2LHCA

Ga98 solution structure
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
b'TTYKLILNLKQAKEEAIKELVDAGTAEKYFKLIANAKTVEGVWTLKDEIKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ga98
publication title Mutational tipping points for switching protein folds and functions.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2lhcA00
2LHGA 2LHCA 2J5YA 1PRBA 2MH8A 2VDBB 1GABA 1TF0B 1GJTA 2KDLA 2N35A 2JWSA 1GJSA 2FS1A
chains in the Genus database with same CATH superfamily
1GKIA 4RF0A 4QHTA 2ZAMA 2F5OA 2DKLA 3UK6A 4GITA 1VDLA 4FWDA 5FTNA 1OFHA 3ZQJA 1DGGA 3BOSA 3TWMA 2F4VM 1ZMUA 3KXEC 3IG5A 4DV1M 3SYLA 3FRIA 2F5NA 4LJ7A 2QENA 3GPUA 3TPZA 5L8RF 4IBCA 1NSFA 1IM2A 1TDHA 3SC3A 1OQYA 2MGWA 2X8AA 3LW5F 1ORYB 4JXJA 2JZ1A 1KSFX 4OU7A 3GPYA 1C7YA 1A5TA 3NBIA 3KW6A 1V92A 3CF2A 1Q3CA 1NV8A 4Q7JA 5LMUM 2Y0QA 1L1TA 3U6CA 4NRWA 2LHCA 2LXEA 4JI0M 1DGHB 2LBCA 1WHCA 1IXSB 3AOEA 4K0KM 3C3EA 5DYGA 3T15A 2WSEF 1OFIA 4LZJA 4Z6YA 2KXEA 2HCBA 2RRUA 2L4EA 2KRUA 1VQ1A 2KZUA 3U6QA 3W68A 5C18A 1IN5A 1IQPA 3HX3A 1G41A 4LJ4A 3L27A 4B7GA 2EKKA 3GO8A 3DOAA 4R7GA 4NL4H 2VQEM 5ITRA 4FWGA 3U6LA 3HHXA 1LTMA 3ZH9B 3W67A 3GPPA 3KOWE 3W0LB 3U5ZA 4IIWA 1L2DA 1QUSA 4G6ZA 2HHHM 2JP7A 2DI0A 1L1ZA 4JI6M 4REZA 5ITXA 4B3TM 3GLHE 2FFJA 3RGSA 4AI6A 1QZEA 1SXJC 3FUTA 1XHBA 1GJTA 1HT1E 4P16A 2DENA 4EIWA 2OQ4A 1R7RA 1IFYA 1FNNA 3W0FA 4X65M 1L2BA 1IBLM 1NJGA 3WHLA 4G4QA 4QOZC 1V33A 3FUVA 3L25A 3HGIA 4DBGB 3AOGA 4RKUF 2DZNB 2DAIA 2QCUA 4I5SA 4L6V6 4LFBM 4F1IA 3SMSA 1OIPA 1Z5AA 3C9PA 3E4RA 2RGOA 1KYIA 2YR0A 4QHSA 1TF0B 4JN6A 3LQRA 2I7PA 3FTEA 4CISA 2JY6B 2DXIA 1G4AE 1VEJA 1ZQ9A 4DV2M 1GL6A 3B9PA 1YUBA 3JR4A 4OVZB 3TWKA 3HU3A 1IBKM 2VF7A 3UZUA 3T1HM 2D7HA 2X4AA 1EE8A 3GLHA 3J27B 2DHYA 2FE8A 3CF6E 5E6JA 2CEAA 3B7QA 2D7GA 3GLGB 1N75A 1Q3BA 5LMNM 2VF8A 3FRHA 4LFCM 2LHGA 4FCWA 4DR1M 4LY6A 1Z5BA 2LWXA 1WIVA 5DNYA 2CHQA 4X62M 3SAVA 4TUWA 1N32M 2L2DA 3FTFA 5ITYA 4JI1M 2Y21A 3IHPA 2LVAA 3IECA 2M60A 3U6DA 1E9RA 3SMPA 4FW9A 2Z8YM 4KLNA 1ZV1A 1PJJA 1OAIA 1NY5A 2K6BA 1SG9A 2JUJA 2QP9X 4FCVA 3MMPA 4WP2A 4L15A 3U60A 3FD9A 