1V92A

Solution structure of the uba domain from p47, a major cofactor of the aaa atpase p97
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, dynamics and interactions of p47, a major adaptor of the AAA ATPase, p97
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Recombination
molecule keywords NSFL1 cofactor p47
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1v92A00
3E21A 1HT1E 2H5XA 1WGNA 1WJ7A 2DENA 2EKFA 4UN2B 3GLIE 1VEGA 2ZTDA 2K0BX 2L2DA 2MGWA 3K9PA 2BWEA 1G4AE 1T43A 2L4FA 1WGLA 2OO9A 4R71A 2RRUA 2LVQD 2DAGA 1XB2B 1XXHE 1IFYA 1VEKA 2JY7A 3BBZA 1TTEA 1HJPA 1OTRA 1IM2A 3FRHA 2L4EA 1NV8A 1JR3E 1SG9A 1HT2E 2JUJA 2DAKA 1HQYE 1VG5A 1R4GA 1BVSA 4WP2A 1WIVA 2QNJA 2KNVA 2LVAA 2QSFX 2LVOC 1GO5A 3GLHE 1AIPC 2B3TA 1ZMUA 2CP8A 2JY6B 3H4JA 1DO2A 1KYIA 2DAEA 2EJSA 2DHYA 2G3QA 3IHPA 2JP7A 4HEOA 3FRIA 2EKKA 3LCVB 3LCUA 1VDLA 3F92A 1OQYA 2KNZA 2MROB 2JY8A 1OAIA 1ZV1A 2DNAA 2JZ0A 1OKSA 1NV9A 2CWBA 2K9DA 3K9OA 4G3OA 4DBGB 3GLGE 1C7YA 1TR8A 5DFLA 2LVNC 3GLFE 2LTUA 2OOBA 2DZLA 2LVPC 1Y8GA 1WHCA 2QHOB 2BWBA 1DV0A 1G3IA 1UFZA 1F4IA 2OOAA 2R0IA 1YLAA 3E46A 1V92A 2MR9A 4F2LA 3FE3A 2HAKA 2KHHA 1G41A 1DO0A 1A5TA 1PGYA 2DAMA 1T6OA 2DAIA 2JY5A 1ZMWA 2DKLA 1QZEA 1VEJA 3IECA 1Q02A 2JNHA 2MJ5B 5JI2E 4GEWA 1CUKA 4Q7JA 2DI0A 3MMPA 1P3QQ 2WZJA 3T6PA 1ZMVA 3B89A 1E94E 2KNAA 1IXSA 2JZ1A 2ZTCA 2HWJA 1EFUB 1WR1B 1MN3A 2LBCA 1VQ1A 2O25A 4F1IA
chains in the Genus database with same CATH superfamily
4GKKM 2H5XA 2DWZB 3VK8A 4QOSA 2F5SA 2C9CA 3T1YM 2VF8A 2CRUA 1OJLA 3KS8A 1QANA 4FD2A 3D8LA 3KW6A 5JI3E 4DV5M 4B3MM 1VEGA 3MHVC 2R18A 4AI6A 2MGWA 4JI7M 3GPPA 1XC8A 3I04M 1G4AE 4AKHA 2L4FA 2KW0A 2FFJA 3AJIB 3ZH9B 3L28A 2JWSA 2LVQD 4D81A 3HJSA 4LGMA 4DV4M 1XXHE 1AUAA 1D0MA 2ZAOA 3TWLA 2G5GX 4LF8M 3GLIB 1QAMA 5EXSA 1VEKA 2JY7A 3ZCBB 4MGIE 1IM2A 4CIZA 2H1RA 3LMMA 3RGSA 2L4EA 4LZZA 1SG9A 1HT2E 3LW5F 3I4VA 1R4GA 5IT9S 4AG6A 4WP2A 5FSWA 2LVAA 4IJFA 2LH0A 5KQDA 4DR3M 3SARA 3U6MA 1T3TA 2LVOC 1GO5A 2BNKA 3SAUA 3JR4A 2K6BA 4DUYM 2CP8A 3GRUA 4G6ZA 3HJQA 3H4JA 4GC9A 1KYIA 3GLFB 3J7AS 3KOWE 4HEOA 4L4UA 4FCWA 5E26A 3FRIA 2EKKA 3LCVB 3B7QA 4NOOB 4FCVA 3J81S 2KNZA 2RKOA 2FOIC 3HHXA 3VDUA 1SXJD 3U6SA 2XZUA 2UUBM 1GJTA 2CWBA 4LFCM 4G3OA 5KO3A 3GLGE 2HL7A 2XFSA 5DFLA 3C3EA 1TH4A 3LQRA 3W68A 1XMQM 2LVPC 3VFDA 2KRKA 4B3RM 2XGNA 2QPAA 1QDRA 4PD2A 4YY3M 4DV2M 4S12A 2ZBKB 1DV0A 1GABA 1G3IA 1F4IA 1TH3A 2RGOA 4AZFA 3MK6A 3SHFA 2C98A 2ZANA 1HQCA 3E46A 1V92A 1JR3A 3T38A 4WURA 2F4VM 1Q3BA 2WSFF 4IBDA 5ITTA 3AL0C 4XBOA 3W0FA 3SAVA 4GRIA 2Z3XA 2L09A 2GNOA 1QUTA 1XXHB 5F3WA 4LF5M 1A5TA 2JY5A 2R6FA 4KODA 4BB9A 2XFTA 3A42A 3IECA 2AHMA 1Q02A 2JNHA 3NBIA 4PT5A 5GKNA 