2LHCA

Ga98 solution structure
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
b'TTYKLILNLKQAKEEAIKELVDAGTAEKYFKLIANAKTVEGVWTLKDEIKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ga98
molecule tags De novo protein
source organism Artificial gene
publication title Mutational tipping points for switching protein folds and functions.
pubmed doi rcsb
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2lhcA00
2VDBB 2N35A 2JWSA 2KDLA 2J5YA 2FS1A 2LHCA 2MH8A 1GABA 2LHGA 1GJSA 1TF0B 1PRBA 1GJTA
chains in the Genus database with same CATH superfamily
3K8ZA 3NWLA 4R3DA 1AIPC 1E9SA 4PCZA 1D0LA 1VG5A 2CV2A 4GKJM 5KPRA 3K1JA 4KO8A 1K82A 1IN8A 1EE8A 2C99A 3AJIB 3AOEA 2MH8A 5EXPA 2CEAA 4NXNM 2M5ZA 4I4LA 4CGYB 3QYBA 2Y20A 1MN3A 1WHCA 4P17A 4UN2B 4LGMA 2QCUA 2YNMD 2ZBKB 4DV0M 1QDTA 3B74A 3FTEA 1NY6A 2BWEA 2FE8A 3LQRA 3AL0C 4FWDA 1T3TA 4M9XA 2CWBA 4X62M 1RU3A 2CHGA 4GHAA 3RFWA 1HT1E 4JI0M 3RGSA 4AG5A 2XLJA 3B7QA 1JR3A 3KOWE 3KP0E 1C1KA 1F4IA 2RKOA 1IN5A 1JR3D 2ZAOA 3BXWA 3HU2A 3IG8A 3B89A 5C18A 5KPTA 4DV6M 2R44A 1IBMM 4JXJA 3GLFB 4DR6M 4FCWA 4CJ6A 4NSOB 1J09A 3SMSA 4LF9M 3LVWA 3GLGE 5DNYA 2VF8A 2QQ8A 4B3RM 1IXZA 4B7GA 2EA0A 1IBKM 2L2DA 4B3SM 4GC5A 1TTEA 4B7HA 4MH0E 3SAUA 4W5WA 1IN6A 3C3EA 5DFLA 2O01F 1E9RA 4WP2A 4LZJA 3B7ZA 2KRUA 3OTOM 3GLIA 3SBJA 2RGOA 4IBIA 4OVZA 2X49A 4KLNA 1HNWM 5E26A 4DV4M 4GRIA 3GLGB 3FYCA 3PNYA 2L4EA 3I4VA 3L27A 1HT2E 4ANRA 1NJGA 1OIZA 3U6CA 5IT9S 4DV3M 2CV1A 2VIIA 1QAMA 2CFOA 3W0FA 3GQ4A 3GRVA 3UJNA 4DR2M 3VFDA 2Y0QA 4L4UA 3CF0A 4I5SA 4FCVA 3RE8A 3VDUA 5IREB 3RGPA 3HJ8A 4GEWA 4R71A 3SAVA 5EXTA 3BOSA 4MGIE 3AKZA 3SMPA 5GKNA 3HU1A 3PFIA 4RNAA 3GLHB 2DAEA 3R9XB 1SXJB 1QUSA 3C3DA 4JYAM 3Q8GA 5FTMA 1MU5A 5ITTA 4AKHA 3T38A 1T43A 4KT0F 1Z5BA 1XNQM 3E4RA 2C98A 5ITXE 3U6DA 1IY1A 1DGGA 3CF2A 3U61A 1S3SA 2DAKA 2UXBM 4MB7A 2F5QA 1GKIA 2XSZA 3HGIA 1TDZA 1NHWC 1Q3CA 4LF8M 3E46A 2UUAM 4ZPXA 1L1ZA 2KDLA 2DI0A 3TWMA 2VDBB 2BJWA 3B7NA 4XBOA 2LVAA 4BB9A 2J7OA 3R8FA 1GVNA 3HJSA 2MGWA 1Q3BA 4OU7A 5FTKA 2CHQA 3AFHA 1ZMUA 3A45A 4NRWA 2DKLA 1CUKA 3GPUA 3Q8XA 1N75A 4GC9A 4LFBM 