4GIPA

Structure of the cleavage-activated prefusion form of the parainfluenza virus 5 (piv5) fusion protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
LDPAALMQIGVIPTNVRQLMYYTEASSAFIVVKLMPTIDSPISGCNITSISSYNATVTKLLQPIGENLETIRNQLIPTRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Fusion glycoprotein F2
publication title Structure of the cleavage-activated prefusion form of the parainfluenza virus 5 fusion protein.
pubmed doi rcsb
source organism Simian virus 5
total genus 16
structure length 81
sequence length 81
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gipA00
4GIPA
chains in the Genus database with same CATH superfamily
4IJFA 4JXJA 2KHHA 2BJVA 2C99A 2KNZA 2HKJA 4CISA 1NY5A 3PFIA 1G59A 5FTKA 1VDDA 3W68A 5E26A 2DAMA 3E21A 4WP2A 4B7HA 4UN2B 2ZM6M 5BPVA 2DVWB 3TL4X 2Y21A 1IXSB 1NVMA 1MX0A 2K0BX 2DAGA 3DOAA 3E9SA 4GRIA 3U61B 5IWAM 3U6MA 1IXSA 4BB9A 3GQ4A 4P17A 2WSCF 3EIEA 4LJ7A 4B7GA 1T3TA 3HU2A 3FUVA 3U6LA 4WW0A 4FWGA 1GJSA 3TE6A 3WHKA 4WURA 1TR8A 5IREB 3K1JA 2DAIA 2GQFA 1ZMUA 2FFJA 2KXEA 3SHGB 4IBCA 3K9PA 1NJFA 4BLCA 2WSFF 5ITTA 3PNYA 1QZMA 1N34M 1OAIA 1DGFA 1I4WA 1G3IA 3GPPA 1C1KA 1X37A 1TGUA 3J27B 4G4OA 2DZLA 1W5TA 1Y8GA 2OO9A 4GITA 1OJLA 2HAKA 3GLFB 4D81A 3M7GA 5ITXE 4X66M 3AOEC 1VG5A 2QZ4A 1OFIA 2DAKA 3HX3A 3I01M 5KQ8A 4YHHM 3FYCA 4QNRA 3GLFE 2OPFA 2AHMA 3B7QA 3TQSA 1E9SA 1N75A 1YSYA 2N35A 1Q39A 2R62A 1MJGM 5EXXA 3B74A 2EA0A 2DAEA 2J5YA 3SAVA 1OQYA 4DV4M 4DR2M 1WGNA 1SXJD 1HJPA 2F4VM 1S3SA 3GLGE 3FRHA 2F5QA 1NJGA 1IQPA 4IBFA 2WZJA 3FUXA 2RKOA 3EIHA 4KODA 4I5SA 1XMQM 1Q02A 4FVMA 1PJQA 1PRBA 4MGHA 3FUUA 5ITRA 4NRWA 1VEJA 3I4VA 3J80S 3UJNA 4M0WA 3A46A 3DA1A 3W67A 1Z5BA 4KO8A 4LRSA 2UXBM 3D8LA 1Z59A 1MN3A 3UGJA 4LF9M 4NSRA 3GLIB 4AKIA 1IXZA 3J2PB 4ZPXA 1QAMA 3UMMA 1N36M 1VEGA 4QHSA 2Q2EB 4GIPA 3GLIE 3GLIA 1F4IA 1DGBA 2XFTA 4OVZB 3VFDA 4F1IA 1GO5A 3LW5F 1DO2A 4QNMA 1JR3E 4JI2M 3C58A 2EUCA 4OVZA 3U6SA 5A2QS 4S12A 3L25A 4LFBM 1A5TA 4GMQA 4LCBA 4G3OA 5KPTA 4LJ9A 1OIZA 2EO2A 2DXIA 1L8QA 2DHYA 4AKHA 2R65A 1QQWA 1DV0A 3V76A 4R3DA 2EKKA 3KDSE 1ORYB 3AJIB 3FUWA 1UFZA 3R9XB 3KOXE 3NBXX 3NWLA 1D0LA 1XXHA 4I8OA 1IN7A 4MB7A 4MH0E 1PJJA 4LF4M 3IG8A 1JR3D 4AQYM 1MU5A 4QOSA 2DWZB 3U6CA 2L7IA 3VKHA 2UU9M 2ERCA 3Q8GA 1ZV1A 4IBJA 4JI8M 4DR1M 1AIPC 2BWBA 1AUAA 3IG5A 2KNVA 2J7OA 3VDUA 1RU3A 2Y0TA 5EXPA 4JI1M 1Z6TA 2W82A 4FWDA 3SASA 4DV3M 3U6DA 3GQ5A 4IBEA 4M0DA 1NNUC 2FNAA 3A42A 5EP3A 1N77A 2HWJA 2ZAMA 1DGGA 1QAOA 3K8ZA 4FCTA 1ZMWA 4AG6A 4B3SM 2ZTCA 3KOWE 1IN4A 5E6JA 1D2NA 4D80A 1ZAEA 2JY5A 3I4YA 2OOAA 4M9SA 4G4RA 1HNWM 4DR7M 3GLHB 1E32A 2VF7A 2FS1A 2K9DA 2WSEF 3CF2A 3ILKA 1EIJA 4AZFA 4BBAA 4JN6A 3GLHE 3GPUA 1XNRM 3J81S 2Z4RA 1Z5CA 1XHBA 3T1HM 2UUAM 3GRYA 2O5RA 2D7EA 3DFZA 3K92A 1QVRA 1EFUB 4I81A 3PXGA 4PD2A 1TH4A 1HNZM 4JI6M 3GRRA 4L15A 3J7AS 1CUKA 2QENA 2KNAA 3C3EA 2QQ8A 3ZC7B 1L1ZA 2G3QA 1WXQA 3GRVA 4JI4M 3FTFA 3FUTA 5EQTA 5GKNA 3U61A 4JI7M 1VQ1A 2APLA 4MGKE 4LFCM 3B7NA 2HHHM 2XZFA 3HGIA 2CWBA 3FE3A 3CTWB 2FE8A 2M60A 5KPZA 1R6BX 2Z3XA 3VK7A 1J5EM 2RGHA 2LVNC 4LJAA 2L7HA 3W0LB 5DNYA 1L2BA 2HL7A 3MK6A 3KS4A 3I04M 4KLNA 1SXJB 4RF0A 2NQ8C 5DYGA 3BOSA 4MGIE 1HQYE 3U6QA 2JA2A 3GO8A 1SXJE 1XC8A 2K47A 1NO1A 3B89A 4X62M 4B3TM 2CEAA 3HHZA 1G41A 4MM3B 2H1RA 2DHRA 3JR4A 5EP2A 5ITXA 2YNMD 4DR3M 4FWHA 4DUZM 3KVWA 3SAWA 4D82A 1D0MA 3GLFA 3ZCBB 2BWEA 4DR5M 1DGHB 4LGYA 2R0IA 1PJSA 4RNAA 1ZQ9A 5EP4A 5EP1A 3GLGB 4LF8M 2KA6B 1XB2B 4XK8F 1WHCA 3MJ5A 3GLGA 3H4JA 2C96A 5LMUM 1HT1E 2QNJA 3F92A 4R71A 2A5YB 5JI2E 2I7NA 1GABA 1IN5A 1NHWC 4I4LA 3IECA 2VDBB 