4TUWA

Drosophila stem-loop binding protein complexed with histone mrna stem-loop, phospho mimic of tpnk and c-terminal region
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
71
Chain Sequence
SSYTEADPAILSRRQKQIDYGKNTAAYERYVEMVPRTRDHPREPNKYGKYSRRAFDGLVKIWRKSLHIYDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein/rna
molecule keywords Histone RNA hairpin-binding protein
total genus 22
structure length 71
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4tuwA00
4QOZC 4L8RC 4TUWA
chains in the Genus database with same CATH superfamily
1TDZA 3FRHA 4M9ZA 1IXZA 2CV1A 3HZJA 2RKOA 2Y0QA 5EP1A 3U6SA 2ZTCA 4GIPA 1ZAEA 4JN6A 3T6PA 4AZFA 5KO3A 3U5ZB 4FD2A 3AKZA 3GQ3A 2ZAOA 1XNQM 1CUKA 1V92A 1NJGA 3VDPA 2X8AA 4IBCA 1NNUC 2XZFA 1PGYA 1QUSA 3FTFA 1XXHB 5FTMA 1MU5A 1RU3A 4LJAA 5GKNA 4B08A 3RGSA 2XLJA 4Z8XA 3SAVA 3BOSA 4P16A 3SFZA 1IN5A 2L4EA 5A2QS 3GLGB 3GRRA 4D81A 2KHHA 4G4NA 2FE8A 3PNVA 3THGA 2DWNA 4OVZA 1T6OA 2BJWA 3GLIE 1TH2A 2GQFA 3SBJA 2A5YB 1D0MA 2Z7JA 2E5LM 3U60A 3ILKA 1MX0A 4DR6M 3A98B 2JZ0A 2VQFM 3FUVA 1IM2A 1XXHA 3I51A 5ITTA 2CUZA 2KW0A 2OOAA 1V33A 5IREB 1VDDA 4LJ5A 4B7HA 5H37D 1QAQA 3OTOM 1N77A 3E46A 1N75A 3L25A 4AKIA 1V34A 1IBKM 1HT1E 2XFSA 1DGGA 2DWMA 1VEKA 2M5ZA 1Y8GA 2MROB 2I7PA 3HJ8A 3ZH9B 1SXJC 2OOBA 3U6PA 1IN8A 2MR9A 2EKFA 1XHBA 2G8LA 1ZMUA 2R46A 4RF0A 1AIPC 1VEGA 5EP2A 1T3TA 1JR3D 2VF7A 2CHVA 3FUXA 1P3QQ 1ZV1A 3HU1A 3B74A 4IBKA 1Q3BA 2WSEF 3T15A 1QYRA 3DOAA 2KRKA 5EXTA 1L2DA 4BBAA 1N33M 2UXBM 2MJ5B 3KS4A 2L7HA 3KSJA 4CHTB 4RKUF 5ITXE 4QHTA 3VKGA 2K6BA 4IIWA 1IN6A 2OPFA 1SXJD 4NSRA 4B3RM 4A3VB 4K0KM 2WSFF 4BB9A 4GRIA 1OFIA 4LF5M 4AKHA 4X65M 1L1ZA 3K9OA 1GABA 2HHHM 3CF2A 3U61A 1WGLA 2HCBA 4KHPM 3A45A 4GKJM 5EXXA 3WHLA 1SG9A 5C1BA 5BPVA 1PJJA 3VDUA 4GC5A 3J80S 2V6ZM 1OIZA 2G5GX 3GRYA 2DZNB 1G3IA 3GQ4A 3SYKA 2CP8A 2LBCA 5E6JA 3J27B 1IXSA 2QNJA 2DAMA 2DKLA 3SASA 4Q7JA 1HNXM 2I7NA 3EIHA 1GVNA 2D7HA 3LMMA 3HU2A 4I81A 2QENA 4FWGA 3U60B 3HHYA 1HQCA 4QHSA 1J7KA 1AUAA 4R7GA 5JI3E 3M6AA 2BWBA 2L4FA 4FW9A 4ANRA 1TTEA 4X64M 3B9PA 1WGNA 4GH9A 1XB2B 2K0BX 1OJLA 2QHOB 4AG6A 4JI1M 4LG2A 4GHLA 3R8FA 3H4MA 1ZMVA 1VEJA 1J5EM 2O25A 3QYEA 4LGMA 4IJEA 4DV7M 2M60A 3C3DA 3UMMA 1UM8A 2C9CA 2Z4SA 5KPTA 2JWSA 1G8PA 2MGWA 3KOZE 3C9PA 4LF7M 1OKSA 1Z59A 2EO2A 3VLFB 3GPUA 3GLFA 4LF9M 1GJTA 4IJFA 3FTCA 4QOZC 3GLGA 2Y0TA 2DWLA 2QP9X 3HKPA 2LHGA 2K9DA 4LFCM 2L09A 2YQZA 5C18A 1XMQM 3FUTA 8CATA 2CWBA 3HJQA 4W5WA 2L7IA 3CGWA 4S12A 4LF6M 4OU7A 1HNWM 2LVPC 3LVWA 3D8LA 2LWXA 2H5XA 4WP2A 4AQYM 2K47A 5L8RF 4B3TM 3U6CA 3T1HM 2ZANA 1IY2A 1IN4A 3LQRA 2LH0A 3SHGB 4REZA 1SXJA 4JI3M 1GL7A 3FYDA 3VFDA 3SYLA 4D80A 2QBYB 3HJSA 4JI6M 1EE8A 1JR3E 1R2ZA 4IBFA 3AL0C 4JI0M 4AKGA 1G4AE 2X4AA 3U6EA 3FRIA 3B7QA 3SAUA 5FTNA 3PFIA 3KOYE 3LW5F 3J7BA 4OX9M 1XWIA 1FNNA 4WW0A 1N32M 4GITA 5EXPA 1Q39A 4B3MM 4GMQA 1FJGM 4MB7A 3GLHB 2DI0A 4LGYA 2CFOA 4MGHA 4DV0M 3LCVB 4MM3B 3UJNA 1OIPA 2QBYA 1GLNA 3KOXE 3Q8XA 4I5SA 2APLA 3FTEA 1WXQA 1N36M 4GEWA 3RFWA 2CV0A 4YHHM 4IBJA 4LJ7A 5FTKA 3I4YA 1BVSA 1TDHA 3B89A 1QDRA 3GLHE 4HEOA 1QANA 3EIEA 2R62A 2QZ4A 1W5TA 1ZMWA 4M0WA 1WIVA 5FLXS 1GO5A 4EIWA 1YSYA 4JI7M 1PJSA 3IG5A 4QOSA 1EFUB 3KW6A 3CF6E 3TL4X 2KEBA 2EJSA 4DR7M 3J81S 2DVWB 4DV3M 3K8ZA 4PDGA 3SAWA 4KODA 1NY5A 3FE3A 4NL4H 4XBOA 5DYGA 3U5ZA 1XMOM 1NVMA 4Z6YA 5BR8M 3JR5A 4L78A 1GJSA 3TWKA 4ITQA 5EP4A 3V76A 3K92A 3W0FA 2ERCA 4F2LA 4PD2A 4M0DA 3TQSA 3L2AA 4XK8F 3W0LB 1TR8A 5LMNM 2FH0A 1QAMA 2CV2A 2LNHC 1QQWA 1PJIA 2UUCM 1IXRC 2OQ4A 4DUYM 5IZ7D 2CHGA 1NV8A 3FYCA 5ITXA 3J7AS 3HHXA 2QSFX 