3C58A 3SHGB 2P5TA 4IBKA 1CUKA 4Q7JA 4WW0A 2F5OA 3M6AA 1P3QQ 2R45A 1QAQA 1X37A 3HU1A 4NC6A 2O5RA 3KXEC 3UZUA 2Y20A 1E94E 4RNAA 4LJ6A 1W5SA 8CATA 4D82A 4CISA 1QQWA 4QOZC 1N32M 2ZTCA 4JI8M 1PJQA 4FWDA 3AOEA 3GQ4A 4M9SA 3SFZA 4NSOB 1N75A 3EIHA 3NBXX 3BBZA 3OTOM 3A45A 3E21A 4EIWA 1WGNA 5DYGA 4IIWA 2X49A 1HNXM 2EO2A 3QYEA 1NHWC 1YUBA 1FNNA 3FUXA 2EKFA 3FUWA 4IJEA 2QBYA 1QVRA 5C18A 3B9PA 4P17A 3GO8A 4M9XA 5A2QS 2ZTDA 1NY5A 2CHQA 3K9PA 2BWEA 2MH8A 5ITXA 2VQFM 3SMPA 3HJ8A 2OO9A 4RF0A 1EIJA 3TWMA 3VKGA 2OPFA 1N36M 3R8FA 4OW0A 2A5YB 5ITQA 3B7NA 3HU3A 1L2CA 4B3TM 4IBCA 2QZ4A 3J2PB 3HWSA 1RU3A 1IFYA 1UM8A 2HKJA 1IQPA 1TTEA 3SMSA 1OTRA 1L8QA 4KLNA 2VIIA 2XZFA 1R7RA 4L15A 2L6OA 2E5LM 2R46A 1NV8A 3J80S 3GPUA 3KOYE 4DV3M 1IN5A 1N34M 3CF2A 1WIVA 2QNJA 2KNVA 2Z7JA 1R2YA 2DXIA 2UXDM 2XH9A 4A3VB 2XF3A 3THGA 5FTLA 3ZC7B 4RF1A 1MJGM 1IN8A 2DAEA 4M0DA 1OFHA 1XNRM 2DHYA 2G3QA 3IHPA 2W82A 1VDLA 5EP2A 3DA1A 5IWAM 1OQYA 2MROB 4B7GA 4FVMA 3UMMA 3A46A 1JB0F 1I4WA 1OAIA 1ZV1A 2R65A 2NQ8C 2R4EA 1OKSA 1N33M 3MJ5A 2FNAA 2K9DA 4MM3B 2XEPA 4M0WA 4DBGB 3SC3A 4LZJA 5ITXE 2J5YA 2KRUA 3ZQJA 1TR8A 1PM5A 2VF7A 4BBAA 2LTUA 4G4QA 2UUAM 5EXTA 1GL6A 1VDDA 1YSYA 2RGHA 4II7A 3CF0A 1UFZA 4QHTA 4JXJA 4X66M 3NWLA 4B7HA 1IN7A 3C9PA 4DR4M 2FE8A 2KZSA 3FUUA 2MR9A 3KSXA 3L27A 3WHKA 2BJVA 1IY1A 4F2LA 2C9OA 2DWMA 2HAKA 4IBFA 3SYKA 2KHHA 4W5WA 1E9RA 1QUSA 1PGYA 4M9ZA 1T6OA 1ZMWA 2DKLA 3IG8A 3R9XB 4LF6M 1JQJC 1XWIA 2CEAA 4JN6A 3L26A 3K2LA 1KSFX 4IBGA 3KSJA 2MJ5B 3FTCA 4MGZE 2Y0TA 3JAMS 5JI2E 2CE7A 2HHHM 1Q3CA 1KFVA 1ORYB 2D7HA 2L7IA 5EXXA 3RGPA 3V76A 1OIPA 1R5LA 3AOEC 2FS1A 2J7NA 4B08A 3TPZA 3VKHA 1V33A 2WZJA 4K0KM 2G8LA 3T6PA 3JR5A 4G4RA 4JI1M 1ZMVA 2DZNB 3B89A 3KP1E 4Y28F 3SBJA 2KNAA 1K3XA 1IY0A 1J09A 3FYDA 2JZ1A 4MB7A 4DR7M 3GRYA 4HLQA 3U60A 4DR6M 1IBKM 2HWJA 3KVWA 1EFUB 4JI2M 1MN3A 2QENA 4OVZB 2ZM6M 4LF9M 1NSFA 4LRSA 1VQ1A 1QZMA 2KA6B 2I7PA 3AKZA 4ITQA 1HT1E 1J5EM 4DV7M 3W0LB 1GJSA 1I94M 2C99A 2LXEA 4AKIA 3E9SA 4MGYE 1SXJA 3E4RA 3GLIE 3KOZE 4L78A 4CGYB 4D80A 5KPZA 4LF4M 1E9SA 1Z5BA 2VDBB 2WSEF 3FTFA 5EP4A 2LWXA 2C96A 4LFAM 2KDLA 4KO8A 1K3WA 1K82A 1SXJC 2DAGA 2V1CA 3GPYA 2EUCA 4KT0F 3K92A 3U60B 2QP9X 1NJGA 4NXMM 2R44A 1Z59A 3U61A 2YFQA 4OVZA 1L2DA 1OFIA 4I81A 4IBIA 3U6OA 5LMNM 1E32A 4RKUF 3FRHA 2CHGA 4R3DA 4JI0M 2JUJA 2J7OA 5EP3A 1QYRA 1VG5A 3CTWB 5EJCA 3RE8A 4DV0M 1BVSA 4JYAM 1NO1A 3TL4X 1IBLM 2QBYB 1XNQM 4LJ8A 1GLNA 3B74A 3GLHA 1AIPC 2B3TA 1IXSB 4X65M 1HR0M 4AQYM 2O01F 2CHVA 3K8ZA 3SAWA 3GLGB 2LHGA 4QNMA 3GLIA 1TH2A 2LNHC 1QAOA 3U6EA 1DGFA 2Z4SA 2DNAA 2F5PA 2JZ0A 4CHTB 4IBBA 3PFIA 2C5RA 1NV9A 2DWLA 3M0EA 3HY5A 3T1HM 1Z5CA 1C7YA 2HCBA 3SASA 3GLFE 2LHCA 2LVNC 