1V92A

Solution structure of the uba domain from p47, a major cofactor of the aaa atpase p97
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords NSFL1 cofactor p47
publication title Structure, dynamics and interactions of p47, a major adaptor of the AAA ATPase, p97
pubmed doi rcsb
source organism Rattus norvegicus
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1v92A00
3GLIE 1TTEA 2JZ0A 2OOAA 2L4FA 1NV9A 2EKKA 1P3QQ 2MROB 1DV0A 1R4GA 1VG5A 4DBGB 1HQYE 1JR3E 1MN3A 4WP2A 2QNJA 4R71A 1V92A 2CWBA 2LVQD 3IECA 2HAKA 1A5TA 2JY8A 4F1IA 2LVPC 2JZ1A 1C7YA 2MGWA 2JY6B 1QZEA 2R0IA 2L2DA 1F4IA 1OAIA 2OOBA 2K9DA 3FE3A 1IM2A 1HJPA 1DO2A 2DAKA 1ZMWA 2KNAA 2JNHA 1UFZA 1WHCA 1TR8A 2DI0A 4UN2B 2G3QA 3MMPA 4F2LA 2LVOC 1OKSA 3B89A 3LCVB 4GEWA 1PGYA 2ZTCA 3GLFE 2DKLA 3K9OA 3LCUA 3FRHA 3BBZA 3IHPA 1Y8GA 4G3OA 1ZMVA 1KYIA 2DENA 3GLGE 3E21A 5JI2E 3GLHE 2DAMA 1XXHE 2MR9A 2QHOB 2KHHA 2BWBA 1VDLA 1G3IA 2H5XA 2JY7A 4HEOA 2JUJA 1OTRA 2BWEA 2L4EA 2LBCA 2JP7A 1HT1E 1IXSA 1T6OA 2DZLA 3K9PA 2ZTDA 2CP8A 1G41A 1AIPC 2HWJA 1WIVA 1WJ7A 2DAIA 2WZJA 2MJ5B 1XB2B 1HT2E 1EFUB 2KNVA 2RRUA 1WR1B 1ZMUA 2O25A 1CUKA 1GO5A 1WGLA 2EJSA 3FRIA 2EKFA 1NV8A 2DAGA 1SG9A 1VQ1A 1WGNA 1Q02A 2LTUA 2DAEA 2DHYA 3F92A 2DNAA 3T6PA 1ZV1A 2LVNC 4Q7JA 2QSFX 2OO9A 2KNZA 3H4JA 1E94E 1BVSA 1VEJA 2JY5A 1OQYA 1T43A 1VEGA 1IFYA 2B3TA 1G4AE 5DFLA 1YLAA 1DO0A 1VEKA 3E46A 2LVAA 2K0BX
chains in the Genus database with same CATH superfamily
1Q3CA 3J27B 2JWSA 1DGHB 2H1RA 2L7IA 3GLIE 1TTEA 4DV0M 4JI0M 2YNMD 3FTCA 2OPFA 3GQ3A 5IZ7D 5KPZA 2OOAA 3HX3A 4IJFA 1QAMA 3GPYA 4CISA 4DBGB 1HQYE 2HKJA 1MN3A 1EIJA 1XMOM 1GABA 1V92A 2CWBA 1OIZA 3A46A 5EP4A 1SXJD 3VKHA 4QNRA 2Y20A 4DV6M 3U60B 1OAOC 2LVPC 2O01F 3B7QA 3PXGA 2JZ1A 3W68A 3FTFA 2J7OA 4L8RC 1QZEA 2R0IA 4LG2A 1LV7A 4LFAM 4I8OA 1VDDA 2CRUA 3BXWA 2K9DA 5C18A 3WHKA 3KW6A 1HJPA 3SYLA 4GITA 1SXJA 1ORYB 1DO2A 1TH4A 4PT5A 1XNRM 1GKIA 3FUWA 2DI0A 2K47A 3PFIA 1I4WA 4LJ7A 3SMPA 4F2LA 5KPTA 2XLJA 1HR0M 2QENA 4JI6M 4LF4M 2CV0A 1IY0A 4MGYE 3KS4A 3T1YM 2F5SA 3KXEC 2UU9M 2Z4SA 1QUSA 3IHPA 3DFZA 2F5NA 4IBDA 2R4JA 4DR2M 1ZMVA 2DENA 4G6ZA 3JR4A 3GLIA 4DV1M 3GLHE 3CGWA 3E4RA 4G4QA 4GH9A 4YY3M 2KHHA 5ITRA 2FFJA 3DOAA 5EXPA 3LQQA 4NL4H 2DWZB 1NJFA 4JI3M 3W67A 1G3IA 2H5XA 2R18A 2RGOA 4OU7A 1PJJA 5EXTA 1H6UA 4XGIA 3GP1A 2O5RA 1MJGM 3DA1A 2L4EA 2D7HA 2VQFM 3AKZA 2JP7A 3U61B 3GLGB 1HT1E 3TWLA 3HJSA 3U5ZB 4FVMA 2D7EA 1QUTA 2Y21A 3U6MA 4DR7M 4IBCA 3W0FA 3UMMA 3NWLA 4ZPXA 2WSFF 2ZTDA 3SATA 1DGFA 1NNUC 1WJ7A 1IN6A 3KOYE 2ZANA 3RE8A 4B3RM 3SAUA 1GO5A 2FS1A 8CATA 2KEBA 4GC9A 1N36M 1T3TA 4QHTA 1SG9A 1NHGC 2VF7A 2LTUA 1WGNA 4I4LA 4IBKA 1QAQA 1KSFX 2EUCA 4LF7M 