1V92A

Solution structure of the uba domain from p47, a major cofactor of the aaa atpase p97
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
b'MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NSFL1 cofactor p47
publication title Structure, dynamics and interactions of p47, a major adaptor of the AAA ATPase, p97
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Recombination
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-01-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1v92A00
1VG5A 2CWBA 1WIVA 1OAIA 2BWEA 2KHHA 1HT1E 4F1IA 2LVNC 1KYIA 1YLAA 2DI0A 2HAKA 3K9PA 2K0BX 3K9OA 1CUKA 1R4GA 2H5XA 3E21A 3GLGE 2DAEA 1P3QQ 3BBZA 2BWBA 1TTEA 1XB2B 2JUJA 2L4EA 1ZMUA 3H4JA 1VEGA 1WGLA 2DAIA 1Y8GA 3IHPA 4UN2B 2LTUA 2JY5A 1AIPC 3MMPA 4GEWA 2ZTCA 4R71A 1WJ7A 3LCVB 2LVQD 2LBCA 2QNJA 1MN3A 2DKLA 1G3IA 2JZ1A 4G3OA 2DAKA 1IFYA 2EJSA 1XXHE 1SG9A 5JI2E 3FRIA 2LVOC 1OKSA 3LCUA 3T6PA 2OOBA 1DO2A 1G41A 4Q7JA 2DNAA 2O25A 1E94E 2L2DA 2OO9A 1OQYA 1UFZA 1QZEA 1V92A 1VEKA 2HWJA 2EKFA 2JZ0A 1OTRA 2QHOB 4DBGB 1DO0A 1NV8A 2DAGA 3GLHE 1VQ1A 1JR3E 1ZMVA 1WR1B 1HQYE 1TR8A 1WGNA 3IECA 2R0IA 1T43A 1ZV1A 2K9DA 2DAMA 1A5TA 1IXSA 1PGYA 2JY6B 2JY8A 2DHYA 1C7YA 3F92A 2B3TA 2EKKA 2KNZA 2LVPC 3B89A 1DV0A 1BVSA 2G3QA 2DZLA 3GLIE 2MGWA 2WZJA 1F4IA 2LVAA 2KNVA 3E46A 2QSFX 2JY7A 1WHCA 2JP7A 2MJ5B 2L4FA 4WP2A 1ZMWA 2JNHA 5DFLA 1NV9A 1HJPA 1GO5A 1IM2A 1Q02A 3FRHA 2OOAA 2MROB 4F2LA 2DENA 1G4AE 1HT2E 2CP8A 1T6OA 1VDLA 2ZTDA 2KNAA 2MR9A 1EFUB 3FE3A 1VEJA 4HEOA 3GLFE 2RRUA
chains in the Genus database with same CATH superfamily
2Y21A 2CWBA 2YFQA 1C1KA 4MGZE 3TWLA 4R3DA 3C3EA 2BWEA 3K8ZA 3U5ZB 1GVNA 1LV7A 2R62A 2G5GX 5BR8M 4PCZA 2K0BX 4YHHM 2F5OA 1G71A 4DUYM 1MJGM 5IWAM 4FD2A 4QNMA 2KRKA 1JR3D 2BWBA 1TTEA 1D0MA 4RF0A 2KEBA 2XZUA 3SARA 2Z4SA 1VEGA 3R8FA 2DAIA 1Y8GA 5KPRA 2Z4RA 1TDHA 2ZTCA 2FH0A 2QCUA 2C99A 3LCVB 5FLXS 2ZAOA 2DWMA 1OIZA 2X4AA 2KW0A 4DR2M 1GL7A 2OQ4A 3SFZA 1NVMA 1VDDA 2XF3A 3SAUA 3WHKA 2EJSA 2BNKA 1SG9A 1D2NA 3K92A 5ITQA 4IBKA 2F5SA 2R45A 1DGFA 2K47A 2G8LA 4NRVA 3FYCA 3J80S 4PD2A 4Q7JA 2XH9A 1Z5AA 3GRYA 4AG5A 2QENA 2DZOB 5E26A 2L2DA 1GLNA 3HHZA 3BXWA 1OQYA 4LF9M 3UMMA 3SYKA 3I4YA 4NC6A 3UZUA 2UUCM 3U6OA 4IBFA 4LFAM 4X62M 3AFHA 1NV8A 4G4RA 5KO3A 2RGOA 3FYDA 4B7HA 1PJSA 1XWIA 1IY0A 1R5LA 1ZMVA 3LQQA 3AJIB 8CATA 4Y28F 4LF5M 3GLGB 4LFBM 1WGNA 2R0IA 1PM5A 3SATA 1IN8A 2CV1A 3Q8XA 3D8LA 4LJAA 2DAMA 3RFWA 5ITYA 1NJFA 1QUSA 4JXJA 1N75A 1D0LA 1A5TA 4M9ZA 1NJGA 4DUZM 2CEAA 4FCTA 2DHYA 3T1HM 1C7YA 3SAWA 1Q3CA 4LJ7A 2LVPC 4QNRA 3ZCBB 4DR3M 3JAMS 1DV0A 4ANRA 4NOOB 3GLIA 3SAVA 1L1ZA 4OX9M 3K2LA 2Y20A 4M0DA 3M6AA 3TE6A 4L16A 2RKOA 2WZJA 3A45A 4X64M 