4GIPA

Structure of the cleavage-activated prefusion form of the parainfluenza virus 5 (piv5) fusion protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
LDPAALMQIGVIPTNVRQLMYYTEASSAFIVVKLMPTIDSPISGCNITSISSYNATVTKLLQPIGENLETIRNQLIPTRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion glycoprotein F2
publication title Structure of the cleavage-activated prefusion form of the parainfluenza virus 5 fusion protein.
pubmed doi rcsb
source organism Simian virus 5
molecule tags Viral protein
total genus 16
structure length 81
sequence length 81
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1110 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gipA00
4GIPA
chains in the Genus database with same CATH superfamily
1ZMUA 1WGNA 2HAKA 2VF7A 3U6SA 4LRTA 3FTCA 3U61B 2Y0TA 3B7QA 5KPZA 4A3VB 4LZZA 3FYDA 2C9OA 1XNRM 2QP9X 1IBLM 1R2ZA 1VEKA 4GHLA 4JI3M 1E94E 4B7FA 2MH8A 2R62A 4LJ6A 3ZQJA 2X49A 3MJ5A 3HHWA 1JQJC 2F5SA 4WURA 5EXSA 4CGYB 4ITQA 1S3SA 4QNMA 5IZ7D 2G5GX 4NXNM 4GH9A 3GLIB 1NVMA 3TQSA 4R3DA 2XSZA 1DGGA 4M9ZA 2Z7JA 3W0LB 2UUAM 1HQCA 3UJNA 1SXJB 2LVNC 1E9RA 4NSRA 2YNMD 2KEBA 4GC5A 3NWLA 5EXPA 1IY0A 1NHGC 1P3QQ 1VEGA 3GQ5A 4LF8M 1TF0B 3DFZA 4JI7M 3FTFA 4NC6A 3ZCBB 3GP1A 2R0IA 5KQ8A 4PD2A 1IM2A 2ERCA 2OO9A 1G4AE 3B89A 3FTDA 3QYBA 4II7A 5ITTA 3L26A 4JXJA 4G4RA 1WGLA 3A45A 2R18A 4LF5M 3U6CA 1NO1A 1SXJD 2JZ1A 3KP0E 1PJSA 4DUYM 1N75A 1Q3BA 3W68A 4YHHM 3GLFE 4BB9A 1I94M 2DHRA 2UU9M 3ILKA 5L8RF 2YFQA 2LTUA 1L8QA 2MR9A 2R6FA 2Y0QA 3I51A 4IIWA 4XBOA 1IN5A 2XFTA 4L6V6 4AW4A 3U6MA 1QDRA 1SXJC 2BNKA 4MGIE 5BR8M 4JI4M 1W5SA 1WJ7A 3LCUA 5E6JA 5FSWA 4LJ8A 1YLAA 4OVZA 1PRBA 2EUCA 4BLCA 2LHCA 4IJEA 1IN6A 3MMPA 4TUWA 3C3EA 3L25A 2L4EA 3MHVC 2L6OA 2LBCA 1QANA 4KHPM 3W0FA 1WR1B 4OU7A 1H6UA 4LCBA 1G59A 1KFVA 2C99A 2EKFA 3PNYA 2MJ5B 1IXSB 4LJ4A 1K82A 4B3SM 5EJCA 3DZDA 4IBJA 4RKUF 2I7NA 1Z5BA 3H4JA 3GLGE 1HNZM 2K9DA 3J7BA 1JB0F 4L4UA 2BJVA 1GLNA 4LJ9A 1J5EM 1FJGM 2UXDM 1TTEA 2GNOA 2L2DA 4FCWA 4WW0A 3GO8A 2JZ0A 1AIPC 1G3IA 2Y20A 3KS8A 5ITRA 3OTOM 1J7KA 2DAEA 3J80S 3RFWA 2D7EA 5KQDA 3U61A 4IJFA 1L2BA 2XH9A 3KSXA 1CUKA 4LF4M 3NBIA 3WHKA 3KDSE 2F5OA 1QAOA 1ZV1A 2G8LA 3AOEC 3I04M 1XC8A 1VG5A 2K6BA 4XK8F 2QZ4A 2HWJA 3U6PA 4MGKE 4JI0M 2Z8YM 4MB7A 5ITYA 5FTLA 3HX3A 3GLIA 3U6LA 2AHMA 2E5LM 1Q3CA 2KDLA 4GITA 4W5WA 1R5LA 1ZAEA 3SBJA 2RRUA 3I01M 2DI0A 2LXEA 1RU3A 4ANRA 3E9SA 1SXJA 2K0BX 3FE3A 4LF9M 1GL7A 3HJ8A 2B3TA 4LZJA 4X64M 3UZUA 2FS1A 1VQ1A 3FUTA 4I81A 4Z8XA 4NSOB 3GQ3A 4QNRA 3C58A 1NJFA 3LVWA 2O25A 1QVRA 2N35A 2JY8A 2WSCF 3GRUA 3GRYA 4G6ZA 2DZLA 2R46A 1IBKM 1OAOC 2EKKA 1V92A 1JR3D 1WHCA 2ZM6M 2LVQD 4KLNA 3HY5A 3IG8A 1NJGA 2CV0A 1GJSA 4AI6A 4NXMM 1IN7A 3FKEA 4JV5M 2XF3A 4RF1A 1IN8A 3HHYA 1NNJA 5DFLA 1C1KA 1N78A 1IFYA 3IECA 3HU3A 1E32A 2UXCM 1LV7A 3VDPA 1FNNA 1XXHE 1Q39A 3GRRA 3C9PA 1IBMM 2XEPA 1PJTA 2FE8A 3VFDA 5ITQA 3GPYA 1Z59A 1Y8GA 3U60A 2APLA 1TR8A 2CFOA 3U5ZB 4PDGA 1R2YA 4DR5M 3T6PA 4L15A 4D80A 4PCZA 3PFIA 2DZOB 4WP2A 1I4WA 2ZAMA 2C5RA 3FD9A 3AOEA 3K9OA 1LTMA 4B3RM 1GKIA 2KRUA 3CF0A 2L7IA 2LVOC 1TH4A 2DZNB 3T1YM 1D0KA 1IXSA 2V1CA 2I7PA 3M6AA 5BPVA 4LJAA 3FYCA 3F92A 2GQFA 5F3WA 2FH0A 1N36M 1ZMWA 4M9SA 3VDUA 3PVSA 2LVPC 2WSFF 3I4VA 1EFUB 2WZJA 2CRUA 1EE8A 3JR4A 2CHVA 4R71A 5FTNA 3A98B 2Z4SA 2Z4RA 3NBXX 1OQYA 2G3QA 2CHGA 1QAMA 2J7NA 3J7AS 4IBGA 4HLQA 4L78A 2LH0A 3SARA 4NRVA 4LFAM 4GRIA 3U6EA 1Z5AA 2YQZA 3FUXA 2CE7A 5IT9S 4JI6M 3KOZE 2BWEA 4DR3M 4G4OA 4QOZC 5ITUA 4LF7M 1MJGM 4GC9A 2LHGA 2KA6B 4CISA 1L2DA 2ZAOA 2JNHA 3BBZA 1JR3A 2DWMA 4DUZM 2CV1A 1QUSA 2RGHA 1WXQA 