3OTOM 4D81A 3T6PA 4P17A 5ITQA 4OX9M 5EQTA 2DHRA 1ZV1A 2C9CA 2LVNC 1X37A 2W82A 3HHXA 1QZMA 2OO9A 3I01M 2XEPA 2KNZA 3D8BA 4KO8A 4KT0F 4LJ4A 1BVSA 4KHPM 3D8LA 1OQYA 1T43A 1VEGA 1D2NA 4IBGA 4LRTA 4QOSA 1G4AE 3GLHA 3B9PA 3Q8XA 3T38A 1IXRC 1PJQA 1VEKA 3C3DA 5ITTA 1SXJB 1Z5BA 2Z8YM 3HHYA 1G59A 2K0BX 2DWMA 5GKNA 4AI6A 2LNHC 2FOIC 2NQ8C 1YE9A 2QZ4A 3KSXA 4PD2A 4NXMM 2KA6B 2WSCF 3TWMA 4CIZA 1GJSA 3FUVA 3MHVC 1R5LA 4IBBA 2GQFA 2L4FA 3FYCA 3KP1E 1NV9A 4MGIE 4S12A 2C5RA 1N33M 4MGHA 1DV0A 3B74A 1R4GA 4R3DA 3KOZE 2QBYA 1QQWA 5ITUA 4LGMA 3GLIB 5KQDA 4JI7M 2N35A 4II7A 2R62A 4JV5M 2UXDM 4DV2M 2XZFA 3EIHA 2VDBB 3NBXX 2JY8A 1D0KA 2KDLA 2FNAA 5FSWA 2MGWA 2JY6B 3CF2A 4FW9A 3J7BA 1XNQM 3VDUA 3J81S 2OOBA 4OVZA 4JI8M 3K1JA 3DZDA 1MX0A 2DAKA 4B3SM 1ZMWA 2KNAA 3CTWB 4AKHA 1XHBA 1UFZA 3L27A 3LVVA 1Z5CA 3MMPA 4AG6A 1N78A 3FUUA 4LCBA 2M5ZA 3J80S 1R2ZA 1PGYA 1J09A 1DGBA 3TPZA 3UJNA 1WXQA 3GLFE 3GO8A 2ZAOA 3M7GA 1ZAEA 3K9OA 2QQ8A 1UM8A 5ITXE 2C98A 3FRHA 4W5WA 1NNJA 3SYKA 1Y8GA 2HL7A 4G3OA 4AW4A 3K92A 4I5SA 2V6ZM 2R65A 4NXNM 1Q3BA 5JI3E 1XXHE 4DR6M 4JYAM 3V76A 4B7FA 4DR5M 4JN6A 1VDLA 2JY7A 5IREB 4B7HA 2JUJA 1OTRA 3KOXE 4QHSA 1PM5A 2Z3XA 4LFCM 1V34A 2X8AA 4ANRA 2XZUA 2BJWA 3QYBA 3T1HM 2LBCA 4L4UA 1L1TA 2QCUA 3GRUA 3RGSA 1IXSA 3AJIB 3GLHB 4RKUF 1HNXM 3AOGA 1PRBA 4KODA 4FD2A 4B3MM 3K9PA 5IWAM 2KZSA 3HKPA 1TH3A 3K8ZA 3MK6A 4Y28F 5EXSA 3AOEA 1QANA 1AIPC 2HWJA 1WIVA 3PVSA 1OIPA 2WZJA 5EJCA 1OJLA 2AHMA 3SBJA 3L29A 1XB2B 1MU5A 1HT2E 1TDHA 3GPUA 2RRUA 5LMUM 1TF0B 1WR1B 2ZBKB 3L2AA 2Q2EB 4YHHM 3TWKA 4GKKM 4NSOB 2QBYB 1I94M 4JI5M 3SARA 3PNVA 2DAGA 1QVRA 4I81A 1VQ1A 7CATA 2CHVA 2DAEA 2DHYA 3IG5A 4M9XA 3F92A 1QDTA 3GLFA 2CFOA 2R44A 4Z8XA 2UXBM 1SXJC 4FWHA 4PCZA 2QSFX 2L6OA 1IQPA 5ITXA 4ITQA 2JXNA 1R6BX 3L28A 4LJ9A 3AFHA 2F5OA 2C99A 1VEJA 2JY5A 2KRUA 3RFWA 3LQRA 2V1CA 2B3TA 4AG5A 2QP9X 2E5LM 1V33A 2YR0A 1XXHA 5DFLA 2ZAMA 1DO0A 3RGPA 4OVZB 4DR3M 3SHFA 2R45A 3U6LA 4RF1A 5F3WA 2J5YA 4GKJM 1OFIA 2Z7JA 4L16A 4REZA 4QOZC 4CHTB 1E9RA 1Z5AA 3GPXA 2DWLA 5FTLA 1L2DA 5EP1A 4LF9M 3TL4X 1NY5A 2MROB 1YUBA 3FD9A 4HL4A 4CJ6A 2YFQA 4LY6A 4WP2A 2Z4RA 4QNMA 3SC3A 3UK6A 1R2YA 2UUCM 4R71A 2OQ4A 2LVQD 3U6OA 2RGHA 2R46A 4JI2M 4MH0E 3PNYA 3IECA 2C96A 3K2LA 2HAKA 2XH9A 3UZUA 4BB9A 2VF8A 3FTDA 5EXXA 3GQ5A 1D0LA 3VK7A 4KLNA 1HQCA 5DYIA 4B7GA 1L2CA 2UXCM 4BLCA 2KW0A 4M9SA 4HLQA 1PJTA 1TH2A 4P16A 4D82A 1F4IA 2DVWB 4NRWA 2LH0A 2A5YB 3FE3A 1G8PA 1IM2A 1IXSB 4IBEA 5ITYA 2X49A 3FKEA 4LJ8A 2ERCA 1IBMM 3LMMA 1N34M 3FYDA 1TR8A 2DWNA 4LF6M 2LVOC 3B89A 1YSYA 2ZTCA 4GRIA 5BR8M 4DV3M 3I4YA 4LZJA 2HHHM 4G4OA 1C1KA 3HHWA 4AKGA 2MH8A 2GNOA 5KQ8A 5EP2A 4G4NA 3BBZA 4L6V6 3ZH9B 4DV5M 4JXJA 4MB7A 