4TUWA

Drosophila stem-loop binding protein complexed with histone mrna stem-loop, phospho mimic of tpnk and c-terminal region
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
71
Chain Sequence
SSYTEADPAILSRRQKQIDYGKNTAAYERYVEMVPRTRDHPREPNKYGKYSRRAFDGLVKIWRKSLHIYDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein/rna
molecule keywords Histone RNA hairpin-binding protein
total genus 22
structure length 71
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4tuwA00
4QOZC 4L8RC 4TUWA
chains in the Genus database with same CATH superfamily
3BBZA 3U60A 4QHTA 2KA6B 4LF4M 2QNJA 3GRYA 5KO3A 4DV4M 3SBJA 2HKJA 1ORYB 2JY5A 1QVRA 2R45A 2KNZA 4B3TM 1N33M 3F92A 4XBOA 4G4NA 2HAKA 2P5TA 3GP1A 4LF8M 3TQSA 3U6PA 4IIWA 5F3WA 4CGYB 3U6OA 2LNHC 3SYLA 5ITQA 1N34M 4LFBM 1IY1A 1OJLA 2OOAA 3D8LA 1DGHB 4LF7M 3U5ZB 1IBMM 2DAEA 1QZMA 5FLXS 3FKEA 4G6ZA 4IBEA 3LCUA 3I51A 3SAVA 3UK6A 3W68A 2K0BX 1PJIA 4PDIA 4LRTA 3HHXA 4GKJM 1J09A 3HZJA 5DNYA 3HHZA 2DWMA 4IBGA 4X62M 1GO5A 4TUWA 5ITTA 4PD2A 2UUBM 4YHHM 2R44A 1YUBA 3K2LA 4DV7M 3CTWB 3FTDA 4MM3B 4QNRA 5FSWA 3AFHA 1C7YA 1W5SA 2DXIA 2JZ0A 4Y28F 1AIPC 4KT0F 3U6CA 2GNOA 1WHCA 1ZMUA 3GLIE 3U61A 2EKKA 2QPAA 3H4MA 3R9XB 1QAMA 1DGFA 3BXWA 1GL6A 3W0FA 1R2YA 3A45A 2LVPC 3IG5A 3UZUA 4WW0A 1XXHB 2G8LA 1R7RA 1OFIA 2DAIA 2DI0A 1UM8A 1J7KA 3I4VA 1XC8A 3J7AS 3U6MA 4IBDA 1DGGA 3U6SA 2CV1A 3FTFA 3KXEC 2FFJA 3C3EA 2QP9X 1L1TA 2R4EA 1IXRC 3AJIB 3UMMA 1R5LA 2BJVA 3HKPA 1Z5BA 3UGJA 3EIEA 4L8RC 1XHBA 2XSZA 2O01F 2FNAA 2QENA 3FE3A 4REZA 4AG5A 2GQFA 2OOBA 3FRIA 1NV9A 3FYCA 4UN2B 1IFYA 5IWAM 2HWJA 3ZH9B 8CATA 4B7FA 4NRVA 2Y0TA 3TE6A 4LFCM 5GKNA 4JI0M 3SASA 1Z59A 3ILKA 1TH3A 4GMQA 3FTEA 2JUJA 2Z3XA 2BNKA 1LTMA 4IBIA 4OVZA 4LJ8A 4L15A 3T38A 2R62A 2QBYB 1NHGC 4HLQA 1OIPA 4W5WA 2L6OA 4GH9A 4LJ4A 1WIVA 4IBJA 2CUZA 2ZBKB 1NO1A 2Z4RA 2DWLA 4L78A 4MGYE 2R4JA 4DV2M 1NY6A 3KVWA 1D2NA 4G4RA 1IN8A 1FNNA 1IM2A 4X66M 3E21A 7CATA 2YNMD 3J27B 3JR4A 4FWGA 1SXJD 4OX9M 1G8PA 3U6LA 3U61B 1HNZM 2UUAM 2RKOA 2RGOA 4OVZB 3GLFB 4DR5M 4PCZA 4AKIA 3B7QA 3U60B 3QYBA 3GLIB 3L2AA 2BJWA 2UXCM 1IBLM 3LCVB 4GHAA 2LWXA 1RU3A 4GRIA 2A5YB 2D7HA 5KPRA 1QQWA 2KNVA 1IY2A 1HT2E 3ZCBB 5JI3E 3KSXA 2BWBA 1NSFA 3EIHA 3T1HM 4NXMM 1N78A 1OTRA 4JI1M 1QAQA 1ZQ9A 4D80A 2DAMA 3KDSE 3M7GA 4R7GA 3SFZA 2R18A 3KP1E 3GPPA 4JI6M 3VDPA 1WGLA 2XFSA 4AW4A 4PDGA 2C5RA 3SYKA 3HU2A 4D82A 2LH0A 3FUUA 1GLNA 4A3VB 3TPZA 2KXEA 1PGYA 2LXEA 2DENA 4LY6A 2JA2A 2ZAOA 4OW0A 4FWDA 4WURA 4AZFA 2WSCF 4EIWA 2DNAA 2Q2EB 3K9OA 4RKUF 2KW0A 1KSFX 1WGNA 2DHYA 2KRUA 1VG5A 4Q7JA 4NXNM 4BBAA 1IQPA 2FE8A 1V33A 2N35A 2W82A 2DKLA 2J7OA 2X4AA 4IBFA 1VDLA 1QUTA 2YFQA 1QYRA 2L7HA 4RNAA 5KPZA 5IT9S 1BVSA 2EJSA 3K9PA 2BWEA 2QBYA 2V6ZM 3B89A 2I7PA 4I4LA 4AQYM 5BR8M 1T3TA 2L2DA 1YSYA 2RGHA 4IJFA 3RE8A 2V1UA 3L29A 3SMSA 4HEOA 1XWIA 4NC6A 2VQEM 4LJ7A 1WXQA 4JXJA 2LHCA 2XZUA 2R6FA 1DO2A 2JWSA 4WP2A 4LF9M 4B08A 3HWSA 5BPVA 4DV0M 5JI2E 1HQCA 4Z8XA 4FWHA 2F5OA 4B7GA 4F1IA 5KQ8A 1OAIA 3GLIA 1ZV1A 2CHGA 3BOSA 3FUXA 2K47A 3GLGA 4DR4M 1NY5A 4F2LA 2F5QA 4B3MM 2OPFA 5EP4A 4QOSA 3NWLA 2MJ5B 2R0IA 1LV7A 2DWZB 3OTOM 3VKGA 4BB9A 1N77A 4XGIA 5EXPA 4MGKE 3QYEA 1D0KA 1F4IA 3HJSA 5DYIA 3M6AA 1XXHA 3JAMS 4CISA 2M5ZA 4MGIE 3SMPA 1XMQM 1QANA 2CWBA 4LRSA 3LVWA 4CJ6A 2DHRA 2JXNA 2R65A 4P16A 1T6OA 1CUKA 2L4EA 3GO8A 4I8OA 2KZSA 5KQDA 2C98A 4KODA 4X65M 3KOYE 1EFUB 4KO8A 4K0KM 2WSFF 2DZLA 1QUSA 3SARA 2CRUA 1XB2B 2JY7A 1SXJA 2DAKA 2MR9A 1QDRA 4LJ6A 2HHHM 5DFLA 3AKZA 1PJJA 3HX3A 3KS8A 3CGWA 3L27A 2YR0A 5EXSA 2HL7A 1IXSB 2ZTDA 4Z6YA 4FCTA 3FUVA 