1V92A

Solution structure of the uba domain from p47, a major cofactor of the aaa atpase p97
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NSFL1 cofactor p47
publication title Structure, dynamics and interactions of p47, a major adaptor of the AAA ATPase, p97
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Recombination
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1v92A00
4WP2A 1DV0A 2KNVA 2MGWA 1T6OA 2BWBA 2JZ0A 1JR3E 5DFLA 1VEKA 2DAKA 1OTRA 3K9PA 3T6PA 3F92A 1G41A 2G3QA 1BVSA 1G4AE 2DHYA 2ZTCA 1QZEA 2LTUA 1NV8A 1OQYA 2LVPC 2MR9A 1VG5A 2DAMA 1C7YA 1OKSA 1GO5A 3GLFE 1XXHE 2CWBA 3MMPA 1SG9A 2DENA 4F2LA 3H4JA 2DNAA 2CP8A 2OOBA 2H5XA 1IXSA 1VDLA 2MJ5B 2K9DA 4UN2B 3GLHE 3GLGE 1TR8A 1ZMUA 2LVOC 1HT1E 2JY5A 4R71A 1F4IA 2JY6B 1CUKA 1WR1B 1WJ7A 1T43A 1ZMVA 1AIPC 2BWEA 2DZLA 2DAEA 2HAKA 1WIVA 2JUJA 2OO9A 1DO0A 1DO2A 1XB2B 2L2DA 1ZV1A 2EKKA 1R4GA 2MROB 3E46A 3B89A 2JY7A 1PGYA 3FRHA 3LCVB 2JY8A 2EKFA 2DKLA 1TTEA 1IM2A 1IFYA 2KNAA 4GEWA 1VEJA 2EJSA 1HJPA 3IECA 2DI0A 1HQYE 2LVAA 1HT2E 1Q02A 2B3TA 1WHCA 1E94E 1NV9A 2HWJA 2ZTDA 2L4EA 1ZMWA 2K0BX 3E21A 2LVQD 3GLIE 2O25A 1UFZA 2LVNC 2KHHA 4F1IA 1WGNA 3K9OA 1P3QQ 1YLAA 1KYIA 1Y8GA 2JZ1A 1A5TA 4DBGB 1MN3A 3LCUA 2WZJA 3IHPA 2JP7A 2DAGA 1OAIA 2L4FA 1VQ1A 2LBCA 1G3IA 2QHOB 2R0IA 1VEGA 3FRIA 3FE3A 2KNZA 2OOAA 1WGLA 3BBZA 2RRUA 1V92A 1EFUB 2JNHA 5JI2E 4Q7JA 2QNJA 2DAIA 2QSFX 4G3OA 4HEOA
chains in the Genus database with same CATH superfamily
1DV0A 3FD9A 1SXJC 4X64M 1GL6A 3ZQJA 4NL4H 2JZ0A 3ZH9B 4YHHM 3B7ZA 2DAKA 3J27B 3KP1E 5L8RF 4MGIE 4R3DA 1VDDA 3UGJA 3SBJA 3GPXA 4LFCM 3L25A 2R4EA 3F92A 1BVSA 3VKHA 2DHYA 1XMQM 4QOSA 2QPAA 2X4AA 3R9XB 4FWGA 2R18A 2LXEA 5GKNA 5IT9S 2LHCA 4IBFA 1D0MA 1IY2A 3PNVA 2LVPC 4TUWA 1SXJD 2MR9A 3SAWA 2Z8YM 4G6ZA 3GPPA 3AOEC 2DAMA 1GVNA 2CUZA 3L26A 3OTOM 3KOXE 3GPUA 4JI4M 1D0KA 1SG9A 2CFOA 2RGOA 3KVWA 5EXSA 4BLCA 2CP8A 3KSJA 4EIWA 1IN5A 1IXSA 1VDLA 2H5XA 2K9DA 1QDRA 3KS4A 3TWLA 1NHWC 3GLGE 2UXDM 2FH0A 1SXJE 2F5OA 1MJGM 2KEBA 1QUSA 3HX3A 2CRUA 2HCBA 3IG5A 4MGZE 4RKUF 4KO8A 4FCWA 1K82A 4IBBA 1F4IA 5EXXA 1AUAA 2VQFM 3I51A 4A3VB 5EP1A 1WJ7A 4G4QA 2HKJA 3RE8A 2QBYA 2Y0QA 5FTNA 2HAKA 3T38A 3HY5A 4IBEA 1WIVA 3I4VA 3FYCA 5KPRA 3C58A 3C3DA 3U6EA 1R7RA 1G71A 2MROB 3EIEA 3KXEC 2HHHM 1NNJA 1NHGC 3U6OA 2JY7A 5JI3E 2L7IA 5BR8M 2D7GA 3GLHB 2D7HA 2EKFA 3HU1A 4QHTA 3JR5A 1MX0A 2L7HA 2M5ZA 4NXMM 4CGYB 4GEWA 3LVWA 1PJQA 3SYKA 3SYLA 2W82A 3A42A 1TDZA 4B7FA 3LW5F 3R8FA 1HJPA 4MGHA 4JI7M 1DGBA 3CF2A 3E9SA 2WSCF 1HQYE 2LVAA 4GC9A 4FVMA 2KDLA 2ERCA 2F5NA 3TWMA 2QENA 2KRUA 3UZUA 2V1UA 3RFWA 2FNAA 1N34M 1J5EM 4JI0M 2Y20A 4B3SM 3HJ8A 3BXWA 1UFZA 2LVNC 1T3TA 2KHHA 