1IQPA 4MGIE 3HX3A 1X37A 3Q8GA 1XC8A 2KRUA 2R45A 2JZ1A 3QWLA 2DAGA 3DFZA 2LVQD 2EA0A 4JI5M 2Y21A 1D2NA 1Z5AA 2C98A 2JY8A 2P5TA 4JI2M 4JI4M 4LF4M 4GKKM 5FTLA 3RE8A 4B3SM 1HR0M 2DZOB 3M7GA 3M0EA 1QAOA 4LJ6A 1DO2A 4LRSA 3KXEC 4NSOB 1NV9A 2QCUA 5FTJA 4DV1M 4CIZA 1OAIA 2KA6B 3HHZA 1E32A 2JUJA 2UU9M 1L2BA 1R5LA 1I94M 4BLCA 2XZUA 3HWSA 1DV0A 1NO1A 1TH4A 1PM5A 2DHRA 3KP1E 2DENA 1Z6TA 3BBZA 4KLNA 3GO8A 2J7OA 3GLIA 4PT5A 1DGFA 4MGKE 3AJIB 2JA2A 4JV5M 3RGPA 2B3TA 3CF0A 2L6OA 3GRVA 1R4GA 4KT0F 1YUBA 1XXHE 2JNHA 2FNAA 3NBIA 2BWEA 3E9SA 1OAOC 3ZQJA 3U6QA 1K3XA 1JQJC 1Z5CA 2CE7A 4MGZE 2ZAMA 3FUUA 2VQEM 2LHCA 2DWZB 1XNRM 1C1KA 3AV0A 4LJ4A 2RGHA 3LCUA 4ZPXA 1GKIA 2VF8A 1D0LA 4LJ9A 3QYBA 3FD9A 4G4RA 1L8QA 2O01F 1QDTA 2ZTDA 1G59A 3HGIA 3I01M 5FSWA 2XEPA 1K3WA 1GL6A 2CEAA 3SHFA 1IN7A 5ITYA 4G4QA 4AW4A 3IHPA 1QVRA 3NWLA 2LXEA 1DGBA 5DYIA 1OFHA 4GC9A 1WJ7A 3H4JA 3K9PA 3L28A 2KZSA 1DGHA 2XSZD 5ITRA 2Z8YM 3C3EA 4LFAM 1VG5A 2DAEA 4DV6M 4DR1M 3A42A 3GQ5A 3GLFB 4FWHA 1R7RA 1QUTA 4HLQA 4MGYE 3KOWE 2X49A 4Y28F 3ZC7B 4L4UA 2F5PA 2UUAM 1Q02A 3C58A 2WZJA 1DO0A 2QQ8A 1L2CA 4M9XA 7CATA 4IBEA 1C7YA 4PDIA 2HAKA 2Y20A 2FFJA 4LZJA 3VKHA 2J5YA 2BJVA 3K1JA 3KS8A 4IBGA 3SATA 1A5TA 2OO9A 1E9RA 3SMSA 4FVMA 1NHWC 2GNOA 2J7NA 2JY5A 3MHVC 4DUZM 2XF3A 2F5NA 2MH8A 2ZBKB 3WHKA 4X66M 4NOOB 2JP7A 4NRWA 1IY1A 1T43A 3B7ZA 4I4LA 3DA1A 2VIIA 3HY5A 3KDSE 2F5SA 3KSXA 2YFQA 1NSFA 3PNYA 1PJTA 2R65A 4LRTA 1E9SA 4HL4A 2KNZA 4FCVA 1OQYA 4II7A 3SMPA 2D7GA 2F5OA 4DV2M 4UN2B 4DR4M 1Z5BA 4JYAM 1J09A 1HQYE 4QNRA 3GPXA 4LCBA 2Z3XA 1YE9A 5EQTA 3UK6A 1D0KA 2KXEA 1R2YA 4B7FA 5LMUM 1H6UA 1KSFX 1HT2E 4OW0A 4FWDA 4F1IA 4YY3M 1EIJA 2XGNA 4L16A 1ORYB 2H1RA 2C9OA 2V1CA 3PVSA 5F3WA 3NBXX 3ZCBB 4LFBM 2LTUA 2XH9A 3DZDA 2HL7A 4IBBA 3U6MA 2R6FA 1NHGC 1HNZM 4L15A 1VDLA 1PRBA 1Q3CA 4CJ6A 3TPZA 3GPPA 3B7NA 2JXNA 2HKJA 2LVAA 3J2PB 5EJCA 1MN3A 1L1TA 2FOIC 2ZM6M 1R6BX 2UXCM 3AOGA 3CTWB 3SARA 4DR5M 2JY7A 4LJ8A 4RF1A 5EXSA 4DR2M 3U61B 2DHYA 3E4RA 1NNJA 2YR0A 1LV7A 1LTMA 2Q2EB 1MJGM 1SXJE 4WURA 3VK7A 3FUWA 3D8BA 2L2DA 4NC6A 5JI2E 2EUCA 3BXWA 1K82A 4JI8M 1WR1B 4LY6A 3MMPA 3SC3A 1QZEA 1WHCA 1ZQ9A 1TGUA 2DZLA 2KDLA 2RRUA 2Z4RA 1IBLM 3I4VA 4NXMM 1KYIA 3JR4A 2XSZA 1TF0B 1W5SA 4I8OA 4NXNM 3VK8A 4L8RC 3GLIB 3U6LA 4OVZB 3W68A 2CRUA 1JR3A 2R0IA 4DR3M 2DNAA 3UGJA 4PCZA 4DV4M 4AG5A 2KZUA 1PJQA 2QPAA 3AOEA 2C5RA 4CISA 5DFLA 1HJPA 2RGOA 4KO8A 2KNAA 3IECA 1SXJB 2R18A 2JY6B 2F4VM 2DAKA 3QAUA 3LQQA 3TE6A 3MJ5A 3UZUA 4GHAA 3W67A 2DXIA 3L29A 4X62M 2N35A 1JB0F 3IG8A 3GPYA 4IBDA 3GRUA 5IWAM 3U6DA 5DNYA 1YLAA 4LF8M 3KFUG 4IBIA 4JXJA 1KFVA 1IBMM 3T38A 3TWLA 2D7EA 4G3OA 5IT9S 2DAIA 4AI6A 2LVNC 3AOEC 4LZZA 3KP0E 1VQ1A 1QZMA 4R3DA 3GLHA 1IXSB 1DGHB 2G3QA 5ITQA 4FCTA 5E26A 2R4EA 4L6V6 4QNMA 3T1YM 4MH0E 5ITUA 2C96A 1S3SA 3JAMS 3HU3A 4NRVA 5KPRA 2V1UA 3LVVA 2YNMD 2R44A 5EP3A 3MK6A 4R71A 4G6ZA 5KPZA 1NJFA 4P17A 3GP1A 3A46A 2AHMA 5KQDA 1TH3A 2C99A 2LVOC 3I04M 3KVWA 2UUBM 1G41A 2BNKA 3HHWA 3L27A 2F5QA 3K2LA 4DV5M 2O5RA 3FKEA 1E94E 3FTDA 2HWJA 4TUWA 5KQ8A 2R4JA 2FS1A 4M9SA 3R9XB 3F92A 2W82A 3E21A 4XGIA 1IY0A 3GLFE 3U6OA 1N78A 2EKKA 2WSCF 2CHQA 1F4IA 4FCWA 2KNVA 4CGYB 1UFZA 1NY6A 3GLGE 2NQ8C 4DBGB 2VDBB 1IFYA 1I4WA 4D82A 4RNAA 3PXGA 3TWMA 3L26A 4G4OA 2XFTA 2UXDM 1OTRA 1G71A 4B7GA 1N34M 3AFHA
chains in the Genus database with same CATH topology
