2LHCA

Ga98 solution structure
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKELVDAGTAEKYFKLIANAKTVEGVWTLKDEIKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ga98
publication title Mutational tipping points for switching protein folds and functions.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2lhcA00
2N35A 2KDLA 2VDBB 2FS1A 2LHGA 1GABA 2JWSA 2LHCA 2MH8A 1TF0B 1GJSA 1PRBA 1GJTA 2J5YA
chains in the Genus database with same CATH superfamily
3B89A 1Z5CA 3HJQA 1PJJA 2BNKA 4B08A 1PJTA 2X8AA 1V34A 1N78A 4IBEA 1MJGM 2LVPC 1NJGA 4M9XA 1JB0F 4IBFA 1HNZM 2CE7A 2EJSA 2FOIC 5FLXS 1T6OA 3ZCBB 5ITTA 3Q8GA 5FSWA 4X65M 4M9ZA 2R44A 4DV6M 1Q39A 1TGUA 3GPUA 2J7NA 4LRSA 4DR2M 3SAUA 1JR3D 1Q02A 2QCUA 8CATA 1QAMA 1L1TA 1Y8GA 1KYIA 2QP9X 2LTUA 3B7ZA 3LQQA 4D82A 4HEOA 3HY5A 3B7QA 2CV0A 1OAIA 4JI4M 2BWEA 1DGFA 4GHAA 1VDLA 1WR1B 1G59A 4OX9M 4BB9A 2QBYA 3SHGB 3D8BA 3U6EA 1DV0A 4NXMM 1L2CA 1GABA 2ZBKB 4JI2M 1I4WA 1GLNA 3TL4X 4FCTA 4LJ7A 4B3TM 4WURA 2HCBA 4JYAM 3GLHE 1LTMA 3LCUA 3JR5A 4OW0A 4R3DA 4DR3M 1Z59A 3NBXX 4IBJA 2I7NA 3J80S 4L8RC 4XK8F 4BBAA 2V1UA 4JI1M 2C96A 1R7RA 1F4IA 2HHHM 1OJLA 4FCWA 1IN6A 3RGPA 4YHHM 1C1KA 2Y0TA 3U60A 4MGKE 4IBKA 3T38A 2WSCF 2P5TA 1WGLA 3SYKA 2RRUA 4IBCA 1J5EM 1N33M 5BR8M 3C9PA 2DZNB 3A42A 2JNHA 1L2BA 1HQCA 1GJSA 2DAGA 4Y28F 4LJ9A 2G8LA 3J7AS 3Q8XA 3PVSA 3ZH9B 4DR5M 3F92A 2JY8A 4DV4M 3AOGA 2DENA 2MGWA 2DAKA 1N77A 2Q2EB 1QAQA 7CATA 3GO8A 3RGSA 1IQPA 2F5PA 3FD9A 1N75A 3K9PA 4LF7M 2L7IA 3GQ5A 1V33A 2VQEM 1DO2A 1TH2A 2GQFA 3THGA 4LJAA 3L25A 4B3MM 4LZZA 2LWXA 3QAUA 4RNAA 3B9PA 1NY5A 3FUWA 4MGYE 1PRBA 1E9SA 5DYGA 4X62M 4X64M 1JR3E 1IXSA 5FTNA 5F3WA 3AFHA 1XHBA 1PM5A 2LVAA 2F5OA 1R2ZA 2VDBB 4DBGB 4DR1M 4II7A 3B7NA 2DZLA 3U6SA 4EIWA 2JZ0A 3AOEC 2H5XA 1D0MA 1VEGA 3HKPA 2XH9A 4Q7JA 3KFUG 3W0LB 3U6OA 1VDDA 4JV5M 2KRKA 1Z5BA 2HKJA 4LRTA 5KPTA 4GC9A 2CHVA 2HWJA 2Y21A 4GMQA 3I51A 3KS4A 3QWLA 2L4FA 5FTMA 2F5QA 2ZTCA 4DR4M 3CTWB 3PFIA 2XGNA 1IN4A 1YUBA 2G5GX 2XEPA 5EXTA 3GLIA 1D2NA 4LF6M 2BWBA 4CJ6A 3HHWA 2L2DA 2RGOA 3TE6A 2BJWA 5C18A 4FWHA 4OVZB 4FWDA 