4TUWA

Drosophila stem-loop binding protein complexed with histone mrna stem-loop, phospho mimic of tpnk and c-terminal region
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
71
Chain Sequence
b'SSYTEADPAILSRRQKQIDYGKNTAAYERYVEMVPRTRDHPREPNKYGKYSRRAFDGLVKIWRKSLHIYDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone RNA hairpin-binding protein
publication title Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein/rna
total genus 22
structure length 71
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4tuwA00
4TUWA 4QOZC 4L8RC
chains in the Genus database with same CATH superfamily
2QCUA 1V92A 1Y8GA 3H4JA 3L27A 4GC5A 3LMMA 4LJ9A 3UMMA 1QAOA 3WHLA 1XNRM 4MB7A 4QOSA 4JI3M 2WSEF 1OFHA 2Y0QA 4GEWA 5L8RF 3LQQA 4AW4A 1EIJA 1MU5A 2CWBA 2CV0A 4PT5A 1GO5A 3U5ZA 2KZSA 2Z4SA 2B3TA 2L7HA 4Y28F 4JI8M 4LZZA 2MH8A 3U5ZB 2JNHA 2MR9A 3LVVA 3KS4A 2F5PA 2EKKA 1YLAA 1S3SA 1XB2B 1N32M 4PCZA 4Q7JA 3K9PA 4GC9A 1TGUA 1NY6A 2DAIA 2YR0A 4DV6M 3FKEA 5JI2E 4M0DA 3KP0E 2LVPC 4LY6A 2DAGA 4B3RM 4JI4M 4I81A 5KQDA 2KW0A 2ZTCA 4UN2B 5DNYA 5FTLA 4YHHM 1OAOC 1XWIA 4QHSA 1NY5A 2FOIC 3M7GA 2KRKA 2V6ZM 3K9OA 4LJ7A 2V1UA 2M5ZA 3TWLA 2BJVA 3HHXA 5FTJA 2DAMA 3AFHA 3GPPA 3GP1A 2R4JA 2LWXA 4R71A 4IBCA 1VQ1A 4MGHA 3SARA 1TTEA 3FUVA 3E4RA 1ZMUA 4FVMA 5ITUA 2CEAA 3Q8XA 4DV4M 1MJGM 1X37A 3R9XB 1IFYA 3K92A 1EE8A 2KDLA 3SBJA 1XNQM 1VDDA 2OO9A 2EUCA 4LJ5A 3B7ZA 3CTWB 3B7NA 4JN6A 2FH0A 3FYCA 1P3QQ 5DYIA 3SASA 4DR6M 2H5XA 4EIWA 4B7FA 2F5QA 4NOOB 3VKHA 4DR2M 4LJAA 4CHTB 3ZCBB 1G3IA 2W82A 2G3QA 2ZAOA 4FCTA 1ORYB 3GRVA 2HCBA 4LGYA 1UM8A 5ITXE 4P16A 4CIZA 1J7KA 1QDRA 2P5TA 4W5WA 5IZ7D 3L25A 4DR5M 3LVWA 4NRVA 1WR1B 3PXGA 1E9SA 1NJGA 2UUAM 1Q02A 2JY5A 3HU3A 4I5SA 4FW9A 8CATA 1I4WA 2RGOA 2K6BA 3L2AA 3GLGE 2DWNA 3GLHA 5KPZA 4GRIA 3GLHB 4L6V6 2M60A 3IHPA 4IJEA 1HJPA 2UXCM 2XEPA 4LZJA 4MM3B 1W5SA 2ERCA 4DUZM 3GRRA 2LVQD 2VDBB 1QVRA 4JI5M 4AQYM 4CGYB 2L4FA 3DFZA 4G4NA 5FTNA 4LF4M 1H6UA 2Y21A 5KPTA 3GO8A 1XXHA 1V34A 1L8QA 1V33A 4M9ZA 3SHGB 2WZJA 2UU9M 3QWLA 1XMQM 3HGIA 5EXXA 5FTKA 1CUKA 1WXQA 1NV8A 1WIVA 1JB0F 2Z3XA 3SAWA 1RU3A 1IY1A 2O25A 1IY0A 3AKZA 4QNMA 4Z8XA 1R2ZA 2UXBM 1N34M 2AHMA 4DBGB 1QZMA 4X62M 3SAVA 3MJ5A 4QOZC 3BBZA 1N75A 1VEKA 3LQRA 1NJFA 3RE8A 2CFOA 1HT2E 3M6AA 3W0FA 4CJ6A 4LFBM 4ZPXA 1DGFA 2HL7A 2HWJA 4NRWA 1IBMM 4IIWA 4LF7M 3ZH9B 2YFQA 1Z59A 5ITQA 2C9OA 1A5TA 4R3DA 5EXSA 1DGHA 3ZQJA 3U6PA 1L1ZA 4NXMM 5ITTA 1DGHB 2DENA 2R65A 3C3EA 2C98A 1TH2A 1SXJD 5DFLA 3KOWE 4PD2A 5BR8M 1JQJC 1PJJA 1J5EM 2L6OA 4DR3M 4AKIA 1R4GA 4X66M 3T15A 1ZV1A 5C1BA 2CP8A 4DV5M 2DHRA 3B89A 3IG5A 2QNJA 3JAMS 3GLIA 1HT1E 2G8LA 1G8PA 1GKIA 3GLIB 3FYDA 2O01F 1OIZA 1YSYA 3HKPA 2R62A 4FWDA 3RGSA 1OAIA 3W0LB 2MJ5B 3A98B 3KW6A 4G4RA 4HL4A 1GVNA 1JR3A 2ZM6M 3UZUA 1IN7A 2VF8A 2EA0A 3SFZA 1Z5CA 2LVOC 3U6LA 3TWMA 2QBYA 1OJLA 3KOXE 1G4AE 2CHGA 2X49A 4LRTA 5FTMA 3T38A 4RF1A 3UGJA 4PDIA 1Q3BA 4NC6A 3DOAA 4AKGA 3KOYE 4LJ6A 2XF3A 4M0WA 2H1RA 2K0BX 1PJQA 2LTUA 3UJNA 1XMOM 3L29A 5EP1A 2DZLA 3E21A 4R7GA 1R5LA 2K9DA 3A45A 4QHTA 1Q3CA 1YE9A 4M9SA 3JR4A 1TF0B 2CHQA 2EJSA 3MMPA 4A3VB 1W5TA 3CF2A 4D80A 3C3DA 2X8AA 2DKLA 3FRIA 4DUYM 4IJFA 2JUJA 2I7PA 5C18A 2ZTDA 4BLCA 2GNOA 5ITRA 3F92A 1IN8A 3B9PA 4KO8A 4L8RC 1ZAEA 3AOGA 4M9XA 1LTMA 2JXNA 4GIPA 3SMPA 1J09A 3VFDA 1SXJA 1DO0A 1DV0A 1SXJB 1L1TA 5BPVA 3SYKA 2DVWB 1IBKM 3IECA 4CISA 2R4EA 4B7GA 2XFSA 3KXEC 2KRUA 2LVNC 1G41A 2VIIA 1PJTA 3KOZE 3KSJA 2F5OA 4GKKM 2FNAA 4I4LA 2DZNB 2A5YB 2KHHA 1VDLA 3L26A 3GQ5A 4LGMA 1NO1A 3FTDA 4NSOB 1SXJC 2F5SA 2KA6B 3OTOM 1KSFX 4K0KM 1GL6A 4JYAM 