2VQEM 4LRSA 2R44A 3EIHA 4FW9A 4X65M 4M9XA 4Q7JA 1DO0A 2HCBA 3B74A 4I5SA 3GQ4A 4JI2M 5EQTA 5FTJA 2ZBKB 3U60B 2X4AA 2DXIA 1TH2A 3TPZA 4GIPA 1UFZA 3CGWA 1XMOM 4Z6YA 2L09A 3AKZA 4CIZA 3HU1A 4DV5M 3GLHB 4AKIA 4L8RC 3PXGA 3UK6A 3QAUA 3UGJA 2R65A 1AUAA 1DGHB 3M7GA 3B7ZA 2ZTDA 3IHPA 4JN6A 3SMSA 2DAMA 4DV0M 4AQYM 3CF6E 2BWBA 3H4MA 5EP4A 2VQFM 3K8ZA 3QWLA 3LCVB 1TGUA 4F1IA 2KZSA 3U5ZA 3HWSA 3L27A 4DR4M 3KFUG 2DWNA 2QCUA 2OQ4A 1HJPA 1ZMVA 2H5XA 3TWKA 1OAIA 4JYAM 4D82A 4AKHA 4QHSA 2QPAA 2WSEF 3FUUA 1T43A 1L1ZA 4DR2M 3QYEA 4B3MM 3KS4A 3A46A 1QQWA 3KOWE 2FFJA 4KT0F 3AJIB 1KSFX 5JI3E 2V1UA 2HKJA 1XB2B 4FVMA 4JI8M 4G4QA 5DYIA 3KOXE 1UM8A 3K9PA 4MGZE 5LMNM 1NSFA 1OJLA 3GPXA 1NY5A 3R8FA 4AG6A 3T15A 3HJSA 3RGSA 2ZANA 4XGIA 2EA0A 1QZMA 4DV4M 1QAQA 4M0DA 2OOBA 3GLIE 4LF6M 1MX0A 4MGHA 1PJJA 2DKLA 3RE8A 3GLFB 2QHOB 3FRIA 3LW5F 5FTKA 1SXJE 4MGYE 4AG5A 1D0MA 2F5PA 2O5RA 4AKGA 3TE6A 3AV0A 4JI1M 1TH3A 3VKGA 1X37A 1MU5A 3E46A 2ZTCA 4DR1M 1TDHA 2KNAA 2CP8A 3HHXA 3ZH9B 3JAMS 1SG9A 2Y21A 4DR6M 3MK6A 1D0LA 3EIEA 2C96A 4YY3M 2JA2A 4GHAA 4DBGB 2EO2A 2O01F 2R4JA 1NV8A 4NL4H 3HKPA 1HNWM 1G8PA 4B08A 4X62M 4P16A 1V33A 1VDDA 3TL4X 3Q8XA 3VLFB 3K92A 4BBAA 4LJ5A 2QENA 4IBKA 2Z3XA 1OIZA 3SAWA 1GVNA 3GLHA 5ITXA 5FTMA 4G4NA 1XWIA 1C7YA 3GLGB 1DGHA 2BJWA 2J5YA 2DENA 3CTWB 2R45A 3GRVA 2QBYB 2DNAA 3HU2A 2XFSA 5H37D 4NOOB 1BVSA 1KYIA 3KP1E 3DOAA 1Z6TA 3J27B 3SHFA 1N77A 4DV3M 2D7HA 2DVWB 3AOGA 5KO3A 2A5YB 4LFBM 1HT2E 3HHZA 4RNAA 1HR0M 1IY2A 4OX9M 4NRWA 3J81S 1MN3A 1YE9A 3KXEC 4B3TM 2KNVA 4KODA 2VIIA 3AFHA 1G71A 1XNQM 1DV0A 2F4VM 1E9SA 1QUTA 3FRHA 1QZEA 2LNHC 3CF2A 3B7NA 3T38A 1PM5A 5LMUM 1L1TA 4OW0A 2HL7A 4FWHA 4R7GA 5DYGA 1GJTA 4GKKM 1VEJA 2VDBB 1IXZA 3D8LA 2XZUA 2JY6B 2P5TA 4F2LA 1V34A 2C9CA 2F5QA 1YSYA 2FOIC 2K47A 2MGWA 2NQ8C 2UUCM 2XZFA 5FLXS 3GLFA 1G41A 1GO5A 4MH0E 2YR0A 3BOSA 4FD2A 2DHYA 1NNUC 1JR3E 4LFCM 4EIWA 4G3OA 4ZPXA 3TWMA 3SAUA 3RGPA 1T3TA 1K3XA 1XXHB 4GEWA 4AZFA 3E21A 3J2PB 2QQ8A 3KVWA 3THGA 4HEOA 4LGYA 5GKNA 4D81A 1QDTA 5DNYA 3U6QA 3L2AA 4UN2B 2JXNA 5A2QS 5EXTA 1OFHA 4PT5A 1PJIA 2MROB 3VKHA 2CUZA 1A5TA 1T6OA 2OOAA 3BXWA 2DWZB 2JP7A 4IBCA 4B7HA 2H1RA 4FCTA 4I8OA 1OTRA 1PJQA 1IXRC 5C1BA 3U6DA 3ZC7B 1XMQM 1TDZA 4GKJM 2DAKA 3SYLA 1VDLA 2M5ZA 2V6ZM 3V76A 2HHHM 1R6BX 3A42A 3UMMA 5IWAM 2EJSA 3KOYE 1W5TA 2Q2EB 2KXEA 2R4EA 1DGBA 5KPTA 3U6OA 3VK7A 3GLGA 3SYKA 1Z5CA 1GL6A 4RF0A 3JR5A 2L4FA 3K1JA 4X66M 2JY5A 5C18A 1K3WA 2QBYA 3T1HM 4Y28F 4DR7M 1IN4A 3HGIA 1IQPA 2KZUA 3B9PA 4IBDA 3SC3A 4DV6M 1L2CA 3VK8A 4GMQA 1NHWC 1PGYA 3L28A 4IBFA 2J7OA 1XHBA 3HJQA 4QHTA 2D7GA 4JI5M 1HNXM 2F5NA 5EXXA 1NV9A 5E26A 4L16A 2KHHA 1N32M 2CWBA 4M0WA 3SASA 1EIJA 1OFIA 4FCVA 4IBBA 3SHGB 4CJ6A 2DAIA 2RKOA 3LQQA 3LVVA 5JI2E 1DGFA 3TWLA 4DV2M 5EP3A 3W67A 2JWSA 1GABA 3D8BA 4P17A 3HZJA 5KPRA 4FWGA 5IREB 1N34M 3R9XB 1F4IA 2XGNA 4FWDA 2L7HA 8CATA 3FUWA 2XSZD 3L29A 3KW6A 3DA1A 1HT1E 2QNJA 4PDIA 1OIPA 4KO8A 5EP1A 2LVAA 4B7GA 4DV1M 3I4YA 3SAVA 3AL0C 1J09A 1YUBA 2FNAA 2JY7A 2CEAA 1IY1A 3IG5A 2W82A 1NY6A 3SATA 2UXBM 3Q8GA 4QOSA 4IBIA 2RGOA 2C98A 3KSJA 4LY6A 3GPPA 4I4LA 4LGMA 4REZA 2QSFX 3E4RA 4OVZB 1D2NA 2CHQA 1XXHA 5EP2A 1DO2A 1Q02A 2LWXA 3C3DA 1R4GA 1OKSA 3K2LA 3PNVA 4CHTB 2VF8A 2DWLA 3FUVA 3LMMA 2UUBM 4K0KM 2CV2A 4LG2A 4IBEA 4DV7M 1ORYB 2KRKA 3FTEA 4MM3B 2M60A 2OPFA 1N33M 3SMPA 2KNZA 3LQRA 2JUJA 3WHLA 7CATA 3GLHE 1QYRA 2X8AA 5ITXE 4LJ7A 3GPUA 1ZQ9A 1R7RA 1HQYE 2KW0A 4HL4A 4S12A 3SFZA 2XLJA 3M0EA 1WIVA 2DAGA
chains in the Genus database with same CATH topology
