4LJ4A

Clpb nbd2 from t. thermophilus, nucleotide-free
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
332
structure length
319
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGEEKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
molecule keywords Chaperone protein ClpB
total genus 101
structure length 319
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj4A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj4A01
4WXPA 3C5HA 3DMDA 1GNQA 2Q21A 1HE1C 1AKYA 4NH0A 5C18A 3ZGXA 4ACBA 2QUZA 2WVJA 3IEUA 2CCJA 3VNUA 1SKYE 2ZRNA 4JVLA 1WRBA 1LW7A 1GRNA 4CZ2A 2XX3A 5EZ5A 4ZI3A 4XOIA 3RHFA 1ZW6A 1NLYA 1HTWA 3CPHA 3PCRB 1IQPA 1O87A 4JLAA 5EUQB 3QNUA 3ZVLA 3PEYA 1K5DA 3L0PA 4IDHA 4MYCA 5G40A 1EXMA 2ZRDA 3GMTA 3LW8A 1P2TA 2GXSA 2YC4C 2RKOA 3EAQA 3BD9A 1SKYB 1VPLA 2FZLA 2F55A 4Q18A 5FUWA 1R10A 2AWOA 1ESMA 4KLZA 5FTMA 4G5RA 3ASZA 4JLOA 4W9MC 4HB4A 3SHWA 1G16A 2ZU0C 5FPYA 2BBOA 1YR6A 2WAYA 1OH6A 2O8EA 4CGZA 4NTZA 3ZS8A 4DLXA 3FKQA 3PXGA 1NVMA 3ND8A 2YOHA 1PLLA 4HAWA 1UAAA 1Q12A 5ANRB 1UM8A 2B7CA 4WBSA 2HUPA 2W83A 1TQ6A 1J8YF 2JJ1A 3CX7A 2ONJA 4I1VA 4I1SA 1ZM7A 4HLUA 2CCKA 1ESNA 4HYYA 4MRSA 1ZBDA 3VU9A 5CM9C 4ITRC 2VIIA 3FFAA 3CX8A 1ZIPA 1VKJA 3NDPA 2XGJA 2BIFA 3AVXA 2X2FA 2IS4A 4O2LA 2C9CA 5EZ6B 1DOAA 2OXRA 3KUDA 4R71A 2F43B 5KUTA 1U2RA 2FF7A 1F2TB 3ZQ6A 2O8BB 1PLKA 3ZVMA 4A36A 2ATVA 2ZSBA 3SYNA 1JEEA 3N2EA 5LB4A 4HLCA 4C3ZA 5KHOC 2XZLA 3KTAB 4ZCLA 3PV0A 4DLWA 3ADBA 1MV5A 1GITA 2WMNB 4M8NE 5KSOA 1XCGB 1I4DD 1ZD1A 4LBWA 3GLGA 1EX6A 4H9GA 1G3MA 1KI3A 1UKZA 4IW3B 3PEVA 1NG1A 1FUKA 3RRZA 1E94E 4GT1A 1J7KA 2QGNA 4MQBA 3RRNA 2I1VB 2OO7A 2VBCA 3AVTA 5D3MA 4BZQA 1ZRHA 3LX5A 2IHYA 3AVQA 2ZR7A 3K0SA 2HT1A 2VP5A 5FOSA 1EK0A 2NG1A 3AF1A 2JATA 2ZRIA 1NNEA 4XD7D 5EJEA 2D7DA 2AN9A 3OIVA 4Q19A 4FCVA 3CZPA 2A30A 2GJ8A 4DSTA 4D0NA 4LYJA 3TGPA 4QL3A 2WOJA 2KSQA 2VL7A 2ZSFA 3DO6A 2G77B 4IXNA 4TSFA 4DB2A 1JBKA 2XNDD 1YRAA 4NBSA 1D2MA 5CYOA 4UNPA 2EWVA 4PHGA 3SNHA 2I1QA 5KNBA 5E7JA 4XSGA 4PPQA 2W00A 3HP1A 1IAQA 4PQYA 3MMPA 1XXHB 1CU1A 3WYGA 3HPQA 4Q9HA 4AG5A 2WKRA 3ETLA 3DZDA 1W4RA 4KFTA 2P2LA 2XSZA 2QAGA 3BB4A 4BFWA 1E4YA 2CLSA 1Z06A 4EPVA 1KI9A 1QHNA 4DDTA 2RGXA 4DRZA 4X8MA 1QF9A 1XTQA 3O8DA 2ORWA 4KVAA 4OQXA 2WPDA 4IJMA 1KSHA 2XAUA 5G41A 4PFSA 3A58B 5JI3E 3MJHA 4P0TA 2WIAA 3O8BA 4JS0A 4DT1A 3HJNA 2E9SA 3B78A 2JCSA 3GLIB 4UQOA 3EZFA 2OBMA 4OQFA 1CLUA 4V0MA 3TVTA 3AP1A 3QBVA 4HEJA 3D6TB 2BCJQ 2J1LA 2TMKA 4Q1CA 1O3YA 4Q21A 3K70D 1SVSA 2DVWB 1ZNXA 2C9YA 2C95A 4AK9A 2IEZA 2OLJA 3MLEA 4IVPA 1MO6A 4LV8B 4WVFA 3IO3A 4LWZA 2BMJA 1UF9A 2BBWA 2CL7X 2O0JA 3QBTA 4M21A 4RSGA 1LF0A 3RC3A 4DCTA 3W6NA 4Q02A 4YMWA 3RS7A 5IRCD 4Q4JA 3U3JA 4LHXA 2E1RA 5JRZA 1Q44A 2ODWA 4B32A 3IEVA 3THWA 4FCWA 3LH5A 4G5QA 1L2TA 2JLRA 5H68A 3G82C 1G20E 1OLOA 5JCZA 5J4LA 