4DV6M 3MHVC 4DR7M 2CP8A 5LMUM 4GEWA 4JN6A 1V34A 5ITXA 3KS4A 4MGHA 3U5ZA 1GABA 3SATA 1E32A 1OFHA 1PJTA 3HJ8A 1IXSA 1TDZA 3HY5A 1UFZA 5EXXA 3VLFB 4LGMA 2XSZD 4JV5M 4IBBA 3SHFA 2X8AA 2DVWB 2OQ4A 1A5TA 2JY8A 1HT1E 2QSFX 4QNMA 5DYGA 4B3SM 3J2PB 2I7NA 4GHLA 1G41A 1Z6TA 1Z5CA 1QZEA 1Y8GA 1PJSA 2UXBM 3THGA 2CE7A 4M0DA 2H1RA 2EKFA 2EO2A 2CEAA 4JI3M 4II7A 1IN7A 3GLHE 2Z8YM 3T1YM 4L4UA 3QWLA 3AOEA 2F5NA 3LMMA 3K92A 3U6QA 1SXJC 3JR5A 1HR0M 4NSOB 3TL4X 2JP7A 2NQ8C 4M9XA 2E5LM 2MGWA 4DR6M 3V76A 1GL7A 5FTMA 2CFOA 4XK8F 4LJ5A 3FUWA 2L4FA 3A46A 2APLA 1FJGM 3B7ZA 4GC5A 3R8FA 4D81A 1Q39A 3H4JA 3GLHB 1E94E 3QAUA 4S12A 1GKIA 1WJ7A 4NRWA 1NJFA 1X37A 3LQQA 3HHYA 3TWLA 2QZ4A 5FTNA 5ITUA 3VK7A 1ZAEA 3Q8GA 1Q02A 2V1CA 1E9SA 1HJPA 1YE9A 2J7NA 5FTKA 5H37D 1L2BA 1XNRM 3M0EA 5E6JA 1GJSA 3WHLA 2MROB 3NBIA 1NV8A 3B74A 2ZTCA 2XH9A 3GQ3A 2B3TA 3I04M 3PVSA 2XLJA 3FYDA 4NOOB 2G5GX 2R46A 3W0LB 1T43A 5FTLA 4FD2A 1MU5A 3GLGB 2LVAA 1E9RA 3GQ5A 4DR1M 1GJTA 2ZAMA 2UU9M 5IREB 1IBKM 4AI6A 2C9CA 3K8ZA 4NL4H 5EP3A 4LF5M 3IECA 4LZZA 1V92A 1MN3A 2CHVA 2JNHA 2YQZA 3B7NA 4MH0E 3U6DA 1JB0F 2WZJA 1K82A 1IN5A 2G3QA 4JI5M 1OAOC 4NSRA 4AG6A 1KYIA 3FD9A 1N36M 1VDDA 2EA0A 5E26A 1L2DA 3KW6A 1EIJA 4MB7A 1SXJE 1Z5AA 2HCBA 3J81S 1TDHA 2H5XA 4RF0A 1DGHA 2XFTA 1IN4A 3KSJA 5EXTA 2X49A 3J7BA 1DV0A 1MJGM 1D0LA 3E9SA 4FCWA 3AOEC 4X64M 3Q8XA 4FW9A 2Y20A 2UXDM 1GVNA 2Y0QA 3RGPA 3TWKA 1ZMVA 2ZANA 5C1BA 2KHHA 3FTCA 3HU3A 1NNJA 4GC9A 1HNXM 3CF0A 2VF8A 2LVQD 3GPYA 1W5TA 4P17A 1TGUA 5EP1A 2LVOC 3GLGE 2QQ8A 4IJEA 1J5EM 2CV0A 3J80S 3LVVA 2UUCM 1TH4A 1DGBA 3GLFA 4AKGA 2VF7A 2CV2A 1NVMA 2QCUA 1L2CA 3MK6A 1G4AE 2VQFM 4B3RM 1IN6A 4DV3M 2DAGA 2L7IA 2LBCA 4R71A 4I81A 1JR3E 2XF3A 4LJAA 2XGNA 1VEKA 4DUZM 4M9SA 1JR3A 2KDLA 3LW5F 4KHPM 4IBKA 3B9PA 4DBGB 1HNWM 5EQTA 3AL0C 3VDUA 1QAOA 1PM5A 4JYAM 2QHOB 5ITXE 5C18A 3PFIA 2ZM6M 3I01M 1I4WA 2AHMA 3FUTA 1NHWC 5EJCA 2K6BA 3L25A 4CHTB 3T6PA 4GIPA 1S3SA 3HU1A 3HJQA 5FTJA 2RRUA 1TR8A 4B7HA 3U6EA 3W67A 3HGIA 3GRRA 1N32M 2LTUA 4BLCA 4LG2A 1VEGA 3IHPA 1R6BX 3C9PA 3L26A 1IXZA 1SXJB 2FOIC 3TWMA 3E4RA 2L09A 1R2ZA 1SG9A 1VQ1A 1EE8A 2C99A 4PT5A 2C9OA 2LVNC 1P3QQ 5LMNM 4MGZE 4LF6M 1ZMWA 1R4GA 5ITRA 4LGYA 2F4VM 3KFUG 4JI4M 3PNYA 2KEBA 3AOGA 3VFDA 2MH8A 1HQYE 2KNAA 2ERCA 4M9ZA 1K3WA 2DZNB 2FH0A 1XXHE 1TF0B 3FRHA 3VKHA 5KPTA 3UJNA 2D7EA 3GLFE 2K9DA 1KFVA 4LCBA 3GQ4A 4DV5M 1PJQA 3CF6E 2OO9A 3KP0E 4LZJA 4G4OA 1XMOM 3NBXX 4QOZC 1Q3CA 2CHQA 2M60A 1D0MA 3HHWA 4M0WA 2C96A 1NJGA 3I4YA 3KOZE 5EP2A 3K1JA 1AUAA 2Y21A 3DZDA 3C3DA 4RF1A 3VK8A 2XEPA 3MMPA 1H6UA 1MX0A 4G4QA 3SAWA 2JZ1A 4GITA 1L1ZA 1OIZA 1I94M 3PXGA 2JY6B 2VIIA 2O25A 2LHGA 2J5YA 4DV1M 1JQJC 3GRUA 4JI7M 1N75A 4R3DA 3L28A 5IZ7D 3DOAA 3RGSA 4DR2M 3DA1A 3GPUA 1C1KA 3ZC7B 3A42A 3PNVA 3KOWE 3DFZA 5ITYA 4LJ9A 4ANRA 3LQRA 3ZQJA 2F5PA 3D8BA 1OQYA 3SHGB 3SC3A 4FCVA 4IBCA 1TTEA 4AKHA 1PRBA 2EUCA 1JR3D 4GKKM 1Q3BA 2DZOB 3A98B 4G3OA 4DUYM 3T15A 1VEJA 2DWNA 1WR1B 2VDBB 1QDTA 2KRKA 2KZUA 1NNUC 3AV0A 4KLNA 4QHSA 1K3XA 4LFAM 4L16A 1G59A 4YY3M 3E46A 3GLHA 4FVMA 2O5RA 1DO0A 5A2QS 1TH2A 3KOXE 3MJ5A 2FS1A 3GPXA 2Z4SA 1XNQM 3C58A 4JI8M 1IY0A 4ZPXA 2D7GA 3RFWA 3CF2A 4OU7A 4CIZA 4DR3M 1YLAA 2XZFA 4JI2M 4I5SA 1G3IA 4L6V6 1L8QA 5L8RF 2Z7JA 3WHKA 4ITQA 3SAUA 2WSEF 3IG8A 1OKSA 3GRVA 2F5SA 4HL4A 1G71A
chains in the Genus database with same CATH topology