3U6SA 4LRTA 3FTCA 3U61B 2Y0TA 5KPZA 4A3VB 4LZZA 3FYDA 2C9OA 1XNRM 2QP9X 1IBLM 1R2ZA 4GHLA 4JI3M 1E94E 4B7FA 2R62A 4LJ6A 2X49A 3MJ5A 3HHWA 1JQJC 2F5SA 4WURA 5EXSA 4CGYB 4ITQA 1S3SA 4QNMA 5IZ7D 2G5GX 4NXNM 4GH9A 3GLIB 1NVMA 3TQSA 4R3DA 2XSZA 1DGGA 4M9ZA 2Z7JA 3W0LB 2UUAM 1HQCA 3UJNA 1SXJB 1E9RA 4NSRA 2YNMD 2KEBA 4GC5A 3NWLA 5EXPA 1IY0A 1NHGC 4LF8M 3GQ5A 3DFZA 4JI7M 3FTFA 3ZCBB 3GP1A 5KQ8A 4PD2A 1IM2A 2ERCA 3FTDA 1G4AE 4II7A 3L26A 5ITTA 4G4RA 4JXJA 3A45A 2R18A 4LF5M 3U6CA 3KP0E 1SXJD 4DUYM 1N75A 1Q3BA 4YHHM 4BB9A 1I94M 2DHRA 2UU9M 3ILKA 2YFQA 4XBOA 1L8QA 3I51A 3U6MA 2Y0QA 4IIWA 4AW4A 2UUBM 1IN5A 2XFTA 4JI4M 2BNKA 1SXJC 4MGIE 5BR8M 1W5SA 5E6JA 5FSWA 4LJ8A 4OVZA 2EUCA 4BLCA 4IJEA 1IN6A 4TUWA 3L25A 3MHVC 2L6OA 1QANA 4KHPM 3W0FA 4OU7A 1H6UA 4LCBA 1G59A 1KFVA 2C99A 3PNYA 1IXSB 4LJ4A 1K82A 4B3SM 5EJCA 3DZDA 4IBJA 2I7NA 1Z5BA 1HNZM 3J7BA 4L4UA 2BJVA 1GLNA 4LJ9A 1J5EM 1FJGM 2UXDM 4WW0A 4FCWA 3GO8A 1G3IA 2Y20A 3KS8A 5ITRA 3OTOM 1J7KA 3J80S 3RFWA 2D7EA 5KQDA 3U61A 4IJFA 1L2BA 2XH9A 3KSXA 4LF4M 3NBIA 3WHKA 3KDSE 2F5OA 1QAOA 2G8LA 3AOEC 1XC8A 2QZ4A 3U6PA 4MGKE 4JI0M 5FTLA 4MB7A 5ITYA 3GLIA 3U6LA 2AHMA 2E5LM 1Q3CA 4GITA 4W5WA 1ZAEA 3SBJA 2LXEA 3E9SA 1SXJA 4LF9M 1GL7A 3HJ8A 4LZJA 4X64M 3UZUA 3FUTA 4I81A 3GQ3A 4Z8XA 4NSOB 3C58A 4QNRA 1NJFA 3LVWA 1QVRA 3GRUA 3GRYA 4G6ZA 2R46A 1IBKM 1JR3D 2ZM6M 4KLNA 3IG8A 1NJGA 2CV0A 4AI6A 4NXMM 1IN7A 3FKEA 4JV5M 2XF3A 4RF1A 1IN8A 3HHYA 1NNJA 1C1KA 1N78A 3HU3A 1E32A 2UXCM 1LV7A 3VDPA 1FNNA 1Q39A 3GRRA 1IBMM 2XEPA 2FE8A 3VFDA 5ITQA 3GPYA 1Z59A 3U60A 2CFOA 3U5ZB 4PDGA 1R2YA 4DR5M 4L15A 4D80A 4PCZA 3PFIA 2DZOB 1I4WA 2ZAMA 2C5RA 3FD9A 3AOEA 4B3RM 1GKIA 2KRUA 3CF0A 2L7IA 3T1YM 1TH4A 2DZNB 5BPVA 2V1CA 2I7PA 3M6AA 4LJAA 3FYCA 5F3WA 1N36M 4M9SA 3VDUA 3PVSA 3I4VA 1EE8A 3JR4A 2CHVA 5FTNA 3A98B 2Z4SA 2Z4RA 2J7NA 2CHGA 1QAMA 3J7AS 4IBGA 4HLQA 4L78A 2LH0A 3SARA 4NRVA 4LFAM 4GRIA 3U6EA 1Z5AA 2YQZA 3FUXA 2CE7A 5IT9S 4JI6M 3KOZE 4DR3M 4G4OA 4QOZC 5ITUA 4LF7M 4GC9A 2KA6B 4CISA 1L2DA 2ZAOA 1JR3A 2DWMA 4DUZM 2CV1A 2RGHA 1WXQA 2VQEM 4LRSA 3EIHA 4FW9A 4X65M 4M9XA 1DO0A 2HCBA 4I5SA 3GQ4A 4JI2M 5EQTA 5FTJA 2ZBKB 3U60B 2X4AA 2DXIA 1TH2A 3TPZA 4GIPA 1XMOM 4Z6YA 2L09A 3AKZA 3HU1A 4DV5M 3GLHB 4AKIA 4L8RC 3PXGA 3UK6A 3QAUA 3UGJA 2R65A 1DGHB 3M7GA 4JN6A 3SMSA 4DV0M 4AQYM 3CF6E 3H4MA 5EP4A 2VQFM 3K8ZA 3QWLA 1TGUA 2KZSA 3U5ZA 3HWSA 3L27A 4DR4M 3KFUG 2DWNA 2QCUA 2OQ4A 4AKHA 3TWKA 4JYAM 4D82A 4QHSA 2QPAA 3FUUA 1L1ZA 4DR2M 4B3MM 3KS4A 3A46A 1QQWA 3KOWE 2FFJA 3AJIB 1KSFX 5JI3E 2V1UA 2HKJA 4FVMA 4JI8M 4G4QA 5DYIA 3KOXE 1UM8A 4MGZE 5LMNM 1NSFA 1OJLA 3GPXA 1NY5A 3R8FA 4AG6A 3T15A 3HJSA 3RGSA 2ZANA 4XGIA 2EA0A 1QZMA 4DV4M 1QAQA 4M0DA 4LF6M 1MX0A 4MGHA 1PJJA 3RE8A 3GLFB 5FTKA 1SXJE 4MGYE 4AG5A 2F5PA 2O5RA 4AKGA 3TE6A 3AV0A 4JI1M 1TH3A 3VKGA 1X37A 1MU5A 4DR1M 1TDHA 3HHXA 3ZH9B 3JAMS 2Y21A 4DR6M 3MK6A 3EIEA 2C96A 4YY3M 2JA2A 4GHAA 2EO2A 2R4JA 4NL4H 3HKPA 1HNWM 1G8PA 4B08A 4X62M 4P16A 1VDDA 3TL4X 3Q8XA 3VLFB 3K92A 4BBAA 4LJ5A 2QENA 4IBKA 2Z3XA 3SAWA 1GVNA 3GLHA 5ITXA 5FTMA 4G4NA 1XWIA 3GLGB 1DGHA 2BJWA 3CTWB 2R45A 3GRVA 2QBYB 3HU2A 2XFSA 5H37D 4NOOB 1KYIA 3KP1E 3DOAA 1Z6TA 3J27B 3SHFA 1N77A 4DV3M 2D7HA 2DVWB 3AOGA 5KO3A 2A5YB 4LFBM 1HT2E 3HHZA 4RNAA 1HR0M 1IY2A 4OX9M 4NRWA 3J81S 1YE9A 3KXEC 4B3TM 4KODA 2VIIA 3AFHA 1XNQM 2F4VM 1E9SA 2LNHC 3CF2A 3T38A 1PM5A 5LMUM 1L1TA 4OW0A 2HL7A 4FWHA 4R7GA 5DYGA 4GKKM 1IXZA 3D8LA 2XZUA 2P5TA 2C9CA 2F5QA 1YSYA 2FOIC 2K47A 2NQ8C 2UUCM 2XZFA 5FLXS 3GLFA 1G41A 4MH0E 3BOSA 2YR0A 4FD2A 1NNUC 4LFCM 4EIWA 4ZPXA 3TWMA 3SAUA 3RGPA 1T3TA 1K3XA 1XXHB 4AZFA 3J2PB 3KVWA 3THGA 4LGYA 5GKNA 4D81A 5DNYA 3U6QA 3L2AA 