1QYRA 2YQZA 3SFZA 3B9PA 3LVVA 4L4UA 2JY8A 1Q3BA 2V6ZM 5ITUA 3SAUA 2B3TA 2L6OA 4M9XA 1IBMM 4A3VB 2UXCM 4PT5A 4XGIA 4MGYE 4LJ8A 4GKJM 3RGPA 4ANRA 5H37D 1XMOM 4DR4M 4FCWA 8CATA 1OFHA 1TF0B 2VIIA 4OW0A 4IBIA 2CHQA 2QSFX 4LG2A 2CV2A 4MGZE 2JXNA 4DV0M 1JR3A 2I7PA 3CF0A 2Z4SA 2QBYB 2ZTDA 3HHYA 1JB0F 3TPZA 4LJ4A 3SHFA 3TWMA 4F2LA 1EE8A 1T6OA 2RRUA 1IN6A 1OKSA 2ZAOA 2XSZD 3KOYE 3KSXA 1IBKM 2QBYA 1VDLA 4NL4H 4LZJA 1D0KA 3K2LA 4LFAM 2DWNA 4R7GA 5EXTA 3THGA 5IT9S 2JY6B 2C5RA 3K9OA 1QUSA 3CF6E 2MR9A 4FCVA 1JQJC 2DNAA 2D7GA 3KXEC 1R5LA 2DKLA 2MJ5B 3KOZE 2DWMA 1NHGC 2KRUA 4TUWA 3DZDA 4GH9A 1G4AE 2Y20A 3GQ3A 2ZANA 2KZSA 2MROB 2QPAA 3JR5A 5F3WA 3HZJA 2C9OA 3HWSA 4DV5M 1IY0A 3KW6A 2QHOB 3QYBA 4CHTB 5ITYA 3RE8A 4DV6M 2UUBM 3LMMA 1TDHA 3TWLA 1R2YA 1QAQA 1T43A 2P5TA 3SC3A 1V34A 3FKEA 3L2AA 2L4EA 2DWLA 2CP8A 4B3RM 1VEKA 4OU7A 1J7KA 5JI3E 4LF5M 4W5WA 2YFQA 3HY5A 4FD2A 1QUTA 2KDLA 2JUJA 1PGYA 1NSFA 1ZMVA 2LWXA 5BR8M 2LXEA 1R7RA 2XGNA 3QWLA 3AKZA 3RGSA 2BJWA 2O01F 1IM2A 2X49A 2RGOA 2XFSA 2XH9A 2Z8YM 4B7FA 3D8BA 3E4RA 4OX9M 3CGWA 4L16A 3FYDA 2XF3A 3GLHA 4DV1M 4IBBA 3KP1E 4RKUF 2H5XA 3LQRA 1K3XA 3HU1A 4AW4A 3FD9A 2VF8A 3BBZA 3LQQA 1SXJC 2L09A 2QP9X 3LCVB 4II7A 5DFLA 3UK6A 5FSWA 4LY6A 4DR6M 2KW0A 4G6ZA 4DBGB 2F5NA 1DO0A 2LVQD 2V1UA 1N33M 2YR0A 2LVOC 2R46A 3LVWA 3Q8XA 4NXNM 1QANA 4B3MM 3SBJA 1GLNA 1IFYA 5DYIA 3U5ZB 4P16A 4CIZA 3KFUG 2C98A 3C9PA 4PDGA 1NV9A 4NC6A 2MGWA 2R18A 3OTOM 3U5ZA 2CE7A 4NSOB 1HNXM 2R4JA 4LF7M 3WHLA 4GHAA 2CHVA 4NXMM 2JWSA 5C18A 1WGLA 2HCBA 2QCUA 3AV0A 2V1CA 4HL4A 5KO3A 2VQEM 2F5PA 1FNNA 4RF1A 5FTLA 1WR1B 3U6EA 3M6AA 4AKGA 1SXJA 4YY3M 5EXSA 3AFHA 1TTEA 1WJ7A 2JNHA 1XWIA 3FTEA 4AI6A 3M0EA 1SG9A 1W5SA 5IZ7D 5EJCA 3H4MA 4NOOB 5KPRA 2DI0A 3HKPA 1KSFX 2BNKA 2Z7JA 4GEWA 1H6UA 2F5SA 4GC5A 4G4QA 1IN8A 1IY2A 3SYLA 4DV7M 3AL0C 7CATA 1QDRA 5FTJA 1J09A 1P3QQ 4IBKA 2CHGA 3GRUA 4IBGA 3GPXA 3HU3A 3SARA 1GJTA 4IJEA 4LJ6A 4B08A 1DGHA 4JI0M 3TWKA 3SATA 3NBIA 2EJSA 2R45A 1C7YA 4AG5A 1V33A 1R4GA 3B7ZA 3KS8A 3GPYA 1G8PA 2D7HA 3ZH9B 4GC9A 2VQFM 3VK8A 1BVSA 3FRIA 2L4FA 2XSZA 1KYIA 2JZ0A 5FTNA 4LJ5A 3HJQA 1E94E 1LTMA 2Y0QA 2LHGA 1IBLM 4JYAM 3PVSA 2G8LA 3T1YM 3J7BA 3QAUA 4XBOA 1V92A 3GP1A 1I94M 4CGYB 1GKIA 2KZUA 1FJGM 3KSJA 5LMNM 4G4NA 2DZOB 3VLFB 1L2CA 3U6PA 3I51A 1TH3A 2X8AA 3KP0E 4PCZA 2R6FA 3L28A 4L6V6 4KT0F 3HJSA 4QHTA 3VDPA 4L8RC 1OIPA 4LF6M 2LH0A 1Z5AA 1GL7A 4JI5M 1E9RA 2O25A 3UZUA 2G5GX 3FTDA 4Z8XA 3HHXA 4JI3M 1YUBA 3AOEA 5KQDA 2C9CA 4EIWA 4K0KM 1Q3CA 5FTMA 2CFOA 2ZBKB 2J7NA 4FW9A 4REZA 4L78A 1YE9A 5ITQA 2R44A 3MHVC 3LCUA 3PNVA 2CV0A 1GL6A 3JAMS 3A98B 1L2DA 1GVNA 4ITQA 1PJIA 5L8RF 1R2ZA 2KEBA 2OOBA 2F5OA 3R8FA 2X4AA 3U6OA 3L27A 3RFWA 1QDTA 1NY6A 2GNOA 1OAOC 3C3DA 1OTRA 1PJTA 4IIWA 4Y28F 2CRUA 1XXHB 1TH2A 1UM8A 2JY7A 3MMPA 2XLJA 4HEOA 4LGMA 2LTUA 1LV7A 1N32M 3FTCA 2R4EA 3SMSA 2K6BA 4Q7JA 2LVPC 1XXHE 5C1BA 1HR0M 2M5ZA 1IY1A 2UUCM 4LRTA 4GHLA 2DENA 4M9ZA 4GKKM 2LNHC 2LBCA 1L1TA 1G71A 4X65M 3QYEA 2LHCA 2EKFA 3HHWA 3AOGA 2OQ4A 3U60B 3IHPA 1TDZA 2CV1A 2L2DA 3VKGA 4IBDA 2LVAA 3U60A 3SMPA 4JV5M 3T38A 4DUYM 4QOZC 1QZEA 2XEPA 4HLQA 3L26A 1HT2E 3T6PA 1K82A 4KHPM 1N78A 4CJ6A 3SYKA 1NNJA 1NV8A 1HQCA 2MH8A 2FOIC 3A45A 4NRVA 3ZQJA 2JP7A 1IXRC 2JZ1A 3W0FA 2CUZA 1WIVA 5FLXS 4Z6YA 1YLAA 3HJ8A 4PDIA 2XZUA 2KRKA 2E5LM 4LZZA 2UXDM 3T15A 1XNQM 1K3WA 4DV2M 2FH0A 3BXWA 1KFVA 2DZNB 3E46A 1PM5A 4X64M 3L29A
chains in the Genus database with same CATH topology