2FE8A 2Y0TA 1IN4A 3GPUA 3HJSA 4L78A 1QDTA 3B74A 4JXJA 3JR5A 2QSFX 2XSZA 1PGYA 4G3OA 7CATA 3U6CA 2Z8YM 3KS8A 2BWEA 3U6SA 3M0EA 2UUCM 2XFTA 4BBAA 3FUXA 2VQFM 3GPXA 3HX3A 4FD2A 2MROB 2WSCF 3VK8A 1FNNA 2RKOA 4B3TM 1PM5A 1DGBA 2FFJA 3AJIB 3U6EA 2Y20A 4IBIA 1LV7A 2C5RA 4DV3M 2QBYB 4WURA 5EJCA 5KQ8A 4BB9A 1NSFA 2KNAA 3CF0A 2Z7JA 4L16A 4FCVA 3GLFA 1G59A 2BJWA 3FD9A 1JR3D 3HHWA 1NHGC 4D82A 4AZFA 3GLFB 1VEJA 3K1JA 3I4VA 4X65M 4IBJA 3L28A 3TE6A 3AOEA 4D81A 1AIPC 1XXHB 3HJQA 1G71A 4B7HA 2R46A 4OW0A 5EXPA 4XK8F 3C58A 2JZ1A 3CGWA 1NHWC 4FWGA 1SXJE 3FUTA 2DWMA 2HAKA 1IN5A 2R6FA 3QYEA 4REZA 2KZUA 2XLJA 2DZOB 4MGIE 3U6MA 3U6QA 1VEGA 4GHLA 3AOEC 3D8BA 2DHYA 3FUUA 3NBXX 2JA2A 3VDUA 4OU7A 1WGNA 4F1IA 2X4AA 3CF6E 4LF8M 3FTFA 2JY7A 5KO3A 2DXIA 1TDHA 3KVWA 3EIHA 2KNZA 1QAMA 3K8ZA 4AI6A 2Z4RA 3T6PA 3EIEA 3HHYA 4IBEA 3J2PB 4MGZE 4OX9M 2XH9A 2XZUA 1SG9A 1EFUB 2V1CA 5LMUM 4LF9M 2LH0A 2D7EA 5EP3A 1QAQA 2CUZA 2L09A 2FS1A 1IBLM 2J5YA 3VDPA 2ZAMA 3SMSA 3J7AS 4LCBA 2XGNA 4GMQA 4LRSA 3TQSA 3J81S 3I51A 4L15A 2JY8A 4DR1M 1E9RA 2JY6B 3VLFB 3TPZA 3KSXA 3PFIA 4ITQA 3GQ4A 4LF6M 3GLHE 2UXDM 1GL7A 1T6OA 2EKFA 1QUTA 3FTCA 5EXTA 3R8FA 2F4VM 2DWZB 1Z5AA 1R6BX 3B7QA 4LF5M 4MH0E 4L4UA 3THGA 2L4EA 1PRBA 4DV7M 2LBCA 2XSZD 3BOSA 5JI3E 3GLFE 3QAUA 1HQCA 4KODA 5H37D 4X64M 1OFIA 3HU1A 2D7GA 2JWSA 4OVZA 4DV1M 1TH4A 4LJ8A 5E26A 5ITXA 4OVZB 1NVMA 1XXHE 3HWSA 2OOAA 4AKHA 1D0MA 1KYIA 4GITA 5E6JA 3W68A 1HNXM 3VK7A 4GHAA 4S12A 3A46A 4QNRA 4RNAA 1DO2A 1QANA 2RGHA 3AV0A 3J27B 1N77A 3GLGA 4HEOA 1UFZA 3E46A 1TDZA 3GLGB 4KLNA 2K47A 1ZMWA 2LNHC 2LVAA 1IM2A 2DWLA 3AL0C 3HY5A 4LFCM 3U6DA 2WSFF 4TUWA 2I7NA 4IBBA 4AG6A 5LMNM 1MX0A 4DV0M 3J7BA 1OTRA 2BWBA 2CRUA 2HHHM 3HJ8A 5GKNA 4JV5M 5FSWA 4JI6M 1E94E 1OKSA 1TH3A 1WGLA 3RGPA 5A2QS 1Z5BA 3U6OA 2R44A 1OQYA 4XBOA 4NL4H 1GJTA 3I01M 3E9SA 2GQFA 1QQWA 2YNMD 1N78A 1R7RA 5IREB 1ZQ9A 4FWHA 4JI7M 3I04M 5EP4A 1GJSA 1IXRC 4B08A 3GLIE 1HR0M 3PVSA 2DAKA 1IXZA 3MHVC 2DI0A 1L2BA 1C7YA 2JP7A 2LHCA 1IQPA 3SATA 4G4OA 1GABA 3PNVA 3LW5F 1Q39A 1IY2A 1JR3E 3BXWA 2C99A 1QYRA 2QHOB 4WW0A 4KT0F 3SC3A 1OIPA 4JI1M 4IBFA 2R45A 2EO2A 3KFUG 1F4IA 3QYBA 1HNZM 2NQ8C 1ZMVA 3FRHA 4LG2A 2CV1A 3FTEA 3C9PA 1N33M 3HU2A 2KNVA 2MGWA 2HKJA 1T43A 2LXEA 2C9CA 4FCWA 2XZFA 4MGYE 4DV2M 4B3SM 1XC8A 2ZBKB 3VKGA 2Q2EB 4RF0A 3MK6A 1PJIA 2QQ8A 1N36M 3WHKA 3TWKA 1K3XA 4IBDA 2KXEA 3PNYA 4IBGA 1HNWM 3D8LA 1D2NA 4NSRA 3RFWA 4GH9A 3T1HM 2ZANA 3LCUA 1TR8A 3V76A 1XHBA 4LFAM 4IBKA 4G6ZA 2J7NA 3GRUA 2CHVA 4JI2M 1WHCA 3FE3A 2RRUA 1K3WA 3SYLA 1AUAA 4AG5A 1K82A 2BNKA 1QZEA 3ILKA 1T3TA 5ITYA 1YUBA 2VQEM 3GQ3A 4ANRA 3H4MA 1VG5A 3FUWA 2C96A 2R18A 1L2DA 1NNUC 3K2LA 4I8OA 4II7A 2CV2A 3HZJA 2QENA 3ZC7B 3NBIA 1L2CA 4WP2A 1MN3A 2DNAA 2O5RA 3A42A 2QP9X 2L7IA 1WJ7A 3DZDA 4G4QA 2QZ4A 4YY3M 3T1YM 5F3WA 3Q8GA 1GLNA 1I94M 3IG8A 4Z6YA 2OQ4A 2G5GX 2DAEA 4LJ4A 4P17A 4JI0M 5EP2A 5FLXS 2QPAA 1NV9A 2D7HA 1IXSA 1D0KA 5DYGA 5EQTA 3UK6A 4HLQA 2F5NA 2N35A 2E5LM 1D0LA 1IXSB 1PJSA 3LCVB 1KFVA 5KPRA 4XGIA 2VF7A 3SAUA 2UUBM 4MGKE 4DR4M 1HQYE 4RKUF 3KP1E 3U61A 3NWLA 4KHPM 2CE7A 3U61B 3KDSE 1R2YA 1DGGA 2J7OA 4B3MM 2OPFA 2L2DA 3I4YA 2JZ0A 2KEBA 3TL4X 3GRYA 4DR7M 2LHGA 4F2LA 3DA1A 3GPYA 3J80S 3U60A 4PDGA 2R0IA 1BVSA 1QUSA 1C1KA 1Z6TA 1FJGM 3U60B 5IT9S 5IWAM 1NNJA 1IN6A 2YQZA 1E32A 3SHFA 2APLA 3HHZA 4NXNM 2OOBA 3W67A 4GKJM
chains in the Genus database with same CATH topology