5A2QS 5EXTA 1OFHA 4PT5A 1PJIA 3VKHA 2CUZA 2DWZB 4B7HA 4IBCA 2H1RA 4FCTA 4I8OA 5C1BA 1IXRC 3U6DA 3ZC7B 1XMQM 1TDZA 4GKJM 3SYLA 2M5ZA 2V6ZM 2HHHM 1R6BX 3A42A 3UMMA 5IWAM 3KOYE 1W5TA 2Q2EB 2KXEA 2R4EA 1DGBA 5KPTA 3U6OA 3VK7A 3GLGA 3SYKA 1Z5CA 1GL6A 4RF0A 3JR5A 3K1JA 4X66M 2QBYA 5C18A 1K3WA 3T1HM 4DR7M 3HGIA 1IN4A 1IQPA 2KZUA 3B9PA 4IBDA 3SC3A 4DV6M 1L2CA 3VK8A 4GMQA 1NHWC 3L28A 4IBFA 2J7OA 1XHBA 3HJQA 4QHTA 2D7GA 4JI5M 1HNXM 2F5NA 5EXXA 5E26A 4L16A 1N32M 4M0WA 3SASA 1OFIA 4FCVA 4IBBA 3SHGB 2RKOA 3LQQA 3LVVA 5JI2E 1DGFA 3TWLA 4DV2M 5EP3A 3D8BA 5KPRA 4FWGA 5IREB 1N34M 3R9XB 2XGNA 4FWDA 2L7HA 8CATA 3FUWA 2XSZD 3L29A 3KW6A 3DA1A 1HT1E 4PDIA 4KO8A 5EP1A 4B7GA 4DV1M 3SAVA 3I4YA 3AL0C 1J09A 1YUBA 2FNAA 2CEAA 1IY1A 3IG5A 2W82A 1NY6A 3SATA 2UXBM 4QOSA 4IBIA 2RGOA 2C98A 3KSJA 4LY6A 3GPPA 4I4LA 4LGMA 4REZA 3E4RA 4OVZB 1D2NA 2CHQA 1XXHA 5EP2A 1DO2A 2LWXA 3K2LA 3PNVA 4CHTB 2DWLA 3FUVA 3LMMA 4K0KM 2CV2A 4LG2A 4IBEA 4DV7M 1ORYB 2KRKA 3FTEA 4MM3B 2M60A 2OPFA 1N33M 3SMPA 3LQRA 3WHLA 7CATA 1QYRA 2X8AA 5ITXE 4LJ7A 3GPUA 1ZQ9A 1R7RA 1HQYE 2KW0A 4HL4A 4S12A 3SFZA 2XLJA 3M0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GIP A; 
#chains in the Genus database with same CATH topology
 1ZMU A;  1WGN A;  2HAK A;  2VF7 A;  3U6S A;  4LRT A;  3FTC A;  3U61 B;  2Y0T A;  3B7Q A;  5KPZ A;  4A3V B;  4LZZ A;  3FYD A;  2C9O A;  1XNR M;  2QP9 X;  1IBL M;  1R2Z A;  1VEK A;  4GHL A;  4JI3 M;  1E94 E;  4B7F A;  2MH8 A;  2R62 A;  4LJ6 A;  3ZQJ A;  2X49 A;  3MJ5 A;  3HHW A;  1JQJ C;  2F5S A;  4WUR A;  5EXS A;  4CGY B;  4ITQ A;  1S3S A;  4QNM A;  5IZ7 D;  2G5G X;  4NXN M;  4GH9 A;  3GLI B;  1NVM A;  3TQS A;  4R3D A;  2XSZ A;  1DGG A;  4M9Z A;  2Z7J A;  3W0L B;  2UUA M;  1HQC A;  3UJN A;  1SXJ B;  2LVN C;  1E9R A;  4NSR A;  2YNM D;  2KEB A;  4GC5 A;  3NWL A;  5EXP A;  1IY0 A;  1NHG C;  1P3Q Q;  1VEG A;  3GQ5 A;  4LF8 M;  1TF0 B;  3DFZ A;  4JI7 M;  3FTF A;  4NC6 A;  3ZCB B;  3GP1 A;  2R0I A;  5KQ8 A;  4PD2 A;  1IM2 A;  2ERC A;  2OO9 A;  1G4A E;  3B89 A;  3FTD A;  3QYB A;  4II7 A;  5ITT A;  3L26 A;  4JXJ A;  4G4R A;  1WGL A;  3A45 A;  2R18 A;  4LF5 M;  3U6C A;  1NO1 A;  1SXJ D;  2JZ1 A;  3KP0 E;  1PJS A;  4DUY M;  1N75 A;  1Q3B A;  3W68 A;  4YHH M;  3GLF E;  4BB9 A;  1I94 M;  2DHR A;  2UU9 M;  3ILK A;  5L8R F;  2YFQ A;  2LTU A;  1L8Q A;  2MR9 A;  2R6F A;  2Y0Q A;  3I51 A;  4IIW A;  4XBO A;  1IN5 A;  2XFT A;  4L6V 6;  4AW4 A;  3U6M A;  1QDR A;  1SXJ C;  2BNK A;  4MGI E;  5BR8 M;  4JI4 M;  1W5S A;  1WJ7 A;  3LCU A;  5E6J A;  5FSW A;  4LJ8 A;  1YLA A;  4OVZ A;  1PRB A;  2EUC A;  4BLC A;  2LHC A;  4IJE A;  1IN6 A;  3MMP A;  4TUW A;  3C3E A;  3L25 A;  2L4E A;  3MHV C;  2L6O A;  2LBC A;  1QAN A;  4KHP M;  3W0F A;  1WR1 B;  4OU7 A;  1H6U A;  4LCB A;  1G59 A;  1KFV A;  2C99 A;  2EKF A;  3PNY A;  2MJ5 B;  1IXS B;  4LJ4 A;  1K82 A;  4B3S M;  5EJC A;  3DZD A;  4IBJ A;  4RKU F;  2I7N A;  1Z5B A;  3H4J A;  3GLG E;  1HNZ M;  2K9D A;  3J7B A;  1JB0 F;  4L4U A;  2BJV A;  1GLN A;  4LJ9 A;  1J5E M;  1FJG M;  2UXD M;  1TTE A;  2GNO A;  2L2D A;  4FCW A;  4WW0 A;  3GO8 A;  2JZ0 A;  1AIP C;  1G3I A;  2Y20 A;  3KS8 A;  5ITR A;  3OTO M;  1J7K A;  2DAE A;  3J80 S;  3RFW A;  2D7E A;  5KQD A;  3U61 A;  4IJF A;  1L2B A;  2XH9 A;  3KSX A;  1CUK A;  4LF4 M;  3NBI A;  3WHK A;  3KDS E;  2F5O A;  1QAO A;  1ZV1 A;  2G8L A;  3AOE C;  3I04 M;  1XC8 A;  1VG5 A;  2K6B A;  4XK8 F;  2QZ4 A;  2HWJ A;  3U6P A;  4MGK E;  4JI0 M;  2Z8Y M;  4MB7 A;  5ITY A;  5FTL A;  3HX3 A;  3GLI A;  3U6L A;  2AHM A;  2E5L M;  1Q3C A;  2KDL A;  4GIT