4Z8XA 4B3MM 4NC6A 1F4IA 4IBBA 2UXCM 1DO2A 3HHWA 3KSJA 1N77A 1G71A 1IN8A 2R0IA 1NHGC 4AKHA 3CGWA 2LVPC 2CHGA 4G3OA 1HT2E 4MGZE 4PDIA 3ZCBB 2JY8A 4NSRA 3KFUG 3AL0C 4GKJM 1L8QA 2YQZA 3PFIA 4AKIA 4MM3B 4W5WA 3FUUA 3FUWA 1IXZA 3R9XB 3A42A 2Z4RA 2RKOA 2Y20A 1GVNA 2CRUA 3DZDA 3L28A 3LVVA 1ZMVA 2CP8A 5EXPA 5FTJA 1E32A 1OIZA 2CWBA 4NXNM 2R65A 1J7KA 3GRRA 4F2LA 1PM5A 2R45A 2DWMA 1OKSA 4G4OA 1WJ7A 1NY6A 2A5YB 3B74A 2VQFM 1E94E 3U61A 1GO5A 4GC9A 4ANRA 5EP2A 3AJIB 1QDTA 2QSFX 3AV0A 1HJPA 3CTWB 4JI5M 1XNQM 3M0EA 3AOEC 2V1UA 4LF9M 2XEPA 2O5RA 2H5XA 1JR3E 4DV0M 4IBKA 3L2AA 4I8OA 1NNJA 1J5EM 2R4EA 1G8PA 3BBZA 3DFZA 1HNZM 4M0DA 5H37D 2MROB 5C1BA 4B3SM 2LVOC 3NBXX 2L7HA 1K3WA 2LTUA 4MGIE 1NNUC 1R4GA 3J2PB 3HHYA 1G59A 1CUKA 2XFTA 3K92A 1IBMM 3HU2A 2KZSA 2P5TA 2CFOA 4IBIA 4D82A 3MHVC 4GRIA 1RU3A 3A46A 3ZC7B 4QOSA 5ITQA 3UGJA 4DR3M 4M9ZA 5EXTA 2K9DA 1PJSA 1R6BX 2KA6B 3WHKA 2HAKA 2XGNA 2FS1A 4B7FA 1MN3A 5A2QS 3I4YA 2MH8A 4DR5M 2MR9A 1VDDA 1R2ZA 4KHPM 2WSFF 4JV5M 3FYCA 1EFUB 3VKGA 3TL4X 3KOXE 5EXSA 3SAUA 1YLAA 4GKKM 1TTEA 5JI2E 4NXMM 2BNKA 1TH2A 1JR3A 3PNYA 3THGA 1DGHA 1Z6TA 1WGNA 4OX9M 2CE7A 1IXSA 4M9SA 4B3RM 1W5SA 2C99A 4CGYB 4II7A 4X66M 1I4WA 2JXNA 2DVWB 2UUCM 1Y8GA 4JI3M 3VDPA 4LF5M 1QVRA 4NRVA 4G4NA 3MK6A 3QWLA 4CIZA 2Z7JA 3VLFB 3KS8A 3TQSA 3GRYA 2Z3XA 3GLFB 1QZMA 3D8LA 3B7NA 3K2LA 1DGFA 2LVNC 2OO9A 2UU9M 3U6SA 3V76A 2F5SA 3ILKA 4WW0A 1XXHE 2ZANA 1IN7A 3E21A 4R71A 2EKFA 2EO2A 4LGMA 3EIHA 1V34A 3GQ4A 1K82A 4GHLA 3GLGE 4IBEA 4LGYA 2X49A 3T1YM 2K0BX 2RGHA 1E9SA 3B89A 3SHGB 4NSOB 1AIPC 2QBYB 3SASA 2LVQD 4LRSA 3LQQA 1UM8A 4D80A 1VEGA 8CATA 2O01F 3FKEA 4LF8M 4PT5A 3I04M 1P3QQ 2WZJA 1XXHB 3LCUA 1SXJB 4MGYE 2JY5A 4XBOA 1GABA 2APLA 2ZTDA 4RF1A 4GMQA 2BWEA 2KNZA 4QNMA 3VDUA 5BPVA 2C9OA 2LNHC 2QNJA 2DWLA 4NOOB 3LVWA 2CUZA 1QQWA 3UJNA 1IN6A 4OVZA 1VG5A 4D81A 4RNAA 2DZOB 2HL7A 2JA2A 3EIEA 1Z5CA 3K8ZA 5FSWA 1W5TA 3F92A 1VEKA 4LRTA 3GLGA 1D2NA 1IY1A 4HEOA 3I51A 5IT9S 3PNVA 4AW4A 4PDGA 3GLIB 1XC8A 1JR3D 2J5YA 4HL4A 4IJEA 4Y28F 4L4UA 1D0KA 3RE8A 4LF7M 1T6OA 5GKNA 4GHAA 1NJFA 3FTCA 2QQ8A 3AFHA 1UFZA 