3U60A 4QHTA 2KA6B 4LF4M 3GRYA 5KO3A 4DV4M 3SBJA 2HKJA 1ORYB 1QVRA 2R45A 4B3TM 1N33M 4XBOA 4G4NA 3GP1A 2P5TA 4LF8M 3TQSA 3U6PA 4IIWA 5F3WA 4CGYB 3U6OA 2LNHC 3SYLA 5ITQA 1N34M 4LFBM 1IY1A 1OJLA 3D8LA 1DGHB 4LF7M 3U5ZB 1IBMM 1QZMA 5FLXS 3FKEA 4G6ZA 4IBEA 3I51A 3SAVA 3UK6A 1PJIA 4PDIA 4LRTA 3HHXA 4GKJM 1J09A 5DNYA 3HHZA 2DWMA 4IBGA 4X62M 4TUWA 5ITTA 4PD2A 2UUBM 4YHHM 1YUBA 3K2LA 4DV7M 3CTWB 3FTDA 4MM3B 4QNRA 5FSWA 3AFHA 1W5SA 2DXIA 3U6CA 3U61A 2QPAA 3H4MA 3R9XB 1QAMA 1DGFA 1GL6A 3W0FA 1R2YA 3A45A 3IG5A 3UZUA 4WW0A 1XXHB 2G8LA 1R7RA 1OFIA 1UM8A 1J7KA 3I4VA 1XC8A 3J7AS 3U6MA 4IBDA 1DGGA 3U6SA 2CV1A 3FTFA 3KXEC 2FFJA 2QP9X 1L1TA 2R4EA 1IXRC 3AJIB 3UMMA 3UGJA 2BJVA 3HKPA 1Z5BA 4L8RC 3EIEA 1XHBA 2XSZA 2FNAA 2QENA 4REZA 4AG5A 3FYCA 5IWAM 3ZH9B 8CATA 4B7FA 4NRVA 2Y0TA 3TE6A 4LFCM 5GKNA 4JI0M 3SASA 1Z59A 3ILKA 1TH3A 4GMQA 3FTEA 2Z3XA 2BNKA 4IBIA 4OVZA 4LJ8A 4L15A 3T38A 2R62A 2QBYB 1NHGC 4HLQA 4W5WA 2L6OA 4GH9A 4LJ4A 4IBJA 2CUZA 2ZBKB 2Z4RA 2DWLA 4L78A 4MGYE 2R4JA 4DV2M 1NY6A 3KVWA 1D2NA 4G4RA 1IN8A 1FNNA 1IM2A 4X66M 7CATA 2YNMD 3J27B 3JR4A 4FWGA 1SXJD 4OX9M 1G8PA 3U6LA 3U61B 1HNZM 2UUAM 2RKOA 2RGOA 4OVZB 3GLFB 4DR5M 4PCZA 4AKIA 3U60B 2UXCM 3GLIB 3L2AA 2BJWA 1IBLM 4GHAA 2LWXA 4GRIA 5KPRA 2A5YB 2D7HA 1QQWA 1IY2A 1HT2E 3ZCBB 5JI3E 3KSXA 3EIHA 1NSFA 3T1HM 4NXMM 1N78A 4JI1M 1QAQA 1ZQ9A 4D80A 3KDSE 3M7GA 4R7GA 3SFZA 2R18A 3KP1E 4JI6M 3VDPA 2XFSA 4AW4A 4PDGA 2C5RA 3SYKA 3HU2A 4D82A 2LH0A 3FUUA 1GLNA 4A3VB 3TPZA 2KXEA 2LXEA 4LY6A 2JA2A 2ZAOA 4OW0A 4FWDA 4WURA 4AZFA 4EIWA 2Q2EB 2KW0A 1KSFX 4BBAA 2KRUA 4NXNM 1IQPA 2FE8A 2W82A 4IBFA 3GPPA 2J7OA 2X4AA 2E5LM 2YFQA 4RNAA 1QYRA 2L7HA 5KPZA 5IT9S 2QBYA 2V6ZM 2I7PA 4I4LA 4AQYM 5BR8M 1T3TA 1YSYA 2RGHA 4IJFA 3RE8A 2V1UA 3L29A 3SMSA 1XWIA 2VQEM 4LJ7A 1WXQA 4JXJA 2XZUA 1DO2A 4LF9M 4B08A 3HWSA 5BPVA 4DV0M 5JI2E 1HQCA 4Z8XA 4FWHA 2F5OA 4B7GA 5KQ8A 3GLIA 3BOSA 2CHGA 3FUXA 3GLGA 2K47A 4DR4M 1NY5A 2F5QA 4B3MM 2OPFA 5EP4A 4QOSA 3NWLA 1LV7A 2DWZB 3OTOM 3VKGA 4BB9A 1N77A 4XGIA 5EXPA 4MGKE 3HJSA 5DYIA 3M6AA 1XXHA 3JAMS 4CISA 2M5ZA 4MGIE 3SMPA 1XMQM 1QANA 4LRSA 3LVWA 2DHRA 2R65A 4P16A 3GO8A 4I8OA 2KZSA 5KQDA 2C98A 4KODA 4X65M 3KOYE 4KO8A 4K0KM 3SARA 1SXJA 2HHHM 4LJ6A 3AKZA 1PJJA 3KS8A 3L27A 2YR0A 5EXSA 2HL7A 1IXSB 4Z6YA 4FCTA 3FUVA 4DV6M 3MHVC 4DR7M 5LMUM 4JN6A 5ITXA 3U5ZA 3KS4A 4MGHA 3SATA 1E32A 1OFHA 1TDZA 3HJ8A 3VLFB 5EXXA 4LGMA 2XSZD 4JV5M 4IBBA 3SHFA 2X8AA 2DVWB 2OQ4A 1HT1E 4QNMA 5DYGA 4B3SM 3J2PB 2I7NA 4GHLA 1G41A 1Z6TA 1Z5CA 2UXBM 3THGA 2CE7A 4M0DA 2H1RA 2EO2A 2CEAA 4JI3M 4II7A 1IN7A 3T1YM 4L4UA 3QWLA 3AOEA 2F5NA 3LMMA 3K92A 3U6QA 1SXJC 3JR5A 1HR0M 4NSOB 3TL4X 2NQ8C 4M9XA 4DR6M 1GL7A 5FTMA 2CFOA 4LJ5A 3FUWA 3A46A 1FJGM 4GC5A 3R8FA 4D81A 1Q39A 4S12A 3GLHB 1E94E 3QAUA 1GKIA 4NRWA 1NJFA 1X37A 3LQQA 3HHYA 3TWLA 2QZ4A 5FTNA 5ITUA 3VK7A 1ZAEA 2V1CA 1E9SA 1YE9A 2J7NA 5FTKA 5H37D 1L2BA 1XNRM 3M0EA 5E6JA 3WHLA 3NBIA 2XH9A 3GQ3A 3PVSA 2XLJA 3FYDA 4NOOB 2G5GX 2R46A 3W0LB 5FTLA 4FD2A 1MU5A 3GLGB 1E9RA 3GQ5A 4DR1M 2ZAMA 2UU9M 5IREB 1IBKM 4AI6A 2C9CA 3K8ZA 4NL4H 5EP3A 4LF5M 4LZZA 2CHVA 2YQZA 3U6DA 4MH0E 1K82A 1IN5A 4JI5M 4NSRA 4AG6A 1KYIA 3FD9A 1N36M 1VDDA 2EA0A 5E26A 1L2DA 3KW6A 4MB7A 1SXJE 1Z5AA 2HCBA 3J81S 1TDHA 4RF0A 1DGHA 3KSJA 1IN4A 2XFTA 5EXTA 2X49A 3J7BA 4X64M 3E9SA 4FCWA 3AOEC 3Q8XA 4FW9A 2Y20A 2UXDM 1GVNA 2Y0QA 3RGPA 3TWKA 2ZANA 5C1BA 3FTCA 3HU3A 1NNJA 4GC9A 1HNXM 3CF0A 3GPYA 1W5TA 5EP1A 1TGUA 4IJEA 1J5EM 2CV0A 3J80S 3LVVA 2UUCM 1TH4A 1DGBA 3GLFA 4AKGA 2CV2A 1NVMA 2QCUA 1L2CA 3MK6A 1G4AE 2VQFM 4B3RM 1IN6A 4DV3M 2L7IA 4I81A 2XF3A 4LJAA 2XGNA 4DUZM 4M9SA 1JR3A 4KHPM 4IBKA 3B9PA 1HNWM 5EQTA 3AL0C 3VDUA 1QAOA 1PM5A 4JYAM 5ITXE 5C18A 3PFIA 2ZM6M 1I4WA 2AHMA 3FUTA 1NHWC 5EJCA 3L25A 4CHTB 4GIPA 1S3SA 3HU1A 3HJQA 5FTJA 