2LHCA

Ga98 solution structure
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKELVDAGTAEKYFKLIANAKTVEGVWTLKDEIKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Ga98
publication title Mutational tipping points for switching protein folds and functions.
pubmed doi rcsb
source organism Artificial gene
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2lhcA00
2VDBB 1GABA 1GJSA 2MH8A 1GJTA 2LHCA 2J5YA 2JWSA 2KDLA 2LHGA 2N35A 2FS1A 1TF0B 1PRBA
chains in the Genus database with same CATH superfamily
4QHSA 1PJQA 3HHXA 4W5WA 2X49A 3SHGB 2F5PA 4L15A 1JQJC 3U6OA 4JYAM 4AKIA 1F4IA 1OIZA 1PJTA 4LRTA 1L2CA 2L4FA 4XK8F 1NNJA 3A42A 2Y21A 3ZQJA 4X66M 1ZAEA 1NY5A 3I4YA 2B3TA 2CRUA 3GPYA 3R8FA 3AL0C 4GC9A 1IM2A 1WGNA 2EJSA 2R18A 3FUXA 5H37D 2DZOB 2K0BX 4GHLA 1HQCA 2LVNC 1UFZA 1AIPC 2R4EA 2KW0A 2FFJA 1IN5A 1YUBA 4KT0F 3A98B 1GVNA 1N77A 1QUSA 4HEOA 3KOZE 2K47A 3FD9A 2K6BA 2QENA 2HKJA 2MH8A 4DR5M 3GQ5A 4DV7M 2KZSA 4QHTA 2P5TA 2XGNA 3AOEA 2ERCA 3M0EA 1D0KA 1TDZA 3T15A 2QZ4A 1VG5A 2WSFF 3SYKA 4K0KM 4CJ6A 3GLFB 1QAMA 3K8ZA 2EUCA 3C3DA 4FWHA 3GLIE 2DAEA 3SBJA 3GLIA 1D0MA 4HL4A 3T1YM 1XMOM 2N35A 1K82A 2FNAA 2QBYB 1VQ1A 4QNMA 3GLGB 4JI6M 3TL4X 3DZDA 4JN6A 3AV0A 2JWSA 1KSFX 3KP1E 2R0IA 1GL6A 1SXJB 2DVWB 5IZ7D 5IWAM 4G4QA 2VF7A 3HHZA 1DO0A 2L7HA 2CV2A 2CV0A 2XZFA 1IQPA 3FUTA 1HNXM 4LJ8A 1HNWM 4MGIE 4F2LA 1I94M 4HLQA 1D2NA 4IBJA 2LTUA 3KXEC 4ANRA 4L8RC 3FTFA 2WSEF 1IBMM 4B7HA 2E5LM 2WZJA 2YFQA 5F3WA 1OJLA 1DGBA 2CV1A 4LF7M 1T3TA 1XNQM 3L25A 1XWIA 5KQDA 3SAWA 3CGWA 2H1RA 4CGYB 3GRYA 2O01F 3FTEA 3OTOM 1L1TA 4DV4M 1N75A 4B7FA 3BOSA 1E94E 1QUTA 3JAMS 1ZMWA 1TDHA 4RNAA 3LVVA 1XNRM 5LMNM 1MN3A 1HT1E 5EXPA 5FTLA 2Z3XA 1Q39A 2ZTCA 4IBKA 4RF1A 2KA6B 3LQQA 2CUZA 3C58A 2H5XA 1R7RA 3BBZA 3SYLA 3RE8A 2Z7JA 8CATA 5DYIA 2JY6B 2LVAA 4LJ7A 1DGHA 1Q3CA 1GJTA 3W67A 5BPVA 1IN7A 5KQ8A 4IBFA 4CHTB 5JI3E 3J27B 3NBIA 4BB9A 3I04M 1V33A 4JV5M 4MB7A 4AQYM 1GL7A 2CHVA 3LVWA 5DNYA 4NRWA 1HR0M 1E9RA 4G3OA 1EE8A 4DV2M 1QVRA 2HCBA 3QYEA 4JI7M 1Z5AA 3KOWE 2XFTA 1CUKA 2APLA 3FE3A 3FUWA 1HNZM 3GRVA 2M5ZA 2OOBA 2VDBB 