4B7HA 1AUAA 2EUCA 2JWSA 4ITQA 2WSCF 2G8LA 2BJVA 4GC5A 3T38A 2QPAA 2J7NA 4FD2A 3SARA 3IG8A 4KT0F 2L7IA 3GRUA 4BBAA 2Q2EB 1GL7A 4G4RA 3J81S 4AG6A 4XGIA 4QNRA 2E5LM 4B08A 3I4VA 4FCTA 3B7ZA 3FE3A 2KNAA 2BJWA 2M5ZA 2ZAOA 5FTLA 4DR2M 4MH0E 1TR8A 4JI7M 1MU5A 5KPTA 1WXQA 4I4LA 4LJ9A 3J80S 2V6ZM 1N33M 2GQFA 3MJ5A 4KODA 4UN2B 1XWIA 1OAOC 3GQ5A 3SBJA 1XMQM 4KO8A 3LCVB 2ZTCA 3SYKA 2C5RA 1YE9A 3BXWA 1Z59A 3I01M 1HQYE 2R62A 3FTDA 2L4FA 2FNAA 3OTOM 2L09A 2F5QA 2XF3A 2R18A 5EP3A 2HWJA 1L2CA 3L29A 1TH4A 3K9OA 1N34M 1NVMA 3U6OA 1KFVA 1WGLA 1QAMA 4IJFA 3QYBA 5EQTA 1D0LA 4WURA 1C1KA 1T3TA 1QUTA 5KQDA 4GIPA 1BVSA 1ZAEA 2DAEA 4AG5A 2ERCA 2Y0TA 2KDLA 2CV0A 4X64M 3SAWA 2CV1A 1MJGM 3J7AS 1SXJD 3HJQA 1GLNA 5FLXS 5F3WA 1YSYA 4LZZA 5FTKA 1I94M 2QZ4A 1IY0A 2XSZA 2VIIA 4ZPXA 3KDSE 5KO3A 4LF6M 3NWLA 5ITXE 2ZBKB 3D8BA 2R6FA 3VKHA 3GLFE 2JZ0A 2DAGA 4JYAM 3U6MA 1QYRA 2UXDM 4FWHA 2UXBM 2Z4SA 4P17A 1Q39A 4YHHM 2DNAA 1XB2B 2OOBA 3CF0A 4DR6M 1DO0A 3HY5A 4L78A 2JNHA 2J7OA 2C9CA 3HJSA 3U5ZB 2W82A 3FYDA 2MJ5B 1S3SA 1EIJA 1OJLA 3Q8GA 4L8RC 5KPZA 2L6OA 2CHVA 5IREB 1N78A 1TH3A 1J09A 2YNMD 2XZFA 1K3XA 2G3QA 3KP1E 4I81A 4S12A 3U6PA 1QAOA 1SXJE 2K47A 4MB7A 4LG2A 2XZUA 4LJ8A 3C58A 3GRVA 4IBGA 4XK8F 2DWZB 2V1CA 3E46A 3KVWA 4L16A 5EP1A 4CJ6A 2UUAM 4IBDA 3TE6A 7CATA 3DA1A 3T6PA 3GLFA 2OPFA 5KPRA 2XLJA 2HKJA 2DWNA 2UUBM 2QHOB 2H1RA 3LMMA 2BWBA 1HNXM 1R5LA 3KOZE 2EA0A 4AKGA 1TGUA 3PVSA 4M0WA 2VDBB 4LJAA 4DUYM 4DR7M 1ZMWA 5KQ8A 1N36M 1GJSA 2XFSA 2R46A 2ZM6M 1NO1A 3TWLA 1HQCA 1MX0A 3SATA 4DV3M 2DZLA 3GLHB 3FUXA 3GLIE 2QBYA 4JI8M 2I7NA 5BR8M 3HKPA 3C3DA 3Q8XA 1G3IA 3JAMS 1HR0M 3J7BA 4LJ6A 1IN4A 2R44A 2KW0A 3GQ3A 1XXHA 1SXJA 2B3TA 2EJSA 3UMMA 3HHZA 1TDZA 3M7GA 1PJIA 1T43A 4DV6M 1XNRM 3GPXA 2YFQA 3E9SA 4MGHA 3L26A 1DGBA 1X37A 4LCBA 3HZJA 4DV4M 4PCZA 1R2YA 4DV5M 1JB0F 5DFLA 4YY3M 3VK7A 2JY7A 3SHFA 2XSZD 4AZFA 4DUZM 3JR5A 1PRBA 2DAMA 3A98B 3R8FA 1H6UA 2DHRA 3M6AA 3U60B 1IY2A 2DAKA 2GNOA 4IBJA 1HNWM 2LH0A 4LF4M 2KRKA 3KS4A 2D7EA 4LFAM 3HWSA 3RGPA 1QDRA 5EJCA 2N35A 3GLIA 4JI2M 1NV9A 1DV0A 2R4JA 5JI3E 4AQYM 5DYIA 4DR4M 1OTRA 