4TUWA

Drosophila stem-loop binding protein complexed with histone mrna stem-loop, phospho mimic of tpnk and c-terminal region
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
71
Chain Sequence
SSYTEADPAILSRRQKQIDYGKNTAAYERYVEMVPRTRDHPREPNKYGKYSRRAFDGLVKIWRKSLHIYDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone RNA hairpin-binding protein
publication title Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein/rna
total genus 22
structure length 71
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4tuwA00
4L8RC 4TUWA 4QOZC
chains in the Genus database with same CATH superfamily
4L6V6 4M0DA 4DV4M 2DWLA 2QQ8A 2HAKA 3TWLA 1V34A 5EP2A 4IBDA 4LJ4A 3VKHA 4MGHA 4X65M 2H1RA 2O01F 2CHGA 3KOYE 1EIJA 2QSFX 3BOSA 5ITUA 1XXHB 1P3QQ 2JZ1A 3QWLA 1HNZM 3W68A 1KFVA 1G4AE 4DV2M 1PM5A 2ERCA 3HHXA 3HJSA 3PFIA 2JP7A 3OTOM 2DAMA 2F4VM 2DAGA 4EIWA 3U60B 1IN5A 1GJTA 3PNYA 3GQ4A 1XMQM 4QNRA 3W0FA 2KHHA 4DR2M 1KYIA 3DZDA 2ZAMA 2CWBA 1JR3E 3WHLA 4DBGB 2QBYA 4LF7M 2CE7A 2FFJA 1UM8A 1W5TA 2EKFA 4IBBA 4BLCA 4DR1M 1D2NA 4ZPXA 4OW0A 2CV2A 2WSCF 2DHYA 1IQPA 3GPXA 4KO8A 3SYLA 4LRSA 2CP8A 2UXBM 3DA1A 3B89A 1G41A 2YQZA 3DOAA 4B3MM 3EIEA 3R9XB 1BVSA 5H37D 1A5TA 2FNAA 1NHGC 3H4JA 3AOGA 3HU1A 3Q8XA 1TF0B 2M60A 4LZZA 3K9PA 4R3DA 3UZUA 1F4IA 2KZSA 2LNHC 3GO8A 3J80S 1SXJB 3SYKA 1V92A 1Z6TA 4OVZB 3VFDA 3C3DA 2BNKA 1QZMA 4DV6M 3FRIA 2H5XA 3IHPA 4XGIA 4G4RA 3FRHA 2M5ZA 2DWZB 4DV7M 2C5RA 3KFUG 5KPRA 1QAQA 1L1ZA 1IY2A 4LZJA 3L25A 1QDRA 4GEWA 1EFUB 3C9PA 2FE8A 4LG2A 2W82A 2FS1A 2Z4SA 1KSFX 4LJAA 3GQ3A 1MN3A 4L4UA 4FWDA 3BBZA 3LW5F 2MR9A 1WXQA 4L78A 5IZ7D 2KDLA 4LFBM 3HJ8A 3SC3A 2JWSA 3FTFA 4JI0M 2MROB 4QNMA 2LVOC 3FUXA 2Z4RA 2KA6B 3HZJA 3HHWA 2F5QA 4JI3M 1HT1E 2EO2A 2LVNC 3KDSE 4KLNA 4S12A 2KRUA 4XK8F 2RGHA 4LF6M 4TUWA 5BPVA 1IY0A 2EA0A 3U61A 2R6FA 3VDUA 5E6JA 1NJFA 1QANA 3K2LA 2LHGA 4L16A 4LGMA 4LJ8A 3HU3A 3J2PB 1TH3A 2DENA 5FTNA 4JI1M 1Z5BA 1ZMUA 1W5SA 4GMQA 4UN2B 1VEKA 1OAIA 4QOSA 4RF1A 2XSZD 1H6UA 3CGWA 4CHTB 3J81S 3GLIA 1IN8A 4HEOA 4A3VB 3U6CA 2CEAA 4G4OA 3HKPA 2E5LM 2UUBM 2QBYB 3ZC7B 1Q3CA 4PT5A 2DWMA 4DR7M 2KNAA 3RGSA 3UGJA 4AKHA 1GL6A 2XFTA 1PGYA 4FVMA 1G71A 1N75A 1ZMWA 4IBCA 2F5PA 4B3SM 3GQ5A 2LXEA 3I51A 3M7GA 1HR0M 1N32M 1R6BX 1VEJA 5EP3A 2P5TA 2UUAM 2HKJA 1WGLA 1AIPC 3SAVA 2I7NA 2UXCM 1OTRA 4FCWA 3ZCBB 5ITTA 1K82A 2CV0A 2X49A 1QUSA 3GRUA 3U6OA 3GPYA 3T1HM 1XWIA 4G3OA 5DNYA 3GLIE 2DZOB 3TWMA 2B3TA 1K3XA 5ITRA 2X8AA 4B7GA 5FTJA 4LFAM 1ORYB 1T43A 4I4LA 4PDIA 1JR3A 1I94M 5KPZA 4MH0E 1GO5A 4DR5M 2DKLA 2J7OA 3B7QA 1XNRM 1RU3A 1QQWA 3NWLA 4GC5A 3L28A 3MJ5A 4LJ5A 2HL7A 2O25A 4LJ6A 3GLFA 4II7A 4M9ZA 3T38A 1YSYA 3T1YM 4AG5A 4RKUF 2MGWA 2LHCA 4FW9A 4M9SA 1MU5A 2LWXA 1DGFA 3L26A 2XZUA 4CISA 1GABA 1IN6A 1Z59A 1NVMA 4HLQA 2XEPA 2KRKA 3SATA 1N33M 2VF8A 2N35A 3KVWA 1NHWC 4IBEA 3W67A 4CIZA 4PD2A 2R45A 3SMSA 2DWNA 2OQ4A 2CHQA 2L4EA 3AL0C 2JUJA 1G3IA 1IY1A 2G3QA 1HQCA 5FTMA 3FUTA 3SHFA 5E26A 1Q3BA 4NRWA 3HGIA 2L6OA 2CRUA 2MJ5B 4R71A 3D8BA 1Q39A 3A98B 3GLFE 3UJNA 4X64M 1OIPA 3U61B 3R8FA 3HJQA 3U6DA 1HQYE 2D7EA 1XC8A 4BB9A 1GKIA 5KQ8A 4X66M 3VK8A 3QAUA 1MX0A 2KNVA 2L7HA 1DO2A 2RGOA 3U6QA 3VK7A 4GHAA 2OPFA 4FCVA 3VDPA 4MB7A 2RRUA 1OAOC 1Y8GA 1T6OA 3DFZA 4GIPA 4MGKE 4LGYA 3KSXA 1NO1A 1WR1B 4NOOB 1GL7A 1QDTA 3AFHA 3GLIB 3FD9A 4LF8M 5C1BA 4B08A 5GKNA 1D0KA 2LVPC 4REZA 1K3WA 5IWAM 1SXJD 4F2LA 4AKIA 3QYEA 3U5ZA 2JY7A 4G6ZA 4MGZE 3TWKA 4AG6A 3V76A 3AKZA 1JQJC 3AV0A 1NNJA 2DAIA 5EP4A 2VQFM 1L2CA 2DZNB 1QUTA 1PJIA 1OFIA 4YY3M 1TH2A 3E9SA 4ANRA 3U6PA 3BXWA 4Y28F 4I8OA 4M0WA 1G59A 