4IJFA 4JXJA 2BJVA 2C99A 4CISA 2HKJA 1NY5A 3PFIA 1G59A 5FTKA 1VDDA 5E26A 4B7HA 2ZM6M 5BPVA 2DVWB 3TL4X 2Y21A 1IXSB 1NVMA 1MX0A 3DOAA 3E9SA 4GRIA 3U61B 5IWAM 3U6MA 4BB9A 3GQ4A 3EIEA 4LJ7A 4B7GA 1T3TA 3HU2A 3FUVA 3U6LA 4WW0A 4FWGA 3TE6A 3WHKA 4WURA 5IREB 3K1JA 2FFJA 2KXEA 3SHGB 4IBCA 4BLCA 1NJFA 5ITTA 3PNYA 1QZMA 1N34M 1DGFA 1I4WA 1G3IA 3GPPA 1C1KA 1X37A 1TGUA 3J27B 4G4OA 1W5TA 4GITA 1OJLA 3GLFB 4D81A 3M7GA 5ITXE 4X66M 3AOEC 2QZ4A 5KQ8A 1OFIA 4YHHM 2OPFA 1L1ZA 3FYCA 4QNRA 2AHMA 3TQSA 1E9SA 1N75A 1YSYA 2R62A 1Q39A 5EXXA 2EA0A 3SAVA 4DV4M 4DR2M 1SXJD 2F4VM 1S3SA 2F5QA 1NJGA 1IQPA 4IBFA 3FUXA 2RKOA 3EIHA 4KODA 4I5SA 1XMQM 4FVMA 4MGHA 3FUUA 5ITRA 4NRWA 3I4VA 3J80S 3UJNA 4M0WA 3A46A 3DA1A 1Z5BA 4KO8A 4LRSA 2UXBM 3D8LA 1Z59A 3UGJA 4LF9M 4NSRA 3GLIB 4AKIA 1IXZA 3J2PB 4ZPXA 1QAMA 3UMMA 1N36M 4QHSA 2Q2EB 4GIPA 3GLIA 1DGBA 2XFTA 4OVZB 3VFDA 1DO2A 4QNMA 4JI2M 3C58A 2EUCA 4OVZA 3U6SA 5A2QS 4S12A 3L25A 4LFBM 4GMQA 2DXIA 4LCBA 5KPTA 4LJ9A 2EO2A 1L8QA 4AKHA 2R65A 1QQWA 4R3DA 3KDSE 1ORYB 3AJIB 3FUWA 3R9XB 3KOXE 3NWLA 4I8OA 1XXHA 1IN7A 4MB7A 4MH0E 1PJJA 4LF4M 3IG8A 1JR3D 4AQYM 1MU5A 4QOSA 2DWZB 3U6CA 2L7IA 3VKHA 2UU9M 2ERCA 4JI8M 4IBJA 4DR1M 3IG5A 2J7OA 3VDUA 2Y0TA 5EXPA 4JI1M 1Z6TA 2W82A 4FWDA 3SASA 4DV3M 3U6DA 3GQ5A 4IBEA 4M0DA 1NNUC 2FNAA 3A42A 5EP3A 1N77A 2ZAMA 1DGGA 1QAOA 3K8ZA 4FCTA 4AG6A 4B3SM 3KOWE 1IN4A 5E6JA 1D2NA 4D80A 1ZAEA 3I4YA 4M9SA 4G4RA 1HNWM 4DR7M 3GLHB 1E32A 3ILKA 3CF2A 4AZFA 4BBAA 4JN6A 3GPUA 1XNRM 3J81S 2Z4RA 1Z5CA 1XHBA 3T1HM 2UUAM 3K92A 2O5RA 2D7EA 3DFZA 3GRYA 1QVRA 4I81A 3PXGA 4PD2A 1HNZM 1TH4A 4JI6M 3GRRA 4L15A 3J7AS 2QENA 3ZC7B 4JI4M 3GRVA 1WXQA 3FTFA 3FUTA 5EQTA 5GKNA 3U61A 4JI7M 4MGKE 4LFCM 2HHHM 2XZFA 3HGIA 3CTWB 2FE8A 2M60A 5KPZA 1R6BX 2Z3XA 3VK7A 1J5EM 2RGHA 4LJAA 2L7HA 3W0LB 5DNYA 1L2BA 2HL7A 3MK6A 3KS4A 4KLNA 4RF0A 1SXJB 2NQ8C 5DYGA 3BOSA 4MGIE 1HQYE 3U6QA 2JA2A 3GO8A 1SXJE 1XC8A 2K47A 4X62M 4B3TM 2CEAA 3HHZA 1G41A 4MM3B 2H1RA 2DHRA 3JR4A 5EP2A 5ITXA 2YNMD 4DR3M 4FWHA 4DUZM 3KVWA 3SAWA 4D82A 3GLFA 3ZCBB 4DR5M 1DGHB 4LGYA 5EP4A 4RNAA 1ZQ9A 5EP1A 3GLGB 4LF8M 2KA6B 3MJ5A 3GLGA 2C96A 5LMUM 1HT1E 5JI2E 2A5YB 2I7NA 1IN5A 1NHWC 4I4LA 1QYRA 2YQZA 3SFZA 3B9PA 3LVVA 4L4UA 1Q3BA 2V6ZM 5ITUA 3SAUA 4M9XA 2L6OA 1IBMM 2UXCM 4A3VB 4PT5A 4XGIA 4MGYE 4LJ8A 4GKJM 3RGPA 5H37D 1XMOM 4DR4M 4FCWA 8CATA 1OFHA 2VIIA 4OW0A 4IBIA 2CHQA 4LG2A 2CV2A 4MGZE 4DV0M 1JR3A 2I7PA 3CF0A 2Z4SA 2QBYB 3HHYA 3TPZA 4LJ4A 3SHFA 3TWMA 1EE8A 2ZAOA 3KOYE 1IN6A 3KSXA 1IBKM 2XSZD 2QBYA 4NL4H 4LZJA 3K2LA 4LFAM 2DWNA 4R7GA 5EXTA 3THGA 5IT9S 2C5RA 3CF6E 4FCVA 1JQJC 2D7GA 3KXEC 3KOZE 2DWMA 1NHGC 2KRUA 4TUWA 3DZDA 4GH9A 1G4AE 2Y20A 3GQ3A 2ZANA 2KZSA 2QPAA 3JR5A 5F3WA 2C9OA 3HWSA 4DV5M 1IY0A 3KW6A 4CHTB 4DV6M 5ITYA 3RE8A 2UUBM 3LMMA 1TDHA 3TWLA 1R2YA 1QAQA 2P5TA 3SC3A 3FKEA 3L2AA 2DWLA 4B3RM 4OU7A 1J7KA 5JI3E 4LF5M 4W5WA 2YFQA 4FD2A 2LWXA 1NSFA 5BR8M 2LXEA 1R7RA 2XGNA 3QWLA 3AKZA 3RGSA 2BJWA 1IM2A 2X49A 2RGOA 2XFSA 2XH9A 4B7FA 3D8BA 3E4RA 4OX9M 4L16A 3FYDA 2XF3A 3GLHA 4DV1M 4IBBA 3KP1E 3LQRA 1K3XA 3HU1A 4AW4A 3FD9A 3LQQA 1SXJC 2L09A 2QP9X 4II7A 3UK6A 5FSWA 4LY6A 4DR6M 2KW0A 4G6ZA 2F5NA 2V1UA 1DO0A 1N33M 2YR0A 2R46A 3LVWA 3Q8XA 4NXNM 1QANA 4B3MM 3SBJA 1GLNA 5DYIA 3U5ZB 4P16A 3KFUG 2C98A 4PDGA 2R18A 3OTOM 3U5ZA 2CE7A 4NSOB 1HNXM 2R4JA 4LF7M 3WHLA 4GHAA 2CHVA 4NXMM 5C18A 2HCBA 2QCUA 3AV0A 4HL4A 2V1CA 5KO3A 2VQEM 2F5PA 1FNNA 4RF1A 5FTLA 3U6EA 3M6AA 4AKGA 1SXJA 4YY3M 5EXSA 3AFHA 1XWIA 3FTEA 4AI6A 3M0EA 1W5SA 5IZ7D 5EJCA 3H4MA 4NOOB 5KPRA 3HKPA 1KSFX 2BNKA 2Z7JA 1H6UA 2F5SA 4GC5A 4G4QA 1IN8A 1IY2A 3SYLA 4DV7M 3AL0C 7CATA 5FTJA 1J09A 4IBKA 2CHGA 3GRUA 4IBGA 3HU3A 3SARA 4IJEA 4LJ6A 4B08A 1DGHA 4JI0M 3TWKA 