1TDZA 4M9ZA 1IXZA 2CV1A 2RKOA 2Y0QA 5EP1A 3U6SA 4GIPA 1ZAEA 3U5ZB 4AZFA 5KO3A 4FD2A 3AKZA 3GQ3A 2ZAOA 1XNQM 1NJGA 3VDPA 2X8AA 4IBCA 1NNUC 2XZFA 3FTFA 1XXHB 5FTMA 1MU5A 4LJAA 4B08A 5GKNA 3RGSA 2XLJA 4Z8XA 3SAVA 3BOSA 4P16A 3SFZA 1IN5A 5A2QS 3GLGB 3GRRA 4D81A 4G4NA 2FE8A 3PNVA 3THGA 2DWNA 4OVZA 2BJWA 1TH2A 3SBJA 2A5YB 2Z7JA 2E5LM 3U60A 3ILKA 1MX0A 4DR6M 3A98B 2VQFM 3FUVA 1IM2A 1XXHA 3I51A 5ITTA 2CUZA 2KW0A 5IREB 1VDDA 4LJ5A 4B7HA 5H37D 1QAQA 3OTOM 1N77A 3L25A 1N75A 4AKIA 1IBKM 1HT1E 2XFSA 1DGGA 2DWMA 2M5ZA 2I7PA 3HJ8A 3ZH9B 1SXJC 3U6PA 1IN8A 1XHBA 2G8LA 2R46A 4RF0A 5EP2A 1T3TA 1JR3D 3HU1A 2CHVA 3FUXA 4JN6A 3T15A 4IBKA 4TUWA 1Q3BA 1L2DA 1N33M 1QYRA 3DOAA 2KRKA 5EXTA 2UXBM 4BBAA 4AI6A 3KS4A 2L7HA 3KSJA 4CHTB 5ITXE 4QHTA 3VKGA 4IIWA 2OPFA 1IN6A 1SXJD 4NSRA 4B3RM 4A3VB 4K0KM 4BB9A 4GRIA 1OFIA 4LF5M 4AKHA 4X65M 1L1ZA 2HHHM 3CF2A 3U61A 4KHPM 2HCBA 3A45A 4GKJM 5EXXA 3WHLA 5C1BA 5BPVA 1PJJA 3VDUA 4GC5A 3J80S 2V6ZM 2G5GX 3GRYA 2DZNB 1G3IA 3GQ4A 3SYKA 5E6JA 3J27B 3SASA 1HNXM 2I7NA 3EIHA 1GVNA 2D7HA 3LMMA 3HU2A 4I81A 2QENA 4FWGA 3U60B 3HHYA 1HQCA 4QHSA 1J7KA 4R7GA 5JI3E 3M6AA 4FW9A 4X64M 3B9PA 4GH9A 4AG6A 1OJLA 4JI1M 4LG2A 4GHLA 3R8FA 3H4MA 1J5EM 4LGMA 4IJEA 4DV7M 2M60A 3UMMA 1UM8A 2C9CA 2Z4SA 5KPTA 1G8PA 3KOZE 4LF7M 1Z59A 2EO2A 3VLFB 3GLFA 3GPUA 4LF9M 4IJFA 3FTCA 4QOZC 3GLGA 2Y0TA 2QP9X 3HKPA 4LFCM 2L09A 2YQZA 5C18A 1XMQM 3FUTA 8CATA 3HJQA 4W5WA 2L7IA 4S12A 4LF6M 4OU7A 1HNWM 4AQYM 3LVWA 3D8LA 2LWXA 2K47A 4B3TM 3U6CA 3T1HM 2ZANA 1IY2A 1IN4A 3LQRA 2LH0A 3SHGB 4REZA 1SXJA 4JI3M 1GL7A 3FYDA 3VFDA 3SYLA 4D80A 2QBYB 3HJSA 4JI6M 1EE8A 1R2ZA 4IBFA 3AL0C 4JI0M 4AKGA 1G4AE 2X4AA 3U6EA 3SAUA 5FTNA 3PFIA 3KOYE 3J7BA 4OX9M 1XWIA 1FNNA 4WW0A 1N32M 4GITA 5EXPA 1Q39A 4B3MM 4GMQA 1FJGM 4MB7A 3GLHB 4LGYA 2CFOA 4MGHA 4DV0M 4MM3B 2QBYA 3UJNA 1GLNA 3KOXE 3Q8XA 4I5SA 3FTEA 1WXQA 1N36M 3RFWA 2CV0A 4YHHM 4IBJA 4LJ7A 5FTKA 3I4YA 1TDHA 2DWLA 4PDIA 1QANA 3EIEA 2R62A 2QZ4A 1W5TA 4M0WA 5FLXS 4EIWA 1YSYA 4JI7M 4QOSA 3IG5A 3KW6A 3CF6E 3TL4X 2KEBA 4DR7M 3J81S 2DVWB 4DV3M 3K8ZA 4PDGA 3SAWA 4KODA 1NY5A 4NL4H 4XBOA 5DYGA 3U5ZA 1XMOM 1NVMA 4Z6YA 5BR8M 3JR5A 4L78A 3TWKA 4ITQA 5EP4A 3W0FA 3K92A 2ERCA 4PD2A 4M0DA 3TQSA 3L2AA 3W0LB 5LMNM 1QAMA 2CV2A 2LNHC 1QQWA 1PJIA 2UUCM 1IXRC 2OQ4A 4DUYM 5IZ7D 2CHGA 3FYCA 5ITXA 3J7AS 3HHXA 1IQPA 4MGIE 1X37A 1XC8A 2KRUA 2R45A 3QWLA 3DFZA 2EA0A 4JI5M 2Y21A 1D2NA 1Z5AA 2C98A 2P5TA 4JI2M 4JI4M 4LF4M 4GKKM 5FTLA 3RE8A 4B3SM 1HR0M 2DZOB 3M7GA 3M0EA 1QAOA 4LJ6A 1DO2A 4LRSA 3KXEC 4NSOB 2QCUA 5FTJA 4DV1M 2KA6B 3HHZA 1E32A 2UU9M 1L2BA 1I94M 4BLCA 2XZUA 3HWSA 1TH4A 1PM5A 2DHRA 3KP1E 1Z6TA 4KLNA 3GO8A 2J7OA 3GLIA 4PT5A 1DGFA 4MGKE 3AJIB 2JA2A 4JV5M 3RGPA 3CF0A 2L6OA 3GRVA 1YUBA 2FNAA 3NBIA 1K3XA 3E9SA 3U6QA 1JQJC 1Z5CA 2CE7A 4MGZE 2ZAMA 3FUUA 2VQEM 2DWZB 1XNRM 1C1KA 3AV0A 4LJ4A 2RGHA 4ZPXA 1GKIA 4LJ9A 3FD9A 4G4RA 1L8QA 1G59A 3HGIA 5FSWA 2XEPA 1K3WA 1GL6A 2CEAA 3SHFA 1IN7A 5ITYA 4G4QA 4AW4A 1QVRA 3NWLA 2LXEA 1DGBA 5DYIA 1OFHA 4GC9A 3L28A 2KZSA 1DGHA 2XSZD 5ITRA 4LFAM 4DR1M 4DV6M 3A42A 3GQ5A 3GLFB 4FWHA 1R7RA 4HLQA 4MGYE 3KOWE 2X49A 3ZC7B 4L4UA 2F5PA 2UUAM 3C58A 1DO0A 1L2CA 4M9XA 7CATA 4IBEA 2Y20A 3VKHA 2FFJA 4LZJA 3K1JA 2BJVA 3KS8A 4IBGA 3SATA 1E9RA 3SMSA 4FVMA 1NHWC 2J7NA 3MHVC 4DUZM 2XF3A 2F5NA 2ZBKB 3WHKA 4X66M 4NOOB 4NRWA 1IY1A 4I4LA 3DA1A 2VIIA 3KDSE 2F5SA 3KSXA 2YFQA 1NSFA 3PNYA 2R65A 4LRTA 1E9SA 4HL4A 4FCVA 3SMPA 4II7A 2D7GA 2F5OA 4DV2M 4JYAM 4DR4M 1Z5BA 1J09A 1HQYE 4QNRA 3GPXA 4LCBA 2Z3XA 1YE9A 5EQTA 3UK6A 2KXEA 1R2YA 4B7FA 5LMUM 1H6UA 1KSFX 1HT2E 4OW0A 4FWDA 4YY3M 2XGNA 4L16A 1ORYB 2H1RA 2C9OA 2V1CA 3PVSA 5F3WA 3ZCBB 4LFBM 2XH9A 3DZDA 2HL7A 4IBBA 3U6MA 1NHGC 1HNZM 4L15A 1Q3CA 3TPZA 3GPPA 2HKJA 3J2PB 5EJCA 1L1TA 2FOIC 2ZM6M 1R6BX 2UXCM 3AOGA 