3KW6A 2FH0A 1PJJA 1YUBA 2EJSA 2OOAA 1XMOM 2YNMD 2KZUA 2C99A 4IJEA 4M9XA 2V6ZM 1FJGM 4ITQA 1IBKM 2CFOA 5DFLA 4DV5M 1CUKA 3KS4A 3GRYA 1IBMM 2ZTDA 4I5SA 3CF6E 1OJLA 1WIVA 1TH4A 2R65A 3E21A 3FYCA 2ZBKB 4IBGA 2WSEF 1IBLM 1HJPA 3HHYA 4MGYE 2K0BX 2QNJA 3GLFB 2XLJA 4RNAA 2K6BA 4L15A 2QZ4A 4QHSA 5IREB 1QYRA 4JXJA 3I01M 1PJTA 4Z6YA 4GITA 1TDHA 2Y21A 2WZJA 4LJ7A 2DXIA 5FTKA 2CUZA 3CF0A 2UU9M 1NNUC 1ZMVA 4DUYM 3HHZA 4OU7A 1IXSA 2O5RA 3SHGB 5IT9S 1AUAA 2JY6B 4NSRA 2XF3A 3GLHA 2F5OA 3AJIB 4GRIA 2APLA 5LMNM 1R4GA 4B3RM 4LF5M 3TQSA 4KHPM 1Z5AA 3C3EA 3KOXE 4FWGA 4NXNM 1C1KA 1R2YA 2DAEA 4MM3B 2GQFA 3T15A 5ITXE 5EXTA 4WW0A 2KEBA 2VF7A 3KOWE 2BJVA 3B9PA 2QCUA 4DV0M 4B3TM 1XNQM 3GLGA 1N78A 3HU2A 5FLXS 2ZTCA 4IBJA 3ZH9B 1L2BA 3PNVA 4LF9M 4GHLA 1L2DA 5EQTA 4W5WA 5EJCA 3B7NA 1NJGA 3TPZA 4WURA 4D80A 2F5SA 4D81A 4DR6M 1E94E 3I04M 3GLHE 3LMMA 4NL4H 1ZV1A 3RGPA 4DR3M 4NSOB 2EKKA 1IM2A 3FUWA 2LVAA 3JR5A 5BR8M 4IIWA 4I81A 1X37A 3NBIA 1ZQ9A 3U5ZB 3K1JA 2AHMA 3IECA 4JI5M 3U6LA 2DI0A 4QOZC 5JI2E 4BBAA 1SXJE 3AOEA 3FKEA 4IJFA 4MGIE 4GKJM 4CJ6A 3GRVA 3KP1E 2I7PA 1HNWM 1YE9A 3GLGE 1VDLA 5KPTA 4LJ9A 2DAKA 1LV7A 3EIHA 4D82A 5F3WA 1GVNA 2F5NA 2LBCA 3JAMS 4DV1M 4XBOA 1G8PA 2Y20A 1TDZA 4JI8M 2R18A 1N77A 3HWSA 1MJGM 3A46A 3ILKA 4NRVA 1DGHA 2JZ0A 3FUVA 1Z5CA 2KNZA 3FTDA 2L09A 1LTMA 4F1IA 4OX9M 1SXJC 1QAOA 3H4MA 2XSZA 2XH9A 4WP2A 1C7YA 5FSWA 2FOIC 1DGBA 3UMMA 2Y0TA 2L2DA 2R44A 2UXDM 3MMPA 2R4EA 1HNXM 2ZANA 2LH0A 2HHHM 4JI4M 3F92A 3KOZE 4JI2M 5ITYA 2K47A 2HCBA 1WGNA 1J5EM 1IN7A 2JXNA 3GRRA 1DGGA 1WHCA 1R5LA 1WJ7A 2VQEM 1QVRA 3M0EA 2QENA 1IXSB 2V1CA 1QAMA 4IBIA 2XZFA 1FNNA 2BWEA 1VEGA 3QYBA 2R4JA 2XFSA 1OFHA 3GLHB 3LQRA 1PRBA 2G5GX 2QP9X 4YHHM 5LMUM 3K8ZA 5DYIA 4GH9A 2UUCM 1E9RA 2DNAA 3B7ZA 3AOEC 4G4NA 3HY5A 3J7BA 3NBXX 1E9SA 3SMPA 2LVQD 1XB2B 3PXGA 5C18A 1GJSA 4R7GA 4Q7JA 4Z8XA 2G8LA 1OQYA 1YLAA 2DZLA 4DUZM 3JR4A 1IN4A 1GLNA 2R62A 3FE3A 1R7RA 5KO3A 3LCUA 3FTEA 1IXZA 2J7NA 3IG8A 2OOBA 3ZQJA 3GLGB 1SG9A 2EUCA 4JI6M 4NC6A 1EE8A 3FUUA 1HT2E 3KXEC 4B7FA 2KXEA 1DV0A 2LTUA 1NSFA 4FWHA 2OO9A 1NY5A 2JY5A 4KT0F 3U6SA 2Z7JA 2C96A 2JY8A 2GNOA 3KSJA 3MHVC 3RFWA 3E46A 1PJQA 1XXHA 4L8RC 4JYAM 3D8LA 3GPUA 5DYGA 1TR8A 4JV5M 2R46A 3M6AA 3I4VA 4K0KM 3KS8A 4X62M 5ITXA 2Z8YM 2K9DA 3PVSA 3SASA 3L29A 4LY6A 1VG5A 4DV3M 4JI7M 1JR3D 3U6EA 3U60A 1J7KA 1ZAEA 4IBFA 2VDBB 2C9OA 2RKOA 4GKKM 2DHRA 3K92A 1L1TA 2V1UA 4PDGA 2HWJA 2BWBA 3L2AA 2DVWB 4LCBA 7CATA 5FTLA 4AQYM 1J09A 3J27B 3L27A 3LVVA 2NQ8C 5ITQA 1XXHE 4IBKA 2X4AA 2YR0A 1DGHB 3LCVB 5EP1A 1D0LA 1TGUA 5EXXA 1L8QA 4FD2A 2JA2A 3LQQA 4G4QA 1NV8A 2C98A 2L4FA 4LRTA 1PJSA 3MK6A 2QPAA 5L8RF 3SBJA 4AW4A 3C58A 4DR4M 1JB0F 1VDDA 2D7GA 3VKGA 4P17A 2D7HA 3RE8A 1TTEA 3KP0E 1D0MA 1IFYA 1SXJA 3CTWB 1I4WA 3B74A 4RF0A 1VQ1A 8CATA 4OVZA 4AKGA 2R0IA 3TL4X 3U6MA 3WHKA 4NXMM 1R2ZA 3I4YA 3SARA 2VIIA 1IXRC 2C9CA 1S3SA 3TE6A 3K9OA 3T6PA 2A5YB 2MH8A 4PCZA 1N36M 4LFCM 4JN6A 5EXPA 3UK6A 2JNHA 3VLFB 5EXSA 4GC9A 3GP1A 1QZEA 3GPPA 1DO0A 2KW0A 3Q8GA 3IG5A 2CV1A 1OIZA 3SFZA 3LVWA 4CGYB 3CF2A 3HX3A 4FCTA 3THGA 1E32A 5KQDA 2Y0QA 2CHVA 2ZAOA 4LF4M 2QHOB 4B7HA 2J5YA 1NV9A 3E4RA 3FYDA 2XGNA 1V33A 3A45A 3J7AS 4P16A 2Z3XA 4AI6A 1OKSA 3A42A 1UFZA 4AZFA 2WSFF 2Q2EB 4QHTA 5JI3E 1T3TA 2L7IA 1NY6A 1Q02A 1N34M 5A2QS 3FTCA 4HL4A 1XHBA 4KODA 3W0LB 3SAUA 3SAWA 2YFQA 2BJWA 2ZM6M
chains in the Genus database with same CATH topology