A;  4W5W A;  1R5L A;  1ZAE A;  3SBJ A;  2RRU A;  3I01 M;  2DI0 A;  2LXE A;  1RU3 A;  4ANR A;  3E9S A;  1SXJ A;  2K0B X;  3FE3 A;  4LF9 M;  1GL7 A;  3HJ8 A;  2B3T A;  4LZJ A;  4X64 M;  3UZU A;  2FS1 A;  1VQ1 A;  3FUT A;  4I81 A;  4Z8X A;  4NSO B;  3GQ3 A;  4QNR A;  3C58 A;  1NJF A;  3LVW A;  2O25 A;  1QVR A;  2N35 A;  2JY8 A;  2WSC F;  3GRU A;  3GRY A;  4G6Z A;  2DZL A;  2R46 A;  1IBK M;  1OAO C;  2EKK A;  1V92 A;  1JR3 D;  1WHC A;  2ZM6 M;  2LVQ D;  4KLN A;  3HY5 A;  3IG8 A;  1NJG A;  2CV0 A;  1GJS A;  4AI6 A;  4NXM M;  1IN7 A;  3FKE A;  4JV5 M;  2XF3 A;  4RF1 A;  1IN8 A;  3HHY A;  1NNJ A;  5DFL A;  1C1K A;  1N78 A;  1IFY A;  3IEC A;  3HU3 A;  1E32 A;  2UXC M;  1LV7 A;  3VDP A;  1FNN A;  1XXH E;  1Q39 A;  3GRR A;  3C9P A;  1IBM M;  2XEP A;  1PJT A;  2FE8 A;  3VFD A;  5ITQ A;  3GPY A;  1Z59 A;  1Y8G A;  3U60 A;  2APL A;  1TR8 A;  2CFO A;  3U5Z B;  4PDG A;  1R2Y A;  4DR5 M;  3T6P A;  4L15 A;  4D80 A;  4PCZ A;  3PFI A;  2DZO B;  4WP2 A;  1I4W A;  2ZAM A;  2C5R A;  3FD9 A;  3AOE A;  3K9O A;  1LTM A;  4B3R M;  1GKI A;  2KRU A;  3CF0 A;  2L7I A;  2LVO C;  1TH4 A;  2DZN B;  3T1Y M;  1D0K A;  1IXS A;  2V1C A;  2I7P A;  3M6A A;  5BPV A;  4LJA A;  3FYC A;  3F92 A;  2GQF A;  5F3W A;  2FH0 A;  1N36 M;  1ZMW A;  4M9S A;  3VDU A;  3PVS A;  2LVP C;  2WSF F;  3I4V A;  1EFU B;  2WZJ A;  2CRU A;  1EE8 A;  3JR4 A;  2CHV A;  4R71 A;  5FTN A;  3A98 B;  2Z4S A;  2Z4R A;  3NBX X;  1OQY A;  2G3Q A;  2CHG A;  1QAM A;  2J7N A;  3J7A S;  4IBG A;  4HLQ A;  4L78 A;  2LH0 A;  3SAR A;  4NRV A;  4LFA M;  4GRI A;  3U6E A;  1Z5A A;  2YQZ A;  3FUX A;  2CE7 A;  5IT9 S;  4JI6 M;  3KOZ E;  2BWE A;  4DR3 M;  4G4O A;  4QOZ C;  5ITU A;  4LF7 M;  1MJG M;  4GC9 A;  2LHG A;  2KA6 B;  4CIS A;  1L2D A;  2ZAO A;  2JNH A;  3BBZ A;  1JR3 A;  2DWM A;  4DUZ M;  2CV1 A;  1QUS A;  2RGH A;  1WXQ A;  2VQE M;  4LRS A;  2R44 A;  3EIH A;  4FW9 A;  4X65 M;  4M9X A;  4Q7J A;  1DO0 A;  2HCB A;  3B74 A;  4I5S A;  3GQ4 A;  4JI2 M;  5EQT A;  5FTJ A;  2ZBK B;  3U60 B;  2X4A A;  2DXI A;  1TH2 A;  3TPZ A;  4GIP A;  1UFZ A;  3CGW A;  1XMO M;  4Z6Y A;  2L09 A;  3AKZ A;  4CIZ A;  3HU1 A;  4DV5 M;  3GLH B;  4AKI A;  4L8R C;  3PXG A;  3UK6 A;  3QAU A;  3UGJ A;  2R65 A;  1AUA A;  1DGH B;  3M7G A;  3B7Z A;  2ZTD A;  3IHP A;  4JN6 A;  3SMS A;  2DAM A;  4DV0 M;  4AQY M;  3CF6 E;  2BWB A;  3H4M A;  5EP4 A;  2VQF M;  3K8Z A;  3QWL A;  3LCV B;  1TGU A;  4F1I A;  2KZS A;  3U5Z A;  3HWS A;  3L27 A;  4DR4 M;  3KFU G;  2DWN A;  2QCU A;  2OQ4 A;  1HJP A;  1ZMV A;  2H5X A;  3TWK A;  1OAI A;  4JYA M;  4D82 A;  4AKH A;  4QHS A;  2QPA A;  2WSE F;  3FUU A;  1T43 A;  1L1Z A;  4DR2 M;  3QYE A;  4B3M M;  3KS4 A;  3A46 A;  1QQW A;  3KOW E;  2FFJ A;  4KT0 F;  3AJI B;  1KSF X;  5JI3 E;  2V1U A;  2HKJ A;  1XB2 B;  4FVM A;  4JI8 M;  4G4Q A;  5DYI A;  3KOX E;  1UM8 A;  3K9P A;  4MGZ E;  5LMN M;  1NSF A;  1OJL A;  3GPX A;  1NY5 A;  3R8F A;  4AG6 A;  3T15 A;  3HJS A;  3RGS A;  2ZAN A;  4XGI A;  2EA0 A;  1QZM A;  4DV4 M;  1QAQ A;  4M0D A;  2OOB A;  3GLI E;  4LF6 M;  1MX0 A;  4MGH A;  1PJJ A;  2DKL A;  3RE8 A;  3GLF B;  2QHO B;  3FRI A;  3LW5 F;  5FTK A;  1SXJ E;  4MGY E;  4AG5 A;  1D0M A;  2F5P A;  2O5R A;  4AKG A;  3TE6 A;  3AV0 A;  4JI1 M;  1TH3 A;  3VKG A;  1X37 A;  1MU5 A;  3E46 A;  2ZTC A;  4DR1 M;  1TDH A;  2KNA A;  2CP8 A;  3HHX A;  3ZH9 B;  3JAM S;  1SG9 A;  2Y21 A;  4DR6 M;  3MK6 A;  1D0L A;  3EIE A;  2C96 A;  4YY3 M;  2JA2 A;  4GHA A;  4DBG B;  2EO2 A;  2O01 F;  2R4J A;  1NV8 A;  4NL4 H;  3HKP A;  1HNW M;  1G8P A;  4B08 A;  4X62 