3SATA 3NBIA 2R45A 4AG5A 3KS8A 3GPYA 1G8PA 2D7HA 3ZH9B 4GC9A 2VQFM 3VK8A 2XSZA 1KYIA 5FTNA 4LJ5A 3HJQA 1E94E 2Y0QA 1IBLM 4JYAM 3PVSA 2G8LA 3T1YM 3J7BA 3QAUA 4XBOA 3GP1A 1I94M 4CGYB 1GKIA 2KZUA 1FJGM 3KSJA 5LMNM 4G4NA 2DZOB 3VLFB 1L2CA 3U6PA 3I51A 1TH3A 2X8AA 3KP0E 4PCZA 3L28A 3GPXA 4QHTA 4L8RC 3HJSA 3VDPA 4LF6M 2LH0A 1Z5AA 1GL7A 4JI5M 1E9RA 3UZUA 2G5GX 3FTDA 4Z8XA 3HHXA 4JI3M 1YUBA 3AOEA 5KQDA 2C9CA 4EIWA 4K0KM 1Q3CA 5FTMA 2CFOA 2ZBKB 2J7NA 4FW9A 4REZA 4L78A 1YE9A 5ITQA 3MHVC 2CV0A 3PNVA 1GL6A 3JAMS 3A98B 1L2DA 1GVNA 4ITQA 1PJIA 1R2ZA 2KEBA 2F5OA 3R8FA 2X4AA 3U6OA 3L27A 3RFWA 1NY6A 4IIWA 2XLJA 1XXHB 1TH2A 1UM8A 4LGMA 1N32M 1LV7A 3FTCA 2R4EA 3SMSA 5C1BA 1HR0M 2M5ZA 1IY1A 2UUCM 4LRTA 4GHLA 4M9ZA 4GKKM 2LNHC 1L1TA 4X65M 3HHWA 3U60B 3AOGA 2OQ4A 2CV1A 1TDZA 3VKGA 4IBDA 3U60A 3SMPA 4JV5M 3T38A 4DUYM 4QOZC 2XEPA 4HLQA 3L26A 1HT2E 1K82A 4KHPM 1N78A 3SYKA 1NNJA 4NRVA 1HQCA 3A45A 2FOIC 1IXRC 3W0FA 2CUZA 5FLXS 4Z6YA 2XZUA 3HJ8A 4PDIA 2KRKA 2E5LM 4LZZA 2UXDM 3T15A 1XNQM 1K3WA 4DV2M 1KFVA 2DZNB 1PM5A 4X64M 3L29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GIP A; 
#chains in the Genus database with same CATH topology
 4IJF A;  4JXJ A;  2KHH A;  2BJV A;  2C99 A;  2KNZ A;  2HKJ A;  4CIS A;  1NY5 A;  3PFI A;  1G59 A;  5FTK A;  1VDD A;  3W68 A;  5E26 A;  2DAM A;  3E21 A;  4WP2 A;  4B7H A;  4UN2 B;  2ZM6 M;  5BPV A;  2DVW B;  3TL4 X;  2Y21 A;  1IXS B;  1NVM A;  1MX0 A;  2K0B X;  2DAG A;  3DOA A;  3E9S A;  4GRI A;  3U61 B;  5IWA M;  3U6M A;  1IXS A;  4BB9 A;  3GQ4 A;  4P17 A;  2WSC F;  3EIE A;  4LJ7 A;  4B7G A;  1T3T A;  3HU2 A;  3FUV A;  3U6L A;  4WW0 A;  4FWG A;  1GJS A;  3TE6 A;  3WHK A;  4WUR A;  1TR8 A;  5IRE B;  3K1J A;  2DAI A;  2GQF A;  1ZMU A;  2FFJ A;  2KXE A;  3SHG B;  4IBC A;  3K9P A;  1NJF A;  4BLC A;  2WSF F;  5ITT A;  3PNY A;  1QZM A;  1N34 M;  1OAI A;  1DGF A;  1I4W A;  1G3I A;  3GPP A;  1C1K A;  1X37 A;  1TGU A;  3J27 B;  4G4O A;  2DZL A;  1W5T A;  1Y8G A;  2OO9 A;  4GIT A;  1OJL A;  2HAK A;  3GLF B;  4D81 A;  3M7G A;  5ITX E;  4X66 M;  3AOE C;  1VG5 A;  2QZ4 A;  1OFI A;  2DAK A;  3HX3 A;  3I01 M;  5KQ8 A;  4YHH M;  3FYC A;  4QNR A;  3GLF E;  2OPF A;  2AHM A;  3B7Q A;  3TQS A;  1E9S A;  1N75 A;  1YSY A;  2N35 A;  1Q39 A;  2R62 A;  1MJG M;  5EXX A;  3B74 A;  2EA0 A;  2DAE A;  2J5Y A;  3SAV A;  1OQY A;  4DV4 M;  4DR2 M;  1WGN A;  1SXJ D;  1HJP A;  2F4V M;  1S3S A;  3GLG E;  3FRH A;  2F5Q A;  1NJG A;  1IQP A;  4IBF A;  2WZJ A;  3FUX A;  2RKO A;  3EIH A;  4KOD A;  4I5S A;  1XMQ M;  1Q02 A;  4FVM A;  1PJQ A;  1PRB A;  4MGH A;  3FUU A;  5ITR A;  4NRW A;  1VEJ A;  3I4V A;  3J80 S;  3UJN A;  4M0W A;  3A46 A;  3DA1 A;  3W67 A;  1Z5B A;  4KO8 A;  4LRS A;  2UXB M;  3D8L A;  1Z59 A;  1MN3 A;  3UGJ A;  4LF9 M;  4NSR A;  3GLI B;  4AKI A;  1IXZ A;  3J2P B;  4ZPX A;  1QAM A;  3UMM A;  1N36 M;  1VEG A;  4QHS A;  2Q2E B;  4GIP A;  3GLI E;  3GLI A;  1F4I A;  1DGB A;  2XFT A;  4OVZ B;  3VFD A;  4F1I A;  1GO5 A;  3LW5 F;  1DO2 A;  4QNM A;  1JR3 E;  4JI2 M;  3C58 A;  2EUC A;  4OVZ A;  3U6S A;  5A2Q S;  4S12 A;  3L25 A;  4LFB M;  1A5T A;  4GMQ A;  4LCB A;  4G3O A;  5KPT A;  4LJ9 A;  1OIZ A;  2EO2 A;  2DXI A;  1L8Q A;  2DHY A;  4AKH A;  2R65 A;  1QQW A;  1DV0 A;  3V76 A;  4R3D A;  2EKK A;  3KDS E;  1ORY B;  3AJI B;  3FUW A;  1UFZ A;  3R9X B;  3KOX E;  3NBX X;  3NWL A;  1D0L A;  1XXH A;  4I8O A;  1IN7 A;  4MB7 A;  4MH0 E;  1PJJ A;  4LF4 M;  3IG8 A;  1JR3 D;  4AQY M;  1MU5 A;  4QOS A;  2DWZ B;  3U6C A;  2L7I A;  3VKH A;  2UU9 M;  2ERC A;  3Q8G A;  1ZV1 A;  