3TWKA 3FUXA 3ZC7B 2NQ8C 2JWSA 4ITQA 2CEAA 3GQ5A 1J7KA 1YLAA 1QDTA 3W67A 8CATA 2JZ1A 2A5YB 1A5TA 2C98A 2V6ZM 3KP0E 4LF4M 3LCUA 5EP2A 3PXGA 3V76A 3GLGA 2EUCA 2LBCA 2DAGA 3I4YA 4IBCA 4AKGA 3QYEA 3C9PA 1JR3D 4AW4A 1VEGA 4BBAA 3TL4X 3U61B 3NWLA 3HHYA 2KNZA 2Y0TA 2VF7A 2YQZA 4IBKA 4L16A 1N33M 2UXBM 2RRUA 1EFUB 5FSWA 2RKOA 4Q7JA 2QNJA 4Y28F 3QAUA 1DGHB 2YFQA 2E5LM 2KA6B 4MGYE 4HEOA 4LRSA 1G8PA 2CE7A 2ZAMA 3FUVA 3GLIB 2XF3A 1N77A 3U6PA 2XZUA 3CF0A 1T6OA 4RNAA 4JXJA 1JR3E 4X65M 2K47A 2UUCM 3J7AS 4LGMA 2QP9X 1QAOA 1N36M 3SC3A 1Q3CA 3TQSA 4HL4A 2HL7A 4M0WA 3SMSA 1LV7A 3H4MA 4FW9A 1HNXM 3FKEA 1S3SA 2F5SA 4WW0A 3L29A 4CIZA 4DR3M 3AV0A 1Z5CA 4X62M 3WHLA 2XH9A 4REZA 2I7NA 4NRVA 4LJ6A 2XSZD 2APLA 1OFHA 1LTMA 4RF1A 2CWBA 4L6V6 2OPFA 4LRTA 5EP3A 3UJNA 4Z8XA 4FD2A 4DR4M 2DNAA 4OX9M 1HR0M 2KW0A 3U5ZB 1IY0A 1JQJC 2MJ5B 4MGKE 3GLHE 4ZPXA 1L1ZA 4B3RM 2CHQA 1GKIA 1ZMUA 2LVOC 3U6LA 3SAUA 4NRWA 1Z5AA 3I01M 2JY5A 3NBIA 4AG6A 4R71A 4LG2A 1GJSA 1CUKA 2ZANA 1L2DA 5IREB 4LJ9A 3VK8A 3GRVA 2ZBKB 3VFDA 4G4OA 4LF9M 4KODA 1DO2A 3FTEA 4GITA 3SATA 1XXHB 2EKKA 2WSFF 5FTLA 4B08A 1N32M 4AI6A 1XNRM 3B7QA 3FUTA 4QHSA 4KHPM 4I8OA 3B89A 3FRHA 2BJVA 3FUUA 4JI3M 2JY8A 3U6DA 3LMMA 4LF8M 2F5QA 1IFYA 3I04M 3W0LB 2CV0A 4YY3M 2Z4SA 1E32A 1Z6TA 3L27A 3HGIA 4B7HA 4JN6A 2DWLA 4LJ7A 1XWIA 1IBLM 4IBJA 1IN6A 5KQDA 4CJ6A 3LVVA 1HT2E 2Z7JA 4MM3B 5F3WA 7CATA 1R2ZA 4AKHA 4AG5A 5ITXE 3SFZA 1WHCA 4MB7A 3THGA 4GKKM 2HWJA 1QYRA 4QOZC 3VKGA 1ZMWA 2I7PA 1PJTA 2K0BX 3E21A 3HHXA 3GLIE 2D7EA 1H6UA 4JI6M 1MU5A 4MH0E 3RGPA 3TE6A 3SARA 1RU3A 1WGNA 1GABA 1YE9A 3W0FA 4WURA 1IXSB 1V33A 3GQ3A 4DV5M 1KYIA 3NBXX 1OAOC 4PCZA 4NXNM 3A98B 3GLHA 2H1RA 3FTCA 3LQRA 2L4FA 3MK6A 1NNUC 1VQ1A 1G3IA 2O01F 4IIWA 4LJ8A 1D0LA 1L2CA 5A2QS 3SAVA 1Q39A 1G59A 2XFTA 3FE3A 4LZZA 3KOZE 3MHVC 1WGLA 1J09A 5E26A 2QBYB 1V92A 2C96A 3DZDA 3DA1A 1E9RA 3SHFA 4LF6M 1QQWA 2QCUA 2DAIA 3AJIB 1EIJA 5KPTA 2GNOA 2KRKA 2QSFX 1DGGA 3KDSE 1PRBA 4GH9A 2YNMD 4DR7M 2R46A 1V34A 3CTWB 4LJAA 4P17A 1HNZM 1IBMM 2R6FA 1VEKA 4IBIA 1OTRA 4LZJA 1TH2A 3K9PA 3U6MA 3DFZA 4AQYM 3HKPA 1G4AE 1I4WA 1SXJA 5EQTA 2EA0A 2ZTCA 3AOGA 2XFSA 3L28A 3PVSA 5KQ8A 3Q8XA 3K8ZA 1NV8A 1OQYA 2UUBM 3B9PA 2G5GX 5C18A 4OU7A 4DV7M 1OJLA 2C9CA 3KOWE 4OVZA 1KFVA 2V1CA 1DGHA 3CGWA 1IQPA 4DV6M 4DUZM 1C7YA 2ZAOA 1GO5A 3HJQA 4DV0M 1XXHE 3MMPA 4F2LA 2OQ4A 4JI1M 3H4JA 2OOBA 4IJEA 3U6QA 4LFBM 5KO3A 3T1YM 3U6CA 1XNQM 4KLNA 1IXRC 3IG8A 3AOEA 4UN2B 2WSEF 2VDBB 1TR8A 3ZCBB 1GJTA 4B7GA 1HT1E 3VK7A 2R45A 5H37D 5ITRA 4GHLA 2C99A 2JY6B 1T43A 4DV3M 1ZAEA 2YR0A 5DNYA 1R2YA 2DZLA 4LJ5A 2DWNA 2DAEA 3U60B 1TDHA 4LF7M 2X49A 1IY1A 3VLFB 1GLNA 1QAQA 1DO0A 2LHGA 2R65A 2L2DA 4FCTA 3GLFB 