2QCUA 3L27A 4GC5A 3LMMA 4LJ9A 3UMMA 1QAOA 3WHLA 1XNRM 4MB7A 4QOSA 4JI3M 2Y0QA 1OFHA 3LQQA 4AW4A 1MU5A 2CV0A 4PT5A 3U5ZA 2KZSA 2Z4SA 2L7HA 4JI8M 4LZZA 3U5ZB 3LVVA 3KS4A 2F5PA 1S3SA 1N32M 4PCZA 4GC9A 1TGUA 1NY6A 2YR0A 4DV6M 3FKEA 5JI2E 4M0DA 3KP0E 4LY6A 4B3RM 4JI4M 4I81A 5KQDA 2KW0A 5DNYA 5FTLA 4YHHM 1XWIA 4QHSA 1NY5A 2FOIC 3M7GA 2KRKA 2V6ZM 4LJ7A 2V1UA 2M5ZA 3TWLA 2BJVA 3HHXA 5FTJA 3AFHA 3GPPA 3GP1A 2OPFA 2R4JA 2LWXA 4IBCA 4MGHA 3SARA 3FUVA 3E4RA 4FVMA 5ITUA 2CEAA 3Q8XA 4DV4M 1X37A 3R9XB 3K92A 1EE8A 3SBJA 1XNQM 1VDDA 2EUCA 4LJ5A 3CTWB 4JN6A 3FYCA 5DYIA 3SASA 4DR6M 4EIWA 2F5QA 4B7FA 3VKHA 4NOOB 4DR2M 4LJAA 4CHTB 3ZCBB 1G3IA 2W82A 2ZAOA 4FCTA 1ORYB 3GRVA 2HCBA 4LGYA 1UM8A 5ITXE 4P16A 1J7KA 2P5TA 4W5WA 5IZ7D 3L25A 4DR5M 3LVWA 4NRVA 3PXGA 1E9SA 1NJGA 2UUAM 3HU3A 4I5SA 4FW9A 8CATA 1I4WA 2RGOA 3L2AA 2DWNA 3GLHA 5KPZA 4GRIA 3GLHB 2M60A 4IJEA 2UXCM 2XEPA 4LZJA 4MM3B 1W5SA 2ERCA 4DUZM 3GRRA 1QVRA 4JI5M 4AQYM 4CGYB 3DFZA 4G4NA 5FTNA 4LF4M 1H6UA 2Y21A 5KPTA 3GO8A 1XXHA 1L8QA 4M9ZA 3SHGB 2UU9M 3QWLA 1XMQM 3HGIA 5EXXA 5FTKA 1WXQA 2Z3XA 3SAWA 1IY1A 1IY0A 3AKZA 4QNMA 4Z8XA 1R2ZA 2UXBM 1N34M 2AHMA 4X62M 1QZMA 3SAVA 3MJ5A 4QOZC 1N75A 3LQRA 1NJFA 3RE8A 2CFOA 1HT2E 3M6AA 3W0FA 4LFBM 4ZPXA 1DGFA 2HL7A 4NRWA 1IBMM 4IIWA 4LF7M 3ZH9B 2YFQA 1Z59A 5ITQA 2C9OA 5EXSA 4R3DA 3U6PA 1DGHA 1L1ZA 4NXMM 5ITTA 1DGHB 2R65A 4PD2A 1PJIA 2C98A 1TH2A 1SXJD 1PJJA 3KOWE 5BR8M 1J5EM 1JQJC 2L6OA 4DR3M 4AKIA 4X66M 3T15A 5C1BA 4DV5M 2DHRA 3IG5A 3JAMS 3GLIA 1HT1E 2G8LA 1G8PA 1GKIA 3GLIB 3FYDA 3HKPA 1YSYA 4FWDA 3W0LB 2R62A 3RGSA 3A98B 3KW6A 4G4RA 4HL4A 1GVNA 1JR3A 2ZM6M 3UZUA 1IN7A 2EA0A 3SFZA 1Z5CA 3U6LA 2QBYA 3TWMA 1OJLA 3KOXE 1G4AE 2CHGA 2X49A 4LRTA 5FTMA 3T38A 4RF1A 3UGJA 4PDIA 1Q3BA 3DOAA 4AKGA 3KOYE 4LJ6A 2XF3A 4M0WA 2H1RA 1XMOM 3UJNA 3L29A 5EP1A 4R7GA 3A45A 4QHTA 1Q3CA 1YE9A 4M9SA 3JR4A 2CHQA 4A3VB 1W5TA 3CF2A 4D80A 2X8AA 4DUYM 4IJFA 5C18A 2I7PA 4BLCA 5ITRA 4KO8A 1IN8A 3B9PA 4L8RC 1ZAEA 3AOGA 4M9XA 3SMPA 4GIPA 3VFDA 1J09A 1SXJA 1DO0A 1SXJB 1L1TA 5BPVA 3SYKA 2DVWB 1IBKM 4CISA 2R4EA 4B7GA 2XFSA 3KXEC 2KRUA 1G41A 2VIIA 3KOZE 3KSJA 2F5OA 4GKKM 2FNAA 4I4LA 2DZNB 2A5YB 3L26A 3GQ5A 4LGMA 3FTDA 4NSOB 1SXJC 2F5SA 2KA6B 3OTOM 1KSFX 4K0KM 1GL6A 4JYAM 2FE8A 2Y0TA 1IN4A 3GPUA 3HJSA 4L78A 4JXJA 3JR5A 2XSZA 3U6CA 7CATA 3KS8A 3U6SA 3M0EA 2UUCM 2XFTA 4BBAA 3FUXA 2VQFM 3GPXA 4FD2A 3VK8A 1FNNA 2RKOA 4B3TM 1PM5A 1DGBA 2FFJA 3AJIB 3U6EA 2Y20A 4IBIA 1LV7A 2C5RA 4DV3M 2QBYB 4WURA 5EJCA 5KQ8A 4BB9A 1NSFA 3CF0A 2Z7JA 4L16A 4FCVA 3GLFA 1G59A 2BJWA 3FD9A 1JR3D 3HHWA 1NHGC 4D82A 4AZFA 3GLFB 3K1JA 3I4VA 4X65M 4IBJA 3L28A 3TE6A 3AOEA 4D81A 1XXHB 3HJQA 4B7HA 2R46A 4OW0A 5EXPA 3C58A 1NHWC 4FWGA 1SXJE 3FUTA 2DWMA 1IN5A 4REZA 2KZUA 2XLJA 2DZOB 4MGIE 3U6MA 3U6QA 4GHLA 3AOEC 3D8BA 3FUUA 3VDUA 4OU7A 2JA2A 2X4AA 3CF6E 4LF8M 3FTFA 5KO3A 2DXIA 1TDHA 3KVWA 3EIHA 1QAMA 3K8ZA 4AI6A 2Z4RA 3EIEA 3HHYA 4IBEA 3J2PB 4MGZE 4OX9M 2XH9A 2XZUA 5LMUM 2V1CA 4LF9M 2LH0A 2D7EA 5EP3A 1QAQA 2CUZA 2L09A 1IBLM 3VDPA 2ZAMA 3SMSA 3J7AS 4LCBA 2XGNA 4GMQA 4LRSA 3TQSA 3J81S 3I51A 4L15A 4DR1M 1E9RA 3VLFB 3TPZA 3KSXA 3PFIA 4ITQA 3GQ4A 4LF6M 2UXDM 1GL7A 3FTCA 5EXTA 3R8FA 2F4VM 2DWZB 1Z5AA 1R6BX 4LF5M 4MH0E 4L4UA 3THGA 4DV7M 2XSZD 3BOSA 5JI3E 3QAUA 1HQCA 4KODA 5H37D 4X64M 1OFIA 3HU1A 2D7GA 4OVZA 4DV1M 1TH4A 4LJ8A 5E26A 5ITXA 4OVZB 1NVMA 3HWSA 4AKHA 1KYIA 4GITA 5E6JA 1HNXM 3VK7A 4GHAA 4S12A 3A46A 4QNRA 4RNAA 1DO2A 1QANA 2RGHA 3AV0A 3J27B 1N77A 3GLGA 1TDZA 3GLGB 4KLNA 2K47A 2LNHC 1IM2A 2DWLA 3AL0C 4LFCM 3U6DA 4TUWA 2I7NA 4IBBA 4AG6A 5LMNM 1MX0A 4DV0M 3J7BA 2HHHM 3HJ8A 5GKNA 4JV5M 5FSWA 4JI6M 1E94E 1TH3A 3RGPA 5A2QS 1Z5BA 3U6OA 4XBOA 4NL4H 3E9SA 1QQWA 2YNMD 1N78A 1R7RA 5IREB 1ZQ9A 4FWHA 4JI7M 5EP4A 1IXRC 