3CTWB 3SARA 4DR5M 4LJ8A 4RF1A 5EXSA 4DR2M 3U61B 3E4RA 1NNJA 2YR0A 1LV7A 2Q2EB 4WURA 1SXJE 3VK7A 3FUWA 3D8BA 5JI2E 2EUCA 1K82A 4JI8M 4LY6A 3SC3A 1ZQ9A 4NXMM 1TGUA 2Z4RA 1IBLM 3I4VA 1KYIA 3JR4A 2XSZA 1W5SA 4L8RC 4I8OA 4NXNM 3VK8A 3GLIB 3U6LA 4OVZB 1JR3A 4DR3M 3UGJA 4PCZA 4DV4M 4AG5A 2KZUA 2QPAA 2C5RA 3AOEA 4CISA 2RGOA 4KO8A 1SXJB 2R18A 2F4VM 3QAUA 3LQQA 3TE6A 3MJ5A 3UZUA 4GHAA 2DXIA 3L29A 4X62M 3IG8A 3GPYA 4IBDA 3GRUA 5IWAM 3U6DA 5DNYA 4LF8M 3KFUG 4IBIA 4JXJA 1KFVA 1IBMM 3T38A 3TWLA 2D7EA 5IT9S 3AOEC 4LZZA 3KP0E 4R3DA 1QZMA 3GLHA 1IXSB 1DGHB 5ITQA 4FCTA 5E26A 2R4EA 4QNMA 3T1YM 4MH0E 5ITUA 2C96A 1S3SA 3JAMS 3HU3A 4NRVA 5KPRA 2V1UA 3LVVA 2YNMD 5EP3A 3MK6A 4G6ZA 5KPZA 1NJFA 3GP1A 3A46A 2AHMA 5KQDA 1TH3A 2C99A 3KVWA 2UUBM 1G41A 2BNKA 3HHWA 3L27A 2F5QA 3K2LA 4DV5M 2O5RA 3FKEA 1E94E 3FTDA 5KQ8A 2R4JA 4M9SA 3R9XB 2W82A 4XGIA 1IY0A 3U6OA 1N78A 2CHQA 4FCWA 4CGYB 1NY6A 2NQ8C 1I4WA 4D82A 4RNAA 3PXGA 3TWMA 3L26A 4G4OA 2XFTA 2UXDM 4B7GA 1N34M 3AFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QOZ C;  4L8R C;  4TUW A; 
#chains in the Genus database with same CATH topology
 1TDZ A;  3FRH A;  4M9Z A;  1IXZ A;  2CV1 A;  3HZJ A;  2RKO A;  2Y0Q A;  5EP1 A;  3U6S A;  2ZTC A;  4GIP A;  1ZAE A;  4JN6 A;  3T6P A;  4AZF A;  5KO3 A;  3U5Z B;  4FD2 A;  3AKZ A;  3GQ3 A;  2ZAO A;  1XNQ M;  1CUK A;  1V92 A;  1NJG A;  3VDP A;  2X8A A;  4IBC A;  1NNU C;  2XZF A;  1PGY A;  1QUS A;  3FTF A;  1XXH B;  5FTM A;  1MU5 A;  1RU3 A;  4LJA A;  5GKN A;  4B08 A;  3RGS A;  2XLJ A;  4Z8X A;  3SAV A;  3BOS A;  4P16 A;  3SFZ A;  1IN5 A;  2L4E A;  5A2Q S;  3GLG B;  3GRR A;  4D81 A;  2KHH A;  4G4N A;  2FE8 A;  3PNV A;  3THG A;  2DWN A;  4OVZ A;  1T6O A;  2BJW A;  3GLI E;  1TH2 A;  2GQF A;  3SBJ A;  2A5Y B;  1D0M A;  2Z7J A;  2E5L M;  3U60 A;  3ILK A;  1MX0 A;  4DR6 M;  3A98 B;  2JZ0 A;  2VQF M;  3FUV A;  1IM2 A;  1XXH A;  3I51 A;  5ITT A;  2CUZ A;  2KW0 A;  2OOA A;  1V33 A;  5IRE B;  1VDD A;  4LJ5 A;  4B7H A;  5H37 D;  1QAQ A;  3OTO M;  1N77 A;  3E46 A;  1N75 A;  3L25 A;  4AKI A;  1V34 A;  1IBK M;  1HT1 E;  2XFS A;  1DGG A;  2DWM A;  1VEK A;  2M5Z A;  1Y8G A;  2MRO B;  2I7P A;  3HJ8 A;  3ZH9 B;  1SXJ C;  2OOB A;  3U6P A;  1IN8 A;  2MR9 A;  2EKF A;  1XHB A;  2G8L A;  1ZMU A;  2R46 A;  4RF0 A;  1AIP C;  1VEG A;  5EP2 A;  1T3T A;  1JR3 D;  2VF7 A;  2CHV A;  3FUX A;  1P3Q Q;  1ZV1 A;  3HU1 A;  3B74 A;  4IBK A;  1Q3B A;  2WSE F;  3T15 A;  1QYR A;  3DOA A;  2KRK A;  5EXT A;  1L2D A;  4BBA A;  1N33 M;  2UXB M;  2MJ5 B;  3KS4 A;  2L7H A;  3KSJ A;  4CHT B;  4RKU F;  5ITX E;  4QHT A;  3VKG A;  2K6B A;  4IIW A;  1IN6 A;  2OPF A;  1SXJ D;  4NSR A;  4B3R M;  4A3V B;  4K0K M;  2WSF F;  4BB9 A;  4GRI A;  1OFI A;  4LF5 M;  4AKH A;  4X65 M;  1L1Z A;  3K9O A;  1GAB A;  2HHH M;  3CF2 A;  3U61 A;  1WGL A;  2HCB A;  4KHP M;  3A45 A;  4GKJ M;  5EXX A;  3WHL A;  1SG9 A;  5C1B A;  5BPV A;  1PJJ A;  3VDU A;  4GC5 A;  3J80 S;  2V6Z M;  1OIZ A;  2G5G X;  3GRY A;  2DZN B;  1G3I A;  3GQ4 A;  3SYK A;  2CP8 A;  2LBC A;  5E6J A;  3J27 B;  1IXS A;  2QNJ A;  2DAM A;  2DKL A;  3SAS A;  4Q7J A;  1HNX M;  2I7N A;  3EIH A;  1GVN A;  2D7H A;  3LMM A;  3HU2 A;  4I81 A;  2QEN A;  4FWG A;  3U60 B;  3HHY A;  1HQC A;  4QHS A;  1J7K A;  1AUA A;  4R7G A;  5JI3 E;  3M6A A;  2BWB A;  2L4F A;  4FW9 A;  4ANR A;  1TTE A;  4X64 M;  3B9P A;  1WGN A;  4GH9 A;  1XB2 B;  2K0B X;  1OJL A;  2QHO B;  4AG6 A;  4JI1 M;  4LG2 A;  4GHL A;  3R8F A;  3H4M A;  1ZMV A;  1VEJ A;  1J5E M;  2O25 A;  3QYE A;  4LGM A;  4IJE A;  4DV7 M;  2M60 