4TUWA

Drosophila stem-loop binding protein complexed with histone mrna stem-loop, phospho mimic of tpnk and c-terminal region
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
71
Chain Sequence
b'SSYTEADPAILSRRQKQIDYGKNTAAYERYVEMVPRTRDHPREPNKYGKYSRRAFDGLVKIWRKSLHIYDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone RNA hairpin-binding protein
publication title Molecular mechanisms for the regulation of histone mRNA stem-loop-binding protein by phosphorylation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein/rna
total genus 22
structure length 71
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15247 SLBP_RNA_bind Histone RNA hairpin-binding protein RNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1120 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4tuwA00
4QOZC 4TUWA 4L8RC
chains in the Genus database with same CATH superfamily
4I8OA 4OU7A 1R6BX 4Q7JA 4PT5A 5EJCA 1DGBA 1OKSA 1XXHE 4LJ4A 4RF0A 3T1HM 2J5YA 2C9OA 4UN2B 2BWBA 3KOWE 3I51A 2D7GA 2JY5A 3W0LB 1K3WA 1IY0A 2LXEA 4GIPA 1ZMVA 1V92A 3FUWA 5FTNA 1PJIA 5L8RF 1V33A 3K9PA 3LQRA 4XGIA 3M0EA 3K9OA 3MJ5A 5ITUA 3HX3A 3LQQA 1QDTA 1TR8A 1GLNA 1Z59A 2EKKA 2C98A 2R0IA 4L78A 1I94M 1PJSA 4LF6M 1T6OA 2CE7A 4NRVA 1H6UA 4MGYE 4Y28F 2KRUA 5ITQA 3AJIB 3KFUG 2KRKA 5LMNM 3DA1A 4EIWA 1NJFA 2KEBA 3JAMS 1JQJC 4R3DA 2Y20A 2Z3XA 4JI0M 3SYKA 1QYRA 3FRIA 1K82A 2KZSA 2DAIA 3LCUA 1IN6A 4B7FA 5EXSA 2VF8A 3K8ZA 2R62A 4GHLA 3QYBA 4P16A 4W5WA 4PCZA 4DV1M 3KW6A 3CF0A 4QOZC 4X62M 4B7GA 2LVAA 4JI7M 1W5SA 5E6JA 2DXIA 3U6OA 2GQFA 4B08A 2N35A 2LVPC 1HQYE 2O5RA 3ILKA 1TH4A 1CUKA 1WGNA 3FYDA 3FTDA 3Q8XA 4GRIA 4G4RA 3U6EA 3GRYA 1IXSA 4JI4M 3K1JA 2I7PA 1XNRM 4QHTA 4BLCA 4DV5M 2G8LA 2G5GX 2ZTDA 3GRRA 4IBGA 1WHCA 1ZAEA 3E4RA 1L2CA 1PJQA 1IN7A 3ZC7B 2YNMD 3SHFA 4DR1M 1HJPA 1L1ZA 1DO2A 2XSZD 1XXHB 4REZA 4MGHA 4JI1M 3DFZA 1T43A 3V76A 4Z8XA 1QZEA 1XHBA 1ZMWA 3B7NA 4FWGA 2VQEM 3U6SA 4FD2A 4LJ6A 1R2YA 5LMUM 4GH9A 1DV0A 2K9DA 3FUUA 2HWJA 2D7EA 4FWHA 2RGHA 4LRTA 4LF7M 2KNAA 2F4VM 1DGHA 1Z6TA 4IBJA 2G3QA 2HL7A 4NOOB 1D0MA 2E5LM 3M6AA 4IBKA 2L7IA 1G41A 2R44A 2CV2A 2QENA 3QAUA 2FOIC 3HGIA 1S3SA 4B3RM 3GQ4A 3LCVB 3SYLA 2R4EA 5BPVA 1L1TA 2Y21A 1QAOA 2DZOB 4XK8F 1IBMM 5ITTA 4JV5M 4PD2A 2KZUA 3E21A 1HR0M 4L4UA 1Q02A 3FTFA 1TTEA 3FYCA 3T15A 4L15A 3MMPA 4M0DA 2OOAA 3SFZA 2CFOA 5E26A 3TWMA 1TDHA 2DAKA 4ZPXA 2QHOB 3A46A 4DR7M 2DWLA 3C3EA 1X37A 3MK6A 4NSOB 3KS8A 1WR1B 3VDPA 1J7KA 1G59A 1GL7A 1RU3A 5EXXA 5C18A 1KFVA 4LJ9A 2JY6B 1IXRC 1GKIA 3QYEA 4L8RC 5KPZA 3HZJA 4DR2M 1MJGM 4RF1A 2UUCM 1G3IA 1PGYA 2HHHM 3A45A 2AHMA 3U6QA 2Z4RA 3D8LA 3IG5A 4LJ8A 3VDUA 2LHGA 3IECA 4FVMA 5KPTA 4JI2M 2F5PA 4X65M 4MGKE 4LJ5A 1D0KA 3AL0C 2R46A 1R5LA 2JZ0A 2MR9A 2APLA 4IBFA 3L2AA 3ZQJA 1IQPA 5A2QS 2H1RA 4JI3M 4LGMA 8CATA 4DV3M 2CHQA 2MROB 4G6ZA 3PXGA 1XC8A 4GKJM 2UXCM 1OIZA 3CF2A 3CGWA 3LMMA 1G71A 1TGUA 3GLFA 5EP3A 3GP1A 1E94E 2LNHC 3JR5A 1HNWM 1D0LA 1DGGA 1OTRA 1Q3CA 2EUCA 1WGLA 3UMMA 4QNMA 4IBEA 3UGJA 1IY1A 3CF6E 1GABA 4IJFA 2MJ5B 3TPZA 1G8PA 4G4QA 4B7HA 1NY6A 2DAGA 3T1YM 3GRVA 3L26A 1TH3A 2C96A 1EIJA 2YR0A 4WP2A 1NNUC 2EJSA 3HU3A 2DAEA 3J7BA 4QOSA 2WSCF 4BB9A 3HHZA 3KOYE 1JB0F 3A42A 3J81S 2J7NA 4HLQA 3GLFE 4NXMM 3WHKA 3U6CA 1VG5A 5JI3E 2Y0QA 3KS4A 3SAUA 4RNAA 2XH9A 3GPUA 2H5XA 1R2ZA 1OJLA 2LWXA 3I4YA 4L16A 4IJEA 4TUWA 1MU5A 4IBDA 2OPFA 2R6FA 2ZAOA 5FTKA 3U60A 4PDIA 1Z5CA 3KVWA 2F5OA 4LY6A 3C58A 2UUAM 4B3SM 3FTCA 5KQDA 3H4JA 2ZANA 7CATA 4KHPM 1TH2A 2XGNA 5IREB 4D82A 3VKGA 1YLAA 2HCBA 3C3DA 4MB7A 2KHHA 1ZQ9A 2L4EA 4M9SA 4LJ7A 2DZNB 2F5QA 4LFCM 2HKJA 1OIPA 1XMOM 