4LJ4A

Clpb nbd2 from t. thermophilus, nucleotide-free
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
332
structure length
319
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGEEKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
total genus 101
structure length 319
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj4A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj4A01
1NN0A 1ZJ6A 3K09C 3NHBA 4BEJA 1JALA 1ZUNB 2NO6A 2W2XA 1W4AA 4V0NA 2LWIA 1H8HD 2EQBA 3HYTA 4Q1BA 4D81A 1A2BA 4QKQA 2XOKA 1XZPA 4MGIR 2VA8A 1ODFA 4ZI3A 2AD1A 1EWRA 2FN4A 3I5XA 1GILA 2D2EA 5GJVC 3LLUA 1E4YA 2RH5A 2EWWA 1BKDR 1KY3A 3RRMA 4NH0A 2Z43A 3ZZ0A 1FFHA 1KI6B 4HUQB 1G3IA 4FMDB 2QNRA 5BW8A 3LH5A 3LD9A 4B71A 2QTFA 2FSFA 3ZS8A 4EJSA 2R6AA 3AH8A 2H8KA 4QGHA 1R10A 1RFLA 5FBRB 3BC1A 1C1KA 2VH5R 3EPKA 2H57A 4QXAA 3LX8A 1R2QA 3MG9A 2NO1A 5AJYA 2ZRFA 2BHRA 4DLRA 3ZVMA 3KDSE 4Q21A 1RZ3A 4PAOA 2ZETA 1N25A 3UIEA 2CNWD 3F0TA 2RAPA 1RRGA 4CEIA 1OSNA 2GWHA 2VTKA 2ZXUA 3RRNA 4G5GA 3PG5A 2ZR7A 3EARA 1E0KA 5CIQA 3Q3JB 5IF9A 1TQ4A 3WXMA 3RS7A 4EPTA 2HUPA 4Q5IA 4Y0VA 3ND9A 3GEEA 3Q72A 1HE8B 2AKYA 1HQYE 3FTQA 2CCKA 5FI1B 4CW7A 1LS1A 4CZ2A 4O2LA 2WJGA 1KSGA 2B8WA 1Z08A 4WZBE 3KTAA 3BFVA 5LB2A 5AUPB 1FP7A 2F9LA 1EFTA 1RKBA 2G88A 3PEUA 2C5LA 3QJYA 5HZHA 2VHTA 1FMJA 1GIAA 1NN5A 2GXQA 3IHLA 2OCAA 2CK3D 3U3OA 5F9HA 4KVGA 4QBHA 4HZUB 2ERYA 4LJAA 1WMSA 3RVBA 4Z1MD 4IFBA 3O8BA 1MR3F 2G83A 2A5GA 3OIUA 5HKKA 4G3XA 2A3RA 1T3LA 1GAJA 3RRYA 4CEHB 4C0LA 3CPHA 1GNRA 1SHKA 3CZPA 4II7A 3K70D 1GVNB 5EP2A 4NYMR 1E3MA 1EX7A 4KLZA 2FZ4A 2IHYA 2IT1A 4D0GA 1OH8A 1IHUA 3IUYA 3R8FA 2MSDB 5M04A 2OT3B 3I72A 5CB8A 2F1IA 3HPQA 3TMKA 1WBBA 1II0A 1W0KD 3KXLA 2WAXA 3SN6A 4ZDIA 1TPZA 3ZDQA 4WVFA 2IS6A 4MKFA 3HR7A 4KFTA 1UJ2A 3CONA 2PCLA 2IYLD 4N0DA 3QKTA 4DDTA 3BD9A 1Z2CA 1U99A 1HT1E 4NCHA 1T5IA 3AP1A 3B1ZA 1F3OA 3HU3A 1T3SA 5IDVA 3TW4A 4KU4A 4M21A 2QE7A 3U44A 5JI3E 1ANKA 4YXWD 1GM5A 1XTQA 4FCWA 1Y63A 2KSQA 4Q1EA 1FMLA 3MD0A 4Q7LA 5KPJA 3THYA 2TMKA 2Z83A 4TWZA 3DPUA 1RRPA 2FE4A 1ZNWA 3M1IA 2NMVA 1KK0A 1G7CA 1R5OA 4D0NA 2OCPA 1G6HA 2R6GA 5H1YA 3VR4A 4Q01A 4B33A 3EG5A 1FL9A 1GITA 2QMOA 2V7QA 2ODEA 4JYCA 2QP3A 5AJZA 3CZQA 1II8A 2N46A 2VO1A 2ZRNA 4NU0A 4DBLC 4Q9JA 4ZCLA 3ZZTA 1SULA 2DBYA 2BMJA 2BBTA 2OV2A 1KDOA 2D7CA 1QHGA 1G64A 4B2PA 2DR3A 3QNUA 2W6ID 2ZITA 4M2LA 2L0XA 3LAWA 1CULC 1ZNYA 3IILA 1FTSA 3P1JA 2X8AA 4KSBA 2B92A 4NCJA 1XPOA 5DSZA 4B35A 2ZRDA 4KI0A 2AD5A 1G5RA 2QA5A 1RW4A 1DOAA 3QOFA 4MGYR 5TARA 3ZIAA 1MRNA 1G8YA 1NVVR 3W5JA 4BFXA 2FSHA 1KO5A 1L4YA 1W4BA 4F91B 2D3WA 4LGMA 3KJHA 4ZKDA 4OI0A 1AQYA 3D3QA 1NMYA 4Q4LA 4R2IA 3R9XA 3NIBA 2XOKD 5TV2A 1EK0A 1D6JA 3VX3A 3PVSA 5DH9A 1JQJC 1KJYA 4CF7A 1NJGA 2YVUA 3P20A 4KAXA 4HLDA 4JIMA 2P2LA 4NP6A 3NVAA 1DTSA 2GVDC 4MYHA 3B7GA 3GLHE 2KE5A 2DWQA 4I1SA 4KODA 2CMKA 2D74A 3ASYA 3GLHB 4DDVA 1NN3A 2RGNC 4IKEA 2VRWA 2G0TA 4I99A 4AKGA 2QN6A 2X2FA 5E7MA 4ITRC 3PCRB 5L3QB 5G41A 4EAQA 2GBLA 4KO8A 4PAMA 3BXZA 3MAAC 1Q57A 2UVQA 4PHTA 2QMHA 1RVDA 3AJIB 3W8NA 1G20E 1ZU5A 1YKSA 1Q1EA 5FL3A 1L2TA 2VHQA 1SHZA 4LV8B 4DSOA 2HT6A 2AN9A 5E4FA 4F38A 1VYTA 2O8FA 4DIDA 4MQBA 1QG4A 1SVSA 2H16A 5CDFE 4NMMA 1Z6XA 5CIWA 2GJ8A 3KFXA 5EXTA 4CEJB 1PLJA 5E7JA 2QORA 4MRNA 3W8RA 5C46F 4N3NA 5IK2A 4C2TA 1FQKA 2O52A 5DN6A 3TVTA 2W0SA 2XTNA 4AK9A 2MSCB 2BM0A 4HLQB 5HCNA 4LDJA 3LW7A 2OAQ1 1G291 1IJEA 4H9GA 4Q47A 5D3MA 5L3VA 3BWDD 4NYIR 3UXMA 1NG1A 1KI1A 2IF0A 4RCZA 3B5JA 3L0PA 3K9LA 1KOFA 1CRPA 1O3YA 1E9AA 3B9QA 3I62A 2BC9A 1N3BA 1FZQA 3FMFA 4LBZA 2BIFA 4DLSA 2ZJYA 4UJ3A 2G1KA 2GDJA 2WBLC 3FWYA 3TR5A 3GJ4A 4TLEA 1QRAA 4A9AA 2FF7A 4IOLA 1W36D 3MWKA 2P67A 1G16A 3MRSA 5BN4A 2WWGA 3KX2A 4C0KA 4FWIB 2YNMA 4KCGA 3THWB 4GMDA 3QG1A 1KJZA 5FUWA 3CX6A 2QEQA 4TL6A 1K5DA 2ZYWX 1XEWX 2A9KA 4LC1A 4P3YA 5KU1A 5E95A 4MGZR 3JZMA 3C16C 1G8GA 2ZI4A 4GP6A 4A8JA 4CYMA 2XSZD 4FWDA 1KI3A 1X86B 2ZJAA 1WDTA 4BRUA 1GNPA 1KDRA 1EFHA 3FMOB 4URZR 4KHZA 5JRZA 2FZLA 1W7AA 1D2MA 1RJ9A 3DO6A 3VMFA 4Q4JB 3QQ5A 1TADA 2QT1A 3IBGA 1I2MA 1OKKD 3REGA 4PSVA 1OIXA 4LHXA 4CT5A 2PL3A 1UKYA 3D6TB 4Z51A 2SHKA 1GKIA 4DB4A 5EP1A 1KDTA 3NG1A 4AYTA 3VKWA 4DT1B 4IDQA 2AX4A 1C4OA 1XCMA 5JCZA 1XBTA 5G40A 1KAGA 5C18A 1CTQA 1JBKA 4WAUA 1OFUX 2I4IA 3B85A 5E3HA 5A4JA 2F55A 4DJTA 2I1VB 4NCIA 1NJFA 2RGDA 3B2EA 1UBCA 3U3MA 3TBKA 2ZAOA 3K0CA 2EFCB 4BZXA 3QF4B 4ON9A 2FEMA 5DI3A 2Y8EA 2FSGA 1OJLA 1E2PA 2VPPA 5LDDC 2HLDD 3I3SR 3V4FA 5AJWA 4NYJQ 2OLKA 1VHTA 4IVPA 2ZRMA 4XSGA 3D31A 5A5GA 1IAQA 1XD2A 1Z8FA 1MO5A 2BEJA 4RD0A 3MMPA 4DCVA 4TMKA 4F4IA 1OH7A 4Q03A 4QM6A 2OE2A 4IOKA 1NBMD 4IVQA 3OFND 5EE3A 4JKIA 2K5UA 2UKDA 1OXVA 2IYRA 5EXXA 4PR0A 3PUXA 3U6KA 1XMIA 3M4YA 4JJKA 3HJNA 3RSOA 2YOFA 3DM5A 4MDEA 4ZIRB 1G3MA 2XJ4A 4A0RA 4BUJA 2CEAA 2H92A 2IC5A 3T1OA 1KJWA 4TZ6A 2CE2X 4KFUA 1WA5A 4KYUA 2GZDA 1SKQA 4EPWA 3ZIAD 1R0XA 4DKXA 4V0OA 4W5HA 2O8CA 4WOPA 2DFTA 3AVOA 5FOXA 5L3SB 1KYIA 1P5ZB 5A0FA 4ACAA 3LBIA 4UXJA 2ANCA 1D5CA 3UK6A 2XXAB 1YVDA 2UZIR 4WBSA 1YZKA 1TL7C 4BEBA 2FFAA 2NG1A 1R0YA 1KMQA 5EUQB 2Z5FA 2JIZD 1U0HC 3DKVA 2QPOA 4IXNA 3D7MA 