3U6EA 4B7HA 3HGIA 3GRRA 1N32M 4BLCA 4LG2A 3L26A 1R6BX 1IXZA 1SXJB 2FOIC 3TWMA 3E4RA 2L09A 1R2ZA 1EE8A 2C99A 4PT5A 2C9OA 5LMNM 4MGZE 4LF6M 5ITRA 4LGYA 2F4VM 3KFUG 4JI4M 3PNYA 2KEBA 3AOGA 3VFDA 1HQYE 2ERCA 4M9ZA 1K3WA 2DZNB 3VKHA 5KPTA 3UJNA 2D7EA 1KFVA 4LCBA 3GQ4A 4DV5M 3CF6E 4G4OA 4LZJA 3KP0E 1XMOM 4QOZC 1Q3CA 2CHQA 2M60A 3HHWA 4M0WA 2C96A 1NJGA 3I4YA 3KOZE 5EP2A 3K1JA 3DZDA 2Y21A 4RF1A 3VK8A 2XEPA 1H6UA 1MX0A 4G4QA 3SAWA 1I94M 4GITA 1L1ZA 3PXGA 2VIIA 4JI7M 4DV1M 1JQJC 3GRUA 1N75A 4R3DA 3L28A 5IZ7D 3DOAA 3RGSA 4DR2M 3DA1A 3GPUA 1C1KA 3ZC7B 3A42A 3PNVA 3KOWE 3DFZA 5ITYA 4LJ9A 3LQRA 2F5PA 3D8BA 3SHGB 3SC3A 4FCVA 4IBCA 4AKHA 2EUCA 1JR3D 4GKKM 1Q3BA 2DZOB 3A98B 4DUYM 3T15A 2DWNA 4KLNA 1K3XA 2KRKA 2KZUA 1NNUC 3AV0A 4QHSA 4LFAM 4L16A 1G59A 4YY3M 3GLHA 4FVMA 2O5RA 1DO0A 5A2QS 1TH2A 3KOXE 3MJ5A 3GPXA 2Z4SA 1XNQM 3C58A 4JI8M 1IY0A 4ZPXA 2D7GA 3RFWA 3CF2A 4OU7A 4DR3M 2XZFA 4JI2M 4I5SA 1G3IA 1L8QA 2Z7JA 3WHKA 4ITQA 3SAUA 3IG8A 3GRVA 2F5SA 4HL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QOZ C;  4L8R C;  4TUW A; 
#chains in the Genus database with same CATH topology
 3BBZ A;  3U60 A;  4QHT A;  2KA6 B;  4LF4 M;  2QNJ A;  3GRY A;  5KO3 A;  4DV4 M;  3SBJ A;  2HKJ A;  1ORY B;  2JY5 A;  1QVR A;  2R45 A;  2KNZ A;  4B3T M;  1N33 M;  3F92 A;  4XBO A;  4G4N A;  2HAK A;  2P5T A;  3GP1 A;  4LF8 M;  3TQS A;  3U6P A;  4IIW A;  5F3W A;  4CGY B;  3U6O A;  2LNH C;  3SYL A;  5ITQ A;  1N34 M;  4LFB M;  1IY1 A;  1OJL A;  2OOA A;  3D8L A;  1DGH B;  4LF7 M;  3U5Z B;  1IBM M;  2DAE A;  1QZM A;  5FLX S;  3FKE A;  4G6Z A;  4IBE A;  3LCU A;  3I51 A;  3SAV A;  3UK6 A;  3W68 A;  2K0B X;  1PJI A;  4PDI A;  4LRT A;  3HHX A;  4GKJ M;  1J09 A;  3HZJ A;  5DNY A;  3HHZ A;  2DWM A;  4IBG A;  4X62 M;  1GO5 A;  4TUW A;  5ITT A;  4PD2 A;  2UUB M;  4YHH M;  2R44 A;  1YUB A;  3K2L A;  4DV7 M;  3CTW B;  3FTD A;  4MM3 B;  4QNR A;  5FSW A;  3AFH A;  1C7Y A;  1W5S A;  2DXI A;  2JZ0 A;  4Y28 F;  1AIP C;  4KT0 F;  3U6C A;  2GNO A;  1WHC A;  1ZMU A;  3GLI E;  3U61 A;  2EKK A;  2QPA A;  3H4M A;  3R9X B;  1QAM A;  1DGF A;  3BXW A;  1GL6 A;  3W0F A;  1R2Y A;  3A45 A;  2LVP C;  3IG5 A;  3UZU A;  4WW0 A;  1XXH B;  2G8L A;  1R7R A;  1OFI A;  2DAI A;  2DI0 A;  1UM8 A;  1J7K A;  3I4V A;  1XC8 A;  3J7A S;  3U6M A;  4IBD A;  1DGG A;  3U6S A;  2CV1 A;  3FTF A;  3KXE C;  2FFJ A;  3C3E A;  2QP9 X;  1L1T A;  2R4E A;  1IXR C;  3AJI B;  3UMM A;  1R5L A;  2BJV A;  3HKP A;  1Z5B A;  3UGJ A;  3EIE A;  4L8R C;  1XHB A;  2XSZ A;  2O01 F;  2FNA A;  2QEN A;  3FE3 A;  4REZ A;  4AG5 A;  2GQF A;  2OOB A;  3FRI A;  1NV9 A;  3FYC A;  4UN2 B;  1IFY A;  5IWA M;  2HWJ A;  3ZH9 B;  8CAT A;  4B7F A;  4NRV A;  2Y0T A;  3TE6 A;  4LFC M;  5GKN A;  4JI0 M;  3SAS A;  1Z59 A;  3ILK A;  1TH3 A;  4GMQ A;  3FTE A;  2JUJ A;  2Z3X A;  2BNK A;  1LTM A;  4IBI A;  4OVZ A;  4LJ8 A;  4L15 A;  3T38 A;  2R62 A;  2QBY B;  1NHG C;  4HLQ A;  1OIP A;  4W5W A;  2L6O A;  4GH9 A;  4LJ4 A;  1WIV A;  4IBJ A;  2CUZ A;  2ZBK B;  1NO1 A;  2Z4R A;  2DWL A;  4L78 A;  4MGY E;  2R4J A;  4DV2 M;  1NY6 A;  3KVW A;  1D2N A;  4G4R A;  1IN8 A;  1FNN A;  1IM2 A;  4X66 M;  3E21 A;  7CAT A;  2YNM D;  3J27 B;  3JR4 A;  4FWG A;  1SXJ D;  4OX9 M;  1G8P A;  3U6L A;  3U61 B;  1HNZ M;  2UUA M;  2RKO A;  2RGO A;  4OVZ B;  3GLF B;  4DR5 M;  4PCZ A;  4AKI A;  3B7Q A;  3U60 B;  3QYB A;  3GLI B;  3L2A A;  2BJW A;  2UXC M;  1IBL M;  3LCV B;  4GHA A;  2LWX A;  1RU3 A;  4GRI A;  2A5Y B;  2D7H A;  5KPR A;  1QQW A;  2KNV A;  1IY2 A;  1HT2 E;  3ZCB B;  5JI3 E;  3KSX