4M0DA 4DV4M 2DWLA 3TWLA 5EP2A 4IBDA 4LJ4A 3VKHA 4MGHA 4X65M 2H1RA 3KOYE 2CHGA 3BOSA 5ITUA 1XXHB 3QWLA 1HNZM 1KFVA 1G4AE 4DV2M 1PM5A 2ERCA 3HHXA 3HJSA 3PFIA 3OTOM 2F4VM 4EIWA 3U60B 1IN5A 3PNYA 3GQ4A 1XMQM 4QNRA 3W0FA 4DR2M 1KYIA 3DZDA 2ZAMA 3WHLA 2QBYA 4LF7M 2CE7A 2FFJA 1UM8A 1W5TA 4DR1M 4IBBA 4BLCA 1D2NA 4ZPXA 4OW0A 2CV2A 3GPXA 1IQPA 4KO8A 3SYLA 4LRSA 2UXBM 3DA1A 1G41A 2YQZA 3DOAA 4B3MM 3EIEA 3R9XB 5H37D 2FNAA 1NHGC 3HU1A 3AOGA 3Q8XA 4LZZA 2M60A 4R3DA 3UZUA 2KZSA 2LNHC 3GO8A 3J80S 1SXJB 3SYKA 1Z6TA 4OVZB 3VFDA 2BNKA 1QZMA 4DV6M 4XGIA 4G4RA 2M5ZA 2DWZB 4DV7M 2C5RA 3KFUG 5KPRA 1QAQA 1L1ZA 1IY2A 4LZJA 3L25A 2FE8A 4LG2A 2W82A 2Z4SA 1KSFX 4LJAA 3GQ3A 4L4UA 4FWDA 1WXQA 4L78A 5IZ7D 4LFBM 3HJ8A 3SC3A 3FTFA 4JI0M 4QNMA 3FUXA 2Z4RA 2KA6B 3HHWA 2F5QA 4JI3M 1HT1E 2EO2A 3KDSE 4KLNA 4S12A 2KRUA 4LF6M 2RGHA 4TUWA 5BPVA 1IY0A 2EA0A 3U61A 3VDUA 5E6JA 1NJFA 1QANA 3K2LA 4L16A 4LGMA 4LJ8A 3HU3A 3J2PB 1TH3A 5FTNA 4JI1M 1Z5BA 1W5SA 4GMQA 4QOSA 4RF1A 2XSZD 1H6UA 4CHTB 3GLIA 3J81S 1IN8A 2E5LM 4A3VB 3U6CA 2CEAA 4G4OA 3HKPA 2QBYB 2UUBM 3ZC7B 1Q3CA 4PT5A 2DWMA 4DR7M 3RGSA 3UGJA 4AKHA 1GL6A 2XFTA 4FVMA 4IBCA 1N75A 2F5PA 4B3SM 3GQ5A 2LXEA 3I51A 3M7GA 1HR0M 1N32M 1R6BX 5EP3A 2P5TA 2UUAM 2HKJA 3SAVA 2UXCM 2I7NA 4FCWA 3ZCBB 5ITTA 1K82A 2CV0A 2X49A 3U6OA 3GPYA 3T1HM 1XWIA 5DNYA 2DZOB 3TWMA 1K3XA 5ITRA 2X8AA 4B7GA 5FTJA 4LFAM 1ORYB 4I4LA 4PDIA 1JR3A 1I94M 5KPZA 4MH0E 4DR5M 2J7OA 1XNRM 1QQWA 3NWLA 4GC5A 3L28A 3MJ5A 4LJ5A 2HL7A 4LJ6A 3GLFA 4II7A 4M9ZA 3T38A 1YSYA 3T1YM 4AG5A 4FW9A 4M9SA 1MU5A 2LWXA 1DGFA 3L26A 2XZUA 4CISA 1IN6A 1Z59A 1NVMA 4HLQA 2XEPA 2KRKA 3SATA 1N33M 3KVWA 4IBEA 1NHWC 4PD2A 2DWNA 2R45A 3SMSA 2OQ4A 2CHQA 3AL0C 3SHFA 1G3IA 1IY1A 5FTMA 1HQCA 3FUTA 5E26A 1Q3BA 4NRWA 3HGIA 2L6OA 3D8BA 1Q39A 3A98B 3UJNA 4X64M 3U61B 3R8FA 3HJQA 3U6DA 1HQYE 2D7EA 1XC8A 4BB9A 1GKIA 5KQ8A 4X66M 3VK8A 3QAUA 1MX0A 2L7HA 1DO2A 2RGOA 3U6QA 3VK7A 4GHAA 2OPFA 4FCVA 3VDPA 4MB7A 4GIPA 3DFZA 4MGKE 4LGYA 3KSXA 4NOOB 1GL7A 3AFHA 3GLIB 4LF8M 3FD9A 5C1BA 4B08A 5GKNA 4REZA 1K3WA 5IWAM 1SXJD 4AKIA 3U5ZA 4G6ZA 4MGZE 3TWKA 4AG6A 3AKZA 1JQJC 3AV0A 1NNJA 1L2CA 5EP4A 2VQFM 2DZNB 1PJIA 1OFIA 4YY3M 1TH2A 3E9SA 3U6PA 4I8OA 4M0WA 1G59A 3KW6A 1PJJA 1YUBA 1XMOM 2YNMD 2KZUA 2C99A 4IJEA 4M9XA 2V6ZM 1FJGM 4ITQA 1IBKM 2CFOA 4DV5M 3KS4A 3GRYA 1IBMM 4I5SA 3CF6E 1OJLA 1TH4A 2R65A 3FYCA 2ZBKB 4IBGA 1IBLM 3HHYA 4MGYE 3GLFB 2XLJA 4RNAA 4L15A 2QZ4A 4QHSA 5IREB 1QYRA 4JXJA 4Z6YA 4GITA 1TDHA 2Y21A 4LJ7A 2DXIA 5FTKA 2CUZA 3CF0A 2UU9M 1NNUC 4DUYM 3HHZA 4OU7A 2O5RA 3SHGB 5IT9S 4NSRA 2XF3A 3GLHA 2F5OA 3AJIB 4GRIA 5LMNM 4B3RM 4LF5M 3TQSA 4KHPM 1Z5AA 3KOXE 4FWGA 4NXNM 1C1KA 1R2YA 4MM3B 3T15A 5ITXE 5EXTA 4WW0A 2KEBA 3KOWE 2BJVA 3B9PA 2QCUA 2BJWA 4DV0M 4B3TM 3GLGA 1XNQM 1N78A 3HU2A 5FLXS 4GHLA 4IBJA 3ZH9B 1L2BA 3PNVA 4LF9M 1L2DA 5EQTA 4W5WA 5EJCA 3TPZA 1NJGA 4D80A 4WURA 2F5SA 4DR6M 4D81A 1E94E 3LMMA 4NL4H 3RGPA 4NSOB 1IM2A 3FUWA 3JR5A 5BR8M 4IIWA 4I81A 1X37A 3NBIA 1ZQ9A 3U5ZB 3K1JA 2AHMA 4JI5M 3U6LA 4QOZC 5JI2E 4BBAA 1SXJE 3AOEA 3FKEA 4IJFA 4MGIE 4GKJM 3GRVA 3KP1E 2I7PA 1HNWM 1YE9A 5KPTA 4LJ9A 1LV7A 3EIHA 4D82A 5F3WA 1GVNA 2F5NA 3JAMS 4DV1M 4XBOA 1G8PA 2Y20A 1TDZA 4JI8M 2R18A 1N77A 3HWSA 3A46A 3ILKA 4NRVA 1DGHA 3FUVA 1Z5CA 3FTDA 4OX9M 2L09A 1SXJC 1QAOA 3H4MA 2XSZA 2XH9A 5FSWA 2FOIC 1DGBA 3UMMA 2Y0TA 2UXDM 2R4EA 1HNXM 2ZANA 2LH0A 2HHHM 4JI4M 3KOZE 4JI2M 5ITYA 2K47A 2HCBA 1J5EM 1IN7A 3GRRA 1DGGA 2VQEM 1QVRA 3M0EA 2QENA 1IXSB 2V1CA 1QAMA 4IBIA 2XZFA 1FNNA 2R4JA 2XFSA 1OFHA 3GLHB 3LQRA 5LMUM 2G5GX 2QP9X 4YHHM 3K8ZA 5DYIA 4GH9A 2UUCM 1E9RA 3AOEC 4G4NA 3J7BA 1E9SA 3SMPA 3PXGA 5C18A 4R7GA 4Z8XA 2G8LA 4DUZM 3JR4A 1IN4A 1GLNA 2R62A 5KO3A 1R7RA 3FTEA 1IXZA 2J7NA 3IG8A 3GLGB 2EUCA 4JI6M 1EE8A 