3LQRA 1R2YA 1W5TA 2J5YA 2R62A 3U6DA 5EP2A 3SARA 2KZUA 3W67A 2F5NA 4FW9A 1GKIA 3CF2A 4AQYM 3I01M 2FS1A 2DWNA 2JUJA 2DWLA 3NBIA 2UUAM 3HU2A 4Z6YA 2V1CA 1L8QA 2BJVA 2FE8A 4LCBA 3W68A 4JI6M 3GLHB 4GHLA 4QOSA 1AIPC 2KRUA 3H4MA 1N32M 2Z4SA 1HQYE 3B74A 1QVRA 3FUTA 3L27A 2UXBM 4JI3M 1E9RA 1OKSA 3SBJA 4NSRA 3U6PA 3KOWE 4I81A 2EA0A 2DHRA 3EIHA 1NV9A 1IN8A 3GLIE 2R65A 1RU3A 3AOEA 4D80A 4AKGA 5JI2E 3GLFB 2Y0QA 4LG2A 1G41A 1GL7A 3TPZA 3L2AA 5EQTA 5FTLA 3AL0C 1SG9A 2A5YB 2KNVA 3KP0E 5GKNA 4G3OA 2LBCA 4IBIA 3RFWA 1E32A 2G3QA 1KSFX 2QSFX 4AW4A 5DNYA 4MH0E 3T15A 4G4RA 5FTKA 3GLFA 2QBYB 3GRYA 2L4EA 3LVVA 1N36M 3KXEC 1NNUC 4NSOB 4DR7M 2JY5A 2C99A 1IM2A 2QPAA 2R18A 3CF6E 3J7BA 1EIJA 2OO9A 3HJ8A 3ILKA 4XGIA 2GNOA 2Z4RA 5ITXA 2YNMD 1DGHB 4PT5A 2DAIA 1MN3A 3C3DA 1IFYA 2CUZA 1YE9A 1J09A 2K6BA 1EE8A 1WHCA 2D7EA 2N35A 5C1BA 2ZM6M 2CV1A 4B7FA 4DUYM 1DGHA 2KW0A 1DGBA 1DGGA 1NY6A 1QDRA 3M6AA 3U60B 1YLAA 5EJCA 2YQZA 2KZSA 2XSZA 5KPZA 2JY6B 4BLCA 3PNVA 4M0DA 3C58A 4B7HA 1QZEA 2MR9A 1MX0A 1ZMWA 1TTEA 2B3TA 1PJSA 4B7GA 1BVSA 2C9CA 2W82A 4B3RM 4KLNA 3SMPA 4IBBA 4DV1M 3NWLA 4RKUF 4UN2B 3HU3A 1UFZA 3SC3A 1HNWM 2Z7JA 5IZ7D 3HU1A 3GLFE 2DI0A 1R5LA 1TR8A 3KSJA 4OU7A 1XMOM 2XFSA 5DFLA 4LF5M 3SFZA 3E9SA 4JXJA 2C98A 2FNAA 4JI0M 4JI7M 1HT2E 1GVNA 1IN7A 3GRVA 4PDGA 2R46A 2OPFA 2D7HA 4GKKM 1JQJC 4LJ6A 1T3TA 5ITRA 3TWLA 4F1IA 1IXSB 3HX3A 2D7GA 1GL6A 3H4JA 4LF4M 4LZJA 3I4YA 3GRUA 3SASA 3V76A 2UU9M 1TDHA 2KXEA 2ZAMA 3GPPA 1G4AE 3E21A 3KW6A 2EKKA 1NJFA 4CGYB 3SYLA 3SATA 4LF9M 1MU5A 1NHGC 3VFDA 2KNAA 3VLFB 2KHHA 2C5RA 5IT9S 4P17A 2LXEA 3GPYA 3AV0A 3U5ZA 3UGJA 1V92A 1QUTA 3E4RA 3DFZA 3GLIB 1N34M 2CEAA 1Q3CA 4GEWA 2ZANA 4GITA 2J7OA 2M5ZA 1VEJA 3GQ4A 1QZMA 2UUCM 4Z8XA 1XNRM 5FTJA 2M60A 3EIEA 1QDTA 1IY0A 2K47A 2XLJA 3WHLA 3FTFA 3AJIB 1XNQM 4GRIA 2RKOA 1OQYA 3E46A 1IBKM 1G3IA 1T43A 5IWAM 3FE3A 4AZFA 3MJ5A 5LMUM 1K82A 2LNHC 3VKGA 3TWMA 4DV0M 3L28A 4QHSA 2VF7A 5LMNM 2Z3XA 5EP1A 1IY2A 4MGHA 1SXJC 1ZAEA 2L6OA 2NQ8C 1IXRC 1TH4A 1I94M 4WP2A 2DXIA 4MGIE 4MM3B 3ZC7B 2UXDM 1NHWC 2X49A 4QOZC 5L8RF 3K8ZA 4AKHA 3FTEA 4MB7A 4JI5M 