2KXEA 4DV0M 1QAMA 3Q8GA 2L6OA 2KW0A 2LTUA 4AKGA 2DKLA 3VFDA 2K0BX 1XWIA 4DV7M 2QBYB 3GLGA 2NQ8C 3HJ8A 2DVWB 4F1IA 2D7HA 3AOGA 2V1CA 2C5RA 1IY2A 1HNXM 2QNJA 3W68A 3PFIA 3GLIA 1TDZA 3R9XB 2DZLA 2J7OA 2DWZB 2YFQA 2ZBKB 5FTLA 3ZH9B 2P5TA 5ITXA 5KPRA 3PNYA 3FD9A 4QHSA 2EA0A 3U6DA 4OX9M 4GC9A 3SHGB 3B89A 5DNYA 2ERCA 1Y8GA 1YSYA 4YY3M 1VDLA 2DENA 5H37D 3J27B 1D2NA 1JR3D 5FSWA 1JR3A 4M9XA 3L29A 4DR3M 1KYIA 2ZTCA 3GLGE 3SASA 1WIVA 2X49A 4LCBA 3VK7A 2DAMA 3GLIE 1FNNA 3TWKA 4DV4M 5ITXE 1NJGA 2QSFX 2R45A 3GLFB 4DR5M 4LG2A 1AUAA 1HNZM 1VEJA 2JY7A 3A98B 2CRUA 4S12A 4XBOA 2RRUA 2CHVA 3I04M 3KSJA 4KT0F 1NSFA 2CV0A 1JR3E 4ITQA 1FJGM 2CEAA 1WXQA 4LFBM 2WZJA 3T38A 1J5EM 4IBBA 4FCVA 2B3TA 4JXJA 3KXEC 4R7GA 3GQ5A 3B7ZA 4DV6M 2FFJA 3OTOM 3AOEA 4GC5A 4L6V6 3LVWA 2JUJA 3B74A 1IN4A 3W67A 3FUVA 4JI8M 4AG6A 2QQ8A 3M7GA 2C9CA 2K47A 2KDLA 3SBJA 1IBLM 2VF7A 1GL6A 4DR6M 1VEKA 4NXNM 2JXNA 3MHVC 4WW0A 2JY8A 3RFWA 2UXBM 4NC6A 1F4IA 1OQYA 4MM3B 4OVZA 2Y0TA 3HJSA 1OAOC 1VQ1A 3L25A 4P17A 2OO9A 3HU2A 5IT9S 3F92A 3FE3A 3J7AS 1L8QA 1YUBA 3I01M 1UFZA 3D8BA 2JZ1A 3HY5A 3LW5F 3GLHA 3FUTA 4DUYM 2UU9M 1E9RA 4MH0E 2CUZA 4QNRA 1IXSB 2KNVA 4CISA 1XXHA 3HU1A 4GMQA 1NY5A 1VEGA 3HHXA 4IBIA 1NNJA 2F5SA 2OOBA 3UZUA 2VIIA 1NO1A 3GLGB 4G3OA 3GO8A 4DBGB 5GKNA 1LTMA 2Z8YM 2DNAA 3RGPA 4PDGA 4NL4H 4KLNA 3IG8A 5ITYA 1IXZA 5ITRA 3GLIB 4AKHA 1GJSA 3I4VA 2MH8A 1N77A 1I4WA 3JR4A 1PRBA 2K6BA 3HJQA 3SAVA 3SARA 4LF4M 4GITA 2LH0A 1TF0B 2XFSA 3GLHE 1QAQA 2WSEF 3K2LA 1SXJD 1N36M 3U6PA 3VLFB 1SXJA 3HHYA 3U5ZA 1IFYA 4CIZA 5EXTA 3THGA 2WSFF 3DOAA 5KO3A 3H4MA 4X64M 2L7HA 2L09A 4JI5M 1IM2A 4Z6YA 1Q39A 1QVRA 1NV9A 1XB2B 2FH0A 3TE6A 1DGHB 1E32A 2Q2EB 3EIHA 3VK8A 2M5ZA 4D81A 2OQ4A 4I4LA 1SG9A 2CP8A 3RGSA 2LVNC 3J80S 5C1BA 1L2BA 4GHAA 3VKHA 3TWLA 3W0FA 4K0KM 1N75A 3E9SA 2XZUA 3HWSA 4CJ6A 1PM5A 3T6PA 2L2DA 1SXJE 1MN3A 1Q3BA 2JWSA 1QQWA 2KNZA 2BNKA 3KDSE 5KQ8A 1J09A 2FNAA 3U6MA 2M60A 3R8FA 2JP7A 1NHGC 2R4JA 1GO5A 4NRWA 1ORYB 2V6ZM 3J2PB 4AG5A 2Z7JA 3NBXX 1VDDA 4BBAA 2BJWA 3L27A 5BR8M 4F2LA 4LF9M 2EO2A 2Z4SA 1DO0A 3FUXA 1P3QQ 2W82A 4LZJA 3GPPA 2DWMA 1N78A 2CWBA 4AKIA 1ZMUA 3SATA 4FCWA 4AZFA 3QWLA 4MGZE 3U61A 3AV0A 3KP1E 2UXDM 4I81A 3TL4X 3GPXA 4G4NA 5DYIA 3NBIA 4A3VB 1R4GA 1OFIA 4HL4A 1KSFX 2YQZA 4CHTB 1HQCA 4ANRA 2RKOA 2O01F 3UJNA 3AKZA 3K92A 3KOZE 3KSXA 2ZM6M 4OVZB 2BWEA 2I7NA 3L28A 5DYGA 3E46A 3U6LA 4D80A 4MGIE 3NWLA 4IIWA 2FS1A 4DR4M 3FKEA 2A5YB 2X8AA 1QANA 1NHWC 1LV7A 3GLHB 3AFHA 3BBZA 4FW9A 1T3TA 3C9PA 1HT2E 1L2DA 1Z5AA 4AI6A 1N34M 2ZAMA 4IBCA 2XSZA 1OFHA 4II7A 3SC3A 2EKFA 1EE8A 1IN5A 1MX0A 2XF3A 3DZDA 2QZ4A 4LRSA 5EP4A 3B9PA 2GNOA 5DFLA 4RKUF 3PVSA 5FTMA 3GQ3A 2LBCA 1G4AE 4R71A 2LVQD 1ZV1A 5FTJA 3AOEC 5EP2A 3FRHA 2XEPA 1W5TA 3GPYA 2X4AA 4KO8A 1C7YA 4DUZM 2V1UA 4JYAM 4X66M 2QPAA 4JN6A 4WURA 2QP9X 1SXJB 3U5ZB 1HT1E 2CHGA 5EP1A 1IBKM 2F5NA 1QUSA 3EIEA 3KOXE 1DGFA 2UUBM 1C1KA 1XNQM 4GEWA 2QCUA 4LJAA 1Z5BA 1NV8A 3SMPA 2CV1A 1V34A 3UK6A 1NVMA 1AIPC 4KODA 4OW0A 5FLXS 4CGYB 4JI6M 1E9SA 1N32M 3KP0E 4DV2M 3U60B 2O25A 2KA6B 4LFAM 3CTWB 4G4OA 2VQFM 3IHPA 4FWDA 1QDRA 3BXWA 4HEOA 4M0WA 4M9ZA 1BVSA 4AQYM 1PJTA 4I5SA 2QBYA 2LVOC 2DHYA 5IWAM 2LHCA 5EXPA 4FCTA 4GKKM 1QZMA 4AW4A 2DHRA 1WJ7A 2FE8A 3BOSA 4NSRA 1K3XA 5IZ7D 3RE8A 2JNHA 2R18A 3HKPA 2MGWA 3SMSA 5F3WA 1YE9A 5JI2E 4YHHM 3GRUA 3TQSA 1GJTA 1A5TA 4LGYA 3FTEA 4LZZA 2R65A 4LF8M 2BJVA 1OAIA 2DI0A 2XLJA 3SAWA 2HAKA 1UM8A 1XMQM 2DWNA 3ZCBB 2L4FA 2XFTA 3U61B 4B3TM 1N33M 2VDBB 2RGOA 3HHWA 3WHLA 2XZFA 1EFUB 1GVNA 1R7RA 3PNVA 4LF5M 1QUTA 3B7QA 1PJJA 2JA2A 2C99A 5EQTA 3LVVA 1SXJC 4B3MM 1IN8A