4FW9A 4CISA 2VDBB 4LGMA 3KSXA 4JI5M 4DR7M 3IG8A 2L7HA 1YE9A 3OTOM 2JY7A 3TWMA 1NSFA 2ZAMA 1Z5BA 3A42A 1NY5A 2MJ5B 3C9PA 4I4LA 2UXCM 1HNXM 1PJIA 2FFJA 3B7QA 2P5TA 4B08A 2JNHA 2DWNA 5IT9S 1E9SA 1HJPA 3JR4A 4LG2A 3ILKA 4LY6A 4AQYM 3U6MA 3PFIA 5FTNA 4Z8XA 4GC9A 1YUBA 2K6BA 2MROB 1N36M 3J81S 3H4MA 3KXEC 4DV6M 2CP8A 1VDLA 2ZTDA 3U61A 5EQTA 5EP2A 3UJNA 3GLHB 2X49A 2R4EA 3VDPA 2OPFA 4W5WA 4IBJA 2L7IA 4FVMA 1L8QA 3I51A 3IG5A 3GLFE 2Q2EB 2RRUA 3QAUA 2C9OA 2M5ZA 4B3RM 1OAIA 2XSZD 4F1IA 3W0LB 2LVNC 1KYIA 1TF0B 2HAKA 2DI0A 2LXEA 4LJ8A 4DV1M 3I01M 4GITA 1QZMA 3PNVA 2DAEA 3GLGE 4BB9A 1P3QQ 1K82A 3DZDA 3HHXA 4IBBA 4LF7M 3DFZA 2JUJA 1ZMUA 1ZQ9A 4A3VB 2XFSA 4B7FA 3NWLA 3RGSA 3TL4X 5ITTA 2I7NA 4LJ9A 2CFOA 1AIPC 4BBAA 5C18A 1SXJA 4DV4M 2D7HA 3U61B 3SHFA 3UK6A 3FUTA 2R65A 1IBLM 1WXQA 2LVQD 3B7ZA 2ERCA 4FWGA 3AOEC 2C96A 4QOZC 2CUZA 2QBYA 1OAOC 2DKLA 3HU1A 3SHGB 3SYLA 5KQDA 1FJGM 3M0EA 3LVVA 4KODA 5EP3A 1XXHE 4KT0F 4XBOA 1XC8A 4B3MM 2UUAM 1XMOM 3KOWE 4AKIA 4GRIA 3U6QA 4NXNM 4G4OA 4JI2M 2J5YA 3MK6A 4IBEA 1K3WA 3U6DA 3FTEA 3KP0E 1N78A 1SXJB 1UFZA 3L28A 2EKFA 1V34A 1GKIA 2JZ0A 2QP9X 4IJFA 1JR3A 4NSRA 3SMPA 2UXDM 4GHLA 4XGIA 3LQRA 4JI7M 3L27A 2DAGA 3A98B 4X65M 2DZNB 3GLHE 3QYEA 2QBYB 2Z8YM 1OJLA 2Z3XA 4LZJA 3HWSA 3B74A 1WR1B 1HQYE 1TR8A 2HCBA 4CHTB 3TPZA 1T3TA 2LNHC 2CHVA 1T43A 3QYBA 1ORYB 1Z6TA 1IY2A 4LCBA 5F3WA 2JY6B 3ZQJA 1NO1A 2VF7A 3LW5F 2KNZA 4RKUF 5ITXE 1I94M 1E32A 4D82A 1DGHA 1YSYA 1BVSA 1IQPA 4I8OA 4XK8F 4BLCA 3B7NA 3CTWB 4AW4A 3J27B 4Z6YA 4I5SA 2MGWA 3AOGA 5GKNA 4JI0M 1TDZA 5EP1A 4YY3M 3L25A 3VKGA 1W5TA 2VIIA 1HNZM 4EIWA 2QSFX 4DR6M 5H37D 5A2QS 3E9SA 2C5RA 1MU5A 1WHCA 4QOSA 3SMSA 2JP7A 3PNYA 4WW0A 1ZMWA 4LJ4A 1Z59A 1EIJA 2WSCF 4IBDA 2DXIA 1EE8A 4QHSA 2L09A 3FRHA 3T1YM 4GC5A 3GQ4A 3EIHA 4AI6A 3JR5A 3CF0A 4LJ6A 3U6EA 1G4AE 5FTMA 1DGHB 3L29A 1T6OA 2F5QA 3T38A 3U6CA 2KZUA 4KHPM 4NRWA 3W67A 1OFIA 5LMNM 1NHGC 1VEJA 2I7PA 3GRVA 4JYAM 2YR0A 1PRBA 5IREB 1I4WA 1VG5A 4GKKM 1WIVA 4L15A 2R4JA 4GHAA 4S12A 1HT1E 3GPXA 1QAOA 4GKJM 1GJTA 3K9PA 4LFCM 4KLNA 3VFDA 4IBCA 3E21A 5LMUM 3BBZA 3RGPA 2N35A 1R2YA 1JB0F 1XB2B 5FTJA 2O5RA 4PDIA 3H4JA 4DV5M 1WGLA 3VK7A 1IY1A 4UN2B 2LTUA 1OIPA 1X37A 2JY5A 4D80A 3J7AS 4CJ6A 2KA6B 3GLIB 4R71A 2HKJA 4M9XA 4P17A 3ZC7B 1R6BX 3PXGA 1HNWM 3V76A 3NBXX 2LBCA 2M60A 2AHMA 2QNJA 2ZBKB 5DNYA 2RGHA 2V1UA 5ITRA 4JI6M 3LMMA 2QPAA 1G3IA 2JZ1A 2KRUA 4G3OA 5BPVA 4LF4M 2R6FA 2R46A 1IFYA 1IN6A 2JWSA 3M7GA 2CE7A 4FCWA 1K3XA 3FUXA 7CATA 5ITUA 4MGYE 2X8AA 1J7KA 4PT5A 3LCUA 4IJEA 2VQEM 1KFVA 2OOBA 5C1BA 1G41A 2BJVA 2H1RA 2XSZA 4IBGA 3TQSA 5IZ7D 1LTMA 3GPUA 2UXBM 1HQCA 4QHTA 1XNQM 2C9CA 2A5YB 3KW6A 4B7GA 4HL4A 4L6V6 4R7GA 4K0KM 4CGYB 1JQJC 1QZEA 