1XXHA 2DAEA 3IHPA 2QENA 2I7PA 1LV7A 2V6ZM 3J27B 3J81S 1EFUB 1P3QQ 2LVQD 2XZUA 2JY7A 5DYIA 4KT0F 4D81A 5KO3A 2X4AA 3QYBA 2UUBM 4DR6M 3VDPA 3FKEA 3IG5A 1G71A 4G4NA 3U6MA 4F2LA 2APLA 3ZQJA 4NRWA 1J7KA 2Z8YM 3AKZA 3LW5F 4DV3M 1IN5A 2WSFF 5H37D 3T1YM 2R45A 2DVWB 3MMPA 3GQ3A 2L7HA 3R8FA 4QNRA 3OTOM 1SXJD 1D0LA 2CV2A 4IBGA 4NC6A 4DV5M 2E5LM 2LH0A 3PXGA 3TQSA 4GIPA 3GLGA 2LHGA 3LVWA 4M9SA 1OTRA 2JP7A 1OIPA 3LMMA 2R0IA 3UZUA 2H1RA 4DV7M 2CFOA 2QHOB 1SXJB 1CUKA 3FUUA 3BBZA 1NO1A 5EXSA 3A98B 3PNYA 3M7GA 2XSZD 4QNMA 1ZMVA 2OQ4A 1NNJA 4CISA 3R9XB 2LVOC 2JZ1A 4CIZA 3K92A 1L1ZA 3U61A 1XXHE 4A3VB 2MJ5B 1WGNA 5ITYA 3HZJA 4L4UA 1SXJA 2FFJA 4LGYA 3U6LA 2VF8A 1ORYB 4TUWA 2O25A 2DZOB 2KNZA 1XMQM 4I4LA 2QQ8A 3KOYE 4G6ZA 3I4VA 3GPXA 3VDUA 2DAMA 2O5RA 1ZV1A 4DV2M 4L78A 3IG8A 1WJ7A 1ZMUA 2CRUA 3SAWA 1UM8A 2C9OA 4RF0A 5KPRA 3JR4A 3FUVA 4JI8M 3BXWA 3L26A 1X37A 3J2PB 2QNJA 4LY6A 4LJ8A 4DUZM 1TF0B 3GLGE 1AUAA 1NSFA 2CWBA 1KFVA 1GJTA 4KHPM 2OOBA 1QQWA 4IJEA 4LJ4A 3UK6A 2Y20A 4NXNM 1HT1E 2YR0A 2RGHA 5EXPA 2VIIA 3HHXA 1JR3A 4FCVA 4P16A 1E94E 1K3WA 1Q3BA 2L09A 5ITXE 3U6CA 1HJPA 3T6PA 3FYCA 1HNXM 1IBMM 3CGWA 3I04M 1OFIA 1TH3A 1K3XA 2F5SA 5BPVA 3K1JA 1SXJE 4GH9A 4JN6A 2R6FA 2ZTDA 1PGYA 5EP3A 5KQ8A 4REZA 2LHCA 3D8LA 3FTCA 4QHTA 2F4VM 1IY1A 1S3SA 4GC5A 5E26A 3U5ZB 2KA6B 1L2DA 3FTDA 3KOXE 3T1HM 2DNAA 3K2LA 4AI6A 1ZQ9A 2YFQA 4X66M 4W5WA 3U6QA 4G4QA 1HR0M 4M0WA 1QANA 2DKLA 3SMSA 4KO8A 2OOAA 1OAOC 3KSXA 3SHFA 3GP1A 4LGMA 2WZJA 5EP4A 2XF3A 3LCVB 3DZDA 3MHVC 4LFAM 1DO0A 2JWSA 3GRRA 2DHYA 4ITQA 1PJQA 1FNNA 1R4GA 3A46A 3RE8A 3VK7A 3SAVA 4IBDA 5EXXA 3JAMS 1Z5AA 4I8OA 4IIWA 4FVMA 1VEKA 2EO2A 4XBOA 3TWKA 2DWMA 4R71A 3KS8A 4HL4A 2JA2A 2XZFA 4NOOB 1OIZA 3HGIA 2K0BX 2KDLA 3FRIA 4AG6A 4YY3M 3VK8A 4RF1A 2ERCA 2WSEF 3HHYA 1GO5A 2CP8A 3KP1E 4ZPXA 1YSYA 2JXNA 2ZAOA 3K9OA 2LVNC 1XB2B 1C7YA 1IBLM 4KODA 5E6JA 4ANRA 1NVMA 1XXHB 2CHGA 5IREB 4PDIA 1D0KA 3M0EA 2EKFA 1R6BX 3MK6A 4AG5A 1VQ1A 2R4EA 3CF0A 1NV8A 4S12A 1OFHA 1XWIA 1H6UA 2MH8A 2R4JA 3FYDA 4I5SA 4LJ5A 4WW0A 4R7GA 5ITQA 4FWGA 3W0FA 2VQFM 3C3EA 2K9DA 3HJSA 2HAKA 