chains in the Genus database with same CATH topology
4I8OA 4OU7A 1R6BX 4PT5A 5EJCA 1DGBA 4LJ4A 4RF0A 3T1HM 2C9OA 3KOWE 3I51A 2D7GA 3W0LB 1K3WA 1IY0A 2LXEA 4GIPA 3FUWA 5FTNA 1PJIA 4XGIA 3LQRA 3M0EA 3MJ5A 5ITUA 3LQQA 1Z59A 1GLNA 1I94M 2C98A 4L78A 4LF6M 2CE7A 4NRVA 1H6UA 4MGYE 2KRUA 5ITQA 3AJIB 3KFUG 2KRKA 5LMNM 3DA1A 4EIWA 1NJFA 2KEBA 3JAMS 1JQJC 4R3DA 2Y20A 2Z3XA 4JI0M 3SYKA 1QYRA 1K82A 2KZSA 1IN6A 4B7FA 5EXSA 3K8ZA 2R62A 4GHLA 4P16A 4W5WA 4PCZA 4DV1M 3KW6A 3CF0A 4QOZC 4X62M 4B7GA 4JI7M 1W5SA 5E6JA 2DXIA 3U6OA 4B08A 2O5RA 1HQYE 3ILKA 1TH4A 4GRIA 3FYDA 3FTDA 3Q8XA 4G4RA 3U6EA 3GRYA 4JI4M 3K1JA 2I7PA 1XNRM 4QHTA 4BLCA 4DV5M 2G8LA 2G5GX 4IBGA 3GRRA 1ZAEA 3E4RA 1L2CA 1IN7A 3ZC7B 2YNMD 3SHFA 4DR1M 1L1ZA 1DO2A 2XSZD 1XXHB 4REZA 4MGHA 4JI1M 3DFZA 4Z8XA 1XHBA 4FWGA 2VQEM 3U6SA 4FD2A 4LJ6A 1R2YA 5LMUM 4GH9A 3FUUA 2D7EA 4FWHA 2RGHA 4LRTA 4LF7M 2F4VM 1DGHA 1Z6TA 4IBJA 2HL7A 4NOOB 2E5LM 3M6AA 4IBKA 2L7IA 1G41A 2CV2A 2QENA 3QAUA 2FOIC 3HGIA 1S3SA 4B3RM 3GQ4A 5BPVA 3SYLA 2R4EA 1L1TA 2Y21A 1QAOA 2DZOB 1IBMM 5ITTA 4JV5M 4PD2A 2KZUA 1HR0M 4L4UA 3FTFA 3FYCA 3T15A 4L15A 4M0DA 3SFZA 2CFOA 5E26A 3TWMA 1TDHA 4ZPXA 3A46A 4DR7M 2DWLA 3KS8A 1X37A 3MK6A 4NSOB 3VDPA 1J7KA 1G59A 1GL7A 5EXXA 5C18A 1KFVA 4LJ9A 1IXRC 1GKIA 4L8RC 5KPZA 4DR2M 2UUCM 4RF1A 1G3IA 2HHHM 3A45A 2AHMA 3U6QA 2Z4RA 3D8LA 3IG5A 4LJ8A 3VDUA 4FVMA 5KPTA 4JI2M 2F5PA 4X65M 4MGKE 4LJ5A 3AL0C 2R46A 4IBFA 3L2AA 1IQPA 5A2QS 2H1RA 4JI3M 4LGMA 8CATA 2CHQA 4G6ZA 3PXGA 1XC8A 4GKJM 2UXCM 3CF2A 3LMMA 1TGUA 3GLFA 5EP3A 3GP1A 1E94E 2LNHC 3JR5A 1HNWM 1DGGA 2EUCA 1Q3CA 3UMMA 4QNMA 4IBEA 3UGJA 1IY1A 3CF6E 4IJFA 3TPZA 1G8PA 4G4QA 4B7HA 1NY6A 3T1YM 3GRVA 3L26A 1TH3A 2C96A 2YR0A 1NNUC 3HU3A 4QOSA 3J7BA 4BB9A 3HHZA 4DV3M 3KOYE 3A42A 3J81S 2J7NA 4HLQA 4NXMM 3WHKA 3U6CA 5JI3E 2Y0QA 3KS4A 3SAUA 4RNAA 2XH9A 3GPUA 1R2ZA 1OJLA 2LWXA 3I4YA 4L16A 4IJEA 4TUWA 1MU5A 4IBDA 2OPFA 2ZAOA 5FTKA 3U60A 4PDIA 1Z5CA 3KVWA 2F5OA 4LY6A 3C58A 2UUAM 4B3SM 3FTCA 5KQDA 2ZANA 7CATA 4KHPM 1TH2A 2XGNA 5IREB 4D82A 3VKGA 2HCBA 4MB7A 1ZQ9A 4M9SA 4LJ7A 2DZNB 2F5QA 4LFCM 2HKJA 1XMOM 2KXEA 4DV0M 1QAMA 2L6OA 2KW0A 4AKGA 3VFDA 1XWIA 4DV7M 2QBYB 3GLGA 2NQ8C 3HJ8A 2DVWB 2D7HA 3AOGA 2V1CA 2C5RA 1IY2A 1HNXM 1TDZA 3GLIA 3PFIA 3R9XB 2J7OA 2DWZB 2YFQA 2ZBKB 5FTLA 3ZH9B 2P5TA 5ITXA 5KPRA 3PNYA 3FD9A 4QHSA 2EA0A 3U6DA 4GC9A 3SHGB 5DNYA 2ERCA 1YSYA 4YY3M 5H37D 3J27B 1D2NA 1JR3D 5FSWA 1JR3A 4M9XA 3L29A 4DR3M 1KYIA 3SASA 4LCBA 2X49A 3VK7A 1FNNA 3TWKA 4DV4M 5ITXE 1NJGA 2R45A 3GLFB 4DR5M 4LG2A 1HNZM 3A98B 4S12A 4XBOA 2CHVA 3KSJA 1NSFA 2CV0A 4ITQA 1FJGM 2CEAA 1WXQA 4LFBM 3T38A 1J5EM 4IBBA 4FCVA 3GQ5A 4JXJA 3KXEC 4R7GA 4DV6M 2FFJA 3OTOM 3AOEA 4GC5A 3LVWA 1IN4A 3FUVA 4JI8M 4AG6A 3M7GA 2C9CA 2K47A 3SBJA 1IBLM 1GL6A 4DR6M 4NXNM 3MHVC 4WW0A 3RFWA 2UXBM 4MM3B 4OVZA 2Y0TA 3HJSA 3L25A 3HU2A 5IT9S 3J7AS 1L8QA 1YUBA 3D8BA 3GLHA 3FUTA 4DUYM 2UU9M 1E9RA 4MH0E 2CUZA 4QNRA 1IXSB 4CISA 1XXHA 3HU1A 4GMQA 1NY5A 3HHXA 4IBIA 1NNJA 2F5SA 3UZUA 2VIIA 3GLGB 3GO8A 5GKNA 3RGPA 4PDGA 4NL4H 4KLNA 3IG8A 5ITYA 1IXZA 5ITRA 3GLIB 4AKHA 3I4VA 1N77A 1I4WA 3JR4A 3HJQA 3SAVA 3SARA 4LF4M 4GITA 2LH0A 2XFSA 1QAQA 3K2LA 1SXJD 1N36M 3U6PA 3VLFB 1SXJA 3HHYA 3U5ZA 5EXTA 3THGA 3DOAA 5KO3A 3H4MA 4X64M 2L7HA 2L09A 4JI5M 1IM2A 4Z6YA 1Q39A 1QVRA 3TE6A 1DGHB 1E32A 2Q2EB 3EIHA 3VK8A 2M5ZA 4D81A 2OQ4A 4I4LA 1L2BA 3RGSA 3J80S 5C1BA 4GHAA 3VKHA 3TWLA 3W0FA 4K0KM 1N75A 3E9SA 2XZUA 3HWSA 1PM5A 1SXJE 4OX9M 1Q3BA 2BNKA 1QQWA 3KDSE 3U6MA 5KQ8A 1J09A 2FNAA 2M60A 3R8FA 1NHGC 2R4JA 4NRWA 1ORYB 2V6ZM 3J2PB 4AG5A 2Z7JA 1VDDA 4BBAA 2BJWA 3L27A 5BR8M 4LF9M 2EO2A 2Z4SA 1DO0A 