1V92A 2HWJA 1IXZA 1VEKA 1QUTA 3RE8A 1AUAA 2QHOB 1QAQA 4DBGB 1L2CA 3J7BA 5FTLA 1IN5A 1QAMA 3GQ3A 2XZFA 2D7EA 2CRUA 3CGWA 3ZH9B 3FD9A 3U5ZA 4G4QA 1QANA 4JI1M 4GH9A 4L78A 5DYGA 3HHWA 4RF1A 5E6JA 1Q39A 1TGUA 3IECA 3VKHA 2Y0TA 3WHLA 1XMQM 1R2ZA 4NL4H 3FTCA 2V6ZM 1NNUC 2HL7A 1PGYA 4JI4M 2CHGA 2JY8A 4NSOB 4MGKE 4OW0A 1KSFX 1E9RA 2KDLA 2F4VM 1UM8A 2EUCA 2GQFA 2JA2A 3B89A 2E5LM 2ZANA 4ZPXA 4FWHA 4REZA 2CV2A 2JXNA 1TH4A 4I81A 4P16A 4RNAA 3GLIE 3GRRA 4CIZA 1F4IA 3HJQA 2LVAA 3E46A 5FSWA 1DGBA 4II7A 2DVWB 2J7OA 2L4FA 3EIEA 1ZAEA 4WP2A 3GRUA 4DR5M 2HHHM 4JV5M 1NNJA 3NBIA 2FNAA 3FKEA 5DFLA 4OVZA 5KPTA 1PJJA 3A46A 1N32M 1GO5A 1Q3BA 2VQFM 1OFHA 2DWZB 2KXEA 2DENA 1XHBA 4DV3M 3U6PA 5DYIA 1HT2E 2Y0QA 3HU2A 1D0KA 3HX3A 3KOXE 3GLFA 3VDUA 2MR9A 3FE3A 2V1CA 3U6SA 1N33M 1V33A 4HEOA 1J5EM 4LRSA 4MGIE 3C3DA 3KOYE 5EJCA 2XEPA 3AKZA 3KFUG 5EXXA 1IBKM 1QQWA 2KHHA 1H6UA 3FUWA 4M9SA 3GLGA 4ITQA 1L2DA 2F5NA 1FNNA 3CF2A 1YLAA 2EO2A 3I04M 3K9OA 2LH0A 1CUKA 1R4GA 2H5XA 4NXMM 4M0WA 4OVZB 5JI3E 4LZZA 1XNRM 2FOIC 2APLA 3UGJA 3HY5A 1RU3A 2L4EA 3HHYA 1G59A 4IIWA 1DGGA 1Z5CA 3FTFA 4L4UA 3MJ5A 3IHPA 2CHQA 3R9XB 4GEWA 3GPYA 3MMPA 4DV2M 5EXSA 1W5SA 1IN7A 4AKGA 1WJ7A 3KOZE 3GLFB 1SXJE 2D7GA 2LHCA 4HLQA 4WURA 3GP1A 4DR4M 3CF6E 3HU3A 5FTKA 2F5PA 3QWLA 4FWDA 1MN3A 2XFTA 4JI8M 1XXHA 1N34M 2YQZA 2DAKA 1IXRC 2ZM6M 4OU7A 3Q8GA 2KZSA 2WSFF 3THGA 5JI2E 3FRIA 4MB7A 2EA0A 3W68A 3KVWA 3AV0A 3T15A 4X66M 4IBIA 2LVOC 3HJSA 2XLJA 3SBJA 1OKSA 3T6PA 1TH2A 1DO2A 1QDRA 2DNAA 1HR0M 4LGYA 4LJ5A 1J09A 2O25A 1E94E 2VF8A 3HKPA 1L2BA 4KO8A 3J2PB 4MM3B 2OO9A 3GO8A 1IN4A 1PJQA 3MHVC 3GLHA 5EXPA 1OTRA 3LVWA 3AL0C 4MGHA 5EP4A 4L8RC 1DO0A 4DV7M 1R7RA 3KS8A 1VQ1A 1JR3E 2DHRA 2W82A 4GIPA 1XXHB 3KP1E 2O01F 3HGIA 5EXTA 4B3SM 1G8PA 4G4NA 3U6LA 1PJTA 2UU9M 2UUBM 1NHWC 3VK8A 2CV0A 1ZV1A 2K9DA 4LF6M 4PDGA 3FUUA 2J7NA 1IXSA 5ITXA 4AKHA 3K1JA 3BOSA 2R18A 2LHGA 2B3TA 2EKKA 3F92A 4AG6A 3U60A 2MH8A 2BJWA 4D81A 2R44A 3FTDA 4JI3M 3B9PA 1GL6A 3DA1A 4DR1M 3W0FA 1IBMM 3L26A 3KDSE 4B3TM 2G3QA 3AOEA 2DZLA 1QYRA 3TWKA 2DWLA 1TH3A 2WSEF 4MH0E 1QVRA 5KQ8A 3HJ8A 2Z7JA 1S3SA 2KNVA 4JN6A 3C58A 1L1TA 4GMQA 4LF8M 2QZ4A 3SC3A 3GPPA 2FE8A 2LWXA 3I4VA 2YNMD 4G6ZA 2FS1A 1GABA 3DOAA 1SXJD 3VLFB 4DV0M 4FCVA 1NV9A 3KSJA 5L8RF 1N77A 1IM2A 1IXSB 1Q02A 2NQ8C 2QQ8A 3D8BA 3SASA 1MX0A 3GQ5A 2GNOA 2OOAA 2C98A 2XGNA 3U60B 2L6OA 4F2LA 3PVSA 1QDTA 4AZFA 1NY6A 3FUVA 4TUWA 3L2AA 3KS4A 2KNAA 1EFUB 1SXJC 3HZJA 1GJSA 3E4RA 5KPZA 4LRTA
chains in the Genus database with same CATH topology