M;  4P16 A;  1V33 A;  1VDD A;  3TL4 X;  3Q8X A;  3VLF B;  3K92 A;  4BBA A;  4LJ5 A;  2QEN A;  4IBK A;  2Z3X A;  1OIZ A;  3SAW A;  1GVN A;  3GLH A;  5ITX A;  5FTM A;  4G4N A;  1XWI A;  1C7Y A;  3GLG B;  1DGH A;  2BJW A;  2J5Y A;  2DEN A;  3CTW B;  2R45 A;  3GRV A;  2QBY B;  2DNA A;  3HU2 A;  2XFS A;  5H37 D;  4NOO B;  1BVS A;  1KYI A;  3KP1 E;  3DOA A;  1Z6T A;  3J27 B;  3SHF A;  1N77 A;  4DV3 M;  2D7H A;  2DVW B;  3AOG A;  5KO3 A;  2A5Y B;  4LFB M;  1HT2 E;  3HHZ A;  4RNA A;  1HR0 M;  1IY2 A;  4OX9 M;  4NRW A;  3J81 S;  1MN3 A;  1YE9 A;  3KXE C;  4B3T M;  2KNV A;  4KOD A;  2VII A;  3AFH A;  1G71 A;  1XNQ M;  1DV0 A;  2F4V M;  1E9S A;  1QUT A;  3FRH A;  1QZE A;  2LNH C;  3CF2 A;  3B7N A;  3T38 A;  1PM5 A;  5LMU M;  1L1T A;  4OW0 A;  2HL7 A;  4FWH A;  4R7G A;  5DYG A;  1GJT A;  4GKK M;  1VEJ A;  2VDB B;  1IXZ A;  3D8L A;  2XZU A;  2JY6 B;  2P5T A;  4F2L A;  1V34 A;  2C9C A;  2F5Q A;  1YSY A;  2FOI C;  2K47 A;  2MGW A;  2NQ8 C;  2UUC M;  2XZF A;  5FLX S;  3GLF A;  1G41 A;  1GO5 A;  4MH0 E;  2YR0 A;  3BOS A;  4FD2 A;  2DHY A;  1NNU C;  1JR3 E;  4LFC M;  4EIW A;  4G3O A;  4ZPX A;  3TWM A;  3SAU A;  3RGP A;  1T3T A;  1K3X A;  1XXH B;  4GEW A;  4AZF A;  3E21 A;  3J2P B;  2QQ8 A;  3KVW A;  3THG A;  4HEO A;  4LGY A;  5GKN A;  4D81 A;  1QDT A;  5DNY A;  3U6Q A;  3L2A A;  4UN2 B;  2JXN A;  5A2Q S;  5EXT A;  1OFH A;  4PT5 A;  1PJI A;  2MRO B;  3VKH A;  2CUZ A;  1A5T A;  1T6O A;  2OOA A;  3BXW A;  2DWZ B;  2JP7 A;  4IBC A;  4B7H A;  2H1R A;  4FCT A;  4I8O A;  1OTR A;  1PJQ A;  1IXR C;  5C1B A;  3U6D A;  3ZC7 B;  1XMQ M;  1TDZ A;  4GKJ M;  2DAK A;  3SYL A;  1VDL A;  2M5Z A;  2V6Z M;  3V76 A;  2HHH M;  1R6B X;  3A42 A;  3UMM A;  5IWA M;  2EJS A;  3KOY E;  1W5T A;  2Q2E B;  2KXE A;  2R4E A;  1DGB A;  5KPT A;  3U6O A;  3VK7 A;  3GLG A;  3SYK A;  1Z5C A;  1GL6 A;  4RF0 A;  3JR5 A;  2L4F A;  3K1J A;  4X66 M;  2JY5 A;  5C18 A;  1K3W A;  2QBY A;  3T1H M;  4Y28 F;  4DR7 M;  1IN4 A;  3HGI A;  1IQP A;  2KZU A;  3B9P A;  4IBD A;  3SC3 A;  4DV6 M;  1L2C A;  3VK8 A;  4GMQ A;  1NHW C;  1PGY A;  3L28 A;  4IBF A;  2J7O A;  1XHB A;  3HJQ A;  4QHT A;  2D7G A;  4JI5 M;  1HNX M;  2F5N A;  5EXX A;  1NV9 A;  5E26 A;  4L16 A;  2KHH A;  1N32 M;  2CWB A;  4M0W A;  3SAS A;  1EIJ A;  1OFI A;  4FCV A;  4IBB A;  3SHG B;  4CJ6 A;  2DAI A;  2RKO A;  3LQQ A;  3LVV A;  5JI2 E;  1DGF A;  3TWL A;  4DV2 M;  5EP3 A;  3W67 A;  2JWS A;  1GAB A;  3D8B A;  4P17 A;  3HZJ A;  5KPR A;  4FWG A;  5IRE B;  1N34 M;  3R9X B;  1F4I A;  2XGN A;  4FWD A;  2L7H A;  8CAT A;  3FUW A;  2XSZ D;  3L29 A;  3KW6 A;  3DA1 A;  1HT1 E;  2QNJ A;  4PDI A;  1OIP A;  4KO8 A;  5EP1 A;  2LVA A;  4B7G A;  4DV1 M;  3I4Y A;  3SAV A;  3AL0 C;  1J09 A;  1YUB A;  2FNA A;  2JY7 A;  2CEA A;  1IY1 A;  3IG5 A;  2W82 A;  1NY6 A;  3SAT A;  2UXB M;  3Q8G A;  4QOS A;  4IBI A;  2RGO A;  2C98 A;  3KSJ A;  4LY6 A;  3GPP A;  4I4L A;  4LGM A;  4REZ A;  2QSF X;  3E4R A;  4OVZ B;  1D2N A;  2CHQ A;  1XXH A;  5EP2 A;  1DO2 A;  1Q02 A;  2LWX A;  3C3D A;  1R4G A;  1OKS A;  3K2L A;  3PNV A;  4CHT B;  2VF8 A;  2DWL A;  3FUV A;  3LMM A;  2UUB M;  4K0K M;  2CV2 A;  4LG2 A;  4IBE A;  4DV7 M;  1ORY B;  2KRK A;  3FTE A;  4MM3 B;  2M60 A;  2OPF A;  1N33 M;  3SMP A;  2KNZ A;  3LQR A;  2JUJ A;  3WHL A;  7CAT A;  3GLH E;  1QYR A;  2X8A A;  5ITX E;  4LJ7 A;  3GPU A;  1ZQ9 A;  1R7R A;  1HQY E;  2KW0 A;  4HL4 A;  4S12 A;  3SFZ A;  2XLJ A;  3M0E A;  1WIV A;  2DAG A; 
#chains in the Genus database with same CATH homology