4IBJ A;  4JI8 M;  4DR1 M;  1AIP C;  2BWB A;  1AUA A;  3IG5 A;  2KNV A;  2J7O A;  3VDU A;  1RU3 A;  2Y0T A;  5EXP A;  4JI1 M;  1Z6T A;  2W82 A;  4FWD A;  3SAS A;  4DV3 M;  3U6D A;  3GQ5 A;  4IBE A;  4M0D A;  1NNU C;  2FNA A;  3A42 A;  5EP3 A;  1N77 A;  2HWJ A;  2ZAM A;  1DGG A;  1QAO A;  3K8Z A;  4FCT A;  1ZMW A;  4AG6 A;  4B3S M;  2ZTC A;  3KOW E;  1IN4 A;  5E6J A;  1D2N A;  4D80 A;  1ZAE A;  2JY5 A;  3I4Y A;  2OOA A;  4M9S A;  4G4R A;  1HNW M;  4DR7 M;  3GLH B;  1E32 A;  2VF7 A;  2FS1 A;  2K9D A;  2WSE F;  3CF2 A;  3ILK A;  1EIJ A;  4AZF A;  4BBA A;  4JN6 A;  3GLH E;  3GPU A;  1XNR M;  3J81 S;  2Z4R A;  1Z5C A;  1XHB A;  3T1H M;  2UUA M;  3GRY A;  2O5R A;  2D7E A;  3DFZ A;  3K92 A;  1QVR A;  1EFU B;  4I81 A;  3PXG A;  4PD2 A;  1TH4 A;  1HNZ M;  4JI6 M;  3GRR A;  4L15 A;  3J7A S;  1CUK A;  2QEN A;  2KNA A;  3C3E A;  2QQ8 A;  3ZC7 B;  1L1Z A;  2G3Q A;  1WXQ A;  3GRV A;  4JI4 M;  3FTF A;  3FUT A;  5EQT A;  5GKN A;  3U61 A;  4JI7 M;  1VQ1 A;  2APL A;  4MGK E;  4LFC M;  3B7N A;  2HHH M;  2XZF A;  3HGI A;  2CWB A;  3FE3 A;  3CTW B;  2FE8 A;  2M60 A;  5KPZ A;  1R6B X;  2Z3X A;  3VK7 A;  1J5E M;  2RGH A;  2LVN C;  4LJA A;  2L7H A;  3W0L B;  5DNY A;  1L2B A;  2HL7 A;  3MK6 A;  3KS4 A;  3I04 M;  4KLN A;  1SXJ B;  4RF0 A;  2NQ8 C;  5DYG A;  3BOS A;  4MGI E;  1HQY E;  3U6Q A;  2JA2 A;  3GO8 A;  1SXJ E;  1XC8 A;  2K47 A;  1NO1 A;  3B89 A;  4X62 M;  4B3T M;  2CEA A;  3HHZ A;  1G41 A;  4MM3 B;  2H1R A;  2DHR A;  3JR4 A;  5EP2 A;  5ITX A;  2YNM D;  4DR3 M;  4FWH A;  4DUZ M;  3KVW A;  3SAW A;  4D82 A;  1D0M A;  3GLF A;  3ZCB B;  2BWE A;  4DR5 M;  1DGH B;  4LGY A;  2R0I A;  1PJS A;  4RNA A;  1ZQ9 A;  5EP4 A;  5EP1 A;  3GLG B;  4LF8 M;  2KA6 B;  1XB2 B;  4XK8 F;  1WHC A;  3MJ5 A;  3GLG A;  3H4J A;  2C96 A;  5LMU M;  1HT1 E;  2QNJ A;  3F92 A;  4R71 A;  2A5Y B;  5JI2 E;  2I7N A;  1GAB A;  1IN5 A;  1NHW C;  4I4L A;  3IEC A;  2VDB B;  1QYR A;  2YQZ A;  3SFZ A;  3B9P A;  3LVV A;  4L4U A;  2JY8 A;  1Q3B A;  2V6Z M;  5ITU A;  3SAU A;  2B3T A;  2L6O A;  4M9X A;  1IBM M;  4A3V B;  2UXC M;  4PT5 A;  4XGI A;  4MGY E;  4LJ8 A;  4GKJ M;  3RGP A;  4ANR A;  5H37 D;  1XMO M;  4DR4 M;  4FCW A;  8CAT A;  1OFH A;  1TF0 B;  2VII A;  4OW0 A;  4IBI A;  2CHQ A;  2QSF X;  4LG2 A;  2CV2 A;  4MGZ E;  2JXN A;  4DV0 M;  1JR3 A;  2I7P A;  3CF0 A;  2Z4S A;  2QBY B;  2ZTD A;  3HHY A;  1JB0 F;  3TPZ A;  4LJ4 A;  3SHF A;  3TWM A;  4F2L A;  1EE8 A;  1T6O A;  2RRU A;  1IN6 A;  1OKS A;  2ZAO A;  2XSZ D;  3KOY E;  3KSX A;  1IBK M;  2QBY A;  1VDL A;  4NL4 H;  4LZJ A;  1D0K A;  3K2L A;  4LFA M;  2DWN A;  4R7G A;  5EXT A;  3THG A;  5IT9 S;  2JY6 B;  2C5R A;  3K9O A;  1QUS A;  3CF6 E;  2MR9 A;  4FCV A;  1JQJ C;  2DNA A;  2D7G A;  3KXE C;  1R5L A;  2DKL A;  2MJ5 B;  3KOZ E;  2DWM A;  1NHG C;  2KRU A;  4TUW A;  3DZD A;  4GH9 A;  1G4A E;  2Y20 A;  3GQ3 A;  2ZAN A;  2KZS A;  2MRO B;  2QPA A;  3JR5 A;  5F3W A;  3HZJ A;  2C9O A;  3HWS A;  4DV5 M;  1IY0 A;  3KW6 A;  2QHO B;  3QYB A;  4CHT B;  5ITY A;  3RE8 A;  4DV6 M;  2UUB M;  3LMM A;  1TDH A;  3TWL A;  1R2Y A;  1QAQ A;  1T43 A;  2P5T A;  3SC3 A;  1V34 A;  3FKE A;  3L2A A;  2L4E A;  2DWL A;  2CP8 A;  4B3R M;  1VEK A;  4OU7 A;  1J7K A;  5JI3 E;  4LF5 M;  4W5W A;  2YFQ A;  3HY5 A;  4FD2 A;  1QUT A;  2KDL A;  2JUJ A;  1PGY A;  1NSF A;  1ZMV A;  2LWX A;  5BR8 M;  2LXE A;  1R7R A;  2XGN A;  3QWL A;  3AKZ A;  3RGS A;  2BJW A;  2O01 F;  1IM2 A;  2X49 A;  2RGO A;  2XFS A;  2XH9 A;  2Z8Y M;  4B7F A;  3D8B A;  3E4R A;  4OX9 M;  3CGW A;  4L16 A;  3FYD A;  