3FUXA 2W82A 4LZJA 3GPPA 2DWMA 4AKIA 1N78A 3SATA 4FCWA 4AZFA 3QWLA 4MGZE 3U61A 3AV0A 3KP1E 2UXDM 4I81A 3TL4X 3GPXA 4G4NA 5DYIA 3NBIA 4A3VB 1OFIA 4HL4A 1KSFX 2YQZA 4CHTB 1HQCA 2RKOA 3UJNA 3AKZA 3K92A 3KOZE 3KSXA 2ZM6M 4OVZB 2I7NA 3L28A 5DYGA 3U6LA 4D80A 4MGIE 3NWLA 4IIWA 4DR4M 3FKEA 2A5YB 2X8AA 1QANA 1NHWC 1LV7A 3GLHB 3AFHA 4FW9A 1T3TA 1HT2E 1L2DA 1Z5AA 4AI6A 1N34M 2ZAMA 4IBCA 2XSZA 1OFHA 4II7A 3SC3A 1EE8A 1IN5A 1MX0A 2XF3A 3DZDA 2QZ4A 4LRSA 5EP4A 3B9PA 3PVSA 5FTMA 3GQ3A 1G4AE 5FTJA 3AOEC 5EP2A 2XEPA 1W5TA 3GPYA 2X4AA 4KO8A 4DUZM 2V1UA 4JYAM 4X66M 2QPAA 4JN6A 4WURA 2QP9X 1SXJB 3U5ZB 1HT1E 2CHGA 5EP1A 1IBKM 2F5NA 3EIEA 3KOXE 1DGFA 2UUBM 1C1KA 1XNQM 2QCUA 4LJAA 1Z5BA 3SMPA 2CV1A 3UK6A 4JI6M 1NVMA 4KODA 4OW0A 5FLXS 4CGYB 1N32M 1E9SA 3KP0E 4DV2M 3U60B 4LFAM 2KA6B 4G4OA 3CTWB 2VQFM 4FWDA 4M9ZA 4M0WA 4AQYM 4I5SA 2QBYA 5IWAM 5EXPA 4FCTA 4GKKM 1QZMA 4AW4A 2DHRA 2FE8A 3BOSA 4NSRA 1K3XA 5IZ7D 3RE8A 2R18A 3HKPA 3SMSA 5F3WA 1YE9A 5JI2E 4YHHM 3GRUA 3TQSA 4LGYA 3FTEA 4LZZA 2R65A 4LF8M 2BJVA 2XLJA 3SAWA 1XMQM 1UM8A 2DWNA 3ZCBB 2XFTA 4B3TM 3U61B 1N33M 3HHWA 2RGOA 3WHLA 2XZFA 1GVNA 1R7RA 3PNVA 4LF5M 1PJJA 2JA2A 2C99A 5EQTA 3LVVA 1SXJC 4B3MM 1IN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QOZ C;  4TUW A;  4L8R C; 
#chains in the Genus database with same CATH topology
 4I8O A;  4OU7 A;  1R6B X;  4Q7J A;  4PT5 A;  5EJC A;  1DGB A;  1OKS A;  1XXH E;  4LJ4 A;  4RF0 A;  3T1H M;  2J5Y A;  2C9O A;  4UN2 B;  2BWB A;  3KOW E;  3I51 A;  2D7G A;  2JY5 A;  3W0L B;  1K3W A;  1IY0 A;  2LXE A;  4GIP A;  1ZMV A;  1V92 A;  3FUW A;  5FTN A;  1PJI A;  5L8R F;  1V33 A;  3K9P A;  3LQR A;  4XGI A;  3M0E A;  3K9O A;  3MJ5 A;  5ITU A;  3HX3 A;  3LQQ A;  1QDT A;  1TR8 A;  1GLN A;  1Z59 A;  2EKK A;  2C98 A;  2R0I A;  4L78 A;  1I94 M;  1PJS A;  4LF6 M;  1T6O A;  2CE7 A;  4NRV A;  1H6U A;  4MGY E;  4Y28 F;  2KRU A;  5ITQ A;  3AJI B;  3KFU G;  2KRK A;  5LMN M;  3DA1 A;  4EIW A;  1NJF A;  2KEB A;  3JAM S;  1JQJ C;  4R3D A;  2Y20 A;  2Z3X A;  4JI0 M;  3SYK A;  1QYR A;  3FRI A;  1K82 A;  2KZS A;  2DAI A;  3LCU A;  1IN6 A;  4B7F A;  5EXS A;  2VF8 A;  3K8Z A;  2R62 A;  4GHL A;  3QYB A;  4P16 A;  4W5W A;  4PCZ A;  4DV1 M;  3KW6 A;  3CF0 A;  4QOZ C;  4X62 M;  4B7G A;  2LVA A;  4JI7 M;  1W5S A;  5E6J A;  2DXI A;  3U6O A;  2GQF A;  4B08 A;  2N35 A;  2LVP C;  1HQY E;  2O5R A;  3ILK A;  1TH4 A;  1CUK A;  1WGN A;  3FYD A;  3FTD A;  3Q8X A;  4GRI A;  4G4R A;  3U6E A;  3GRY A;  1IXS A;  4JI4 M;  3K1J A;  2I7P A;  1XNR M;  4QHT A;  4BLC A;  4DV5 M;  2G8L A;  2G5G X;  2ZTD A;  3GRR A;  4IBG A;  1WHC A;  1ZAE A;  3E4R A;  1L2C A;  1PJQ A;  1IN7 A;  3ZC7 B;  2YNM D;  3SHF A;  4DR1 M;  1HJP A;  1L1Z A;  1DO2 A;  2XSZ D;  1XXH B;  4REZ A;  4MGH A;  4JI1 M;  3DFZ A;  1T43 A;  3V76 A;  4Z8X A;  1QZE A;  1XHB A;  1ZMW A;  3B7N A;  4FWG A;  2VQE M;  3U6S A;  4FD2 A;  4LJ6 A;  1R2Y A;  5LMU M;  4GH9 A;  1DV0 A;  2K9D A;  3FUU A;  2HWJ A;  2D7E A;  4FWH A;  2RGH A;  4LRT A;  4LF7 M;  2KNA A;  2F4V M;  1DGH A;  1Z6T A;  4IBJ A;  2G3Q A;  2HL7 A;  4NOO B;  1D0M A;  2E5L M;  3M6A A;  4IBK A;  2L7I A;  1G41 A;  2R44 A;  2CV2 A;  2QEN A;  3QAU A;  2FOI C;  3HGI A;  1S3S A;  4B3R M;  3GQ4 A;  3LCV B;  3SYL A;  2R4E A;  5BPV A;  1L1T A;  2Y21 A;  1QAO A;  2DZO B;  4XK8 F;  1IBM M;  5ITT A;  4JV5 M;  4PD2 A;  2KZU A;  3E21 A;  1HR0 M;  4L4U A;  1Q02 A;  3FTF A;  1TTE A;  3FYC A;  3T15 A;  4L15 A;  3MMP A;  4M0D A;  2OOA A;  3SFZ A;  2CFO A;  5E26 A;  3TWM A;  1TDH A;  2DAK A;  4ZPX A;  2QHO B;  3A46 A;  4DR7 M;  2DWL A;  3C3E A;  1X37 