 3U6S A;  4LRT A;  3FTC A;  3U61 B;  2Y0T A;  5KPZ A;  4A3V B;  4LZZ A;  3FYD A;  2C9O A;  1XNR M;  2QP9 X;  1IBL M;  1R2Z A;  4GHL A;  4JI3 M;  1E94 E;  4B7F A;  2R62 A;  4LJ6 A;  2X49 A;  3MJ5 A;  3HHW A;  1JQJ C;  2F5S A;  4WUR A;  5EXS A;  4CGY B;  4ITQ A;  1S3S A;  4QNM A;  5IZ7 D;  2G5G X;  4NXN M;  4GH9 A;  3GLI B;  1NVM A;  3TQS A;  4R3D A;  2XSZ A;  1DGG A;  4M9Z A;  2Z7J A;  3W0L B;  2UUA M;  1HQC A;  3UJN A;  1SXJ B;  1E9R A;  4NSR A;  2YNM D;  2KEB A;  4GC5 A;  3NWL A;  5EXP A;  1IY0 A;  1NHG C;  4LF8 M;  3GQ5 A;  3DFZ A;  4JI7 M;  3FTF A;  3ZCB B;  3GP1 A;  5KQ8 A;  4PD2 A;  1IM2 A;  2ERC A;  3FTD A;  1G4A E;  4II7 A;  3L26 A;  5ITT A;  4G4R A;  4JXJ A;  3A45 A;  2R18 A;  4LF5 M;  3U6C A;  3KP0 E;  1SXJ D;  4DUY M;  1N75 A;  1Q3B A;  4YHH M;  4BB9 A;  1I94 M;  2DHR A;  2UU9 M;  3ILK A;  2YFQ A;  4XBO A;  1L8Q A;  3I51 A;  3U6M A;  2Y0Q A;  4IIW A;  4AW4 A;  2UUB M;  1IN5 A;  2XFT A;  4JI4 M;  2BNK A;  1SXJ C;  4MGI E;  5BR8 M;  1W5S A;  5E6J A;  5FSW A;  4LJ8 A;  4OVZ A;  2EUC A;  4BLC A;  4IJE A;  1IN6 A;  4TUW A;  3L25 A;  3MHV C;  2L6O A;  1QAN A;  4KHP M;  3W0F A;  4OU7 A;  1H6U A;  4LCB A;  1G59 A;  1KFV A;  2C99 A;  3PNY A;  1IXS B;  4LJ4 A;  1K82 A;  4B3S M;  5EJC A;  3DZD A;  4IBJ A;  2I7N A;  1Z5B A;  1HNZ M;  3J7B A;  4L4U A;  2BJV A;  1GLN A;  4LJ9 A;  1J5E M;  1FJG M;  2UXD M;  4WW0 A;  4FCW A;  3GO8 A;  1G3I A;  2Y20 A;  3KS8 A;  5ITR A;  3OTO M;  1J7K A;  3J80 S;  3RFW A;  2D7E A;  5KQD A;  3U61 A;  4IJF A;  1L2B A;  2XH9 A;  3KSX A;  4LF4 M;  3NBI A;  3WHK A;  3KDS E;  2F5O A;  1QAO A;  2G8L A;  3AOE C;  1XC8 A;  2QZ4 A;  3U6P A;  4MGK E;  4JI0 M;  5FTL A;  4MB7 A;  5ITY A;  3GLI A;  3U6L A;  2AHM A;  2E5L M;  1Q3C A;  4GIT A;  4W5W A;  1ZAE A;  3SBJ A;  2LXE A;  3E9S A;  1SXJ A;  4LF9 M;  1GL7 A;  3HJ8 A;  4LZJ A;  4X64 M;  3UZU A;  3FUT A;  4I81 A;  3GQ3 A;  4Z8X A;  4NSO B;  3C58 A;  4QNR A;  1NJF A;  3LVW A;  1QVR A;  3GRU A;  3GRY A;  4G6Z A;  2R46 A;  1IBK M;  1JR3 D;  2ZM6 M;  4KLN A;  3IG8 A;  1NJG A;  2CV0 A;  4AI6 A;  4NXM M;  1IN7 A;  3FKE A;  4JV5 M;  2XF3 A;  4RF1 A;  1IN8 A;  3HHY A;  1NNJ A;  1C1K A;  1N78 A;  3HU3 A;  1E32 A;  2UXC M;  1LV7 A;  3VDP A;  1FNN A;  1Q39 A;  3GRR A;  1IBM M;  2XEP A;  2FE8 A;  3VFD A;  5ITQ A;  3GPY A;  1Z59 A;  3U60 A;  2CFO A;  3U5Z B;  4PDG A;  1R2Y A;  4DR5 M;  4L15 A;  4D80 A;  4PCZ A;  3PFI A;  2DZO B;  1I4W A;  2ZAM A;  2C5R A;  3FD9 A;  3AOE A;  4B3R M;  1GKI A;  2KRU A;  3CF0 A;  2L7I A;  3T1Y M;  1TH4 A;  2DZN B;  5BPV A;  2V1C A;  2I7P A;  3M6A A;  4LJA A;  3FYC A;  5F3W A;  1N36 M;  4M9S A;  3VDU A;  3PVS A;  3I4V A;  1EE8 A;  3JR4 A;  2CHV A;  5FTN A;  3A98 B;  2Z4S A;  2Z4R A;  2J7N A;  2CHG A;  1QAM A;  3J7A S;  4IBG A;  4HLQ A;  4L78 A;  2LH0 A;  3SAR A;  4NRV A;  4LFA M;  4GRI A;  3U6E A;  1Z5A A;  2YQZ A;  3FUX A;  2CE7 A;  5IT9 S;  4JI6 M;  3KOZ E;  4DR3 M;  4G4O A;  4QOZ C;  5ITU A;  4LF7 M;  4GC9 A;  2KA6 B;  4CIS A;  1L2D A;  2ZAO A;  1JR3 A;  2DWM A;  4DUZ M;  2CV1 A;  2RGH A;  1WXQ A;  2VQE M;  4LRS A;  3EIH A;  4FW9 A;  4X65 M;  4M9X A;  1DO0 A;  2HCB A;  4I5S A;  3GQ4 A;  4JI2 M;  5EQT A;  5FTJ A;  2ZBK B;  3U60 B;  2X4A A;  2DXI A;  1TH2 A;  3TPZ A;  4GIP A;  1XMO M;  4Z6Y A;  2L09 A;  3AKZ A;  3HU1 A;  4DV5 M;  3GLH B;  4AKI A;  4L8R C;  3PXG A;  3UK6 A;  3QAU A;  3UGJ A;  2R65 A;  1DGH B;  3M7G A;  4JN6 A;  3SMS A;  4DV0 M;  4AQY M;  3CF6 E;  3H4M A;  5EP4 A;  2VQF M;  3K8Z A;  3QWL A;  1TGU A;  2KZS A;  3U5Z A;  3HWS A;  3L27 A;  4DR4 M;  3KFU G;  2DWN A;  2QCU A;  2OQ4 A;  4AKH A;  