4B08A 1HR0M 3PVSA 3MHVC 1IXZA 1L2BA 1IQPA 3SATA 4G4OA 3PNVA 1Q39A 1IY2A 4WW0A 3SC3A 2C99A 1QYRA 4JI1M 4IBFA 2R45A 2EO2A 3KFUG 1HNZM 2NQ8C 4LG2A 2CV1A 3FTEA 1N33M 3HU2A 2HKJA 2LXEA 4FCWA 2C9CA 2XZFA 4MGYE 4DV2M 4B3SM 1XC8A 2ZBKB 3VKGA 2Q2EB 4RF0A 3MK6A 1N36M 3WHKA 3TWKA 1K3XA 4IBDA 2KXEA 3PNYA 4IBGA 1HNWM 3D8LA 1D2NA 4NSRA 3RFWA 4GH9A 3T1HM 2ZANA 1XHBA 4LFAM 4IBKA 4G6ZA 2J7NA 3GRUA 2CHVA 4JI2M 1K3WA 3SYLA 4AG5A 1K82A 2BNKA 3ILKA 1T3TA 5ITYA 1YUBA 2VQEM 3GQ3A 3H4MA 3FUWA 2C96A 2R18A 1L2DA 1NNUC 3K2LA 4I8OA 4II7A 2CV2A 2QENA 3ZC7B 3NBIA 1L2CA 2O5RA 3A42A 2QP9X 2L7IA 3DZDA 4G4QA 2QZ4A 4YY3M 3T1YM 5F3WA 1I94M 1GLNA 3IG8A 4Z6YA 2OQ4A 2G5GX 4LJ4A 4JI0M 5EP2A 5FLXS 2QPAA 2D7HA 5DYGA 3UK6A 5EQTA 2F5NA 4HLQA 2E5LM 1IXSB 1KFVA 5KPRA 4XGIA 3SAUA 2UUBM 4MGKE 4DR4M 1HQYE 3KP1E 3U61A 3NWLA 4KHPM 2CE7A 3U61B 3KDSE 1R2YA 1DGGA 2J7OA 4B3MM 3I4YA 2KEBA 3TL4X 3GRYA 4DR7M 3DA1A 3GPYA 3J80S 3U60A 4PDGA 1FJGM 1Z6TA 1C1KA 3U60B 5IT9S 5IWAM 1NNJA 1IN6A 2YQZA 1E32A 3SHFA 3HHZA 4NXNM 4GKJM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TUW A;  4QOZ C;  4L8R C; 
#chains in the Genus database with same CATH topology
 2QCU A;  1V92 A;  1Y8G A;  3H4J A;  3L27 A;  4GC5 A;  3LMM A;  4LJ9 A;  3UMM A;  1QAO A;  3WHL A;  1XNR M;  4MB7 A;  4QOS A;  4JI3 M;  2WSE F;  1OFH A;  2Y0Q A;  4GEW A;  5L8R F;  3LQQ A;  4AW4 A;  1EIJ A;  1MU5 A;  2CWB A;  2CV0 A;  4PT5 A;  1GO5 A;  3U5Z A;  2KZS A;  2Z4S A;  2B3T A;  2L7H A;  4Y28 F;  4JI8 M;  4LZZ A;  2MH8 A;  3U5Z B;  2JNH A;  2MR9 A;  3LVV A;  3KS4 A;  2F5P A;  2EKK A;  1YLA A;  1S3S A;  1XB2 B;  1N32 M;  4PCZ A;  4Q7J A;  3K9P A;  4GC9 A;  1TGU A;  1NY6 A;  2DAI A;  2YR0 A;  4DV6 M;  3FKE A;  5JI2 E;  4M0D A;  3KP0 E;  2LVP C;  4LY6 A;  2DAG A;  4B3R M;  4JI4 M;  4I81 A;  5KQD A;  2KW0 A;  2ZTC A;  4UN2 B;  5DNY A;  5FTL A;  4YHH M;  1OAO C;  1XWI A;  4QHS A;  1NY5 A;  2FOI C;  3M7G A;  2KRK A;  2V6Z M;  3K9O A;  4LJ7 A;  2V1U A;  2M5Z A;  3TWL A;  2BJV A;  3HHX A;  5FTJ A;  2DAM A;  3AFH A;  3GPP A;  3GP1 A;  2R4J A;  2LWX A;  4R71 A;  4IBC A;  1VQ1 A;  4MGH A;  3SAR A;  1TTE A;  3FUV A;  3E4R A;  1ZMU A;  4FVM A;  5ITU A;  2CEA A;  3Q8X A;  4DV4 M;  1MJG M;  1X37 A;  3R9X B;  1IFY A;  3K92 A;  1EE8 A;  2KDL A;  3SBJ A;  1XNQ M;  1VDD A;  2OO9 A;  2EUC A;  4LJ5 A;  3B7Z A;  3CTW B;  3B7N A;  4JN6 A;  2FH0 A;  3FYC A;  1P3Q Q;  5DYI A;  3SAS A;  4DR6 M;  2H5X A;  4EIW A;  4B7F A;  2F5Q A;  4NOO B;  3VKH A;  4DR2 M;  4LJA A;  4CHT B;  3ZCB B;  1G3I A;  2W82 A;  2G3Q A;  2ZAO A;  4FCT A;  1ORY B;  3GRV A;  2HCB A;  4LGY A;  1UM8 A;  5ITX E;  4P16 A;  4CIZ A;  1J7K A;  1QDR A;  2P5T A;  4W5W A;  5IZ7 D;  3L25 A;  4DR5 M;  3LVW A;  4NRV A;  1WR1 B;  3PXG A;  1E9S A;  1NJG A;  2UUA M;  1Q02 A;  2JY5 A;  3HU3 A;  4I5S A;  4FW9 A;  8CAT A;  1I4W A;  2RGO A;  2K6B A;  3L2A A;  3GLG E;  2DWN A;  3GLH A;  5KPZ A;  4GRI A;  3GLH B;  4L6V 6;  2M60 A;  3IHP A;  4IJE A;  1HJP A;  2UXC M;  2XEP A;  4LZJ A;  4MM3 B;  1W5S A;  2ERC A;  4DUZ M;  3GRR A;  2LVQ D;  2VDB B;  1QVR A;  4JI5 M;  4AQY M;  4CGY B;  2L4F A;  3DFZ A;  4G4N A;  5FTN A;  4LF4 M;  1H6U A;  2Y21 A;  5KPT A;  3GO8 A;  1XXH A;  1V34 A;  1L8Q A;  1V33 A;  4M9Z A;  3SHG B;  2WZJ A;  2UU9 M;  3QWL A;  1XMQ M;  3HGI A;  5EXX A;  5FTK A;  1CUK A;  1WXQ A;  1NV8 A;  1WIV A;  1JB0 F;  2Z3X A;  3SAW A;  1RU3 A;  1IY1 A;  2O25 A;  1IY0 A;  3AKZ A;  4QNM A;  4Z8X A;  1R2Z A;  2UXB M;  1N34 M;  2AHM A;  4DBG B;  1QZM A;  4X62 M;  3SAV A;  3MJ5 A;  4QOZ C;  3BBZ A;  1N75 A;  1VEK