4AG6A 5BR8M 4P17A 2Z4SA 2HHHM 4ZPXA 1G41A 1NV8A 2A5YB 1OAOC 2XFSA 4NRVA 2XSZD 4DR7M 2C9OA 4KO8A 4MH0E 2UXCM 5DYGA 3HJQA 2DKLA 3UGJA 4WP2A 3B7ZA 1PGYA 5IREB 3GPUA 3KSXA 3K1JA 4CIZA 2DWLA 3U6QA 3GLHE 4RF0A 3B7QA 2DHYA 3U6MA 4GRIA 4KODA 1QQWA 3GLHA 4FD2A 3QAUA 4NOOB 4Z6YA 4OW0A 2DAIA 2LWXA 1WR1B 4AI6A 2L2DA 3FKEA 2XSZA 1VDDA 5DFLA 2QNJA 3UMMA 3ZH9B 3B7NA 2F5SA 2JY5A 4OVZB 1QAQA 4DR2M 3L28A 3FUVA 1XC8A 3FYDA 2HWJA 3M7GA 3NWLA 3GQ3A 4BBAA 3H4JA 1K3XA 5EP4A 1VDLA 1XMQM 3THGA 3D8LA 3B9PA 2D7EA 1PJJA 1KYIA 4JXJA 5EQTA 1NV9A 4IBEA 2JXNA 3IHPA 3U61B 3GQ4A 1A5TA 1NHWC 4M0WA 3WHLA 3KFUG 2YQZA 3U6PA 3PFIA 1J09A 5EXTA 1VEKA 3AOGA 3HU1A 1R2YA 4NXNM 3GPPA 2X8AA 1G4AE 2CE7A 3Q8XA 4I8OA 3U60A 5ITUA 1GKIA 1GO5A 1IXZA 3CF2A 1VEJA 4LJ6A 4X65M 1XB2B 2LHCA 2L6OA 3GP1A 4CISA 1XXHE 1YSYA 5FLXS 2DAMA 4UN2B 2QPAA 4I81A 3L26A 2ZTDA 1XXHA 2LVQD 3RFWA 1V34A 2QCUA 4LF8M 4G4RA 4P16A 2J7OA 5EXXA 4Q7JA 3GO8A 5FSWA 2C98A 4B3SM 2RRUA 3LMMA 3SC3A 2V1UA 2X4AA 4LJAA 1Z6TA 4MM3B 2KNAA 4WW0A 1R2ZA 4DR6M 4L4UA 4JI1M 3TWKA 2GNOA 4B7GA 5GKNA 1PJSA 4IBCA 1J7KA 1S3SA 2C96A 3Q8GA 4LG2A 3VKGA 4QOSA 2RGHA 4FCVA 3SARA 4LF4M 3K9PA 1FNNA 3VLFB 1QZMA 1G3IA 4S12A 3RGSA 3A45A 3GLIB 1OAIA 2YR0A 1OFHA 4GC5A 4GH9A 4NSRA 4M9SA 5FTMA 4LFAM 3W0FA 3U5ZA 1ZQ9A 1TTEA 3B74A 3HHYA 2C5RA 3FTCA 2LHGA 1QDTA 4B3TM 2ZAOA 1C1KA 1V92A 3V76A 2DAGA 5ITXE 4LY6A 2G5GX 4JI8M 1SXJC 4D82A 4JI3M 5ITXA 3AOEC 1OKSA 1LV7A 2W82A 2D7HA 2V6ZM 2VF8A 3CF0A 1NY6A 4FCTA 2BJWA 2UUCM 3AJIB 3UJNA 3E46A 5C18A 3KS4A 4GIPA 4AKGA 3T38A 2CEAA 1WIVA 3E9SA 3NBXX 1L2DA 1AUAA 1QANA 2KHHA 3SMSA 1MX0A 2J5YA 3UK6A 2F5NA 3TWLA 2FS1A 2I7NA 4D80A 1PRBA 2VQEM 3HJSA 4GMQA 2FOIC 3U6EA 2MROB 3SAVA 4NSOB 4AG5A 1FJGM 4DV5M 3EIEA 1YE9A 2HAKA 2DAKA 2XF3A 3M6AA 7CATA 2OOAA 4IIWA 3U6DA 3CTWB 1IFYA 4L78A 2MGWA 2KXEA 4GHAA 3HZJA 1IXSB 4DUYM 5KO3A 3J80S 4F1IA 3AKZA 2HL7A 1L8QA 2BNKA 2DZLA 3ZCBB 2ZBKB 3T1HM 1Q02A 1ZV1A 3UZUA 4RKUF 3HKPA 4PT5A 2R62A 1L1ZA 2L09A 3I4VA 4L6V6 4DR4M 5ITYA 4IBGA 2Q2EB 4YHHM 3SASA 3MMPA 3L29A 1NVMA 2R44A 1DGGA 5LMUM 4LF5M 3LW5F 2QQ8A 1IXRC 3I01M 4IJFA 1DGHB 2EKFA 