3FUUA 1HT2E 3KXEC 4B7FA 2KXEA 1NSFA 4FWHA 1NY5A 3U6SA 2Z7JA 2C96A 3KSJA 3MHVC 3RFWA 1XXHA 4L8RC 4JYAM 3D8LA 3GPUA 5DYGA 4JV5M 2R46A 3M6AA 3I4VA 4K0KM 3KS8A 4X62M 5ITXA 3SASA 3PVSA 3L29A 4LY6A 4DV3M 4JI7M 1JR3D 3U6EA 3U60A 1J7KA 1ZAEA 4IBFA 2C9OA 2RKOA 4GKKM 2DHRA 3K92A 1L1TA 2V1UA 4PDGA 5FTLA 3L2AA 2DVWB 4LCBA 7CATA 4AQYM 1J09A 3J27B 3L27A 3LVVA 2NQ8C 5ITQA 4IBKA 2X4AA 2YR0A 1DGHB 5EP1A 1TGUA 5EXXA 1L8QA 4FD2A 2JA2A 3LQQA 4G4QA 2C98A 3SBJA 4LRTA 3MK6A 2QPAA 4DR4M 4AW4A 3C58A 1VDDA 2D7GA 3VKGA 2D7HA 3RE8A 3KP0E 1SXJA 3CTWB 1I4WA 4RF0A 8CATA 4OVZA 4AKGA 3TL4X 3U6MA 3WHKA 4NXMM 1R2ZA 3I4YA 3SARA 2VIIA 1IXRC 2C9CA 1S3SA 3TE6A 2A5YB 4PCZA 1N36M 4LFCM 4JN6A 5EXPA 3UK6A 3VLFB 5EXSA 4GC9A 3GP1A 3GPPA 1DO0A 2KW0A 2CV1A 3IG5A 3SFZA 3LVWA 4CGYB 3CF2A 3THGA 4FCTA 5KQDA 1E32A 4DR3M 2Y0QA 2CHVA 2ZAOA 4LF4M 4B7HA 3E4RA 3FYDA 2XGNA 3A45A 3J7AS 4P16A 2Z3XA 4AI6A 3A42A 4AZFA 5JI3E 2Q2EB 4QHTA 1T3TA 2L7IA 1NY6A 1N34M 5A2QS 3FTCA 4HL4A 1XHBA 4KODA 3W0LB 3SAUA 3SAWA 2YFQA 3GRUA 2ZM6M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8R C;  4TUW A;  4QOZ C; 
#chains in the Genus database with same CATH topology
 4L6V 6;  4M0D A;  4DV4 M;  2DWL A;  2QQ8 A;  2HAK A;  3TWL A;  1V34 A;  5EP2 A;  4IBD A;  4LJ4 A;  3VKH A;  4MGH A;  4X65 M;  2H1R A;  2O01 F;  2CHG A;  3KOY E;  1EIJ A;  2QSF X;  3BOS A;  5ITU A;  1XXH B;  1P3Q Q;  2JZ1 A;  3QWL A;  1HNZ M;  3W68 A;  1KFV A;  1G4A E;  4DV2 M;  1PM5 A;  2ERC A;  3HHX A;  3HJS A;  3PFI A;  2JP7 A;  3OTO M;  2DAM A;  2F4V M;  2DAG A;  4EIW A;  3U60 B;  1IN5 A;  1GJT A;  3PNY A;  3GQ4 A;  1XMQ M;  4QNR A;  3W0F A;  2KHH A;  4DR2 M;  1KYI A;  3DZD A;  2ZAM A;  2CWB A;  1JR3 E;  3WHL A;  4DBG B;  2QBY A;  4LF7 M;  2CE7 A;  2FFJ A;  1UM8 A;  1W5T A;  2EKF A;  4IBB A;  4BLC A;  4DR1 M;  1D2N A;  4ZPX A;  4OW0 A;  2CV2 A;  2WSC F;  2DHY A;  1IQP A;  3GPX A;  4KO8 A;  3SYL A;  4LRS A;  2CP8 A;  2UXB M;  3DA1 A;  3B89 A;  1G41 A;  2YQZ A;  3DOA A;  4B3M M;  3EIE A;  3R9X B;  1BVS A;  5H37 D;  1A5T A;  2FNA A;  1NHG C;  3H4J A;  3AOG A;  3HU1 A;  3Q8X A;  1TF0 B;  2M60 A;  4LZZ A;  3K9P A;  4R3D A;  3UZU A;  1F4I A;  2KZS A;  2LNH C;  3GO8 A;  3J80 S;  1SXJ B;  3SYK A;  1V92 A;  1Z6T A;  4OVZ B;  3VFD A;  3C3D A;  2BNK A;  1QZM A;  4DV6 M;  3FRI A;  2H5X A;  3IHP A;  4XGI A;  4G4R A;  3FRH A;  2M5Z A;  2DWZ B;  4DV7 M;  2C5R A;  3KFU G;  5KPR A;  1QAQ A;  1L1Z A;  1IY2 A;  4LZJ A;  3L25 A;  1QDR A;  4GEW A;  1EFU B;  3C9P A;  2FE8 A;  4LG2 A;  2W82 A;  2FS1 A;  2Z4S A;  1KSF X;  4LJA A;  3GQ3 A;  1MN3 A;  4L4U A;  4FWD A;  3BBZ A;  3LW5 F;  2MR9 A;  1WXQ A;  4L78 A;  5IZ7 D;  2KDL A;  4LFB M;  3HJ8 A;  3SC3 A;  2JWS A;  3FTF A;  4JI0 M;  2MRO B;  4QNM A;  2LVO C;  3FUX A;  2Z4R A;  2KA6 B;  3HZJ A;  3HHW A;  2F5Q A;  4JI3 M;  1HT1 E;  2EO2 A;  2LVN C;  3KDS E;  4KLN A;  4S12 A;  2KRU A;  4XK8 F;  2RGH A;  4LF6 M;  4TUW A;  5BPV A;  1IY0 A;  2EA0 A;  3U61 A;  2R6F A;  3VDU A;  5E6J A;  1NJF A;  1QAN A;  3K2L A;  2LHG A;  4L16 A;  4LGM A;  4LJ8 A;  3HU3 A;  3J2P B;  1TH3 A;  2DEN A;  5FTN A;  4JI1 M;  1Z5B A;  1ZMU A;  1W5S A;  4GMQ A;  4UN2 B;  1VEK A;  1OAI A;  4QOS A;  4RF1 A;  2XSZ D;  1H6U A;  3CGW A;  4CHT B;  3J81 S;  3GLI A;  1IN8 A;  4HEO A;  4A3V B;  3U6C A;  2CEA A;  4G4O A;  3HKP A;  2E5L M;  2UUB M;  2QBY B;  3ZC7 B;  1Q3C A;  4PT5 A;  2DWM A;  4DR7 M;  2KNA A;  3RGS A;  3UGJ A;  4AKH A;  1GL6 A;  2XFT A;  1PGY A;  4FVM A;  1G71 A;  1N75 A;  1ZMW A;  4IBC A;  2F5P A;  4B3S M;  3GQ5 A;  2LXE A;  3I51 A;  3M7G