4BLOA 2WJHA 3OEHA 2BBWA 4MYTA 4JVNA 3M6AA 3CWZA 2CL0X 3N5CA 1G3QA 2FG5A 3N70A 2AR7A 3GLIE 5AR1A 4G5QA 4BFVA 5AUOB 2DCUA 4D4KA 2XEXA 4LK2A 3GLIB 3GJ6A 1M8PA 1Q3HA 3FDIA 1KKMA 2ZJBA 2HT1A 1HT2E 4AG6A 4EKDA 4TL7A 1Q3TA 1QHHA 4EQ6B 3PEWA 1OXSC 2J46A 3EX7C 3JVVA 2JAQA 1FP6A 4Q1FA 4H1UA 4LOAA 1T0HB 2BOVA 2OBNA 4HDOB 1YR9A 3T06B 1E2GA 3KB1A 4NKRA 4M1TA 1R4AA 1YE8A 2RGXA 5FUVA 4LYJA 2AK3A 4C7OB 5G3ZA 4JS0A 1ONBA 1P2TA 1KY2A 2ZU6A 3TKLA 1XXHE 4LRSA 2ANBA 2V6ZM 3LVQE 5EP3A 2ZS7A 1HYQA 5JRJA 2XNSA 3WHKA 4TYQA 3RLFA 4PANA 1XXHB 1EXMA 2C96A 4D25A 5IK2D 3EPHA 5FUYA 4V0KA 521PA 2WMNB 1ESNA 3QI2A 3RRZA 5DN6D 3H4MA 1DS6A 1Q1BA 2P3SA 4Q7JB 3EASA 5FFMA 2J7KA 1W2GA 5LD2B 1T3HA 4L4UA 2PLFA 2JLYA 3K09A 3AF4A 3KKMA 1BMFA 3CNOA 5EJEA 1JEEA 3AM1A 3RNLA 2PT7A 2AXPA 2ZE7A 1S1CA 2ZRAA 4PHGA 4AKEA 1IONA 2DWOA 2FPLA 1UKZA 3C5HA 3P4XA 4M53A 4Z54A 3FHCB 3SC3A 4OYHA 1JI0A 4YC7A 2D06A 2GHIA 4PO9A 1Z6AA 2ZRIA 5FPHA 1J90A 3RS5A 2AWOA 2FA9A 1KI2A 4QBGB 3DVLA 2QBYB 1N6NA 3CLVA 1ZBDA 1BYUA 1VHLA 1GKYA 1P60A 1BOFA 1CJKC 4FMCF 4GRAA 1DG3A 4DUGD 3UMSA 5DLQC 1ZP6A 2JLRA 4O25A 3WYGA 4YMWA 1LV7A 2WKQA 3GLGE 4JBYA 2EFHB 2ATVA 3BE4A 3WBKA 2QM8A 1HA3A 3THXA 2GF0A 3GLGB 2V55B 1E0SA 3EIEA 1ZM4A 1F2TB 1F2UA 4LJ8A 4LRTA 4M9ZA 4DC9A 1U81A 3PUYA 5BXQC 2ZM5A 4A92A 2XX3A 4PPFA 4BFWA 1E9SA 2DFNA 2F1RA 1PLKA 1ZMXA 3NBZC 4FMBB 1E99A 1OXUA 1OXXK 4O2RA 4Q9HA 3K9HA 5P21A 2YZ2A 2W0MA 1IJFA 4HB3A 4C0QC 4A2WA 3U7HB 2QPAA 5CB6A 2VBCA 4QM7A 3GFOA 1CKEA 3RWMB 2NGRA 4DLZA 3TAHA 1QVRA 1XRJA 2W58A 3T1QA 4QC2A 4PQYA 2E1RA 2EYQA 4N1AA 2ZTSA 4A0GA 3NH9A 3EWSA 1KI7A 2ZUBA 2DWZB 3SR0A 5FPKA 2ZSDA 3ZVLA 2NTYC 1W0KA 1EFRA 2VP2A 4R7ZA 3A4LA 4MKHA 5L3RA 1XB2A 2W6JD 3RSLA 3DZDA 1MKYA 3RHFA 1XPRA 3DOEA 4LHYA 5DYIA 2FX3A 2GXUA 3RYTC 1G9XA 3GLFE 5L8VA 2QL6A 2V6JA 3CF0A 4PXAA 3VR5A 1SVIA 4TTRA 3GLFB 2VP9A 2GEVA 3CRMA 3TQCA 2IYVA 2X77A 1M1YE 1HV8A 3FFBA 2WKPA 2H5EA 4ARZA 4XWKA 2QQEA 4NCNA 1LNZA 1OIWA 2IYTA 2ODNA 1OH5A 2F1HA 2J0SA 3W90A 2JCSA 4DLUA 4FMCB 3IKJA 3SE0A 1XPUA 1G4UR 1AS3A 3EAQA 3QKSA 2WICA 3KKOA 1NSFA 3PR1A 2H7VA 4NTZA 1DAKA 1VPLA 4RD1A 3RDPA 3V00A 3CUEF 1KIMA 4L5BA 2KBFA 4IRUB 5B2ZA 2JATA 3BERA 3SEAA 4M9XA 2VP5A 2OG2A 3AVPA 2CVFA 2WWHA 2QM7A 4IJMA 1JQLB 5BYKA 5DNYB 3OEHD 3ZQJA 3GEIA 3ADKA 4P4TA 1RYHA 5FOTA 3N2IA 1VYUA 2YOHA 1RPZA 1DAIA 1ZC3A 2MSEB 5DO9A 1N6KA 5SZHB 3LW8A 4X8HA 5EUMA 3VR1A 1YZGA 4F4CA 2VP0A 1AGPA 2F3RA 3MLEA 4HATA 4NPHA 2YJTD 3WYAA 3X1DA 3W6NA 5KO2A 1W5SA 4Q4AA 2IYYA 3NBFA 1LVGA 4MKIA 4LJYA 4C0BA 3CNLA 4E22A 4GOKA 4QL3A 4RFVA 2QSZA 2BVNA 1PZNA 1NN1A 2GILA 4DLYA 3TAUA 4Q19A 3CPJB 1GL9B 3LBHA 1E2JA 4EIWA 4D80A 2BKEA 5FBVB 2HCJB 4YQFA 3KZ1E 2ATXA 4MUAA 4KV9A 1T91A 2A78A 1UKEA 2EU8A 4OI4A 3LV8A 4DB2A 1UEJA 2FH5B 5J4HA 3FOZA 2QAGC 2OCYC 2EVWX 1OPXA 4B43A 3QVUA 2PMDA 1JPJA 1QBKC 3ADBA 4KXFB 1R0ZA 3UKDA 2B7BA 4EPYA 1FX0A 4TQUS 3PV0A 2V3CC 2HYIC 1HQCA 1KI4A 1KAOA 4QGGA 2BMEA 2Z0MA 4OQXA 4D4MA 4DEXA 4QHTA 2ZE6A 2Q9BA 1WQ1R 1BMFD 4B3CA 4KITB 4LY6A 3O47A 3IBYA 1P9WA 2GNOA 3PUVA 2AFIE 4LBVA 3C8UA 2IX3A 2IUTA 1C9KA 1ZYUA 3QXCA 3W6OA 1U0JA 1TF5A 1QZMA 4Q4HB 2DY1A 4GSYA 4G5RA 4MH0R 3U7GA 3C14C 1N6IA 4P4SA 2VEDA 3GJ3A 3FPAA 3ZLJA 4TYWA 3GP8A 1OV4A 4LHVA 3ZS9A 2GJAA 4JVLA 5FPSA 3V9PA 2C8VA 2I3BA 4JZKA 621PA 1S96A 5KUTA 2O8DB 3WBJA 2OXRA 1MH1A 1W48A 3E1SA 1OW3B 3Q5EA 5EE5B 1XJCA 2O8EA 1Q0UA 2RGNA 3T5GA 4B76A 4L9SA 4R2HA 2IBMA 3TSZA 1ZM9A 2W83A 3IQXA 1MABA 821PA 5FBLB 3JZAA 4MRVA 4IEIA 3K0AA 3IPYA 5JLJA 1O87A 2VSFA 2J0UB 1ZW6A 3U4QB 3CIOA 1N5KA 3MGCA 2ZVPX 4DSNA 1I4LD 5CYOA 4IDPA 2AXNA 4WA7A 3WNCA 3CR8A 3WNDA 1Z5ZA 4LV6A 4OK3A 1US8B 1Z0JA 4OHZA 3GJ7A 3A36A 5IHPA 2WWIA 3KJGA 4LJ5A 3GFTA 2NOAA 4UNRA 2D62A 4BLSA 1H8EA 1G6OA 1XU4A 1MRSA 3AEZA 4HAYA 4BFSA 4XOIA 1S0UA 4A0HA 2R8RA 3B82A 3THOA 4M1WA 1GFIA 1BYIA 2X19A 2R44A 2ZJZA 1I4TD 2ZJ8A 1MO6A 4Q48A 1HEIA 5H70A 1KO8A 5BWMA 1ZCBA 1COWD 2IYXA 3KL4A 1YZUA 2A5FA 4YMTA 4RFSB 5DIFA 1NMZA 3R7WB 4LCBA 1ELOA 3K0FB 3CBQA 3I8XA 5FTKA 4R71A 3G5UA 1TTTA 1KSFX 2IEYA 1MO4A 3ASZA 2XSZA 5J4YA 1EFRD 2HF9A 4Q9IA 1ZINA 4U5XA 2C9OA 4M22A 1KSJA 2XZLA 3RS4A 4URVR 1N0VC 1E94E 1Z47A 2PLRA 4QRHA 1V43A 2YINC 5FH9A 3PQCA 3QXHA 1Z6TA 1P3JA 2QY9A 3D8BA 5JCPA 2Q3MA 3CX7A 1G7RA 1OKKA 3EXAA 3ZD6A 2G3YA 1EX6A 4AD8A 3EPLA 1KGDA 2EYUA 1G18A 1DAFA 4UQOA 4LPSA 1G3UA 1CF4A 4Z8YA 2KBEA 3OIVA 1NRJB 2OLJA 3LX5A 4HAWA 1FW6A 1Z06A 2ZYUX 2X1VA 1ETUA 4C2UA 2KWIA 4TLDA 5FBQB 4WIAA 3OF5A 4TN1A 1GP2A 5FR1A 4US2R 5ELXA 1OB2A 3OZXA 4PC2A 4CVNA 2HLDA 5JWOA 1QVAA 1SXJE 5TY0A 4P4UA 1LTQA 2EFEB 2F3TA 4GZMA 1SXJB 4QFMA 3VQTA 2FPKA 2DZOB 2QT0A 2ZIAA 2PCJA 2YC2C 4LC0A 1IM2A 3RS3A 4I1UA 4MRPA 3PEYA 3Q8XB 1DPFA 4C3ZA 4JN6A 1NBMA 2ZRKA 3OFNA 4U00A 3ZQ6A 2UZ3A 5GVRA 2WJIA 3QXJA 5FI0B 1NI3A 3SQXA 1VCMA 4RZ3A 1KNQA 2GKSA 1GKUB 4BLQA 4PSKA 4GITA 3U3KA 3W5IA 1XTKA 3A4MA 5JWRA 3KUDA 2AWNA 1Z63A 1XMSA 2V1XA 4CT4B 4AY2A 2P6NA 4ERNA 3KW6A 4ACBA 5LD2C 2FNAA 3A6PC 5JI2E 1G17A 2XTMA 1W49A 5FOSA 5FTJA 4B2IA 2YOGA 2QU8A 1DO2A 1OIVA 3IIJA 2R6DA 3A58B 3A8TA 2BM1A 1AS2A 1XX6A 1A7JA 1PUIA 3V4RA 4OBEA 4I4LA 4JT2A 4XH9B 3QPVA 