A;  3LQR A;  1NJF A;  3RE8 A;  2CFO A;  1HT2 E;  3M6A A;  3W0F A;  4CJ6 A;  4LFB M;  4ZPX A;  1DGF A;  2HL7 A;  2HWJ A;  4NRW A;  1IBM M;  4IIW A;  4LF7 M;  3ZH9 B;  2YFQ A;  1Z59 A;  5ITQ A;  2C9O A;  1A5T A;  4R3D A;  5EXS A;  1DGH A;  3ZQJ A;  3U6P A;  1L1Z A;  4NXM M;  5ITT A;  1DGH B;  2DEN A;  2R65 A;  3C3E A;  2C98 A;  1TH2 A;  1SXJ D;  5DFL A;  3KOW E;  4PD2 A;  5BR8 M;  1JQJ C;  1PJJ A;  1J5E M;  2L6O A;  4DR3 M;  4AKI A;  1R4G A;  4X66 M;  3T15 A;  1ZV1 A;  5C1B A;  2CP8 A;  4DV5 M;  2DHR A;  3B89 A;  3IG5 A;  2QNJ A;  3JAM S;  3GLI A;  1HT1 E;  2G8L A;  1G8P A;  1GKI A;  3GLI B;  3FYD A;  2O01 F;  1OIZ A;  1YSY A;  3HKP A;  2R62 A;  4FWD A;  3RGS A;  1OAI A;  3W0L B;  2MJ5 B;  3A98 B;  3KW6 A;  4G4R A;  4HL4 A;  1GVN A;  1JR3 A;  2ZM6 M;  3UZU A;  1IN7 A;  2VF8 A;  2EA0 A;  3SFZ A;  1Z5C A;  2LVO C;  3U6L A;  3TWM A;  2QBY A;  1OJL A;  3KOX E;  1G4A E;  2CHG A;  2X49 A;  4LRT A;  5FTM A;  3T38 A;  4RF1 A;  3UGJ A;  4PDI A;  1Q3B A;  4NC6 A;  3DOA A;  4AKG A;  3KOY E;  4LJ6 A;  2XF3 A;  4M0W A;  2H1R A;  2K0B X;  1PJQ A;  2LTU A;  3UJN A;  1XMO M;  3L29 A;  5EP1 A;  2DZL A;  3E21 A;  4R7G A;  1R5L A;  2K9D A;  3A45 A;  4QHT A;  1Q3C A;  1YE9 A;  4M9S A;  3JR4 A;  1TF0 B;  2CHQ A;  2EJS A;  3MMP A;  4A3V B;  1W5T A;  3CF2 A;  4D80 A;  3C3D A;  2X8A A;  2DKL A;  3FRI A;  4DUY M;  4IJF A;  2JUJ A;  2I7P A;  5C18 A;  2ZTD A;  4BLC A;  2GNO A;  5ITR A;  3F92 A;  1IN8 A;  3B9P A;  4KO8 A;  4L8R C;  1ZAE A;  3AOG A;  4M9X A;  1LTM A;  2JXN A;  4GIP A;  3SMP A;  1J09 A;  3VFD A;  1SXJ A;  1DO0 A;  1DV0 A;  1SXJ B;  1L1T A;  5BPV A;  3SYK A;  2DVW B;  1IBK M;  3IEC A;  4CIS A;  2R4E A;  4B7G A;  2XFS A;  3KXE C;  2KRU A;  2LVN C;  1G41 A;  2VII A;  1PJT A;  3KOZ E;  3KSJ A;  2F5O A;  4GKK M;  2FNA A;  4I4L A;  2DZN B;  2A5Y B;  2KHH A;  1VDL A;  3L26 A;  3GQ5 A;  4LGM A;  1NO1 A;  3FTD A;  4NSO B;  1SXJ C;  2F5S A;  2KA6 B;  3OTO M;  1KSF X;  4K0K M;  1GL6 A;  4JYA M;  2FE8 A;  2Y0T A;  1IN4 A;  3GPU A;  3HJS A;  4L78 A;  1QDT A;  3B74 A;  4JXJ A;  3JR5 A;  2QSF X;  2XSZ A;  1PGY A;  4G3O A;  7CAT A;  3U6C A;  2Z8Y M;  3KS8 A;  2BWE A;  3U6S A;  3M0E A;  2UUC M;  2XFT A;  4BBA A;  3FUX A;  2VQF M;  3GPX A;  3HX3 A;  4FD2 A;  2MRO B;  2WSC F;  3VK8 A;  1FNN A;  2RKO A;  4B3T M;  1PM5 A;  1DGB A;  2FFJ A;  3AJI B;  3U6E A;  2Y20 A;  4IBI A;  1LV7 A;  2C5R A;  4DV3 M;  2QBY B;  4WUR A;  5EJC A;  5KQ8 A;  4BB9 A;  1NSF A;  2KNA A;  3CF0 A;  2Z7J A;  4L16 A;  4FCV A;  3GLF A;  1G59 A;  2BJW A;  3FD9 A;  1JR3 D;  3HHW A;  1NHG C;  4D82 A;  4AZF A;  3GLF B;  1VEJ A;  3K1J A;  3I4V A;  4X65 M;  4IBJ A;  3L28 A;  3TE6 A;  3AOE A;  4D81 A;  1AIP C;  1XXH B;  3HJQ A;  1G71 A;  4B7H A;  2R46 A;  4OW0 A;  5EXP A;  4XK8 F;  3C58 A;  2JZ1 A;  3CGW A;  1NHW C;  4FWG A;  1SXJ E;  3FUT A;  2DWM A;  2HAK A;  1IN5 A;  2R6F A;  3QYE A;  4REZ A;  2KZU A;  2XLJ A;  2DZO B;  4MGI E;  3U6M A;  3U6Q A;  1VEG A;  4GHL A;  3AOE C;  3D8B A;  2DHY A;  3FUU A;  3NBX X;  2JA2 A;  3VDU A;  4OU7 A;  1WGN A;  4F1I A;  2X4A A;  3CF6 E;  4LF8 M;  3FTF A;  2JY7 A;  5KO3 A;  2DXI A;  1TDH A;  3KVW A;  3EIH A;  2KNZ A;  1QAM A;  3K8Z A;  4AI6 A;  2Z4R A;  3T6P A;  3EIE A;  3HHY A;  4IBE A;  3J2P B;  4MGZ E;  4OX9 M;  2XH9 A;  2XZU A;  1SG9 A;  1EFU B;  2V1C A;  5LMU M;  4LF9 M;  2LH0 A;  2D7E A;  5EP3 A;  1QAQ A;  2CUZ A;  2L09 A;  2FS1 A;  1IBL M;  2J5Y A;  3VDP A;  2ZAM A;  3SMS A;  3J7A S;  4LCB A;  2XGN A;  4GMQ A;  4LRS A;  3TQS A;  3J81 S;  3I51 A;  4L15 A;  2JY8 