3L2AA 5ITTA 4I5SA 4XBOA 4X64M 3KP0E 2C99A 2BWEA 2Z4RA 2DENA 3HU2A 3LCUA 1Z5BA 2JUJA 1NNUC 3FYCA 4REZA 3F92A 4MGHA 3BXWA 4DV0M 4B08A 1MJGM 1IY1A 3FUUA 4M9ZA 2L4EA 3CF6E 2O25A 5KPZA 5FTKA 2F4VM 3ZC7B 2Y0QA 2JA2A 2DI0A 2KRKA 4II7A 1IBKM 4GKJM 3HGIA 4DV1M 1BVSA 2Y20A 4DR1M 4KHPM 4QOZC 4LJ9A 3KSJA 1T43A 3W0LB 2UUBM 4JI0M 2DNAA 3SATA 2FE8A 2XLJA 1ZMVA 4B3MM 3QYBA 2JNHA 2VIIA 3J81S 2UXDM 3EIHA 3HHWA 3IECA 3E4RA 3TWMA 3A46A 1WGLA 1PJIA 3MJ5A 4R3DA 4PCZA 4LJ5A 2G8LA 1E32A 3U6CA 1P3QQ 2DHRA 1JR3D 1WHCA 2LNHC 3RGPA 2ZM6M 4MGZE 2KRUA 3GLHB 2VQFM 2AHMA 2KEBA 2Z8YM 4NL4H 1N34M 1J5EM 3MHVC 3KS8A 4DR3M 2RKOA 4OU7A 3SFZA 2ZANA 2J7NA 3J7AS 3U61A 2EKKA 4WURA 3WHKA 2F5OA 1D0LA 4G4NA 3KW6A 4R71A 1IY2A 2LVOC 3KDSE 5E26A 1MU5A 3KVWA 5EJCA 2QSFX 1QAOA 1VEGA 1NHGC 4LCBA 4A3VB 1WJ7A 1N32M 1JR3E 2BJVA 1WXQA 2M60A 4LGMA 4M0DA 4FCWA 1JR3A 3GRRA 3VDUA 4KLNA 3VDPA 1SXJD 4BLCA 2XZUA 1N36M 3B89A 1TF0B 1IY0A 1TH4A 1Z59A 1OFIA 4FW9A 3KOXE 3HY5A 2ZAMA 4FWDA 5A2QS 3GLFE 2OPFA 2JY8A 1G59A 4JI2M 3KOYE 3GLFA 4B3RM 5IT9S 1JB0F 3JR4A 4OX9M 1H6UA 3R9XB 3HJ8A 4DUZM 1TR8A 1Z5CA 4M9XA 2CWBA 4Y28F 1ORYB 1IN8A 5FTJA 3GLGE 4LZJA 2KDLA 2QBYA 1DV0A 4FVMA 3GLGA 3U60B 3L27A 1SXJE 4DV3M 2YNMD 1NO1A 2OO9A 1UM8A 2JP7A 1SXJA 2KZUA 4IBIA 4AW4A 4TUWA 1OIPA 1ZMUA 2R4JA 3K92A 1NSFA 4NC6A 4EIWA 1YLAA 4LFCM 4XGIA 1NJGA 1XXHB 2DXIA 2CHGA 3FRIA 3U6LA 2UU9M 4IJEA 4JI5M 2O5RA 3PVSA 2K9DA 1G71A 3GRUA 3J2PB 1QZEA 4MGKE 3SMPA 2LVPC 1E9SA 1R6BX 2LXEA 2CP8A 1GABA 1PM5A 2R45A 2RGOA 2EO2A 5EP3A 1W5TA 3VK8A 4MGYE 1W5SA 1HQYE 1SG9A 3HX3A 4LF9M 4G4OA 3C9PA 4D81A 2UXBM 1TGUA 2QP9X 4NXMM 3C3EA 5EXSA 2BWBA 2JZ0A 3H4MA 2MJ5B 3FTDA 4GEWA 4PDIA 4L16A 2CFOA 4GKKM 3U5ZB 1DO2A 3LCVB 4LFBM 3D8BA 3I51A 5EP2A 5KPTA 1KFVA 2G3QA 2R6FA 2Y0TA 3DA1A 3E21A 4YY3M 3TQSA 2XEPA 2EA0A 1QDRA 5FTNA 2UUAM 2LH0A 2DWZB 2L7IA 2I7PA 4QNRA 1Q3BA 2NQ8C 4LRSA 1RU3A 3VFDA 5ITQA 4GITA 1GLNA 3IG8A 1DGFA 4LJ4A 4Z8XA 3VK7A 1IXSA 5C1BA 3T6PA 1EFUB 2DZNB 3K9OA 3K2LA 5L8RF 1G8PA 1N78A 1QYRA 2GQFA 3VKHA 4FWGA 1K3WA 5ITRA 2LBCA 1IBLM 1R4GA 2DWNA 3TE6A 2DWMA 1XHBA 3MK6A 3DOAA 4IBDA 