4CHTB 4GKJM 3UJNA 1FJGM 2MROB 4FD2A 5ITUA 2HL7A 4LFCM 3HWSA 4G4OA 1QYRA 4K0KM 4PCZA 2CHQA 2UXCM 3FUXA 4PD2A 3DA1A 2AHMA 1XC8A 3BOSA 1TDZA 2EUCA 4MGZE 4L15A 1WXQA 4NL4H 3GLGB 3UMMA 1WIVA 1Z6TA 1A5TA 4OVZA 5KQDA 3FRHA 4L6V6 4AKIA 4LFBM 1W5SA 2KEBA 3L29A 4NRVA 2FH0A 4B3SM 2XFTA 3IECA 4IJFA 3KDSE 3QYEA 5A2QS 3WHKA 4L16A 3DOAA 3U61B 4LF8M 1QUSA 1VG5A 3KOZE 3KVWA 3HHZA 5JI3E 2O01F 3VKHA 4HLQA 3A45A 1G8PA 2QZ4A 3GLHA 1QAOA 1IXZA 2DWZB 1PJIA
chains in the Genus database with same CATH topology
2N35A 2KDLA 2VDBB 2FS1A 2LHGA 1GABA 2JWSA 2LHCA 2MH8A 1TF0B 1GJSA 1PRBA 1GJTA 2J5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N35 A;  2KDL A;  2VDB B;  2FS1 A;  2LHG A;  1GAB A;  2JWS A;  2LHC A;  2MH8 A;  1TF0 B;  1GJS A;  1PRB A;  1GJT A;  2J5Y A; 
#chains in the Genus database with same CATH topology
 3B89 A;  1Z5C A;  3HJQ A;  1PJJ A;  2BNK A;  4B08 A;  1PJT A;  2X8A A;  1V34 A;  1N78 A;  4IBE A;  1MJG M;  2LVP C;  1NJG A;  4M9X A;  1JB0 F;  4IBF A;  1HNZ M;  2CE7 A;  2EJS A;  2FOI C;  5FLX S;  1T6O A;  3ZCB B;  5ITT A;  3Q8G A;  5FSW A;  4X65 M;  4M9Z A;  2R44 A;  4DV6 M;  1Q39 A;  1TGU A;  3GPU A;  2J7N A;  4LRS A;  4DR2 M;  3SAU A;  1JR3 D;  1Q02 A;  2QCU A;  8CAT A;  1QAM A;  1L1T A;  1Y8G A;  1KYI A;  2QP9 X;  2LTU A;  3B7Z A;  3LQQ A;  4D82 A;  4HEO A;  3HY5 A;  3B7Q A;  2CV0 A;  1OAI A;  4JI4 M;  2BWE A;  1DGF A;  4GHA A;  1VDL A;  1WR1 B;  1G59 A;  4OX9 M;  4BB9 A;  2QBY A;  3SHG B;  3D8B A;  3U6E A;  1DV0 A;  4NXM M;  1L2C A;  1GAB A;  2ZBK B;  4JI2 M;  1I4W A;  1GLN A;  3TL4 X;  4FCT A;  4LJ7 A;  4B3T M;  4WUR A;  2HCB A;  4JYA M;  3GLH E;  1LTM A;  3LCU A;  3JR5 A;  4OW0 A;  4R3D A;  4DR3 M;  1Z59 A;  3NBX X;  4IBJ A;  2I7N A;  3J80 S;  4L8R C;  4XK8 F;  4BBA A;  2V1U A;  4JI1 M;  2C96 A;  1R7R A;  1F4I A;  2HHH M;  1OJL A;  4FCW A;  1IN6 A;  3RGP A;  4YHH M;  1C1K A;  2Y0T A;  3U60 A;  4MGK E;  4IBK A;  3T38 A;  2WSC F;  2P5T A;  1WGL A;  3SYK A;  2RRU A;  4IBC A;  1J5E M;  1N33 M;  5BR8 M;  3C9P A;  2DZN B;  3A42 A;  2JNH A;  1L2B A;  1HQC A;  1GJS A;  