A;  3C3D A;  3UMM A;  1UM8 A;  2C9C A;  2Z4S A;  5KPT A;  2JWS A;  1G8P A;  2MGW A;  3KOZ E;  3C9P A;  4LF7 M;  1OKS A;  1Z59 A;  2EO2 A;  3VLF B;  3GPU A;  3GLF A;  4LF9 M;  1GJT A;  4IJF A;  3FTC A;  4QOZ C;  3GLG A;  2Y0T A;  2DWL A;  2QP9 X;  3HKP A;  2LHG A;  2K9D A;  4LFC M;  2L09 A;  2YQZ A;  5C18 A;  1XMQ M;  3FUT A;  8CAT A;  2CWB A;  3HJQ A;  4W5W A;  2L7I A;  3CGW A;  4S12 A;  4LF6 M;  4OU7 A;  1HNW M;  2LVP C;  3LVW A;  3D8L A;  2LWX A;  2H5X A;  4WP2 A;  4AQY M;  2K47 A;  5L8R F;  4B3T M;  3U6C A;  3T1H M;  2ZAN A;  1IY2 A;  1IN4 A;  3LQR A;  2LH0 A;  3SHG B;  4REZ A;  1SXJ A;  4JI3 M;  1GL7 A;  3FYD A;  3VFD A;  3SYL A;  4D80 A;  2QBY B;  3HJS A;  4JI6 M;  1EE8 A;  1JR3 E;  1R2Z A;  4IBF A;  3AL0 C;  4JI0 M;  4AKG A;  1G4A E;  2X4A A;  3U6E A;  3FRI A;  3B7Q A;  3SAU A;  5FTN A;  3PFI A;  3KOY E;  3LW5 F;  3J7B A;  4OX9 M;  1XWI A;  1FNN A;  4WW0 A;  1N32 M;  4GIT A;  5EXP A;  1Q39 A;  4B3M M;  4GMQ A;  1FJG M;  4MB7 A;  3GLH B;  2DI0 A;  4LGY A;  2CFO A;  4MGH A;  4DV0 M;  3LCV B;  4MM3 B;  3UJN A;  1OIP A;  2QBY A;  1GLN A;  3KOX E;  3Q8X A;  4I5S A;  2APL A;  3FTE A;  1WXQ A;  1N36 M;  4GEW A;  3RFW A;  2CV0 A;  4YHH M;  4IBJ A;  4LJ7 A;  5FTK A;  3I4Y A;  1BVS A;  1TDH A;  3B89 A;  1QDR A;  3GLH E;  4HEO A;  1QAN A;  3EIE A;  2R62 A;  2QZ4 A;  1W5T A;  1ZMW A;  4M0W A;  1WIV A;  5FLX S;  1GO5 A;  4EIW A;  1YSY A;  4JI7 M;  1PJS A;  3IG5 A;  4QOS A;  1EFU B;  3KW6 A;  3CF6 E;  3TL4 X;  2KEB A;  2EJS A;  4DR7 M;  3J81 S;  2DVW B;  4DV3 M;  3K8Z A;  4PDG A;  3SAW A;  4KOD A;  1NY5 A;  3FE3 A;  4NL4 H;  4XBO A;  5DYG A;  3U5Z A;  1XMO M;  1NVM A;  4Z6Y A;  5BR8 M;  3JR5 A;  4L78 A;  1GJS A;  3TWK A;  4ITQ A;  5EP4 A;  3V76 A;  3K92 A;  3W0F A;  2ERC A;  4F2L A;  4PD2 A;  4M0D A;  3TQS A;  3L2A A;  4XK8 F;  3W0L B;  1TR8 A;  5LMN M;  2FH0 A;  1QAM A;  2CV2 A;  2LNH C;  1QQW A;  1PJI A;  2UUC M;  1IXR C;  2OQ4 A;  4DUY M;  5IZ7 D;  2CHG A;  1NV8 A;  3FYC A;  5ITX A;  3J7A S;  3HHX A;  2QSF X;  1IQP A;  4MGI E;  3HX3 A;  1X37 A;  3Q8G A;  1XC8 A;  2KRU A;  2R45 A;  2JZ1 A;  3QWL A;  2DAG A;  3DFZ A;  2LVQ D;  2EA0 A;  4JI5 M;  2Y21 A;  1D2N A;  1Z5A A;  2C98 A;  2JY8 A;  2P5T A;  4JI2 M;  4JI4 M;  4LF4 M;  4GKK M;  5FTL A;  3RE8 A;  4B3S M;  1HR0 M;  2DZO B;  3M7G A;  3M0E A;  1QAO A;  4LJ6 A;  1DO2 A;  4LRS A;  3KXE C;  4NSO B;  1NV9 A;  2QCU A;  5FTJ A;  4DV1 M;  4CIZ A;  1OAI A;  2KA6 B;  3HHZ A;  1E32 A;  2JUJ A;  2UU9 M;  1L2B A;  1R5L A;  1I94 M;  4BLC A;  2XZU A;  3HWS A;  1DV0 A;  1NO1 A;  1TH4 A;  1PM5 A;  2DHR A;  3KP1 E;  2DEN A;  1Z6T A;  3BBZ A;  4KLN A;  3GO8 A;  2J7O A;  3GLI A;  4PT5 A;  1DGF A;  4MGK E;  3AJI B;  2JA2 A;  4JV5 M;  3RGP A;  2B3T A;  3CF0 A;  2L6O A;  3GRV A;  1R4G A;  4KT0 F;  1YUB A;  1XXH E;  2JNH A;  2FNA A;  3NBI A;  2BWE A;  3E9S A;  1OAO C;  3ZQJ A;  3U6Q A;  1K3X A;  1JQJ C;  1Z5C A;  2CE7 A;  4MGZ E;  2ZAM A;  3FUU A;  2VQE M;  2LHC A;  2DWZ B;  1XNR M;  1C1K A;  3AV0 A;  4LJ4 A;  2RGH A;  3LCU A;  4ZPX A;  1GKI A;  2VF8 A;  1D0L A;  4LJ9 A;  3QYB A;  3FD9 A;  4G4R A;  1L8Q A;  2O01 F;  1QDT A;  2ZTD A;  1G59 A;  3HGI A;  3I01 M;  5FSW A;  2XEP A;  1K3W A;  1GL6 A;  2CEA A;  3SHF A;  1IN7 A;  5ITY A;  4G4Q A;  4AW4 A;  3IHP A;  1QVR A;  3NWL A;  2LXE A;  1DGB A;  5DYI A;  1OFH A;  4GC9 A;  1WJ7 A;  3H4J A;  3K9P A;  3L28 A;  2KZS A;  1DGH A;  2XSZ D;  5ITR A;  2Z8Y M;  3C3E A;  4LFA M;  1VG5 A;  2DAE A;  4DV6 M;  4DR1 M;  3A42 A;  3GQ5 A;  3GLF B;  4FWH A;  1R7R A;  1QUT