4JI4M 3HU1A 1D0MA 3QYEA 2NQ8C 3VK8A 4PD2A 1PGYA 4FVMA 4OW0A 2G5GX 2C98A 1QAQA 3H4MA 3GP1A 1NHWC 5EP4A 3U6EA 1IXRC 4GH9A 3AKZA 3KSXA 3U61B 4BLCA 2KHHA 4A3VB 3K1JA 4IBFA 5IWAM 4CHTB 5ITUA 2O25A 5EXXA 2AHMA 3KOYE 5ITTA 3H4JA 4MGKE 5IZ7D 4DV7M 1XMOM 2KNVA 1Q02A 3PXGA 1PJQA 3SFZA 2FH0A 2CV2A 1JQJC 3HJ8A 1FJGM 2FOIC 1LV7A 2KEBA 1WR1B 2OOAA 3VFDA 4GEWA 2XH9A 4M9XA 5E26A 5FTMA 4BB9A 2F5PA 3QAUA 1QANA 4HLQA 4R3DA 3A45A 3K9PA 3KP0E 4LJ5A 1PJTA 2C96A 3RFWA
chains in the Genus database with same CATH topology
2LHGA 2LHCA 2J5YA 1PRBA 2MH8A 2VDBB 1GABA 1TF0B 1GJTA 2KDLA 2N35A 2JWSA 1GJSA 2FS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHG A;  2LHC A;  2J5Y A;  1PRB A;  2MH8 A;  2VDB B;  1GAB A;  1TF0 B;  1GJT A;  2KDL A;  2N35 A;  2JWS A;  1GJS A;  2FS1 A; 
#chains in the Genus database with same CATH topology
 1GKI A;  4RF0 A;  4QHT A;  2ZAM A;  2F5O A;  2DKL A;  3UK6 A;  4GIT A;  1VDL A;  4FWD A;  5FTN A;  1OFH A;  3ZQJ A;  1DGG A;  3BOS A;  3TWM A;  2F4V M;  1ZMU A;  3KXE C;  3IG5 A;  4DV1 M;  3SYL A;  3FRI A;  2F5N A;  4LJ7 A;  2QEN A;  3GPU A;  3TPZ A;  5L8R F;  4IBC A;  1NSF A;  1IM2 A;  1TDH A;  3SC3 A;  1OQY A;  2MGW A;  2X8A A;  3LW5 F;  1ORY B;  4JXJ A;  2JZ1 A;  1KSF X;  4OU7 A;  3GPY A;  1C7Y A;  1A5T A;  3NBI A;  3KW6 A;  1V92 A;  3CF2 A;  1Q3C A;  1NV8 A;  4Q7J A;  5LMU M;  2Y0Q A;  1L1T A;  3U6C A;  4NRW A;  2LHC A;  2LXE A;  4JI0 M;  1DGH B;  2LBC A;  1WHC A;  1IXS B;  3AOE A;  4K0K M;  3C3E A;  5DYG A;  3T15 A;  2WSE F;  1OFI A;  4LZJ A;  4Z6Y A;  2KXE A;  2HCB A;  2RRU A;  2L4E A;  2KRU A;  1VQ1 A;  2KZU A;  3U6Q A;  3W68 A;  5C18 A;  1IN5 A;  1IQP A;  3HX3 A;  1G41 A;  4LJ4 A;  3L27 A;  4B7G A;  2EKK A;  3GO8 A;  3DOA A;  4R7G A;  4NL4 H;  2VQE M;  5ITR A;  4FWG A;  3U6L A;  3HHX A;  1LTM A;  3ZH9 B;  3W67 A;  3GPP A;  3KOW E;  3W0L B;  3U5Z A;  4IIW A;  1L2D A;  1QUS A;  4G6Z A;  2HHH M;  2JP7 A;  2DI0 A;  1L1Z A;  4JI6 M;  4REZ A;  5ITX A;  4B3T M;  3GLH E;  2FFJ A;  3RGS A;  4AI6 A;  1QZE A;  1SXJ C;  3FUT A;  1XHB A;  1GJT A;  1HT1 E;  4P16 A;  