2ZM6M 1ZV1A 2VQEM 4DV2M 2O5RA 4FWDA 4JI8M 1YSYA 2FOIC 3HHWA 3KSXA 4L78A 4GKJM 2X8AA 1IN4A 3E46A 1NO1A 4LY6A 5FLXS 2VIIA 3D8LA 1E9SA 4KT0F 2FS1A 4HLQA 4D80A 3E4RA 3JAMS 3M6AA 1D2NA 2R44A 2KNAA 1XC8A 1L8QA 1VEJA 1TH3A 1PM5A 2CHGA 1N75A 1PJSA 3HZJA 1KSFX 1Q3BA 4K0KM 1GL7A 4G4NA 1Q02A 2B3TA 2EO2A 4ANRA 1E94E 3A45A 3C3EA 3ILKA 3UK6A 2ZTDA 3GQ4A 4JI2M 5DYGA 4L15A 1XXHA 1OIPA 4S12A 1NSFA 4JI5M 3B7NA 2DHRA 1IN8A 4M9SA 4JV5M 1P3QQ 4I5SA 5FTKA 3VDUA 5BPVA 1JR3A 2L09A 1NJFA 2LH0A 2Z4RA 4DBGB 3T1HM 1MN3A 4CISA 2WZJA 2G8LA 2KZUA 3IHPA 4DUYM 4B3MM 1OAIA 1ORYB 3KS8A 2QHOB 4D81A 3PNYA 3HU2A 3FTFA 3FRIA 5ITTA 4OW0A 2JXNA 2OOAA 4XGIA 1FNNA 3BBZA 1QUTA 3SHGB 5C1BA 2C5RA 4LF5M 4NOOB 4G4RA 5JI2E 2K6BA 2J7OA 2XZFA 1PJJA 4I4LA 4G3OA 2F4VM 1QZMA 1NJGA 3HHZA 4RF0A 4WP2A 4X66M 4D82A 5LMNM 2QQ8A 1I94M 5EXPA 2KNVA 3M7GA 3J81S 2LWXA 4AKIA 2MGWA 4IBGA 2BWBA 5LMUM 2XEPA 5DFLA 3SASA 1OFIA 3KFUG 5FTMA 2UUAM 3BOSA 3KW6A 2DZOB 3T6PA 3AKZA 3K2LA 1K3XA 4PT5A 3GRUA 1G41A 2G3QA 3FYDA 1IXZA 3WHKA 4Z6YA 2CV1A 2CHVA 4AZFA 1QZEA 1W5SA 2LNHC 2LTUA 3GRYA 3T15A 4NC6A 2XSZA 3SMPA 4I81A 4LFAM 4W5WA 1NY6A 1Z5BA 5ITUA 1QVRA 3GRRA 1VG5A 2Z3XA 1OKSA 5IZ7D 1NY5A 3GLFE 1QAMA 1C1KA 4L4UA 3HU3A 1W5TA 2JA2A 3CF6E 4DR6M 2DENA 3LQQA 4CHTB 1DGFA 3DOAA 2DWZB 3RGSA 1L2BA 1OIZA 2J7NA 4QNRA 3U6SA 5EJCA 3J80S 3QYBA 4GC5A 2BJWA 3JR4A 1HQCA 3HJSA 1N78A 2F5PA 4XBOA 4PD2A 2CV2A 2BNKA 1Z59A 3U61A 1FJGM 1WR1B 2AHMA 2KZSA 5EXTA 4DR5M 2DZNB 4DR1M 1ZMVA 1AIPC 1EE8A 2BWEA 4IBDA 2JUJA 5ITXA 1ZQ9A 2OO9A 3FTDA 1XB2B 5FTJA 2GQFA 3GLIA 2FFJA 2QZ4A 4FCVA 1R4GA 3B74A 2R62A 4IJFA 1TF0B 4GHAA 3GO8A 1X37A 3GP1A 1PGYA 3EIHA 4II7A 2KXEA 4LCBA 4DR2M 2UU9M 3KOYE 3LCVB 4JYAM 1XHBA 2DVWB 2DKLA 1TTEA 3GLGB 1IM2A 3J2PB 1SXJB 5ITYA 3W68A 3D8BA 4DV4M 2EJSA 2P5TA 4GRIA 3K92A 4PDIA 3L2AA 3IECA 3VDPA 5IWAM 4M0DA 2DI0A 4OVZB 2L6OA 3MJ5A 2DWMA 4BB9A 4M9ZA 3U60A 2VF8A 1NV9A 4NSOB 1R5LA 3PFIA 1XMOM 2DXIA 2L4EA 1YUBA 2LVQD 2O25A 3GLFA 1JB0F 2UXCM 3FUWA 4GIPA 4F1IA 4NSRA 2RGHA 3K9OA 4DV1M 4B3TM 4QNMA 5E6JA 4GMQA 1PJIA 1L1TA 3M0EA 2R4JA 3HWSA 4PDGA 1Y8GA 1R6BX 4M9XA 1WXQA 3K1JA 1TH4A 3U5ZA 5DYIA 2JP7A 3Q8GA 1QANA 4LGYA 2C9OA 2R0IA 2J5YA 2XGNA 4LJ4A 2M60A 2MH8A 3AFHA 5EP4A 1HNWM 3UMMA 1UM8A 2N35A 3J7BA 2FE8A 4R7GA 1TGUA 5KPZA 5ITQA 3QWLA 4L8RC 3AL0C 1IN7A 2JNHA 2XLJA 4P16A 3A46A 1NVMA 4XK8F 3TPZA 3GPYA 4FWHA 2Y21A 2Q2EB 1IBKM 1K3WA
chains in the Genus database with same CATH topology