4LJ6A 4D81A 3MK6A 1R2YA 2DWMA 4JI4M 1TDHA 2YR0A 3KS8A 3KP1E 4IBBA 1YLAA 3GPYA 1HNZM 4OX9M 1XXHB 3T1YM 3DA1A 2MROB 5FLXS 2UXCM 1G8PA 2L09A 5KQDA 1EIJA 4LCBA 3SYKA 4GIPA 3U5ZB 1N36M 2HWJA 1HR0M 2KZSA 1OQYA 3D8BA 2EJSA 3SHGB 2DXIA 1N33M 2X4AA 3FUUA 3M6AA 1XMQM 4LF5M 1DGHA 2DNAA 3NBIA 4G4NA 4LGYA 3AV0A 3J81S 3MHVC 3JR4A 2FFJA 2J5YA 1SXJE 4HL4A 4GITA 4K0KM 1TF0B 3GLHE 2CV0A 3FUVA 3K2LA 1NV8A 2JXNA 2V1CA 3H4JA 4M0WA 2YQZA 1NNJA 4X64M 3M0EA 4D82A 4AI6A 1GJSA 3KSJA 1G41A 1NHGC 1Z59A 4MGHA 3D8LA 2LVOC 3W67A 4B3MM 1XB2B 3AOEC 1L8QA 1IXSB 2DAIA 2VQEM 3HX3A 1IQPA 2QPAA 4G3OA 1IM2A 3VKGA 3HU3A 1J7KA 1UFZA 2FOIC 3EIEA 3QAUA 1OJLA 2K0BX 5BPVA 3K9PA 2FNAA 3U6OA 4G6ZA 3ZC7B 3B9PA 1ORYB 1R6BX 2L7IA 1MX0A 3BBZA 4R7GA 2JUJA 3WHLA 3U61B 2JZ1A 1V33A 3GPXA 2Z8YM 4M9SA 1PGYA 1VDDA 3VDPA 1IY0A 2F5OA 1PJJA 2HAKA 4LF6M 2V1UA 5C1BA 1WR1B 2X8AA 3KW6A 3FRIA 1HQCA 1VQ1A 3I01M 4MGKE 1YE9A 3GLHA 4LJ4A 4CHTB 1E94E 4LG2A 1D2NA 5EP2A 2ZM6M 1TH3A 4DV2M 3HJQA 2C5RA 2LBCA 3THGA 2B3TA 2W82A 3HZJA 1Z5CA 3DZDA 3EIHA 4S12A 2DHYA 2LVPC 2HCBA 3HKPA 2JY7A 3LCUA 3U6PA 3T6PA 2R45A 1V92A 2KNVA 3IG5A 1DGBA 4AG6A 2DHRA 4WW0A 1G59A 3VK7A 3GRUA 2KXEA 1N32M 3HHYA 3J80S 2OOBA 1IN7A 2J7NA 3L29A 1VEKA 3V76A 2YFQA 4AW4A 3M7GA 4IJFA 2JWSA 1SXJC 5FSWA 4WURA 3FUXA 2R0IA 3LW5F 3NBXX 4L78A 2LH0A 1QAOA 3VK8A 2K9DA 3VKHA 1TH2A 4L15A 2FH0A 2UUCM 3FRHA 2OPFA 2WZJA 5EJCA 2DWLA 1GABA 4NC6A 1IBLM 4G4OA 2MR9A 2R62A 4II7A 4LF7M 1WGNA 3JR5A 3J7AS 3T15A 4LJAA 2QNJA 5H37D 2CP8A 2P5TA 4PD2A 1DO2A 1ZMWA 2KZUA 5KO3A 3SHFA 4REZA 5ITRA 3U6SA 3SATA 2M60A 5JI2E 2I7NA 4XGIA 1L2CA 2HHHM 4F2LA 4DR4M 3LQQA 1TGUA 4LJ9A 2G8LA 4IJEA 4Z6YA 2UUBM 3DFZA 3W0LB 4QHTA 1Z5AA 3GQ3A 1K3WA 3U60A 2LHCA 1DGHB 1T6OA 3A98B 2I7PA 2XFTA 2H1RA 3PVSA 3WHKA 1J5EM 2V6ZM 1GJTA 4LFAM 4LJ5A 4DR7M 1NNUC 3FYDA 2H5XA 2BJVA 2KA6B 5EP3A 1ZV1A 1GL6A 3FD9A 3SC3A 3TQSA 1NO1A 2KHHA 4L16A 5F3WA 4DR3M 3UGJA 2Y21A 2KW0A 4B08A 3ZCBB 4B3TM 2Z7JA 2JZ0A 2HKJA 4I81A 3TPZA 2DWNA 2EUCA 1ZAEA 2XH9A 3E21A 2UU9M 2L7HA 1NSFA 1QUTA 4PT5A 1W5TA 2BWBA 2WSCF 4NXMM 2QENA 1N34M 1N78A 4X66M 4DV5M 1TH4A 4JI3M 