2O0KA 3RS5A 3ZH9B 2H5EA 3EASA 2IW3A 1SVIA 5JJKA 4CT5A 4CEJA 2XB4A 1E9CA 2HV8A 1JR6A 3WBJA 2R6DA 3ZQJA 1N2CE 1LV7A 5CK5A 4M1KA 2PLRA 4RD4A 1FTSA 2O8CB 1DPFA 4OI2A 3PUYA 3QKSB 3IIKA 4ZV4A 3TRFA 2D4HA 4MYUA 1RJ9A 4TQAA 3ZS9A 5HZHA 3I92A 2MSEB 4MKFA 4D4LA 3PVSA 1COWD 2DPXA 3AKYA 5EE0A 4GOKA 1CR4A 4KCGA 1NLZA 2FFHA 1QVAA 1Q1ZA 2G3YA 2OCPA 2ODNA 1TADA 2ZJAA 1LS1A 1OB5A 2RH5A 2EYUA 3BGWA 1KO5A 4POAA 3X1DA 1E2KA 1X8JA 2QQEA 3BH0A 4C0BA 4WA7A 4X8LA 1U0HC 3AJIB 4DLTA 1A82A 2HJGA 2QAGB 2I4IA 3Q5EA 4BFVA 1II9A 4FD2A 2BM0A 4HDQB 4XWOA 3FMIA 1Q20A 2EYQA 3WNDA 3EC2A 5JWOA 1R7RA 1D6JA 2FFAA 1W47A 3B60A 4Q48A 1JB1A 4ACAA 1UEIA 1JR3E 3PG5A 2J59A 1N5IA 1S2MA 5JI2E 3EARA 3WRYC 4A2PA 1ELOA 3C14C 5FOWA 4KSCA 5B30A 2I3BA 4WOPA 4RFVA 4GOXA 2LWIA 1UKEA 5HZKA 2QAGC 4TYPA 3I8SA 4B3CA 1E4VA 2XOKD 3IQXA 2F3TA 1XEXB 1SHZA 3IHWA 4KFRA 5TB5A 4LYAA 4L4UA 1GG2A 3SN6A 3U6BA 5EP1A 3FOZA 4A0GA 1UKYA 3I32A 4LBZA 4I1OA 1KDRA 4C4PA 1NJFA 4KO8A 3PQCA 5CLQA 4JN6A 3QPUA 4ZI2A 1OV4A 1Y63A 3Q72A 1FZQA 1KTVA 5D3MB 3ICQB 3GCGA 1CJKC 1WP9A 3SDZA 1N6RA 4S35A 3E1SA 3IDQA 3IPXA 3K53A 4NCIA 1Q3HA 4PC7A 3SR0A 4JLBA 4Q66C 5B2ZA 3PUVA 4H1UA 1P9NA 2NO0A 4IOJA 2GJKA 4B6FA 3EPHA 1XXHE 2YOGA 2FFQA 1JXOA 3N70A 1OYYA 1FMJA 4Q4JB 3TE6A 2PCJA 2BWJA 3AQ4A 1FL9A 1GRRA 2EFCB 4V02A 1KDTA 3U7HB 2Z83A 4TTPA 3A1VA 3GJ6A 4JIMA 2E87A 1IHUA 5KDLA 4B47A 2FE4A 1QHIA 2X77A 2YZ2A 1D8TA 3W5JA 2XTNA 1W0JD 4IDPA 3KKMA 4OQLA 5TARA 2XB2A 4GNKA 4W7SA 2G1KA 4MRVA 1BYIA 3K8YA 4HUQA 3CH4B 4WAUA 3UKDA 3AVOA 1VCIA 1B23P 2AKAB 3U44B 5JEDA 3B6EA 4AYWA 3AF2A 1NKTA 1E9DA 3ZD7A 2J7KA 2OEPA 1RJ9B 2WSSD 2NQ2C 2JLWA 3EXAA 3U3MA 1JAIA 4RKEA 4DUGA 1S9HA 2OAQ1 3AV0B 2ZPTX 1KNQA 2GHIA 2P3SA 2ZYVX 2IC5A 2Z4RA 1P2SA 4TZ6A 4DT1B 1I2MA 4M1YA 1XMJA 1CJVC 2BM1A 5FBRB 2N1BA 1VHTA 2IX3A 1QHHB 1E3MA 3EA5A 1U94A 1T3HA 1MRSA 1US8B 4KV9A 1IN7A 1A4RA 1RRFA 4KBGA 1WBDA 1EX7A 4HI0E 4IDNA 2J0QA 2AFIE 3GLGE 1SVKA 3LFUA 2VF7A 5CJPA 3RLFA 1QDEA 4CYMA 1NN5A 2RHMA 4EAQA 1D2NA 3REFA 3LAWA 5FI0B 4Q1AA 5IF9A 3CO5A 2WICA 4C0SA 1CKEA 4BEBA 5DI3A 2ZRFA 3SI7A 2V6ZM 4URZR 2XTZA 1MO4A 5EXSA 1EFCA 2Q3FA 1E99A 2V7QD 4ESVA 3KJEA 2PT7A 1G8YA 1U98A 3U3OA 1NJGA 4XSHA 1KOFA 2RGCA 4TMXA 3AH8A 1YVDA 2QI9C 4U7DA 1GKYA 1MABB 2WWIA 5KU1A 4FMDB 4A92A 3TK1A 5FUXA 4Q47A 2CEAA 4KFSA 2FN4A 3GLHA 2QMHA 1VG9B 1AS3A 4RFSA 2CL0X 4JLKA 4FXPA 4MRRA 3PEWA 3HDTA 5DGXA 3ZVRA 2OUKA 1DEKA 5CYPA 4TWZA 1MO3A 2P6UA 2J87A 3I5YA 4BZPA 5LPNA 3VMFA 2QN6A 1UFQA 1KHTA 1P6XA 4B35A 4A2QA 4BFTA 2KWIA 4HB0A 1VYUA 2ORVA 4B73A 1FOEB 2CLDX 4JYBA 1XJ0A 2YNMA 2CBZA 4BECA 2WHXA 4B3GA 2J5XA 2GNOA 4HSEA 3R9XA 1D2EA 4O25A 4DLVA 3DOFA 5L3QB 2DBYA 4F4CA 4GL2A 4ZCIA 4UNQA 2IT1A 1SZPA 2PH1A 2YYZA 3CLVA 1KO4A 3CNOA 4AKEA 1IOZA 5BN3A 1P9RA 3IGFA 2Y8EA 1KI8A 1YZNA 4V0ME 3SZRA 1E96A 3TBKA 1SVOA 