4WP2A 1DV0A 2KNVA 2MGWA 1T6OA 2BWBA 2JZ0A 1JR3E 5DFLA 1VEKA 2DAKA 1OTRA 3K9PA 3T6PA 3F92A 1G41A 2G3QA 1BVSA 1G4AE 2DHYA 2ZTCA 1QZEA 2LTUA 1NV8A 1OQYA 2LVPC 2MR9A 1VG5A 2DAMA 1C7YA 1OKSA 1GO5A 3GLFE 1XXHE 2CWBA 3MMPA 1SG9A 2DENA 4F2LA 3H4JA 2DNAA 2CP8A 2OOBA 2H5XA 1IXSA 1VDLA 2MJ5B 2K9DA 4UN2B 3GLHE 3GLGE 1TR8A 1ZMUA 2LVOC 1HT1E 2JY5A 4R71A 1F4IA 2JY6B 1CUKA 1WR1B 1WJ7A 1T43A 1ZMVA 1AIPC 2BWEA 2DZLA 2DAEA 2HAKA 1WIVA 2JUJA 2OO9A 1DO0A 1DO2A 1XB2B 2L2DA 1ZV1A 2EKKA 1R4GA 2MROB 3E46A 3B89A 2JY7A 1PGYA 3FRHA 3LCVB 2JY8A 2EKFA 2DKLA 1TTEA 1IM2A 1IFYA 2KNAA 4GEWA 1VEJA 2EJSA 1HJPA 3IECA 2DI0A 1HQYE 2LVAA 1HT2E 1Q02A 2B3TA 1WHCA 1E94E 1NV9A 2HWJA 2ZTDA 2L4EA 1ZMWA 2K0BX 3E21A 2LVQD 3GLIE 2O25A 1UFZA 2LVNC 2KHHA 4F1IA 1WGNA 3K9OA 1P3QQ 1YLAA 1KYIA 1Y8GA 2JZ1A 1A5TA 4DBGB 1MN3A 3LCUA 2WZJA 3IHPA 2JP7A 2DAGA 1OAIA 2L4FA 1VQ1A 2LBCA 1G3IA 2QHOB 2R0IA 1VEGA 3FRIA 3FE3A 2KNZA 2OOAA 1WGLA 3BBZA 2RRUA 1V92A 1EFUB 2JNHA 5JI2E 4Q7JA 2QNJA 2DAIA 2QSFX 4G3OA 4HEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WP2 A;  1DV0 A;  2KNV A;  2MGW A;  1T6O A;  2BWB A;  2JZ0 A;  1JR3 E;  5DFL A;  1VEK A;  2DAK A;  1OTR A;  3K9P A;  3T6P A;  3F92 A;  1G41 A;  2G3Q A;  1BVS A;  1G4A E;  2DHY A;  2ZTC A;  1QZE A;  2LTU A;  1NV8 A;  1OQY A;  2LVP C;  2MR9 A;  1VG5 A;  2DAM A;  1C7Y A;  1OKS A;  1GO5 A;  3GLF E;  1XXH E;  2CWB A;  3MMP A;  1SG9 A;  2DEN A;  4F2L A;  3H4J A;  2DNA A;  2CP8 A;  2OOB A;  2H5X A;  1IXS A;  1VDL A;  2MJ5 B;  2K9D A;  4UN2 B;  3GLH E;  3GLG E;  1TR8 A;  1ZMU A;  2LVO C;  1HT1 E;  2JY5 A;  4R71 A;  1F4I A;  2JY6 B;  1CUK A;  1WR1 B;  1WJ7 A;  1T43 A;  1ZMV A;  1AIP C;  2BWE A;  2DZL A;  2DAE A;  2HAK A;  1WIV A;  2JUJ A;  2OO9 A;  1DO0 A;  1DO2 A;  1XB2 B;  2L2D A;  1ZV1 A;  2EKK A;  1R4G A;  2MRO B;  3E46 A;  3B89 A;  2JY7 A;  1PGY A;  3FRH A;  3LCV B;  2JY8 A;  2EKF A;  2DKL A;  1TTE A;  1IM2 A;  1IFY A;  2KNA A;  4GEW A;  1VEJ A;  2EJS A;  1HJP A;  3IEC A;  2DI0 A;  1HQY E;  2LVA A;  1HT2 E;  1Q02 A;  2B3T A;  1WHC A;  1E94 E;  1NV9 A;  2HWJ A;  2ZTD A;  2L4E A;  1ZMW A;  2K0B X;  3E21 A;  2LVQ D;  3GLI E;  2O25 A;  1UFZ A;  2LVN C;  2KHH A;  4F1I A;  1WGN A;  3K9O A;  1P3Q Q;  1YLA A;  1KYI A;  1Y8G A;  2JZ1 A;  1A5T A;  4DBG B;  1MN3 A;  3LCU A;  2WZJ A;  3IHP A;  2JP7 A;  2DAG A;  1OAI A;  2L4F A;  1VQ1 A;  2LBC A;  1G3I A;  2QHO B;  2R0I A;  1VEG A;  3FRI A;  3FE3 A;  2KNZ A;  2OOA A;  1WGL A;  3BBZ A;  2RRU A;  1V92 A;  1EFU B;  2JNH A;  5JI2 E;  4Q7J A;  2QNJ A;  2DAI A;  2QSF X;  4G3O A;  4HEO A; 
#chains in the Genus database with same CATH topology
 1DV0 A;  3FD9 A;  1SXJ C;  4X64 M;  1GL6 A;  3ZQJ A;  4NL4 H;  2JZ0 A;  3ZH9 B;  4YHH M;  3B7Z A;  2DAK A;  3J27 B;  3KP1 E;  5L8R F;  4MGI E;  4R3D A;  1VDD A;  3UGJ A;  3SBJ A;  3GPX A;  4LFC M;  3L25 A;  2R4E A;  3F92 A;  1BVS A;  3VKH A;  2DHY A;  1XMQ M;  4QOS A;  2QPA A;  2X4A A;  3R9X B;  4FWG A;  2R18 A;  2LXE A;  5GKN A;  5IT9 S;  2LHC A;  4IBF A;  1D0M A;  1IY2 A;  3PNV A;  2LVP C;  4TUW A;  1SXJ D;  2MR9 A;  3SAW A;  2Z8Y M;  4G6Z A;  3GPP A;  3AOE C;  2DAM A;  1GVN A;  2CUZ A;  3L26 A;  3OTO M;  3KOX E;  3GPU A;  4JI4 M;  1D0K A;  1SG9 A;  2CFO A;  2RGO A;  3KVW A;  5EXS A;  4BLC A;  2CP8 A;  3KSJ A;  4EIW A;  1IN5 A;  1IXS A;  1VDL A;  2H5X A;  2K9D A;  1QDR A;  3KS4 A;  3TWL A;  1NHW C;  3GLG E;  2UXD M;  2FH0 A;  1SXJ E;  2F5O A;  1MJG M;  2KEB A;  1QUS A;  3HX3 A;  2CRU A;  2HCB A;  3IG5 A;  4MGZ E;  4RKU F;  4KO8 A;  4FCW A;  1K82 A;  4IBB A;  1F4I A;  5EXX A;  1AUA A;  2VQF M;  3I51 A;  4A3V B;  5EP1 A;  1WJ7 A;  4G4Q A;  2HKJ A;  3RE8 A;  2QBY A;  2Y0Q A;  5FTN A;  2HAK A;  3T38 A;  3HY5 A;  4IBE A;  1WIV A;  3I4V A;  3FYC A;  5KPR A;  3C58 A;  3C3D A;  3U6E A;  1R7R A;  1G71 A;  2MRO B;  3EIE A;  3KXE C;  2HHH M;  1NNJ A;  1NHG C;  3U6O A;  2JY7 A;  5JI3 E;  2L7I A;  5BR8 M;  2D7G A;  3GLH B;  2D7H A;  2EKF A;  3HU1 A;  4QHT A;  3JR5 A;  1MX0 A;  2L7H A;  2M5Z A;  4NXM M;  4CGY B;  4GEW A;  3LVW A;  1PJQ A;  3SYK A;  3SYL A;  2W82 A;  3A42 A;  1TDZ A;  4B7F A;  3LW5 F;  3R8F A;  1HJP A;  4MGH A;  4JI7 M;  1DGB A;  3CF2 A;  3E9S A;  2WSC F;  1HQY E;  2LVA A;  4GC9 A;  4FVM A;  2KDL A;  2ERC A;  2F5N A;  3TWM A;  2QEN A;  2KRU A;  3UZU A;  2V1U A;  3RFW A;  2FNA A;  1N34 M;  1J5E M;  4JI0 M;  2Y20 A;  4B3S M;  3HJ8 A;  3BXW A;  1UFZ A;  2LVN C;  1T3T A;  2KHH A;  3TWK A;  3FUX A;  3ZC7 B;  2NQ8 C;  2JWS A;  4ITQ A;  2CEA A;  3GQ5 A;  1J7K A;  1YLA A;  1QDT A;  3W67 A;  8CAT A;  2JZ1 A;  2A5Y B;  1A5T A;  2C98 A;  2V6Z M;  3KP0 E;  4LF4 M;  3LCU A;  5EP2 A;  3PXG A;  3V76 A;  3GLG A;  2EUC A;  2LBC A;  2DAG A;  3I4Y A;  4IBC A;  4AKG A;  3QYE A;  3C9P A;  1JR3 D;  4AW4 A;  1VEG A;  4BBA A;  3TL4 X;  3U61 B;  3NWL A;  3HHY A;  2KNZ A;  2Y0T A;  2VF7 A;  2YQZ A;  4IBK A;  4L16 A;  1N33 M;  2UXB M;  2RRU A;  1EFU B;  5FSW A;  2RKO A;  4Q7J A;  2QNJ A;  4Y28 F;  3QAU A;  1DGH B;  2YFQ A;  2E5L M;  2KA6 B;  4MGY E;  4HEO A;  4LRS A;  1G8P A;  2CE7 A;  2ZAM A;  3FUV A;  3GLI B;  2XF3 A;  1N77 A;  3U6P A;  2XZU A;  3CF0 A;  1T6O A;  4RNA A;  4JXJ A;  1JR3 E;  4X65 M;  2K47 A;  2UUC M;  3J7A S;  4LGM A;  2QP9 X;  1QAO A;  1N36 M;  3SC3 A;  1Q3C A;  3TQS A;  4HL4 A;  2HL7 A;  4M0W A;  3SMS A;  1LV7 A;  3H4M A;  4FW9 A;  1HNX M;  3FKE A;  1S3S A;  2F5S A;  4WW0 A;  3L29 A;  4CIZ A;  4DR3 M;  3AV0 A;  1Z5C A;  4X62 M;  3WHL A;  2XH9 A;  4REZ A;  2I7N A;  4NRV A;  4LJ6 A;  2XSZ D;  2APL A;  1OFH A;  1LTM A;  4RF1 A;  2CWB A;  4L6V 6;  2OPF A;  4LRT A;  5EP3 A;  3UJN A;  4Z8X