3GLIE 5E6JA 3L25A 1X37A 1NJFA 3A46A 2CE7A 1Q02A 2Z3XA 3C9PA 1R5LA 4RF0A 4IBJA 2XFSA 3GO8A 1PM5A 4DV1M 2AHMA 1Q39A 3QWLA 1R7RA 4FD2A 2OQ4A 5ITQA 4B7FA 4G4QA 3UZUA 2APLA 1G4AE 1DO0A 2QHOB 4LRSA 4IBKA 4QNMA 3H4MA 1IXSA 1EFUB 2JP7A 3L26A 1R2ZA 2GQFA 3CGWA 1PJIA 1OKSA 4IIWA 4QNRA 3ZQJA 3FTDA 1KSFX 2MJ5B 3GLFA 4IBCA 4JN6A 2LHGA 2XF3A 1AUAA 3GLFE 3E9SA 4Q7JA 4QHSA 4DR5M 5FTJA 4LFCM 2E5LM 5A2QS 2NQ8C 5EP1A 3TWLA 1G71A 4FWGA 1KFVA 2DENA 3SYLA 5ITXA 4DUYM 4JI5M 1VDLA 1LV7A 2DZOB 4X65M 3CTWB 2Q2EB 4AKIA 2ZTCA 5L8RF 1OAIA 3KDSE 3K92A 3LCVB 3UMMA 4IBGA 2ERCA 4MGZE 3GRYA 4GH9A 2EKFA 1PJQA 3KXEC 1YUBA 4Y28F 1OTRA 1P3QQ 3KOZE 5BR8M 1ZQ9A 2KNZA 1WGLA 2LXEA 3K9OA 1GL7A 1OIPA 2R46A 3GLGA 3HHWA 3VLFB 2F5SA 1I4WA 1MJGM 2LVNC 3IECA 2L6OA 1JQJC 4M0DA 1A5TA 2EO2A 3KOXE 5IWAM 1G3IA 3TE6A 3GLIB 4TUWA 5FTNA 1SXJD 5DYIA 4YHHM 4FWHA 1C7YA 3J2PB 4HLQA 5DYGA 3L2AA 2XZUA 2GNOA 4NSRA 3FTCA 4Z8XA 5ITYA 4KHPM 4GHLA 5EQTA 3TWKA 4PDIA 4JI1M 2UXDM 1HNXM 2A5YB 4F1IA 3ZH9B 4JI7M 8CATA 2QZ4A 3LMMA 3MMPA 4RKUF 3I04M 3GPPA 2JY8A 2JY6B 3FUTA 3I4YA 2F4VM 3FTFA 3LVVA 4L8RC 5FTLA 4P16A 2K47A 1D0KA 3SFZA 1XMOM 4ITQA 3KFUG 3HHXA 1NVMA 4NRVA 3SASA 2OO9A 3GP1A 3SARA 7CATA 2QBYB 2HL7A 2RGHA 1FNNA 3I51A 1PJTA 2R6FA 2LWXA 3FE3A 4GMQA 1SXJA 4LRTA 4NL4H 4RF1A 1QANA 2XZFA 1K3XA 2JA2A 4LJ8A 3KVWA 2CRUA 2XEPA 1L2DA 2DWZB 3MJ5A 2O5RA 4PDGA 1QDRA 5KQ8A 5EXSA 3C58A 1BVSA 1QQWA 3ILKA 1DV0A 2R4EA 5LMUM 3GRRA 2K6BA 2ZAMA 4MGYE 2DVWB 2JY5A 4DUZM 1ZMVA 3TL4X 1SG9A 5KPZA 1IN4A 2VF7A 3AOGA 2R4JA 4JV5M 3L28A 2C9OA 2RRUA 1QYRA 3UK6A 3U6QA 4QOSA 2KNAA 2Y0TA 3HY5A 3F92A 1H6UA 1OAOC 2XGNA 2N35A 2R65A 4LJ7A 2D7HA 4JI8M 4FW9A 4LZZA 4OVZB 1QZMA 1GLNA 1XXHE 1QAQA 1QVRA 1OFHA 3PNVA 2R18A 2C9CA 2LVQD 2ZANA 3T1HM 3FUWA 1WXQA 4GKKM 2G3QA 2Z4SA 4M9ZA 4BLCA 1L2BA 1PRBA 2BNKA 4LF4M 2QSFX 3KSXA 2CUZA 4HEOA 4KODA 4MM3B 1R4GA 4AZFA 4IBDA 4XK8F 2DAMA 4BBAA 4DV7M 1QZEA 3W68A 1HJPA 3J7BA 4JI6M 1KYIA 4QOZC 2LTUA 2FS1A 1XNRM 3U6LA 2DZLA 1HQYE 1WJ7A 2WSFF 2KRKA 2D7GA 4FCTA 1Z6TA 1UM8A 5ITUA 3HWSA 1XC8A 4IBEA 1TR8A 4LY6A 3GQ5A 1D0MA 4D80A 2XSZD 1LTMA 1WIVA 2ZTDA 2JNHA 