2DEN A;  4EIW A;  2OQ4 A;  1R7R A;  1IFY A;  1FNN A;  3W0F A;  4X65 M;  1L2B A;  1IBL M;  1NJG A;  3WHL A;  4G4Q A;  4QOZ C;  1V33 A;  3FUV A;  3L25 A;  3HGI A;  4DBG B;  3AOG A;  4RKU F;  2DZN B;  2DAI A;  2QCU A;  4I5S A;  4L6V 6;  4LFB M;  4F1I A;  3SMS A;  1OIP A;  1Z5A A;  3C9P A;  3E4R A;  2RGO A;  1KYI A;  2YR0 A;  4QHS A;  1TF0 B;  4JN6 A;  3LQR A;  2I7P A;  3FTE A;  4CIS A;  2JY6 B;  2DXI A;  1G4A E;  1VEJ A;  1ZQ9 A;  4DV2 M;  1GL6 A;  3B9P A;  1YUB A;  3JR4 A;  4OVZ B;  3TWK A;  3HU3 A;  1IBK M;  2VF7 A;  3UZU A;  3T1H M;  2D7H A;  2X4A A;  1EE8 A;  3GLH A;  3J27 B;  2DHY A;  2FE8 A;  3CF6 E;  5E6J A;  2CEA A;  3B7Q A;  2D7G A;  3GLG B;  1N75 A;  1Q3B A;  5LMN M;  2VF8 A;  3FRH A;  4LFC M;  2LHG A;  4FCW A;  4DR1 M;  4LY6 A;  1Z5B A;  2LWX A;  1WIV A;  5DNY A;  2CHQ A;  4X62 M;  3SAV A;  4TUW A;  1N32 M;  2L2D A;  3FTF A;  5ITY A;  4JI1 M;  2Y21 A;  3IHP A;  2LVA A;  3IEC A;  2M60 A;  3U6D A;  1E9R A;  3SMP A;  4FW9 A;  2Z8Y M;  4KLN A;  1ZV1 A;  1PJJ A;  1OAI A;  1NY5 A;  2K6B A;  1SG9 A;  2JUJ A;  2QP9 X;  4FCV A;  3MMP A;  4WP2 A;  4L15 A;  3U60 A;  3FD9 A;  4Z8X A;  4B3M M;  4NC6 A;  1F4I A;  4IBB A;  2UXC M;  1DO2 A;  3HHW A;  3KSJ A;  1N77 A;  1G71 A;  1IN8 A;  2R0I A;  1NHG C;  4AKH A;  3CGW A;  2LVP C;  2CHG A;  4G3O A;  1HT2 E;  4MGZ E;  4PDI A;  3ZCB B;  2JY8 A;  4NSR A;  3KFU G;  3AL0 C;  4GKJ M;  1L8Q A;  2YQZ A;  3PFI A;  4AKI A;  4MM3 B;  4W5W A;  3FUU A;  3FUW A;  1IXZ A;  3R9X B;  3A42 A;  2Z4R A;  2RKO A;  2Y20 A;  1GVN A;  2CRU A;  3DZD A;  3L28 A;  3LVV A;  1ZMV A;  2CP8 A;  5EXP A;  5FTJ A;  1E32 A;  1OIZ A;  2CWB A;  4NXN M;  2R65 A;  1J7K A;  3GRR A;  4F2L A;  1PM5 A;  2R45 A;  2DWM A;  1OKS A;  4G4O A;  1WJ7 A;  1NY6 A;  2A5Y B;  3B74 A;  2VQF M;  1E94 E;  3U61 A;  1GO5 A;  4GC9 A;  4ANR A;  5EP2 A;  3AJI B;  1QDT A;  2QSF X;  3AV0 A;  1HJP A;  3CTW B;  4JI5 M;  1XNQ M;  3M0E A;  3AOE C;  2V1U A;  4LF9 M;  2XEP A;  2O5R A;  2H5X A;  1JR3 E;  4DV0 M;  4IBK A;  3L2A A;  4I8O A;  1NNJ A;  1J5E M;  2R4E A;  1G8P A;  3BBZ A;  3DFZ A;  