2DAG A;  4Y28 F;  4LJ9 A;  2G8L A;  3J7A S;  3Q8X A;  3PVS A;  3ZH9 B;  4DR5 M;  3F92 A;  2JY8 A;  4DV4 M;  3AOG A;  2DEN A;  2MGW A;  2DAK A;  1N77 A;  2Q2E B;  1QAQ A;  7CAT A;  3GO8 A;  3RGS A;  1IQP A;  2F5P A;  3FD9 A;  1N75 A;  3K9P A;  4LF7 M;  2L7I A;  3GQ5 A;  1V33 A;  2VQE M;  1DO2 A;  1TH2 A;  2GQF A;  3THG A;  4LJA A;  3L25 A;  4B3M M;  4LZZ A;  2LWX A;  3QAU A;  4RNA A;  3B9P A;  1NY5 A;  3FUW A;  4MGY E;  1PRB A;  1E9S A;  5DYG A;  4X62 M;  4X64 M;  1JR3 E;  1IXS A;  5FTN A;  5F3W A;  3AFH A;  1XHB A;  1PM5 A;  2LVA A;  2F5O A;  1R2Z A;  2VDB B;  4DBG B;  4DR1 M;  4II7 A;  3B7N A;  2DZL A;  3U6S A;  4EIW A;  2JZ0 A;  3AOE C;  2H5X A;  1D0M A;  1VEG A;  3HKP A;  2XH9 A;  4Q7J A;  3KFU G;  3W0L B;  3U6O A;  1VDD A;  4JV5 M;  2KRK A;  1Z5B A;  2HKJ A;  4LRT A;  5KPT A;  4GC9 A;  2CHV A;  2HWJ A;  2Y21 A;  4GMQ A;  3I51 A;  3KS4 A;  3QWL A;  2L4F A;  5FTM A;  2F5Q A;  2ZTC A;  4DR4 M;  3CTW B;  3PFI A;  2XGN A;  1IN4 A;  1YUB A;  2G5G X;  2XEP A;  5EXT A;  3GLI A;  1D2N A;  4LF6 M;  2BWB A;  4CJ6 A;  3HHW A;  2L2D A;  2RGO A;  3TE6 A;  2BJW A;  5C18 A;  4FWH A;  4OVZ B;  4FWD A;  3LQR A;  1R2Y A;  1W5T A;  2J5Y A;  2R62 A;  3U6D A;  5EP2 A;  3SAR A;  2KZU A;  3W67 A;  2F5N A;  4FW9 A;  1GKI A;  3CF2 A;  4AQY M;  3I01 M;  2FS1 A;  2DWN A;  2JUJ A;  2DWL A;  3NBI A;  2UUA M;  3HU2 A;  4Z6Y A;  2V1C A;  1L8Q A;  2BJV A;  2FE8 A;  4LCB A;  3W68 A;  4JI6 M;  3GLH B;  4GHL A;  4QOS A;  1AIP C;  2KRU A;  3H4M A;  1N32 M;  2Z4S A;  1HQY E;  3B74 A;  1QVR A;  3FUT A;  3L27 A;  2UXB M;  4JI3 M;  1E9R A;  1OKS A;  3SBJ A;  4NSR A;  3U6P A;  3KOW E;  4I81 A;  2EA0 A;  2DHR A;  3EIH A;  1NV9 A;  1IN8 A;  3GLI E;  2R65 A;  1RU3 A;  3AOE A;  4D80 A;  4AKG A;  5JI2 E;  3GLF B;  2Y0Q A;  4LG2 A;  1G41 A;  1GL7 A;  3TPZ A;  3L2A A;  5EQT A;  5FTL A;  3AL0 C;  1SG9 A;  2A5Y B;  2KNV A;  3KP0 E;  5GKN A;  4G3O A;  2LBC A;  4IBI A;  3RFW A;  1E32 A;  2G3Q A;  1KSF X;  2QSF X;  4AW4 A;  5DNY A;  4MH0 E;  3T15 A;  4G4R A;  5FTK A;  3GLF A;  2QBY B;  3GRY A;  2L4E A;  3LVV A;  