3SAWA 1JB0F 1XHBA 1N77A 2CHVA 2VQFM 3U6MA 3KOYE 1VEJA 4L6V6 2G5GX 2C96A 4DR1M 4A3VB 3U5ZA 3JAMS 5EXXA 3QYEA 4EIWA 3IHPA 2O25A 1XWIA 1XXHA 4AKGA 4DBGB 1IXRC 4CIZA 4JI2M 3PXGA 3U60B 5IZ7D 2QP9X 2L4FA 4IBFA 2QBYA 2OOAA 3U6EA 1FJGM 2D7EA 1PJSA 4NOOB 1E32A 1Y8GA 3KS4A 5LMNM 1IY2A 1JR3E 2KEBA 2Z4RA 1IFYA 3CF6E 1VEGA 2F5NA 3FKEA 1V34A 2EKKA 2LNHC 1W5SA 1DGFA 3A42A 1NY5A 1L1TA 4AQYM 2F5PA 4CISA 3HHZA 4I8OA 1OFIA 1YSYA 4FVMA 4G4RA 5EP4A 1NV9A 2DZNB 2WSEF 5JI3E 4OW0A 3DOAA 4YY3M 1GO5A 3J27B 1I94M 2DAGA
chains in the Genus database with same CATH topology
2VDBB 2N35A 2JWSA 2KDLA 2J5YA 2FS1A 2LHCA 2MH8A 1GABA 2LHGA 1GJSA 1TF0B 1PRBA 1GJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDB B;  2N35 A;  2JWS A;  2KDL A;  2J5Y A;  2FS1 A;  2LHC A;  2MH8 A;  1GAB A;  2LHG A;  1GJS A;  1TF0 B;  1PRB A;  1GJT A; 
#chains in the Genus database with same CATH topology
 3K8Z A;  3NWL A;  4R3D A;  1AIP C;  1E9S A;  4PCZ A;  1D0L A;  1VG5 A;  2CV2 A;  4GKJ M;  5KPR A;  3K1J A;  4KO8 A;  1K82 A;  1IN8 A;  1EE8 A;  2C99 A;  3AJI B;  3AOE A;  2MH8 A;  5EXP A;  2CEA A;  4NXN M;  2M5Z A;  4I4L A;  4CGY B;  3QYB A;  2Y20 A;  1MN3 A;  1WHC A;  4P17 A;  4UN2 B;  4LGM A;  2QCU A;  2YNM D;  2ZBK B;  4DV0 M;  1QDT A;  3B74 A;  3FTE A;  1NY6 A;  2BWE A;  2FE8 A;  3LQR A;  3AL0 C;  4FWD A;  1T3T A;  4M9X A;  2CWB A;  4X62 M;  1RU3 A;  2CHG A;  4GHA A;  3RFW A;  1HT1 E;  4JI0 M;  3RGS A;  4AG5 A;  2XLJ A;  3B7Q A;  1JR3 A;  3KOW E;  3KP0 E;  1C1K A;  1F4I A;  2RKO A;  1IN5 A;  1JR3 D;  2ZAO A;  3BXW A;  3HU2 A;  3IG8 A;  3B89 A;  5C18 A;  5KPT A;  4DV6 M;  2R44 A;  1IBM M;  4JXJ A;  3GLF B;  4DR6 M;  4FCW A;  4CJ6 A;  4NSO B;  1J09 A;  3SMS A;  4LF9 M;  3LVW A;  3GLG E;  5DNY A;  2VF8 A;  2QQ8 A;  4B3R M;  1IXZ A;  4B7G A;  2EA0 A;  1IBK M;  2L2D A;  4B3S M;  4GC5 A;  1TTE A;  4B7H A;  4MH0 E;  3SAU A;  4W5W A;  1IN6 A;  3C3E A;  5DFL A;  2O01 F;  1E9R A;  4WP2 A;  4LZJ A;  3B7Z A;  2KRU A;  3OTO M;  3GLI A;  3SBJ A;  2RGO A;  4IBI A;  4OVZ A;  2X49 A;  4KLN A;  1HNW M;  5E26 A;  4DV4 M;  4GRI A;  3GLG B;  