A;  4DR1 M;  1E9R A;  2JY6 B;  3VLF B;  3TPZ A;  3KSX A;  3PFI A;  4ITQ A;  3GQ4 A;  4LF6 M;  3GLH E;  2UXD M;  1GL7 A;  1T6O A;  2EKF A;  1QUT A;  3FTC A;  5EXT A;  3R8F A;  2F4V M;  2DWZ B;  1Z5A A;  1R6B X;  3B7Q A;  4LF5 M;  4MH0 E;  4L4U A;  3THG A;  2L4E A;  1PRB A;  4DV7 M;  2LBC A;  2XSZ D;  3BOS A;  5JI3 E;  3GLF E;  3QAU A;  1HQC A;  4KOD A;  5H37 D;  4X64 M;  1OFI A;  3HU1 A;  2D7G A;  2JWS A;  4OVZ A;  4DV1 M;  1TH4 A;  4LJ8 A;  5E26 A;  5ITX A;  4OVZ B;  1NVM A;  1XXH E;  3HWS A;  2OOA A;  4AKH A;  1D0M A;  1KYI A;  4GIT A;  5E6J A;  3W68 A;  1HNX M;  3VK7 A;  4GHA A;  4S12 A;  3A46 A;  4QNR A;  4RNA A;  1DO2 A;  1QAN A;  2RGH A;  3AV0 A;  3J27 B;  1N77 A;  3GLG A;  4HEO A;  1UFZ A;  3E46 A;  1TDZ A;  3GLG B;  4KLN A;  2K47 A;  1ZMW A;  2LNH C;  2LVA A;  1IM2 A;  2DWL A;  3AL0 C;  3HY5 A;  4LFC M;  3U6D A;  2WSF F;  4TUW A;  2I7N A;  4IBB A;  4AG6 A;  5LMN M;  1MX0 A;  4DV0 M;  3J7B A;  1OTR A;  2BWB A;  2CRU A;  2HHH M;  3HJ8 A;  5GKN A;  4JV5 M;  5FSW A;  4JI6 M;  1E94 E;  1OKS A;  1TH3 A;  1WGL A;  3RGP A;  5A2Q S;  1Z5B A;  3U6O A;  2R44 A;  1OQY A;  4XBO A;  4NL4 H;  1GJT A;  3I01 M;  3E9S A;  2GQF A;  1QQW A;  2YNM D;  1N78 A;  1R7R A;  5IRE B;  1ZQ9 A;  4FWH A;  4JI7 M;  3I04 M;  5EP4 A;  1GJS A;  1IXR C;  4B08 A;  3GLI E;  1HR0 M;  3PVS A;  2DAK A;  1IXZ A;  3MHV C;  2DI0 A;  1L2B A;  1C7Y A;  2JP7 A;  2LHC A;  1IQP A;  3SAT A;  4G4O A;  1GAB A;  3PNV A;  3LW5 F;  1Q39 A;  1IY2 A;  1JR3 E;  3BXW A;  2C99 A;  1QYR A;  2QHO B;  4WW0 A;  4KT0 F;  3SC3 A;  1OIP A;  4JI1 M;  4IBF A;  2R45 A;  2EO2 A;  3KFU G;  1F4I A;  3QYB A;  1HNZ M;  2NQ8 C;  1ZMV A;  3FRH A;  4LG2 A;  2CV1 A;  3FTE A;  3C9P A;  1N33 M;  3HU2 A;  2KNV A;  2MGW A;  2HKJ A;  1T43 A;  2LXE A;  2C9C A;  4FCW A;  2XZF A;  4MGY E;  4DV2 M;  4B3S M;  1XC8 A;  2ZBK B;  3VKG A;  2Q2E B;  4RF0 A;  3MK6 A;  1PJI A;  2QQ8 A;  1N36 M;  3WHK A;  3TWK A;  1K3X A;  4IBD A;  2KXE A;  3PNY A;  4IBG A;  1HNW M;  3D8L A;  1D2N A;  4NSR A;  3RFW A;  4GH9 A;  3T1H M;  2ZAN A;  3LCU A;  1TR8 A;  3V76 A;  1XHB A;  4LFA M;  4IBK A;  4G6Z A;  2J7N A;  3GRU A;  2CHV A;  4JI2 M;  1WHC A;  3FE3 A;  2RRU A;  1K3W A;  3SYL A;  1AUA A;  4AG5 A;  1K82 A;  2BNK A;  1QZE A;  3ILK A;  1T3T A;  5ITY A;  1YUB A;  2VQE M;  3GQ3 A;  4ANR A;  3H4M A;  1VG5 A;  3FUW A;  2C96 A;  2R18 A;  1L2D A;  1NNU C;  3K2L A;  4I8O A;  4II7 A;  2CV2 A;  3HZJ A;  2QEN A;  3ZC7 B;  3NBI A;  1L2C A;  4WP2 A;  1MN3 A;  2DNA A;  2O5R A;  3A42 A;  2QP9 X;  2L7I A;  1WJ7 A;  3DZD A;  4G4Q A;  2QZ4 A;  4YY3 M;  3T1Y M;  5F3W A;  3Q8G A;  1GLN A;  1I94 M;  3IG8 A;  4Z6Y A;  2OQ4 A;  2G5G X;  2DAE A;  4LJ4 A;  4P17 A;  4JI0 M;  5EP2 A;  5FLX S;  2QPA A;  1NV9 A;  2D7H A;  1IXS A;  1D0K A;  5DYG A;  5EQT A;  3UK6 A;  4HLQ A;  2F5N A;  2N35 A;  2E5L M;  1D0L A;  1IXS B;  1PJS A;  3LCV B;  1KFV A;  5KPR A;  4XGI A;  2VF7 A;  3SAU A;  2UUB M;  4MGK E;  4DR4 M;  1HQY E;  4RKU F;  3KP1 E;  3U61 A;  3NWL A;  4KHP M;  2CE7 A;  3U61 B;  3KDS E;  1R2Y A;  1DGG A;  2J7O A;  4B3M M;  2OPF A;  2L2D A;  3I4Y A;  2JZ0 A;  2KEB A;  3TL4 X;  3GRY A;  4DR7 M;  2LHG A;  4F2L A;  3DA1 A;  3GPY A;  3J80 S;  3U60 A;  4PDG A;  2R0I A;  1BVS A;  1QUS A;  1C1K A;  1Z6T A;  1FJG M;  3U60 B;  5IT9 S;  5IWA M;  1NNJ A;  1IN6 A;  2YQZ A;  1E32 A;  3SHF A;  2APL A;  3HHZ A;  4NXN M;  2OOB A;  3W67 A;  4GKJ M; 
#chains in the Genus database with same CATH homology