1N36 M;  3KXE C;  1NNU C;  4NSO B;  4DR7 M;  2JY5 A;  2C99 A;  1IM2 A;  2QPA A;  2R18 A;  3CF6 E;  3J7B A;  1EIJ A;  2OO9 A;  3HJ8 A;  3ILK A;  4XGI A;  2GNO A;  2Z4R A;  5ITX A;  2YNM D;  1DGH B;  4PT5 A;  2DAI A;  1MN3 A;  3C3D A;  1IFY A;  2CUZ A;  1YE9 A;  1J09 A;  2K6B A;  1EE8 A;  1WHC A;  2D7E A;  2N35 A;  5C1B A;  2ZM6 M;  2CV1 A;  4B7F A;  4DUY M;  1DGH A;  2KW0 A;  1DGB A;  1DGG A;  1NY6 A;  1QDR A;  3M6A A;  3U60 B;  1YLA A;  5EJC A;  2YQZ A;  2KZS A;  2XSZ A;  5KPZ A;  2JY6 B;  4BLC A;  3PNV A;  4M0D A;  3C58 A;  4B7H A;  1QZE A;  2MR9 A;  1MX0 A;  1ZMW A;  1TTE A;  2B3T A;  1PJS A;  4B7G A;  1BVS A;  2C9C A;  2W82 A;  4B3R M;  4KLN A;  3SMP A;  4IBB A;  4DV1 M;  3NWL A;  4RKU F;  4UN2 B;  3HU3 A;  1UFZ A;  3SC3 A;  1HNW M;  2Z7J A;  5IZ7 D;  3HU1 A;  3GLF E;  2DI0 A;  1R5L A;  1TR8 A;  3KSJ A;  4OU7 A;  1XMO M;  2XFS A;  5DFL A;  4LF5 M;  3SFZ A;  3E9S A;  4JXJ A;  2C98 A;  2FNA A;  4JI0 M;  4JI7 M;  1HT2 E;  1GVN A;  1IN7 A;  3GRV A;  4PDG A;  2R46 A;  2OPF A;  2D7H A;  4GKK M;  1JQJ C;  4LJ6 A;  1T3T A;  5ITR A;  3TWL A;  4F1I A;  1IXS B;  3HX3 A;  2D7G A;  1GL6 A;  3H4J A;  4LF4 M;  4LZJ A;  3I4Y A;  3GRU A;  3SAS A;  3V76 A;  2UU9 M;  1TDH A;  2KXE A;  2ZAM A;  3GPP A;  1G4A E;  3E21 A;  3KW6 A;  2EKK A;  1NJF A;  4CGY B;  3SYL A;  3SAT A;  4LF9 M;  1MU5 A;  1NHG C;  3VFD A;  2KNA A;  3VLF B;  2KHH A;  2C5R A;  5IT9 S;  4P17 A;  2LXE A;  3GPY A;  3AV0 A;  3U5Z A;  3UGJ A;  1V92 A;  1QUT A;  3E4R A;  3DFZ A;  3GLI B;  1N34 M;  2CEA A;  1Q3C A;  4GEW A;  2ZAN A;  4GIT A;  2J7O A;  2M5Z A;  1VEJ A;  3GQ4 A;  1QZM A;  2UUC M;  4Z8X A;  1XNR M;  5FTJ A;  2M60 A;  3EIE A;  1QDT A;  1IY0 A;  2K47 A;  2XLJ A;  3WHL A;  3FTF A;  3AJI B;  1XNQ M;  4GRI A;  2RKO A;  1OQY A;  3E46 A;  1IBK M;  1G3I A;  1T43 A;  5IWA M;  3FE3 A;  4AZF A;  3MJ5 A;  5LMU M;  1K82 A;  2LNH C;  3VKG A;  3TWM A;  4DV0 M;  3L28 A;  4QHS A;  2VF7 A;  5LMN M;  2Z3X A;  5EP1 A;  1IY2 A;  4MGH A;  1SXJ C;  1ZAE A;  2L6O A;  2NQ8 C;  1IXR C;  1TH4 A;  1I94 M;  4WP2 A;  2DXI A;  4MGI