1HURA 2V54A 4HZIA 5C4GB 2JIZA 4LX0A 4ASUD 4WXRA 1NKSA 3TW8B 1OYWA 2VF8A 4BWYA 1G8HA 2ZREA 1P7CA 3B1YA 5SZIA 2PMKA 4RCYA 1RRCA 2LKDA 2RGAA 4P31A 3CF6R 2BDTA 1KI6A 4QGAA 4HUQA 1Z28A 5KDOA 4OKSA 1JAIA 3E5HA 3QY0A 5G53C 1P2UA 4KBGA 4TYYA 2OBMA 4UNPA 1J99A 3LQQA 3U3JA 2VIIA 3SNHA 5B30A 4IDNA 1KZ7B 2WV9A 2JLVA 4US1R 3OHMA 4BFYA 1TAGA 4FW9A 1XEXB 1JR3E 1NY6A 1J70A 2PZGA 4A6PA 2IS4A 2ORIA 1VCNA 1IY2A 4LV5B 1E98A 1GRQA 3X1XA 5K8IA 3SJAA 3KB2A 1TU3A 1Z0IA 2FJUA 4RKFA 2FWRA 4YDHB 1DAHA 5AUQA 2D7DA 4LWZA 1LW7A 3KXIA 4UXHA 1XCPA 3AV0B 3ICEA 4ZV4A 2XITA 3NKVA 4G01B 1OFIA 4A6XA 4JLDA 2WM9B 3S1AB 1N0UA 1L7VC 5FL7A 2WPDD 5JSZB 2A2ZA 4DHEA 3NWJA 4GNKA 4PC3A 2ZS8A 5JWHA 2CJWB 2FV8A 4RJLA 1RYFA 4RSGA 1TUEA 1E9EA 1NVXQ 1T6NA 3FE2A 3I4LA 5FPYA 4D2IA 1M7GA 3TE6A 3FVQA 2ZRPA 2C77A 1F6BA 1KSHA 1K5GA 1FUUA 2QGNA 1TNDA 2QI9C 5J4VA 2ZSEA 2OUKA 3QSYA 4RY2A 4JBXA 1YR8A 2WJYA 3EZ2A 2A30A 2Q0HA 4PC7A 4D6PA 5KSYA 1DAEA 1LF5A 4BASA 2YC4C 2DHRA 3RABA 1OHHD 3P26A 1ESMA 3VR3A 1KMHB 2GVZC 5CLQA 3SZRA 2Z6VA 3GPLA 5KHOC 4Q7MB 4HZUA 1H8ED 3FFAA 2WJVA 1FOEB 1E4VA 4BECA 1E2DA 3H86A 2DWPA 1CBUA 1N5IA 1XTIA 1IY1A 1DE0A 3CB4A 2QAGB 3AF1A 2ZAMA 1C1YA 3HP1A 1KDPA 1OXTA 4CEHA 3FKQA 2WOOA 4DUGA 4Q9LA 4O0MA 3T35A 2J87A 4LI0A 2GZHA 5DE3A 2REBA 3W6PA 3C4JA 2IYQA 2NO0A 1TF2A 2A5YB 3X1YA 1D2EA 3TNFA 5EE9A 4Z8XA 4O3MA 3TUZC 3B1WA 3B60A 1N0WA 4MGKR 3CW2A 2VYFA 4NYMQ 4JLAA 3FYHA 3LRPA 4Y0AA 2GA8A 2C99A 2F43B 4XVQA 3GJ5A 4FI3C 1DEKA 4S35A 3AVVA 1JPNA 2CLDX 5KSOA 3ZVNA 2BJVA 1YZQA 4NBSA 4L9WA 2WIBA 4NCKA 1W0JA 1S3GA 1EFCA 4I1VA 1ZUHA 2KRKA 2N42A 1XWIA 3MJHA 1DBSA 3AGPA 2ZE5A 2JDID 3VNUA 3PENA 3LVRE 1E9RA 2B8TA 2G6BA 4NONA 3C15C 3MSXA 1TQ6A 1AN0A 4V03A 2J0VA 1GNQA 1R8QA 3U7FB 3WP0A 1NSTA 3K9NA 4WZAE 2P0EA 3UMRA 1W1WA 1W4RA 3DMNA 3EIQA 1R8SA 4HAXA 2O0KA 3U7EB 4PFSA 2EFDB 5JECA 1KNXA 2W6JA 3K0SA 4A0FA 1TU4A 1H65A 1HUQA 3AF3A 3Q9LA 1WE2A 5FTNA 4R98A 4UXIA 1ZIPA 3OIYA 2V9PA 2XZPA 3LO5A 2CXXA 5KPDA 2MMCA 3K70B 1RE0A 5JZVA 2XJ9A 2OFWA 4FWTA 4C30A 1UBGA 4M1KA 5J4LA 3BB4A 4U02A 1ZNZA 2IUSA 5B58C 1YU9A 1DVRA 2YWHA 2WKRA 4DIEA 1F48A 2FGJA 2ZI7A 3WNBA 1T9HA 4DSUA 2IXFA 3SJBA 2NZ8A 2ZI6A 4LRWA 3HR8A 1CIPA 2ZR9A 5CJ2A 5GJCA 5B64A 4ESVA 1XJQA 2BEKA 2F6RA 5BQ5A 3OAAD 3I8SA 3X1WA 3SHFA 1WBDA 2VSOA 4P33A 2ECKA 2FOLA 1B0UA 1CJUC 1NVUQ 3R9WA 2QGZA 3CPEA 2J5XA 4JLJA 4QHSA 1XFAA 3Q85A 1CRQA 3IO3A 2IXGA 3SJZA 3TLXA 2HXSA 3I61A 1U0LA 4B75A 1G19A 3FMPB 1XP8A 4EFLA 5J47A 1JXOA 3CF2A 5HPYB 2GXSA 1NVVQ 1M6NA 1Z2AA 2W2VA 3QKRB 3QE0A 2O8BB 1LB1B 3CM0A 4NL4H 3KQHA 2A5DA 3SS8A 2WIAA 3U3RA 3BH6A 2OZEA 1KK3A 5EZ5A 3VU9B 2ZRGA 3SYLA 1XTRA 3T1TA 4LZZA 4I81A 1XNJA 5AJXA 3LA6A 3UATA 2QAJA 2IYZA 3GLHA 1FUKA 4LPKA 3VHLB 2GCOB 4QNRA 3NDPA 4MUBA 4C0SA 1PUJA 5L3QA 1NVMA 3LFUA 1IN4A 1F5NA 5KSZA 1A2KC 3WMEA 4RD3A 5HCIA 4JLBA 2ZRHA 2OAP1 1E1QD 4TQAA 5FOVA 4JLKA 1UKVY 1TF7A 1CJTC 3L0IB 3QENA 4PHHA 2GJ9A 3L8YA 2GJSA 4XD7A 3F3YA 2OHFA 2ZUDA 4D0LB 721PA 4W9MC 3IHWA 1W2HA 2PH1A 1UADA 3I92A 5JEDA 3BBPA 3SFVA 4FWHA 4M1YA 4ESHA 1Z0DA 1JB1A 4RD2A 2J0QA 1P6XA 4V02A 5FUXA 3WY9A 3TUIC 1QHYA 1XCGB 3KJEA 1KO7A 3WRYC 2ZJ2A 5FL7D 4PQFA 4TQ9A 1ZNXA 4CEJA 3U5ZB 1RRFA 2DFLA 1AKEA 1NKTA 5CDFA 4AWXA 3CNNA 2WZQA 3A4NA 3U61B 2R6FA 4D26A 1ZRHA 4DDWA 4GOJA 1E2IA 4LHWA 2BBOA 5CK4A 1IXRC 4Q9KA 1YRAA 4AURA 4YDSA 1Z6GA 4RZXA 4HAVA 3IPXA 4QJ4A 2P6UA 2CDNA 3TSWA 1YHNA 1YZTA 4A82A 4NE2A 4XJXA 2JLUA 3KFVA 1I2DA 4F93B 3WP1B 4RZ2A 2J7PD 4LJ4A 4EJSB 4NYIQ 2VHUA 3NEJA 3AUYA 4YMUA 2VL7A 2ZE8A 3AF0A 2IYWA 2WWWA 4HLUC 4ZDJA 4URXR 3SI7A 2IEZA 2HEIA 1IBRA 4Q1DA 5LB4A 3AKYA 3UPUA 3THWA 3QG5A 4GL2A 1VG1A 4WZ6A 1E69A 3TH5A 4U7DA 3VNVA 4CEIB 3PUWA 3MCAA 3EWAA 4G0NA 2J3EA 2P65A 4LHZA 2QRZA 3SYNA 2IF2A 2R65A 1JJ7A 3AF2A 4PX9A 421PA 4B3DA 1T8TA 3EC2A 3NXSA 2VF7A 4TTQA 4D4LA 1B23P 1NP6A 1NLYA 1KO4A 4A4DA 1Z83A 2AFHE 5ANRB 1SXJC 3G0HA 4Q4JA 2RGBA 2NPFA 1XZQA 1BH2A 4BFZA 1W0JD 2FSIA 2PJRA 1MOZA 3WYFA 4XVRA 4KFRA 4PPQA 4OHWA 1COWA 1G5TA 2PX3A 3A1UA 2OBLA 3VX4A 1VG0B 3KTAB 4DT1A 5JHGB 2EWVA 1DG1G 5AK0A 1FNNA 1GRRA 4PPNA 4B47A 3ECCA 5J4KA 2ZU0C 6Q21A 4NZYA 1G5PA 2BKUA 4JL8A 3NTUA 1U9IC 2GK6A 4BPBA 1XD9A 1U2RA 2CL6X 4M1SA 2JJ2D 3QF4A 1JNYA 2GEDA 5FTMA 4Q00A 2GESA 3PUZA 1DADA 5BYJA 4OQFA 1R7RA 3R8CA 1E96A 4ZDKA 2PT5A 1E2MA 1MV5A 4IVRA 2W2TA 1W36B 4XSHA 2FEOA 2OO7A 1VIYA 5F3WB 3DKPA 5JJLA 2QROA 1VIAA 4B6FA 3BH7A 4OQMA 3IEUA 1YR7A 2JGNA 3CO5A 4QNMA 4M9QA 2NIPA 5EQTA 2QRNA 5EE0A 4C0AC 3Q7QA 1VYVA 1Z29A 1XMVA 3L8ZA 3SFZA 2R6CA 1UDWA 1VCIA 1R5BA 3DOFA 3JVUA 4DRZA 5JS7A 2QQ0A 3HDTA 1UBFA 4B48A 1EGAA 4EPRA 4B44A 4ABYA 5JBQA 1NG9A 3ONWA 1CP2A 4HSEA 4ZIRA 2YV5A 1G41A 4LJ6A 2VLIA 2OESA 2RGCA 5AUNB 2PEZA 2Z4SA 4LYHA 1TEXA 1TQ2A 1QG2A 1YZNA 2ONJA 4OL0A 1QHNA 2V4ZA 4QJ5A 1A1VA 2Q9AA 4DXAA 5L3SA 5K8UA 1N5JA 3NDBB 3QKUA 2OXCA 2WWFA 2XXAA 5K8TA 5SZKB 3U44B 4DSTA 5AWFC 3THYB 1IN8A 5J40A 3UG7A 3LNCA 3EZFA 1SKYE 3BB3A 4URWR 1OLOA 3FHOA 2OILA 4MRSA 3MHVC 3PXGA 1XEFA 3VHXA 1E1RA 4ZPXA 2RGGA 1SKYB 4Q18A 3VAAA 1L8QA 1NL3A 3RAPR 4TL8A 3DZ8A 1G7SA 3LLMA 1EESA 3AQ4A 1II8B 4JLOA 5HZKA 5C2JB 3A1SA 5IT5A 