3AVPA 3B1VA 5TVKA 2GCNA 3TW4A 1Z47A 2D7CA 1YZQA 2F1JA 5HE8A 3U3RA 4BWYA 5JS7A 1PV4A 3K70B 1G64A 1TEVA 2KRKA 1U8YA 2JLSA 2A5JA 4GMXA 4YXWA 2ZI6A 1OHHA 1E9RA 2FSGA 2RMKA 3MD0A 1NP6A 2B8TA 3DPUA 4D4KA 5J4YA 2ZE6A 1SXJD 1P5ZB 2C96A 1L4YA 4BLRA 2VRWA 3QF4B 2QAJA 3K9GA 3GP8A 3FHOA 2EFHB 2FSIA 1CRPA 1OXVA 3TLXA 1Z28A 1N6NA 5DO9A 1NMXA 3MG9A 1A7JA 3QPVA 1PLJA 1NL3A 1UBEA 3DOEA 2JIZD 1A5TA 4JYCA 4Q7JB 1T3SA 4LX0A 2ZS8A 2QP9X 4KYUA 4FWTA 2PBRA 3VR1A 2ZU6A 3BK7A 2CL6X 2YOFA 3U60B 3AP2A 4LI0A 1W1WA 1ZM2A 2EWWA 4O2RA 3ZD6A 3GEIA 1JR3A 4YC7A 3ZIAA 1OIXA 5KTYA 5TMPA 4GDFA 3QVUA 1Z8FA 2OHFA 4CF7A 2QT1A 2ZAOA 4NPHA 1HE8B 1HUQA 3ZIAD 5M04A 2FV8A 4EFMA 1GM5A 1CULC 3GJ3A 5JECA 2BCGY 4NYMQ 3R8CA 2ONKA 4QM7A 4WZ6A 2ANBA 2GTPA 2IXEA 1KYIA 1B0UA 1P72A 1ZD8A 3MCAA 4LC1A 3SEAA 3M6AA 4PZLA 3M4YA 3LQQA 3GJXC 1FX0B 3Q9LA 1H8HA 3AEZA 1Z3IX 4IDQA 4JJZA 2JJ1D 2GKSA 2ZJBA 2RGNC 2EU8A 1OFHA 4MGZR 3FHTA 1EFRD 1A2KC 1NSTA 2FPMA 3R7WB 1C1YA 3QKRA 5G3YA 2P67A 4QHSA 1QG4A 1TU4A 4LPKA 1W2HA 4FWIB 1E9SA 1XBTA 2WM9B 4P4UA 1LS6A 2HLDA 2XTMA 4D80A 1XDBA 3HU1A 1IN4A 1Z63A 2R44A 1DO0A 2XJ4A 3VKGA 2ZRGA 4G1UC 3OFND 4GZLA 4ZDJA 1TL7C 4AY2A 3I8XA 2ZYUX 4URUR 5AUNB 5A0FA 4PXAA 2A78A 1XMSA 2VHJA 3CIOA 3SJBA 2QRNA 3RABA 1KKMA 4ARZB 4PAOA 2VA8A 5E7MA 2G1JA 1Z6XA 1Z29A 2D3WA 3W8NA 2IYYA 4V0OA 1YKSA 1GSIA 1TU3A 1CF4A 1Q21A 1UJ2A 2CJWA 4LJ4A 3CF6R 1F2TA 2B7BA 1D9XA 4IXMA 3UG6A 5FPKA 2BDTA 4K46A 2R62A 4M1SA 4TSFD 1PVOA 1N0UA 4MDFA 1UADA 3ZZUA 3R7WA 3RS3A 1IN6A 3EZ7A 5SZJA 4Q4HA 5G53C 4RZ3A 4S2EA 2ZJOA 3GQBA 4W5JA 1U9IA 3IKJA 1XX6A 2F7SA 3JZAA 3WBKA 3X1YA 4E22A 5CITA 2REXB 3LXXA 3OFNA 1OFIA 5HKKD 1M7BA 3VR6A 3S1AA 3JZMA 4LRTA 4PZYA 5JFGA 5KOYA 4W5WA 1JJVA 2R6CA 5IDVA 1DS6A 1Z6TA 4AKGA 4M0LA 3WY9A 4R2IA 1W5TA 1OFTA 1QHGA 2C8VA 1X3SA 2XJ9A 5DSZA 3LX8A 4GFDA 2O0HA 4Z8XA 1N5JA 1G3RA 1OXUA 2FA9A 4GZMA 3C4JA 3SJCA 3DHWC 3AKDA 1BMFD 3MHVC 4YLGA 3H4MA 3CPEA 4N1AA 1G3UA 2NZJA 4NKRA 3I72A 3GPLA 2CLCX 4LY6A 1K6MA 821PA 2AR7A 3GJ4A 1OH5A 3ONWA 1M7HA 1P2UA 4PSVA 3WRXC 2IYWA 1ZVQA 4EPWA 4CRWB 3I62A 4Q9KA 2BBSA 2FSFA 3TVDA 4LJAA 5FR2A 1ZP6A 2VLIA 4MKIA 4Q4AB 5KDOA 1WXQA 1N6IA 4RJLA 1ZCAA 4F92B 2HCJB 2IYRA 2JDIA 4UXIA 4C0JA 1FNNA 3QF4A 4TLCA 3THYB 2DFTA 1R0XA 3BB3A 1L7VC 4YONB 4F38A 5FUVA 4BFXA 1OJLA 2H18A 4A0FA 3TUJC 3T06B 1CIPA 3W3AA 4G01B 4NE2A 1DAFA 3BAFA 3WMGA 4D0LB 2VHUA 5JJIA 1G5PA 4TYYA 2H7VA 1KK3A 1L4UA 2B6HA 3KUCA 3VNVA 3BERA 2W2XA 3KZ1E 5JHGB 3TR5A 2FFBA 1UKVY 3NKVA 3OEED 4KI0A 2PX3A 1SXJC 2BMFA 5EXXA 3DM9B 2JEOA 1F2UA 2ZRJA 4MGIR 1II0A 2ZS9A 4EJSA 4FCTA 1KK2A 4RZXA 4AKIA 4IVQA 4QHTA 1G7SA 2W6ID 3NH6A 5J40A 3KQLA 2OZEA 1RYHA 4PO1A 1US8A 3W6PA 1TNDA 4DCVA 1BH2A 3SFVA 4R2HA 1CR1A 2YV5A 2QBYA 1KI7A 4JVNA 2WJVA 5LBIA 1XEWX 2H1LA 1EFUA 1UBGA 1J8MF 4OHXA 3ZVNA 2VP4A 4DEXA 2WKPA 5K8UA 