3FYC A;  3PNY A;  2L4E A;  3I4V A;  3L27 A;  1HT2 E;  4ANR A;  1NJG A;  1OIZ A;  3U6C A;  5IT9 S;  4DV3 M;  2CV1 A;  2VII A;  1QAM A;  2CFO A;  3W0F A;  3GQ4 A;  3GRV A;  3UJN A;  4DR2 M;  3VFD A;  2Y0Q A;  4L4U A;  3CF0 A;  4I5S A;  4FCV A;  3RE8 A;  3VDU A;  5IRE B;  3RGP A;  3HJ8 A;  4GEW A;  4R71 A;  3SAV A;  5EXT A;  3BOS A;  4MGI E;  3AKZ A;  3SMP A;  5GKN A;  3HU1 A;  3PFI A;  4RNA A;  3GLH B;  2DAE A;  3R9X B;  1SXJ B;  1QUS A;  3C3D A;  4JYA M;  3Q8G A;  5FTM A;  1MU5 A;  5ITT A;  4AKH A;  3T38 A;  1T43 A;  4KT0 F;  1Z5B A;  1XNQ M;  3E4R A;  2C98 A;  5ITX E;  3U6D A;  1IY1 A;  1DGG A;  3CF2 A;  3U61 A;  1S3S A;  2DAK A;  2UXB M;  4MB7 A;  2F5Q A;  1GKI A;  2XSZ A;  3HGI A;  1TDZ A;  1NHW C;  1Q3C A;  4LF8 M;  3E46 A;  2UUA M;  4ZPX A;  1L1Z A;  2KDL A;  2DI0 A;  3TWM A;  2VDB B;  2BJW A;  3B7N A;  4XBO A;  2LVA A;  4BB9 A;  2J7O A;  3R8F A;  1GVN A;  3HJS A;  2MGW A;  1Q3B A;  4OU7 A;  5FTK A;  2CHQ A;  3AFH A;  1ZMU A;  3A45 A;  4NRW A;  2DKL A;  1CUK A;  3GPU A;  3Q8X A;  1N75 A;  4GC9 A;  4LFB M;  4LJ6 A;  4D81 A;  3MK6 A;  1R2Y A;  2DWM A;  4JI4 M;  1TDH A;  2YR0 A;  3KS8 A;  3KP1 E;  4IBB A;  1YLA A;  3GPY A;  1HNZ M;  4OX9 M;  1XXH B;  3T1Y M;  3DA1 A;  2MRO B;  5FLX S;  2UXC M;  1G8P A;  2L09 A;  5KQD A;  1EIJ A;  4LCB A;  3SYK A;  4GIP A;  3U5Z B;  1N36 M;  2HWJ A;  1HR0 M;  2KZS A;  1OQY A;  3D8B A;  2EJS A;  3SHG B;  2DXI A;  1N33 M;  2X4A A;  3FUU A;  3M6A A;  1XMQ M;  4LF5 M;  1DGH A;  2DNA A;  3NBI A;  4G4N A;  4LGY A;  3AV0 A;  3J81 S;  3MHV C;  3JR4 A;  2FFJ A;  2J5Y A;  1SXJ E;  4HL4 A;  4GIT A;  4K0K M;  1TF0 B;  3GLH E;  2CV0 A;  3FUV A;  3K2L A;  1NV8 A;  2JXN A;  2V1C A;  3H4J A;  4M0W A;  2YQZ A;  1NNJ A;  4X64 M;  3M0E A;  4D82 A;  4AI6 A;  1GJS A;  3KSJ A;  1G41 A;  1NHG C;  1Z59 A;  4MGH A;  3D8L A;  2LVO C;  3W67 A;  4B3M M;  1XB2 B;  3AOE C;  1L8Q A;  1IXS B;  2DAI A;  2VQE M;  3HX3 A;  1IQP A;  2QPA A;  4G3O A;  1IM2 A;  3VKG A;  3HU3 A;  1J7K A;  1UFZ A;  2FOI C;  3EIE A;  3QAU A;  1OJL A;  2K0B X;  5BPV A;  3K9P A;  2FNA A;  3U6O A;  