A;  4HLQ A;  4MGY E;  3KOW E;  2X49 A;  4Y28 F;  3ZC7 B;  4L4U A;  2F5P A;  2UUA M;  1Q02 A;  3C58 A;  2WZJ A;  1DO0 A;  2QQ8 A;  1L2C A;  4M9X A;  7CAT A;  4IBE A;  1C7Y A;  4PDI A;  2HAK A;  2Y20 A;  2FFJ A;  4LZJ A;  3VKH A;  2J5Y A;  2BJV A;  3K1J A;  3KS8 A;  4IBG A;  3SAT A;  1A5T A;  2OO9 A;  1E9R A;  3SMS A;  4FVM A;  1NHW C;  2GNO A;  2J7N A;  2JY5 A;  3MHV C;  4DUZ M;  2XF3 A;  2F5N A;  2MH8 A;  2ZBK B;  3WHK A;  4X66 M;  4NOO B;  2JP7 A;  4NRW A;  1IY1 A;  1T43 A;  3B7Z A;  4I4L A;  3DA1 A;  2VII A;  3HY5 A;  3KDS E;  2F5S A;  3KSX A;  2YFQ A;  1NSF A;  3PNY A;  1PJT A;  2R65 A;  4LRT A;  1E9S A;  4HL4 A;  2KNZ A;  4FCV A;  1OQY A;  4II7 A;  3SMP A;  2D7G A;  2F5O A;  4DV2 M;  4UN2 B;  4DR4 M;  1Z5B A;  4JYA M;  1J09 A;  1HQY E;  4QNR A;  3GPX A;  4LCB A;  2Z3X A;  1YE9 A;  5EQT A;  3UK6 A;  1D0K A;  2KXE A;  1R2Y A;  4B7F A;  5LMU M;  1H6U A;  1KSF X;  1HT2 E;  4OW0 A;  4FWD A;  4F1I A;  4YY3 M;  1EIJ A;  2XGN A;  4L16 A;  1ORY B;  2H1R A;  2C9O A;  2V1C A;  3PVS A;  5F3W A;  3NBX X;  3ZCB B;  4LFB M;  2LTU A;  2XH9 A;  3DZD A;  2HL7 A;  4IBB A;  3U6M A;  2R6F A;  1NHG C;  1HNZ M;  4L15 A;  1VDL A;  1PRB A;  1Q3C A;  4CJ6 A;  3TPZ A;  3GPP A;  3B7N A;  2JXN A;  2HKJ A;  2LVA A;  3J2P B;  5EJC A;  1MN3 A;  1L1T A;  2FOI C;  2ZM6 M;  1R6B X;  2UXC M;  3AOG A;  3CTW B;  3SAR A;  4DR5 M;  2JY7 A;  4LJ8 A;  4RF1 A;  5EXS A;  4DR2 M;  3U61 B;  2DHY A;  3E4R A;  1NNJ A;  2YR0 A;  1LV7 A;  1LTM A;  2Q2E B;  1MJG M;  1SXJ E;  4WUR A;  3VK7 A;  3FUW A;  3D8B A;  2L2D A;  4NC6 A;  5JI2 E;  2EUC A;  3BXW A;  1K82 A;  4JI8 M;  1WR1 B;  4LY6 A;  3MMP A;  3SC3 A;  1QZE A;  1WHC A;  1ZQ9 A;  1TGU A;  2DZL A;  2KDL A;  2RRU A;  2Z4R A;  1IBL M;  3I4V A;  4NXM M;  1KYI A;  3JR4 A;  2XSZ A;  1TF0 B;  1W5S A;  4I8O A;  4NXN M;  3VK8 A;  4L8R C;  3GLI B;  3U6L A;  4OVZ B;  3W68 A;  2CRU A;  1JR3 A;  2R0I A;  4DR3 M;  2DNA A;  3UGJ A;  4PCZ A;  4DV4 M;  4AG5 A;  2KZU A;  1PJQ A;  2QPA A;  3AOE A;  2C5R A;  4CIS A;  5DFL A;  1HJP A;  2RGO A;  4KO8 A;  2KNA A;  3IEC A;  1SXJ B;  2R18 A;  2JY6 B;  2F4V M;  2DAK A;  3QAU A;  3LQQ A;  3TE6 A;  3MJ5 A;  3UZU A;  4GHA A;  3W67 A;  2DXI A;  3L29 A;  4X62 M;  2N35 A;  1JB0 F;  3IG8 A;  3GPY A;  4IBD A;  3GRU A;  5IWA M;  3U6D A;  5DNY A;  1YLA A;  4LF8 M;  3KFU G;  4IBI A;  4JXJ A;  1KFV A;  1IBM M;  3T38 A;  3TWL A;  2D7E A;  4G3O A;  5IT9 S;  2DAI A;  4AI6 A;  2LVN C;  3AOE C;  4LZZ A;  3KP0 E;  1VQ1 A;  1QZM A;  4R3D A;  3GLH A;  1IXS B;  1DGH B;  2G3Q A;  5ITQ A;  4FCT A;  5E26 A;  2R4E A;  4L6V 6;  4QNM A;  3T1Y M;  4MH0 E;  5ITU A;  2C96 A;  1S3S A;  3JAM S;  3HU3 A;  4NRV A;  5KPR A;  2V1U A;  3LVV A;  2YNM D;  2R44 A;  5EP3 A;  3MK6 A;  4R71 A;  4G6Z A;  5KPZ A;  1NJF A;  4P17 A;  3GP1 A;  3A46 A;  2AHM A;  5KQD A;  1TH3 A;  2C99 A;  2LVO C;  3I04 M;  3KVW A;  2UUB M;  1G41 A;  2BNK A;  3HHW A;  3L27 A;  2F5Q A;  3K2L A;  4DV5 M;  2O5R A;  3FKE A;  1E94 E;  3FTD A;  2HWJ A;  4TUW A;  5KQ8 A;  2R4J A;  2FS1 A;  4M9S A;  3R9X B;  3F92 A;  2W82 A;  3E21 A;  4XGI A;  1IY0 A;  3GLF E;  3U6O A;  1N78 A;  2EKK A;  2WSC F;  2CHQ A;  1F4I A;  4FCW A;  2KNV A;  4CGY B;  1UFZ A;  1NY6 A;  3GLG E;  2NQ8 C;  4DBG B;  2VDB B;  1IFY A;  1I4W A;  4D82 A;  4RNA A;  3PXG A;  3TWM A;  3L26 A;  4G4O A;  2XFT A;  2UXD M;  1OTR A;  1G71 A;  4B7G A;  1N34 M;  3AFH A; 
#chains in the Genus database with same CATH homology