4M9ZA 3MAAC 1UEJA 1U99A 3D7MA 4US1R 3U6KA 3U5ZB 1E69A 3C41J 4L5BA 4EKDA 1YQTA 2V6JA 3K0EA 3EG5A 4RD6A 3KKPA 4A0HA 3BJIC 4DLYA 5KPDA 4LC0A 4PR0A 3FFBA 4URYR 3KKOA 3P4YA 1W36B 2FMXA 1FW6A 3CW2A 4NHOA 1GNRA 1E2JA 4DSUA 4TTQA 2V8OA 3GD7A 1E32A 4LHVA 4NONA 4A2WA 4OJKA 1Q22A 3LBHA 2GAAA 4C0LA 4Q9JA 3W90A 4D25A 1ZM9A 3T34A 1CR0A 2QBYB 2AD1A 4QGHA 221PA 5DN6D 4TYQA 3BRWD 4G5OA 3NEJA 4BLTA 2GVZC 1G3IA 1NVVQ 1S96A 2QRZA 3F3YA 4NP6A 1T5LA 5FL7D 1TF7A 1W4CA 4PAQA 3VHLB 2C5LA 4NDZA 2FSHA 2H17A 2R6GA 2GXQA 5JLJA 1SXJA 121PA 1GL9B 2RGDA 4QXAA 1KI2A 3TSZA 4CVNA 2ZE7A 5HPYB 4PANA 4B71A 2IK8A 3KJHA 3IHLA 2O8FA 3IIJA 4XVRA 5UKDA 2F9MA 4HAZA 2D62A 1N5LA 1ETUA 5FI1B 4KFUA 3VQTA 5FUYA 2H57A 2JJ2D 5A4JA 4A15A 3ADKA 2V54A 5FFMA 4XWAA 3TAHA 4B2IA 1ZU4A 2BKUA 2GZHA 3D8BA 4PPNA 1AKEA 3RNLA 5DI9A 2G88A 1SXJB 3M0EA 3MRSA 4QM6A 5B58C 4GP7A 2ZI5A 2G9NA 4DDVA 5JJLA 4RCYA 1IY0A 1D9ZA 3ADDA 4BGDA 3H86A 4DKXA 2RGBA 1NN1A 5BYJA 3ZZTA 4QRHA 2O8BA 1NY5A 1VCOA 4HDOB 2FPLA 2A5FA 1SVWA 2DFLA 3KFVA 5EE1A 2J45A 4FMCF 1FP7A 2RCNA 5LB2A 1DBSA 2J0UA 3K0FB 4FINA 4P3YA 3EZ2A 3Q85A 1Z0KA 2IF2A 3CF0A 1QHYA 3NBFA 1FTNA 1Z83A 1XD2B 1XMVA 4JMPA 4QJ3A 4I1UA 4FWHA 3HR7A 1CTQA 1L8QA 4XJXA 2F9LA 4PC2A 2P5SA 2DY1A 3MSXA 3GLHE 4LOAA 1ZC3A 3VR3A 6Q21A 3OHMA 2ORIA 4QFMA 1UBCA 3DKPA 3FMOB 1GILA 4RFSB 5B64A 1GOTA 3K9HA 3RWOA 2ZRMA 2ZXUA 5J5CA 3EZ9A 3AUYA 5JWRA 3B1XA 3TAUA 5CB8A 3IO5A 1OSNA 2ANCA 2ATXA 4QKQA 2R9VA 2DZOB 4TQUS 1X1RA 4LBYA 1VCNA 2ZSEA 1OKKD 3X2SA 1JXMA 2HYDA 3OF5A 2FNAA 3TKLA 2OV2A 2XNDA 1HT2E 2YWFA 4HAVA 3IBYA 4UJ3A 3L2OB 2KE5A 3NVAA 2ODBA 1AM4D 1JAHA 1AGPA 2QU8A 5KSZA 1CR2A 3KX2A 4MGKR 1XD2A 3NG1A 3UXMA 1G6OA 4DB4A 4B75A 1MO5A 1TF5A 1YR7A 1EWQA 4LJ5A 4PPGA 2LKDA 5DHFA 2VPPA 5KYKA 3V9PA 3AVWA 1LTQA 2ZVQX 1JR3D 5JZVA 1IN5A 4ASUD 3ZJYA 4PQFA 3G5UA 1KO8A 1VECA 1M2OB 2HJVA 3GLIA 4MYHA 4XD7A 5BXQC 2QENA 3L0SA 1IJFA 4DSNA 3K09A 5L8VA 4ZDWA 4OI4A 1RKBA 2PEYA 4JSYA 2FEOA 3VR2A 2JJ8A 2OCAA 5J4HA 2VP6A 5C4GB 1G8GA 3NIBA 2WJGA 2K5UA 5HCIA 2W6JA 4A82A 1KIMA 2GRJA 4F4IA 1EGAA 4Q4AA 4B34A 3A8TA 1BMFA 3K1JA 3CWZA 1E2PA 1BKDR 3BOSA 3WYAA 4HZUA 4R98A 2Z43A 1OE0A 1Q3TA 2OE2A 1DAIA 1VG1A 4BLPA 2QMOA 3UMRA 1E9AA 3I5XA 2HT6A 4Q03A 4KITB 1XU4A 1NN3A 3K0AA 1E2LA 2CVFA 2DWQA 5JWHA 3L43A 1AJEA 3QXCA 2CDNA 1BOFA 4DIDA 1Z6GA 3LD9A 1Z08A 2RGGA 3FVQA 4HLQB 1KY3A 3K09C 1WE2A 2GEUA 5C46F 1I2DA 4OHVA 1XXHA 3T15A 4PHFA 3TMKA 4EFLA 1JALA 1KO1A 2JDID 2R6FA 4AI6A 2WJIA 1S8FA 3GFPA 4NCHA 5GJWC 3T5GA 3UG7A 1DELA 2IYSA 3X1XA 2BJWA 1ZUNB 2VP2A 4NCKA 4DLRA 2WWXA 1J2JA 4RD0A 3HYTA 2N46A 1SHKA 4Z54A 2F1HA 2C78A 1E0KA 3AF3A 5BYKA 2CNWA 4OKSA 4DC9A 1S4QA 5JCPA 2C04A 4TMTA 1HYQA 2QSYA 1PZNA 2IL1A 1E1QD 1CRQA 5IK2D 3B5JA 1LFDB 2GCOA 2CNWD 1FX0A 3DMNA 4IRUB 4AURA 3CRW1 3OEHD 4JJKA 1Z22A 2XEXA 2YWGA 1OB2A 1N0VC 