4G6Z A;  3ZC7 B;  3B9P A;  1ORY B;  1R6B X;  2L7I A;  1MX0 A;  3BBZ A;  4R7G A;  2JUJ A;  3WHL A;  3U61 B;  2JZ1 A;  1V33 A;  3GPX A;  2Z8Y M;  4M9S A;  1PGY A;  1VDD A;  3VDP A;  1IY0 A;  2F5O A;  1PJJ A;  2HAK A;  4LF6 M;  2V1U A;  5C1B A;  1WR1 B;  2X8A A;  3KW6 A;  3FRI A;  1HQC A;  1VQ1 A;  3I01 M;  4MGK E;  1YE9 A;  3GLH A;  4LJ4 A;  4CHT B;  1E94 E;  4LG2 A;  1D2N A;  5EP2 A;  2ZM6 M;  1TH3 A;  4DV2 M;  3HJQ A;  2C5R A;  2LBC A;  3THG A;  2B3T A;  2W82 A;  3HZJ A;  1Z5C A;  3DZD A;  3EIH A;  4S12 A;  2DHY A;  2LVP C;  2HCB A;  3HKP A;  2JY7 A;  3LCU A;  3U6P A;  3T6P A;  2R45 A;  1V92 A;  2KNV A;  3IG5 A;  1DGB A;  4AG6 A;  2DHR A;  4WW0 A;  1G59 A;  3VK7 A;  3GRU A;  2KXE A;  1N32 M;  3HHY A;  3J80 S;  2OOB A;  1IN7 A;  2J7N A;  3L29 A;  1VEK A;  3V76 A;  2YFQ A;  4AW4 A;  3M7G A;  4IJF A;  2JWS A;  1SXJ C;  5FSW A;  4WUR A;  3FUX A;  2R0I A;  3LW5 F;  3NBX X;  4L78 A;  2LH0 A;  1QAO A;  3VK8 A;  2K9D A;  3VKH A;  1TH2 A;  4L15 A;  2FH0 A;  2UUC M;  3FRH A;  2OPF A;  2WZJ A;  5EJC A;  2DWL A;  1GAB A;  4NC6 A;  1IBL M;  4G4O A;  2MR9 A;  2R62 A;  4II7 A;  4LF7 M;  1WGN A;  3JR5 A;  3J7A S;  3T15 A;  4LJA A;  2QNJ A;  5H37 D;  2CP8 A;  2P5T A;  4PD2 A;  1DO2 A;  1ZMW A;  2KZU A;  5KO3 A;  3SHF A;  4REZ A;  5ITR A;  3U6S A;  3SAT A;  2M60 A;  5JI2 E;  2I7N A;  4XGI A;  1L2C A;  2HHH M;  4F2L A;  4DR4 M;  3LQQ A;  1TGU A;  4LJ9 A;  2G8L A;  4IJE A;  4Z6Y A;  2UUB M;  3DFZ A;  3W0L B;  4QHT A;  1Z5A A;  3GQ3 A;  1K3W A;  3U60 A;  2LHC A;  1DGH B;  1T6O A;  3A98 B;  2I7P A;  2XFT A;  2H1R A;  3PVS A;  3WHK A;  1J5E M;  2V6Z M;  1GJT A;  4LFA M;  4LJ5 A;  4DR7 M;  1NNU C;  3FYD A;  2H5X A;  2BJV A;  2KA6 B;  5EP3 A;  1ZV1 A;  1GL6 A;  3FD9 A;  3SC3 A;  3TQS A;  1NO1 A;  2KHH A;  4L16 A;  5F3W A;  4DR3 M;  3UGJ A;  2Y21 A;  2KW0 A;  4B08 A;  3ZCB B;  4B3T M;  2Z7J A;  2JZ0 A;  2HKJ A;  4I81 A;  3TPZ A;  2DWN A;  2EUC A;  1ZAE A;  2XH9 A;  3E21 A;  2UU9 M;  2L7H A;  1NSF A;  1QUT A;  4PT5 A;  1W5T A;  2BWB A;  2WSC F;  4NXM M;  2QEN A;  1N34 M;  1N78 A;  4X66 M;  4DV5 