3E21A 3HJ8A 2L7HA 1XMQM 3THGA 4GHAA 3GQ4A 3GLFB 3KS8A 3J7AS 3ZQJA 2D7GA 1NVMA 1DGGA 4DV4M 2BWEA 4OW0A 5FTNA 3Q8GA 4GMQA 3HJQA 3KFUG 1IN8A 4PDIA 5C1BA 2F4VM 5H37D 5IT9S 2Y0TA 3SAWA 1XXHB 1NY6A 1IN7A 4DR4M 4X66M 3J2PB 1QAOA 1N32M 1JQJC 1QYRA 1T6OA 3SAVA 3QAUA 2XSZD 5A2QS 5FTMA 3I04M 5E6JA 2CP8A 4Z6YA 2CHGA 1E32A 3NBIA 1N77A 1KFVA 1G41A 4NRVA 1GLNA 4LJ6A 3L25A 2I7NA 3A42A 2MJ5B 4L15A 2VQEM 2KNVA 4RF0A 5DNYA 3H4MA 1ZMUA 4GHLA 2F5QA 2KZUA 1WGLA 1RU3A 3FRIA 1XC8A 3VKGA 1Q39A 4A3VB 3ZCBB 4D80A 2XSZA 4X65M 3W0LB 1K3WA 2DNAA 4NOOB 4MM3B 2FE8A 3JAMS 3FUTA 3M6AA 4L78A 4Q7JA 1L1ZA 2XFTA 1J5EM 4EIWA 3H4JA 1NO1A 2RKOA 2R6FA 2CV1A 2LHGA 1IN5A 2K6BA 2V1UA 4WW0A 1TDZA 5EP3A 2LVAA 4M0DA 3E9SA 1S3SA 4LF8M 3MJ5A 1HNZM 2R4EA 4DR1M 2L09A 4LFBM 3JR5A 1IN4A 1W5SA 2CHQA 2XF3A 3GRVA 3HY5A 3VFDA 1L8QA 1Z6TA 2I7PA 2JZ0A 1NHWC 4JI4M 2EKKA 1P3QQ 3WHLA 3I51A 5FLXS 1VG5A 3VLFB 1JR3E 2EO2A 2QNJA 1GVNA 3I4VA 4PDGA 5L8RF 1R7RA 2C9OA 4GIPA 4MGZE 2ZM6M 2EA0A 4XBOA 1EE8A 3SMSA 1A5TA 4IJEA 1ZQ9A 4AZFA 3FTEA 3LVWA 4F1IA 3QWLA 3FUXA 1L2BA 4FWGA 4GC5A 1C7YA 1FJGM 3SASA 3U6DA 1G71A 2L2DA 2KXEA 1NSFA 3AOEC 1OAIA 4DUZM 3U6CA 2XFSA 1LTMA 4MGKE 2CE7A 1AUAA 1E9SA 1K82A 3U6PA 4B08A 4LF5M 3VDPA 4AQYM 2JNHA 4FCVA 2DZNB 1DGHA 1WHCA 3CF0A 4M9ZA 4UN2B 1TGUA 3HZJA 4XK8F 2G3QA 3GRRA 3AL0C 2WSEF 1OKSA 4CGYB 3KP0E 4DUYM 4B3TM 3C58A 3LCVB 4GEWA 1FNNA 4FWDA 2CUZA 1IBKM 1HNWM 2QPAA 1GJTA 2DKLA 3UGJA 5KPRA 3B7ZA 4TUWA 1JR3D 3C9PA 3LCUA 4NC6A 3A45A 2XGNA 3KDSE 5LMNM 4X62M 4RNAA 1KYIA 2P5TA 3C3EA 4LGYA 3GLGE 5JI2E 1K3XA 3T15A 2DAMA 3L26A 3KVWA 3ZC7B 1IY1A 2MR9A 2QHOB 3U60A 1PJSA 3ILKA 3SFZA 2BNKA 5KO3A 2CV2A 2BWBA 2X4AA 3HU1A 4HEOA 5FTKA 2DXIA 1N75A 2FH0A 2J7NA 1JR3A 1Z59A 3U6QA 2UUAM 3HU3A 4LJ5A 4LRSA 5E26A 3B7NA 1GL7A 5BPVA 1OFHA 2G8LA 5FTJA 3LW5F 4DV7M 3VK8A 4NSRA 1JB0F 3M0EA 4BBAA 2UUBM 3HWSA 2DZLA 3TE6A 1IBLM 3U6EA 4JI1M 3QYEA 3HGIA 2DZOB 3KOWE 2M60A 2DAIA 4FCTA 1PJIA 1EFUB 2CEAA 2LXEA 3HU2A 2O25A 4M0WA 3TQSA 4G4RA 1CUKA 1W5TA 2EJSA 4LZZA 2EKFA 2LWXA 3HHZA 1NV8A 3SHGB 3BOSA 3AV0A 5DYGA 1Q02A 1SXJE 3CF6E 1XWIA 3EIEA 2Y0QA 2G5GX 2APLA 3GPPA 3R9XB 4X64M 3IG8A 2F5PA 2KRKA 3R8FA 4IBIA 3U6SA 2VIIA 2YQZA 4K0KM 1E94E 1IXZA 2JA2A 1GL6A 4R7GA 3GRYA 3GLGA 2HCBA 3U61A 1IFYA 4AKIA 3U5ZA 1YLAA 4IBFA 3A98B 1D0MA 3E46A 1QDRA 2LHCA 3KSJA 4IIWA 2BJVA 1IY2A 1J7KA 1NJGA 4FCWA 4LJAA 4IBJA 4WURA
chains in the Genus database with same CATH topology