3NBZC 3RS4A 3BXZA 4AIIA 4A0RA 3BE4A 1QBKC 3TSWA 2IYQA 2YKGA 4HUQB 3SBEA 2G6BA 2PLFA 4URXR 4F91B 1RE0A 4DIEA 3GFTA 2OM2A 1YJ5A 1P75A 1F48A 2FX3A 1VMAA 4CIDA 8OHMA 1JPNA 5K8IA 1J70A 4CDGA 3FKSA 1Z0IA 2JA1A 2XXAB 2GA8A 5DLQC 1E0SA 2WSMA 3GJ8A 3CUEF 3CR8A 1I4TD 1FMLA 1IXZA 4IKEA 2C03A 1AGRA 3PUXA 1GL7A 4LUCA 4XTCS 2RHDA 5HCNA 2WMOB 1T6NA 2UKDA 5FBLB 4M9XA 2JASA 2QEQA 4UNNA 1IONA 4Y0AA 3UWOA 4KXFB 4B48A 3NHAA 3SS8A 4DDWA 4JKYA 1NBMD 4LJ9A 1OIWA 2VEDA 3T61A 2AWNA 1TUIA 1P60A 3RRMA 2MMGA 4UNRA 2KBFA 2HXSA 4IDOA 4QNRA 2VP9A 721PA 1XPUA 1ZD9A 4C0AC 4Z1MA 1VCMA 4NU0A 2C99A 2O8CA 3CPJB 1KNXA 1KI1A 2WTUA 1XTRA 2OAP1 2IYXA 4E07A 1R5OA 1H8ED 5HE9A 4B44A 2ERYA 3VLFB 3B1ZA 4GP6A 2H16A 3AM1A 4DBLC 4OQNA 4TMWA 3A4NA 2A2ZA 4L15A 1H8EA 4FWGA 4AYTA 3AB3A 1NVWQ 1E2NA 2ZI4A 4TMVA 3T1OA 1ONBA 2X2EA 3NH9A 4E03A 1K5GA 1N5KA 2ZM5A 4JKIA 1W49A 3QF7A 3QPWA 4KLNA 1W4AA 3HU3A 4LV6A 4DWJA 1M7GA 5J4KA 3QXXA 1KZGB 3AVUA 3SJAA 1T8TA 1P62B 1UPTA 4D4MA 5L3SB 3PUZA 5GADl 3TNFA 5AUQA 5BWMA 3CR7A 2NOAA 2ZREA 2QM8A 5HR5A 5DE3A 5LD2C 1TEXA 1KKLA 5GVSA 2PL3A 4PX9A 1AQUA 4P4SA 4Q9IA 1HEIA 1ZNZA 4PTLA 2BC9A 2EVWX 4PHHA 4JBYA 3BB1A 1R4AA 1X6VA 4TLBA 2QT0A 4G0NA 3FMPB 2JLZA 1ZYUA 1ZCBA 1KK1A 4PC1A 2NO7A 5AJVB 5E95A 1R8QA 3BH6A 5SZIA 1NRJB 5CIWA 2IF0A 2ZRBA 2ZYTX 5FL3A 4FIDA 3U2QA 4Q1EA 1W2GA 1EESA 2F1IA 3A4MA 3KTAA 3KQKA 2FH5B 1T0JB 3BH7A 3AKCA 4PPFA 3LA6A 1BYUA 3BIFA 4PZZA 4E5UA 1AZSC 3K9NA 1G8PA 2WWFA 4HZIA 1X86B 2OILA 5TY0A 3GLGB 1KAGA 1T3LA 2AL7A 1N0WA 1FQKA 4IOLA 5G3ZA 5FTKA 4N0DA 3SFZA 1NMZA 2QQ0A 1ZM3A 3QEJA 4MITA 4B76A 2QMUA 4YXWD 4UNSA 1QHXA 2BKEA 3KXIA 4BRUA 3P4XA 3KQNA 4I81A 4ESHA 3EIQA 1N6HA 3RS0A 5KPJA 4M4SA 4RCZA 1NVVR 1VYTA 4URVR 4LPSA 3MJRA 1M74A 2WWWA 3TSOA 2IS2A 1XEFA 2V7QA 4M9SA 1W36C 3UIEA 2WZQA 4FW9A 1KI6B 3O8RA 1G4UR 2VH5R 1A2BA 1KAOA 1SVLA 2KB0A 4WZBE 4C9BA 4JLDA 4IVRA 4M22A 5DN6A 1VTKA 4N0EA 1XMIA 4II7A 4Q01A 3Q7QA 1DE0A 4A6XA 5AJWA 4LJ6A 5AJZA 3QSYA 3DVLA 4IFEA 2AXNA 5FL7A 1SVMA 2FPKA 1U0JA 4TQ9A 3SBDA 3RYTC 1E1RA 3T5DA 2MSDB 5AUOB 1U81A 2DR3A 3GEEA 2GCPA 4BPBA 4YDHB 2ZIAA 5J4VA 2O8FB 4WW0A 2VHCA 3BFVA 5HTKA 2C77A 1QZXA 1RPZA 1H65A 2DWPA 3BS4A 2F43A 4MA4A 3U3KA 5P21A 2Z4SA 1XPRA 1TQ2A 4XIGS 4C7OB 1DARA 3W34A 4ZIRA 3V00A 2V55B 2OFOA 3PEUA 2NO1A 5E4FA 2ZSDA 1XZPA 1OIVA 1RRPA 2QPOA 3LBNA 4L16A 2IEYA 5BW8A 1N3BA 2GJ9A 1TAGA 3P27A 3CKLA 4NYJR 1T4GA 4LK2A 1FP6A 4QC2A 5GJCA 5E3HA 3G0HA 1OHHD 4KHZA 4DCSA 3REGA 2O5VA 4HDCA 1A1VA 1F5NA 1Z5ZA 1W48A 3OE7D 1W7AA 2WOOA 3CF2A 1ZM4A 3KDSE 4Z8YA 2YHSA 2O8EB 4CEIA 2P5TB 4V0KA 2DFNA 4EPYA 2ZQ5A 3K0CC 4BASA 1R2QA 2R2AA 3HWSA 3CRVA 3QOFA 4JSTA 4M9QA 3LWNA 2CVHA 1OFUX 1AK2A 3P32A 1KSJA 3F8TA 2FOLA 3EC1A 3VFDA 4KVGA 1UDWA 1VIYA 1IXRC 2X8AA 1BO6A 1AA9A 2P6RA 4CEHA 1XCMA 2OFWA 1QG2A 4WXRA 1E98A 1GKIA 2W58A 2ZRPA 