3GPXA 4ITQA 4IBBA 1C7YA 2JY7A 2CHQA 3PNVA 3PNYA 1OQYA 1NJFA 2V1CA 1Y8GA 2D7GA 4AZFA 2C9CA 3PXGA 5JI2E 2R46A 2R65A 2JZ1A 4PD2A 4LGYA 5KPRA 1IN4A 3QWLA 1LTMA 4X62M 2F5QA 2QHOB 4AKHA 1TH2A 3ILKA 2WSCF 3SHFA 3SAUA 4DV6M 4LZZA 1L2BA 2MR9A 4G6ZA 2XH9A 4JI4M 4LF6M 3HWSA 3LQRA 4I4LA 3IG5A 3JR5A 4OVZA 4PDGA 3AFHA 2KNZA 1GJSA 3FRHA 1N33M 1I4WA 5EP1A 3TPZA 1TH3A 2FH0A 1EIJA 3HU3A 1HJPA 5E6JA 3W68A 1X37A 2KNVA 1HT2E 1OTRA 1R5LA 1T6OA 4DBGB 1IN6A 3J7BA 3U6SA 2OQ4A 3DFZA 4R7GA
chains in the Genus database with same CATH topology
2VDBB 1GABA 1GJSA 2MH8A 1GJTA 2LHCA 2J5YA 2JWSA 2KDLA 2LHGA 2N35A 2FS1A 1TF0B 1PRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDB B;  1GAB A;  1GJS A;  2MH8 A;  1GJT A;  2LHC A;  2J5Y A;  2JWS A;  2KDL A;  2LHG A;  2N35 A;  2FS1 A;  1TF0 B;  1PRB A; 
#chains in the Genus database with same CATH topology
 4QHS A;  1PJQ A;  3HHX A;  4W5W A;  2X49 A;  3SHG B;  2F5P A;  4L15 A;  1JQJ C;  3U6O A;  4JYA M;  4AKI A;  1F4I A;  1OIZ A;  1PJT A;  4LRT A;  1L2C A;  2L4F A;  4XK8 F;  1NNJ A;  3A42 A;  2Y21 A;  3ZQJ A;  4X66 M;  1ZAE A;  1NY5 A;  3I4Y A;  2B3T A;  2CRU A;  3GPY A;  3R8F A;  3AL0 C;  4GC9 A;  1IM2 A;  1WGN A;  2EJS A;  2R18 A;  3FUX A;  5H37 D;  2DZO B;  2K0B X;  4GHL A;  1HQC A;  2LVN C;  1UFZ A;  1AIP C;  2R4E A;  2KW0 A;  2FFJ A;  1IN5 A;  1YUB A;  4KT0 F;  3A98 B;  1GVN A;  1N77 A;  1QUS A;  4HEO A;  3KOZ E;  2K47 A;  3FD9 A;  2K6B A;  2QEN A;  2HKJ A;  2MH8 A;  4DR5 M;  3GQ5 A;  4DV7 M;  2KZS A;  4QHT A;  2P5T A;  2XGN A;  3AOE A;  2ERC A;  3M0E A;  1D0K A;  1TDZ A;  3T15 A;  2QZ4 A;  1VG5 A;  2WSF F;  3SYK A;  4K0K M;  4CJ6 A;  3GLF B;  1QAM A;  3K8Z A;  2EUC A;  3C3D A;  4FWH A;  3GLI E;  2DAE A;  3SBJ A;  3GLI A;  1D0M A;  4HL4 A;  3T1Y M;  1XMO M;  2N35 A;  1K82 A;  2FNA A;  2QBY B;  1VQ1 A;  4QNM A;  3GLG B;  4JI6 M;  3TL4 X;  3DZD A;  4JN6 A;  3AV0 A;  2JWS A;  1KSF X;  3KP1 E;  2R0I A;  1GL6 A;  1SXJ B;  2DVW B;  5IZ7 D;  5IWA M;  4G4Q A;  2VF7 A;  3HHZ A;  1DO0 A;  2L7H A;  2CV2 A;  2CV0 A;  2XZF A;  1IQP A;  3FUT A;  1HNX M;  4LJ8 