4PDGA 4FWGA 2OOBA 3FUTA 5KPRA 3GRVA 1PJSA 1Y8GA 2D7GA 3HKPA 4NRVA 1TDZA 2DVWB 2DWNA 5BR8M 4Z8XA 2BWBA 4DR1M 4CJ6A 1JR3D 1GL7A 1NHGC 4OU7A 1C1KA 2I7NA 2OOAA 2YQZA 5EQTA 2ERCA 5L8RF 3SATA 2L7HA 2ZAMA 1G8PA 3HZJA 3PXGA 4I8OA 3VK7A 1NJFA 1QDTA 5KPTA 1G41A 5LMUM 2DAMA 3D8BA 1PRBA 4ZPXA 1DGBA 1ZQ9A 3I51A 4LRTA 4MGHA 1IBMM 2X4AA 4QNRA 2OQ4A 3W67A 2V6ZM 4IBEA 4LCBA 1DGHA 4L6V6 3J27B 3CF6E 4GEWA 4LJ5A 2UUCM 2Z4RA 2JXNA 4XGIA 5EP1A 1IN4A 2KEBA 3Q8XA 3GP1A 3B7ZA 4DR5M 4DR2M 3CGWA 3TE6A 1D2NA 4B7FA 2Y0QA 4MH0E 5DYIA 2DI0A 4Z6YA 3MMPA 3GPXA 4JI4M 1GKIA 5ITUA 1TF0B 2F5NA 1WXQA 4G4NA 3HGIA 1OIZA 1Z6TA 4TUWA 4DV6M 2F5QA 2Z8YM 3DZDA 2M5ZA 1YE9A 4BLCA 3GLFA 4GHAA 1NNJA 1IXSA 4GITA 2V1UA 1IXZA 3FYCA 4P16A 2JA2A 4X62M 2DHRA 3HU2A 3WHLA 1PJIA 4LG2A 1XMOM 1L2BA 4OX9M 3AOGA 4GC5A 3PVSA 4X64M 2O25A 2Y21A 3AV0A 3FKEA 3FUVA 4NL4H 4F1IA 2Q2EB 5H37D 3U6DA 5E6JA 2YR0A 3K1JA 4LGYA 1N78A 3GQ3A 1L1TA 4FCTA 1WJ7A 2UXBM 2DENA 3LVWA 4REZA 3FTDA 2K47A 1SXJB 3BXWA 4UN2B 3PNVA 3KFUG 1MU5A 2K0BX 1G71A 2M60A 3U6CA 2L2DA 2UXCM 3GRRA 4L8RC 2CV2A 3QWLA 1T43A 3J7BA 1IN6A 1WGLA 4LJ9A 1G59A 4R71A 3H4MA 2RRUA 3AFHA 4L16A 1LV7A 4LFBM 1XB2B 5C1BA 3U61B 4AG5A 2XLJA 3QYBA 3VLFB 4XK8F 4NRWA 2EA0A 1LTMA 4LF7M 1HJPA 2KZUA 1R2ZA 3KDSE 3U6QA 4R7GA 4DUZM 1IXRC 1JR3E 1DGHB 3LVVA 3BOSA 3I01M 4PCZA 5FTNA 3HHWA 5IZ7D 2DAKA 1HQYE 3I4YA 4GMQA 2CFOA 4LJ7A 3HHZA 2CV1A 4JI3M 4JI6M 1SXJE 2QSFX 4G4OA 2XSZD 4KHPM 1J7KA 3KP0E 3GLHE 5FTMA 4HL4A 1ZMUA 4IBJA 2JY6B 1DO2A 3HHYA 4QHSA 2EJSA 1HNWM 2JP7A 3L29A 1PJJA 3SYLA 1NY6A 2KXEA 3GLGA 4GIPA 4DV1M 3LCUA 4ANRA 3KOXE 4I5SA 2N35A 4LJ4A 3VDPA 1DGGA 3F92A 1EE8A 2GQFA 3TWKA 2JY8A 3PNYA 3U5ZB 3QAUA 3DOAA 1NVMA 3K9OA 2D7EA 1H6UA 3DFZA 1D0KA 5KQ8A 2R62A 3FD9A 3ILKA 3M7GA 2DZLA 5ITRA 1MX0A 2FH0A 1WHCA 2QQ8A 5IREB 2UU9M 2QHOB 4B3SM 3LQQA 4AW4A 3EIEA 3L2AA 3GQ5A 1S3SA 3C3DA 2R0IA 3TQSA 4GHLA 4NSRA 3FTEA 1YLAA 3T15A 5BPVA 3FE3A 2APLA 3GLHB 1NNUC 3IG5A 4FWHA 1OAOC 3UJNA 1DO0A 1XHBA 4PDIA 4LJAA 2DAIA 4GH9A 3UGJA 3U6PA 3UK6A 1QZEA 2R4JA 4NXNM 1R6BX 1XXHA 1FJGM 2DZOB 3RFWA 1PJTA 3U5ZA 2VQEM 2CUZA 1VEJA 3Q8GA 7CATA 3U6LA 1TDHA 2XSZA 2X8AA 4JV5M 1Z5AA 5FLXS 1D0LA 5FTKA 1L1ZA 5DNYA 4AKGA 5FTJA 3L25A 1IY2A 2BJWA 2WSCF 5ITYA 4GKJM 3HX3A 4MGKE 2CV0A 1V34A 1Q39A 1N77A 2YNMD 4FW9A 5EXPA 4YHHM 4I4LA 1W5TA 1WR1B 1ZAEA 4LY6A 2QCUA 3KS4A 1HNZM 3A98B 2LBCA 1GVNA 1TGUA 4JI5M
chains in the Genus database with same CATH topology
3E21A 1HT1E 2H5XA 1WGNA 1WJ7A 2DENA 2EKFA 4UN2B 3GLIE 1VEGA 2ZTDA 2K0BX 2L2DA 2MGWA 3K9PA 2BWEA 1G4AE 1T43A 2L4FA 1WGLA 2OO9A 4R71A 2RRUA 2LVQD 2DAGA 1XB2B 1XXHE 1IFYA 1VEKA 2JY7A 3BBZA 1TTEA 1HJPA 1OTRA 1IM2A 3FRHA 2L4EA 1NV8A 1JR3E 1SG9A 1HT2E 2JUJA 2DAKA 1HQYE 1VG5A 1R4GA 1BVSA 4WP2A 1WIVA 2QNJA 2KNVA 2LVAA 2QSFX 2LVOC 1GO5A 3GLHE 1AIPC 2B3TA 1ZMUA 2CP8A 2JY6B 3H4JA 1DO2A 1KYIA 2DAEA 2EJSA 2DHYA 2G3QA 3IHPA 2JP7A 4HEOA 3FRIA 2EKKA 3LCVB 3LCUA 1VDLA 3F92A 1OQYA 2KNZA 2MROB 2JY8A 1OAIA 1ZV1A 2DNAA 2JZ0A 1OKSA 1NV9A 2CWBA 2K9DA 3K9OA 4G3OA 4DBGB 3GLGE 1C7YA 1TR8A 5DFLA 2LVNC 3GLFE 2LTUA 2OOBA 2DZLA 2LVPC 1Y8GA 1WHCA 2QHOB 2BWBA 1DV0A 1G3IA 1UFZA 1F4IA 2OOAA 2R0IA 1YLAA 3E46A 1V92A 2MR9A 4F2LA 3FE3A 2HAKA 2KHHA 1G41A 1DO0A 1A5TA 1PGYA 2DAMA 1T6OA 2DAIA 2JY5A 1ZMWA 2DKLA 1QZEA 1VEJA 3IECA 1Q02A 2JNHA 2MJ5B 5JI2E 4GEWA 1CUKA 4Q7JA 2DI0A 3MMPA 1P3QQ 2WZJA 3T6PA 1ZMVA 3B89A 1E94E 2KNAA 1IXSA 2JZ1A 2ZTCA 2HWJA 1EFUB 1WR1B 1MN3A 2LBCA 1VQ1A 2O25A 4F1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E21 A;  1HT1 E;  2H5X A;  1WGN A;  1WJ7 A;  2DEN A;  2EKF A;  4UN2 B;  3GLI E;  1VEG A;  2ZTD A;  2K0B X;  2L2D A;  2MGW A;  3K9P A;  2BWE A;  1G4A E;  1T43 A;  2L4F A;  1WGL A;  2OO9 A;  4R71 A;  2RRU A;  2LVQ D;  2DAG A;  1XB2 B;  1XXH E;  1IFY A;  1VEK A;  2JY7 A;  3BBZ A;  1TTE A;  1HJP A;  1OTR A;  1IM2 A;  3FRH A;  2L4E A;  1NV8 A;  1JR3 E;  1SG9 A;  1HT2 E;  2JUJ A;  2DAK A;  1HQY E;  1VG5 A;  1R4G A;  1BVS A;  4WP2 A;  1WIV A;  2QNJ A;  2KNV A;  2LVA A;  2QSF X;  2LVO C;  1GO5 A;  3GLH E;  1AIP C;  2B3T A;  1ZMU A;  2CP8 A;  2JY6 B;  3H4J A;  1DO2 A;  1KYI A;  2DAE A;  2EJS A;  2DHY A;  2G3Q A;  3IHP A;  2JP7 A;  4HEO A;  3FRI A;  2EKK A;  3LCV B;  3LCU A;  1VDL A;  3F92 A;  1OQY A;  2KNZ A;  2MRO B;  2JY8 A;  1OAI A;  1ZV1 A;  2DNA A;  2JZ0 A;  1OKS A;  1NV9 A;  2CWB A;  2K9D A;  3K9O A;  4G3O A;  4DBG B;  3GLG E;  1C7Y A;  1TR8 A;  5DFL A;  2LVN C;  3GLF E;  2LTU A;  2OOB A;  2DZL A;  2LVP C;  1Y8G A;  1WHC A;  2QHO B;  2BWB A;  1DV0 A;  1G3I A;  1UFZ A;  1F4I A;  2OOA A;  2R0I A;  1YLA A;  3E46 A;  1V92 A;  2MR9 A;  4F2L A;  3FE3 A;  2HAK A;  2KHH A;  1G41 A;  1DO0 A;  1A5T A;  1PGY A;  2DAM A;  1T6O A;  2DAI A;  2JY5 A;  1ZMW A;  2DKL A;  1QZE A;  1VEJ A;  3IEC A;  1Q02 A;  2JNH A;  2MJ5 B;  5JI2 E;  4GEW A;  1CUK A;  4Q7J A;  2DI0 A;  3MMP A;  1P3Q Q;  2WZJ A;  3T6P A;  1ZMV A;  3B89 A;  1E94 E;  2KNA A;  1IXS A;  2JZ1 A;  2ZTC A;  2HWJ A;  1EFU B;  1WR1 B;  1MN3 A;  2LBC A;  1VQ1 A;  2O25 A;  4F1I A; 
#chains in the Genus database with same CATH topology