M;  1TH4 A;  4JI3 M;  3GLI E;  5E6J A;  3L25 A;  1X37 A;  1NJF A;  3A46 A;  2CE7 A;  1Q02 A;  2Z3X A;  3C9P A;  1R5L A;  4RF0 A;  4IBJ A;  2XFS A;  3GO8 A;  1PM5 A;  4DV1 M;  2AHM A;  1Q39 A;  3QWL A;  1R7R A;  4FD2 A;  2OQ4 A;  5ITQ A;  4B7F A;  4G4Q A;  3UZU A;  2APL A;  1G4A E;  1DO0 A;  2QHO B;  4LRS A;  4IBK A;  4QNM A;  3H4M A;  1IXS A;  1EFU B;  2JP7 A;  3L26 A;  1R2Z A;  2GQF A;  3CGW A;  1PJI A;  1OKS A;  4IIW A;  4QNR A;  3ZQJ A;  3FTD A;  1KSF X;  2MJ5 B;  3GLF A;  4IBC A;  4JN6 A;  2LHG A;  2XF3 A;  1AUA A;  3GLF E;  3E9S A;  4Q7J A;  4QHS A;  4DR5 M;  5FTJ A;  4LFC M;  2E5L M;  5A2Q S;  2NQ8 C;  5EP1 A;  3TWL A;  1G71 A;  4FWG A;  1KFV A;  2DEN A;  3SYL A;  5ITX A;  4DUY M;  4JI5 M;  1VDL A;  1LV7 A;  2DZO B;  4X65 M;  3CTW B;  2Q2E B;  4AKI A;  2ZTC A;  5L8R F;  1OAI A;  3KDS E;  3K92 A;  3LCV B;  3UMM A;  4IBG A;  2ERC A;  4MGZ E;  3GRY A;  4GH9 A;  2EKF A;  1PJQ A;  3KXE C;  1YUB A;  4Y28 F;  1OTR A;  1P3Q Q;  3KOZ E;  5BR8 M;  1ZQ9 A;  2KNZ A;  1WGL A;  2LXE A;  3K9O A;  1GL7 A;  1OIP A;  2R46 A;  3GLG A;  3HHW A;  3VLF B;  2F5S A;  1I4W A;  1MJG M;  2LVN C;  3IEC A;  2L6O A;  1JQJ C;  4M0D A;  1A5T A;  2EO2 A;  3KOX E;  5IWA M;  1G3I A;  3TE6 A;  3GLI B;  4TUW A;  5FTN A;  1SXJ D;  5DYI A;  4YHH M;  4FWH A;  1C7Y A;  3J2P B;  4HLQ A;  5DYG A;  3L2A A;  2XZU A;  2GNO A;  4NSR A;  3FTC A;  4Z8X A;  5ITY A;  4KHP M;  4GHL A;  5EQT A;  3TWK A;  4PDI A;  4JI1 M;  2UXD M;  1HNX M;  2A5Y B;  4F1I A;  3ZH9 B;  4JI7 M;  8CAT A;  2QZ4 A;  3LMM A;  3MMP A;  4RKU F;  3I04 M;  3GPP A;  2JY8 A;  2JY6 B;  3FUT A;  3I4Y A;  2F4V M;  3FTF A;  3LVV A;  4L8R C;  5FTL A;  4P16 A;  2K47 A;  1D0K A;  3SFZ A;  1XMO M;  4ITQ A;  3KFU G;  3HHX A;  1NVM A;  4NRV A;  3SAS A;  2OO9 A;  3GP1 A;  3SAR A;  7CAT A;  2QBY B;  2HL7 A;  2RGH A;  1FNN A;  3I51 A;  1PJT A;  2R6F A;  2LWX A;  3FE3 A;  4GMQ A;  1SXJ A;  4LRT A;  4NL4 H;  4RF1 A;  1QAN A;  2XZF A;  1K3X A;  2JA2 A;  4LJ8 A;  3KVW A;  2CRU A;  2XEP A;  1L2D A;  2DWZ B;  3MJ5 A;  2O5R A;  4PDG A;  1QDR A;  5KQ8 A;  5EXS A;  3C58 