A;  2BWB A;  1NSF A;  3EIH A;  3T1H M;  4NXM M;  1N78 A;  1OTR A;  4JI1 M;  1QAQ A;  1ZQ9 A;  4D80 A;  2DAM A;  3KDS E;  3M7G A;  4R7G A;  3SFZ A;  2R18 A;  3KP1 E;  3GPP A;  4JI6 M;  3VDP A;  1WGL A;  2XFS A;  4AW4 A;  4PDG A;  2C5R A;  3SYK A;  3HU2 A;  4D82 A;  2LH0 A;  3FUU A;  1GLN A;  4A3V B;  3TPZ A;  2KXE A;  1PGY A;  2LXE A;  2DEN A;  4LY6 A;  2JA2 A;  2ZAO A;  4OW0 A;  4FWD A;  4WUR A;  4AZF A;  2WSC F;  4EIW A;  2DNA A;  2Q2E B;  3K9O A;  4RKU F;  2KW0 A;  1KSF X;  1WGN A;  2DHY A;  2KRU A;  1VG5 A;  4Q7J A;  4NXN M;  4BBA A;  1IQP A;  2FE8 A;  1V33 A;  2N35 A;  2W82 A;  2DKL A;  2J7O A;  2X4A A;  4IBF A;  1VDL A;  1QUT A;  2YFQ A;  1QYR A;  2L7H A;  4RNA A;  5KPZ A;  5IT9 S;  1BVS A;  2EJS A;  3K9P A;  2BWE A;  2QBY A;  2V6Z M;  3B89 A;  2I7P A;  4I4L A;  4AQY M;  5BR8 M;  1T3T A;  2L2D A;  1YSY A;  2RGH A;  4IJF A;  3RE8 A;  2V1U A;  3L29 A;  3SMS A;  4HEO A;  1XWI A;  4NC6 A;  2VQE M;  4LJ7 A;  1WXQ A;  4JXJ A;  2LHC A;  2XZU A;  2R6F A;  1DO2 A;  2JWS A;  4WP2 A;  4LF9 M;  4B08 A;  3HWS A;  5BPV A;  4DV0 M;  5JI2 E;  1HQC A;  4Z8X A;  4FWH A;  2F5O A;  4B7G A;  4F1I A;  5KQ8 A;  1OAI A;  3GLI A;  1ZV1 A;  2CHG A;  3BOS A;  3FUX A;  2K47 A;  3GLG A;  4DR4 M;  1NY5 A;  4F2L A;  2F5Q A;  4B3M M;  2OPF A;  5EP4 A;  4QOS A;  3NWL A;  2MJ5 B;  2R0I A;  1LV7 A;  2DWZ B;  3OTO M;  3VKG A;  4BB9 A;  1N77 A;  4XGI A;  5EXP A;  4MGK E;  3QYE A;  1D0K A;  1F4I A;  3HJS A;  5DYI A;  3M6A A;  1XXH A;  3JAM S;  4CIS A;  2M5Z A;  4MGI E;  3SMP A;  1XMQ M;  1QAN A;  2CWB A;  4LRS A;  3LVW A;  4CJ6 A;  2DHR A;  2JXN A;  2R65 A;  4P16 A;  1T6O A;  1CUK A;  2L4E A;  3GO8 A;  4I8O A;  2KZS A;  5KQD A;  2C98 A;  4KOD A;  4X65 M;  3KOY E;  1EFU B;  4KO8 A;  4K0K M;  2WSF F;  2DZL A;  1QUS A;  3SAR A;  2CRU A;  1XB2 B;  2JY7 A;  1SXJ A;  2DAK A;  2MR9 A;  1QDR A;  4LJ6 A;  2HHH M;  5DFL A;  3AKZ A;  1PJJ A;  3HX3 A;  3KS8 A;  3CGW A;  3L27 A;  2YR0 A;  5EXS A;  2HL7 A;  1IXS B;  2ZTD A;  4Z6Y A;  4FCT A;  3FUV A;  4DV6 M;  3MHV C;  4DR7 M;  2CP8 A;  5LMU M;  4GEW A;  4JN6 A;  1V34 A;  5ITX A;  3KS4 A;  4MGH A;  3U5Z A;  1GAB A;  3SAT A;  1E32 A;  1OFH A;  1PJT A;  3HJ8 A;  1IXS A;  1TDZ A;  3HY5 A;  1UFZ A;  5EXX A;  3VLF B;  4LGM A;  2XSZ D;  4JV5 M;  4IBB A;  3SHF A;  2X8A A;  2DVW B;  2OQ4 A;  1A5T A;  2JY8 A;  1HT1 E;  2QSF X;  4QNM A;  5DYG A;  4B3S M;  3J2P B;  2I7N A;  4GHL A;  1G41 A;  1Z6T A;  1Z5C A;  1QZE A;  1Y8G A;  1PJS A;  2UXB M;  3THG A;  2CE7 A;  4M0D A;  2H1R A;  2EKF A;  2EO2 A;  2CEA A;  4JI3 M;  4II7 A;  1IN7 A;  3GLH E;  2Z8Y M;  3T1Y M;  4L4U A;  3QWL A;  3AOE A;  2F5N A;  3LMM A;  3K92 A;  3U6Q A;  1SXJ C;  3JR5 A;  1HR0 M;  4NSO B;  3TL4 X;  2JP7 A;  2NQ8 C;  4M9X A;  2E5L M;  2MGW A;  4DR6 M;  3V76 A;  1GL7 A;  5FTM A;  2CFO A;  4XK8 F;  4LJ5 A;  3FUW A;  2L4F A;  3A46 A;  2APL A;  1FJG M;  3B7Z A;  4GC5 A;  3R8F A;  4D81 A;  1Q39 A;  3H4J A;  3GLH B;  1E94 E;  3QAU A;  4S12 A;  1GKI A;  1WJ7 A;  4NRW A;  1NJF A;  1X37 A;  3LQQ A;  3HHY A;  3TWL A;  2QZ4 A;  5FTN A;  5ITU A;  3VK7 A;  1ZAE A;  3Q8G A;  1Q02 A;  2V1C A;  1E9S A;  1HJP A;  1YE9 A;  2J7N A;  5FTK A;  5H37 D;  1L2B A;  1XNR M;  3M0E A;  5E6J A;  1GJS A;  3WHL A;  2MRO B;  3NBI A;  1NV8 A;  3B74 A;  2ZTC A;  2XH9 A;  3GQ3 A;  2B3T A;  3I04 M;  3PVS A;  2XLJ A;  3FYD A;  4NOO B;  2G5G X;  2R46 A;  3W0L B;  1T43 A;  5FTL A;  4FD2 A;  1MU5 A;  3GLG B;  2LVA A;  1E9R A;  3GQ5 A;  4DR1 M;  1GJT A;  2ZAM A;  2UU9 M;  5IRE B;  1IBK M;  4AI6 A;  2C9C