2ZVQX 4EPXA 3GLIA 3GQBA 5FOWA 3AVXA 1CR1A 3RS2A 1PV4A 4XTCS 2Q6TA 3QVVA 4KSCA 1Z3IX 1IY0A 3VTKA 2C03A 1Q22A 1AJEA 4XVUA 3IIKA 4PZYA 2C98A 1SVWA 4EQ6A 1CXZA 1JJVA 3AKEA 4PQRA 2ASEA 5FOUA 4B3FX 2B6HA 2GCNA 1IQPA 4MITA 1L4UA 4JT4A 4JSYA 3DM9B 4IDHA 4Q66C 4ASUA 4TLBA 4XD7D 5DI9A 4PSAA 4DLWA 4C7OA 1KKLA 2OSBA 2IWRA 1XMJA 4IFEA 2ZI5A 2G77B 1HE1C 3W9YA 1OF1A 4IW3B 5TVKA 4X8LA 1IN5A 1KZGB 2A7QA 4GFDA 3RANA 4BLPA 2A5JA 4RKEA 1UM8A 1XXHA 4FCVA 2EW1A 2GZAA 2WAYA 1NF3A 4XWOA 1KI8A 2Z4RA 1P75A 1EFUA 5CM9C 1OE0A 1ZAKA 1ZD9A 3LDAA 4TMWA 2IA5A 3BIFA 4QJ3A 5JFGA 1EWQA 4GP7A 1NMXA 4LJ9A 1N5LA 3TIFA 1TUIA 3KQUA 1IN7A 1K6MA 3SDZA 2GJKA 1NIJA 3SOPA 1CR0A 3CRVA 5J5CA 4CGZA 2YWEA 2G1JA 3P27A 3KQKA 4C4PA 1VKJA 2JEOA 5CJPA 4DEYA 1S4QA 2QBYA 5EP4A 1JR6A 4JL6A 3CWQA 4LBYA 2WPDA 4F92B 2HCBA 4QOSA 1DARA 3GFPA 4YONB 2GEUA 2MMGA 3EZ6A 4LSGA 1BO6A 4OHYA 1AZSC 2JA1A 3VKGA 3OEEA 4K8OA 1G4AE 4D4JA 4M1OA 2O8FB 2ZEJA 1M74A 1CR2A 1N6OA 3GLGA 4TMZA 5IRCD 1F2TA 4MYCA 3AGQA 5TDHA 4DLXA 4GI7A 4TSFD 3ZGXA 2ERXA 1CLUA 1OHHA 1PVOA 1A82A 2HXYA 4TLCA 5HE8A 2IUUA 4JYBA 1OFHA 1GRNA 3K70C 2J59A 3BFXA 4AKIA 3OE7A 3K9GA 5TMPA 5E7IA 4JJZA 2C95A 1X6VA 5DHFA 4DWJA 3FGNA 4BRWA 1GWNA 4TYNA 3ICQB 5F2EA 4TL9A 3QPUA 1AKYA 5D3MB 2NO9A 5HE9A 2H17A 1NVWQ 2C78A 3BFKA 2BCJQ 4P0TA 3W3ZB 5TXGA 3I32A 1YRBA 3Q7PA 4MYUA 1BS1A 1QHXA 2E9SA 3L0OA 2EFGA 1E2FA 3EA0A 2IYUA 5B57C 1UPTA 1VECA 3PEVA 3I73A 2AKAB 1QDEA 2KB0A 1T5LA 3WMGA 4PHFA 2RHMA 2ZJOA 4FN5A 1U8YA 1ZIOA 2P5SA 2JLQA 4S2EA 1J8MF 4GBMA 3B13B 3T12A 1J8YF 3GLFA 3B1VA 3LWNA 1E79D 4AI6A 1NLZA 2JDIA 1FPMA 3GJ8A 4Q7KA 5GADl 1JEDA 2BBSA 2ZRCA 4A8JB 3HWSA 3C5CA 3H0KA 4RD6A 4ZI2A 1VTKA 4A36A 4TYPA 1HH4A 2DPXA 4UJ5A 3GJ0A 4NDZA 1RJ9B 1JECA 2ODWA 3CRW1 4DLTA 1NIPA 3UWKA 4V0LA 2F1JA 3CH5A 3MFYA 4KLNA 4B74A 1TQDA 3RC3A 1Q20A 4G1UC 3LY5A 4TZ0A 3A37A 3ZH9B 4MRRA 3FKSA 1Z22A 2WJJA 5F98A 4DZZA 1UAAA 2P6RA 5EE1A 2ZSBA 3ADDA 1IXSB 1ZD8A 1Q1ZA 1XDBA 5KSPA 4FD2A 2B21A 2QP4A 3QEJA 3O8CA 4KBFA 5KNBA 5EXSA 3CH4B 1GL6A 4ILEA 4NYJR 2ZI3A 4V0ME 2HDNB 4BQSA 2ODBA 4K81B 1G21E 1SVKA 2F7SA 2IK8A 2YWFA 3NBXX 5DI3B 4JVSB 5JS8A 4OHVA 1E1RD 3OAAA 2VHCA 5F9FA 2ZQ5A 3ADCA 4XWAA 1SZPA 1Z6YA 3QXSA 3E2IA 3AVWA 121PA 5TB5A 1XD2B 4OQLA 1F60A 2IWHA 1W47A 4JVMA 2J1LA 2J9RA 2XNDA 3VLFB 2REOA 3H84A 3QUSA 4TT3A 3UWOA 1EG7A 1P4SA 1E0AA 3GJXC 3NC1C 1DAMA 1AGRA 5JEEA 1OH6A 1J7KA 3QPWA 2WTUA 3K0EA 4QG7A 2RHDA 4JLPA 2ZUCA 4PO1A 4EJSC 2JJ8A 3QEOA 1E0JA 4US0R 5GVSA 1CJVC 4F7WA 3BH0A 5H8WA 2QMUA 3IIMA 2JLSA 4IDOA 1Z0AA 2QTVB 3BOSA 4JLMA 2O8CB 1D9XA 1ZU4A 2J45A 1N6LA 1MO3A 5CM8B 1R5NA 4EPVA 2B7CA 3EW9A 4FXPA 3AB3A 5CYPA 1FTNA 1ZM2A 3DL0A 5SZJA 4F4JA 3QXXA 4A1FA 2HJGA 4E07A 5KYKA 1E1QA 2ZRJA 3Q5DA 3DMDA 3H2YA 4HB0A 5LBIA 1HTWA 2JLZA 4QHYA 2WMOB 2ZS9A 3BB1A 2AL7A 4UNSA 3KUCA 4E03A 4KVAA 4A2PA 3TSOA 1YQTA 2GAOA 2YKGA 4Q4HA 4PZLA 3ZJYA 1UEIA 1W5TA 3F8TA 3SBDA 4JSTA 5KDDA 3B1XA 4W5JA 1E9BA 2O8DA 1QHHB 2QMEA 4BE7B 2YYZA 2WWYA 2ORWA 2WSMA 2J41A 2IS2A 2F9MA 3AP2A 2FU5C 2H1LA 3OEED 4M1MA 2PZEA 2C9CA 3MWJA 1U8AA 1LS6A 4Q1CA 3A1VA 2J0UA 4EDHA 3U4QA 2BWJA 1ZD1A 3LXRA 4GOXA 2PBRA 2JLXA 2FFHA 3TK1A 3RS0A 1E2EA 1US8A 1QF9A 2CHQA 2JJ1A 2WSSA 1K8RA 4AC9A 4POAA 1AZTA 1W36C 4EUNA 3EZ7A 2J7PA 1E2LA 2NZJA 1XJ0A 2BMDA 3PITA 3SU8A 3AVYA 4GZLA 3OE7D 2G0NA 3BJIC 4CRWB 2Q9CA 5C4MA 4DCUA 4NHOA 5CLLA 1YZLA 1X8KA 2NPIA 1TEVA 3TR0A 2VP4A 4TTPA 4URUR 3QIAA 2ZR0A 3UANA 3VR2A 2HJVA 4QGFA 1II9A 4M4SA 4RFSA 1P73A 4ZCIA 5BN3A 1P62B 3R7WA 4FCTA 3KQLA 3K0FA 3MWLA 5KTYA 1A4RA 1W44A 1ZUIA 3L82B 2NQ2C 4I1OA 2I1QA 4BZQA 5D3QA 2GF9A 3F5FA 3TQFA 1HY3A 4FINA 3QBTA 3O8RA 4B73A 1ZM7A 1Q44A 2BJWA 3QBVA 2R2AA 1GTVA 1NY5A 4BFTA 4DCTA 4L8GA 4LYFA 1E6CA 3T1VA 5HKKD 1XTSA 3GEHA 3QF7A 2BCGY 1NNEA 3NC0C 1CJMA 4HDCA 1LY1A 3KKNA 1WCV1 1SQ5A 1PLLA 2GK7A 1X3SA 3MWYW 3LQRA 2C2HA 4JMPA 2KI5A 1DELA 1KI9A 2HF8A 2ZJ5A 1WF3A 2XB4A 2ZANA 1ZC4A 4GT1A 1QZXA 1XTJA 4K46A 3FB4A 4HLUA 3AVUA 5FBWB 3THXB 4DDUA 1X1SA 3TJZA 8OHMA 1F2UB 3FHTA 4HI0E 4KFSA 4MDFA 4LUCA 2CHGA 4G5SA 2GXAA 1DO0A 3R20A 3RC8A 2OFXA 4HLCA 4PAQA 1S1MA 1W4CA 4OJKA 1SVOA 4EFMA 1TX4B 2JJ2A 1N6PA 3TRFA 2KJQA 4FIDA 4GMXA 2JASA 4DCNA 1UF9A 4PO8A 3FKSD 3ZYCA 4E5UA 1LFDB 4TMVA 4B6EA 3B6EA 1SXJA 1G8PA 2QUZA 5FPTA 3OESA 2IW3A 2QE7D 2CHVA 3BS4A 2GETA 3DDCA 2ZRBA 2FMXA 3U60B 1GSIA 1S2MA 1UFQA 3L0SA 2ZRLA 4GPTA 2NO7A 1D9ZA 4M9SA 3IGFA 4W5WA 5AJVB 3RWOA 2CVHA 3X1ZA 1Q12A 1JAHA 4V0MA 4JLVA 3SBEA 3HU2A 4YMVA 3AVTA 4BLTA 2AHOA 2DVWB 4MKGA 4XIGS 4AYXA 2OEPA 2V7QD 4UKDA 1DAGA 4N0EA 4M0LA 2RCNA 1E2KA 1AK2A 2IXEA 3PIRA 1U9IA 4C0HA 1AS0A 1CEEA 1OT3A 5DISB 2IHBA 1SVLA 2REXB 3O8DA 2Q21A 1TMKA 2XNDD 3ZVRA 1GZSA 2O5VA 1YJ5A 4TT3D 1UBEA 1VMAA 2OFOA 2WHXA 4UNNA 5GJBA 2FPMA 2VQSA 4HB4A 1M7BA 1VDZA 1WB9A 3AKCA 4KJZA 3ZZUA 4ARZB 4L16A 1KK2A 4B3BA 2C04A 3B9PA 2AK2A 2OM2A 3NEYA 4AG5A 1FNMA 1T4GA 1U94A 4BZPA 2DFKB 1IOZA 1SVMA 1ZCAA 2O0HA 5DYGA 1BIFA 1E2HA 2WWXA 1IN6A 4C0JA 2HYDA 2E87A 3QKSB 4DVGA 4WW0A 4OI1A 3ZD7A 1GDDA 2FDCA 2RKOA 1CS4C 2GBLC 4ZO4A 3LXXA 2QPTA 4A2QA 4XTRA 3UMFA 5K8LA 3IDQA 3AUXA 3HYRA 4BLRA 3BGWA 3AP3A 