1VG5A 2CWBA 1WIVA 1OAIA 2BWEA 2KHHA 1HT1E 4F1IA 2LVNC 1KYIA 1YLAA 2DI0A 2HAKA 3K9PA 2K0BX 3K9OA 1CUKA 1R4GA 2H5XA 3E21A 3GLGE 2DAEA 1P3QQ 3BBZA 2BWBA 1TTEA 1XB2B 2JUJA 2L4EA 1ZMUA 3H4JA 1VEGA 1WGLA 2DAIA 1Y8GA 3IHPA 4UN2B 2LTUA 2JY5A 1AIPC 3MMPA 4GEWA 2ZTCA 4R71A 1WJ7A 3LCVB 2LVQD 2LBCA 2QNJA 1MN3A 2DKLA 1G3IA 2JZ1A 4G3OA 2DAKA 1IFYA 2EJSA 1XXHE 1SG9A 5JI2E 3FRIA 2LVOC 1OKSA 3LCUA 3T6PA 2OOBA 1DO2A 1G41A 4Q7JA 2DNAA 2O25A 1E94E 2L2DA 2OO9A 1OQYA 1UFZA 1QZEA 1V92A 1VEKA 2HWJA 2EKFA 2JZ0A 1OTRA 2QHOB 4DBGB 1DO0A 1NV8A 2DAGA 3GLHE 1VQ1A 1JR3E 1ZMVA 1WR1B 1HQYE 1TR8A 1WGNA 3IECA 2R0IA 1T43A 1ZV1A 2K9DA 2DAMA 1A5TA 1IXSA 1PGYA 2JY6B 2JY8A 2DHYA 1C7YA 3F92A 2B3TA 2EKKA 2KNZA 2LVPC 3B89A 1DV0A 1BVSA 2G3QA 2DZLA 3GLIE 2MGWA 2WZJA 1F4IA 2LVAA 2KNVA 3E46A 2QSFX 2JY7A 1WHCA 2JP7A 2MJ5B 2L4FA 4WP2A 1ZMWA 2JNHA 5DFLA 1NV9A 1HJPA 1GO5A 1IM2A 1Q02A 3FRHA 2OOAA 2MROB 4F2LA 2DENA 1G4AE 1HT2E 2CP8A 1T6OA 1VDLA 2ZTDA 2KNAA 2MR9A 1EFUB 3FE3A 1VEJA 4HEOA 3GLFE 2RRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VG5 A;  2CWB A;  1WIV A;  1OAI A;  2BWE A;  2KHH A;  1HT1 E;  4F1I A;  2LVN C;  1KYI A;  1YLA A;  2DI0 A;  2HAK A;  3K9P A;  2K0B X;  3K9O A;  1CUK A;  1R4G A;  2H5X A;  3E21 A;  3GLG E;  2DAE A;  1P3Q Q;  3BBZ A;  2BWB A;  1TTE A;  1XB2 B;  2JUJ A;  2L4E A;  1ZMU A;  3H4J A;  1VEG A;  1WGL A;  2DAI A;  1Y8G A;  3IHP A;  4UN2 B;  2LTU A;  2JY5 A;  1AIP C;  3MMP A;  4GEW A;  2ZTC A;  4R71 A;  1WJ7 A;  3LCV B;  2LVQ D;  2LBC A;  2QNJ A;  1MN3 A;  2DKL A;  1G3I A;  2JZ1 A;  4G3O A;  2DAK A;  1IFY A;  2EJS A;  1XXH E;  1SG9 A;  5JI2 E;  3FRI A;  2LVO C;  1OKS A;  3LCU A;  3T6P A;  2OOB A;  1DO2 A;  1G41 A;  4Q7J A;  2DNA A;  2O25 A;  1E94 E;  2L2D A;  2OO9 A;  1OQY A;  1UFZ A;  1QZE A;  1V92 A;  1VEK A;  2HWJ A;  2EKF A;  2JZ0 A;  1OTR A;  2QHO B;  4DBG B;  1DO0 A;  1NV8 A;  2DAG A;  3GLH E;  1VQ1 A;  1JR3 E;  1ZMV A;  1WR1 B;  1HQY E;  1TR8 A;  1WGN A;  3IEC A;  2R0I A;  1T43 A;  1ZV1 A;  2K9D A;  2DAM A;  1A5T A;  1IXS A;  1PGY A;  2JY6 B;  2JY8 A;  2DHY A;  1C7Y A;  3F92 A;  2B3T A;  2EKK A;  2KNZ A;  2LVP C;  3B89 A;  1DV0 A;  1BVS A;  2G3Q A;  2DZL A;  3GLI E;  2MGW A;  2WZJ A;  1F4I A;  2LVA A;  2KNV A;  3E46 A;  2QSF X;  2JY7 A;  1WHC A;  2JP7 A;  2MJ5 B;  2L4F A;  4WP2 A;  1ZMW A;  2JNH A;  5DFL A;  1NV9 A;  1HJP A;  1GO5 A;  1IM2 A;  1Q02 A;  3FRH A;  2OOA A;  2MRO B;  4F2L A;  2DEN A;  1G4A E;  1HT2 E;  2CP8 A;  1T6O A;  1VDL A;  2ZTD A;  2KNA A;  2MR9 A;  1EFU B;  3FE3 A;  1VEJ A;  4HEO A;  3GLF E;  2RRU A; 
#chains in the Genus database with same CATH topology