A;  3K8Z A;  4NL4 H;  5EP3 A;  4LF5 M;  3IEC A;  4LZZ A;  1V92 A;  1MN3 A;  2CHV A;  2JNH A;  2YQZ A;  3B7N A;  4MH0 E;  3U6D A;  1JB0 F;  2WZJ A;  1K82 A;  1IN5 A;  2G3Q A;  4JI5 M;  1OAO C;  4NSR A;  4AG6 A;  1KYI A;  3FD9 A;  1N36 M;  1VDD A;  2EA0 A;  5E26 A;  1L2D A;  3KW6 A;  1EIJ A;  4MB7 A;  1SXJ E;  1Z5A A;  2HCB A;  3J81 S;  1TDH A;  2H5X A;  4RF0 A;  1DGH A;  2XFT A;  1IN4 A;  3KSJ A;  5EXT A;  2X49 A;  3J7B A;  1DV0 A;  1MJG M;  1D0L A;  3E9S A;  4FCW A;  3AOE C;  4X64 M;  3Q8X A;  4FW9 A;  2Y20 A;  2UXD M;  1GVN A;  2Y0Q A;  3RGP A;  3TWK A;  1ZMV A;  2ZAN A;  5C1B A;  2KHH A;  3FTC A;  3HU3 A;  1NNJ A;  4GC9 A;  1HNX M;  3CF0 A;  2VF8 A;  2LVQ D;  3GPY A;  1W5T A;  4P17 A;  1TGU A;  5EP1 A;  2LVO C;  3GLG E;  2QQ8 A;  4IJE A;  1J5E M;  2CV0 A;  3J80 S;  3LVV A;  2UUC M;  1TH4 A;  1DGB A;  3GLF A;  4AKG A;  2VF7 A;  2CV2 A;  1NVM A;  2QCU A;  1L2C A;  3MK6 A;  1G4A E;  2VQF M;  4B3R M;  1IN6 A;  4DV3 M;  2DAG A;  2L7I A;  2LBC A;  4R71 A;  4I81 A;  1JR3 E;  2XF3 A;  4LJA A;  2XGN A;  1VEK A;  4DUZ M;  4M9S A;  1JR3 A;  2KDL A;  3LW5 F;  4KHP M;  4IBK A;  3B9P A;  4DBG B;  1HNW M;  5EQT A;  3AL0 C;  3VDU A;  1QAO A;  1PM5 A;  4JYA M;  2QHO B;  5ITX E;  5C18 A;  3PFI A;  2ZM6 M;  3I01 M;  1I4W A;  2AHM A;  3FUT A;  1NHW C;  5EJC A;  2K6B A;  3L25 A;  4CHT B;  3T6P A;  4GIP A;  1S3S A;  3HU1 A;  3HJQ A;  5FTJ A;  2RRU A;  1TR8 A;  4B7H A;  3U6E A;  3W67 A;  3HGI A;  3GRR A;  1N32 M;  2LTU A;  4BLC A;  4LG2 A;  1VEG A;  3IHP A;  1R6B X;  3C9P A;  3L26 A;  1IXZ A;  1SXJ B;  2FOI C;  3TWM A;  3E4R A;  2L09 A;  1R2Z A;  1SG9 A;  1VQ1 A;  1EE8 A;  2C99 A;  4PT5 A;  2C9O A;  2LVN C;  1P3Q Q;  5LMN M;  4MGZ E;  4LF6 M;  1ZMW A;  1R4G A;  5ITR A;  4LGY A;  2F4V M;  3KFU G;  4JI4 M;  3PNY A;  2KEB A;  3AOG A;  3VFD A;  2MH8 A;  1HQY E;  2KNA A;  2ERC A;  4M9Z A;  1K3W A;  2DZN B;  2FH0 A;  1XXH E;  1TF0 B;  3FRH A;  3VKH A;  5KPT A;  3UJN A;  2D7E A;  3GLF E;  2K9D A;  1KFV A;  4LCB A;  3GQ4 A;  4DV5 M;  1PJQ A;  3CF6 E;  2OO9 A;  3KP0 E;  4LZJ A;  4G4O A;  1XMO M;  3NBX X;  4QOZ C;  1Q3C A;  2CHQ A;  2M60 A;  1D0M A;  3HHW A;  4M0W A;  2C96 A;  1NJG A;  3I4Y A;  3KOZ E;  5EP2 A;  3K1J A;  1AUA A;  2Y21 A;  3DZD A;  3C3D A;  4RF1 A;  3VK8 A;  2XEP A;  3MMP A;  1H6U A;  1MX0 A;  4G4Q A;  3SAW A;  2JZ1 A;  4GIT A;  1L1Z A;  1OIZ A;  1I94 M;  3PXG A;  2JY6 B;  2VII A;  2O25 A;  2LHG A;  2J5Y A;  4DV1 M;  1JQJ C;  3GRU A;  4JI7 M;  1N75 A;  4R3D A;  3L28 A;  5IZ7 D;  3DOA A;  3RGS A;  4DR2 M;  3DA1 A;  3GPU A;  1C1K A;  3ZC7 B;  3A42 A;  3PNV A;  3KOW E;  3DFZ A;  5ITY A;  4LJ9 A;  4ANR A;  3LQR A;  3ZQJ A;  2F5P A;  3D8B A;  1OQY A;  3SHG B;  3SC3 A;  4FCV A;  4IBC A;  1TTE A;  4AKH A;  1PRB A;  2EUC A;  1JR3 D;  4GKK M;  1Q3B A;  2DZO B;  3A98 B;  4G3O A;  4DUY M;  3T15 A;  1VEJ A;  2DWN A;  1WR1 B;  2VDB B;  1QDT A;  2KRK A;  2KZU A;  1NNU C;  3AV0 A;  4KLN A;  4QHS A;  1K3X A;  4LFA M;  4L16 A;  1G59 A;  4YY3 M;  3E46 A;  3GLH A;  4FVM A;  2O5R A;  1DO0 A;  5A2Q S;  1TH2 A;  3KOX E;  3MJ5 A;  2FS1 A;  3GPX A;  2Z4S A;  1XNQ M;  3C58 A;  4JI8 M;  1IY0 A;  4ZPX A;  2D7G A;  3RFW A;  3CF2 A;  4OU7 A;  4CIZ A;  4DR3 M;  1YLA A;  2XZF A;  4JI2 M;  4I5S A;  1G3I A;  4L6V 6;  1L8Q A;  5L8R F;  2Z7J A;  3WHK A;  4ITQ A;  3SAU A;  2WSE F;  3IG8 A;  1OKS A;  3GRV A;  2F5S A;  4HL4 A;  1G71 A; 
#chains in the Genus database with same CATH homology