4Q7LA 4D26A 3QEOA 1WF3A 4TL8A 1S3GA 2ZAMA 4MUAA 3O8CA 5LD2B 1U9IC 2CHVA 3L8YA 5TDHA 3SU8A 2CK3A 1E1QA 1OXXK 4IEEA 3E5HA 4PHTA 2QTHA 5TV2A 2J0UB 1YHNA 2AHOA 3OZXA 4ASUA 4EQ6A 2OCYC 5H70A 1V43A 1F2UB 3CRQA 2BEKA 3CNNA 1Z2AA 5D3QA 2R8RA 5CIQA 1ZU5A 1JPJA 2OSBA 3H2YA 3H84A 3E2IA 1GUAA 1V5WA 4M1OA 2IWHA 2B92A 3AUXA 2XXAA 3MWJA 1II8B 5SZKB 4B3DA 1ZJ6A 2ZJYA 1JQJC 2QPAA 3SQXA 4Y0VA 3IIMA 2UVQA 2KBEA 4JT2A 4DLZA 2V1UA 2J41A 2VYFA 3LVQE 3WP1B 2VSOA 2QA5A 3KL4A 2WWYA 3QKRB 3QKUA 4NL4H 3DDCA 3A36A 4MRPA 2DHRA 2QGZA 2PZFA 4P33A 2QTVB 2ZJ8A 3RRYA 2WJHA 4LV5B 2PZGA 3GLIE 4F7WA 3I3SR 3GLFE 4FMCB 2B21A 4LZZA 3GLHB 4LYFA 4BFSA 1G291 4TYNA 5EQTA 2RAPA 1XEXA 3UMSA 2XITA 1E0AA 5F2EA 3BWDD 2X19A 4ZIRB 4GPTA 2J46A 4OBEA 3ADCA 1G1MA 5FH9A 4D2IA 3EA0A 3HPRA 3R9IA 2Z5FA 3W8RA 1E2IA 3GLFA 2MMCA 2CJWB 2QROA 5CB6A 1TQ4A 1BS1A 3C8UA 4YMSA 1CJTC 1G21E 2Q3MA 4M1WA 4BLOA 4Z1MD 3B8HA 3NC1C 1ZIOA 1Q57A 1GWNA 1T5IA 3CX6A 4Z51A 4JZKA 3EWAA 4P4TA 1MKYA 3U4QA 1OXSC 1XD9A 4ZKDA 1TMKA 2AK2A 2IYUA 2QTFA 2EFEB 1MR3F 2BJVA 1W4BA 2ZUDA 4W5HA 3RAPR 2HF8A 3THXA 2ZI7A 1N6LA 3K0AB 621PA 4DEYA 5FPTA 4KYIB 1G7RA 4US0R 4DHEA 4M53A 4WZAE 4Q7KA 1CEEA 2B8WA 3QKSA 4DCNA 2IYZA 1KI6A 4BE7B 1C1KA 2W2TA 4UJ5A 3N2IA 3RDPA 4V0LA 2ZR9A 4GBMA 3W9YA 2ERXA 2HEIA 1ZMXA 3LLMA 4PQRA 1P9WA 3OIWA 4QJ4A 4BEJA 4M2LA 3QIAA 3OEHA 2X1VA 3THOA 4D4JA 2AXPA 2AKYA 3B2EA 1WA5A 4NYIR 1VDZA 1CJUC 3NXSA 3T35A 5KSYA 2FU5C 3P26A 2CE7A 3LBIA 1FNMA 3SQWA 4DSOA 1FFHA 3U44A 2Q9BA 4Q1DA 3ZYCA 4GSYA 1HA3A 1GAJA 1QRAA 1YZKA 1XEWY 2DWZB 2QZ4A 2AX4A 1P3JA 5BQ5A 4BZXA 1RRGA 3NWJA 4B2LA 2BMDA 2DB3A 4NYMR 5AUPB 4OK5A 4IHQA 2NMVA 3BFXA 3KQHA 1YU9A 2OXCA 3THWB 4XVUA 4KU4A 3EWSA 2FGJA 4NYIQ 2GEDA 4ZCMA 1AN0A 2ZJZA 4NZYA 3J81k 3VX4A 2IYLD 4AYXA 3LO5A 4LBVA 4DDUA 1W44A 5EXPA 2REOA 3A4LA 2NPIA 4JLJA 3LDAA 1G17A 1M1YE 3UWKA 4DLUA 2L0XA 4FMDF 3QY0A 4Q9LA 4EPRA 3TQCA 4O3MA 1W46A 3W6OA 4RY2A 2KJQA 4YQFA 1QHHA 1MT0A 3LLUA 3QXHA 2CCGA 4K8OA 4JLMA 1QVRA 4YMTA 3L8ZA 2IHBA 3MFYA 3PIRA 4LGMA 1ZNWA 3LRPA 4PSKA 3S1AB 2IYVA 3P20A 1EWRA 1GFIA 3TUZC 1E79D 4CEIB 4Q5IA 2ZR0A 5FOXA 3B9PA 1Z6YA 3T1QA 1Z0FA 2UZ3A 1M34E 5JSZA 3EPJA 5F9FA 5IK2A 3GEHA 4B74A 3SYLA 1U8AA 1YR8A 2Q6TA 3UATA 4C0QC 4JLVA 2JLUA 2N42A 4QHYA 1N25A 3EIEA 4G5GA 1ANKA 3MGCA 1TX4B 2IYTA 2NIPA 2Q0HA 5EE9A 1GKUB 1NLFA 1P73A 4MH0R 2ZE8A 4Q7MB 4KBFA 3K9LA 3TQFA 2NO9A 3DKVA 1KGDA 2BBTA 4JL8A 5IT5A 2QY9A 4OK3A 3RANA 2F6RA 3HU2A 3TIFA 3GJ5A 4AWXA 4DVGA 3CRRA 1U0LA 3VTKA 2G0NA 4QOSA 3GFOA 2GDJA 4BLSA 4Q4LA 1ZC4A 5ELXA 3B7GA 2WBLC 4DUGD 1XD8A 1LY1A 1CXZA 4QBHA 5EP4A 1KMHB 1IJEA 3F5FA 3HR8A 4OYHA 4YDSA 1PUIA 3B1YA 3B13B 5JHHB 3UPUA 3QG1A 1GP2A 1AZTA 2ZRLA 3GJ0A 2QE7A 2IWRA 5GVRA 2ZRCA 2IS1A 1HT1E 4DXAA 2Q3HA 3B85A 3KB1A 4HAUA 1P61B 2RGEA 4BFZA 4JBXA 2GETA 4TL9A 3D31A 1XZQA 