 2Y21 A;  2CWB A;  2YFQ A;  1C1K A;  4MGZ E;  3TWL A;  4R3D A;  3C3E A;  2BWE A;  3K8Z A;  3U5Z B;  1GVN A;  1LV7 A;  2R62 A;  2G5G X;  5BR8 M;  4PCZ A;  2K0B X;  4YHH M;  2F5O A;  1G71 A;  4DUY M;  1MJG M;  5IWA M;  4FD2 A;  4QNM A;  2KRK A;  1JR3 D;  2BWB A;  1TTE A;  1D0M A;  4RF0 A;  2KEB A;  2XZU A;  3SAR A;  2Z4S A;  1VEG A;  3R8F A;  2DAI A;  1Y8G A;  5KPR A;  2Z4R A;  1TDH A;  2ZTC A;  2FH0 A;  2QCU A;  2C99 A;  3LCV B;  5FLX S;  2ZAO A;  2DWM A;  1OIZ A;  2X4A A;  2KW0 A;  4DR2 M;  1GL7 A;  2OQ4 A;  3SFZ A;  1NVM A;  1VDD A;  2XF3 A;  3SAU A;  3WHK A;  2EJS A;  2BNK A;  1SG9 A;  1D2N A;  3K92 A;  5ITQ A;  4IBK A;  2F5S A;  2R45 A;  1DGF A;  2K47 A;  2G8L A;  4NRV A;  3FYC A;  3J80 S;  4PD2 A;  4Q7J A;  2XH9 A;  1Z5A A;  3GRY A;  4AG5 A;  2QEN A;  2DZO B;  5E26 A;  2L2D A;  1GLN A;  3HHZ A;  3BXW A;  1OQY A;  4LF9 M;  3UMM A;  3SYK A;  3I4Y A;  4NC6 A;  3UZU A;  2UUC M;  3U6O A;  4IBF A;  4LFA M;  4X62 M;  3AFH A;  1NV8 A;  4G4R A;  5KO3 A;  2RGO A;  3FYD A;  4B7H A;  1PJS A;  1XWI A;  1IY0 A;  1R5L A;  1ZMV A;  3LQQ A;  3AJI B;  8CAT A;  4Y28 F;  4LF5 M;  3GLG B;  4LFB M;  1WGN A;  2R0I A;  1PM5 A;  3SAT A;  1IN8 A;  2CV1 A;  3Q8X A;  3D8L A;  4LJA A;  2DAM A;  3RFW A;  5ITY A;  1NJF A;  1QUS A;  4JXJ A;  1N75 A;  1D0L A;  1A5T A;  4M9Z A;  1NJG A;  4DUZ M;  2CEA A;  4FCT A;  2DHY A;  3T1H M;  1C7Y A;  3SAW A;  1Q3C A;  4LJ7 A;  2LVP C;  4QNR A;  3ZCB B;  4DR3 M;  3JAM S;  1DV0 A;  4ANR A;  4NOO B;  3GLI A;  3SAV A;  1L1Z A;  4OX9 M;  3K2L A;  2Y20 A;  4M0D A;  3M6A A;  3TE6 A;  4L16 A;  2RKO A;  2WZJ A;  3A45 A;  4X64 M;  4FW9 A;  4CIS A;  2VDB B;  4LGM A;  3KSX A;  4JI5 M;  4DR7 M;  3IG8 A;  2L7H A;  1YE9 A;  3OTO M;  2JY7 A;  3TWM A;  1NSF A;  2ZAM A;  1Z5B A;  3A42 A;  1NY5 A;  2MJ5 B;  3C9P A;  4I4L A;  2UXC M;  1HNX M;  1PJI A;  2FFJ A;  3B7Q A;  2P5T A;  4B08 A;  2JNH A;  2DWN A;  5IT9 S;  1E9S A;  1HJP A;  3JR4 A;  4LG2 A;  3ILK A;  4LY6 A;  4AQY M;  3U6M A;  3PFI A;  5FTN A;  4Z8X A;  4GC9 A;  1YUB A;  2K6B A;  2MRO B;  1N36 M;  3J81 S;  3H4M A;  3KXE C;  4DV6 M;  2CP8 A;  1VDL A;  2ZTD A;  3U61 A;  5EQT A;  5EP2 A;  3UJN A;  3GLH B;  2X49 A;  2R4E A;  3VDP A;  2OPF A;  4W5W A;  4IBJ A;  2L7I A;  4FVM A;  1L8Q A;  3I51 A;  3IG5 A;  3GLF E;  2Q2E B;  2RRU A;  3QAU A;  2C9O A;  2M5Z A;  4B3R M;  1OAI A;  2XSZ D;  4F1I A;  3W0L B;  2LVN C;  1KYI A;  1TF0 B;  2HAK A;  2DI0 A;  2LXE A;  4LJ8 A;  4DV1 M;  3I01 M;  4GIT A;  1QZM A;  3PNV A;  2DAE A;  3GLG E;  4BB9 A;  1P3Q Q;  1K82 A;  3DZD A;  3HHX A;  4IBB A;  4LF7 M;  3DFZ A;  2JUJ A;  1ZMU A;  1ZQ9 A;  4A3V B;  2XFS A;  4B7F A;  3NWL A;  3RGS A;  3TL4 X;  5ITT A;  2I7N A;  4LJ9 A;  2CFO A;  1AIP C;  4BBA A;  5C18 A;  1SXJ A;  4DV4 M;  2D7H A;  3U61 B;  3SHF A;  3UK6 A;  3FUT A;  2R65 A;  1IBL M;  1WXQ A;  2LVQ D;  3B7Z A;  2ERC A;  4FWG A;  3AOE C;  2C96 A;  4QOZ C;  2CUZ A;  2QBY A;  1OAO C;  2DKL A;  3HU1 A;  3SHG B;  3SYL A;  5KQD A;  1FJG M;  3M0E A;  3LVV A;  4KOD A;  5EP3 A;  1XXH E;  4KT0 F;  4XBO A;  1XC8 A;  4B3M M;  2UUA M;  1XMO M;  3KOW E;  4AKI A;  4GRI A;  3U6Q A;  4NXN M;  4G4O A;  4JI2 M;  2J5Y A;  3MK6 A;  4IBE A;  1K3W A;  3U6D A;  3FTE A;  3KP0 E;  1N78 A;  1SXJ B;  1UFZ A;  3L28 A;  2EKF A;  1V34 A;  1GKI A;  2JZ0 A;  2QP9 X;  4IJF A;  1JR3 A;  4NSR A;  3SMP A;  2UXD M;  4GHL A;  4XGI A;  3LQR A;  4JI7 M;  3L27 A;  2DAG A;  3A98 B;  4X65 M;  2DZN B;  3GLH E;  3QYE A;  2QBY B;  2Z8Y M;  1OJL A;  2Z3X A;  4LZJ A;  3HWS A;  3B74 A;  1WR1 B;  1HQY E;  1TR8 A;  2HCB A;  4CHT B;  3TPZ A;  1T3T A;  2LNH C;  2CHV A;  1T43 A;  3QYB A;  1ORY B;  1Z6T A;  1IY2 A;  4LCB A;  5F3W A;  2JY6 B;  3ZQJ A;  1NO1 A;  2VF7 A;  3LW5 F;  2KNZ A;  4RKU F;  5ITX E;  1I94 M;  1E32 A;  4D82 A;  1DGH A;  1YSY A;  1BVS A;  1IQP A;  4I8O A;  4XK8 F;  4BLC A;  3B7N A;  3CTW B;  4AW4 A;  3J27 B;  4Z6Y A;  4I5S A;  2MGW A;  3AOG A;  5GKN A;  4JI0 M;  1TDZ A;  5EP1 A;  4YY3 M;  3L25 A;  3VKG A;  1W5T A;  2VII A;  1HNZ M;  4EIW A;  2QSF X;  4DR6 M;  5H37 D;  5A2Q S;  3E9S A;  2C5R A;  1MU5 A;  1WHC A;  4QOS A;  3SMS A;  2JP7 A;  3PNY A;  4WW0 A;  1ZMW A;  4LJ4 A;  1Z59 A;  1EIJ A;  2WSC F;  4IBD A;  2DXI A;  1EE8 A;  4QHS A;  2L09 A;  3FRH A;  3T1Y M;  4GC5 A;  3GQ4 A;  3EIH A;  4AI6 A;  3JR5 A;  3CF0 A;  4LJ6 A;  3U6E A;  1G4A E;  5FTM A;  1DGH B;  3L29 A;  1T6O A;  2F5Q A;  3T38 A;  3U6C A;  2KZU A;  4KHP M;  4NRW A;  3W67 A;  1OFI A;  5LMN M;  1NHG C;  1VEJ A;  2I7P A;  3GRV A;  4JYA M;  2YR0 A;  1PRB A;  5IRE B;  1I4W A;  1VG5 A;  4GKK M;  1WIV A;  4L15 A;  2R4J A;  4GHA A;  4S12 A;  1HT1 E;  3GPX A;  1QAO A;  4GKJ M;  1GJT A;  3K9P A;  4LFC M;  4KLN A;  3VFD A;  4IBC A;  3E21 A;  5LMU M;  3BBZ A;  3RGP A;  2N35 A;  1R2Y A;  1JB0 F;  1XB2 B;  5FTJ A;  2O5R A;  4PDI A;  3H4J A;  4DV5 M;  1WGL A;  3VK7 A;  1IY1 A;  4UN2 B;  2LTU A;  1OIP A;  1X37 A;  2JY5 A;  4D80 A;  3J7A S;  4CJ6 A;  2KA6 B;  3GLI B;  4R71 A;  2HKJ A;  4M9X A;  4P17 A;  3ZC7 B;  1R6B X;  3PXG A;  1HNW M;  3V76 A;  3NBX X;  2LBC A;  2M60 A;  2AHM A;  2QNJ A;  2ZBK B;  5DNY A;  2RGH A;  2V1U A;  5ITR A;  4JI6 M;  3LMM A;  2QPA A;  1G3I A;  2JZ1 A;  2KRU A;  4G3O A;  5BPV A;  4LF4 M;  2R6F A;  2R46 A;  1IFY A;  1IN6 A;  2JWS A;  3M7G A;  2CE7 A;  4FCW A;  1K3X A;  3FUX A;  7CAT A;  5ITU A;  4MGY E;  2X8A A;  1J7K A;  4PT5 A;  3LCU A;  4IJE A;  2VQE M;  1KFV A;  2OOB A;  5C1B A;  1G41 A;  2BJV A;  2H1R A;  2XSZ A;  4IBG A;  3TQS A;  5IZ7 D;  1LTM A;  3GPU A;  2UXB M;  1HQC A;  4QHT A;  1XNQ M;  2C9C A;  2A5Y B;  3KW6 A;  4B7G A;  4HL4 