 3U60 A;  4QHT A;  2KA6 B;  4LF4 M;  3GRY A;  5KO3 A;  4DV4 M;  3SBJ A;  2HKJ A;  1ORY B;  1QVR A;  2R45 A;  4B3T M;  1N33 M;  4XBO A;  4G4N A;  3GP1 A;  2P5T A;  4LF8 M;  3TQS A;  3U6P A;  4IIW A;  5F3W A;  4CGY B;  3U6O A;  2LNH C;  3SYL A;  5ITQ A;  1N34 M;  4LFB M;  1IY1 A;  1OJL A;  3D8L A;  1DGH B;  4LF7 M;  3U5Z B;  1IBM M;  1QZM A;  5FLX S;  3FKE A;  4G6Z A;  4IBE A;  3I51 A;  3SAV A;  3UK6 A;  1PJI A;  4PDI A;  4LRT A;  3HHX A;  4GKJ M;  1J09 A;  5DNY A;  3HHZ A;  2DWM A;  4IBG A;  4X62 M;  4TUW A;  5ITT A;  4PD2 A;  2UUB M;  4YHH M;  1YUB A;  3K2L A;  4DV7 M;  3CTW B;  3FTD A;  4MM3 B;  4QNR A;  5FSW A;  3AFH A;  1W5S A;  2DXI A;  3U6C A;  3U61 A;  2QPA A;  3H4M A;  3R9X B;  1QAM A;  1DGF A;  1GL6 A;  3W0F A;  1R2Y A;  3A45 A;  3IG5 A;  3UZU A;  4WW0 A;  1XXH B;  2G8L A;  1R7R A;  1OFI A;  1UM8 A;  1J7K A;  3I4V A;  1XC8 A;  3J7A S;  3U6M A;  4IBD A;  1DGG A;  3U6S A;  2CV1 A;  3FTF A;  3KXE C;  2FFJ A;  2QP9 X;  1L1T A;  2R4E A;  1IXR C;  3AJI B;  3UMM A;  3UGJ A;  2BJV A;  3HKP A;  1Z5B A;  4L8R C;  3EIE A;  1XHB A;  2XSZ A;  2FNA A;  2QEN A;  4REZ A;  4AG5 A;  3FYC A;  5IWA M;  3ZH9 B;  8CAT A;  4B7F A;  4NRV A;  2Y0T A;  3TE6 A;  4LFC M;  5GKN A;  4JI0 M;  3SAS A;  1Z59 A;  3ILK A;  1TH3 A;  4GMQ A;  3FTE A;  2Z3X A;  2BNK A;  4IBI A;  4OVZ A;  4LJ8 A;  4L15 A;  3T38 A;  2R62 A;  2QBY B;  1NHG C;  4HLQ A;  4W5W A;  2L6O A;  4GH9 A;  4LJ4 A;  4IBJ A;  2CUZ A;  2ZBK B;  2Z4R A;  2DWL A;  4L78 A;  4MGY E;  2R4J A;  4DV2 M;  1NY6 A;  3KVW A;  1D2N A;  4G4R A;  1IN8 A;  1FNN A;  1IM2 A;  4X66 M;  7CAT A;  2YNM D;  3J27 B;  3JR4 A;  4FWG A;  1SXJ D;  4OX9 M;  1G8P A;  3U6L A;  3U61 B;  1HNZ M;  2UUA M;  2RKO A;  2RGO A;  4OVZ B;  3GLF B;  4DR5 M;  4PCZ A;  4AKI A;  3U60 B;  2UXC M;  3GLI B;  3L2A A;  2BJW A;  1IBL M;  4GHA A;  2LWX A;  4GRI A;  5KPR A;  2A5Y B;  2D7H A;  1QQW A;  1IY2 A;  1HT2 E;  3ZCB B;  5JI3 E;  3KSX A;  3EIH A;  1NSF A;  3T1H M;  4NXM M;  1N78 A;  4JI1 M;  1QAQ A;  1ZQ9 A;  4D80 A;  3KDS E;  3M7G A;  4R7G A;  3SFZ A;  2R18 A;  3KP1 E;  4JI6 M;  3VDP A;  2XFS A;  4AW4 A;  4PDG A;  2C5R A;  3SYK A;  3HU2 A;  4D82 A;  2LH0 A;  3FUU A;  1GLN A;  4A3V B;  3TPZ A;  2KXE A;  2LXE A;  4LY6 A;  2JA2 A;  2ZAO A;  4OW0 A;  4FWD A;  4WUR A;  4AZF A;  4EIW A;  2Q2E B;  2KW0 A;  1KSF X;  4BBA A;  2KRU A;  4NXN M;  1IQP A;  2FE8 A;  2W82 A;  4IBF A;  3GPP A;  2J7O A;  2X4A A;  2E5L M;  2YFQ A;  4RNA A;  1QYR A;  2L7H A;  5KPZ A;  5IT9 S;  2QBY A;  2V6Z M;  2I7P A;  4I4L A;  4AQY M;  5BR8 M;  1T3T A;  1YSY A;  2RGH A;  4IJF A;  3RE8 A;  2V1U A;  3L29 A;  3SMS A;  1XWI A;  2VQE M;  4LJ7 A;  1WXQ A;  4JXJ A;  2XZU A;  1DO2 A;  4LF9 M;  4B08 A;  3HWS A;  5BPV A;  4DV0 M;  5JI2 E;  1HQC A;  4Z8X A;  4FWH A;  2F5O A;  4B7G A;  5KQ8 A;  3GLI A;  3BOS A;  2CHG A;  3FUX A;  3GLG A;  2K47 A;  4DR4 M;  1NY5 A;  2F5Q A;  4B3M M;  2OPF A;  5EP4 A;  4QOS A;  3NWL A;  1LV7 A;  2DWZ B;  3OTO M;  3VKG A;  4BB9 A;  1N77 A;  4XGI A;  5EXP A;  4MGK E;  3HJS A;  5DYI A;  3M6A A;  1XXH A;  3JAM S;  4CIS A;  2M5Z A;  4MGI E;  3SMP A;  1XMQ M;  1QAN A;  4LRS A;  3LVW A;  2DHR A;  2R65 A;  4P16 A;  3GO8 A;  4I8O A;  2KZS A;  5KQD A;  2C98 A;  4KOD A;  4X65 M;  3KOY E;  4KO8 A;  4K0K M;  3SAR A;  1SXJ A;  2HHH M;  4LJ6 A;  3AKZ A;  1PJJ A;  3KS8 A;  3L27 A;  2YR0 A;  5EXS A;  2HL7 A;  1IXS B;  4Z6Y A;  4FCT A;  3FUV A;  4DV6 M;  3MHV C;  4DR7 M;  5LMU M;  4JN6 A;  5ITX A;  3U5Z A;  3KS4 A;  4MGH A;  3SAT A;  1E32 A;  1OFH A;  1TDZ A;  3HJ8 A;  3VLF B;  5EXX A;  4LGM A;  2XSZ D;  4JV5 M;  4IBB A;  3SHF A;  2X8A A;  2DVW