 4GKK M;  2H5X A;  2DWZ B;  3VK8 A;  4QOS A;  2F5S A;  2C9C A;  3T1Y M;  2VF8 A;  2CRU A;  1OJL A;  3KS8 A;  1QAN A;  4FD2 A;  3D8L A;  3KW6 A;  5JI3 E;  4DV5 M;  4B3M M;  1VEG A;  3MHV C;  2R18 A;  4AI6 A;  2MGW A;  4JI7 M;  3GPP A;  1XC8 A;  3I04 M;  1G4A E;  4AKH A;  2L4F A;  2KW0 A;  2FFJ A;  3AJI B;  3ZH9 B;  3L28 A;  2JWS A;  2LVQ D;  4D81 A;  3HJS A;  4LGM A;  4DV4 M;  1XXH E;  1AUA A;  1D0M A;  2ZAO A;  3TWL A;  2G5G X;  4LF8 M;  3GLI B;  1QAM A;  5EXS A;  1VEK A;  2JY7 A;  3ZCB B;  4MGI E;  1IM2 A;  4CIZ A;  2H1R A;  3LMM A;  3RGS A;  2L4E A;  4LZZ A;  1SG9 A;  1HT2 E;  3LW5 F;  3I4V A;  1R4G A;  5IT9 S;  4AG6 A;  4WP2 A;  5FSW A;  2LVA A;  4IJF A;  2LH0 A;  5KQD A;  4DR3 M;  3SAR A;  3U6M A;  1T3T A;  2LVO C;  1GO5 A;  2BNK A;  3SAU A;  3JR4 A;  2K6B A;  4DUY M;  2CP8 A;  3GRU A;  4G6Z A;  3HJQ A;  3H4J A;  4GC9 A;  1KYI A;  3GLF B;  3J7A S;  3KOW E;  4HEO A;  4L4U A;  4FCW A;  5E26 A;  3FRI A;  2EKK A;  3LCV B;  3B7Q A;  4NOO B;  4FCV A;  3J81 S;  2KNZ A;  2RKO A;  2FOI C;  3HHX A;  3VDU A;  1SXJ D;  3U6S A;  2XZU A;  2UUB M;  1GJT A;  2CWB A;  4LFC M;  4G3O A;  5KO3 A;  3GLG E;  2HL7 A;  2XFS A;  5DFL A;  3C3E A;  1TH4 A;  3LQR A;  3W68 A;  1XMQ M;  2LVP C;  3VFD A;  2KRK A;  4B3R M;  2XGN A;  2QPA A;  1QDR A;  4PD2 A;  4YY3 M;  4DV2 M;  4S12 A;  2ZBK B;  1DV0 A;  1GAB A;  1G3I A;  1F4I A;  1TH3 A;  2RGO A;  4AZF A;  3MK6 A;  3SHF A;  2C98 A;  2ZAN A;  1HQC A;  3E46 A;  1V92 A;  1JR3 A;  3T38 A;  4WUR A;  2F4V M;  1Q3B A;  2WSF F;  4IBD A;  5ITT A;  3AL0 C;  4XBO A;  3W0F A;  3SAV A;  4GRI A;  2Z3X A;  2L09 A;  2GNO A;  1QUT A;  1XXH B;  5F3W A;  4LF5 M;  1A5T A;  2JY5 A;  2R6F A;  4KOD A;  4BB9 A;  2XFT A;  3A42 A;  3IEC A;  2AHM A;  1Q02 A;  2JNH A;  3NBI A;  4PT5 A;  5GKN A;  3C58 A;  3SHG B;  2P5T A;  4IBK A;  1CUK A;  4Q7J A;  4WW0 A;  2F5O A;  3M6A A;  1P3Q Q;  2R45 A;  1QAQ A;  1X37 A;  3HU1 A;  4NC6 A;  2O5R A;  3KXE C;  3UZU A;  2Y20 A;  1E94 E;  4RNA A;  4LJ6 A;  1W5S A;  8CAT A;  4D82 A;  4CIS A;  1QQW A;  4QOZ C;  1N32 M;  2ZTC A;  4JI8 M;  1PJQ A;  4FWD A;  3AOE A;  3GQ4 A;  4M9S A;  3SFZ A;  4NSO B;  1N75 A;  3EIH A;  3NBX X;  3BBZ A;  3OTO M;  3A45 A;  3E21 A;  4EIW A;  1WGN A;  5DYG A;  4IIW A;  2X49 A;  1HNX M;  2EO2 A;  3QYE A;  1NHW C;  1YUB A;  1FNN A;  3FUX A;  2EKF A;  3FUW A;  4IJE A;  2QBY A;  1QVR A;  5C18 A;  3B9P A;  4P17 A;  3GO8 A;  4M9X A;  5A2Q S;  2ZTD A;  1NY5 A;  2CHQ A;  3K9P A;  2BWE A;  2MH8 A;  5ITX A;  2VQF M;  3SMP A;  3HJ8 A;  2OO9 A;  4RF0 A;  1EIJ A;  3TWM A;  3VKG A;  2OPF A;  1N36 M;  3R8F A;  4OW0 A;  2A5Y B;  5ITQ A;  3B7N A;  3HU3 A;  1L2C A;  4B3T M;  4IBC A;  2QZ4 A;  3J2P B;  3HWS A;  1RU3 A;  1IFY A;  1UM8 A;  2HKJ A;  1IQP A;  1TTE A;  3SMS A;  1OTR A;  1L8Q A;  4KLN A;  2VII A;  2XZF A;  1R7R A;  4L15 A;  2L6O A;  2E5L M;  2R46 A;  1NV8 A;  3J80 S;  3GPU A;  3KOY E;  4DV3 M;  1IN5 A;  1N34 M;  3CF2 A;  1WIV A;  2QNJ A;  2KNV A;  2Z7J A;  1R2Y A;  2DXI A;  2UXD M;  2XH9 A;  4A3V B;  2XF3 A;  3THG A;  5FTL A;  3ZC7 B;  4RF1 A;  1MJG M;  1IN8 A;  2DAE A;  4M0D A;  1OFH A;  1XNR M;  2DHY A;  2G3Q A;  3IHP A;  2W82 A;  1VDL A;  5EP2 A;  3DA1 A;  5IWA M;  1OQY A;  2MRO B;  4B7G A;  4FVM A;  3UMM A;  3A46 A;  1JB0 F;  1I4W A;  1OAI A;  1ZV1 A;  2R65 A;  2NQ8 C;  2R4E A;  1OKS A;  1N33 M;  3MJ5 A;  2FNA A;  2K9D A;  4MM3 B;  2XEP A;  4M0W A;  4DBG B;  3SC3 A;  4LZJ A;  5ITX E;  2J5Y A;  2KRU A;  3ZQJ A;  1TR8 A;  1PM5 A;  2VF7 A;  4BBA A;  2LTU A;  4G4Q A;  2UUA M;  5EXT A;  1GL6 A;  1VDD A;  1YSY A;  2RGH A;  4II7 A;  3CF0 A;  1UFZ A;  4QHT A;  4JXJ A;  4X66 M;  3NWL A;  4B7H A;  1IN7 A;  3C9P A;  4DR4 M;  2FE8 A;  2KZS A;  3FUU A;  2MR9 A;  3KSX A;  3L27 A;  3WHK A;  2BJV A;  1IY1 A;  4F2L A;  2C9O A;  2DWM A;  2HAK A;  4IBF A;  3SYK A;  2KHH A;  4W5W A;  1E9R A;  1QUS A;  1PGY A;  4M9Z A;  1T6O A;  1ZMW A;  2DKL A;  3IG8 A;  3R9X B;  4LF6 M;  1JQJ C;  1XWI A;  2CEA A;  4JN6 A;  3L26 A;  3K2L A;  1KSF X;  4IBG A;  3KSJ A;  2MJ5 B;  3FTC A;  4MGZ E;  2Y0T A;  3JAM S;  5JI2 E;  2CE7 A;  2HHH M;  1Q3C A;  1KFV A;  1ORY B;  2D7H A;  2L7I A;  5EXX A;  3RGP A;  3V76 A;  1OIP A;  1R5L A;  3AOE C;  2FS1 A;  2J7N A;  4B08 A;  3TPZ A;  3VKH A;  1V33 A;  2WZJ A;  4K0K M;  2G8L A;  3T6P A;  3JR5 A;  4G4R A;  4JI1 M;  1ZMV A;  2DZN B;  3B89 A;  3KP1 E;  4Y28 F;  3SBJ A;  2KNA A;  1K3X A;  1IY0 A;  1J09 A;  3FYD A;  2JZ1 A;  4MB7 A;  4DR7 M;  3GRY A;  4HLQ A;  3U60 A;  4DR6 M;  1IBK M;  2HWJ A;  3KVW A;  1EFU B;  4JI2 M;  1MN3 A;  2QEN A;  4OVZ B;  2ZM6 M;  4LF9 M;  1NSF A;  4LRS A;  1VQ1 A;  1QZM A;  2KA6 B;  2I7P A;  3AKZ A;  4ITQ A;  1HT1 E;  1J5E M;  4DV7 M;  3W0L B;  1GJS A;  1I94 M;  2C99 A;  2LXE A;  4AKI A;  3E9S A;  4MGY E;  1SXJ A;  3E4R A;  3GLI E;  3KOZ E;  4L78 A;  4CGY B;  4D80 A;  5KPZ A;  4LF4 M;  1E9S A;  1Z5B A;  2VDB B;  2WSE F;  3FTF A;  5EP4 A;  2LWX A;  2C96 A;  4LFA M;  2KDL A;  4KO8 A;  1K3W A;  1K82 A;  1SXJ C;  2DAG A;  2V1C A;  3GPY A;  2EUC A;  4KT0 F;  3K92 A;  3U60 B;  2QP9 X;  1NJG A;  4NXM M;  2R44 A;  1Z59 A;  3U61 A;  2YFQ A;  4OVZ A;  1L2D A;  1OFI A;  4I81 A;  4IBI A;  3U6O A;  5LMN M;  1E32 A;  4RKU F;  3FRH A;  2CHG A;  4R3D A;  4JI0 M;  2JUJ A;  2J7O A;  5EP3 A;  1QYR A;  1VG5 A;  3CTW B;  5EJC A;  3RE8 A;  4DV0 M;  1BVS A;  4JYA M;  1NO1 A;  3TL4 X;  1IBL M;  2QBY B;  1XNQ M;  4LJ8 A;  1GLN A;  3B74 A;  3GLH A;  1AIP C;  2B3T A;  1IXS B;  4X65 M;  1HR0 M;  4AQY M;  2O01 F;  2CHV A;  3K8Z A;  3SAW A;  3GLG B;  2LHG A;  4QNM A;  3GLI A;  1TH2 A;  2LNH C;  1QAO A;  3U6E A;  1DGF A;  2Z4S A;  2DNA A;  