A;  4FD2 A;  4DR4 M;  2DNA A;  4OX9 M;  1HR0 M;  2KW0 A;  3U5Z B;  1IY0 A;  1JQJ C;  2MJ5 B;  4MGK E;  3GLH E;  4ZPX A;  1L1Z A;  4B3R M;  2CHQ A;  1GKI A;  1ZMU A;  2LVO C;  3U6L A;  3SAU A;  4NRW A;  1Z5A A;  3I01 M;  2JY5 A;  3NBI A;  4AG6 A;  4R71 A;  4LG2 A;  1GJS A;  1CUK A;  2ZAN A;  1L2D A;  5IRE B;  4LJ9 A;  3VK8 A;  3GRV A;  2ZBK B;  3VFD A;  4G4O A;  4LF9 M;  4KOD A;  1DO2 A;  3FTE A;  4GIT A;  3SAT A;  1XXH B;  2EKK A;  2WSF F;  5FTL A;  4B08 A;  1N32 M;  4AI6 A;  1XNR M;  3B7Q A;  3FUT A;  4QHS A;  4KHP M;  4I8O A;  3B89 A;  3FRH A;  2BJV A;  3FUU A;  4JI3 M;  2JY8 A;  3U6D A;  3LMM A;  4LF8 M;  2F5Q A;  1IFY A;  3I04 M;  3W0L B;  2CV0 A;  4YY3 M;  2Z4S A;  1E32 A;  1Z6T A;  3L27 A;  3HGI A;  4B7H A;  4JN6 A;  2DWL A;  4LJ7 A;  1XWI A;  1IBL M;  4IBJ A;  1IN6 A;  5KQD A;  4CJ6 A;  3LVV A;  1HT2 E;  2Z7J A;  4MM3 B;  5F3W A;  7CAT A;  1R2Z A;  4AKH A;  4AG5 A;  5ITX E;  3SFZ A;  1WHC A;  4MB7 A;  3THG A;  4GKK M;  2HWJ A;  1QYR A;  4QOZ C;  3VKG A;  1ZMW A;  2I7P A;  1PJT A;  2K0B X;  3E21 A;  3HHX A;  3GLI E;  2D7E A;  1H6U A;  4JI6 M;  1MU5 A;  4MH0 E;  3RGP A;  3TE6 A;  3SAR A;  1RU3 A;  1WGN A;  1GAB A;  1YE9 A;  3W0F A;  4WUR A;  1IXS B;  1V33 A;  3GQ3 A;  4DV5 M;  1KYI A;  3NBX X;  1OAO C;  4PCZ A;  4NXN M;  3A98 B;  3GLH A;  2H1R A;  3FTC A;  3LQR A;  2L4F A;  3MK6 A;  1NNU C;  1VQ1 A;  1G3I A;  2O01 F;  4IIW A;  4LJ8 A;  1D0L A;  1L2C A;  5A2Q S;  3SAV A;  1Q39 A;  1G59 A;  2XFT A;  3FE3 A;  4LZZ A;  3KOZ E;  3MHV C;  1WGL A;  1J09 A;  5E26 A;  2QBY B;  1V92 A;  2C96 A;  3DZD A;  3DA1 A;  1E9R A;  3SHF A;  4LF6 M;  1QQW A;  2QCU A;  2DAI A;  3AJI B;  1EIJ A;  5KPT A;  2GNO A;  2KRK A;  2QSF X;  1DGG A;  3KDS E;  1PRB A;  4GH9 A;  2YNM D;  4DR7 M;  2R46 A;  1V34 A;  3CTW B;  4LJA A;  4P17 A;  1HNZ M;  1IBM M;  2R6F A;  1VEK A;  4IBI A;  1OTR A;  4LZJ A;  1TH2 A;  3K9P A;  3U6M A;  3DFZ A;  4AQY M;  3HKP A;  1G4A E;  1I4W A;  1SXJ A;  5EQT A;  2EA0 A;  2ZTC A;  3AOG A;  2XFS A;  3L28 A;  3PVS A;  5KQ8 A;  3Q8X A;  3K8Z A;  1NV8 A;  1OQY A;  2UUB M;  3B9P A;  2G5G X;  5C18 A;  4OU7 A;  4DV7 M;  1OJL A;  2C9C A;  3KOW E;  4OVZ A;  1KFV A;  2V1C A;  1DGH A;  3CGW A;  1IQP A;  4DV6 M;  4DUZ M;  1C7Y A;  2ZAO A;  1GO5 A;  3HJQ A;  4DV0 M;  1XXH E;  3MMP A;  4F2L A;  2OQ4 A;  4JI1 M;  3H4J A;  2OOB A;  4IJE A;  3U6Q A;  4LFB M;  5KO3 A;  3T1Y M;  3U6C A;  1XNQ M;  4KLN A;  1IXR C;  3IG8 A;  3AOE A;  4UN2 B;  2WSE F;  2VDB B;  1TR8 A;  3ZCB B;  1GJT A;  4B7G A;  1HT1 E;  3VK7 A;  2R45 A;  5H37 D;  5ITR A;  4GHL A;  2C99 A;  2JY6 B;  1T43 A;  4DV3 M;  1ZAE A;  2YR0 A;  5DNY A;  1R2Y A;  2DZL