E;  4MM3 B;  3ZC7 B;  2UXD M;  1NHW C;  2X49 A;  4QOZ C;  5L8R F;  3K8Z A;  4AKH A;  3FTE A;  4MB7 A;  4JI5 M;  1XXH A;  2DAE A;  3IHP A;  2QEN A;  2I7P A;  1LV7 A;  2V6Z M;  3J27 B;  3J81 S;  1EFU B;  1P3Q Q;  2LVQ D;  2XZU A;  2JY7 A;  5DYI A;  4KT0 F;  4D81 A;  5KO3 A;  2X4A A;  3QYB A;  2UUB M;  4DR6 M;  3VDP A;  3FKE A;  3IG5 A;  1G71 A;  4G4N A;  3U6M A;  4F2L A;  2APL A;  3ZQJ A;  4NRW A;  1J7K A;  2Z8Y M;  3AKZ A;  3LW5 F;  4DV3 M;  1IN5 A;  2WSF F;  5H37 D;  3T1Y M;  2R45 A;  2DVW B;  3MMP A;  3GQ3 A;  2L7H A;  3R8F A;  4QNR A;  3OTO M;  1SXJ D;  1D0L A;  2CV2 A;  4IBG A;  4NC6 A;  4DV5 M;  2E5L M;  2LH0 A;  3PXG A;  3TQS A;  4GIP A;  3GLG A;  2LHG A;  3LVW A;  4M9S A;  1OTR A;  2JP7 A;  1OIP A;  3LMM A;  2R0I A;  3UZU A;  2H1R A;  4DV7 M;  2CFO A;  2QHO B;  1SXJ B;  1CUK A;  3FUU A;  3BBZ A;  1NO1 A;  5EXS A;  3A98 B;  3PNY A;  3M7G A;  2XSZ D;  4QNM A;  1ZMV A;  2OQ4 A;  1NNJ A;  4CIS A;  3R9X B;  2LVO C;  2JZ1 A;  4CIZ A;  3K92 A;  1L1Z A;  3U61 A;  1XXH E;  4A3V B;  2MJ5 B;  1WGN A;  5ITY A;  3HZJ A;  4L4U A;  1SXJ A;  2FFJ A;  4LGY A;  3U6L A;  2VF8 A;  1ORY B;  4TUW A;  2O25 A;  2DZO B;  2KNZ A;  1XMQ M;  4I4L A;  2QQ8 A;  3KOY E;  4G6Z A;  3I4V A;  3GPX A;  3VDU A;  2DAM A;  2O5R A;  1ZV1 A;  4DV2 M;  4L78 A;  3IG8 A;  1WJ7 A;  1ZMU A;  2CRU A;  3SAW A;  1UM8 A;  2C9O A;  4RF0 A;  5KPR A;  3JR4 A;  3FUV A;  4JI8 M;  3BXW A;  3L26 A;  1X37 A;  3J2P B;  2QNJ A;  4LY6 A;  4LJ8 A;  4DUZ M;  1TF0 B;  3GLG E;  1AUA A;  1NSF A;  2CWB A;  1KFV A;  1GJT A;  4KHP M;  2OOB A;  1QQW A;  4IJE A;  4LJ4 A;  3UK6 A;  2Y20 A;  4NXN M;  1HT1 E;  2YR0 A;  2RGH A;  5EXP A;  2VII A;  3HHX A;  1JR3 A;  4FCV A;  4P16 A;  1E94 E;  1K3W A;  1Q3B A;  2L09 A;  5ITX E;  3U6C A;  1HJP A;  3T6P A;  3FYC A;  1HNX M;  1IBM M;  3CGW A;  3I04 M;  1OFI A;  1TH3 A;  1K3X A;  2F5S A;  5BPV A;  3K1J A;  1SXJ E;  4GH9 A;  4JN6 A;  2R6F A;  2ZTD A;  1PGY A;  5EP3 A;  5KQ8 A;  4REZ A;  2LHC A;  3D8L A;  3FTC A;  4QHT A;  2F4V M;  1IY1 A;  1S3S A;  4GC5 A;  5E26 A;  3U5Z B;  2KA6 B;  