2F5P A;  2JZ0 A;  4CHT B;  4IBB A;  3PFI A;  2C5R A;  1NV9 A;  2DWL A;  3M0E A;  3HY5 A;  3T1H M;  1Z5C A;  1C7Y A;  2HCB A;  3SAS A;  3GLF E;  2LHC A;  2LVN C;  4PDG A;  4FWG A;  2OOB A;  3FUT A;  5KPR A;  3GRV A;  1PJS A;  1Y8G A;  2D7G A;  3HKP A;  4NRV A;  1TDZ A;  2DVW B;  2DWN A;  5BR8 M;  4Z8X A;  2BWB A;  4DR1 M;  4CJ6 A;  1JR3 D;  1GL7 A;  1NHG C;  4OU7 A;  1C1K A;  2I7N A;  2OOA A;  2YQZ A;  5EQT A;  2ERC A;  5L8R F;  3SAT A;  2L7H A;  2ZAM A;  1G8P A;  3HZJ A;  3PXG A;  4I8O A;  3VK7 A;  1NJF A;  1QDT A;  5KPT A;  1G41 A;  5LMU M;  2DAM A;  3D8B A;  1PRB A;  4ZPX A;  1DGB A;  1ZQ9 A;  3I51 A;  4LRT A;  4MGH A;  1IBM M;  2X4A A;  4QNR A;  2OQ4 A;  3W67 A;  2V6Z M;  4IBE A;  4LCB A;  1DGH A;  4L6V 6;  3J27 B;  3CF6 E;  4GEW A;  4LJ5 A;  2UUC M;  2Z4R A;  2JXN A;  4XGI A;  5EP1 A;  1IN4 A;  2KEB A;  3Q8X A;  3GP1 A;  3B7Z A;  4DR5 M;  4DR2 M;  3CGW A;  3TE6 A;  1D2N A;  4B7F A;  2Y0Q A;  4MH0 E;  5DYI A;  2DI0 A;  4Z6Y A;  3MMP A;  3GPX A;  4JI4 M;  1GKI A;  5ITU A;  1TF0 B;  2F5N A;  1WXQ A;  4G4N A;  3HGI A;  1OIZ A;  1Z6T A;  4TUW A;  4DV6 M;  2F5Q A;  2Z8Y M;  3DZD A;  2M5Z A;  1YE9 A;  4BLC A;  3GLF A;  4GHA A;  1NNJ A;  1IXS A;  4GIT A;  2V1U A;  1IXZ A;  3FYC A;  4P16 A;  2JA2 A;  4X62 M;  2DHR A;  3HU2 A;  3WHL A;  1PJI A;  4LG2 A;  1XMO M;  1L2B A;  4OX9 M;  3AOG A;  4GC5 A;  3PVS A;  4X64 M;  2O25 A;  2Y21 A;  3AV0 A;  3FKE A;  3FUV A;  4NL4 H;  4F1I A;  2Q2E B;  5H37 D;  3U6D A;  5E6J A;  2YR0 A;  3K1J A;  4LGY A;  1N78 A;  3GQ3 A;  1L1T A;  4FCT A;  1WJ7 A;  2UXB M;  2DEN A;  3LVW A;  4REZ A;  3FTD A;  2K47 A;  1SXJ B;  3BXW A;  4UN2 B;  3PNV A;  3KFU G;  1MU5 A;  2K0B X;  1G71 A;  2M60 A;  3U6C A;  2L2D A;  2UXC M;  3GRR A;  4L8R C;  2CV2 A;  3QWL A;  1T43 A;  3J7B A;  1IN6 A;  1WGL A;  4LJ9 A;  1G59 A;  4R71 A;  3H4M A;  2RRU A;  3AFH A;  4L16 A;  1LV7 A;  4LFB M;  1XB2 B;  5C1B A;  3U61 B;  4AG5 A;  2XLJ A;  3QYB A;  3VLF B;  4XK8 F;  4NRW A;  2EA0 A;  1LTM A;  4LF7 M;  1HJP A;  2KZU A;  1R2Z A;  3KDS E;  3U6Q A;  4R7G A;  4DUZ M;  1IXR C;  1JR3 E;  1DGH B;  3LVV A;  3BOS A;  3I01 M;  4PCZ A;  5FTN A;  3HHW A;  5IZ7 D;  2DAK A;  1HQY E;  3I4Y A;  4GMQ A;  2CFO A;  4LJ7 A;  3HHZ A;  2CV1 A;  4JI3 M;  4JI6 M;  1SXJ E;  2QSF X;  4G4O A;  2XSZ D;  4KHP M;  1J7K A;  3KP0 E;  3GLH E;  5FTM A;  4HL4 A;  1ZMU A;  4IBJ A;  2JY6 B;  1DO2 A;  3HHY A;  4QHS A;  2EJS A;  1HNW M;  2JP7 A;  3L29 A;  1PJJ A;  3SYL A;  1NY6 A;  2KXE A;  3GLG A;  4GIP A;  4DV1 M;  3LCU A;  4ANR A;  3KOX E;  4I5S A;  2N35 A;  4LJ4 A;  3VDP A;  1DGG A;  3F92 A;  1EE8 A;  2GQF A;  3TWK A;  2JY8 A;  3PNY A;  3U5Z B;  3QAU