A;  1HR0 M;  1N32 M;  1R6B X;  1VEJ A;  5EP3 A;  2P5T A;  2UUA M;  2HKJ A;  1WGL A;  1AIP C;  3SAV A;  2I7N A;  2UXC M;  1OTR A;  4FCW A;  3ZCB B;  5ITT A;  1K82 A;  2CV0 A;  2X49 A;  1QUS A;  3GRU A;  3U6O A;  3GPY A;  3T1H M;  1XWI A;  4G3O A;  5DNY A;  3GLI E;  2DZO B;  3TWM A;  2B3T A;  1K3X A;  5ITR A;  2X8A A;  4B7G A;  5FTJ A;  4LFA M;  1ORY B;  1T43 A;  4I4L A;  4PDI A;  1JR3 A;  1I94 M;  5KPZ A;  4MH0 E;  1GO5 A;  4DR5 M;  2DKL A;  2J7O A;  3B7Q A;  1XNR M;  1RU3 A;  1QQW A;  3NWL A;  4GC5 A;  3L28 A;  3MJ5 A;  4LJ5 A;  2HL7 A;  2O25 A;  4LJ6 A;  3GLF A;  4II7 A;  4M9Z A;  3T38 A;  1YSY A;  3T1Y M;  4AG5 A;  4RKU F;  2MGW A;  2LHC A;  4FW9 A;  4M9S A;  1MU5 A;  2LWX A;  1DGF A;  3L26 A;  2XZU A;  4CIS A;  1GAB A;  1IN6 A;  1Z59 A;  1NVM A;  4HLQ A;  2XEP A;  2KRK A;  3SAT A;  1N33 M;  2VF8 A;  2N35 A;  3KVW A;  1NHW C;  4IBE A;  3W67 A;  4CIZ A;  4PD2 A;  2R45 A;  3SMS A;  2DWN A;  2OQ4 A;  2CHQ A;  2L4E A;  3AL0 C;  2JUJ A;  1G3I A;  1IY1 A;  2G3Q A;  1HQC A;  5FTM A;  3FUT A;  3SHF A;  5E26 A;  1Q3B A;  4NRW A;  3HGI A;  2L6O A;  2CRU A;  2MJ5 B;  4R71 A;  3D8B A;  1Q39 A;  3A98 B;  3GLF E;  3UJN A;  4X64 M;  1OIP A;  3U61 B;  3R8F A;  3HJQ A;  3U6D A;  1HQY E;  2D7E A;  1XC8 A;  4BB9 A;  1GKI A;  5KQ8 A;  4X66 M;  3VK8 A;  3QAU A;  1MX0 A;  2KNV A;  2L7H A;  1DO2 A;  2RGO A;  3U6Q A;  3VK7 A;  4GHA A;  2OPF A;  4FCV A;  3VDP A;  4MB7 A;  2RRU A;  1OAO C;  1Y8G A;  1T6O A;  3DFZ A;  4GIP A;  4MGK E;  4LGY A;  3KSX A;  1NO1 A;  1WR1 B;  4NOO B;  1GL7 A;  1QDT A;  3AFH A;  3GLI B;  3FD9 A;  4LF8 M;  5C1B A;  4B08 A;  5GKN A;  1D0K A;  2LVP C;  4REZ A;  1K3W A;  5IWA M;  1SXJ D;  4F2L A;  4AKI A;  3QYE A;  3U5Z A;  2JY7 A;  4G6Z A;  4MGZ E;  3TWK A;  4AG6 A;  3V76 A;  3AKZ A;  1JQJ C;  3AV0 A;  1NNJ A;  2DAI A;  5EP4 A;  2VQF M;  1L2C A;  2DZN B;  1QUT A;  1PJI A;  1OFI A;  4YY3 M;  1TH2 A;  3E9S A;  4ANR A;  3U6P A;  3BXW A;  4Y28 F;  4I8O A;  4M0W A;  1G59 A;  3KW6 A;  2FH0 A;  1PJJ A;  1YUB A;  2EJS A;  2OOA A;  1XMO M;  2YNM D;  2KZU A;  2C99 A;  4IJE A;  4M9X A;  2V6Z M;  1FJG M;  4ITQ A;  1IBK M;  2CFO A;  5DFL A;  4DV5 M;  1CUK A;  3KS4 A;  3GRY A;  1IBM M;  2ZTD A;  4I5S A;  3CF6 E;  1OJL A;  1WIV A;  1TH4 A;  2R65 A;  3E21 A;  3FYC A;  2ZBK B;  4IBG A;  2WSE F;  1IBL M;  1HJP A;  3HHY A;  4MGY E;  2K0B X;  2QNJ A;  3GLF B;  2XLJ A;  4RNA A;  2K6B A;  4L15 A;  2QZ4 A;  4QHS A;  5IRE B;  1QYR A;  4JXJ A;  3I01 M;  1PJT A;  4Z6Y A;  4GIT A;  1TDH A;  2Y21 A;  2WZJ A;  4LJ7 A;  2DXI A;  5FTK A;  2CUZ A;  3CF0 A;  2UU9 M;  1NNU C;  1ZMV A;  4DUY M;  3HHZ A;  4OU7 A;  1IXS A;  2O5R A;  3SHG B;  5IT9 S;  1AUA A;  2JY6 B;  4NSR A;  2XF3 A;  3GLH A;  2F5O A;  3AJI B;  4GRI A;  2APL A;  5LMN M;  1R4G A;  4B3R M;  4LF5 M;  3TQS A;  4KHP M;  1Z5A A;  3C3E A;  3KOX E;  4FWG A;  4NXN M;  1C1K A;  1R2Y A;  2DAE A;  4MM3 B;  2GQF A;  3T15 A;  5ITX E;  5EXT A;  4WW0 A;  2KEB A;  2VF7 A;  3KOW E;  2BJV A;  3B9P A;  2QCU A;  4DV0 M;  4B3T M;  1XNQ M;  3GLG A;  1N78 A;  3HU2 A;  5FLX S;  2ZTC A;  4IBJ A;  3ZH9 B;  1L2B A;  3PNV A;  4LF9 M;  4GHL A;  1L2D A;  5EQT A;  4W5W A;  5EJC A;  3B7N A;  1NJG A;  3TPZ A;  4WUR A;  4D80 A;  2F5S A;  4D81 A;  4DR6 M;  1E94 E;  3I04 M;  3GLH E;  3LMM A;  4NL4 H;  1ZV1 A;  3RGP A;  4DR3 M;  4NSO B;  2EKK A;  1IM2 A;  3FUW A;  2LVA A;  3JR5 A;  5BR8 M;  4IIW A;  4I81 A;  1X37 A;  3NBI A;  1ZQ9 A;  3U5Z B;  3K1J A;  2AHM A;  3IEC A;  4JI5 M;  3U6L A;  2DI0 A;  4QOZ C;  5JI2 E;  4BBA A;  1SXJ E;  3AOE