1HNZ M;  4M0D A;  5H37 D;  2MRO B;  5C1B A;  4B3S M;  2LVO C;  3NBX X;  2L7H A;  1K3W A;  2LTU A;  4MGI E;  1NNU C;  1R4G A;  3J2P B;  3HHY A;  1G59 A;  1CUK A;  2XFT A;  3K92 A;  1IBM M;  3HU2 A;  2KZS A;  2P5T A;  2CFO A;  4IBI A;  4D82 A;  3MHV C;  4GRI A;  1RU3 A;  3A46 A;  3ZC7 B;  4QOS A;  5ITQ A;  3UGJ A;  4DR3 M;  4M9Z A;  5EXT A;  2K9D A;  1PJS A;  1R6B X;  2KA6 B;  3WHK A;  2HAK A;  2XGN A;  2FS1 A;  4B7F A;  1MN3 A;  5A2Q S;  3I4Y A;  2MH8 A;  4DR5 M;  2MR9 A;  1VDD A;  1R2Z A;  4KHP M;  2WSF F;  4JV5 M;  3FYC A;  1EFU B;  3VKG A;  3TL4 X;  3KOX E;  5EXS A;  3SAU A;  1YLA A;  4GKK M;  1TTE A;  5JI2 E;  4NXM M;  2BNK A;  1TH2 A;  1JR3 A;  3PNY A;  3THG A;  1DGH A;  1Z6T A;  1WGN A;  4OX9 M;  2CE7 A;  1IXS A;  4M9S A;  4B3R M;  1W5S A;  2C99 A;  4CGY B;  4II7 A;  4X66 M;  1I4W A;  2JXN A;  2DVW B;  2UUC M;  1Y8G A;  4JI3 M;  3VDP A;  4LF5 M;  1QVR A;  4NRV A;  4G4N A;  3MK6 A;  3QWL A;  4CIZ A;  2Z7J A;  3VLF B;  3KS8 A;  3TQS A;  3GRY A;  2Z3X A;  3GLF B;  1QZM A;  3D8L A;  3B7N A;  3K2L A;  1DGF A;  2LVN C;  2OO9 A;  2UU9 M;  3U6S A;  3V76 A;  2F5S A;  3ILK A;  4WW0 A;  1XXH E;  2ZAN A;  1IN7 A;  3E21 A;  4R71 A;  2EKF A;  2EO2 A;  4LGM A;  3EIH A;  1V34 A;  3GQ4 A;  1K82 A;  4GHL A;  3GLG E;  4IBE A;  4LGY A;  2X49 A;  3T1Y M;  2K0B X;  2RGH A;  1E9S A;  3B89 A;  3SHG B;  4NSO B;  1AIP C;  2QBY B;  3SAS A;  2LVQ D;  4LRS A;  3LQQ A;  1UM8 A;  4D80 A;  1VEG A;  8CAT A;  2O01 F;  3FKE A;  4LF8 M;  4PT5 A;  3I04 M;  1P3Q Q;  2WZJ A;  1XXH B;  3LCU A;  1SXJ B;  4MGY E;  2JY5 A;  4XBO A;  1GAB A;  2APL A;  2ZTD A;  4RF1 A;  4GMQ A;  2BWE A;  2KNZ A;  4QNM A;  3VDU A;  5BPV A;  2C9O A;  2LNH C;  2QNJ A;  2DWL A;  4NOO B;  3LVW A;  2CUZ A;  1QQW A;  3UJN A;  1IN6 A;  4OVZ A;  1VG5 A;  4D81 A;  4RNA A;  2DZO B;  2HL7 A;  2JA2 A;  3EIE A;  1Z5C A;  3K8Z A;  5FSW A;  1W5T A;  3F92 A;  1VEK A;  4LRT A;  3GLG A;  1D2N A;  1IY1 A;  4HEO A;  3I51 A;  5IT9 S;  3PNV A;  4AW4 A;  4PDG A;  3GLI B;  1XC8 A;  1JR3 D;  2J5Y A;  4HL4 A;  4IJE A;  4Y28 F;  4L4U A;  1D0K A;  