A;  3MK6 A;  4NSO B;  3KS8 A;  1WR1 B;  3VDP A;  1J7K A;  1G59 A;  1GL7 A;  1RU3 A;  5EXX A;  5C18 A;  1KFV A;  4LJ9 A;  2JY6 B;  1IXR C;  1GKI A;  3QYE A;  4L8R C;  5KPZ A;  3HZJ A;  4DR2 M;  1MJG M;  4RF1 A;  2UUC M;  1G3I A;  1PGY A;  2HHH M;  3A45 A;  2AHM A;  3U6Q A;  2Z4R A;  3D8L A;  3IG5 A;  4LJ8 A;  3VDU A;  2LHG A;  3IEC A;  4FVM A;  5KPT A;  4JI2 M;  2F5P A;  4X65 M;  4MGK E;  4LJ5 A;  1D0K A;  3AL0 C;  2R46 A;  1R5L A;  2JZ0 A;  2MR9 A;  2APL A;  4IBF A;  3L2A A;  3ZQJ A;  1IQP A;  5A2Q S;  2H1R A;  4JI3 M;  4LGM A;  8CAT A;  4DV3 M;  2CHQ A;  2MRO B;  4G6Z A;  3PXG A;  1XC8 A;  4GKJ M;  2UXC M;  1OIZ A;  3CF2 A;  3CGW A;  3LMM A;  1G71 A;  1TGU A;  3GLF A;  5EP3 A;  3GP1 A;  1E94 E;  2LNH C;  3JR5 A;  1HNW M;  1D0L A;  1DGG A;  1OTR A;  1Q3C A;  2EUC A;  1WGL A;  3UMM A;  4QNM A;  4IBE A;  3UGJ A;  1IY1 A;  3CF6 E;  1GAB A;  4IJF A;  2MJ5 B;  3TPZ A;  1G8P A;  4G4Q A;  4B7H A;  1NY6 A;  2DAG A;  3T1Y M;  3GRV A;  3L26 A;  1TH3 A;  2C96 A;  1EIJ A;  2YR0 A;  4WP2 A;  1NNU C;  2EJS A;  3HU3 A;  2DAE A;  3J7B A;  4QOS A;  2WSC F;  4BB9 A;  3HHZ A;  3KOY E;  1JB0 F;  3A42 A;  3J81 S;  2J7N A;  4HLQ A;  3GLF E;  4NXM M;  3WHK A;  3U6C A;  1VG5 A;  5JI3 E;  2Y0Q A;  3KS4 A;  3SAU A;  4RNA A;  2XH9 A;  3GPU A;  2H5X A;  1R2Z A;  1OJL A;  2LWX A;  3I4Y A;  4L16 A;  4IJE A;  4TUW A;  1MU5 A;  4IBD A;  2OPF A;  2R6F A;  2ZAO A;  5FTK A;  3U60 A;  4PDI A;  1Z5C A;  3KVW A;  2F5O A;  4LY6 A;  3C58 A;  2UUA M;  4B3S M;  3FTC A;  5KQD A;  3H4J A;  2ZAN A;  7CAT A;  4KHP M;  1TH2 A;  2XGN A;  5IRE B;  4D82 A;  3VKG A;  1YLA A;  2HCB A;  3C3D A;  4MB7 A;  2KHH A;  1ZQ9 A;  2L4E A;  4M9S A;  4LJ7 A;  2DZN B;  2F5Q A;  4LFC M;  2HKJ A;  1OIP A;  1XMO M;  2KXE A;  4DV0 M;  1QAM A;  3Q8G A;  2L6O A;  2KW0 A;  2LTU A;  4AKG A;  2DKL A;  3VFD A;  2K0B X;  1XWI A;  4DV7 M;  2QBY B;  3GLG A;  2NQ8 C;  3HJ8 A;  2DVW B;  4F1I A;  2D7H A;  3AOG A;  2V1C A;  2C5R A;  1IY2 A;  1HNX M;  2QNJ A;  3W68 A;  3PFI A;  3GLI A;  1TDZ A;  3R9X B;  2DZL A;  2J7O A;  2DWZ B;  2YFQ A;  2ZBK B;  5FTL A;  3ZH9 B;  2P5T A;  5ITX A;  5KPR A;  3PNY A;  3FD9 A;  4QHS A;  2EA0 A;  3U6D A;  4OX9 M;  4GC9 A;  3SHG B;  3B89 A;  5DNY A;  2ERC A;  1Y8G A;  1YSY A;  4YY3 M;  1VDL A;  2DEN A;  5H37 D;  3J27 B;  1D2N A;  1JR3 D;  5FSW A;  1JR3 A;  4M9X A;  3L29 A;  4DR3 M;  1KYI A;  2ZTC A;  3GLG E;  3SAS A;  1WIV A;  2X49 A;  4LCB A;  3VK7 A;  2DAM A;  3GLI E;  1FNN A;  3TWK A;  4DV4 M;  5ITX E;  1NJG A;  2QSF X;  2R45 A;  3GLF B;  4DR5 M;  4LG2 A;  1AUA A;  1HNZ M;  1VEJ A;  2JY7 A;  3A98 B;  2CRU A;  4S12 A;  4XBO A;  2RRU A;  2CHV A;  3I04 M;  3KSJ A;  4KT0 F;  1NSF A;  2CV0 A;  1JR3 E;  4ITQ A;  1FJG M;  2CEA A;  1WXQ A;  4LFB M;  2WZJ A;  3T38 A;  1J5E M;  4IBB A;  4FCV A;  2B3T A;  4JXJ A;  3KXE C;  4R7G A;  3GQ5 A;  3B7Z A;  4DV6 M;  2FFJ A;  3OTO M;  3AOE A;  4GC5 A;  4L6V 6;  3LVW A;  2JUJ A;  3B74 A;  1IN4 A;  3W67 A;  3FUV A;  4JI8 M;  4AG6 A;  2QQ8 A;  3M7G A;  2C9C A;  2K47 A;  2KDL A;  3SBJ A;  1IBL M;  2VF7 A;  1GL6 A;  4DR6 M;  1VEK A;  4NXN M;  2JXN A;  3MHV C;  4WW0 A;  2JY8 A;  3RFW A;  2UXB M;  4NC6 A;  1F4I A;  1OQY A;  4MM3 B;  4OVZ A;  2Y0T A;  3HJS A;  1OAO C;  1VQ1 A;  3L25 A;  4P17 A;  2OO9 A;  3HU2 A;  5IT9 S;  3F92 A;  3FE3 A;  3J7A S;  1L8Q A;  1YUB A;  3I01 M;  1UFZ A;  3D8B A;  2JZ1 A;  3HY5 A;  3LW5 F;  3GLH A;  3FUT A;  4DUY M;  2UU9 M;  1E9R A;  4MH0 E;  2CUZ A;  4QNR A;  1IXS B;  2KNV A;  4CIS A;  1XXH A;  3HU1 A;  4GMQ A;  1NY5 A;  1VEG A;  3HHX A;  4IBI A;  1NNJ A;  