A;  4L6V 6;  4R7G A;  4K0K M;  4CGY B;  1JQJ C;  1QZE A;  1V92 A;  2HWJ A;  1IXZ A;  1VEK A;  1QUT A;  3RE8 A;  1AUA A;  2QHO B;  1QAQ A;  4DBG B;  1L2C A;  3J7B A;  5FTL A;  1IN5 A;  1QAM A;  3GQ3 A;  2XZF A;  2D7E A;  2CRU A;  3CGW A;  3ZH9 B;  3FD9 A;  3U5Z A;  4G4Q A;  1QAN A;  4JI1 M;  4GH9 A;  4L78 A;  5DYG A;  3HHW A;  4RF1 A;  5E6J A;  1Q39 A;  1TGU A;  3IEC A;  3VKH A;  2Y0T A;  3WHL A;  1XMQ M;  1R2Z A;  4NL4 H;  3FTC A;  2V6Z M;  1NNU C;  2HL7 A;  1PGY A;  4JI4 M;  2CHG A;  2JY8 A;  4NSO B;  4MGK E;  4OW0 A;  1KSF X;  1E9R A;  2KDL A;  2F4V M;  1UM8 A;  2EUC A;  2GQF A;  2JA2 A;  3B89 A;  2E5L M;  2ZAN A;  4ZPX A;  4FWH A;  4REZ A;  2CV2 A;  2JXN A;  1TH4 A;  4I81 A;  4P16 A;  4RNA A;  3GLI E;  3GRR A;  4CIZ A;  1F4I A;  3HJQ A;  2LVA A;  3E46 A;  5FSW A;  1DGB A;  4II7 A;  2DVW B;  2J7O A;  2L4F A;  3EIE A;  1ZAE A;  4WP2 A;  3GRU A;  4DR5 M;  2HHH M;  4JV5 M;  1NNJ A;  3NBI A;  2FNA A;  3FKE A;  5DFL A;  4OVZ A;  5KPT A;  1PJJ A;  3A46 A;  1N32 M;  1GO5 A;  1Q3B A;  2VQF M;  1OFH A;  2DWZ B;  2KXE A;  2DEN A;  1XHB A;  4DV3 M;  3U6P A;  5DYI A;  1HT2 E;  2Y0Q A;  3HU2 A;  1D0K A;  3HX3 A;  3KOX E;  3GLF A;  3VDU A;  2MR9 A;  3FE3 A;  2V1C A;  3U6S A;  1N33 M;  1V33 A;  4HEO A;  1J5E M;  4LRS A;  4MGI E;  3C3D A;  3KOY E;  5EJC A;  2XEP A;  3AKZ A;  3KFU G;  5EXX A;  1IBK M;  1QQW A;  2KHH A;  1H6U A;  3FUW A;  4M9S A;  3GLG A;  4ITQ A;  1L2D A;  2F5N A;  1FNN A;  3CF2 A;  1YLA A;  2EO2 A;  3I04 M;  3K9O A;  2LH0 A;  1CUK A;  1R4G A;  2H5X A;  4NXM M;  4M0W A;  4OVZ B;  5JI3 E;  4LZZ A;  1XNR M;  2FOI C;  2APL A;  3UGJ A;  3HY5 A;  1RU3 A;  2L4E A;  3HHY A;  1G59 A;  4IIW A;  1DGG A;  1Z5C A;  3FTF A;  4L4U A;  3MJ5 A;  3IHP A;  2CHQ A;  3R9X B;  4GEW A;  3GPY A;  3MMP A;  4DV2 M;  5EXS A;  1W5S A;  1IN7 A;  4AKG A;  1WJ7 A;  3KOZ E;  3GLF B;  1SXJ E;  2D7G A;  2LHC A;  4HLQ A;  4WUR A;  3GP1 A;  4DR4 M;  3CF6 E;  3HU3 A;  5FTK A;  2F5P A;  3QWL A;  4FWD A;  1MN3 A;  2XFT A;  4JI8 M;  1XXH A;  1N34 M;  2YQZ A;  2DAK A;  1IXR C;  2ZM6 M;  4OU7 A;  3Q8G A;  2KZS A;  2WSF F;  3THG A;  5JI2 E;  3FRI A;  4MB7 A;  2EA0 A;  3W68 A;  3KVW A;  3AV0 A;  3T15 A;  4X66 M;  4IBI A;  2LVO C;  3HJS A;  2XLJ A;  3SBJ A;  1OKS A;  3T6P A;  1TH2 A;  1DO2 A;  1QDR A;  2DNA A;  1HR0 M;  4LGY A;  4LJ5 A;  1J09 A;  2O25 A;  1E94 E;  2VF8 A;  3HKP A;  1L2B A;  4KO8 A;  3J2P B;  4MM3 B;  2OO9 A;  3GO8 A;  1IN4 A;  1PJQ A;  3MHV C;  3GLH A;  5EXP A;  1OTR A;  3LVW A;  3AL0 C;  4MGH A;  5EP4 A;  4L8R C;  1DO0 A;  4DV7 M;  1R7R A;  3KS8 A;  1VQ1 A;  1JR3 E;  2DHR A;  2W82 A;  4GIP A;  1XXH B;  3KP1 E;  2O01 F;  3HGI A;  5EXT A;  4B3S