3RE8 A;  4LF7 M;  1T6O A;  5GKN A;  4GHA A;  1NJF A;  3FTC A;  2QQ8 A;  3AFH A;  1UFZ A;  4B7H A;  1AUA A;  2EUC A;  2JWS A;  4ITQ A;  2WSC F;  2G8L A;  2BJV A;  4GC5 A;  3T38 A;  2QPA A;  2J7N A;  4FD2 A;  3SAR A;  3IG8 A;  4KT0 F;  2L7I A;  3GRU A;  4BBA A;  2Q2E B;  1GL7 A;  4G4R A;  3J81 S;  4AG6 A;  4XGI A;  4QNR A;  2E5L M;  4B08 A;  3I4V A;  4FCT A;  3B7Z A;  3FE3 A;  2KNA A;  2BJW A;  2M5Z A;  2ZAO A;  5FTL A;  4DR2 M;  4MH0 E;  1TR8 A;  4JI7 M;  1MU5 A;  5KPT A;  1WXQ A;  4I4L A;  4LJ9 A;  3J80 S;  2V6Z M;  1N33 M;  2GQF A;  3MJ5 A;  4KOD A;  4UN2 B;  1XWI A;  1OAO C;  3GQ5 A;  3SBJ A;  1XMQ M;  4KO8 A;  3LCV B;  2ZTC A;  3SYK A;  2C5R A;  1YE9 A;  3BXW A;  1Z59 A;  3I01 M;  1HQY E;  2R62 A;  3FTD A;  2L4F A;  2FNA A;  3OTO M;  2L09 A;  2F5Q A;  2XF3 A;  2R18 A;  5EP3 A;  2HWJ A;  1L2C A;  3L29 A;  1TH4 A;  3K9O A;  1N34 M;  1NVM A;  3U6O A;  1KFV A;  1WGL A;  1QAM A;  4IJF A;  3QYB A;  5EQT A;  1D0L A;  4WUR A;  1C1K A;  1T3T A;  1QUT A;  5KQD A;  4GIP A;  1BVS A;  1ZAE A;  2DAE A;  4AG5 A;  2ERC A;  2Y0T A;  2KDL A;  2CV0 A;  4X64 M;  3SAW A;  2CV1 A;  1MJG M;  3J7A S;  1SXJ D;  3HJQ A;  1GLN A;  5FLX S;  5F3W A;  1YSY A;  4LZZ A;  5FTK A;  1I94 M;  2QZ4 A;  1IY0 A;  2XSZ A;  2VII A;  4ZPX A;  3KDS E;  5KO3 A;  4LF6 M;  3NWL A;  5ITX E;  2ZBK B;  3D8B A;  2R6F A;  3VKH A;  3GLF E;  2JZ0 A;  2DAG A;  4JYA M;  3U6M A;  1QYR A;  2UXD M;  4FWH A;  2UXB M;  2Z4S A;  4P17 A;  1Q39 A;  4YHH M;  2DNA A;  1XB2 B;  2OOB A;  3CF0 A;  4DR6 M;  1DO0 A;  3HY5 A;  4L78 A;  2JNH A;  2J7O A;  2C9C A;  3HJS A;  3U5Z B;  2W82 A;  3FYD A;  2MJ5 B;  1S3S A;  1EIJ A;  1OJL A;  3Q8G A;  4L8R C;  5KPZ A;  2L6O A;  2CHV A;  5IRE B;  1N78 A;  1TH3 A;  1J09 A;  2YNM D;  2XZF A;  1K3X A;  2G3Q A;  3KP1 E;  4I81 A;  4S12 A;  3U6P A;  1QAO A;  1SXJ E;  2K47 A;  4MB7 A;  4LG2 A;  2XZU A;  4LJ8 A;  3C58 A;  3GRV A;  4IBG A;  4XK8 F;  2DWZ B;  2V1C A;  3E46 A;  3KVW A;  4L16 A;  5EP1 A;  4CJ6 A;  2UUA M;  4IBD A;  3TE6 A;  7CAT A;  3DA1 A;  3T6P A;  3GLF A;  2OPF A;  5KPR A;  2XLJ A;  