2XF3 A;  3GLH A;  4DV1 M;  4IBB A;  3KP1 E;  4RKU F;  2H5X A;  3LQR A;  1K3X A;  3HU1 A;  4AW4 A;  3FD9 A;  2VF8 A;  3BBZ A;  3LQQ A;  1SXJ C;  2L09 A;  2QP9 X;  3LCV B;  4II7 A;  5DFL A;  3UK6 A;  5FSW A;  4LY6 A;  4DR6 M;  2KW0 A;  4G6Z A;  4DBG B;  2F5N A;  1DO0 A;  2LVQ D;  2V1U A;  1N33 M;  2YR0 A;  2LVO C;  2R46 A;  3LVW A;  3Q8X A;  4NXN M;  1QAN A;  4B3M M;  3SBJ A;  1GLN A;  1IFY A;  5DYI A;  3U5Z B;  4P16 A;  4CIZ A;  3KFU G;  2C98 A;  3C9P A;  4PDG A;  1NV9 A;  4NC6 A;  2MGW A;  2R18 A;  3OTO M;  3U5Z A;  2CE7 A;  4NSO B;  1HNX M;  2R4J A;  4LF7 M;  3WHL A;  4GHA A;  2CHV A;  4NXM M;  2JWS A;  5C18 A;  1WGL A;  2HCB A;  2QCU A;  3AV0 A;  2V1C A;  4HL4 A;  5KO3 A;  2VQE M;  2F5P A;  1FNN A;  4RF1 A;  5FTL A;  1WR1 B;  3U6E A;  3M6A A;  4AKG A;  1SXJ A;  4YY3 M;  5EXS A;  3AFH A;  1TTE A;  1WJ7 A;  2JNH A;  1XWI A;  3FTE A;  4AI6 A;  3M0E A;  1SG9 A;  1W5S A;  5IZ7 D;  5EJC A;  3H4M A;  4NOO B;  5KPR A;  2DI0 A;  3HKP A;  1KSF X;  2BNK A;  2Z7J A;  4GEW A;  1H6U A;  2F5S A;  4GC5 A;  4G4Q A;  1IN8 A;  1IY2 A;  3SYL A;  4DV7 M;  3AL0 C;  7CAT A;  1QDR A;  5FTJ A;  1J09 A;  1P3Q Q;  4IBK A;  2CHG A;  3GRU A;  4IBG A;  3GPX A;  3HU3 A;  3SAR A;  1GJT A;  4IJE A;  4LJ6 A;  4B08 A;  1DGH A;  4JI0 M;  3TWK A;  3SAT A;  3NBI A;  2EJS A;  2R45 A;  1C7Y A;  4AG5 A;  1V33 A;  1R4G A;  3B7Z A;  3KS8 A;  3GPY A;  1G8P A;  2D7H A;  3ZH9 B;  4GC9 A;  2VQF M;  3VK8 A;  1BVS A;  3FRI A;  2L4F A;  2XSZ A;  1KYI A;  2JZ0 A;  5FTN A;  4LJ5 A;  3HJQ A;  1E94 E;  1LTM A;  2Y0Q A;  2LHG A;  1IBL M;  4JYA M;  3PVS A;  2G8L A;  3T1Y M;  3J7B A;  3QAU A;  4XBO A;  1V92 A;  3GP1 A;  1I94 M;  4CGY B;  1GKI A;  2KZU A;  1FJG M;  3KSJ A;  5LMN M;  4G4N A;  2DZO B;  3VLF B;  1L2C A;  3U6P A;  3I51 A;  1TH3 A;  2X8A A;  3KP0 E;  4PCZ A;  2R6F A;  3L28 A;  4L6V 6;  4KT0 F;  3HJS A;  4QHT A;  3VDP A;  4L8R C;  1OIP A;  4LF6 M;  2LH0 A;  1Z5A A;  1GL7 A;  4JI5 M;  1E9R A;  2O25 A;  3UZU A;  2G5G X;  3FTD A;  4Z8X A;  3HHX A;  4JI3 M;  1YUB A;  3AOE A;  5KQD A;  2C9C A;  4EIW A;  4K0K M;  1Q3C A;  5FTM A;  2CFO A;  2ZBK B;  2J7N A;  4FW9 A;  4REZ A;  4L78 A;  1YE9 A;  5ITQ A;  2R44 A;  3MHV C;  3LCU A;  3PNV A;  2CV0 A;  1GL6 A;  3JAM S;  3A98 B;  1L2D A;  1GVN A;  4ITQ A;  1PJI A;  5L8R F;  1R2Z A;  2KEB A;  2OOB A;  2F5O A;  3R8F A;  2X4A A;  3U6O A;  3L27 A;  3RFW A;  1QDT A;  1NY6 A;  2GNO A;  1OAO C;  3C3D A;  1OTR A;  1PJT A;  4IIW A;  4Y28 F;  2CRU A;  1XXH B;  1TH2 A;  1UM8 A;  2JY7 A;  3MMP A;  2XLJ A;  4HEO A;  4LGM A;  2LTU A;  1LV7 A;  1N32 M;  3FTC A;  2R4E A;  3SMS A;  2K6B A;  4Q7J A;  2LVP C;  1XXH E;  5C1B A;  1HR0 M;  2M5Z A;  1IY1 A;  2UUC M;  4LRT A;  4GHL A;  2DEN A;  4M9Z A;  4GKK M;  2LNH C;  2LBC A;  1L1T A;  1G71 A;  4X65 M;  3QYE A;  2LHC A;  2EKF A;  3HHW A;  3AOG A;  2OQ4 A;  3U60 B;  3IHP A;  1TDZ A;  2CV1 A;  2L2D A;  3VKG A;  4IBD A;  2LVA A;  3U60 A;  3SMP A;  4JV5 M;  3T38 A;  4DUY M;  4QOZ C;  1QZE A;  2XEP A;  4HLQ A;  3L26 A;  1HT2 E;  3T6P A;  1K82 A;  4KHP M;  1N78 A;  4CJ6 A;  3SYK A;  1NNJ A;  1NV8 A;  1HQC A;  2MH8 A;  2FOI C;  3A45 A;  4NRV A;  3ZQJ A;  2JP7 A;  1IXR C;  2JZ1 A;  3W0F A;  2CUZ A;  1WIV A;  5FLX S;  4Z6Y A;  1YLA A;  3HJ8 A;  4PDI A;  2XZU A;  2KRK A;  2E5L M;  4LZZ A;  2UXD M;  3T15 A;  1XNQ M;  1K3W A;  4DV2 M;  2FH0 A;  3BXW A;  1KFV A;  2DZN B;  3E46 A;  1PM5 A;  4X64 M;  3L29 A; 
#chains in the Genus database with same CATH homology