1HY3A 1COWA 3PR1A 4BQSA 2GF9A 1HQCA 2BV3A 2GBLC 3A1SA 1IN8A 3CZQA 1KJZA 1Z07A 2EW1A 5DI3B 2V9PA 2WWHA 5KO2A 2WJYA 3KXKA 5DH9A 3ICEA 2ZEJA 3OAAA 2WAXA 2QSZA 1OYWA 4PC6A 3VKWA 1WBBA 3OE7A 1YE8A 3R8FA 5L3VA 4ZDIA 5H1YA 3W5IA 2MSCB 3AGQA 2ZANA 4F93B 4XVQA 5DNYB 4JL6A 2BHRA 2EFDB 3A37A 2V4ZA 3LXRA 4N3NA 3AVYA 3OAAD 4TYWA 4PO9A 3ASYA 4TLEA 1Z0AA 3SE0A 1R6BX 2ZRKA 1W0KA 2YJTD 5AJXA 4HB3A 4IOKA 2J0VA 1XTSA 2PCLA 4U00A 1MRNA 4AG6A 4OQMA 4TL6A 1KI4A 4OI1A 2ZRAA 3L82B 5B57C 1S1CA 3UK6A 2F3RA 3OIUA 2GJSA 5EXTA 2P65A 1WMSA 1YZTA 4A9AA 1R0YA 4TTRA 4R7ZA 1R0ZA 3Q5DA 2YINC 2QORA 5IHPA 5FPHA 3EPKA 5AR1A 2OT3B 1RRCA 2O8DA 4EJSC 4DLSA 3X1ZA 1M8PA 1RFLA 1SQ5A 2PT5A 2W6IA 3C15C 2DCUA 1XP8A 3VR5A 2JLYA 1NY6A 3QVVA 4L9WA 1X37A 1DG1G 1E1RD 4LJ7A 1RVDA 3FPAA 4NYJQ 2A5YB 2ASEA 1JECA 2A3RA 2VF8A 3KKQA 3IBGA 1W36D 1WB9A 1E0JA 2AK3A 4V0NA 1SGWA 1E9EA 5FR1A 3ZLJA 5DYIA 4CEJB 3PUWA 2GXAA 1PJRA 4P31A 2FJUA 1DAKA 1JI0A 1X1SA 1BIFA 5FOTA 5F9HA 4LRWA 1ODFA 4RD2A 2YC2C 3FE2A 4B2PA 5FBVB 3Q3JB 4TLAA 2V3CC 2GF0A 4DZZA 1XTIA 3KXLA 3OEEA 3RSOA 4DCUA 2XNSA 4HLDA 4B6EA 4UXHA 3SOPA 3BBPA 4EDHA 4BRWA 3A1UA 3FB4A 2Q9AA 4RZ2A 4X8OA 1NIJA 4BLQA 1E2QA 2QPTA 2ZITA 4B33A 4EPXA 4C2UA 1XB2A 4ILEA 3A6PC 3K0CA 4MKHA 1GL6A 5JS8A 1GRQA 2DWOA 2PMKA 3AVVA 4QBFA 1E2DA 2V6IA 4TMZA 1QZMA 4XH9B 2NTYC 4A8JC 3O47A 2WJJA 4CEHB 2HDNB 2PX0A 2UZIR 2EQBA 1EG7A 4TN1A 1CBUA 2GJAA 2VSXA 2REBA 2WWGA 3AGPA 4QJ5A 5CM8B 1Y3AA 4XWKA 2YWHA 1I4LD 4ZO4A 1Q0UA 3TJZA 1KMHA 2V1XA 5CDFA 3SYKA 1Q1QA 2H92A 1XF9A 4F4JA 3IILA 3LVRE 4H1VA 2G83A 1R8SA 2P6NA 3A1TA 4K81B 4C30A 2YVUA 1YZGA 3WNBA 5FTLA 1TPZA 2JIZA 3CRMA 1G41A 3AF4A 4HB2A 4X8HA 4MGYR 1Q1BA 2XOKA 5BN4A 2FG5A 1WDTA 3Q8XB 1UDXA 2RB4A 1MH1A 1G8FA 3LQRA 4TT3A 2OESA 3KFXA 1GTVA 3KKNA 4Q00A 3L0OA 521PA 3VKHA 2A9KA 1S9DA 2GZDA 1DAMA 1G7TA 3QI2A 4TT3D 2GVDC 1DTSA 1EFHA 3MWLA 3CONA 1XTJA 3E70C 2LKCA 4OJQA 3U7FB 1XJQA 4NMMA 1DG3A 4YMUA 1NG9A 2CK3D 3U7GA 4URWR 1JEDA 3QXSA 1Z6AA 4A8JA 1DADA 4MUBA 1T8UA 1IBRA 3WMFA 4BUJA 1ZUIA 4C0KA 2ZETA 5C1BA 1E6CA 4ZPXA 1HH4A 2QNRA 1OKKA 3GJ7A 3QXJA 4OL0A 1X8KA 4MYTA 1KMQA 5A5GA 1LVGA 2ECKA 2RGNA 1G7CA 4US2R 1R0WA 4KJZA 1Z2CA 2SHKA 3CBQA 2KI5A 2ZRHA 4J0QA 1LF5A 3I61A 1EFRA 2PMDA 1G4AE 2ZUCA 3NTUA 4C2TA 3HYRA 3PENA 2ZJ5A 1W0JA 4P4SB 1M6NA 2GAOA 4HZUB 2ZYWX 2IBMA 4LJYA 3K70C 5JBQA 3F0TA 1Q1EA 2JJ2A 1GIAA 4FI3C 4G5SA 4D0GA 4U5XA 4B3FX 2RGAA 1P2VA 1VIAA 5AJYA 1RIFA 2W0SA 3I73A 4LHYA 2GK6A 5AWFC 3AKEA 1S1MA 4AD8A 1RZ3A 3EZ6A 3FHCB 3THXB 4YMVA 5FTNA 2GESA 3EW9A 3CB4A 5EE3A 2CE2X 3IUYA 5DIFA 4A3VB 4LRSA 1P4SA 3QUSA 1LNZA 1G8HA 1ZUHA 3B9QA 5CJ2A 4FWDA 2JLXA 1G5TA 1DAGA 2HLDD 5EE5B 4C7OA 5CDFE 4JL5A 2ZSAA 1P7CA 3CWQA 4PO8A 1NVXQ 4O0MA 4OHYA 2W2VA 3U7EB 2GXUA 1LB1B 2ZI3A 1H8HD 3VR4A 3FTQA 1G6HA 1JQLB 1S0UA 2CHGA 3T1TA 3R9WA 4AKHA 