A;  1HNW M;  4MGI E;  4F2L A;  1I94 M;  4HLQ A;  1D2N A;  4IBJ A;  2LTU A;  3KXE C;  4ANR A;  4L8R C;  3FTF A;  2WSE F;  1IBM M;  4B7H A;  2E5L M;  2WZJ A;  2YFQ A;  5F3W A;  1OJL A;  1DGB A;  2CV1 A;  4LF7 M;  1T3T A;  1XNQ M;  3L25 A;  1XWI A;  5KQD A;  3SAW A;  3CGW A;  2H1R A;  4CGY B;  3GRY A;  2O01 F;  3FTE A;  3OTO M;  1L1T A;  4DV4 M;  1N75 A;  4B7F A;  3BOS A;  1E94 E;  1QUT A;  3JAM S;  1ZMW A;  1TDH A;  4RNA A;  3LVV A;  1XNR M;  5LMN M;  1MN3 A;  1HT1 E;  5EXP A;  5FTL A;  2Z3X A;  1Q39 A;  2ZTC A;  4IBK A;  4RF1 A;  2KA6 B;  3LQQ A;  2CUZ A;  3C58 A;  2H5X A;  1R7R A;  3BBZ A;  3SYL A;  3RE8 A;  2Z7J A;  8CAT A;  5DYI A;  2JY6 B;  2LVA A;  4LJ7 A;  1DGH A;  1Q3C A;  1GJT A;  3W67 A;  5BPV A;  1IN7 A;  5KQ8 A;  4IBF A;  4CHT B;  5JI3 E;  3J27 B;  3NBI A;  4BB9 A;  3I04 M;  1V33 A;  4JV5 M;  4MB7 A;  4AQY M;  1GL7 A;  2CHV A;  3LVW A;  5DNY A;  4NRW A;  1HR0 M;  1E9R A;  4G3O A;  1EE8 A;  4DV2 M;  1QVR A;  2HCB A;  3QYE A;  4JI7 M;  1Z5A A;  3KOW E;  2XFT A;  1CUK A;  2APL A;  3FE3 A;  3FUW A;  1HNZ M;  3GRV A;  2M5Z A;  2OOB A;  2VDB B;  4AG6 A;  5BR8 M;  4P17 A;  2Z4S A;  2HHH M;  4ZPX A;  1G41 A;  1NV8 A;  2A5Y B;  1OAO C;  2XFS A;  4NRV A;  2XSZ D;  4DR7 M;  2C9O A;  4KO8 A;  4MH0 E;  2UXC M;  5DYG A;  3HJQ A;  2DKL A;  3UGJ A;  4WP2 A;  3B7Z A;  1PGY A;  5IRE B;  3GPU A;  3KSX A;  3K1J A;  4CIZ A;  2DWL A;  3U6Q A;  3GLH E;  4RF0 A;  3B7Q A;  2DHY A;  3U6M A;  4GRI A;  4KOD A;  1QQW A;  3GLH A;  4FD2 A;  3QAU A;  4NOO B;  4Z6Y A;  4OW0 A;  2DAI A;  2LWX A;  1WR1 B;  4AI6 A;  2L2D A;  3FKE A;  2XSZ A;  1VDD A;  5DFL A;  2QNJ A;  3UMM A;  3ZH9 B;  3B7N A;  2F5S A;  2JY5 A;  4OVZ B;  1QAQ A;  4DR2 M;  3L28 A;  3FUV A;  1XC8 A;  3FYD A;  2HWJ A;  3M7G A;  3NWL A;  3GQ3 A;  4BBA A;  3H4J A;  1K3X A;  5EP4 A;  1VDL A;  1XMQ M;  3THG A;  3D8L A;  3B9P A;  2D7E A;  1PJJ A;  1KYI A;  4JXJ A;  5EQT A;  1NV9 A;  4IBE A;  2JXN A;  3IHP A;  3U61 B;  3GQ4 A;  1A5T A;  1NHW C;  4M0W A;  3WHL A;  3KFU G;  2YQZ A;  3U6P A;  3PFI A;  1J09 A;  5EXT A;  1VEK A;  3AOG A;  