 1TDZ A;  4M9Z A;  1IXZ A;  2CV1 A;  2RKO A;  2Y0Q A;  5EP1 A;  3U6S A;  4GIP A;  1ZAE A;  3U5Z B;  4AZF A;  5KO3 A;  4FD2 A;  3AKZ A;  3GQ3 A;  2ZAO A;  1XNQ M;  1NJG A;  3VDP A;  2X8A A;  4IBC A;  1NNU C;  2XZF A;  3FTF A;  1XXH B;  5FTM A;  1MU5 A;  4LJA A;  4B08 A;  5GKN A;  3RGS A;  2XLJ A;  4Z8X A;  3SAV A;  3BOS A;  4P16 A;  3SFZ A;  1IN5 A;  5A2Q S;  3GLG B;  3GRR A;  4D81 A;  4G4N A;  2FE8 A;  3PNV A;  3THG A;  2DWN A;  4OVZ A;  2BJW A;  1TH2 A;  3SBJ A;  2A5Y B;  2Z7J A;  2E5L M;  3U60 A;  3ILK A;  1MX0 A;  4DR6 M;  3A98 B;  2VQF M;  3FUV A;  1IM2 A;  1XXH A;  3I51 A;  5ITT A;  2CUZ A;  2KW0 A;  5IRE B;  1VDD A;  4LJ5 A;  4B7H A;  5H37 D;  1QAQ A;  3OTO M;  1N77 A;  3L25 A;  1N75 A;  4AKI A;  1IBK M;  1HT1 E;  2XFS A;  1DGG A;  2DWM A;  2M5Z A;  2I7P A;  3HJ8 A;  3ZH9 B;  1SXJ C;  3U6P A;  1IN8 A;  1XHB A;  2G8L A;  2R46 A;  4RF0 A;  5EP2 A;  1T3T A;  1JR3 D;  3HU1 A;  2CHV A;  3FUX A;  4JN6 A;  3T15 A;  4IBK A;  4TUW A;  1Q3B A;  1L2D A;  1N33 M;  1QYR A;  3DOA A;  2KRK A;  5EXT A;  2UXB M;  4BBA A;  4AI6 A;  3KS4 A;  2L7H A;  3KSJ A;  4CHT B;  5ITX E;  4QHT A;  3VKG A;  4IIW A;  2OPF A;  1IN6 A;  1SXJ D;  4NSR A;  4B3R M;  4A3V B;  4K0K M;  4BB9 A;  4GRI A;  1OFI A;  4LF5 M;  4AKH A;  4X65 M;  1L1Z A;  2HHH M;  3CF2 A;  3U61 A;  4KHP M;  2HCB A;  3A45 A;  4GKJ M;  5EXX A;  3WHL A;  5C1B A;  5BPV A;  1PJJ A;  3VDU A;  4GC5 A;  3J80 S;  2V6Z M;  2G5G X;  3GRY A;  2DZN B;  1G3I A;  3GQ4 A;  3SYK A;  5E6J A;  3J27 B;  3SAS A;  1HNX M;  2I7N A;  3EIH A;  1GVN A;  2D7H A;  3LMM A;  3HU2 A;  4I81 A;  2QEN A;  4FWG A;  3U60 B;  3HHY A;  1HQC A;  4QHS A;  1J7K A;  4R7G A;  5JI3 E;  3M6A A;  4FW9 A;  4X64 M;  3B9P A;  4GH9 A;  4AG6 A;  1OJL A;  4JI1 M;  4LG2 A;  4GHL A;  3R8F A;  3H4M A;  1J5E M;  4LGM A;  4IJE A;  4DV7 M;  2M60 A;  3UMM A;  1UM8 A;  2C9C A;  2Z4S A;  5KPT A;  1G8P A;  3KOZ E;  4LF7 M;  1Z59 A;  2EO2 A;  3VLF B;  3GLF A;  3GPU A;  4LF9 M;  4IJF A;  3FTC A;  4QOZ C;  3GLG A;  2Y0T A;  2QP9 X;  3HKP A;  4LFC M;  2L09 A;  2YQZ A;  5C18 A;  1XMQ M;  3FUT A;  8CAT A;  3HJQ A;  4W5W A;  2L7I A;  4S12 A;  4LF6 M;  4OU7 A;  1HNW M;  4AQY M;  3LVW A;  3D8L A;  2LWX A;  2K47 A;  4B3T M;  3U6C A;  3T1H M;  2ZAN A;  1IY2 A;  1IN4 A;  3LQR A;  2LH0 A;  3SHG B;  4REZ A;  1SXJ A;  4JI3 M;  1GL7 A;  3FYD A;  3VFD A;  3SYL A;  4D80 A;  2QBY B;  3HJS A;  4JI6 M;  1EE8 A;  1R2Z A;  4IBF A;  3AL0 C;  4JI0 M;  4AKG A;  1G4A E;  2X4A A;  3U6E A;  3SAU A;  5FTN A;  3PFI A;  3KOY E;  3J7B A;  4OX9 M;  1XWI A;  1FNN A;  4WW0 A;  1N32 M;  4GIT A;  5EXP A;  1Q39 A;  4B3M M;  4GMQ A;  1FJG M;  4MB7 A;  3GLH B;  4LGY A;  2CFO A;  4MGH A;  4DV0 M;  4MM3 B;  2QBY A;  3UJN A;  1GLN A;  3KOX E;  3Q8X A;  4I5S A;  3FTE A;  1WXQ A;  1N36 M;  3RFW A;  2CV0 A;  4YHH M;  4IBJ A;  4LJ7 A;  5FTK A;  3I4Y A;  1TDH A;  2DWL A;  4PDI A;  1QAN A;  3EIE A;  2R62 A;  2QZ4 A;  1W5T A;  4M0W A;  5FLX S;  4EIW A;  1YSY A;  4JI7 M;  4QOS A;  3IG5 A;  3KW6 A;  3CF6 E;  3TL4 X;  2KEB A;  4DR7 M;  3J81 S;  2DVW B;  4DV3 M;  3K8Z A;  4PDG A;  3SAW A;  4KOD A;  1NY5 A;  4NL4 H;  4XBO A;  5DYG A;  3U5Z A;  1XMO M;  1NVM A;  4Z6Y A;  5BR8 M;  3JR5 A;  4L78 A;  3TWK A;  4ITQ A;  5EP4 A;  3W0F A;  3K92 A;  2ERC A;  4PD2 A;  4M0D A;  3TQS A;  3L2A A;  3W0L B;  5LMN M;  1QAM A;  2CV2 A;  2LNH C;  1QQW A;  1PJI A;  2UUC M;  1IXR C;  2OQ4 A;  4DUY M;  5IZ7 D;  2CHG A;  3FYC A;  5ITX A;  3J7A S;  3HHX A;  1IQP A;  4MGI E;  1X37 A;  1XC8 A;  2KRU A;  2R45 A;  3QWL A;  3DFZ A;  2EA0 A;  4JI5 M;  2Y21 A;  1D2N A;  1Z5A A;  2C98 A;  2P5T A;  4JI2 M;  4JI4 