A;  4LJ5 A;  2DWN A;  2DAE A;  3U60 B;  1TDH A;  4LF7 M;  2X49 A;  1IY1 A;  3VLF B;  1GLN A;  1QAQ A;  1DO0 A;  2LHG A;  2R65 A;  2L2D A;  4FCT A;  3GLF B;  2ZM6 M;  1ZV1 A;  2VQE M;  4DV2 M;  2O5R A;  4FWD A;  4JI8 M;  1YSY A;  2FOI C;  3HHW A;  3KSX A;  4L78 A;  4GKJ M;  2X8A A;  1IN4 A;  3E46 A;  1NO1 A;  4LY6 A;  5FLX S;  2VII A;  3D8L A;  1E9S A;  4KT0 F;  2FS1 A;  4HLQ A;  4D80 A;  3E4R A;  3JAM S;  3M6A A;  1D2N A;  2R44 A;  2KNA A;  1XC8 A;  1L8Q A;  1VEJ A;  1TH3 A;  1PM5 A;  2CHG A;  1N75 A;  1PJS A;  3HZJ A;  1KSF X;  1Q3B A;  4K0K M;  1GL7 A;  4G4N A;  1Q02 A;  2B3T A;  2EO2 A;  4ANR A;  1E94 E;  3A45 A;  3C3E A;  3ILK A;  3UK6 A;  2ZTD A;  3GQ4 A;  4JI2 M;  5DYG A;  4L15 A;  1XXH A;  1OIP A;  4S12 A;  1NSF A;  4JI5 M;  3B7N A;  2DHR A;  1IN8 A;  4M9S A;  4JV5 M;  1P3Q Q;  4I5S A;  5FTK A;  3VDU A;  5BPV A;  1JR3 A;  2L09 A;  1NJF A;  2LH0 A;  2Z4R A;  4DBG B;  3T1H M;  1MN3 A;  4CIS A;  2WZJ A;  2G8L A;  2KZU A;  3IHP A;  4DUY M;  4B3M M;  1OAI A;  1ORY B;  3KS8 A;  2QHO B;  4D81 A;  3PNY A;  3HU2 A;  3FTF A;  3FRI A;  5ITT A;  4OW0 A;  2JXN A;  2OOA A;  4XGI A;  1FNN A;  3BBZ A;  1QUT A;  3SHG B;  5C1B A;  2C5R A;  4LF5 M;  4NOO B;  4G4R A;  5JI2 E;  2K6B A;  2J7O A;  2XZF A;  1PJJ A;  4I4L A;  4G3O A;  2F4V M;  1QZM A;  1NJG A;  3HHZ A;  4RF0 A;  4WP2 A;  4X66 M;  4D82 A;  5LMN M;  2QQ8 A;  1I94 M;  5EXP A;  2KNV A;  3M7G A;  3J81 S;  2LWX A;  4AKI A;  2MGW A;  4IBG A;  2BWB A;  5LMU M;  2XEP A;  5DFL A;  3SAS A;  1OFI A;  3KFU G;  5FTM A;  2UUA M;  3BOS A;  3KW6 A;  2DZO B;  3T6P A;  3AKZ A;  3K2L A;  1K3X A;  4PT5 A;  3GRU A;  1G41 A;  2G3Q A;  3FYD A;  1IXZ A;  3WHK A;  4Z6Y A;  2CV1 A;  2CHV A;  4AZF A;  1QZE A;  1W5S A;  2LNH C;  2LTU A;  3GRY A;  3T15 A;  4NC6 A;  2XSZ A;  3SMP A;  4I81 A;  4LFA M;  4W5W A;  1NY6 A;  1Z5B A;  5ITU A;  1QVR A;  3GRR A;  1VG5 A;  2Z3X A;  1OKS A;  5IZ7 D;  1NY5 A;  3GLF E;  1QAM A;  1C1K A;  4L4U A;  3HU3 A;  1W5T A;  2JA2 A;  3CF6 E;  4DR6 M;  2DEN A;  3LQQ A;  4CHT B;  1DGF A;  3DOA A;  2DWZ B;  3RGS A;  1L2B A;  1OIZ A;  2J7N A;  4QNR A;  3U6S A;  5EJC A;  3J80 S;  3QYB A;  4GC5 A;  2BJW A;  3JR4 A;  1HQC A;  3HJS A;  1N78 A;  2F5P A;  4XBO A;  4PD2 A;  2CV2 A;  2BNK A;  1Z59 A;  3U61 A;  1FJG M;  1WR1 B;  2AHM A;  2KZS A;  5EXT A;  4DR5 M;  2DZN B;  4DR1 M;  1ZMV A;  1AIP C;  1EE8 A;  2BWE A;  4IBD A;  2JUJ A;  5ITX A;  1ZQ9 A;  2OO9 A;  3FTD A;  1XB2 B;  5FTJ A;  2GQF A;  3GLI A;  2FFJ A;  2QZ4 A;  4FCV A;  1R4G A;  3B74 A;  2R62 A;  4IJF A;  1TF0 B;  4GHA A;  3GO8 A;  1X37 A;  3GP1 A;  1PGY A;  3EIH A;  4II7 A;  2KXE A;  4LCB A;  4DR2 M;  2UU9 M;  