3HU1 A;  1R2Y A;  4NXN M;  3GPP A;  2X8A A;  1G4A E;  2CE7 A;  3Q8X A;  4I8O A;  3U60 A;  5ITU A;  1GKI A;  1GO5 A;  1IXZ A;  3CF2 A;  1VEJ A;  4LJ6 A;  4X65 M;  1XB2 B;  2LHC A;  2L6O A;  3GP1 A;  4CIS A;  1XXH E;  1YSY A;  5FLX S;  2DAM A;  4UN2 B;  2QPA A;  4I81 A;  3L26 A;  2ZTD A;  1XXH A;  2LVQ D;  3RFW A;  1V34 A;  2QCU A;  4LF8 M;  4G4R A;  4P16 A;  2J7O A;  5EXX A;  4Q7J A;  3GO8 A;  5FSW A;  2C98 A;  4B3S M;  2RRU A;  3LMM A;  3SC3 A;  2V1U A;  2X4A A;  4LJA A;  1Z6T A;  4MM3 B;  2KNA A;  4WW0 A;  1R2Z A;  4DR6 M;  4L4U A;  4JI1 M;  3TWK A;  2GNO A;  4B7G A;  5GKN A;  1PJS A;  4IBC A;  1J7K A;  1S3S A;  2C96 A;  3Q8G A;  4LG2 A;  3VKG A;  4QOS A;  2RGH A;  4FCV A;  3SAR A;  4LF4 M;  3K9P A;  1FNN A;  3VLF B;  1QZM A;  1G3I A;  4S12 A;  3RGS A;  3A45 A;  3GLI B;  1OAI A;  2YR0 A;  1OFH A;  4GC5 A;  4GH9 A;  4NSR A;  4M9S A;  5FTM A;  4LFA M;  3W0F A;  3U5Z A;  1ZQ9 A;  1TTE A;  3B74 A;  3HHY A;  2C5R A;  3FTC A;  2LHG A;  1QDT A;  4B3T M;  2ZAO A;  1C1K A;  1V92 A;  3V76 A;  2DAG A;  5ITX E;  4LY6 A;  2G5G X;  4JI8 M;  1SXJ C;  4D82 A;  4JI3 M;  5ITX A;  3AOE C;  1OKS A;  1LV7 A;  2W82 A;  2D7H A;  2V6Z M;  2VF8 A;  3CF0 A;  1NY6 A;  4FCT A;  2BJW A;  2UUC M;  3AJI B;  3UJN A;  3E46 A;  5C18 A;  3KS4 A;  4GIP A;  4AKG A;  3T38 A;  2CEA A;  1WIV A;  3E9S A;  3NBX X;  1L2D A;  1AUA A;  1QAN A;  2KHH A;  3SMS A;  1MX0 A;  2J5Y A;  3UK6 A;  2F5N A;  3TWL A;  2FS1 A;  2I7N A;  4D80 A;  1PRB A;  2VQE M;  3HJS A;  4GMQ A;  2FOI C;  3U6E A;  2MRO B;  3SAV A;  4NSO B;  4AG5 A;  1FJG M;  4DV5 M;  3EIE A;  1YE9 A;  2HAK A;  2DAK A;  2XF3 A;  3M6A A;  7CAT A;  2OOA A;  4IIW A;  3U6D A;  3CTW B;  1IFY A;  4L78 A;  2MGW A;  2KXE A;  4GHA A;  3HZJ A;  1IXS B;  4DUY M;  5KO3 A;  3J80 S;  4F1I A;  3AKZ A;  2HL7 A;  1L8Q A;  2BNK A;  2DZL A;  3ZCB B;  2ZBK B;  3T1H M;  1Q02 A;  1ZV1 A;  3UZU A;  4RKU F;  3HKP A;  4PT5 A;  2R62 A;  1L1Z A;  2L09 A;  3I4V A;  4L6V 6;  4DR4 M;  5ITY A;  4IBG A;  2Q2E B;  4YHH M;  3SAS A;  3MMP A;  3L29 A;  1NVM A;  2R44 A;  1DGG A;  5LMU M;  