2F5S A;  2OOB A;  3UZU A;  2VII A;  1NO1 A;  3GLG B;  4G3O A;  3GO8 A;  4DBG B;  5GKN A;  1LTM A;  2Z8Y M;  2DNA A;  3RGP A;  4PDG A;  4NL4 H;  4KLN A;  3IG8 A;  5ITY A;  1IXZ A;  5ITR A;  3GLI B;  4AKH A;  1GJS A;  3I4V A;  2MH8 A;  1N77 A;  1I4W A;  3JR4 A;  1PRB A;  2K6B A;  3HJQ A;  3SAV A;  3SAR A;  4LF4 M;  4GIT A;  2LH0 A;  1TF0 B;  2XFS A;  3GLH E;  1QAQ A;  2WSE F;  3K2L A;  1SXJ D;  1N36 M;  3U6P A;  3VLF B;  1SXJ A;  3HHY A;  3U5Z A;  1IFY A;  4CIZ A;  5EXT A;  3THG A;  2WSF F;  3DOA A;  5KO3 A;  3H4M A;  4X64 M;  2L7H A;  2L09 A;  4JI5 M;  1IM2 A;  4Z6Y A;  1Q39 A;  1QVR A;  1NV9 A;  1XB2 B;  2FH0 A;  3TE6 A;  1DGH B;  1E32 A;  2Q2E B;  3EIH A;  3VK8 A;  2M5Z A;  4D81 A;  2OQ4 A;  4I4L A;  1SG9 A;  2CP8 A;  3RGS A;  2LVN C;  3J80 S;  5C1B A;  1L2B A;  4GHA A;  3VKH A;  3TWL A;  3W0F A;  4K0K M;  1N75 A;  3E9S A;  2XZU A;  3HWS A;  4CJ6 A;  1PM5 A;  3T6P A;  2L2D A;  1SXJ E;  1MN3 A;  1Q3B A;  2JWS A;  1QQW A;  2KNZ A;  2BNK A;  3KDS E;  5KQ8 A;  1J09 A;  2FNA A;  3U6M A;  2M60 A;  3R8F A;  2JP7 A;  1NHG C;  2R4J A;  1GO5 A;  4NRW A;  1ORY B;  2V6Z M;  3J2P B;  4AG5 A;  2Z7J A;  3NBX X;  1VDD A;  4BBA A;  2BJW A;  3L27 A;  5BR8 M;  4F2L A;  4LF9 M;  2EO2 A;  2Z4S A;  1DO0 A;  3FUX A;  1P3Q Q;  2W82 A;  4LZJ A;  3GPP A;  2DWM A;  1N78 A;  2CWB A;  4AKI A;  1ZMU A;  3SAT A;  4FCW A;  4AZF A;  3QWL A;  4MGZ E;  3U61 A;  3AV0 A;  3KP1 E;  2UXD M;  4I81 A;  3TL4 X;  3GPX A;  4G4N A;  5DYI A;  3NBI A;  4A3V B;  1R4G A;  1OFI A;  4HL4 A;  1KSF X;  2YQZ A;  4CHT B;  1HQC A;  4ANR A;  2RKO A;  2O01 F;  3UJN A;  3AKZ A;  3K92 A;  3KOZ E;  3KSX A;  2ZM6 M;  4OVZ B;  2BWE A;  2I7N A;  3L28 A;  5DYG A;  3E46 A;  3U6L A;  4D80 A;  4MGI E;  3NWL A;  4IIW A;  2FS1 A;  4DR4 M;  3FKE A;  2A5Y B;  2X8A A;  1QAN A;  1NHW C;  1LV7 A;  3GLH B;  3AFH A;  3BBZ A;  4FW9 A;  1T3T A;  3C9P A;  1HT2 E;  1L2D A;  1Z5A A;  4AI6 A;  1N34 M;  2ZAM A;  4IBC A;  2XSZ A;  1OFH A;  4II7 A;  3SC3 A;  2EKF A;  1EE8 A;  1IN5 A;  1MX0 A;  2XF3 A;  3DZD A;  2QZ4 A;  4LRS A;  5EP4 A;  3B9P A;  2GNO A;  5DFL A;  4RKU F;  3PVS A;  5FTM A;  3GQ3 A;  2LBC A;  1G4A E;  4R71 A;  2LVQ D;  1ZV1 A;  5FTJ A;  3AOE C;  5EP2 A;  3FRH A;  2XEP A;  1W5T A;  3GPY A;  2X4A A;  4KO8 A;  1C7Y A;  4DUZ M;  2V1U A;  4JYA M;  4X66 M;  2QPA A;  4JN6 A;  4WUR A;  2QP9 X;  1SXJ B;  3U5Z B;  1HT1 E;  2CHG A;  5EP1 A;  1IBK M;  2F5N A;  1QUS A;  3EIE A;  3KOX E;  1DGF A;  2UUB M;  1C1K A;  1XNQ M;  4GEW A;  2QCU A;  4LJA A;  1Z5B A;  1NV8 A;  3SMP A;  2CV1 A;  1V34 A;  3UK6 A;  1NVM A;  1AIP C;  4KOD A;  4OW0 A;  5FLX S;  4CGY B;  4JI6 M;  1E9S A;  1N32 M;  3KP0 E;  4DV2 M;  3U60 B;  2O25 A;  2KA6 B;  4LFA M;  3CTW B;  4G4O A;  2VQF M;  3IHP A;  4FWD A;  1QDR A;  3BXW A;  4HEO A;  4M0W A;  4M9Z A;  1BVS A;  4AQY M;  1PJT A;  4I5S A;  2QBY A;  2LVO C;  2DHY A;  5IWA M;  2LHC A;  5EXP A;  4FCT A;  4GKK M;  1QZM A;  4AW4 A;  2DHR A;  1WJ7 A;  2FE8 A;  3BOS A;  4NSR A;  1K3X A;  5IZ7 D;  3RE8 A;  2JNH A;  2R18 A;  3HKP A;  2MGW A;  3SMS A;  5F3W A;  1YE9 A;  5JI2 E;  4YHH M;  3GRU A;  3TQS A;  1GJT A;  1A5T A;  4LGY A;  3FTE A;  4LZZ A;  2R65 A;  4LF8 M;  2BJV A;  1OAI A;  2DI0 A;  2XLJ A;  3SAW A;  2HAK A;  1UM8 A;  1XMQ M;  2DWN A;  3ZCB B;  2L4F A;  2XFT A;  3U61 B;  4B3T M;  1N33 M;  2VDB B;  2RGO A;  3HHW A;  3WHL A;  2XZF A;  1EFU B;  1GVN A;  1R7R A;  3PNV A;  4LF5 M;  1QUT A;  3B7Q A;  1PJJ A;  2JA2 A;  2C99 A;  5EQT A;  3LVV A;  1SXJ C;  4B3M M;  1IN8 A; 
#chains in the Genus database with same CATH homology