B;  2OQ4 A;  1HT1 E;  4QNM A;  5DYG A;  4B3S M;  3J2P B;  2I7N A;  4GHL A;  1G41 A;  1Z6T A;  1Z5C A;  2UXB M;  3THG A;  2CE7 A;  4M0D A;  2H1R A;  2EO2 A;  2CEA A;  4JI3 M;  4II7 A;  1IN7 A;  3T1Y M;  4L4U A;  3QWL A;  3AOE A;  2F5N A;  3LMM A;  3K92 A;  3U6Q A;  1SXJ C;  3JR5 A;  1HR0 M;  4NSO B;  3TL4 X;  2NQ8 C;  4M9X A;  4DR6 M;  1GL7 A;  5FTM A;  2CFO A;  4LJ5 A;  3FUW A;  3A46 A;  1FJG M;  4GC5 A;  3R8F A;  4D81 A;  1Q39 A;  4S12 A;  3GLH B;  1E94 E;  3QAU A;  1GKI A;  4NRW A;  1NJF A;  1X37 A;  3LQQ A;  3HHY A;  3TWL A;  2QZ4 A;  5FTN A;  5ITU A;  3VK7 A;  1ZAE A;  2V1C A;  1E9S A;  1YE9 A;  2J7N A;  5FTK A;  5H37 D;  1L2B A;  1XNR M;  3M0E A;  5E6J A;  3WHL A;  3NBI A;  2XH9 A;  3GQ3 A;  3PVS A;  2XLJ A;  3FYD A;  4NOO B;  2G5G X;  2R46 A;  3W0L B;  5FTL A;  4FD2 A;  1MU5 A;  3GLG B;  1E9R A;  3GQ5 A;  4DR1 M;  2ZAM A;  2UU9 M;  5IRE B;  1IBK M;  4AI6 A;  2C9C A;  3K8Z A;  4NL4 H;  5EP3 A;  4LF5 M;  4LZZ A;  2CHV A;  2YQZ A;  3U6D A;  4MH0 E;  1K82 A;  1IN5 A;  4JI5 M;  4NSR A;  4AG6 A;  1KYI A;  3FD9 A;  1N36 M;  1VDD A;  2EA0 A;  5E26 A;  1L2D A;  3KW6 A;  4MB7 A;  1SXJ E;  1Z5A A;  2HCB A;  3J81 S;  1TDH A;  4RF0 A;  1DGH A;  3KSJ A;  1IN4 A;  2XFT A;  5EXT A;  2X49 A;  3J7B A;  4X64 M;  3E9S A;  4FCW A;  3AOE C;  3Q8X A;  4FW9 A;  2Y20 A;  2UXD M;  1GVN A;  2Y0Q A;  3RGP A;  3TWK A;  2ZAN A;  5C1B A;  3FTC A;  3HU3 A;  1NNJ A;  4GC9 A;  1HNX M;  3CF0 A;  3GPY A;  1W5T A;  5EP1 A;  1TGU A;  4IJE A;  1J5E M;  2CV0 A;  3J80 S;  3LVV A;  2UUC M;  1TH4 A;  1DGB A;  3GLF A;  4AKG A;  2CV2 A;  1NVM A;  2QCU A;  1L2C A;  3MK6 A;  1G4A E;  2VQF M;  4B3R M;  1IN6 A;  4DV3 M;  2L7I A;  4I81 A;  2XF3 A;  4LJA A;  2XGN A;  4DUZ M;  4M9S A;  1JR3 A;  4KHP M;  4IBK A;  3B9P A;  1HNW M;  5EQT A;  3AL0 C;  3VDU A;  1QAO A;  1PM5 A;  4JYA M;  5ITX E;  5C18 A;  3PFI A;  2ZM6 M;  1I4W A;  2AHM A;  3FUT A;  1NHW C;  5EJC A;  3L25 A;  4CHT B;  4GIP A;  1S3S A;  3HU1 A;  3HJQ A;  5FTJ A;  3U6E A;  4B7H A;  3HGI A;  3GRR A;  1N32 M;  4BLC A;  4LG2 A;  3L26 A;  1R6B X;  1IXZ A;  1SXJ B;  2FOI C;  3TWM A;  3E4R A;  2L09 A;  1R2Z A;  1EE8 A;  2C99 A;  4PT5 A;  2C9O A;  5LMN M;  4MGZ E;  4LF6 M;  5ITR A;  4LGY A;  2F4V M;  3KFU G;  4JI4 M;  3PNY A;  2KEB A;  3AOG A;  3VFD A;  1HQY E;  2ERC A;  4M9Z A;  1K3W A;  2DZN B;  3VKH A;  5KPT A;  3UJN A;  2D7E A;  1KFV A;  4LCB A;  3GQ4 A;  4DV5 M;  3CF6 E;  4G4O A;  4LZJ A;  3KP0 E;  1XMO M;  4QOZ C;  1Q3C A;  2CHQ A;  2M60 A;  3HHW A;  4M0W A;  2C96 A;  1NJG A;  3I4Y A;  3KOZ E;  5EP2 A;  3K1J A;  3DZD A;  2Y21 A;  4RF1 A;  3VK8 A;  2XEP A;  1H6U A;  1MX0 A;  4G4Q A;  3SAW A;  1I94 M;  4GIT A;  1L1Z A;  3PXG A;  2VII A;  4JI7 M;  4DV1 M;  1JQJ C;  3GRU A;  1N75 A;  4R3D A;  3L28 A;  5IZ7 D;  3DOA A;  3RGS A;  4DR2 M;  3DA1 A;  3GPU A;  1C1K A;  3ZC7 B;  3A42 A;  3PNV A;  3KOW E;  3DFZ A;  5ITY A;  4LJ9 A;  3LQR A;  2F5P A;  3D8B A;  3SHG B;  3SC3 A;  4FCV A;  4IBC A;  4AKH A;  2EUC A;  1JR3 D;  4GKK M;  1Q3B A;  2DZO B;  3A98 B;  4DUY M;  3T15 A;  2DWN A;  4KLN A;  1K3X A;  2KRK A;  2KZU A;  1NNU C;  3AV0 A;  4QHS A;  4LFA M;  4L16 A;  1G59 A;  4YY3 M;  3GLH A;  4FVM A;  2O5R A;  1DO0 A;  5A2Q S;  1TH2 A;  3KOX E;  3MJ5 A;  3GPX A;  2Z4S A;  1XNQ M;  3C58 A;  4JI8 M;  1IY0 A;  4ZPX A;  2D7G A;  3RFW A;  3CF2 A;  4OU7 A;  4DR3 M;  2XZF A;  4JI2 M;  4I5S A;  1G3I A;  1L8Q A;  2Z7J A;  3WHK A;  4ITQ A;  3SAU A;  3IG8 A;  3GRV A;  2F5S A;  4HL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...