4LF5 M;  3LW5 F;  2QQ8 A;  1IXR C;  3I01 M;  4IJF A;  1DGH B;  2EKF A;  3L2A A;  5ITT A;  4I5S A;  4XBO A;  4X64 M;  3KP0 E;  2C99 A;  2BWE A;  2Z4R A;  2DEN A;  3HU2 A;  3LCU A;  1Z5B A;  2JUJ A;  1NNU C;  3FYC A;  4REZ A;  3F92 A;  4MGH A;  3BXW A;  4DV0 M;  4B08 A;  1MJG M;  1IY1 A;  3FUU A;  4M9Z A;  2L4E A;  3CF6 E;  2O25 A;  5KPZ A;  5FTK A;  2F4V M;  3ZC7 B;  2Y0Q A;  2JA2 A;  2DI0 A;  2KRK A;  4II7 A;  1IBK M;  4GKJ M;  3HGI A;  4DV1 M;  1BVS A;  2Y20 A;  4DR1 M;  4KHP M;  4QOZ C;  4LJ9 A;  3KSJ A;  1T43 A;  3W0L B;  2UUB M;  4JI0 M;  2DNA A;  3SAT A;  2FE8 A;  2XLJ A;  1ZMV A;  4B3M M;  3QYB A;  2JNH A;  2VII A;  3J81 S;  2UXD M;  3EIH A;  3HHW A;  3IEC A;  3E4R A;  3TWM A;  3A46 A;  1WGL A;  1PJI A;  3MJ5 A;  4R3D A;  4PCZ A;  4LJ5 A;  2G8L A;  1E32 A;  3U6C A;  1P3Q Q;  2DHR A;  1JR3 D;  1WHC A;  2LNH C;  3RGP A;  2ZM6 M;  4MGZ E;  2KRU A;  3GLH B;  2VQF M;  2AHM A;  2KEB A;  2Z8Y M;  4NL4 H;  1N34 M;  1J5E M;  3MHV C;  3KS8 A;  4DR3 M;  2RKO A;  4OU7 A;  3SFZ A;  2ZAN A;  2J7N A;  3J7A S;  3U61 A;  2EKK A;  4WUR A;  3WHK A;  2F5O A;  1D0L A;  4G4N A;  3KW6 A;  4R71 A;  1IY2 A;  2LVO C;  3KDS E;  5E26 A;  1MU5 A;  3KVW A;  5EJC A;  2QSF X;  1QAO A;  1VEG A;  1NHG C;  4LCB A;  4A3V B;  1WJ7 A;  1N32 M;  1JR3 E;  2BJV A;  1WXQ A;  2M60 A;  4LGM A;  4M0D A;  4FCW A;  1JR3 A;  3GRR A;  3VDU A;  4KLN A;  3VDP A;  1SXJ D;  4BLC A;  2XZU A;  1N36 M;  3B89 A;  1TF0 B;  1IY0 A;  1TH4 A;  1Z59 A;  1OFI A;  4FW9 A;  3KOX E;  3HY5 A;  2ZAM A;  4FWD A;  5A2Q S;  3GLF E;  2OPF A;  2JY8 A;  1G59 A;  4JI2 M;  3KOY E;  3GLF A;  4B3R M;  5IT9 S;  1JB0 F;  3JR4 A;  4OX9 M;  1H6U A;  3R9X B;  3HJ8 A;  4DUZ M;  1TR8 A;  1Z5C A;  4M9X A;  2CWB A;  4Y28 F;  1ORY B;  1IN8 A;  5FTJ A;  3GLG E;  4LZJ A;  2KDL A;  2QBY A;  1DV0 A;  4FVM A;  3GLG A;  3U60 B;  3L27 A;  1SXJ E;  4DV3 M;  2YNM D;  1NO1 A;  2OO9 A;  1UM8 A;  2JP7 A;  1SXJ A;  2KZU A;  4IBI A;  4AW4 A;  4TUW A;  1OIP A;  1ZMU A;  2R4J A;  3K92 A;  1NSF A;  4NC6 A;  4EIW A;  1YLA A;  4LFC M;  4XGI A;  1NJG A;  1XXH B;  2DXI