 4I8O A;  4OU7 A;  1R6B X;  4PT5 A;  5EJC A;  1DGB A;  4LJ4 A;  4RF0 A;  3T1H M;  2C9O A;  3KOW E;  3I51 A;  2D7G A;  3W0L B;  1K3W A;  1IY0 A;  2LXE A;  4GIP A;  3FUW A;  5FTN A;  1PJI A;  4XGI A;  3LQR A;  3M0E A;  3MJ5 A;  5ITU A;  3LQQ A;  1Z59 A;  1GLN A;  1I94 M;  2C98 A;  4L78 A;  4LF6 M;  2CE7 A;  4NRV A;  1H6U A;  4MGY E;  2KRU A;  5ITQ A;  3AJI B;  3KFU G;  2KRK A;  5LMN M;  3DA1 A;  4EIW A;  1NJF A;  2KEB A;  3JAM S;  1JQJ C;  4R3D A;  2Y20 A;  2Z3X A;  4JI0 M;  3SYK A;  1QYR A;  1K82 A;  2KZS A;  1IN6 A;  4B7F A;  5EXS A;  3K8Z A;  2R62 A;  4GHL A;  4P16 A;  4W5W A;  4PCZ A;  4DV1 M;  3KW6 A;  3CF0 A;  4QOZ C;  4X62 M;  4B7G A;  4JI7 M;  1W5S A;  5E6J A;  2DXI A;  3U6O A;  4B08 A;  2O5R A;  1HQY E;  3ILK A;  1TH4 A;  4GRI A;  3FYD A;  3FTD A;  3Q8X A;  4G4R A;  3U6E A;  3GRY A;  4JI4 M;  3K1J A;  2I7P A;  1XNR M;  4QHT A;  4BLC A;  4DV5 M;  2G8L A;  2G5G X;  4IBG A;  3GRR A;  1ZAE A;  3E4R A;  1L2C A;  1IN7 A;  3ZC7 B;  2YNM D;  3SHF A;  4DR1 M;  1L1Z A;  1DO2 A;  2XSZ D;  1XXH B;  4REZ A;  4MGH A;  4JI1 M;  3DFZ A;  4Z8X A;  1XHB A;  4FWG A;  2VQE M;  3U6S A;  4FD2 A;  4LJ6 A;  1R2Y A;  5LMU M;  4GH9 A;  3FUU A;  2D7E A;  4FWH A;  2RGH A;  4LRT A;  4LF7 M;  2F4V M;  1DGH A;  1Z6T A;  4IBJ A;  2HL7 A;  4NOO B;  2E5L M;  3M6A A;  4IBK A;  2L7I A;  1G41 A;  2CV2 A;  2QEN A;  3QAU A;  2FOI C;  3HGI A;  1S3S A;  4B3R M;  3GQ4 A;  5BPV A;  3SYL A;  2R4E A;  1L1T A;  2Y21 A;  1QAO A;  2DZO B;  1IBM M;  5ITT A;  4JV5 M;  4PD2 A;  2KZU A;  1HR0 M;  4L4U A;  3FTF A;  3FYC A;  3T15 A;  4L15 A;  4M0D A;  3SFZ A;  2CFO A;  5E26 A;  3TWM A;  1TDH A;  4ZPX A;  3A46 A;  4DR7 M;  2DWL A;  3KS8 A;  1X37 A;  3MK6 A;  4NSO B;  3VDP A;  1J7K A;  1G59 A;  1GL7 A;  5EXX A;  5C18 A;  1KFV A;  4LJ9 A;  1IXR C;  1GKI A;  4L8R C;  5KPZ A;  4DR2 M;  2UUC M;  4RF1 A;  1G3I A;  2HHH M;  3A45 A;  2AHM A;  3U6Q A;  2Z4R A;  3D8L A;  3IG5 A;  4LJ8 A;  3VDU A;  4FVM A;  5KPT A;  4JI2 M;  2F5P A;  4X65 M;  4MGK E;  4LJ5 A;  3AL0 C;  2R46 A;  4IBF A;  3L2A A;  1IQP A;  5A2Q S;  2H1R A;  4JI3 M;  4LGM A;  8CAT A;  2CHQ A;  4G6Z A;  3PXG A;  1XC8 A;  4GKJ M;  2UXC M;  3CF2 A;  3LMM A;  1TGU A;  3GLF A;  5EP3 A;  3GP1 A;  1E94 E;  2LNH C;  3JR5 A;  1HNW M;  1DGG A;  2EUC A;  1Q3C A;  3UMM A;  4QNM A;  4IBE A;  3UGJ A;  1IY1 A;  3CF6 E;  4IJF A;  3TPZ A;  1G8P A;  4G4Q A;  4B7H A;  1NY6 A;  3T1Y M;  3GRV A;  3L26 A;  1TH3 A;  2C96 A;  2YR0 A;  1NNU C;  3HU3 A;  4QOS A;  3J7B A;  4BB9 A;  3HHZ A;  4DV3 M;  3KOY E;  3A42 A;  3J81 S;  2J7N A;  4HLQ A;  4NXM M;  3WHK A;  3U6C A;  5JI3 E;  2Y0Q A;  3KS4 A;  3SAU A;  4RNA A;  2XH9 A;  3GPU A;  1R2Z A;  1OJL A;  2LWX A;  3I4Y A;  4L16 A;  4IJE A;  4TUW A;  1MU5 A;  4IBD A;  2OPF A;  2ZAO A;  5FTK A;  3U60 A;  4PDI A;  1Z5C A;  3KVW A;  2F5O A;  4LY6 A;  3C58 A;  2UUA M;  4B3S M;  3FTC A;  5KQD A;  2ZAN A;  7CAT A;  4KHP M;  1TH2 A;  2XGN A;  5IRE B;  4D82 A;  3VKG A;  2HCB A;  4MB7 A;  1ZQ9 A;  4M9S A;  4LJ7 A;  2DZN B;  2F5Q A;  4LFC M;  2HKJ A;  1XMO M;  2KXE A;  4DV0 M;  1QAM A;  2L6O A;  2KW0 A;  4AKG A;  3VFD A;  1XWI A;  4DV7 M;  2QBY B;  3GLG A;  2NQ8 C;  3HJ8 A;  2DVW B;  2D7H A;  3AOG A;  2V1C A;  2C5R A;  1IY2 A;  1HNX M;  1TDZ A;  3GLI A;  3PFI A;  3R9X B;  2J7O A;  2DWZ B;  2YFQ A;  2ZBK B;  5FTL A;  3ZH9 B;  2P5T A;  5ITX A;  5KPR A;  3PNY A;  3FD9 A;  4QHS A;  2EA0 A;  3U6D A;  4GC9 A;  3SHG B;  5DNY A;  2ERC A;  1YSY A;  4YY3 M;  5H37 D;  3J27 B;  1D2N A;  1JR3 D;  5FSW A;  1JR3 A;  4M9X A;  3L29 A;  4DR3 M;  1KYI A;  3SAS A;  4LCB A;  