3KOY E;  3LCV B;  4JYA M;  1XHB A;  2DVW B;  2DKL A;  1TTE A;  3GLG B;  1IM2 A;  3J2P B;  1SXJ B;  5ITY A;  3W68 A;  3D8B A;  4DV4 M;  2EJS A;  2P5T A;  4GRI A;  3K92 A;  4PDI A;  3L2A A;  3IEC A;  3VDP A;  5IWA M;  4M0D A;  2DI0 A;  4OVZ B;  2L6O A;  3MJ5 A;  2DWM A;  4BB9 A;  4M9Z A;  3U60 A;  2VF8 A;  1NV9 A;  4NSO B;  1R5L A;  3PFI A;  1XMO M;  2DXI A;  2L4E A;  1YUB A;  2LVQ D;  2O25 A;  3GLF A;  1JB0 F;  2UXC M;  3FUW A;  4GIP A;  4F1I A;  4NSR A;  2RGH A;  3K9O A;  4DV1 M;  4B3T M;  4QNM A;  5E6J A;  4GMQ A;  1PJI A;  1L1T A;  3M0E A;  2R4J A;  3HWS A;  4PDG A;  1Y8G A;  1R6B X;  4M9X A;  1WXQ A;  3K1J A;  1TH4 A;  3U5Z A;  5DYI A;  2JP7 A;  3Q8G A;  1QAN A;  4LGY A;  2C9O A;  2R0I A;  2J5Y A;  2XGN A;  4LJ4 A;  2M60 A;  2MH8 A;  3AFH A;  5EP4 A;  1HNW M;  3UMM A;  1UM8 A;  2N35 A;  3J7B A;  2FE8 A;  4R7G A;  1TGU A;  5KPZ A;  5ITQ A;  3QWL A;  4L8R C;  3AL0 C;  1IN7 A;  2JNH A;  2XLJ A;  4P16 A;  3A46 A;  1NVM A;  4XK8 F;  3TPZ A;  3GPY A;  4FWH A;  2Y21 A;  2Q2E B;  1IBK M;  1K3W A; 
#chains in the Genus database with same CATH homology
 4WP2 A;  1DV0 A;  2KNV A;  2MGW A;  1T6O A;  2BWB A;  2JZ0 A;  1JR3 E;  5DFL A;  1VEK A;  2DAK A;  1OTR A;  3K9P A;  3T6P A;  3F92 A;  1G41 A;  2G3Q A;  1BVS A;  1G4A E;  2DHY A;  2ZTC A;  1QZE A;  2LTU A;  1NV8 A;  1OQY A;  2LVP C;  2MR9 A;  1VG5 A;  2DAM A;  1C7Y A;  1OKS A;  1GO5 A;  3GLF E;  1XXH E;  2CWB A;  3MMP A;  1SG9 A;  2DEN A;  4F2L A;  3H4J A;  2DNA A;  2CP8 A;  2OOB A;  2H5X A;  1IXS A;  1VDL A;  2MJ5 B;  2K9D A;  4UN2 B;  3GLH E;  3GLG E;  1TR8 A;  1ZMU A;  2LVO C;  1HT1 E;  2JY5 A;  4R71 A;  1F4I A;  2JY6 B;  1CUK A;  1WR1 B;  1WJ7 A;  1T43 A;  1ZMV A;  1AIP C;  2BWE A;  2DZL A;  2DAE A;  2HAK A;  1WIV A;  2JUJ A;  2OO9 A;  1DO0 A;  1DO2 A;  1XB2 B;  2L2D A;  1ZV1 A;  2EKK A;  1R4G A;  2MRO B;  3E46 A;  3B89 A;  2JY7 A;  1PGY A;  3FRH A;  3LCV B;  2JY8 A;  2EKF A;  2DKL A;  1TTE A;  1IM2 A;  1IFY A;  2KNA A;  4GEW A;  1VEJ A;  2EJS A;  1HJP A;  3IEC A;  2DI0 A;  1HQY E;  2LVA A;  1HT2 E;  1Q02 A;  2B3T A;  1WHC A;  1E94 E;  1NV9 A;  2HWJ A;  2ZTD A;  2L4E A;  1ZMW A;  2K0B X;  3E21 A;  2LVQ D;  3GLI E;  2O25 A;  1UFZ A;  2LVN C;  2KHH A;  4F1I A;  1WGN A;  3K9O A;  1P3Q Q;  1YLA A;  1KYI A;  1Y8G A;  2JZ1 A;  1A5T A;  4DBG B;  1MN3 A;  3LCU A;  2WZJ A;  3IHP A;  2JP7 A;  2DAG A;  1OAI A;  2L4F A;  1VQ1 A;  2LBC A;  1G3I A;  2QHO B;  2R0I A;  1VEG A;  3FRI A;  3FE3 A;  2KNZ A;  2OOA A;  1WGL A;  3BBZ A;  2RRU A;  1V92 A;  1EFU B;  2JNH A;  5JI2 E;  4Q7J A;  2QNJ A;  2DAI A;  2QSF X;  4G3O A;  4HEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...