3GLIE 1TTEA 2JZ0A 2OOAA 2L4FA 1NV9A 2EKKA 1P3QQ 2MROB 1DV0A 1R4GA 1VG5A 4DBGB 1HQYE 1JR3E 1MN3A 4WP2A 2QNJA 4R71A 1V92A 2CWBA 2LVQD 3IECA 2HAKA 1A5TA 2JY8A 4F1IA 2LVPC 2JZ1A 1C7YA 2MGWA 2JY6B 1QZEA 2R0IA 2L2DA 1F4IA 1OAIA 2OOBA 2K9DA 3FE3A 1IM2A 1HJPA 1DO2A 2DAKA 1ZMWA 2KNAA 2JNHA 1UFZA 1WHCA 1TR8A 2DI0A 4UN2B 2G3QA 3MMPA 4F2LA 2LVOC 1OKSA 3B89A 3LCVB 4GEWA 1PGYA 2ZTCA 3GLFE 2DKLA 3K9OA 3LCUA 3FRHA 3BBZA 3IHPA 1Y8GA 4G3OA 1ZMVA 1KYIA 2DENA 3GLGE 3E21A 5JI2E 3GLHE 2DAMA 1XXHE 2MR9A 2QHOB 2KHHA 2BWBA 1VDLA 1G3IA 2H5XA 2JY7A 4HEOA 2JUJA 1OTRA 2BWEA 2L4EA 2LBCA 2JP7A 1HT1E 1IXSA 1T6OA 2DZLA 3K9PA 2ZTDA 2CP8A 1G41A 1AIPC 2HWJA 1WIVA 1WJ7A 2DAIA 2WZJA 2MJ5B 1XB2B 1HT2E 1EFUB 2KNVA 2RRUA 1WR1B 1ZMUA 2O25A 1CUKA 1GO5A 1WGLA 2EJSA 3FRIA 2EKFA 1NV8A 2DAGA 1SG9A 1VQ1A 1WGNA 1Q02A 2LTUA 2DAEA 2DHYA 3F92A 2DNAA 3T6PA 1ZV1A 2LVNC 4Q7JA 2QSFX 2OO9A 2KNZA 3H4JA 1E94E 1BVSA 1VEJA 2JY5A 1OQYA 1T43A 1VEGA 1IFYA 2B3TA 1G4AE 5DFLA 1YLAA 1DO0A 1VEKA 3E46A 2LVAA 2K0BX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLI E;  1TTE A;  2JZ0 A;  2OOA A;  2L4F A;  1NV9 A;  2EKK A;  1P3Q Q;  2MRO B;  1DV0 A;  1R4G A;  1VG5 A;  4DBG B;  1HQY E;  1JR3 E;  1MN3 A;  4WP2 A;  2QNJ A;  4R71 A;  1V92 A;  2CWB A;  2LVQ D;  3IEC A;  2HAK A;  1A5T A;  2JY8 A;  4F1I A;  2LVP C;  2JZ1 A;  1C7Y A;  2MGW A;  2JY6 B;  1QZE A;  2R0I A;  2L2D A;  1F4I A;  1OAI A;  2OOB A;  2K9D A;  3FE3 A;  1IM2 A;  1HJP A;  1DO2 A;  2DAK A;  1ZMW A;  2KNA A;  2JNH A;  1UFZ A;  1WHC A;  1TR8 A;  2DI0 A;  4UN2 B;  2G3Q A;  3MMP A;  4F2L A;  2LVO C;  1OKS A;  3B89 A;  3LCV B;  4GEW A;  1PGY A;  2ZTC A;  3GLF E;  2DKL A;  3K9O A;  3LCU A;  3FRH A;  3BBZ A;  3IHP A;  1Y8G A;  4G3O A;  1ZMV A;  1KYI A;  2DEN A;  3GLG E;  3E21 A;  5JI2 E;  3GLH E;  2DAM A;  1XXH E;  2MR9 A;  2QHO B;  2KHH A;  2BWB A;  1VDL A;  1G3I A;  2H5X A;  2JY7 A;  4HEO A;  2JUJ A;  1OTR A;  2BWE A;  2L4E A;  2LBC A;  2JP7 A;  1HT1 E;  1IXS A;  1T6O A;  2DZL A;  3K9P A;  2ZTD A;  2CP8 A;  1G41 A;  1AIP C;  2HWJ A;  1WIV A;  1WJ7 A;  2DAI A;  2WZJ A;  2MJ5 B;  1XB2 B;  1HT2 E;  1EFU B;  2KNV A;  2RRU A;  1WR1 B;  1ZMU A;  2O25 A;  1CUK A;  1GO5 A;  1WGL A;  2EJS A;  3FRI A;  2EKF A;  1NV8 A;  2DAG A;  1SG9 A;  1VQ1 A;  1WGN A;  1Q02 A;  2LTU A;  2DAE A;  2DHY A;  3F92 A;  2DNA A;  3T6P A;  1ZV1 A;  2LVN C;  4Q7J A;  2QSF X;  2OO9 A;  2KNZ A;  3H4J A;  1E94 E;  1BVS A;  1VEJ A;  2JY5 A;  1OQY A;  1T43 A;  1VEG A;  1IFY A;  2B3T A;  1G4A E;  5DFL A;  1YLA A;  1DO0 A;  1VEK A;  3E46 A;  2LVA A;  2K0B X; 
#chains in the Genus database with same CATH topology