M;  4LF4 M;  4GKK M;  5FTL A;  3RE8 A;  4B3S M;  1HR0 M;  2DZO B;  3M7G A;  3M0E A;  1QAO A;  4LJ6 A;  1DO2 A;  4LRS A;  3KXE C;  4NSO B;  2QCU A;  5FTJ A;  4DV1 M;  2KA6 B;  3HHZ A;  1E32 A;  2UU9 M;  1L2B A;  1I94 M;  4BLC A;  2XZU A;  3HWS A;  1TH4 A;  1PM5 A;  2DHR A;  3KP1 E;  1Z6T A;  4KLN A;  3GO8 A;  2J7O A;  3GLI A;  4PT5 A;  1DGF A;  4MGK E;  3AJI B;  2JA2 A;  4JV5 M;  3RGP A;  3CF0 A;  2L6O A;  3GRV A;  1YUB A;  2FNA A;  3NBI A;  1K3X A;  3E9S A;  3U6Q A;  1JQJ C;  1Z5C A;  2CE7 A;  4MGZ E;  2ZAM A;  3FUU A;  2VQE M;  2DWZ B;  1XNR M;  1C1K A;  3AV0 A;  4LJ4 A;  2RGH A;  4ZPX A;  1GKI A;  4LJ9 A;  3FD9 A;  4G4R A;  1L8Q A;  1G59 A;  3HGI A;  5FSW A;  2XEP A;  1K3W A;  1GL6 A;  2CEA A;  3SHF A;  1IN7 A;  5ITY A;  4G4Q A;  4AW4 A;  1QVR A;  3NWL A;  2LXE A;  1DGB A;  5DYI A;  1OFH A;  4GC9 A;  3L28 A;  2KZS A;  1DGH A;  2XSZ D;  5ITR A;  4LFA M;  4DR1 M;  4DV6 M;  3A42 A;  3GQ5 A;  3GLF B;  4FWH A;  1R7R A;  4HLQ A;  4MGY E;  3KOW E;  2X49 A;  3ZC7 B;  4L4U A;  2F5P A;  2UUA M;  3C58 A;  1DO0 A;  1L2C A;  4M9X A;  7CAT A;  4IBE A;  2Y20 A;  3VKH A;  2FFJ A;  4LZJ A;  3K1J A;  2BJV A;  3KS8 A;  4IBG A;  3SAT A;  1E9R A;  3SMS A;  4FVM A;  1NHW C;  2J7N A;  3MHV C;  4DUZ M;  2XF3 A;  2F5N A;  2ZBK B;  3WHK A;  4X66 M;  4NOO B;  4NRW A;  1IY1 A;  4I4L A;  3DA1 A;  2VII A;  3KDS E;  2F5S A;  3KSX A;  2YFQ A;  1NSF A;  3PNY A;  2R65 A;  4LRT A;  1E9S A;  4HL4 A;  4FCV A;  3SMP A;  4II7 A;  2D7G A;  2F5O A;  4DV2 M;  4JYA M;  4DR4 M;  1Z5B A;  1J09 A;  1HQY E;  4QNR A;  3GPX A;  4LCB A;  2Z3X A;  1YE9 A;  5EQT A;  3UK6 A;  2KXE A;  1R2Y A;  4B7F A;  5LMU M;  1H6U A;  1KSF X;  1HT2 E;  4OW0 A;  4FWD A;  4YY3 M;  2XGN A;  4L16 A;  1ORY B;  2H1R A;  2C9O A;  2V1C A;  3PVS A;  5F3W A;  3ZCB B;  4LFB M;  2XH9 A;  3DZD A;  2HL7 A;  4IBB A;  3U6M A;  1NHG C;  1HNZ M;  4L15 A;  1Q3C A;  3TPZ A;  3GPP A;  2HKJ A;  3J2P B;  5EJC A;  1L1T A;  2FOI C;  2ZM6 M;  1R6B X;  2UXC M;  3AOG A;  3CTW B;  3SAR A;  4DR5 M;  4LJ8 A;  4RF1 A;  5EXS A;  4DR2 M;  3U61 B;  3E4R A;  1NNJ A;  2YR0 A;  1LV7 A;  2Q2E B;  4WUR A;  1SXJ E;  3VK7 A;  3FUW A;  3D8B A;  5JI2 E;  2EUC A;  1K82 A;  4JI8 M;  4LY6 A;  3SC3 A;  1ZQ9 A;  4NXM M;  1TGU A;  2Z4R A;  1IBL M;  3I4V A;  1KYI A;  3JR4 A;  2XSZ A;  1W5S A;  4L8R C;  4I8O A;  4NXN M;  3VK8 A;  3GLI B;  3U6L A;  4OVZ B;  1JR3 A;  4DR3 M;  3UGJ A;  4PCZ A;  4DV4 M;  4AG5 A;  2KZU A;  2QPA A;  2C5R A;  3AOE A;  4CIS A;  2RGO A;  4KO8 A;  1SXJ B;  2R18 A;  2F4V M;  3QAU A;  3LQQ A;  3TE6 A;  3MJ5 A;  3UZU A;  4GHA A;  2DXI A;  3L29 A;  4X62 M;  3IG8 A;  3GPY A;  4IBD A;  3GRU A;  5IWA M;  3U6D A;  5DNY A;  4LF8 M;  3KFU G;  4IBI A;  4JXJ A;  1KFV A;  1IBM M;  3T38 A;  3TWL A;  2D7E A;  5IT9 S;  3AOE C;  4LZZ A;  3KP0 E;  4R3D A;  1QZM A;  3GLH A;  1IXS B;  1DGH B;  5ITQ A;  4FCT A;  5E26 A;  2R4E A;  4QNM A;  3T1Y M;  4MH0 E;  5ITU A;  2C96 A;  1S3S A;  3JAM S;  3HU3 A;  4NRV A;  5KPR A;  2V1U A;  3LVV A;  2YNM D;  5EP3 A;  3MK6 A;  4G6Z A;  5KPZ A;  1NJF A;  3GP1 A;  3A46 A;  2AHM A;  5KQD A;  1TH3 A;  2C99 A;  3KVW A;  2UUB M;  1G41 A;  2BNK A;  3HHW A;  3L27 A;  2F5Q A;  3K2L A;  4DV5 M;  2O5R A;  3FKE A;  1E94 E;  3FTD A;  5KQ8 A;  2R4J A;  4M9S A;  3R9X B;  2W82 A;  4XGI A;  1IY0 A;  3U6O A;  1N78 A;  2CHQ A;  4FCW A;  4CGY B;  1NY6 A;  2NQ8 C;  1I4W A;  4D82 A;  4RNA A;  3PXG A;  3TWM A;  3L26 A;  4G4O A;  2XFT A;  2UXD M;  4B7G A;  1N34 M;  3AFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...