 2QCU A;  3L27 A;  4GC5 A;  3LMM A;  4LJ9 A;  3UMM A;  1QAO A;  3WHL A;  1XNR M;  4MB7 A;  4QOS A;  4JI3 M;  2Y0Q A;  1OFH A;  3LQQ A;  4AW4 A;  1MU5 A;  2CV0 A;  4PT5 A;  3U5Z A;  2KZS A;  2Z4S A;  2L7H A;  4JI8 M;  4LZZ A;  3U5Z B;  3LVV A;  3KS4 A;  2F5P A;  1S3S A;  1N32 M;  4PCZ A;  4GC9 A;  1TGU A;  1NY6 A;  2YR0 A;  4DV6 M;  3FKE A;  5JI2 E;  4M0D A;  3KP0 E;  4LY6 A;  4B3R M;  4JI4 M;  4I81 A;  5KQD A;  2KW0 A;  5DNY A;  5FTL A;  4YHH M;  1XWI A;  4QHS A;  1NY5 A;  2FOI C;  3M7G A;  2KRK A;  2V6Z M;  4LJ7 A;  2V1U A;  2M5Z A;  3TWL A;  2BJV A;  3HHX A;  5FTJ A;  3AFH A;  3GPP A;  3GP1 A;  2OPF A;  2R4J A;  2LWX A;  4IBC A;  4MGH A;  3SAR A;  3FUV A;  3E4R A;  4FVM A;  5ITU A;  2CEA A;  3Q8X A;  4DV4 M;  1X37 A;  3R9X B;  3K92 A;  1EE8 A;  3SBJ A;  1XNQ M;  1VDD A;  2EUC A;  4LJ5 A;  3CTW B;  4JN6 A;  3FYC A;  5DYI A;  3SAS A;  4DR6 M;  4EIW A;  2F5Q A;  4B7F A;  3VKH A;  4NOO B;  4DR2 M;  4LJA A;  4CHT B;  3ZCB B;  1G3I A;  2W82 A;  2ZAO A;  4FCT A;  1ORY B;  3GRV A;  2HCB A;  4LGY A;  1UM8 A;  5ITX E;  4P16 A;  1J7K A;  2P5T A;  4W5W A;  5IZ7 D;  3L25 A;  4DR5 M;  3LVW A;  4NRV A;  3PXG A;  1E9S A;  1NJG A;  2UUA M;  3HU3 A;  4I5S A;  4FW9 A;  8CAT A;  1I4W A;  2RGO A;  3L2A A;  2DWN A;  3GLH A;  5KPZ A;  4GRI A;  3GLH B;  2M60 A;  4IJE A;  2UXC M;  2XEP A;  4LZJ A;  4MM3 B;  1W5S A;  2ERC A;  4DUZ M;  3GRR A;  1QVR A;  4JI5 M;  4AQY M;  4CGY B;  3DFZ A;  4G4N A;  5FTN A;  4LF4 M;  1H6U A;  2Y21 A;  5KPT A;  3GO8 A;  1XXH A;  1L8Q A;  4M9Z A;  3SHG B;  2UU9 M;  3QWL A;  1XMQ M;  3HGI A;  5EXX A;  5FTK A;  1WXQ A;  2Z3X A;  3SAW A;  1IY1 A;  1IY0 A;  3AKZ A;  4QNM A;  4Z8X A;  1R2Z A;  2UXB M;  1N34 M;  2AHM A;  4X62 M;  1QZM A;  3SAV A;  3MJ5 A;  4QOZ C;  1N75 A;  3LQR A;  1NJF A;  3RE8 A;  2CFO A;  1HT2 E;  3M6A A;  3W0F A;  4LFB M;  4ZPX A;  1DGF A;  2HL7 A;  4NRW A;  1IBM M;  4IIW A;  4LF7 M;  3ZH9 B;  2YFQ A;  1Z59 A;  5ITQ A;  2C9O A;  5EXS A;  4R3D A;  3U6P A;  1DGH A;  1L1Z A;  4NXM M;  5ITT A;  1DGH B;  2R65 A;  4PD2 A;  1PJI A;  2C98 A;  1TH2 A;  1SXJ D;  1PJJ A;  3KOW E;  5BR8 M;  1J5E M;  1JQJ C;  2L6O A;  4DR3 M;  4AKI A;  4X66 M;  3T15 A;  5C1B A;  4DV5 M;  2DHR A;  3IG5 A;  3JAM S;  3GLI A;  1HT1 E;  2G8L A;  1G8P A;  1GKI A;  3GLI B;  3FYD A;  3HKP A;  1YSY A;  4FWD A;  3W0L B;  2R62 A;  3RGS A;  3A98 B;  3KW6 A;  4G4R A;  4HL4 A;  1GVN A;  1JR3 A;  2ZM6 M;  3UZU A;  1IN7 A;  2EA0 A;  3SFZ A;  1Z5C A;  3U6L A;  2QBY A;  3TWM A;  1OJL A;  3KOX E;  1G4A E;  2CHG A;  2X49 A;  4LRT A;  5FTM A;  3T38 A;  4RF1 A;  3UGJ A;  4PDI A;  1Q3B A;  3DOA A;  4AKG A;  3KOY E;  4LJ6 A;  2XF3 A;  4M0W A;  2H1R A;  1XMO M;  3UJN A;  3L29 A;  5EP1 A;  4R7G A;  3A45 A;  4QHT A;  1Q3C A;  1YE9 A;  4M9S A;  3JR4 A;  2CHQ A;  4A3V B;  1W5T A;  3CF2 A;  4D80 A;  2X8A A;  4DUY M;  4IJF A;  5C18 A;  2I7P A;  4BLC A;  5ITR A;  4KO8 A;  1IN8 A;  3B9P A;  4L8R C;  1ZAE A;  3AOG A;  4M9X A;  3SMP A;  4GIP A;  3VFD A;  1J09 A;  1SXJ A;  1DO0 A;  1SXJ B;  1L1T A;  5BPV A;  3SYK A;  2DVW B;  1IBK M;  4CIS A;  2R4E A;  4B7G A;  2XFS A;  3KXE C;  2KRU A;  1G41 A;  2VII A;  3KOZ E;  3KSJ A;  2F5O A;  4GKK M;  2FNA A;  4I4L A;  2DZN B;  2A5Y B;  3L26 A;  3GQ5 A;  4LGM A;  3FTD A;  4NSO B;  1SXJ C;  2F5S A;  2KA6 B;  3OTO M;  1KSF X;  4K0K M;  1GL6 A;  4JYA M;  2FE8 A;  2Y0T A;  1IN4 A;  3GPU A;  3HJS A;  4L78 A;  4JXJ A;  3JR5 A;  2XSZ A;  3U6C A;  7CAT A;  3KS8 A;  3U6S A;  3M0E A;  2UUC M;  2XFT A;  4BBA A;  3FUX A;  2VQF M;  3GPX A;  4FD2 A;  3VK8 A;  1FNN A;  2RKO A;  4B3T M;  1PM5 A;  1DGB A;  2FFJ A;  3AJI B;  