2X49 A;  3VK7 A;  1FNN A;  3TWK A;  4DV4 M;  5ITX E;  1NJG A;  2R45 A;  3GLF B;  4DR5 M;  4LG2 A;  1HNZ M;  3A98 B;  4S12 A;  4XBO A;  2CHV A;  3KSJ A;  1NSF A;  2CV0 A;  4ITQ A;  1FJG M;  2CEA A;  1WXQ A;  4LFB M;  3T38 A;  1J5E M;  4IBB A;  4FCV A;  3GQ5 A;  4JXJ A;  3KXE C;  4R7G A;  4DV6 M;  2FFJ A;  3OTO M;  3AOE A;  4GC5 A;  3LVW A;  1IN4 A;  3FUV A;  4JI8 M;  4AG6 A;  3M7G A;  2C9C A;  2K47 A;  3SBJ A;  1IBL M;  1GL6 A;  4DR6 M;  4NXN M;  3MHV C;  4WW0 A;  3RFW A;  2UXB M;  4MM3 B;  4OVZ A;  2Y0T A;  3HJS A;  3L25 A;  3HU2 A;  5IT9 S;  3J7A S;  1L8Q A;  1YUB A;  3D8B A;  3GLH A;  3FUT A;  4DUY M;  2UU9 M;  1E9R A;  4MH0 E;  2CUZ A;  4QNR A;  1IXS B;  4CIS A;  1XXH A;  3HU1 A;  4GMQ A;  1NY5 A;  3HHX A;  4IBI A;  1NNJ A;  2F5S A;  3UZU A;  2VII A;  3GLG B;  3GO8 A;  5GKN A;  3RGP A;  4PDG A;  4NL4 H;  4KLN A;  3IG8 A;  5ITY A;  1IXZ A;  5ITR A;  3GLI B;  4AKH A;  3I4V A;  1N77 A;  1I4W A;  3JR4 A;  3HJQ A;  3SAV A;  3SAR A;  4LF4 M;  4GIT A;  2LH0 A;  2XFS A;  1QAQ A;  3K2L A;  1SXJ D;  1N36 M;  3U6P A;  3VLF B;  1SXJ A;  3HHY A;  3U5Z A;  5EXT A;  3THG A;  3DOA A;  5KO3 A;  3H4M A;  4X64 M;  2L7H A;  2L09 A;  4JI5 M;  1IM2 A;  4Z6Y A;  1Q39 A;  1QVR A;  3TE6 A;  1DGH B;  1E32 A;  2Q2E B;  3EIH A;  3VK8 A;  2M5Z A;  4D81 A;  2OQ4 A;  4I4L A;  1L2B A;  3RGS A;  3J80 S;  5C1B A;  4GHA A;  3VKH A;  3TWL A;  3W0F A;  4K0K M;  1N75 A;  3E9S A;  2XZU A;  3HWS A;  1PM5 A;  1SXJ E;  4OX9 M;  1Q3B A;  2BNK A;  1QQW A;  3KDS E;  3U6M A;  5KQ8 A;  1J09 A;  2FNA A;  2M60 A;  3R8F A;  1NHG C;  2R4J A;  4NRW A;  1ORY B;  2V6Z M;  3J2P B;  4AG5 A;  2Z7J A;  1VDD A;  4BBA A;  2BJW A;  3L27 A;  5BR8 M;  4LF9 M;  2EO2 A;  2Z4S A;  1DO0 A;  3FUX A;  2W82 A;  4LZJ A;  3GPP A;  2DWM A;  4AKI A;  1N78 A;  3SAT A;  4FCW A;  4AZF A;  3QWL A;  4MGZ E;  3U61 A;  3AV0 A;  3KP1 E;  2UXD M;  4I81 A;  3TL4 X;  3GPX A;  4G4N A;  5DYI A;  3NBI A;  4A3V B;  1OFI A;  4HL4 A;  1KSF X;  2YQZ A;  4CHT B;  1HQC A;  2RKO A;  3UJN A;  3AKZ A;  3K92 A;  3KOZ E;  3KSX A;  2ZM6 M;  4OVZ B;  2I7N A;  3L28 A;  5DYG A;  3U6L A;  4D80 A;  4MGI E;  3NWL A;  4IIW A;  4DR4 M;  3FKE A;  2A5Y B;  2X8A A;  1QAN A;  1NHW C;  1LV7 A;  3GLH B;  3AFH A;  4FW9 A;  1T3T A;  1HT2 E;  1L2D A;  1Z5A A;  4AI6 A;  1N34 M;  2ZAM A;  4IBC A;  2XSZ A;  1OFH A;  4II7 A;  3SC3 A;  1EE8 A;  1IN5 A;  1MX0 A;  2XF3 A;  3DZD A;  2QZ4 A;  4LRS A;  5EP4 A;  3B9P A;  3PVS A;  5FTM A;  3GQ3 A;  1G4A E;  5FTJ A;  3AOE C;  5EP2 A;  2XEP A;  1W5T A;  3GPY A;  2X4A A;  4KO8 A;  4DUZ M;  2V1U A;  4JYA M;  4X66 M;  2QPA A;  4JN6 A;  4WUR A;  2QP9 X;  1SXJ B;  3U5Z B;  1HT1 E;  2CHG A;  5EP1 A;  1IBK M;  2F5N A;  3EIE A;  3KOX E;  1DGF A;  2UUB M;  1C1K A;  1XNQ M;  2QCU A;  4LJA A;  1Z5B A;  3SMP A;  2CV1 A;  3UK6 A;  4JI6 M;  1NVM A;  4KOD A;  4OW0 A;  5FLX S;  4CGY B;  1N32 M;  1E9S A;  3KP0 E;  4DV2 M;  3U60 B;  4LFA M;  2KA6 B;  4G4O A;  3CTW B;  2VQF M;  4FWD A;  4M9Z A;  4M0W A;  4AQY M;  4I5S A;  2QBY A;  5IWA M;  5EXP A;  4FCT A;  4GKK M;  1QZM A;  4AW4 A;  2DHR A;  2FE8 A;  3BOS A;  4NSR A;  1K3X A;  5IZ7 D;  3RE8 A;  2R18 A;  3HKP A;  3SMS A;  5F3W A;  1YE9 A;  5JI2 E;  4YHH M;  3GRU A;  3TQS A;  4LGY A;  3FTE A;  4LZZ A;  2R65 A;  4LF8 M;  2BJV A;  2XLJ A;  3SAW A;  1XMQ M;  1UM8 A;  2DWN A;  3ZCB B;  2XFT A;  4B3T M;  3U61 B;  1N33 M;  3HHW A;  2RGO A;  3WHL A;  2XZF A;  1GVN A;  1R7R A;  3PNV A;  4LF5 M;  1PJJ A;  2JA2 A;  2C99 A;  5EQT A;  3LVV A;  1SXJ C;  4B3M M;  1IN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...