A;  3DOA A;  1NVM A;  3K9O A;  2D7E A;  1H6U A;  3DFZ A;  1D0K A;  5KQ8 A;  2R62 A;  3FD9 A;  3ILK A;  3M7G A;  2DZL A;  5ITR A;  1MX0 A;  2FH0 A;  1WHC A;  2QQ8 A;  5IRE B;  2UU9 M;  2QHO B;  4B3S M;  3LQQ A;  4AW4 A;  3EIE A;  3L2A A;  3GQ5 A;  1S3S A;  3C3D A;  2R0I A;  3TQS A;  4GHL A;  4NSR A;  3FTE A;  1YLA A;  3T15 A;  5BPV A;  3FE3 A;  2APL A;  3GLH B;  1NNU C;  3IG5 A;  4FWH A;  1OAO C;  3UJN A;  1DO0 A;  1XHB A;  4PDI A;  4LJA A;  2DAI A;  4GH9 A;  3UGJ A;  3U6P A;  3UK6 A;  1QZE A;  2R4J A;  4NXN M;  1R6B X;  1XXH A;  1FJG M;  2DZO B;  3RFW A;  1PJT A;  3U5Z A;  2VQE M;  2CUZ A;  1VEJ A;  3Q8G A;  7CAT A;  3U6L A;  1TDH A;  2XSZ A;  2X8A A;  4JV5 M;  1Z5A A;  5FLX S;  1D0L A;  5FTK A;  1L1Z A;  5DNY A;  4AKG A;  5FTJ A;  3L25 A;  1IY2 A;  2BJW A;  2WSC F;  5ITY A;  4GKJ M;  3HX3 A;  4MGK E;  2CV0 A;  1V34 A;  1Q39 A;  1N77 A;  2YNM D;  4FW9 A;  5EXP A;  4YHH M;  4I4L A;  1W5T A;  1WR1 B;  1ZAE A;  4LY6 A;  2QCU A;  3KS4 A;  1HNZ M;  3A98 B;  2LBC A;  1GVN A;  1TGU A;  4JI5 M; 
#chains in the Genus database with same CATH homology
 3E21 A;  1HT1 E;  2H5X A;  1WGN A;  1WJ7 A;  2DEN A;  2EKF A;  4UN2 B;  3GLI E;  1VEG A;  2ZTD A;  2K0B X;  2L2D A;  2MGW A;  3K9P A;  2BWE A;  1G4A E;  1T43 A;  2L4F A;  1WGL A;  2OO9 A;  4R71 A;  2RRU A;  2LVQ D;  2DAG A;  1XB2 B;  1XXH E;  1IFY A;  1VEK A;  2JY7 A;  3BBZ A;  1TTE A;  1HJP A;  1OTR A;  1IM2 A;  3FRH A;  2L4E A;  1NV8 A;  1JR3 E;  1SG9 A;  1HT2 E;  2JUJ A;  2DAK A;  1HQY E;  1VG5 A;  1R4G A;  1BVS A;  4WP2 A;  1WIV A;  2QNJ A;  2KNV A;  2LVA A;  2QSF X;  2LVO C;  1GO5 A;  3GLH E;  1AIP C;  2B3T A;  1ZMU A;  2CP8 A;  2JY6 B;  3H4J A;  1DO2 A;  1KYI A;  2DAE A;  2EJS A;  2DHY A;  2G3Q A;  3IHP A;  2JP7 A;  4HEO A;  3FRI A;  2EKK A;  3LCV B;  3LCU A;  1VDL A;  3F92 A;  1OQY A;  2KNZ A;  2MRO B;  2JY8 A;  1OAI A;  1ZV1 A;  2DNA A;  2JZ0 A;  1OKS A;  1NV9 A;  2CWB A;  2K9D A;  3K9O A;  4G3O A;  4DBG B;  3GLG E;  1C7Y A;  1TR8 A;  5DFL A;  2LVN C;  3GLF E;  2LTU A;  2OOB A;  2DZL A;  2LVP C;  1Y8G A;  1WHC A;  2QHO B;  2BWB A;  1DV0 A;  1G3I A;  1UFZ A;  1F4I A;  2OOA A;  2R0I A;  1YLA A;  3E46 A;  1V92 A;  2MR9 A;  4F2L A;  3FE3 A;  2HAK A;  2KHH A;  1G41 A;  1DO0 A;  1A5T A;  1PGY A;  2DAM A;  1T6O A;  2DAI A;  2JY5 A;  1ZMW A;  2DKL A;  1QZE A;  1VEJ A;  3IEC A;  1Q02 A;  2JNH A;  2MJ5 B;  5JI2 E;  4GEW A;  1CUK A;  4Q7J A;  2DI0 A;  3MMP A;  1P3Q Q;  2WZJ A;  3T6P A;  1ZMV A;  3B89 A;  1E94 E;  2KNA A;  1IXS A;  2JZ1 A;  2ZTC A;  2HWJ A;  1EFU B;  1WR1 B;  1MN3 A;  2LBC A;  1VQ1 A;  2O25 A;  4F1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...