4A3VB 3CX8A 4HB2A 1CR4A 3C41J 5H68A 4B3GA 4LYAA 1XEXA 1Z0FA 1P9NA 5KOYA 5EXPA 1KTVA 3PFIA 2CCGA 3WHLA 3T61A 4OK5A 3K8YA 4CDGA 4AIIA 3T34A 1S9DA 2PJZA 1JR3A 1VG8A 2V6IA 3VR6A 1Q21A 1XD8A 1M7HA 3IO5A 2XGJA 3T5DA 4IEEA 3VFDA 3SYKA 2YHSA 4JKYA 4Q4AB 4QBIA 3HU1A 3P4YA 4RD4A 3R9IA 3S1AA 2PX0A 2ZYTX 2D2FA 2ZI9A 3M0EA 2ZPTX 4AKHA 1XF9A 2ZSFA 5JSZA 2XB2A 2CJWA 4OJQA 1X8JA 1H8HA 1G1MA 2YWGA 1GOTA 5DHAA 4UNQA 2ZROA 3NBYC 3AVQA 1OFTA 1V5WA 4E09A 3WRXC 4URYR 3DEFA 3AKDA 2DZNB 2WOJA 4WXPA 5KDLA 3UG6A 4PZZA 5CITA 2R62A 2HV8A 3EIHA 2N1BA 1NLFA 1M2OB 5HR5A 2JJ1D 2WSSD 1I4DD 2RB4A 1KMHA 3I5YA 4EFNA 5CK5A 2BV3A 4AYWA 3T15A 1P9RA 3TVDA 221PA 2CL7X 1FX0B 4X8MA 5BN5A 1FQJA 4H1VA 2LKCA 4RZUA 3EC1A 2QAGA 2V1UA 3N2EA 2GCPA 4TMTA 2H18A 4A8JC 3SQWA 4YMSA 3B8HA 3G82C 2RGEA 2GAAA 1JXMA 3J81k 2CBZA 2CNWA 2ZYVX 4Q02A 1P2VA 5UKDA 1X37A 1OB5A 1P72A 2QG6A 2CCJA 4MA4A 4QBFA 2FGKA 4YLGA 4C9BA 5GJWC 5JMTA 4OK6A 2C9YA 3I1FA 5DGXA 4B32A 4P4SB 1E9DA 4TSFA 3KKQA 2FFQA 2F43A 5EZ6B 4JBWA 1XEWY 1KK1A 1E9CA 4IXMA 4B3XA 2R9VA 3LBNA 1J2JA 2V8OA 3ETLA 3FMIA 4JLNA 1AQUA 2O8EB 4W7SA 3L2OB 5FTLA 1N6RA 2LCFA 1S3SA 3X2SA 2IS1A 1PJRA 2ONKA 4IOJA 5JJIA 1MABB 3K53A 4ZDWA 3K0AB 3C7KA 2VP6A 2XZOA 3K0CC 3TGPA 2QTHA 2CLCX 4HUTA 1KO1A 3GD7A 4HAUA 1S9HA 1ZM3A 3KXKA 1SGWA 2W00A 2OCBA 1U90A 1WP9A 5C1BA 1OYYA 2CK3A 1RC8A 1W46A 1YR6A 3BAFA 4Z1MA 4B34A 3ND8A 3NH6A 1R6BX 1GUAA 2CLSA 4OHXA 3VKHA 5FR2A 1G8FA 1IXZA 1UDXA 1RIFA 4L15A 1MT0A 1N6HA 3BRWD 4D82A 1Y3AA 1Q1QA 2G9NA 5KNCA 3CRRA 1P61B 3A1WA 2RMKA 2WVJA 4HDQB 1SXJD 4X8OA 3B78A 1Z07A 4OQNA 5G3YA 2QP9X 5JHHB 1U98A 5LPNA 1A5TA 1E79A 1G3RA 3U6BA 1M34E 1T8UA 1N2CE 4PC1A 2XAUA 1LF0A 3K1JA 3CRQA 3MJRA 4IHQA 2XTZA 2ZSAA 1ZVQA 1E2NA 4B2LA 3SJCA 4DLVA 1QHIA 1P2SA 3E70C 2FFBA 4P32A 1WXQA 2VHJA 4JL5A 4TLAA 4J0QA 1AA9A 3KKPA 4R9UC 1KHTA 2IL1A 1AM4D 3KQNA 4FMDF 4FWGA 2PZFA 1GL7A 1D8TA 3MUFA 1E32A 3NHAA 3WMFA 3H1TA 4OI2A 1GG2A 3CR7A 1X8LA 3P32A 4KYIB 4ZKEA 3GMTA 1R0WA 3EZ9A 4TMXA 4YXWA 3A1TA 1S8FA 2P5TB 2JLWA 1CU1A 1VG9B 4PTLA 2O8BA 2QZ4A 3QKRA 2QENA 1AIPA 4PPGA 4PC6A 3EPJA 4HYYA 2GTPA 1QHSA 4BGDA 3CKLA 4M8NE 1T0JB 3W3AA 3VU9A 4BFUA 4LBWA 4CIDA 5JJKA 1E9FA 2DYKA 1Z0KA 3U2QA 4ZCMA 2GCOA 4Q1AA 1NBME 4IOMA 2D4HA 4DCSA 3REFA 3KJIA 2O0JA 3DHWC 4HEJA 3SHWA 3EA5A 5KNDA 1G7TA 3BORA 3HPRA 2Q3FA 3L43A 2BMFA 2W6IA 2IYSA 2CE7A 1VCOA 1JR3D 2X2EA 2GRJA 3W34A 4LJ7A 4G5OA 3IEVA 2PEYA 3BK7A 2VSXA 2DB3A 2QSYA 4HAZA 4A15A 5HTKA 2ORVA 3OIWA 3TUJC 3IQWA 2Q3HA 1U8ZA 3PJRA 1X1RA 4RVCA 1E2QA 3GCGA 1D2NA 1WRBA 4GDFA
chains in the Genus database with same CATH superfamily
1H2WA 3O75A 4R5MA 5EJAA 2B1RA 1BKDR 1KEEB 2AH5A 1KI6B 4YTEA 3L7AA 4NS4A 4W1QA 2H8KA 4RUKA 2J30A 5FBRB 1C1KA 3D6VA 5IMSA 1LK0A 1N25A 3ANXA 3PHLA 4CEIA 1RM5A 4PICA 3UJAA 3MT8A 3QUAA 3VNAA 2J9YB 3QLVA 4O2LA 3KR0A 3K7EA 1U31A 3KTAA 2F9LA 1CY6A 4DUZM 4KPUA 1ENZA 4CDRA 4ENWA 2G83A 3SASA 4JV5M 4CEHB 1SOUA 2I6XA 1KRWA 1ACJA 4ZMBA 2JW5A 1EX7A 3JY6A 2P9EA 4E15A 3R8FA 5BSFA 5ITQA 3I72A 1VFNA 2X4IA 3VO9A 3N7UA 5ARDA 4G41A 1MJ5A 3A9UA 4O08A 3S81A 3VR5D 3E21A 1L8LA 1GU1A 1ND6A 3V6MA 2PL5A 3B1ZA 3HU3A 3TW4A 4P6VF 4OAQA 3VZDA 4NZ9A 5KNDH 5GOTA 2R6GA 1G6HA 4JBGA 5K0LA 2XFSA 5FSWA 2ODEA 1XWFA 5DCYA 2FZVA 4LZLA 2AFRA 2E5LM 5EEGA 5AW4A 1MD9A 1Q83A 2D7CA 3AESB 3AZQA 3ICCA 1CULC 3DVAA 4HWSA 2CFOA 1Z9BA 1JTEA 1R0RE 3BN3A 4PLGA 3EH2A 1PQYA 3SXPA 2G63A 1H2AS 3GA0A 2PBLA 3PVSA 1DSSG 2P9QA 2GVDC 3BULA 1QJCA 4BJHB 5E2AA 3REQB 5F23A 1GUBA 2ZWOA 3PB3A 4DSAA 1Q1EA 2GAFA 2X9VA 1W9MA 2A14A 4EGJA 3QMWA 1U1IA 3G0BA 2EKDA 3L0BA 3QMVA 2ZAYA 1B3RA 3AWIA 1Q17A 5KBYA 3FSJX 4JB8A 4DAEA 1N1DA 2C94A 3GUCA 3UXMA 1U3GA 1YR1A 1DGFA 3BIJA 1MB2A 1C9NA 5LZ2A 2Q7XA 2DQKA 2WB4A 5ITWA 5HWSA 1QIGA 5E0OA 4RY0A 1BEEA 1KOJA 5AHRA 4X66M 3QW4B 4TL6A 3K4PA 1OC2A 4GP6A 1XGKA 5IAGA 3R3ZA 5JRZA 3WIVA 3IBGA 4ZTUB 5JCOA 1WQ4A 1KOLA 2E55A 3AR4A 3HJFA 4JD5A 1CZUA 1ISGA 4OHOA 1CT9A 2BDEA 5F1OA 1NJFA 2EFCB 1NJ2A 2Y8EA 2VPPA 1SC4A 3FX2A 1T25A 5EE3A 2FMIA 1P5HA 1ID8A 1OXVA 4Z7NB 4IWXA 3PGMA 4EO4A 3U9SA 1TYDE 4B6SA 1B0PA 3D0KA 2Q4DA 1BWQA 1WKCA 5DGDA 2HXGA 3OEHA 4JVNA 2F64A 3L25A 5E3JA 3SCZA 1NJ8A 5AR1A 3CBGA 4Z0NA 4AS1A 4AG6A 2GPJA 3JVVA 4HDOB 1E2GA 5HGJA 5K6AA 5FUVA 3T41A 4CCYB 4TYQA 4MVJP 3DKKA 2WIFA 1Q1BA 2FKAA 5DNCA 4ONEA 3H1PA 1BMFA 2PT7A 2B7LA 1IJBA 1PHRA 3CJTA 1R0KA 1ZBDA 1BYUA 4BMPB 3QVKA 4WOKA 3OOEA 3DYBA 4J75A 3PICA 1RR6A 3GCXA 5LZ9A 4ETNA 3GT4A 4X20A 1HKHA 3D5EA 2F1RA 4HVAA 4F60A 4ZK2A 1S2GA 3OPVA 3L93A 5CB6A 4XDHA 4NMXB 5K8CA 1RAEA 3TD9A 4B09A 3M70A 3VM6A 2NACA 2C57A 3EWSA 4J0GA 2QX9A 4RQUA 2FKNA 5L8VA 1Y9JA 4TTRA 4D9MA 4A23A 1N3IA 1FNBA 3PUKA 4EBBA 1M1YB 3O8NA 5KTRA 3DUFB 5EFZA 2J0SA 1XMQB 3D6UA 1TGVA 1L8XA 2H7VA 1WCIB 1JIXA 1O94A 4IRUB 3SEAA 1L7NA 5DNYB 5A4KA 5I7AA 2I7XA 1RPZA 4OREX 1YGYA 4B5KA 4H7HA 2I2FA 2F3RA 1VL1A 5JDCC 3C6MA 2IYYA 1ZIYA 3ZCRA 3H42B 4I6JA 4CHTB 3R7BA 4Q19A 1BE8A 2FVXA 3EIWA 3EVEA 4QICA 4IZOA 3HZRA 5A9SB 3VZPA 3CE6A 3WICA 1S7CA 2PMDA 2QTCA 2IXDA 3ADBA 1JB0F 1WBJB 2HYIC 4IJVA 4DEXA 4D9HA 5MF6A 5E6SB 4AO6A 4ZANA 1QZTA 1U0JA 2ACKA 3QVMA 1N6IA 