A;  3FKE A;  4IJF A;  4MGI E;  4GKJ M;  4CJ6 A;  3GRV A;  3KP1 E;  2I7P A;  1HNW M;  1YE9 A;  3GLG E;  1VDL A;  5KPT A;  4LJ9 A;  2DAK A;  1LV7 A;  3EIH A;  4D82 A;  5F3W A;  1GVN A;  2F5N A;  2LBC A;  3JAM S;  4DV1 M;  4XBO A;  1G8P A;  2Y20 A;  1TDZ A;  4JI8 M;  2R18 A;  1N77 A;  3HWS A;  1MJG M;  3A46 A;  3ILK A;  4NRV A;  1DGH A;  2JZ0 A;  3FUV A;  1Z5C A;  2KNZ A;  3FTD A;  2L09 A;  1LTM A;  4F1I A;  4OX9 M;  1SXJ C;  1QAO A;  3H4M A;  2XSZ A;  2XH9 A;  4WP2 A;  1C7Y A;  5FSW A;  2FOI C;  1DGB A;  3UMM A;  2Y0T A;  2L2D A;  2R44 A;  2UXD M;  3MMP A;  2R4E A;  1HNX M;  2ZAN A;  2LH0 A;  2HHH M;  4JI4 M;  3F92 A;  3KOZ E;  4JI2 M;  5ITY A;  2K47 A;  2HCB A;  1WGN A;  1J5E M;  1IN7 A;  2JXN A;  3GRR A;  1DGG A;  1WHC A;  1R5L A;  1WJ7 A;  2VQE M;  1QVR A;  3M0E A;  2QEN A;  1IXS B;  2V1C A;  1QAM A;  4IBI A;  2XZF A;  1FNN A;  2BWE A;  1VEG A;  3QYB A;  2R4J A;  2XFS A;  1OFH A;  3GLH B;  3LQR A;  1PRB A;  2G5G X;  2QP9 X;  4YHH M;  5LMU M;  3K8Z A;  5DYI A;  4GH9 A;  2UUC M;  1E9R A;  2DNA A;  3B7Z A;  3AOE C;  4G4N A;  3HY5 A;  3J7B A;  3NBX X;  1E9S A;  3SMP A;  2LVQ D;  1XB2 B;  3PXG A;  5C18 A;  1GJS A;  4R7G A;  4Q7J A;  4Z8X A;  2G8L A;  1OQY A;  1YLA A;  2DZL A;  4DUZ M;  3JR4 A;  1IN4 A;  1GLN A;  2R62 A;  3FE3 A;  1R7R A;  5KO3 A;  3LCU A;  3FTE A;  1IXZ A;  2J7N A;  3IG8 A;  2OOB A;  3ZQJ A;  3GLG B;  1SG9 A;  2EUC A;  4JI6 M;  4NC6 A;  1EE8 A;  3FUU A;  1HT2 E;  3KXE C;  4B7F A;  2KXE A;  1DV0 A;  2LTU A;  1NSF A;  4FWH A;  2OO9 A;  1NY5 A;  2JY5 A;  4KT0 F;  3U6S A;  2Z7J A;  2C96 A;  2JY8 A;  2GNO A;  3KSJ A;  3MHV C;  3RFW A;  3E46 A;  1PJQ A;  1XXH A;  4L8R C;  4JYA M;  3D8L A;  3GPU A;  5DYG A;  1TR8 A;  4JV5 M;  2R46 A;  3M6A A;  3I4V A;  4K0K M;  3KS8 A;  4X62 M;  5ITX A;  2Z8Y M;  2K9D A;  3PVS A;  3SAS A;  3L29 A;  4LY6 A;  1VG5 A;  4DV3 M;  4JI7 M;  1JR3 D;  3U6E A;  3U60 A;  1J7K A;  1ZAE A;  4IBF A;  2VDB B;  2C9O A;  2RKO A;  4GKK M;  2DHR A;  3K92 A;  1L1T A;  2V1U A;  4PDG A;  2HWJ A;  2BWB A;  3L2A A;  2DVW B;  4LCB A;  7CAT A;  5FTL A;  4AQY M;  1J09 A;  3J27 B;  3L27 A;  3LVV A;  2NQ8 C;  5ITQ A;  1XXH E;  4IBK A;  2X4A A;  2YR0 A;  1DGH B;  3LCV B;  5EP1 A;  1D0L A;  1TGU A;  5EXX A;  1L8Q A;  4FD2 A;  2JA2 A;  3LQQ A;  4G4Q A;  1NV8 A;  2C98 A;  2L4F A;  4LRT A;  1PJS A;  3MK6 A;  2QPA A;  5L8R F;  3SBJ A;  4AW4 A;  3C58 A;  4DR4 M;  1JB0 F;  1VDD A;  2D7G A;  3VKG A;  4P17 A;  2D7H A;  3RE8 A;  1TTE A;  3KP0 E;  1D0M A;  1IFY A;  1SXJ A;  3CTW B;  1I4W A;  3B74 A;  4RF0 A;  1VQ1 A;  8CAT A;  4OVZ A;  4AKG A;  2R0I A;  3TL4 X;  3U6M A;  3WHK A;  4NXM M;  1R2Z A;  3I4Y A;  3SAR A;  2VII A;  1IXR C;  2C9C A;  1S3S A;  3TE6 A;  3K9O A;  3T6P A;  2A5Y B;  2MH8 A;  4PCZ A;  1N36 M;  4LFC M;  4JN6 A;  5EXP A;  3UK6 A;  2JNH A;  3VLF B;  5EXS A;  4GC9 A;  3GP1 A;  1QZE A;  3GPP A;  1DO0 A;  2KW0 A;  3Q8G A;  3IG5 A;  2CV1 A;  1OIZ A;  3SFZ A;  3LVW A;  4CGY B;  3CF2 A;  3HX3 A;  4FCT A;  3THG A;  1E32 A;  5KQD A;  2Y0Q A;  2CHV A;  2ZAO A;  4LF4 M;  2QHO B;  4B7H A;  2J5Y A;  1NV9 A;  3E4R A;  3FYD A;  2XGN A;  1V33 A;  3A45 A;  3J7A S;  4P16 A;  2Z3X A;  4AI6 A;  1OKS A;  3A42 A;  1UFZ A;  4AZF A;  2WSF F;  2Q2E B;  4QHT A;  5JI3 E;  1T3T A;  2L7I A;  1NY6 A;  1Q02 A;  1N34 M;  5A2Q S;  3FTC A;  4HL4 A;  1XHB A;  4KOD A;  3W0L B;  3SAU A;  3SAW A;  2YFQ A;  2BJW A;  2ZM6 M; 
#chains in the Genus database with same CATH homology