1L2D A;  3FTD A;  3KOX E;  3T1H M;  2DNA A;  3K2L A;  4AI6 A;  1ZQ9 A;  2YFQ A;  4X66 M;  4W5W A;  3U6Q A;  4G4Q A;  1HR0 M;  4M0W A;  1QAN A;  2DKL A;  3SMS A;  4KO8 A;  2OOA A;  1OAO C;  3KSX A;  3SHF A;  3GP1 A;  4LGM A;  2WZJ A;  5EP4 A;  2XF3 A;  3LCV B;  3DZD A;  3MHV C;  4LFA M;  1DO0 A;  2JWS A;  3GRR A;  2DHY A;  4ITQ A;  1PJQ A;  1FNN A;  1R4G A;  3A46 A;  3RE8 A;  3VK7 A;  3SAV A;  4IBD A;  5EXX A;  3JAM S;  1Z5A A;  4I8O A;  4IIW A;  4FVM A;  1VEK A;  2EO2 A;  4XBO A;  3TWK A;  2DWM A;  4R71 A;  3KS8 A;  4HL4 A;  2JA2 A;  2XZF A;  4NOO B;  1OIZ A;  3HGI A;  2K0B X;  2KDL A;  3FRI A;  4AG6 A;  4YY3 M;  3VK8 A;  4RF1 A;  2ERC A;  2WSE F;  3HHY A;  1GO5 A;  2CP8 A;  3KP1 E;  4ZPX A;  1YSY A;  2JXN A;  2ZAO A;  3K9O A;  2LVN C;  1XB2 B;  1C7Y A;  1IBL M;  4KOD A;  5E6J A;  4ANR A;  1NVM A;  1XXH B;  2CHG A;  5IRE B;  4PDI A;  1D0K A;  3M0E A;  2EKF A;  1R6B X;  3MK6 A;  4AG5 A;  1VQ1 A;  2R4E A;  3CF0 A;  1NV8 A;  4S12 A;  1OFH A;  1XWI A;  1H6U A;  2MH8 A;  2R4J A;  3FYD A;  4I5S A;  4LJ5 A;  4WW0 A;  4R7G A;  5ITQ A;  4FWG A;  3W0F A;  2VQF M;  3C3E A;  2K9D A;  3HJS A;  2HAK A;  4CHT B;  4GKJ M;  3UJN A;  1FJG M;  2MRO B;  4FD2 A;  5ITU A;  2HL7 A;  4LFC M;  3HWS A;  4G4O A;  1QYR A;  4K0K M;  4PCZ A;  2CHQ A;  2UXC M;  3FUX A;  4PD2 A;  3DA1 A;  2AHM A;  1XC8 A;  3BOS A;  1TDZ A;  2EUC A;  4MGZ E;  4L15 A;  1WXQ A;  4NL4 H;  3GLG B;  3UMM A;  1WIV A;  1Z6T A;  1A5T A;  4OVZ A;  5KQD A;  3FRH A;  4L6V 6;  4AKI A;  4LFB M;  1W5S A;  2KEB A;  3L29 A;  4NRV A;  2FH0 A;  4B3S M;  2XFT A;  3IEC A;  4IJF A;  3KDS E;  3QYE A;  5A2Q S;  3WHK A;  4L16 A;  3DOA A;  3U61 B;  4LF8 M;  1QUS A;  1VG5 A;  3KOZ E;  3KVW A;  3HHZ A;  5JI3 E;  2O01 F;  3VKH A;  4HLQ A;  3A45 A;  1G8P A;  2QZ4 A;  3GLH A;  1QAO A;  1IXZ A;  2DWZ B;  1PJI A; 
#chains in the Genus database with same CATH homology
 2N35 A;  2KDL A;  2VDB B;  2FS1 A;  2LHG A;  1GAB A;  2JWS A;  2LHC A;  2MH8 A;  1TF0 B;  1GJS A;  1PRB A;  1GJT A;  2J5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...