3H4JA 4TYWA 5HA5A 2EJSA 2I7TA 3WA6A 4WESA 3T3MB 3K0AA 3U4QB 4Q3DA 5C0OE 4LV6A 3PQ4A 3GFTA 3U9TA 4F3RA 4ADSG 1G6OA 1XU4A 5ICEA 2LVPC 1X74A 2ZJ8A 5I4KA 2Q4RA 4G1CA 5BWMA 4FZ3A 4H0NA 1EIWA 4MGZE 4JLSA 4IX9A 4RDIA 3RS4A 4B3RM 2FOIA 4RWEA 3D1VA 3GROA 3N9IA 4BVEA 4U6SA 1Z6TA 5JCPA 4O4IB 4L8LA 3B20A 1YBAA 2KBEA 2NNWB 3U6SA 1Z06A 3GK3A 4QOHA 3GBSA 4TLDA 3W0LB 3IHTA 2NYRA 1Q1GA 4PN7A 2HLDA 3L1JA 1ULUA 4RAQA 1LJUA 2G07A 1WS6A 4P4UA 1SFRA 2YC2C 1YVEI 3ZQ6A 5FI0B 4RZ3A 4CKBA 4RTRA 4ZHQF 4O2BB 2X0EA 4KDCA 3IT1A 5J3JA 3M3PA 1DO2A 4CCAA 4TKUB 1MBZA 2J7NA 1MOPA 2VHZA 5JJ5A 2RGOA 2LBPA 2FW9A 5U9CA 3R3JA 3RVKA 4QSMA 3D0OA 3ZWDA 3L7LA 1IEVA 1DWPA 5G53C 3F6BX 4IAOA 3U7RA 2B5WA 2P9HA 3SQNA 2JGIA 1VHQA 1J70A 1R6VA 5JNSA 1BCRB 4LDRA 2JNWA 3W5VA 3NQ41 4WCVA 1QYIA 4YDHB 1SEVA 4LWZA 1L5MA 3NKVA 1Z4OA 4A6XA 1ZESA 3MINB 4KJXA 5FL7A 2A2ZA 4RSMA 2QT9A 1AHNA 2CJWB 2AMVA 3NUQA 5BNIA 4PZEA 4IO1A 2DX7A 4HNUA 3KJQA 3SNKA 4E4RA 1MP0A 2X8BA 3AI3A 3TXYA 3P26A 4P2BA 1YXMA 3OOSA 4ZXFA 1E4VA 3JTMA 4MUEA 3JQ8B 1OR8A 5DE3A 1C7QA 1JHDA 5I6DA 1EQUA 2OBBA 2NO0A 1TF2A 2J31A 4ZEVA 1N0WA 3CW2A 1NXOA 4MB2A 3INYA 3MYYA 3I58A 4NBSA 4KREA 3ANSA 2X3UA 3T1YM 1X7WA 4I1VA 3IOEA 3RAGA 2QSFX 2B8TA 1JWLA 3KOOA 5KTKA 4LRXA 3EXIA 3EIQA 2G4CA 3OA0A 3DC7A 2CMDA 3K70B 3B6JA 3TQTA 2XCQA 1CVIA 2H11A 1EAMA 3FVVA 4HDKA 1YFKA 3C8HA 1ZLXA 2GM5A 3ISVA 3HVUA 3RFWA 3SVLA 1U0RA 1ECFA 1JTVA 3H9CA 4F8EA 2J5XA 3TLAA 1CRQA 4ZCRA 2GN6A 3TLXA 2GPNA 1GVHA 1NVVQ 1M6NA 3CM0A 3TKAA 1AUVA 3HMKA 4M8SA 1EGVB 3R3SA 2XYRA 4CODB 3O8QB 2QAJA 4MUBA 2E4YA 4C0SA 2DNAA 3GLVA 3H5LA 1NVMA 1KMMA 5DXFA 4FQ5A 3OQOA 3ZVKA 1RAIA 1F6WA 3RT9A 1XO1A 3C7AA 3WTCA 3IOMA 2QSUA 1W2HA 4CMKA 4YJHA 4FWHA 3FDFA 4FFOA 4NIMA 5CFOA 1YCDA 5K5EA 1F06A 1CUSA 3JQFC 3KFUG 3WKAA 1YD7A 1LI7A 2ZTCA 5AKKA 2Q5QA 2JLUA 3I42A 1CG6A 4MLZA 2GN4A 4Y0NA 1YCGA 3WP1B 3HEAA 4DLAA 2J7PD 2R4EA 4GQAA 4MH0E 3TBHA 3S2IA 3ASVA 4TLLB 1NBIA 3CR3C 1DJOA 3AKYA 2CF6A 4FFMA 5B3LA 3WGIA 3OKCA 4K8RB 1QH1A 3LC0A 4Z6YA 1AF7A 4MVJF 4LXIA 3VBEA 4K9NA 3UCEA 1NQAO 3ENVA 3UHJA 3W7AA 4OHWA 1VEGA 2OBLA 3DL7A 2VCYA 4V0QA 2NTNA 2MTBA 2L18A 1CF9A 4NZYA 3W68A 2GTIA 2CL6X 2HMAA 3AY6A 4OBWA 1P80A 1HE5A 3IDAA 2EGHA 4OQMA 3Q7QA 3CVWA 1DWQA 4Z3KA 1F12A 2Q8PA 1NW7A 3K6RA 1JHQA 4ZIRA 1SD1A 1C29B 4QDUA 2GEFA 3PSHA 2AI1A 3K6SA 4Y2SA 2L2QA 1DEXA 3U44B 3BSFA 1OC4A 1SKYE 4URWR 1OLOA 3PGXA 1J1UA 2RGGA 1U4SA 3VR6H 3VAAA 2YRXA 1G7SA 5C2JB 2IEDA 3AVXA 2NXWA 3VH1A 1U7HA 1I5OA 2ASEA 1W5FA 1X7DA 5BSWA 4Y8VA 3AETA 3HB9A 1IN1A 1U8EA 4XE5A 1H22A 2W6PA 2JCYA 2ZSKA 3GELA 5EIBD 3QBJA 1USUA 1YJCA 1IBCA 2A1IA 3JQEA 4CKEB 1FFGA 4LJ9A 4BX0A 5F7OA 2O1WA 2QRGA 3ACBA 2ATCA 3KQKA 1M76A 4K6OA 2X5KO 4FNGA 2HCBA 3I9V6 5HDQA 2YQZA 4D4JA 4Y2PA 3WL7A 4XR9A 5LOVF 1MQ9A 2Q6VA 3R3WA 4AWAA 2OQIA 4O33A 3B1FA 5E7IA 4OLAA 2B69A 3VVCA 4AZ0A 3FAKA 3CNHA 4G4JA 4TYNA 4WK4B 3OX4A 1AKYA 5HE9A 2BCJQ 1TF0B 2M60A 2DH5A 3L0OA 2GJ4A 4UTRA 3I73A 1PJAA 3M5DA 4U2DA 2P9FA 3GA7A 3B13B 3NDRA 3G02A 3W7VA 2WPNA 1EM8B 3HRHA 4TYPA 3CG4A 3GJ0A 2ODWA 2XADA 1ZD2P 2OOAA 2Q41A 4V0LA 3CH5A 3HXKA 5TSDA 3NS7A 4YP7A 2Y4NA 1SU8A 2GO1A 4JA2A 5K3FA 5ALMA 4NARA 1G71A 4M6WA 3I2GA 5KNBA 1GL6A 1B1CA 2ZI3A 4RV4A 5J2TB 2ODBA 2CMHA 3GUVA 1RYYA 1UFZA 4G0YA 5F9FA 2P9CA 3AVWA 1ZGJA 2HY7A 4XA8A 4JB0A 3LUFA 5ALFA 2WJ4A 1GYPA 4OV6B 3ZCTA 2C9BA 4JLPA 4F84A 1XP5A 5JD6A 1DIRA 3BD7A 1F51E 1NATA 4LCJA 2F17A 3GF4A 1QORA 1TT5B 2PPLA 5G1NA 5CYPA 3E61A 1SQ6A 1UC4B 5DM4A 2FMFA 2FCAA 1AXRA 4LRUA 3EE6A 3MK6A 4JDUA 3KD3A 4JI5M 1U2TA 4LF4M 3KM0A 3AIOA 1RYNA 2IX9A 5CX1B 2EG5A 2VUTA 1ADBA 1NQVA 4KNYA 2IEIA 4IQ0A 4R1LA 2VQFM 4PCUA 3SBDA 3IERA 3PQFA 4E32A 4NABA 3BAZA 1LQUA 4CQMB 2WSMA 2J41A 1YSYA 4C2AA 3RTBA 2P40A 4TZKA 1ICIA 1W36C 4POAA 1AZTA 1VC2A 4F6RB 2EP5A 4MR9B 4GZLA 4YIKA 1UC5B 3PXAA 1TEVA 4QPPA 5LUBA 2JFHA 1WVIA 4NX2A 4ZARA 4BCBA 4EF4A 1NY5A 2VH2A 3VSAA 2F5NA 1RC1A 1H6BA 4RS4A 3LQRA 4FGKA 2W37A 1KI9A 5JC8A 3HXOA 3TCXB 1X1SA 2OV6A 1XNHA 1L4FA 2YVKA 1TX4B 4QU0A 1N6PA 4HDMB 2O7SA 4I55A 5HIAA 2WVAA 4EGCB 2F59A 3CLTC 1G8PA 5FPTA 3MJDA 4W9NA 1FRQA 4M9SA 5AJVB 4IBIA 2CVHA 4DR7B 3X1ZA 2QX7A 4JB2A 4V0MA 1JTFA 1XB2B 1A7AA 4N0EA 3WISA 4U9HS 1IUOA 4GOOD 1NI4A 2IHBA 3GPPA 1Y6RA 2PS9A 3KRTA 3KOYA 4M86A 3C6QA 1VDZA 4B87A 4AG5A 1XQVA 2PUWA 3TW8A 4G0VA 3ZD7A 3PHBE 1ZR4A 3ICWA 4DUYM 5EXPA 2HRRA 3D0QA 2RK4A 3SQLA 1E4EB 3WZLA 3T5DA 1M9NA 1Z38A 2P2CA 3IVXA 1OQYA 4MIKA 4MKXA 3NPAA 4KN9S 4R68A 4JJ4A 1OFTA 3DEFA 1GPWB 2I34A 1L4BA 5CITA 4QDXA 2JGFA 4ZOCA 1E8NA 1Q0ZA 3I5YA 2LHGA 3K05A 4DS3A 4KXMA 2H18A 1OLSB 1E3TA 4Q02A 3GH1A 2QUBA 1EE1A 4ZI7B 4OK6A 3LUKA 5M34A 3SEZA 1FXSA 1N5DA 1M8JA 1SRRA 3RTDA 4ZO6A 2RIRA 5K0GA 1RZRD 2FLKA 4B08A 2VP6A 3F92A 2YZKA 1F8YA 1Y1QA 3ZBQA 1PGNA 1RLOA 3DGEC 3NV7A 4REQB 1G8FA 4B8ZA 1EWVA 1X94A 1YRQA 4HUJA 3I12A 2BFDA 3IYLW 4YFVA 1XZCA 4KX3A 2XAUA 1X2BA 2Y1EA 4I1IA 2ST1A 1LQTA 2LVNC 1DGQA 4TLAA 4HPWA 1F38A 1E62A 1KVTA 1S8FA 2GDZA 3HUEA 2O8BA 4OLFA 5HZMA 3AL3A 4WY5A 4KE6A 4CBVA 1YV9A 3TQHA 2FZGA 4N76A 3EA5A 1DIGA 2I3GA 3ZNQA 4FJ1A 1HI9A 2BF4A 5IARA 1NYTA 3TUJC 1GUFA 2YV2A 2XB6A 