M;  1G8P A;  4G4N A;  3U6L A;  1PJT A;  2UU9 M;  2UUB M;  1NHW C;  3VK8 A;  2CV0 A;  1ZV1 A;  2K9D A;  4LF6 M;  4PDG A;  3FUU A;  2J7N A;  1IXS A;  5ITX A;  4AKH A;  3K1J A;  3BOS A;  2R18 A;  2LHG A;  2B3T A;  2EKK A;  3F92 A;  4AG6 A;  3U60 A;  2MH8 A;  2BJW A;  4D81 A;  2R44 A;  3FTD A;  4JI3 M;  3B9P A;  1GL6 A;  3DA1 A;  4DR1 M;  3W0F A;  1IBM M;  3L26 A;  3KDS E;  4B3T M;  2G3Q A;  3AOE A;  2DZL A;  1QYR A;  3TWK A;  2DWL A;  1TH3 A;  2WSE F;  4MH0 E;  1QVR A;  5KQ8 A;  3HJ8 A;  2Z7J A;  1S3S A;  2KNV A;  4JN6 A;  3C58 A;  1L1T A;  4GMQ A;  4LF8 M;  2QZ4 A;  3SC3 A;  3GPP A;  2FE8 A;  2LWX A;  3I4V A;  2YNM D;  4G6Z A;  2FS1 A;  1GAB A;  3DOA A;  1SXJ D;  3VLF B;  4DV0 M;  4FCV A;  1NV9 A;  3KSJ A;  5L8R F;  1N77 A;  1IM2 A;  1IXS B;  1Q02 A;  2NQ8 C;  2QQ8 A;  3D8B A;  3SAS A;  1MX0 A;  3GQ5 A;  2GNO A;  2OOA A;  2C98 A;  2XGN A;  3U60 B;  2L6O A;  4F2L A;  3PVS A;  1QDT A;  4AZF A;  1NY6 A;  3FUV A;  4TUW A;  3L2A A;  3KS4 A;  2KNA A;  1EFU B;  1SXJ C;  3HZJ A;  1GJS A;  3E4R A;  5KPZ A;  4LRT A; 
#chains in the Genus database with same CATH homology
 1VG5 A;  2CWB A;  1WIV A;  1OAI A;  2BWE A;  2KHH A;  1HT1 E;  4F1I A;  2LVN C;  1KYI A;  1YLA A;  2DI0 A;  2HAK A;  3K9P A;  2K0B X;  3K9O A;  1CUK A;  1R4G A;  2H5X A;  3E21 A;  3GLG E;  2DAE A;  1P3Q Q;  3BBZ A;  2BWB A;  1TTE A;  1XB2 B;  2JUJ A;  2L4E A;  1ZMU A;  3H4J A;  1VEG A;  1WGL A;  2DAI A;  1Y8G A;  3IHP A;  4UN2 B;  2LTU A;  2JY5 A;  1AIP C;  3MMP A;  4GEW A;  2ZTC A;  4R71 A;  1WJ7 A;  3LCV B;  2LVQ D;  2LBC A;  2QNJ A;  1MN3 A;  2DKL A;  1G3I A;  2JZ1 A;  4G3O A;  2DAK A;  1IFY A;  2EJS A;  1XXH E;  1SG9 A;  5JI2 E;  3FRI A;  2LVO C;  1OKS A;  3LCU A;  3T6P A;  2OOB A;  1DO2 A;  1G41 A;  4Q7J A;  2DNA A;  2O25 A;  1E94 E;  2L2D A;  2OO9 A;  1OQY A;  1UFZ A;  1QZE A;  1V92 A;  1VEK A;  2HWJ A;  2EKF A;  2JZ0 A;  1OTR A;  2QHO B;  4DBG B;  1DO0 A;  1NV8 A;  2DAG A;  3GLH E;  1VQ1 A;  1JR3 E;  1ZMV A;  1WR1 B;  1HQY E;  1TR8 A;  1WGN A;  3IEC A;  2R0I A;  1T43 A;  1ZV1 A;  2K9D A;  2DAM A;  1A5T A;  1IXS A;  1PGY A;  2JY6 B;  2JY8 A;  2DHY A;  1C7Y A;  3F92 A;  2B3T A;  2EKK A;  2KNZ A;  2LVP C;  3B89 A;  1DV0 A;  1BVS A;  2G3Q A;  2DZL A;  3GLI E;  2MGW A;  2WZJ A;  1F4I A;  2LVA A;  2KNV A;  3E46 A;  2QSF X;  2JY7 A;  1WHC A;  2JP7 A;  2MJ5 B;  2L4F A;  4WP2 A;  1ZMW A;  2JNH A;  5DFL A;  1NV9 A;  1HJP A;  1GO5 A;  1IM2 A;  1Q02 A;  3FRH A;  2OOA A;  2MRO B;  4F2L A;  2DEN A;  1G4A E;  1HT2 E;  2CP8 A;  1T6O A;  1VDL A;  2ZTD A;  2KNA A;  2MR9 A;  1EFU B;  3FE3 A;  1VEJ A;  4HEO A;  3GLF E;  2RRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...