3U6E A;  2Y20 A;  4IBI A;  1LV7 A;  2C5R A;  4DV3 M;  2QBY B;  4WUR A;  5EJC A;  5KQ8 A;  4BB9 A;  1NSF A;  3CF0 A;  2Z7J A;  4L16 A;  4FCV A;  3GLF A;  1G59 A;  2BJW A;  3FD9 A;  1JR3 D;  3HHW A;  1NHG C;  4D82 A;  4AZF A;  3GLF B;  3K1J A;  3I4V A;  4X65 M;  4IBJ A;  3L28 A;  3TE6 A;  3AOE A;  4D81 A;  1XXH B;  3HJQ A;  4B7H A;  2R46 A;  4OW0 A;  5EXP A;  3C58 A;  1NHW C;  4FWG A;  1SXJ E;  3FUT A;  2DWM A;  1IN5 A;  4REZ A;  2KZU A;  2XLJ A;  2DZO B;  4MGI E;  3U6M A;  3U6Q A;  4GHL A;  3AOE C;  3D8B A;  3FUU A;  3VDU A;  4OU7 A;  2JA2 A;  2X4A A;  3CF6 E;  4LF8 M;  3FTF A;  5KO3 A;  2DXI A;  1TDH A;  3KVW A;  3EIH A;  1QAM A;  3K8Z A;  4AI6 A;  2Z4R A;  3EIE A;  3HHY A;  4IBE A;  3J2P B;  4MGZ E;  4OX9 M;  2XH9 A;  2XZU A;  5LMU M;  2V1C A;  4LF9 M;  2LH0 A;  2D7E A;  5EP3 A;  1QAQ A;  2CUZ A;  2L09 A;  1IBL M;  3VDP A;  2ZAM A;  3SMS A;  3J7A S;  4LCB A;  2XGN A;  4GMQ A;  4LRS A;  3TQS A;  3J81 S;  3I51 A;  4L15 A;  4DR1 M;  1E9R A;  3VLF B;  3TPZ A;  3KSX A;  3PFI A;  4ITQ A;  3GQ4 A;  4LF6 M;  2UXD M;  1GL7 A;  3FTC A;  5EXT A;  3R8F A;  2F4V M;  2DWZ B;  1Z5A A;  1R6B X;  4LF5 M;  4MH0 E;  4L4U A;  3THG A;  4DV7 M;  2XSZ D;  3BOS A;  5JI3 E;  3QAU A;  1HQC A;  4KOD A;  5H37 D;  4X64 M;  1OFI A;  3HU1 A;  2D7G A;  4OVZ A;  4DV1 M;  1TH4 A;  4LJ8 A;  5E26 A;  5ITX A;  4OVZ B;  1NVM A;  3HWS A;  4AKH A;  1KYI A;  4GIT A;  5E6J A;  1HNX M;  3VK7 A;  4GHA A;  4S12 A;  3A46 A;  4QNR A;  4RNA A;  1DO2 A;  1QAN A;  2RGH A;  3AV0 A;  3J27 B;  1N77 A;  3GLG A;  1TDZ A;  3GLG B;  4KLN A;  2K47 A;  2LNH C;  1IM2 A;  2DWL A;  3AL0 C;  4LFC M;  3U6D A;  4TUW A;  2I7N A;  4IBB A;  4AG6 A;  5LMN M;  1MX0 A;  4DV0 M;  3J7B A;  2HHH M;  3HJ8 A;  5GKN A;  4JV5 M;  5FSW A;  4JI6 M;  1E94 E;  1TH3 A;  3RGP A;  5A2Q S;  1Z5B A;  3U6O A;  4XBO A;  4NL4 H;  3E9S A;  1QQW A;  2YNM D;  1N78 A;  1R7R A;  5IRE B;  1ZQ9 A;  4FWH A;  4JI7 M;  5EP4 A;  1IXR C;  4B08 A;  1HR0 M;  3PVS A;  3MHV C;  1IXZ A;  1L2B A;  1IQP A;  3SAT A;  4G4O A;  3PNV A;  1Q39 A;  1IY2 A;  4WW0 A;  3SC3 A;  2C99 A;  1QYR A;  4JI1 M;  4IBF A;  2R45 A;  2EO2 A;  3KFU G;  1HNZ M;  2NQ8 C;  4LG2 A;  2CV1 A;  3FTE A;  1N33 M;  3HU2 A;  2HKJ A;  2LXE A;  4FCW A;  2C9C A;  2XZF A;  4MGY E;  4DV2 M;  4B3S M;  1XC8 A;  2ZBK B;  3VKG A;  2Q2E B;  4RF0 A;  3MK6 A;  1N36 M;  3WHK A;  3TWK A;  1K3X A;  4IBD A;  2KXE A;  3PNY A;  4IBG A;  1HNW M;  3D8L A;  1D2N A;  4NSR A;  3RFW A;  4GH9 A;  3T1H M;  2ZAN A;  1XHB A;  4LFA M;  4IBK A;  4G6Z A;  2J7N A;  3GRU A;  2CHV A;  4JI2 M;  1K3W A;  3SYL A;  4AG5 A;  1K82 A;  2BNK A;  3ILK A;  1T3T A;  5ITY A;  1YUB A;  2VQE M;  3GQ3 A;  3H4M A;  3FUW A;  2C96 A;  2R18 A;  1L2D A;  1NNU C;  3K2L A;  4I8O A;  4II7 A;  2CV2 A;  2QEN A;  3ZC7 B;  3NBI A;  1L2C A;  2O5R A;  3A42 A;  2QP9 X;  2L7I A;  3DZD A;  4G4Q A;  2QZ4 A;  4YY3 M;  3T1Y M;  5F3W A;  1I94 M;  1GLN A;  3IG8 A;  4Z6Y A;  2OQ4 A;  2G5G X;  4LJ4 A;  4JI0 M;  5EP2 A;  5FLX S;  2QPA A;  2D7H A;  5DYG A;  3UK6 A;  5EQT A;  2F5N A;  4HLQ A;  2E5L M;  1IXS B;  1KFV A;  5KPR A;  4XGI A;  3SAU A;  2UUB M;  4MGK E;  4DR4 M;  1HQY E;  3KP1 E;  3U61 A;  3NWL A;  4KHP M;  2CE7 A;  3U61 B;  3KDS E;  1R2Y A;  1DGG A;  2J7O A;  4B3M M;  3I4Y A;  2KEB A;  3TL4 X;  3GRY A;  4DR7 M;  3DA1 A;  3GPY A;  3J80 S;  3U60 A;  4PDG A;  1FJG M;  1Z6T A;  1C1K A;  3U60 B;  5IT9 S;  5IWA M;  1NNJ A;  1IN6 A;  2YQZ A;  1E32 A;  3SHF A;  3HHZ A;  4NXN M;  4GKJ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...