3OCJA 2WHRA 4GYYA 4NLLA 1JALA 2IPLA 3ANYB 2NO6A 5CDSA 3U61A 1H8HD 1CUAA 4LXYA 3EB9A 2YXPX 2HWWA 2V59A 3OZAA 4Z3OA 4X00A 1J8DA 4MX8A 4W8OA 3I9LA 5DWQA 1U9JA 3TZCA 1JHZA 1ZI8A 1YMUA 4CG2A 4MRAA 1A5SB 1ZL0A 3LX8A 2C7VA 1NASA 2MSWA 4O8CA 2X8LA 3ETCA 3MWEB 1ND5A 4P0PB 4R6WA 3UIEA 4BKRA 1CUXA 2CF5A 3MUNA 4Y1GA 1JKIA 1M2KA 1YE9A 2EJBA 2H08A 3CIFA 2AFHA 2Z98A 3H19A 3KSDO 4H7FA 2CMFA 1FP7A 4K2AA 5K99A 1FSGA 1W581 4IBFA 1QE3A 4F2WA 2ERCA 3RVBA 4LJAA 4IFBA 3EXFA 4EW3A 2EUCA 1Z4LA 3FTDA 4X1KB 1SHKA 3BVPA 1GVNB 4W6QA 2PUFA 2YV1A 1IHUA 4DWVA 2FTKE 2OT3B 2F1IA 3HPQA 3DDHA 4ZDIA 4YRAA 3HGTA 3HR7A 3NBAA 2Q07A 4N0DA 3KXPA 2GA9A 4BB5A 4QYWA 3S1SA 4Q7LA 1JIVA 4LFCB 3HUFA 2OCPA 4G4GA 4FFWA 2BHSA 1ZN9A 1F8XA 4NESA 3WKDA 3W5BA 5B6IA 5EYPA 3HCEA 3QNUA 5INTA 1ESDA 1VJRA 3RYIA 3NHKA 1X1QA 1NURA 2IH5A 3JASA 4Y7CA 5IKXA 1L8OA 1MRNA 4RHEA 3U31A 3JQDA 1W4BA 2G82A 3C3BA 3VX3A 1JQJC 5ALKA 3GN2A 4UEWA 4FSDA 2FR8C 2KE5A 2CMKA 5AD1A 2JAPA 3ASYA 2BZ1A 3ZTYA 4ARCA 4FFSA 4I99A 1VLHA 4AQYM 3OI7A 2PKXA 3CZAA 1H9BA 1TCBA 1E77A 1HNWB 2CUTA 1YKSA 3T9FA 2RC5A 3D0RA 5BW6B 1VYTA 1XN1A 4GC9A 1Z6XA 2DGDA 4D9JA 4N3NA 4KAAA 1CS0B 1QQTA 5T57A 5IW8A 4JQSA 3UVEA 2FW1A 1TZ2A 2EL7A 1UMKA 3ACCA 2I6TA 3L0PA 3P4UA 5E4JA 4C1NA 2BC9A 3FMFA 4DIOA 3GDOA 4FT2A 4RTPA 3THWB 1JJFA 2A9KA 4LC1A 2B1IA 1AK9A 1W19A 1X86B 1GSAA 4CV3A 1KDRA 1IWBB 4Q4JB 3NP9A 1WR8A 4R9SA 4CT5A 3TX6A 3V1UA 1CNMA 2PLNA 1XSEA 1CHDA 5G40A 1W30A 5A4JA 3ZXSA 3JD0A 4NCIA 1E3LA 4ZD6A 4PYKA 1E2PA 1EUQA 3NIFB 3PK0A 3VV3A 3AUAA 1IM5A 4F56A 3JVEA 3A7EA 1W4LA 1DC7A 4WFKA 2CYCA 3FLEA 4TZ6A 4EPWA 2VWGA 2O8CA 2HV9A 5A0FA 3WSVA 5BVHB 2XXAB 4Y1RA 3BFJA 2HNKA 1E92A 3N5CA 2IGTA 2DCUA 2MWMA 3BILA 3GLIB 1CNFA 3GQBB 1M8PA 4R0NA 2C7GA 5JC1A 1H4TA 1HT2E 2REQB 1H0SA 4NKRA 1YE8A 4LKRA 1NWHA 4XUDA 4JS0A 1KY2A 1XXHE 4EY4A 1ULTA 4FBGA 3UXHA 5FUYA 2WMNB 4HXYA 2BE9A 3SOZA 1E7WA 3AF4A 2ZE7A 1N8KA 1LNSA 4E03A 1JI0A 3IVRA 1X7ZB 1VJGA 4L8YA 1RWQA 1CUFA 5FFNA 2DVMA 2P4SA 3RTGA 3OO0A 5JH7A 3QVLA 3HYLA 2V5AA 2WKQA 4WK6A 4XQGA 4JBYA 3BE4A 2DWMA 1L4LA 5AW8A 5IH7A 3RYFA 1TVKA 3U17A 1R8YA 4PPFA 4UDNA 3NBZC 3D54D 2C88A 3MWDB 2PVPA 2I66A 3EXEB 1Z39A 1PL6A 4KQCA 2NTYC 2VP2A 2A1UA 4UHBA 1I30A 5CFNA 2BFWA 3OFSA 3CF0A 1RADA 1SVIA 1HLGA 4M0EA 4B0PA 3W2TA 3R0VA 3VKUA 3FI0A 4XM1A 4EUSA 5DOZA 4QDOA 1NSFA 1T34A 2Y1GA 2FEAA 4XLLA 3SC6A 2YQ5A 4LG1A 2DLCX 3W2EA 5BORA 2R0IA 4MJLA 5JD4A 2QG9A 3WDKA 5DO9A 3TL2A 2JZ0A 4AM8A 2WZBA 3E58A 3TAUA 1JN0A 2HDHA 2BKEA 1KTIA 4GI2A 3KZ1E 2PFSA 5DIZA 5BY2A 4OI4A 3LV8A 5C1OA 5B1IA 2E4ZA 5J4HA 4RKRA 4B43A 4UM9B 5BRJA 5KVAA 5KPZA 3CZRA 4MLDA 2W2QA 1HFWA 1KI4A 4CWAA 4O4IF 3LUCA 3KYDB 4D3FA 4KITB 1SIWA 2O2GA 1KS2A 1QZMA 2QSJA 5FF9A 5I45A 1QYDA 3MT9A 4JWKA 2Y92A 1OV4A 4AJ2A 3CN9A 5EE5B 4BBJA 2DUWA 4BXOB 5C8DA 1RYZA 2AGVA 2B99A 2KHHA 4JC0A 4DCMA 1WUIS 4V38A 3GJ7A 2WWIA 1ZUD1 1YZHA 1C8KA 2ZDHA 4X7RA 2E4UA 4LISA 2EBWA 4O2BF 2R44A 2IYXA 1NMEA 3T7IA 3WNQA 1I6WA 4EELA 1BHJA 1IL0A 4R71A 1XTUA 5I47A 1IATA 2AOUB 3M82A 4MVCA 2C9OA 3OY7A 1ZISA 1I5RA 1Z47A 1PJTA 2FQYA 1U0GA 2Q3MA 2W6ZA 4N5MA 4P4GA 1GZVA 1DAFA 4I8DA 4AT1A 2PSHA 1XF1A 1L6IA 2X9GA 3IRUA 5ELXA 3KAKA 1AKMA 3MUOA 4NBKA 4D8YA 4F5YA 1D0MA 2FG7C 4GLOA 5K8JB 4JN6A 4B80A 1X14A 4PTZA 4BLQA 1GQRA 3PHGA 2BR3A 3NHYA 4Y1EA 4Q3KA 2BGKA 1IZ0A 1ZUNA 3PF8A 4CF5A 4Z4FA 4E3WA 1LPBB 3LLSA 3QPVA 4CM7A 4MQ5A 4LX0A 1P7CA 4QUHA 1PT9A 2J9ZB 5SZIA 5AVVA 1GGKA 5DX8A 4KLRA 2P2ZA 3UT5B 3IX7A 4KBGA 4UNPA 2FMKA 4CI0B 1ZMBA 1NY6A 3BXWA 3BE8A 2OR3A 1VCNA 5K8IA 3SZMA 3ZCVA 2K0BX 3KB2A 4L6AA 1DAHA 1FSPA 2BHTA 1K4YA 1XCPA 1I2BA 2WTMA 5EAIA 2WPDD 3ENWA 4FNMA 2CUNA 1PWEA 3O84A 3I4LA 1FUYB 2PFKA 2PQ2A 2JFBA 1KP9A 3STTA 3GPUA 3ZKWA 2WJYA 3L07A 4BLWA 3HDYA 3N0WA 1LF5A 4GR4A 1RBZA 4CM9D 1P19A 1O9HA 3B74A 1JHOA 2O3JA 3U0VA 3H86A 1O97D 4DCOA 1OXTA 2AHMA 3WJ7A 3NHRA 2VYVA 1X70A 5ITVA 4YAEA 1VHWA 4AG3A 3L05A 4JWTA 1XVLA 4N18A 2PXXA 4CFYA 1DEKA 4S35A 4JEIA 4L9WA 2YHUA 4BO9A 4E2YA 4C0XA 1XHFA 3EGDB 2Q5FA 2PKYX 3SIPA 5T4HA 1ZK3A 1AN0A 1GNQA 4YK7A 1VRVA 3UMRA 3P5SA 1T9BA 2OV3A 5C34B 1Q16A 2VNSA 3AF3A 3F6EX 1BE0A 3TGLA 1QIMA 3I0NA 2GBPA 5KI6A 4LHEA 1Q0SA 5G0WA 1SUCA 4C30A 5J5VA 1SUFA 4KGZA 1V95A 3SJBA 1ORYB 1VDMA 1XJQA 5BSKA 1XZLA 3PJGA 2CGEA 4YBRA 3ULKA 3VZQA 3FMPB 3LOQA 2EBHX 2X40A 4YJFB 4RVFA 3TSAA 3MTDA 2R7KA 4HADA 2WIAA 5TVGA 3T6PA 2UZ1A 3PNMA 1FUKA 4EVSA 1PUJA 3QFCA 2D8AA 4DJEC 3IKVA 3QK7A 2WTXA 4PZDA 2GJ9A 4XD7A 4LHSA 2AI3A 1SEPA 3EDMA 1A95A 3D81A 4RD2A 1R16A 3BZWA 1QHYA 2DU8A 2G8LA 3PVCA 1O95C 1L4HA 2X9QA 4D4GA 3KXDA 4HLQA 1KDZA 3H2ZA 1K6EA 1OWNA 3OM1A 1YZTA 1XUOA 3IV7A 3L8CA 1NR5A 2LRHA 1GTRA 4RMGA 1GLNA 4J16A 1V96A 3VR2D 4B3JA 5A4DA 2H1VA 4CEIB 4Q82A 4O4LA 2P65A 2R65A 2B1JA 3WKCA 2VF7A 3D1JA 4D4LA 2HPHA 4GAEA 1SXJC 2MT9A 1Z15A 1UM9A 4IF6A 4ALJA 4JQOA 4CDNA 4UBNA 1VG0B 3KTAB 4QUIA 5BMOA 4KPUB 2EJWA 1FNNA 2RC6A 3TXAA 1RWPA 1QYVA 4H3HB 2BFPA 4KVZA 3WHIA 3CVVA 2EP8A 2LVAA 2XYHA 3PHCA 1NM5C 4EYOA 2HTFA 2EJCA 5EE0A 5FUMA 1C4XA 3TO5A 2QLFA 3DOFA 2VXYA 4EO9A 1UBFA 3QU9A 4ABYA 4LG2A 1RQNA 2XBMA 3MJ5A 3F78A 4WSOA 1XJ5A 4ENRA 2XB8A 