 4IJF A;  4JXJ A;  2BJV A;  2C99 A;  4CIS A;  2HKJ A;  1NY5 A;  3PFI A;  1G59 A;  5FTK A;  1VDD A;  5E26 A;  4B7H A;  2ZM6 M;  5BPV A;  2DVW B;  3TL4 X;  2Y21 A;  1IXS B;  1NVM A;  1MX0 A;  3DOA A;  3E9S A;  4GRI A;  3U61 B;  5IWA M;  3U6M A;  4BB9 A;  3GQ4 A;  3EIE A;  4LJ7 A;  4B7G A;  1T3T A;  3HU2 A;  3FUV A;  3U6L A;  4WW0 A;  4FWG A;  3TE6 A;  3WHK A;  4WUR A;  5IRE B;  3K1J A;  2FFJ A;  2KXE A;  3SHG B;  4IBC A;  4BLC A;  1NJF A;  5ITT A;  3PNY A;  1QZM A;  1N34 M;  1DGF A;  1I4W A;  1G3I A;  3GPP A;  1C1K A;  1X37 A;  1TGU A;  3J27 B;  4G4O A;  1W5T A;  4GIT A;  1OJL A;  3GLF B;  4D81 A;  3M7G A;  5ITX E;  4X66 M;  3AOE C;  2QZ4 A;  5KQ8 A;  1OFI A;  4YHH M;  2OPF A;  1L1Z A;  3FYC A;  4QNR A;  2AHM A;  3TQS A;  1E9S A;  1N75 A;  1YSY A;  2R62 A;  1Q39 A;  5EXX A;  2EA0 A;  3SAV A;  4DV4 M;  4DR2 M;  1SXJ D;  2F4V M;  1S3S A;  2F5Q A;  1NJG A;  1IQP A;  4IBF A;  3FUX A;  2RKO A;  3EIH A;  4KOD A;  4I5S A;  1XMQ M;  4FVM A;  4MGH A;  3FUU A;  5ITR A;  4NRW A;  3I4V A;  3J80 S;  3UJN A;  4M0W A;  3A46 A;  3DA1 A;  1Z5B A;  4KO8 A;  4LRS A;  2UXB M;  3D8L A;  1Z59 A;  3UGJ A;  4LF9 M;  4NSR A;  3GLI B;  4AKI A;  1IXZ A;  3J2P B;  4ZPX A;  1QAM A;  3UMM A;  1N36 M;  4QHS A;  2Q2E B;  4GIP A;  3GLI A;  1DGB A;  2XFT A;  4OVZ B;  3VFD A;  1DO2 A;  4QNM A;  4JI2 M;  3C58 A;  2EUC A;  4OVZ A;  3U6S A;  5A2Q S;  4S12 A;  3L25 A;  4LFB M;  4GMQ A;  2DXI A;  4LCB A;  5KPT A;  4LJ9 A;  2EO2 A;  1L8Q A;  4AKH A;  2R65 A;  1QQW A;  4R3D A;  3KDS E;  1ORY B;  3AJI B;  3FUW A;  3R9X B;  3KOX E;  3NWL A;  4I8O A;  1XXH A;  1IN7 A;  4MB7 A;  4MH0 E;  1PJJ A;  4LF4 M;  3IG8 A;  1JR3 D;  4AQY M;  1MU5 A;  4QOS A;  2DWZ B;  3U6C A;  2L7I A;  3VKH A;  2UU9 M;  2ERC A;  4JI8 M;  4IBJ A;  4DR1 M;  3IG5 A;  2J7O A;  3VDU A;  2Y0T A;  5EXP A;  4JI1 M;  1Z6T A;  2W82 A;  4FWD A;  3SAS A;  4DV3 M;  3U6D A;  3GQ5 A;  4IBE A;  4M0D A;  1NNU C;  2FNA A;  3A42 A;  5EP3 A;  1N77 A;  2ZAM A;  1DGG A;  1QAO A;  3K8Z A;  4FCT A;  4AG6 A;  4B3S M;  3KOW E;  1IN4 A;  5E6J A;  1D2N A;  4D80 A;  1ZAE A;  3I4Y A;  4M9S A;  4G4R A;  1HNW M;  4DR7 M;  3GLH B;  1E32 A;  3ILK A;  3CF2 A;  4AZF A;  4BBA A;  4JN6 A;  3GPU A;  1XNR M;  3J81 S;  2Z4R A;  1Z5C A;  1XHB A;  3T1H M;  2UUA M;  3K92 A;  2O5R A;  2D7E A;  3DFZ A;  3GRY A;  1QVR A;  4I81 A;  3PXG A;  4PD2 A;  1HNZ M;  1TH4 A;  4JI6 M;  3GRR A;  4L15 A;  3J7A S;  2QEN A;  3ZC7 B;  4JI4 M;  3GRV A;  1WXQ A;  3FTF A;  3FUT A;  5EQT A;  5GKN A;  3U61 A;  4JI7 M;  4MGK E;  4LFC M;  2HHH M;  2XZF A;  3HGI A;  3CTW B;  2FE8 A;  2M60 A;  5KPZ A;  1R6B X;  2Z3X A;  3VK7 A;  1J5E M;  2RGH A;  4LJA A;  2L7H A;  3W0L B;  5DNY A;  1L2B A;  2HL7 A;  3MK6 A;  3KS4 A;  4KLN A;  4RF0 A;  1SXJ B;  2NQ8 C;  5DYG A;  3BOS A;  4MGI E;  1HQY E;  3U6Q A;  2JA2 A;  3GO8 A;  1SXJ E;  1XC8 A;  2K47 A;  4X62 M;  4B3T M;  2CEA A;  3HHZ A;  1G41 A;  4MM3 B;  2H1R A;  2DHR A;  3JR4 A;  5EP2 A;  5ITX A;  2YNM D;  4DR3 M;  4FWH A;  4DUZ M;  3KVW A;  3SAW A;  4D82 A;  3GLF A;  3ZCB B;  4DR5 M;  1DGH B;  4LGY A;  5EP4 A;  4RNA A;  1ZQ9 A;  5EP1 A;  3GLG B;  4LF8 M;  2KA6 B;  3MJ5 A;  3GLG A;  2C96 A;  5LMU M;  1HT1 E;  5JI2 E;  2A5Y B;  2I7N A;  1IN5 A;  1NHW C;  4I4L A;  1QYR A;  2YQZ A;  3SFZ A;  3B9P A;  3LVV A;  4L4U A;  1Q3B A;  2V6Z M;  5ITU A;  3SAU A;  4M9X A;  2L6O A;  1IBM M;  2UXC M;  4A3V B;  4PT5 A;  4XGI A;  4MGY E;  4LJ8 A;  4GKJ M;  3RGP A;  5H37 D;  1XMO M;  4DR4 M;  4FCW A;  8CAT A;  1OFH A;  2VII A;  4OW0 A;  4IBI A;  2CHQ A;  4LG2 A;  2CV2 A;  4MGZ E;  4DV0 M;  1JR3 A;  2I7P A;  3CF0 A;  2Z4S