2HKJ A;  2DWN A;  2UUB M;  2QHO B;  2H1R A;  3LMM A;  2BWB A;  1HNX M;  1R5L A;  3KOZ E;  2EA0 A;  4AKG A;  1TGU A;  3PVS A;  4M0W A;  2VDB B;  4LJA A;  4DUY M;  4DR7 M;  1ZMW A;  5KQ8 A;  1N36 M;  1GJS A;  2XFS A;  2R46 A;  2ZM6 M;  1NO1 A;  3TWL A;  1HQC A;  1MX0 A;  3SAT A;  4DV3 M;  2DZL A;  3GLH B;  3FUX A;  3GLI E;  2QBY A;  4JI8 M;  2I7N A;  5BR8 M;  3HKP A;  3C3D A;  3Q8X A;  1G3I A;  3JAM S;  1HR0 M;  3J7B A;  4LJ6 A;  1IN4 A;  2R44 A;  2KW0 A;  3GQ3 A;  1XXH A;  1SXJ A;  2B3T A;  2EJS A;  3UMM A;  3HHZ A;  1TDZ A;  3M7G A;  1PJI A;  1T43 A;  4DV6 M;  1XNR M;  3GPX A;  2YFQ A;  3E9S A;  4MGH A;  3L26 A;  1DGB A;  1X37 A;  4LCB A;  3HZJ A;  4DV4 M;  4PCZ A;  1R2Y A;  4DV5 M;  1JB0 F;  5DFL A;  4YY3 M;  3VK7 A;  2JY7 A;  3SHF A;  2XSZ D;  4AZF A;  4DUZ M;  3JR5 A;  1PRB A;  2DAM A;  3A98 B;  3R8F A;  1H6U A;  2DHR A;  3M6A A;  3U60 B;  1IY2 A;  2DAK A;  2GNO A;  4IBJ A;  1HNW M;  2LH0 A;  4LF4 M;  2KRK A;  3KS4 A;  2D7E A;  4LFA M;  3HWS A;  3RGP A;  1QDR A;  5EJC A;  2N35 A;  3GLI A;  4JI2 M;  1NV9 A;  1DV0 A;  2R4J A;  5JI3 E;  4AQY M;  5DYI A;  4DR4 M;  1OTR A;  4JI4 M;  3HU1 A;  1D0M A;  3QYE A;  2NQ8 C;  3VK8 A;  4PD2 A;  1PGY A;  4FVM A;  4OW0 A;  2G5G X;  2C98 A;  1QAQ A;  3H4M A;  3GP1 A;  1NHW C;  5EP4 A;  3U6E A;  1IXR C;  4GH9 A;  3AKZ A;  3KSX A;  3U61 B;  4BLC A;  2KHH A;  4A3V B;  3K1J A;  4IBF A;  5IWA M;  4CHT B;  5ITU A;  2O25 A;  5EXX A;  2AHM A;  3KOY E;  5ITT A;  3H4J A;  4MGK E;  5IZ7 D;  4DV7 M;  1XMO M;  2KNV A;  1Q02 A;  3PXG A;  1PJQ A;  3SFZ A;  2FH0 A;  2CV2 A;  1JQJ C;  3HJ8 A;  1FJG M;  2FOI C;  1LV7 A;  2KEB A;  1WR1 B;  2OOA A;  3VFD A;  4GEW A;  2XH9 A;  4M9X A;  5E26 A;  5FTM A;  4BB9 A;  2F5P A;  3QAU A;  1QAN A;  4HLQ A;  4R3D A;  3A45 A;  3K9P A;  3KP0 E;  4LJ5 A;  1PJT A;  2C96 A;  3RFW A; 
#chains in the Genus database with same CATH homology
 2LHG A;  2LHC A;  2J5Y A;  1PRB A;  2MH8 A;  2VDB B;  1GAB A;  1TF0 B;  1GJT A;  2KDL A;  2N35 A;  2JWS A;  1GJS A;  2FS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...