 4M0D A;  4DV4 M;  2DWL A;  3TWL A;  5EP2 A;  4IBD A;  4LJ4 A;  3VKH A;  4MGH A;  4X65 M;  2H1R A;  3KOY E;  2CHG A;  3BOS A;  5ITU A;  1XXH B;  3QWL A;  1HNZ M;  1KFV A;  1G4A E;  4DV2 M;  1PM5 A;  2ERC A;  3HHX A;  3HJS A;  3PFI A;  3OTO M;  2F4V M;  4EIW A;  3U60 B;  1IN5 A;  3PNY A;  3GQ4 A;  1XMQ M;  4QNR A;  3W0F A;  4DR2 M;  1KYI A;  3DZD A;  2ZAM A;  3WHL A;  2QBY A;  4LF7 M;  2CE7 A;  2FFJ A;  1UM8 A;  1W5T A;  4DR1 M;  4IBB A;  4BLC A;  1D2N A;  4ZPX A;  4OW0 A;  2CV2 A;  3GPX A;  1IQP A;  4KO8 A;  3SYL A;  4LRS A;  2UXB M;  3DA1 A;  1G41 A;  2YQZ A;  3DOA A;  4B3M M;  3EIE A;  3R9X B;  5H37 D;  2FNA A;  1NHG C;  3HU1 A;  3AOG A;  3Q8X A;  4LZZ A;  2M60 A;  4R3D A;  3UZU A;  2KZS A;  2LNH C;  3GO8 A;  3J80 S;  1SXJ B;  3SYK A;  1Z6T A;  4OVZ B;  3VFD A;  2BNK A;  1QZM A;  4DV6 M;  4XGI A;  4G4R A;  2M5Z A;  2DWZ B;  4DV7 M;  2C5R A;  3KFU G;  5KPR A;  1QAQ A;  1L1Z A;  1IY2 A;  4LZJ A;  3L25 A;  2FE8 A;  4LG2 A;  2W82 A;  2Z4S A;  1KSF X;  4LJA A;  3GQ3 A;  4L4U A;  4FWD A;  1WXQ A;  4L78 A;  5IZ7 D;  4LFB M;  3HJ8 A;  3SC3 A;  3FTF A;  4JI0 M;  4QNM A;  3FUX A;  2Z4R A;  2KA6 B;  3HHW A;  2F5Q A;  4JI3 M;  1HT1 E;  2EO2 A;  3KDS E;  4KLN A;  4S12 A;  2KRU A;  4LF6 M;  2RGH A;  4TUW A;  5BPV A;  1IY0 A;  2EA0 A;  3U61 A;  3VDU A;  5E6J A;  1NJF A;  1QAN A;  3K2L A;  4L16 A;  4LGM A;  4LJ8 A;  3HU3 A;  3J2P B;  1TH3 A;  5FTN A;  4JI1 M;  1Z5B A;  1W5S A;  4GMQ A;  4QOS A;  4RF1 A;  2XSZ D;  1H6U A;  4CHT B;  3GLI A;  3J81 S;  1IN8 A;  2E5L M;  4A3V B;  3U6C A;  2CEA A;  4G4O A;  3HKP A;  2QBY B;  2UUB M;  3ZC7 B;  1Q3C A;  4PT5 A;  2DWM A;  4DR7 M;  3RGS A;  3UGJ A;  4AKH A;  1GL6 A;  2XFT A;  4FVM A;  4IBC A;  1N75 A;  2F5P A;  4B3S M;  3GQ5 A;  2LXE A;  3I51 A;  3M7G A;  1HR0 M;  1N32 M;  1R6B X;  5EP3 A;  2P5T A;  2UUA M;  2HKJ A;  3SAV A;  2UXC M;  2I7N A;  4FCW A;  3ZCB B;  5ITT A;  1K82 A;  2CV0 A;  2X49 A;  3U6O A;  3GPY A;  3T1H M;  1XWI A;  5DNY A;  2DZO B;  3TWM A;  1K3X A;  5ITR A;  2X8A A;  4B7G A;  5FTJ A;  4LFA M;  1ORY B;  4I4L A;  4PDI A;  1JR3 A;  1I94 M;  5KPZ A;  4MH0 E;  4DR5 M;  2J7O A;  1XNR M;  1QQW A;  3NWL A;  4GC5 A;  3L28 A;  3MJ5 A;  4LJ5 A;  2HL7 A;  4LJ6 A;  3GLF A;  4II7 A;  4M9Z A;  3T38 A;  1YSY A;  3T1Y M;  4AG5 A;  4FW9 A;  4M9S A;  1MU5 A;  2LWX A;  1DGF A;  3L26 A;  2XZU A;  4CIS A;  1IN6 A;  1Z59 A;  1NVM A;  4HLQ A;  2XEP A;  2KRK A;  3SAT A;  1N33 M;  3KVW A;  4IBE A;  1NHW C;  4PD2 A;  2DWN A;  2R45 A;  3SMS A;  2OQ4 A;  2CHQ A;  3AL0 C;  3SHF A;  1G3I A;  1IY1 A;  5FTM A;  1HQC A;  3FUT A;  5E26 A;  1Q3B A;  4NRW A;  3HGI A;  2L6O A;  3D8B A;  1Q39 A;  3A98 B;  3UJN A;  4X64 M;  3U61 B;  3R8F A;  3HJQ A;  3U6D A;  1HQY E;  2D7E A;  1XC8 A;  4BB9 A;  1GKI A;  5KQ8 A;  4X66 M;  3VK8 A;  3QAU A;  1MX0 A;  2L7H A;  1DO2 A;  2RGO A;  3U6Q A;  3VK7 A;  4GHA A;  2OPF A;  4FCV A;  3VDP A;  4MB7 A;  4GIP A;  3DFZ A;  4MGK E;  4LGY A;  3KSX A;  4NOO B;  1GL7 A;  3AFH A;  3GLI B;  4LF8 M;  3FD9 A;  5C1B A;  4B08 A;  5GKN A;  4REZ A;  1K3W A;  5IWA M;  1SXJ D;  4AKI A;  3U5Z A;  4G6Z A;  4MGZ E;  3TWK A;  4AG6 A;  3AKZ A;  1JQJ C;  3AV0 A;  1NNJ A;  1L2C A;  5EP4 A;  2VQF M;  2DZN B;  1PJI A;  1OFI A;  4YY3 M;  1TH2 A;  3E9S A;  3U6P A;  4I8O A;  4M0W A;  1G59 A;  3KW6 A;  1PJJ A;  1YUB A;  1XMO M;  2YNM D;  2KZU A;  2C99 A;  4IJE A;  4M9X A;  2V6Z M;  1FJG M;  4ITQ A;  1IBK M;  2CFO A;  4DV5 M;  3KS4 A;  3GRY A;  1IBM M;  4I5S A;  3CF6 E;  1OJL A;  1TH4 A;  2R65 A;  3FYC A;  2ZBK B;  4IBG A;  1IBL M;  3HHY A;  4MGY E;  3GLF B;  2XLJ A;  4RNA A;  4L15 A;  2QZ4 A;  