 1Q3C A;  3J27 B;  2JWS A;  1DGH B;  2H1R A;  2L7I A;  3GLI E;  1TTE A;  4DV0 M;  4JI0 M;  2YNM D;  3FTC A;  2OPF A;  3GQ3 A;  5IZ7 D;  5KPZ A;  2OOA A;  3HX3 A;  4IJF A;  1QAM A;  3GPY A;  4CIS A;  4DBG B;  1HQY E;  2HKJ A;  1MN3 A;  1EIJ A;  1XMO M;  1GAB A;  1V92 A;  2CWB A;  1OIZ A;  3A46 A;  5EP4 A;  1SXJ D;  3VKH A;  4QNR A;  2Y20 A;  4DV6 M;  3U60 B;  1OAO C;  2LVP C;  2O01 F;  3B7Q A;  3PXG A;  2JZ1 A;  3W68 A;  3FTF A;  2J7O A;  4L8R C;  1QZE A;  2R0I A;  4LG2 A;  1LV7 A;  4LFA M;  4I8O A;  1VDD A;  2CRU A;  3BXW A;  2K9D A;  5C18 A;  3WHK A;  3KW6 A;  1HJP A;  3SYL A;  4GIT A;  1SXJ A;  1ORY B;  1DO2 A;  1TH4 A;  4PT5 A;  1XNR M;  1GKI A;  3FUW A;  2DI0 A;  2K47 A;  3PFI A;  1I4W A;  4LJ7 A;  3SMP A;  4F2L A;  5KPT A;  2XLJ A;  1HR0 M;  2QEN A;  4JI6 M;  4LF4 M;  2CV0 A;  1IY0 A;  4MGY E;  3KS4 A;  3T1Y M;  2F5S A;  3KXE C;  2UU9 M;  2Z4S A;  1QUS A;  3IHP A;  3DFZ A;  2F5N A;  4IBD A;  2R4J A;  4DR2 M;  1ZMV A;  2DEN A;  4G6Z A;  3JR4 A;  3GLI A;  4DV1 M;  3GLH E;  3CGW A;  3E4R A;  4G4Q A;  4GH9 A;  4YY3 M;  2KHH A;  5ITR A;  2FFJ A;  3DOA A;  5EXP A;  3LQQ A;  4NL4 H;  2DWZ B;  1NJF A;  4JI3 M;  3W67 A;  1G3I A;  2H5X A;  2R18 A;  2RGO A;  4OU7 A;  1PJJ A;  5EXT A;  1H6U A;  4XGI A;  3GP1 A;  2O5R A;  1MJG M;  3DA1 A;  2L4E A;  2D7H A;  2VQF M;  3AKZ A;  2JP7 A;  3U61 B;  3GLG B;  1HT1 E;  3TWL A;  3HJS A;  3U5Z B;  4FVM A;  2D7E A;  1QUT A;  2Y21 A;  3U6M A;  4DR7 M;  4IBC A;  3W0F A;  3UMM A;  3NWL A;  4ZPX A;  2WSF F;  2ZTD A;  3SAT A;  1DGF A;  1NNU C;  1WJ7 A;  1IN6 A;  3KOY E;  2ZAN A;  3RE8 A;  4B3R M;  3SAU A;  1GO5 A;  2FS1 A;  8CAT A;  2KEB A;  4GC9 A;  1N36 M;  1T3T A;  4QHT A;  1SG9 A;  1NHG C;  2VF7 A;  2LTU A;  1WGN A;  4I4L A;  4IBK A;  1QAQ A;  1KSF X;  2EUC A;  4LF7 M;  3OTO M;  4D81 A;  3T6P A;  4P17 A;  5ITQ A;  4OX9 M;  5EQT A;  2DHR A;  1ZV1 A;  2C9C A;  2LVN C;  1X37 A;  2W82 A;  3HHX A;  1QZM A;  2OO9 A;  3I01 M;  2XEP A;  2KNZ A;  3D8B A;  4KO8 A;  4KT0 F;  4LJ4 A;  1BVS A;  4KHP M;  3D8L A;  1OQY A;  1T43 A;  1VEG A;  1D2N A;  4IBG A;  4LRT A;  4QOS A;  1G4A E;  3GLH A;  3B9P A;  3Q8X A;  3T38 A;  1IXR C;  1PJQ A;  1VEK A;  3C3D A;  5ITT A;  1SXJ B;  1Z5B A;  2Z8Y M;  3HHY A;  1G59 A;  2K0B X;  2DWM A;  5GKN A;  4AI6 A;  2LNH C;  2FOI C;  2NQ8 C;  1YE9 A;  2QZ4 A;  3KSX A;  4PD2 A;  4NXM M;  2KA6 B;  2WSC F;  3TWM A;  4CIZ A;  1GJS A;  3FUV A;  3MHV C;  1R5L A;  4IBB A;  2GQF A;  2L4F A;  3FYC A;  3KP1 E;  1NV9 A;  4MGI E;  4S12 A;  2C5R A;  1N33 M;  4MGH A;  1DV0 A;  3B74 A;  1R4G A;  4R3D A;  3KOZ E;  2QBY A;  1QQW A;  5ITU A;  4LGM A;  3GLI B;  5KQD A;  4JI7 M;  2N35 A;  4II7 A;  2R62 A;  4JV5 M;  2UXD M;  4DV2 M;  2XZF A;  3EIH A;  2VDB B;  3NBX X;  2JY8 A;  1D0K A;  2KDL A;  2FNA A;  5FSW A;  2MGW A;  2JY6 B;  3CF2 A;  4FW9 A;  3J7B A;  1XNQ M;  3VDU A;  3J81 S;  2OOB A;  4OVZ A;  4JI8 M;  3K1J A;  3DZD A;  1MX0 A;  2DAK A;  4B3S M;  1ZMW A;  