A;  2QBY B;  3HHY A;  3TPZ A;  4LJ4 A;  3SHF A;  3TWM A;  1EE8 A;  2ZAO A;  3KOY E;  1IN6 A;  3KSX A;  1IBK M;  2XSZ D;  2QBY A;  4NL4 H;  4LZJ A;  3K2L A;  4LFA M;  2DWN A;  4R7G A;  5EXT A;  3THG A;  5IT9 S;  2C5R A;  3CF6 E;  4FCV A;  1JQJ C;  2D7G A;  3KXE C;  3KOZ E;  2DWM A;  1NHG C;  2KRU A;  4TUW A;  3DZD A;  4GH9 A;  1G4A E;  2Y20 A;  3GQ3 A;  2ZAN A;  2KZS A;  2QPA A;  3JR5 A;  5F3W A;  2C9O A;  3HWS A;  4DV5 M;  1IY0 A;  3KW6 A;  4CHT B;  4DV6 M;  5ITY A;  3RE8 A;  2UUB M;  3LMM A;  1TDH A;  3TWL A;  1R2Y A;  1QAQ A;  2P5T A;  3SC3 A;  3FKE A;  3L2A A;  2DWL A;  4B3R M;  4OU7 A;  1J7K A;  5JI3 E;  4LF5 M;  4W5W A;  2YFQ A;  4FD2 A;  2LWX A;  1NSF A;  5BR8 M;  2LXE A;  1R7R A;  2XGN A;  3QWL A;  3AKZ A;  3RGS A;  2BJW A;  1IM2 A;  2X49 A;  2RGO A;  2XFS A;  2XH9 A;  4B7F A;  3D8B A;  3E4R A;  4OX9 M;  4L16 A;  3FYD A;  2XF3 A;  3GLH A;  4DV1 M;  4IBB A;  3KP1 E;  3LQR A;  1K3X A;  3HU1 A;  4AW4 A;  3FD9 A;  3LQQ A;  1SXJ C;  2L09 A;  2QP9 X;  4II7 A;  3UK6 A;  5FSW A;  4LY6 A;  4DR6 M;  2KW0 A;  4G6Z A;  2F5N A;  2V1U A;  1DO0 A;  1N33 M;  2YR0 A;  2R46 A;  3LVW A;  3Q8X A;  4NXN M;  1QAN A;  4B3M M;  3SBJ A;  1GLN A;  5DYI A;  3U5Z B;  4P16 A;  3KFU G;  2C98 A;  4PDG A;  2R18 A;  3OTO M;  3U5Z A;  2CE7 A;  4NSO B;  1HNX M;  2R4J A;  4LF7 M;  3WHL A;  4GHA A;  2CHV A;  4NXM M;  5C18 A;  2HCB A;  2QCU A;  3AV0 A;  4HL4 A;  2V1C A;  5KO3 A;  2VQE M;  2F5P A;  1FNN A;  4RF1 A;  5FTL A;  3U6E A;  3M6A A;  4AKG A;  1SXJ A;  4YY3 M;  5EXS A;  3AFH A;  1XWI A;  3FTE A;  4AI6 A;  3M0E A;  1W5S A;  5IZ7 D;  5EJC A;  3H4M A;  4NOO B;  5KPR A;  3HKP A;  1KSF X;  2BNK A;  2Z7J A;  1H6U A;  2F5S A;  4GC5 A;  4G4Q A;  1IN8 A;  1IY2 A;  3SYL A;  4DV7 M;  3AL0 C;  7CAT A;  5FTJ A;  1J09 A;  4IBK A;  2CHG A;  3GRU A;  4IBG A;  3HU3 A;  3SAR A;  4IJE A;  4LJ6 A;  4B08 A;  1DGH A;  4JI0 M;  3TWK A;  3SAT A;  3NBI A;  2R45 A;  4AG5 A;  3KS8 A;  3GPY A;  1G8P A;  2D7H A;  3ZH9 B;  4GC9 A;  2VQF M;  3VK8 A;  2XSZ A;  1KYI A;  5FTN A;  4LJ5 A;  3HJQ A;  1E94 E;  2Y0Q A;  1IBL M;  4JYA M;  3PVS A;  2G8L A;  3T1Y M;  3J7B A;  3QAU A;  4XBO A;  3GP1 A;  1I94 M;  4CGY B;  1GKI A;  2KZU A;  1FJG M;  3KSJ A;  5LMN M;  4G4N A;  2DZO B;  3VLF B;  1L2C A;  3U6P A;  3I51 A;  1TH3 A;  2X8A A;  3KP0 E;  4PCZ A;  3L28 A;  3GPX A;  4QHT A;  4L8R C;  3HJS A;  3VDP A;  4LF6 M;  2LH0 A;  1Z5A A;  1GL7 A;  4JI5 M;  1E9R A;  3UZU A;  2G5G X;  3FTD A;  4Z8X A;  3HHX A;  4JI3 M;  1YUB A;  3AOE A;  5KQD A;  2C9C A;  4EIW A;  4K0K M;  1Q3C A;  5FTM A;  2CFO A;  2ZBK B;  2J7N A;  4FW9 A;  4REZ A;  4L78 A;  1YE9 A;  5ITQ A;  3MHV C;  2CV0 A;  3PNV A;  1GL6 A;  3JAM S;  3A98 B;  1L2D A;  1GVN A;  4ITQ A;  1PJI A;  1R2Z A;  2KEB A;  2F5O A;  3R8F A;  2X4A A;  3U6O A;  3L27 A;  3RFW A;  1NY6 A;  4IIW A;  2XLJ A;  1XXH B;  1TH2 A;  1UM8 A;  4LGM A;  1N32 M;  1LV7 A;  3FTC A;  2R4E A;  3SMS A;  5C1B A;  1HR0 M;  2M5Z A;  1IY1 A;  2UUC M;  4LRT A;  4GHL A;  4M9Z A;  4GKK M;  2LNH C;  1L1T A;  4X65 M;  3HHW A;  3U60 B;  3AOG A;  2OQ4 A;  2CV1 A;  1TDZ A;  3VKG A;  4IBD A;  3U60 A;  3SMP A;  4JV5 M;  3T38 A;  4DUY M;  4QOZ C;  2XEP A;  4HLQ A;  3L26 A;  1HT2 E;  1K82 A;  4KHP M;  1N78 A;  3SYK A;  1NNJ A;  4NRV A;  1HQC A;  3A45 A;  2FOI C;  1IXR C;  3W0F A;  2CUZ A;  5FLX S;  4Z6Y A;  2XZU A;  3HJ8 A;  4PDI A;  2KRK A;  2E5L M;  4LZZ A;  2UXD M;  3T15 A;  1XNQ M;  1K3W A;  4DV2 M;  1KFV A;  2DZN B;  1PM5 A;  4X64 M;  3L29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...