A;  1BVS A;  1QQW A;  3ILK A;  1DV0 A;  2R4E A;  5LMU M;  3GRR A;  2K6B A;  2ZAM A;  4MGY E;  2DVW B;  2JY5 A;  4DUZ M;  1ZMV A;  3TL4 X;  1SG9 A;  5KPZ A;  1IN4 A;  2VF7 A;  3AOG A;  2R4J A;  4JV5 M;  3L28 A;  2C9O A;  2RRU A;  1QYR A;  3UK6 A;  3U6Q A;  4QOS A;  2KNA A;  2Y0T A;  3HY5 A;  3F92 A;  1H6U A;  1OAO C;  2XGN A;  2N35 A;  2R65 A;  4LJ7 A;  2D7H A;  4JI8 M;  4FW9 A;  4LZZ A;  4OVZ B;  1QZM A;  1GLN A;  1XXH E;  1QAQ A;  1QVR A;  1OFH A;  3PNV A;  2R18 A;  2C9C A;  2LVQ D;  2ZAN A;  3T1H M;  3FUW A;  1WXQ A;  4GKK M;  2G3Q A;  2Z4S A;  4M9Z A;  4BLC A;  1L2B A;  1PRB A;  2BNK A;  4LF4 M;  2QSF X;  3KSX A;  2CUZ A;  4HEO A;  4KOD A;  4MM3 B;  1R4G A;  4AZF A;  4IBD A;  4XK8 F;  2DAM A;  4BBA A;  4DV7 M;  1QZE A;  3W68 A;  1HJP A;  3J7B A;  4JI6 M;  1KYI A;  4QOZ C;  2LTU A;  2FS1 A;  1XNR M;  3U6L A;  2DZL A;  1HQY E;  1WJ7 A;  2WSF F;  2KRK A;  2D7G A;  4FCT A;  1Z6T A;  1UM8 A;  5ITU A;  3HWS A;  1XC8 A;  4IBE A;  1TR8 A;  4LY6 A;  3GQ5 A;  1D0M A;  4D80 A;  2XSZ D;  1LTM A;  1WIV A;  2ZTD A;  2JNH A;  3SAW A;  1JB0 F;  1XHB A;  1N77 A;  2CHV A;  2VQF M;  3U6M A;  3KOY E;  1VEJ A;  4L6V 6;  2G5G X;  2C96 A;  4DR1 M;  4A3V B;  3U5Z A;  3JAM S;  5EXX A;  3QYE A;  4EIW A;  3IHP A;  2O25 A;  1XWI A;  1XXH A;  4AKG A;  4DBG B;  1IXR C;  4CIZ A;  4JI2 M;  3PXG A;  3U60 B;  5IZ7 D;  2QP9 X;  2L4F A;  4IBF A;  2QBY A;  2OOA A;  3U6E A;  1FJG M;  2D7E A;  1PJS A;  4NOO B;  1E32 A;  1Y8G A;  3KS4 A;  5LMN M;  1IY2 A;  1JR3 E;  2KEB A;  2Z4R A;  1IFY A;  3CF6 E;  1VEG A;  2F5N A;  3FKE A;  1V34 A;  2EKK A;  2LNH C;  1W5S A;  1DGF A;  3A42 A;  1NY5 A;  1L1T A;  4AQY M;  2F5P A;  4CIS A;  3HHZ A;  4I8O A;  1OFI A;  1YSY A;  4FVM A;  4G4R A;  5EP4 A;  1NV9 A;  2DZN B;  2WSE F;  5JI3 E;  4OW0 A;  3DOA A;  4YY3 M;  1GO5 A;  3J27 B;  1I94 M;  2DAG A; 
#chains in the Genus database with same CATH homology
 2VDB B;  2N35 A;  2JWS A;  2KDL A;  2J5Y A;  2FS1 A;  2LHC A;  2MH8 A;  1GAB A;  2LHG A;  1GJS A;  1TF0 B;  1PRB A;  1GJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...