2KNA A;  3CTW B;  4AKH A;  1XHB A;  1UFZ A;  3L27 A;  3LVV A;  1Z5C A;  3MMP A;  4AG6 A;  1N78 A;  3FUU A;  4LCB A;  2M5Z A;  3J80 S;  1R2Z A;  1PGY A;  1J09 A;  1DGB A;  3TPZ A;  3UJN A;  1WXQ A;  3GLF E;  3GO8 A;  2ZAO A;  3M7G A;  1ZAE A;  3K9O A;  2QQ8 A;  1UM8 A;  5ITX E;  2C98 A;  3FRH A;  4W5W A;  1NNJ A;  3SYK A;  1Y8G A;  2HL7 A;  4G3O A;  4AW4 A;  3K92 A;  4I5S A;  2V6Z M;  2R65 A;  4NXN M;  1Q3B A;  5JI3 E;  1XXH E;  4DR6 M;  4JYA M;  3V76 A;  4B7F A;  4DR5 M;  4JN6 A;  1VDL A;  2JY7 A;  5IRE B;  4B7H A;  2JUJ A;  1OTR A;  3KOX E;  4QHS A;  1PM5 A;  2Z3X A;  4LFC M;  1V34 A;  2X8A A;  4ANR A;  2XZU A;  2BJW A;  3QYB A;  3T1H M;  2LBC A;  4L4U A;  1L1T A;  2QCU A;  3GRU A;  3RGS A;  1IXS A;  3AJI B;  3GLH B;  4RKU F;  1HNX M;  3AOG A;  1PRB A;  4KOD A;  4FD2 A;  4B3M M;  3K9P A;  5IWA M;  2KZS A;  3HKP A;  1TH3 A;  3K8Z A;  3MK6 A;  4Y28 F;  5EXS A;  3AOE A;  1QAN A;  1AIP C;  2HWJ A;  1WIV A;  3PVS A;  1OIP A;  2WZJ A;  5EJC A;  1OJL A;  2AHM A;  3SBJ A;  3L29 A;  1XB2 B;  1MU5 A;  1HT2 E;  1TDH A;  3GPU A;  2RRU A;  5LMU M;  1TF0 B;  1WR1 B;  2ZBK B;  3L2A A;  2Q2E B;  4YHH M;  3TWK A;  4GKK M;  4NSO B;  2QBY B;  1I94 M;  4JI5 M;  3SAR A;  3PNV A;  2DAG A;  1QVR A;  4I81 A;  1VQ1 A;  7CAT A;  2CHV A;  2DAE A;  2DHY A;  3IG5 A;  4M9X A;  3F92 A;  1QDT A;  3GLF A;  2CFO A;  2R44 A;  4Z8X A;  2UXB M;  1SXJ C;  4FWH A;  4PCZ A;  2QSF X;  2L6O A;  1IQP A;  5ITX A;  4ITQ A;  2JXN A;  1R6B X;  3L28 A;  4LJ9 A;  3AFH A;  2F5O A;  2C99 A;  1VEJ A;  2JY5 A;  2KRU A;  3RFW A;  3LQR A;  2V1C A;  2B3T A;  4AG5 A;  2QP9 X;  2E5L M;  1V33 A;  2YR0 A;  1XXH A;  5DFL A;  2ZAM A;  1DO0 A;  3RGP A;  4OVZ B;  4DR3 M;  3SHF A;  2R45 A;  3U6L A;  4RF1 A;  5F3W A;  2J5Y A;  4GKJ M;  1OFI A;  2Z7J A;  4L16 A;  4REZ A;  4QOZ C;  4CHT B;  1E9R A;  1Z5A A;  3GPX A;  2DWL A;  5FTL A;  1L2D A;  5EP1 A;  4LF9 M;  3TL4 X;  1NY5 A;  2MRO B;  1YUB A;  3FD9 A;  4HL4 A;  4CJ6 A;  2YFQ A;  4LY6 A;  4WP2 A;  2Z4R A;  4QNM A;  3SC3 A;  3UK6 A;  1R2Y A;  2UUC M;  4R71 A;  2OQ4 A;  2LVQ D;  3U6O A;  2RGH A;  2R46 A;  4JI2 M;  4MH0 E;  3PNY A;  3IEC A;  2C96 A;  3K2L A;  2HAK A;  2XH9 A;  3UZU A;  4BB9 A;  2VF8 A;  3FTD A;  5EXX A;  3GQ5 A;  1D0L A;  3VK7 A;  4KLN A;  1HQC A;  5DYI A;  4B7G A;  1L2C A;  2UXC M;  4BLC A;  2KW0 A;  4M9S A;  4HLQ A;  1PJT A;  1TH2 A;  4P16 A;  4D82 A;  1F4I A;  2DVW B;  4NRW A;  2LH0 A;  2A5Y B;  3FE3 A;  1G8P A;  1IM2 A;  1IXS B;  4IBE A;  5ITY A;  2X49 A;  3FKE A;  4LJ8 A;  2ERC A;  1IBM M;  3LMM A;  1N34 M;  3FYD A;  1TR8 A;  2DWN A;  4LF6 M;  2LVO C;  3B89 A;  1YSY A;  2ZTC A;  4GRI A;  5BR8 M;  4DV3 