3TWK A;  4JYA M;  4D82 A;  4QHS A;  2QPA A;  3FUU A;  1L1Z A;  4DR2 M;  4B3M M;  3KS4 A;  3A46 A;  1QQW A;  3KOW E;  2FFJ A;  3AJI B;  1KSF X;  5JI3 E;  2V1U A;  2HKJ A;  4FVM A;  4JI8 M;  4G4Q A;  5DYI A;  3KOX E;  1UM8 A;  4MGZ E;  5LMN M;  1NSF A;  1OJL A;  3GPX A;  1NY5 A;  3R8F A;  4AG6 A;  3T15 A;  3HJS A;  3RGS A;  2ZAN A;  4XGI A;  2EA0 A;  1QZM A;  4DV4 M;  1QAQ A;  4M0D A;  4LF6 M;  1MX0 A;  4MGH A;  1PJJ A;  3RE8 A;  3GLF B;  5FTK A;  1SXJ E;  4MGY E;  4AG5 A;  2F5P A;  2O5R A;  4AKG A;  3TE6 A;  3AV0 A;  4JI1 M;  1TH3 A;  3VKG A;  1X37 A;  1MU5 A;  4DR1 M;  1TDH A;  3HHX A;  3ZH9 B;  3JAM S;  2Y21 A;  4DR6 M;  3MK6 A;  3EIE A;  2C96 A;  4YY3 M;  2JA2 A;  4GHA A;  2EO2 A;  2R4J A;  4NL4 H;  3HKP A;  1HNW M;  1G8P A;  4B08 A;  4X62 M;  4P16 A;  1VDD A;  3TL4 X;  3Q8X A;  3VLF B;  3K92 A;  4BBA A;  4LJ5 A;  2QEN A;  4IBK A;  2Z3X A;  3SAW A;  1GVN A;  3GLH A;  5ITX A;  5FTM A;  4G4N A;  1XWI A;  3GLG B;  1DGH A;  2BJW A;  3CTW B;  2R45 A;  3GRV A;  2QBY B;  3HU2 A;  2XFS A;  5H37 D;  4NOO B;  1KYI A;  3KP1 E;  3DOA A;  1Z6T A;  3J27 B;  3SHF A;  1N77 A;  4DV3 M;  2D7H A;  2DVW B;  3AOG A;  5KO3 A;  2A5Y B;  4LFB M;  1HT2 E;  3HHZ A;  4RNA A;  1HR0 M;  1IY2 A;  4OX9 M;  4NRW A;  3J81 S;  1YE9 A;  3KXE C;  4B3T M;  4KOD A;  2VII A;  3AFH A;  1XNQ M;  2F4V M;  1E9S A;  2LNH C;  3CF2 A;  3T38 A;  1PM5 A;  5LMU M;  1L1T A;  4OW0 A;  2HL7 A;  4FWH A;  4R7G A;  5DYG A;  4GKK M;  1IXZ A;  3D8L A;  2XZU A;  2P5T A;  2C9C A;  2F5Q A;  1YSY A;  2FOI C;  2K47 A;  2NQ8 C;  2UUC M;  2XZF A;  5FLX S;  3GLF A;  1G41 A;  4MH0 E;  3BOS A;  2YR0 A;  4FD2 A;  1NNU C;  4LFC M;  4EIW A;  4ZPX A;  3TWM A;  3SAU A;  3RGP A;  1T3T A;  1K3X A;  1XXH B;  4AZF A;  3J2P B;  3KVW A;  3THG A;  4LGY A;  5GKN A;  4D81 A;  5DNY A;  3U6Q A;  3L2A A;  5A2Q S;  5EXT A;  1OFH A;  4PT5 A;  1PJI A;  3VKH A;  2CUZ A;  2DWZ B;  4B7H A;  4IBC A;  2H1R A;  4FCT A;  4I8O A;  5C1B A;  1IXR C;  3U6D A;  3ZC7 B;  1XMQ M;  1TDZ A;  4GKJ M;  3SYL A;  2M5Z A;  2V6Z M;  2HHH M;  1R6B X;  3A42 A;  3UMM A;  5IWA M;  3KOY E;  1W5T A;  2Q2E B;  2KXE A;  2R4E A;  1DGB A;  5KPT A;  3U6O A;  3VK7 A;  3GLG A;  3SYK A;  1Z5C A;  1GL6 A;  4RF0 A;  3JR5 A;  3K1J A;  4X66 M;  2QBY A;  5C18 A;  1K3W A;  3T1H M;  4DR7 M;  3HGI A;  1IN4 A;  1IQP A;  2KZU A;  3B9P A;  4IBD A;  3SC3 A;  4DV6 M;  1L2C A;  3VK8 A;  4GMQ A;  1NHW C;  3L28 A;  4IBF A;  2J7O A;  1XHB A;  3HJQ A;  4QHT A;  2D7G A;  4JI5 M;  1HNX M;  2F5N A;  5EXX A;  5E26 A;  4L16 A;  1N32 M;  4M0W A;  3SAS A;  1OFI A;  4FCV A;  4IBB A;  3SHG B;  2RKO A;  3LQQ A;  3LVV A;  5JI2 E;  1DGF A;  3TWL A;  4DV2 M;  5EP3 A;  3D8B A;  5KPR A;  4FWG A;  5IRE B;  1N34 M;  3R9X B;  2XGN A;  4FWD A;  2L7H A;  8CAT A;  3FUW A;  2XSZ D;  3L29 A;  3KW6 A;  3DA1 A;  1HT1 E;  4PDI A;  4KO8 A;  5EP1 A;  4B7G A;  4DV1 M;  3SAV A;  3I4Y A;  3AL0 C;  1J09 A;  1YUB A;  2FNA A;  2CEA A;  1IY1 A;  3IG5 A;  2W82 A;  1NY6 A;  3SAT A;  2UXB M;  4QOS A;  4IBI A;  2RGO A;  2C98 A;  3KSJ A;  4LY6 A;  3GPP A;  4I4L A;  4LGM A;  4REZ A;  3E4R A;  4OVZ B;  1D2N A;  2CHQ A;  1XXH A;  5EP2 A;  1DO2 A;  2LWX A;  3K2L A;  3PNV A;  4CHT B;  2DWL A;  3FUV A;  3LMM A;  4K0K M;  2CV2 A;  4LG2 A;  4IBE A;  4DV7 M;  1ORY B;  2KRK A;  3FTE A;  4MM3 B;  2M60 A;  2OPF A;  1N33 M;  3SMP A;  3LQR A;  3WHL A;  7CAT A;  1QYR A;  2X8A A;  5ITX E;  4LJ7 A;  3GPU A;  1ZQ9 A;  1R7R A;  1HQY E;  2KW0 A;  4HL4 A;  4S12 A;  3SFZ A;  2XLJ A;  3M0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...