4QHS A;  5IRE B;  1QYR A;  4JXJ A;  4Z6Y A;  4GIT A;  1TDH A;  2Y21 A;  4LJ7 A;  2DXI A;  5FTK A;  2CUZ A;  3CF0 A;  2UU9 M;  1NNU C;  4DUY M;  3HHZ A;  4OU7 A;  2O5R A;  3SHG B;  5IT9 S;  4NSR A;  2XF3 A;  3GLH A;  2F5O A;  3AJI B;  4GRI A;  5LMN M;  4B3R M;  4LF5 M;  3TQS A;  4KHP M;  1Z5A A;  3KOX E;  4FWG A;  4NXN M;  1C1K A;  1R2Y A;  4MM3 B;  3T15 A;  5ITX E;  5EXT A;  4WW0 A;  2KEB A;  3KOW E;  2BJV A;  3B9P A;  2QCU A;  2BJW A;  4DV0 M;  4B3T M;  3GLG A;  1XNQ M;  1N78 A;  3HU2 A;  5FLX S;  4GHL A;  4IBJ A;  3ZH9 B;  1L2B A;  3PNV A;  4LF9 M;  1L2D A;  5EQT A;  4W5W A;  5EJC A;  3TPZ A;  1NJG A;  4D80 A;  4WUR A;  2F5S A;  4DR6 M;  4D81 A;  1E94 E;  3LMM A;  4NL4 H;  3RGP A;  4NSO B;  1IM2 A;  3FUW A;  3JR5 A;  5BR8 M;  4IIW A;  4I81 A;  1X37 A;  3NBI A;  1ZQ9 A;  3U5Z B;  3K1J A;  2AHM A;  4JI5 M;  3U6L A;  4QOZ C;  5JI2 E;  4BBA A;  1SXJ E;  3AOE A;  3FKE A;  4IJF A;  4MGI E;  4GKJ M;  3GRV A;  3KP1 E;  2I7P A;  1HNW M;  1YE9 A;  5KPT A;  4LJ9 A;  1LV7 A;  3EIH A;  4D82 A;  5F3W A;  1GVN A;  2F5N A;  3JAM S;  4DV1 M;  4XBO A;  1G8P A;  2Y20 A;  1TDZ A;  4JI8 M;  2R18 A;  1N77 A;  3HWS A;  3A46 A;  3ILK A;  4NRV A;  1DGH A;  3FUV A;  1Z5C A;  3FTD A;  4OX9 M;  2L09 A;  1SXJ C;  1QAO A;  3H4M A;  2XSZ A;  2XH9 A;  5FSW A;  2FOI C;  1DGB A;  3UMM A;  2Y0T A;  2UXD M;  2R4E A;  1HNX M;  2ZAN A;  2LH0 A;  2HHH M;  4JI4 M;  3KOZ E;  4JI2 M;  5ITY A;  2K47 A;  2HCB A;  1J5E M;  1IN7 A;  3GRR A;  1DGG A;  2VQE M;  1QVR A;  3M0E A;  2QEN A;  1IXS B;  2V1C A;  1QAM A;  4IBI A;  2XZF A;  1FNN A;  2R4J A;  2XFS A;  1OFH A;  3GLH B;  3LQR A;  5LMU M;  2G5G X;  2QP9 X;  4YHH M;  3K8Z A;  5DYI A;  4GH9 A;  2UUC M;  1E9R A;  3AOE C;  4G4N A;  3J7B A;  1E9S A;  3SMP A;  3PXG A;  5C18 A;  4R7G A;  4Z8X A;  2G8L A;  4DUZ M;  3JR4 A;  1IN4 A;  1GLN A;  2R62 A;  5KO3 A;  1R7R A;  3FTE A;  1IXZ A;  2J7N A;  3IG8 A;  3GLG B;  2EUC A;  4JI6 M;  1EE8 A;  3FUU A;  1HT2 E;  3KXE C;  4B7F A;  2KXE A;  1NSF A;  4FWH A;  1NY5 A;  3U6S A;  2Z7J A;  2C96 A;  3KSJ A;  3MHV C;  3RFW A;  1XXH A;  4L8R C;  4JYA M;  3D8L A;  3GPU A;  5DYG A;  4JV5 M;  2R46 A;  3M6A A;  3I4V A;  4K0K M;  3KS8 A;  4X62 M;  5ITX A;  3SAS A;  3PVS A;  3L29 A;  4LY6 A;  4DV3 M;  4JI7 M;  1JR3 D;  3U6E A;  3U60 A;  1J7K A;  1ZAE A;  4IBF A;  2C9O A;  2RKO A;  4GKK M;  2DHR A;  3K92 A;  1L1T A;  2V1U A;  4PDG A;  5FTL A;  3L2A A;  2DVW B;  4LCB A;  7CAT A;  4AQY M;  1J09 A;  3J27 B;  3L27 A;  3LVV A;  2NQ8 C;  5ITQ A;  4IBK A;  2X4A A;  2YR0 A;  1DGH B;  5EP1 A;  1TGU A;  5EXX A;  1L8Q A;  4FD2 A;  2JA2 A;  3LQQ A;  4G4Q A;  2C98 A;  3SBJ A;  4LRT A;  3MK6 A;  2QPA A;  4DR4 M;  4AW4 A;  3C58 A;  1VDD A;  2D7G A;  3VKG A;  2D7H A;  3RE8 A;  3KP0 E;  1SXJ A;  3CTW B;  1I4W A;  4RF0 A;  8CAT A;  4OVZ A;  4AKG A;  3TL4 X;  3U6M A;  3WHK A;  4NXM M;  1R2Z A;  3I4Y A;  3SAR A;  2VII A;  1IXR C;  2C9C A;  1S3S A;  3TE6 A;  2A5Y B;  4PCZ A;  1N36 M;  4LFC M;  4JN6 A;  5EXP A;  3UK6 A;  3VLF B;  5EXS A;  4GC9 A;  3GP1 A;  3GPP A;  1DO0 A;  2KW0 A;  2CV1 A;  3IG5 A;  3SFZ A;  3LVW A;  4CGY B;  3CF2 A;  3THG A;  4FCT A;  5KQD A;  1E32 A;  4DR3 M;  2Y0Q A;  2CHV A;  2ZAO A;  4LF4 M;  4B7H A;  3E4R A;  3FYD A;  2XGN A;  3A45 A;  3J7A S;  4P16 A;  2Z3X A;  4AI6 A;  3A42 A;  4AZF A;  5JI3 E;  2Q2E B;  4QHT A;  1T3T A;  2L7I A;  1NY6 A;  1N34 M;  5A2Q S;  3FTC A;  4HL4 A;  1XHB A;  4KOD A;  3W0L B;  3SAU A;  3SAW A;  2YFQ A;  3GRU A;  2ZM6 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...