M;  3I4Y A;  4LZJ A;  2HHH M;  4G4O A;  1C1K A;  3HHW A;  4AKG A;  2MH8 A;  2GNO A;  5KQ8 A;  5EP2 A;  4G4N A;  3BBZ A;  4L6V 6;  3ZH9 B;  4DV5 M;  4JXJ A;  4MB7 A;  3E21 A;  3HJ8 A;  2L7H A;  1XMQ M;  3THG A;  4GHA A;  3GQ4 A;  3GLF B;  3KS8 A;  3J7A S;  3ZQJ A;  2D7G A;  1NVM A;  1DGG A;  4DV4 M;  2BWE A;  4OW0 A;  5FTN A;  3Q8G A;  4GMQ A;  3HJQ A;  3KFU G;  1IN8 A;  4PDI A;  5C1B A;  2F4V M;  5H37 D;  5IT9 S;  2Y0T A;  3SAW A;  1XXH B;  1NY6 A;  1IN7 A;  4DR4 M;  4X66 M;  3J2P B;  1QAO A;  1N32 M;  1JQJ C;  1QYR A;  1T6O A;  3SAV A;  3QAU A;  2XSZ D;  5A2Q S;  5FTM A;  3I04 M;  5E6J A;  2CP8 A;  4Z6Y A;  2CHG A;  1E32 A;  3NBI A;  1N77 A;  1KFV A;  1G41 A;  4NRV A;  1GLN A;  4LJ6 A;  3L25 A;  2I7N A;  3A42 A;  2MJ5 B;  4L15 A;  2VQE M;  2KNV A;  4RF0 A;  5DNY A;  3H4M A;  1ZMU A;  4GHL A;  2F5Q A;  2KZU A;  1WGL A;  1RU3 A;  3FRI A;  1XC8 A;  3VKG A;  1Q39 A;  4A3V B;  3ZCB B;  4D80 A;  2XSZ A;  4X65 M;  3W0L B;  1K3W A;  2DNA A;  4NOO B;  4MM3 B;  2FE8 A;  3JAM S;  3FUT A;  3M6A A;  4L78 A;  4Q7J A;  1L1Z A;  2XFT A;  1J5E M;  4EIW A;  3H4J A;  1NO1 A;  2RKO A;  2R6F A;  2CV1 A;  2LHG A;  1IN5 A;  2K6B A;  2V1U A;  4WW0 A;  1TDZ A;  5EP3 A;  2LVA A;  4M0D A;  3E9S A;  1S3S A;  4LF8 M;  3MJ5 A;  1HNZ M;  2R4E A;  4DR1 M;  2L09 A;  4LFB M;  3JR5 A;  1IN4 A;  1W5S A;  2CHQ A;  2XF3 A;  3GRV A;  3HY5 A;  3VFD A;  1L8Q A;  1Z6T A;  2I7P A;  2JZ0 A;  1NHW C;  4JI4 M;  2EKK A;  1P3Q Q;  3WHL A;  3I51 A;  5FLX S;  1VG5 A;  3VLF B;  1JR3 E;  2EO2 A;  2QNJ A;  1GVN A;  3I4V A;  4PDG A;  5L8R F;  1R7R A;  2C9O A;  4GIP A;  4MGZ E;  2ZM6 M;  2EA0 A;  4XBO A;  1EE8 A;  3SMS A;  1A5T A;  4IJE A;  1ZQ9 A;  4AZF A;  3FTE A;  3LVW A;  4F1I A;  3QWL A;  3FUX A;  1L2B A;  4FWG A;  4GC5 A;  1C7Y A;  1FJG M;  3SAS A;  3U6D A;  1G71 A;  2L2D A;  2KXE A;  1NSF A;  3AOE C;  1OAI A;  4DUZ M;  3U6C A;  2XFS A;  1LTM A;  4MGK E;  2CE7 A;  1AUA A;  1E9S A;  1K82 A;  3U6P A;  4B08 A;  4LF5 M;  3VDP A;  4AQY M;  2JNH A;  4FCV A;  2DZN B;  1DGH A;  1WHC A;  3CF0 A;  4M9Z A;  4UN2 B;  1TGU A;  3HZJ A;  4XK8 F;  2G3Q A;  3GRR A;  3AL0 C;  2WSE F;  1OKS A;  4CGY B;  3KP0 E;  4DUY M;  4B3T M;  3C58 A;  3LCV B;  4GEW A;  1FNN A;  4FWD A;  2CUZ A;  1IBK M;  1HNW M;  2QPA A;  1GJT A;  2DKL A;  3UGJ A;  5KPR A;  3B7Z A;  4TUW A;  1JR3 D;  3C9P A;  3LCU A;  4NC6 A;  3A45 A;  2XGN A;  3KDS E;  5LMN M;  4X62 M;  4RNA A;  1KYI A;  2P5T A;  3C3E A;  4LGY A;  3GLG E;  5JI2 E;  1K3X A;  3T15 A;  2DAM A;  3L26 A;  3KVW A;  3ZC7 B;  1IY1 A;  2MR9 A;  2QHO B;  3U60 A;  1PJS A;  3ILK A;  3SFZ A;  2BNK A;  5KO3 A;  2CV2 A;  2BWB A;  2X4A A;  3HU1 