4B6PA 1QG2A 5IC5A 3H8WA 3E0QA 1MO2A 3FM9A 4YAKA 3T4XA 1T4CA 3PFGA 3I52A 4AY5A 1FZTA 4MRMA 3KKLA 4ZAGA 1XRQA 5FOWA 3RS2A 4CTKA 3H1GA 3HBNA 3QVVA 3VTKA 1Q22A 1NC3A 2YH2A 4EQ6A 4QUEA 3LCVB 3FZGA 3HY3A 3DVAB 1FLDA 2HHAA 2OSBA 3KE8A 1F9AA 1XQWA 2XHZA 5A4MS 2PV7A 1QTRA 1CZLA 1H2ZA 1N75A 4ZVPA 4GP7A 1ZH4A 1N5LA 1R4GA 1EBBA 1TW3A 1ZN2A 4N8SA 1U28A 2JEOA 1X2EA 3ZTTA 4F92B 4PGMA 3RARA 1HZZA 4PXSA 1UFOA 1G4AE 3ANLA 3S7ZA 2QIPA 1M74A 4RH3A 4UREA 2G9ZA 4TMZA 5HOQA 4MQMA 1CLUA 5J2TF 4C43A 2VUIB 3BFXA 3WGYA 1TT7A 3W9SA 1LFAA 1QE5A 1VPTA 2B83A 4KMRA 1JQBA 8AT1A 2WUDA 1ZD3A 3CU5A 1R27A 3ROZA 1UPTA 1DC5A 2HM7A 2O07A 4PHFA 2ZJOA 3NTQA 1B0AA 5CXUA 4RJTA 4GBMA 3OIGA 1ZLYA 4A36A 2UUAB 1HH4A 1RD4A 2PD6A 2CLIB 3Q7RA 5AXDA 2V8BA 5H7XA 4M38A 2HMVA 1K6XA 4KDFA 2YY7A 3C5EA 4GMKA 3BXHA 4ND5A 4JVSB 3JYOA 4XYLA 4LXUA 3DHYA 3ZJTA 3OAAA 5IZ4A 3I9KA 4C06A 1IHPA 4OQLA 5EZQA 4JI8B 1O6FA 4GKKM 3SLRA 1P4SA 5HMLA 3DVQX 1U9CA 1VL6A 3KCQA 3Q9UA 1BNCA 2Z3ZA 3U26A 4QYTA 4XFKA 3QEOA 3WL6A 2J7OA 1LTMA 3BH0A 5HRAA 1RWVA 3IIMA 2JLSA 1Q2UA 4OM8A 5ALOA 1DCFA 1OY1A 4WZZA 4A1FA 4MUYA 3ORHA 3VOBA 1U02A 2E5FA 1VPVA 3K1TA 5IAOA 1W8IA 1WF6A 4MINA 2MR5A 3AINA 3R40A 3L7CA 5MGBA 4QVGA 3BE5A 2H1LA 4GOLD 1A97A 2F8LA 3MJTA 2J0UA 2WU3A 1X87A 2PBRA 5J63A 2QLMA 2LIVA 1US8A 4QSHA 4JEMA 1K8RA 1XQ6A 4RGVA 3SU8A 1YRWA 3QLEA 1RXEA 3IMEA 3L7IA 3URMA 2H1OA 3VU3A 3UANA 1GZ7A 3MWLA 5KTYA 3OTOB 1AV6A 2GF9A 2I4TA 2IGBA 3QBVA 3KSJA 1ENOA 3ZV3A 1LJ8A 4F4UA 2BEUA 3KKNA 1SQ5A 3GVCA 3OY2A 4C4TA 4LAFA 2IE8A 1QZXA 1SHTX 3S6JA 8OHMA 4HI0E 4X20B 4LUCA 2CHGA 9ABPA 4WKPA 1DBQA 4EFMA 3IP9A 1LDYA 4X64B 3BRWA 4DCNA 3D2CA 3DNMA 3FKSD 1CWUA 2QUZA 2FMXA 4OF4A 1S2MA 1RCUA 2QX8A 5F77A 2FZ5A 4QUDA 2V7QD 3LUDA 1E2KA 3FWHA 2Y0QA 4EGAA 2VKQA 2REXB 3CZ5A 1BWRA 3AHJA 2R18A 1SCQA 3ZDZB 6GPBA 3KOZE 5FO1A 2OM2A 1FNMA 4BZPA 1FDTA 4PX5A 4C0JA 4WW0A 1WR1B 3GG9A 4ZI7F 2MIIA 3K9WA 4LYAA 2V03A 3AR2A 4Z5XA 5LUAA 3E05A 1JR3A 3C9PA 3VR6A 3HXPA 3HH8A 2IITA 2GWRA 2HR1A 4E5VA 3S1AA 2ZPTX 3H11A 4F5WA 1QNLA 3KPVA 1H93A 3ZK7A 4H3VA 4UNQA 1XNQM 1C9DB 1I2ZA 1C3XA 4NMLA 1YLAA 4DV1B 4WXPA 2IOHA 3H5VA 2OGTA 1W52X 2JJ1D 5K0FA 1VSBA 3CTWB 4RZUA 3R76A 4J0KA 3UYKA 3U81A 1UOEA 4V39A 1B41A 3SQWA 4IIXA 4YMSA 1NR1A 2RGEA 3TQSA 1ZBQA 5HIIA 4MPDA 3I8OA 2WM3A 1GTL1 1JSLA 3MYRA 3I1FA 4Z0TA 3L0YA 4JP1A 4TSFA 3ML1A 1E9CA 2JZCA 4WESB 1GA4A 1Z16A 3K0AB 2VNJA 3TGPA 2X3YA 5AXBA 5DX1A 1OYYA 3DULA 3QFHA 3ND8A 1UDXA 2TSYB 2QJFA 1Y4DE 2BGLA 3RYCA 2JY8A 2A67A 5LPNA 4BWFB 2PTGA 1HEUA 4MAAA 4PC1A 5IT9A 2XTZA 3C7CB 3TMYA 2PT6A 1KEKA 3IV6A 5HJ7A 1KY4A 1QHEA 4F2LA 1JEQA 5E9AA 5JSUA 4I3GA 2HHLA 2Z3VA 1B74A 4LS3A 4QUJA 5C3UA 2VJDA 4IOMA 3E82A 2PJDA 4WBNA 2W6NA 4AS2A 1LRJA 2W6IA 1TYEB 3VO2A 4V24A 4Q3OA 4CKBB 1NBEA 3L8EA 1HWYA 3NCHA 1E59A 1WU7A 4HO1X 2W2XA 2GD6A 3GRPA 1A2BA 2XOKA 4MGIR 2BUCA 3AIIA 1E4YA 1A9OA 1S8NA 3PC4A 2OHGA 1PZFA 4FMDB 5BW8A 3HSSA 3LD9A 5KVQA 1BN6A 1ZOLA 5TQVA 2WZDA 3KSBC 2R6AA 3Q3IA 3Q3VA 3NR2A 1C1XA 4J0HA 3T3PB 4DR6B 3OTIA 5CNKA 2XNCA 3DAFA 2IV3A 3QNWA 2RBKA 4OHBA 3ORQA 3A0RB 1SZDA 3Q15C 4HNQA 4Y0VA 3VRHA 1Y6FA 1K86A 4BEVA 3L0DA 1C0PA 1EU1A 5LQSA 2B8WA 5AUPB 1E5TA 1DQPA 1ONPA 3BWBA 4N54A 3NHMA 2OCAA 3CEHA 1XCJA 2OAGA 2A5GA 4RK4A 1FW8A 4EI2A 3OIUA 2NU8A 2BF7A 3ZE6A 1SC3A 3ZDAA 2JCXA 1U0EA 2Q5IA 3VR5H 4CG1A 4AUMA 4URHA 3IUYA 1M54A 1ZOSA 3Q87B 4MKFA 3HS3A 4KQFA 1RWWA 3F5QA 2V0CA 4MI6A 1X7WB 3SDSA 5LM3A 3AHCA 5H59A 2O1EA 3V8RA 2QE7A 1SUAA 3IG8A 2NXJA 1GZ5A 2N0SA 3WWEA 1I0IA 3EXIB 3ROGA 4JODA 4B4KA 5FUQA 1SKUA 3UMCA 4RMNA 4IIFA 2G17A 4HDKB 1ATZA 1MHTA 2FUEA 4JQZA 2X8AA 1V7ZA 4E88A 4NCJA 1USIA 1LRKA 5LP1A 1FQOA 1RLMA 3W5JA 3VKVA 2GYWA 3J7BA 1RP1A 5ESXA 4GX0A 3VO8A 4CFSA 4Q4LA 2X9NA 5ILQA 4NCBA 4C6TA 4QLBA 5JU6A 2C2YA 2O06A 2BNKA 5K6TA 3GLHE 3QQPA 4EA7A 4R81A 2DECA 1MPXA 3LOUA 1V5FA 4AKGA 1D0IA 4RHXA 1NVMB 1VLMA 2GBLA 5GWXA 4MAMA 4HF7A 2W8BA 2C7BA 2QMHA 2XEPA 3WGVA 1SO8A 1G20E 1N3YA 1ZU5A 3RGGA 5ALXA 2XH9A 2QD4A 2VRCD 1X0VA 4KWEA 4GMHA 4YJHB 1Y81A 4B7ZA 5E7JA 3PA6A 2B6NA 4M8KA 1F0KA 2CZGA 2IIQA 2POCA 3JZFA 4I2VA 4NYIR 3LDUA 4RCZA 4I66A 3FH0A 1L2DA 5G0SA 1RQGA 1E9AA 1T6ZA 3RK4A 4HQLA 4QARA 1PGJA 5GOZA 4UAJA 2NWQA 3BHJA 3MWKA 3ISTA 5GZ1A 3D5TA 1U3WA 4GMDA 2A1TS 3QG1A 3R7DA 2QEQA 1J9GA 1XEWX 3JZMA 1QH1B 2K47A 4MV5A 1C9YA 1LBIA 4KHZA 1RJ9A 4P08A 4G4SP 1MX5A 2O5CA 1V7PC 2YV3A 3SBJA 2UDPA 4ZO8A 4IDQA 1IXSA 1LUAA 5AW5A 4YYZA 1XBTA 3HJTA 1CTQA 1NHGC 5EPOA 2O50A 2ZAOA 4ON9A 4BMVA 2A5LA 3I3SR 4XPZA 2CHFA 1MO5A 5TNXA 4X44A 2HKJA 3D6AA 3E4DA 2MSLA 4XB2A 2WY2D 2JLBA 3VPGA 1GAEO 2Q1XA 4ZIRB 3S68A 1KJWA 2I2AA 4KFUA 1WA5A 4X54A 2GK3A 3HMQA 4X97A 2QTVA 4HPJB 4WOPA 3KT8A 2Z56A 4RETA 2KNAA 3K6SB 3UK6A 5H4HA 4ZO7A 1YVDA 5AW3A 1Y0BA 2ZSIA 3GARA 3MVEA 1ENPA 3M6AA 3DE4X 1OU0A 2QY6A 13PKA 5KX5A 2ZK7A 1UXOA 1TM3E 2XEXA 2ZJBA 1DC6A 4EKDA 2R97A 2NZXA 5D51S 2PGIA 3PNQA 4AICA 1Q02A 3AETB 5G3ZA 4ZHSA 4BBZA 1Z74A 4OIFA 3TKLA 4LRSA 2ANBA 2V6ZM 5EP3A 3WHKA 1YDMA 3ZCUA 3SHTA 4V3BA 3EPHA 4O5AA 4BQQA 4KK3A 1DS6A 2ZG6A 1J42A 2IHUA 2PSEA 1SY7A 1C80A 3AM1A 4QLAA 4BE4A 1E1NA 4YC7A 5JFOA 4RQBA