A;  2CHG A;  3FRI A;  3U6L A;  2UU9 M;  4IJE A;  4JI5 M;  2O5R A;  3PVS A;  2K9D A;  1G71 A;  3GRU A;  3J2P B;  1QZE A;  4MGK E;  3SMP A;  2LVP C;  1E9S A;  1R6B X;  2LXE A;  2CP8 A;  1GAB A;  1PM5 A;  2R45 A;  2RGO A;  2EO2 A;  5EP3 A;  1W5T A;  3VK8 A;  4MGY E;  1W5S A;  1HQY E;  1SG9 A;  3HX3 A;  4LF9 M;  4G4O A;  3C9P A;  4D81 A;  2UXB M;  1TGU A;  2QP9 X;  4NXM M;  3C3E A;  5EXS A;  2BWB A;  2JZ0 A;  3H4M A;  2MJ5 B;  3FTD A;  4GEW A;  4PDI A;  4L16 A;  2CFO A;  4GKK M;  3U5Z B;  1DO2 A;  3LCV B;  4LFB M;  3D8B A;  3I51 A;  5EP2 A;  5KPT A;  1KFV A;  2G3Q A;  2R6F A;  2Y0T A;  3DA1 A;  3E21 A;  4YY3 M;  3TQS A;  2XEP A;  2EA0 A;  1QDR A;  5FTN A;  2UUA M;  2LH0 A;  2DWZ B;  2L7I A;  2I7P A;  4QNR A;  1Q3B A;  2NQ8 C;  4LRS A;  1RU3 A;  3VFD A;  5ITQ A;  4GIT A;  1GLN A;  3IG8 A;  1DGF A;  4LJ4 A;  4Z8X A;  3VK7 A;  1IXS A;  5C1B A;  3T6P A;  1EFU B;  2DZN B;  3K9O A;  3K2L A;  5L8R F;  1G8P A;  1N78 A;  1QYR A;  2GQF A;  3VKH A;  4FWG A;  1K3W A;  5ITR A;  2LBC A;  1IBL M;  1R4G A;  2DWN A;  3TE6 A;  2DWM A;  1XHB A;  3MK6 A;  3DOA A;  4IBD A;  3GPX A;  4ITQ A;  4IBB A;  1C7Y A;  2JY7 A;  2CHQ A;  3PNV A;  3PNY A;  1OQY A;  1NJF A;  2V1C A;  1Y8G A;  2D7G A;  4AZF A;  2C9C A;  3PXG A;  5JI2 E;  2R46 A;  2R65 A;  2JZ1 A;  4PD2 A;  4LGY A;  5KPR A;  1IN4 A;  3QWL A;  1LTM A;  4X62 M;  2F5Q A;  2QHO B;  4AKH A;  1TH2 A;  3ILK A;  2WSC F;  3SHF A;  3SAU A;  4DV6 M;  4LZZ A;  1L2B A;  2MR9 A;  4G6Z A;  2XH9 A;  4JI4 M;  4LF6 M;  3HWS A;  3LQR A;  4I4L A;  3IG5 A;  3JR5 A;  4OVZ A;  4PDG A;  3AFH A;  2KNZ A;  1GJS A;  3FRH A;  1N33 M;  1I4W A;  5EP1 A;  3TPZ A;  1TH3 A;  2FH0 A;  1EIJ A;  3HU3 A;  1HJP A;  5E6J A;  3W68 A;  1X37 A;  2KNV A;  1HT2 E;  1OTR A;  1R5L A;  1T6O A;  4DBG B;  1IN6 A;  3J7B A;  3U6S A;  2OQ4 A;  3DFZ A;  4R7G A; 
#chains in the Genus database with same CATH homology
 2VDB B;  1GAB A;  1GJS A;  2MH8 A;  1GJT A;  2LHC A;  2J5Y A;  2JWS A;  2KDL A;  2LHG A;  2N35 A;  2FS1 A;  1TF0 B;  1PRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...