A;  4HEO A;  5FTK A;  2DXI A;  1N75 A;  2FH0 A;  2J7N A;  1JR3 A;  1Z59 A;  3U6Q A;  2UUA M;  3HU3 A;  4LJ5 A;  4LRS A;  5E26 A;  3B7N A;  1GL7 A;  5BPV A;  1OFH A;  2G8L A;  5FTJ A;  3LW5 F;  4DV7 M;  3VK8 A;  4NSR A;  1JB0 F;  3M0E A;  4BBA A;  2UUB M;  3HWS A;  2DZL A;  3TE6 A;  1IBL M;  3U6E A;  4JI1 M;  3QYE A;  3HGI A;  2DZO B;  3KOW E;  2M60 A;  2DAI A;  4FCT A;  1PJI A;  1EFU B;  2CEA A;  2LXE A;  3HU2 A;  2O25 A;  4M0W A;  3TQS A;  4G4R A;  1CUK A;  1W5T A;  2EJS A;  4LZZ A;  2EKF A;  2LWX A;  3HHZ A;  1NV8 A;  3SHG B;  3BOS A;  3AV0 A;  5DYG A;  1Q02 A;  1SXJ E;  3CF6 E;  1XWI A;  3EIE A;  2Y0Q A;  2G5G X;  2APL A;  3GPP A;  3R9X B;  4X64 M;  3IG8 A;  2F5P A;  2KRK A;  3R8F A;  4IBI A;  3U6S A;  2VII A;  2YQZ A;  4K0K M;  1E94 E;  1IXZ A;  2JA2 A;  1GL6 A;  4R7G A;  3GRY A;  3GLG A;  2HCB A;  3U61 A;  1IFY A;  4AKI A;  3U5Z A;  1YLA A;  4IBF A;  3A98 B;  1D0M A;  3E46 A;  1QDR A;  2LHC A;  3KSJ A;  4IIW A;  2BJV A;  1IY2 A;  1J7K A;  1NJG A;  4FCW A;  4LJA A;  4IBJ A;  4WUR A; 
#chains in the Genus database with same CATH homology
 3GLI E;  1TTE A;  2JZ0 A;  2OOA A;  2L4F A;  1NV9 A;  2EKK A;  1P3Q Q;  2MRO B;  1DV0 A;  1R4G A;  1VG5 A;  4DBG B;  1HQY E;  1JR3 E;  1MN3 A;  4WP2 A;  2QNJ A;  4R71 A;  1V92 A;  2CWB A;  2LVQ D;  3IEC A;  2HAK A;  1A5T A;  2JY8 A;  4F1I A;  2LVP C;  2JZ1 A;  1C7Y A;  2MGW A;  2JY6 B;  1QZE A;  2R0I A;  2L2D A;  1F4I A;  1OAI A;  2OOB A;  2K9D A;  3FE3 A;  1IM2 A;  1HJP A;  1DO2 A;  2DAK A;  1ZMW A;  2KNA A;  2JNH A;  1UFZ A;  1WHC A;  1TR8 A;  2DI0 A;  4UN2 B;  2G3Q A;  3MMP A;  4F2L A;  2LVO C;  1OKS A;  3B89 A;  3LCV B;  4GEW A;  1PGY A;  2ZTC A;  3GLF E;  2DKL A;  3K9O A;  3LCU A;  3FRH A;  3BBZ A;  3IHP A;  1Y8G A;  4G3O A;  1ZMV A;  1KYI A;  2DEN A;  3GLG E;  3E21 A;  5JI2 E;  3GLH E;  2DAM A;  1XXH E;  2MR9 A;  2QHO B;  2KHH A;  2BWB A;  1VDL A;  1G3I A;  2H5X A;  2JY7 A;  4HEO A;  2JUJ A;  1OTR A;  2BWE A;  2L4E A;  2LBC A;  2JP7 A;  1HT1 E;  1IXS A;  1T6O A;  2DZL A;  3K9P A;  2ZTD A;  2CP8 A;  1G41 A;  1AIP C;  2HWJ A;  1WIV A;  1WJ7 A;  2DAI A;  2WZJ A;  2MJ5 B;  1XB2 B;  1HT2 E;  1EFU B;  2KNV A;  2RRU A;  1WR1 B;  1ZMU A;  2O25 A;  1CUK A;  1GO5 A;  1WGL A;  2EJS A;  3FRI A;  2EKF A;  1NV8 A;  2DAG A;  1SG9 A;  1VQ1 A;  1WGN A;  1Q02 A;  2LTU A;  2DAE A;  2DHY A;  3F92 A;  2DNA A;  3T6P A;  1ZV1 A;  2LVN C;  4Q7J A;  2QSF X;  2OO9 A;  2KNZ A;  3H4J A;  1E94 E;  1BVS A;  1VEJ A;  2JY5 A;  1OQY A;  1T43 A;  1VEG A;  1IFY A;  2B3T A;  1G4A E;  5DFL A;  1YLA A;  1DO0 A;  1VEK A;  3E46 A;  2LVA A;  2K0B X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...