2NO6A 3KB2A 2IS6A 4EFNA 3AF0A 4BFYA 5TXGA 3B1WA 1TTTA 3T12A 1DAEA 2NGRA 2OFXA 2VO1A 4IEIA 1U8ZA 5FOUA 5KDDA 4R9UC 3W3ZB 3VAAA 1ZAKA 4BFUA 1CP2A 4G3XA 1C9KA 1XWIA 2O8DB 3LY5A 1IXSB 1KSGA 5JRJA 1KY2A 2C2HA 3NDBB 2AD5A 4E09A 1JNYA 1R5BA 4LJ8A 1IY2A 2H8KA 1XTKA 4EIWA 1RYFA 2VP0A 3P1JA 2ZI9A 4RZUA 3PJRA 3FKSD 3QQ5A 2GBLA 2PJRA 2IUUA 3C5CA 1YR9A 3DZ8A 3EX7C 1E9FA 2J7PA 1FQJA 1WCV1 3A1WA 4MRNA 2C98A 1C4OA 1J90A 4HAXA 2WKQA 3U61B 2WV9A 4A1FA 1OH8A 2W6JD 1HV8A 2GZAA 3U4QB 3CH5A 4IFBA 4LDJA 5K8LA 1G3QA 2DZNB 3KQUA 3WYFA 1Z0JA 4HLUC 4L9SA 1KJWA 4JLNA 4M1TA 3EPLA 2XSZD 1TF2A 4EPTA 4JVSB 4QG7A 5GJVC 4ARZA 2Q9CA 3DEFA 4LHZA 3V4RA 2VHTA 2PEZA 4QNMA 1N6PA 2Z6VA 2HXYA 3SHFA 1G5RA 3R20A 4D82A 2BMEA 3WMEA 3DM5A 2JLQA 1IY1A 1KSFX 1XCPA 3NHBA 1F6BA 4QGFA 3NBXX 1XRJA 5JSZB 4B3BA 3TW8B 4Q1BA 5C2JB 4B43A 3QG5A 1CS4C 4P32A 4ON9A 3ZZ0A 2J7PD 3MWKA 4KSBA 3X1WA 3N5CA 1EFTA 3NEYA 2CXXA 1VYVA 1K8RA 2XZPA 1NIPA 4QBIA 1E2EA 2VTKA 4PAMA 3OESA 1E79A 2IUSA 3C7KA 1XNJA 5J47A 2ZROA 2QP4A 1G9XA 2P0EA 1WQ1R 1RW4A 4B3XA 1Z0DA 3FDIA 3I4LA 4UKDA 5SZHB 4C0HA 4IOMA 1W0KD 4ZKEA 3RSLA 1UBFA 2ODEA 2NZ8A 1TUEA 1PUJA 1NBMA 5GJBA 3IPYA 1AS0A 4QGAA 1KK0A 2OCBA 2ZUBA 2IUTA 1KDPA 2OBLA 2BVNA 5L3SA 421PA 1ZINA 3TR0A 1NI3A 3KJGA 5F98A 3JVUA 4TLDA 4ABYA 2HYIC 2PJZA 5DISB 2AFHE 5FTJA 3H1TA 1XPOA 5EP2A 4TL7A 1GNPA 1QHSA 3C16C 3FWYA 2ZJ2A 3LNCA 4EUNA 2J0SA 3ND9A 1OT3A 4AC9A 1MOZA 4I4LA 1X8LA 3MWYW 1U90A 5HKKA 2JGNA 4OK6A 3PFIA 1T0HB 1E2HA 4CW7A 3RS2A 1FUUA 1KJYA 2QE7D 4LSGA 4PSAA 2WIBA 4RD1A 1AIPA 2GCOB 1NN0A 2JAQA 4JVMA 3VHXA 5CLLA 3LV8A 1YZUA 1YRBA 5EUMA 4OHZA 3EIHA 2OBNA 5F3WB 5L3RA 2D2FA 4LHWA 3WXMA 3THYA 2LCFA 1SXJE 2FZ4A 3NBYC 1NSFA 1DVRA 1VHLA 5DHAA 3WHKA 1HQYE 3TUIC 1CJMA 3B82A 2C9OA 3JVVA 4FMBB 1ZNYA 1NKSA 2A5DA 3OIYA 4FN5A 4NCJA 2WPDD 4XTRA 1OPXA 3BC1A 4HUTA 2A7QA 3SJZA 2FGKA 5KNCA 5LDDC 4GITA 4D81A 5L3QA 2BEJA 1NVUQ 2IXFA 3FGNA 2XZOA 3CNLA 3QJYA 2D74A 2FWRA 5K8TA 2FDCA 1D5CA 1OW3B 3KW6A 2IA5A 1F3OA 1N6KA 2D2EA 1G18A 3WNCA 5JEEA 1VG8A 3IQWA 1W5SA 3FYHA 1G19A 3GLFB 3ECCA 1IM2A 3DL0A 2J3EA 3T1VA 4RVCA 2VSFA 4L8GA 1DAHA 3FMFA 1E2FA 1NBME 2ZVPX 4JBWA 4GRAA 3I1FA 2DFKB 5FPSA 4MKGA 2PZEA 1R5NA 4QBGB 3D3QA 1JJ7A 5FBQB 2FEMA 5AK0A 1GZSA 4CT4B 2OG2A 3H0KA 2ZTSA 2YWEA 4A6PA 5E7IA 4A4DA 3AP3A 1II8A 1KZ7B 1GVNB 4JLPA 3RVBA 3SC3A 2O52A 4MDEA 2CMKA 3QKTA 4M1MA 4WIAA 1VG0B 2NPFA 4Q4HB 1OF1A 2EFGA 4HATA 5FBWB 2CHQA 3K0FA 4EJSB 4KODA 4EQ6B 4ERNA 5KNDA 2IXGA 1F60A 2QG6A 3LW7A 4HAYA 4TZ0A 4GOJA 1OH7A 5H8WA 3RWMB 1E2GA 1AS2A 3QENA 2VHQA 1KO7A 2OLKA 1SKQA 1XJCA 1T91A 3KJIA 4PC3A 4UXJA 5C4MA 1S3SA 2QP3A 1T9HA 1KDOA 2BOVA 4NCNA 3MUFA 3ZDQA 2HCBA 1RC8A 2ZE5A 4RD3A 3Q7PA 3UANA 2J9RA 3VU9B 3VX3A 2GK7A 1SULA 1DO2A 5EP3A 4V03A 1AQYA 2DYKA 2F1RA 4RKFA 4ZDKA 2HF9A 2QMEA 3TH5A 3BFKA 1E9BA 2GEVA 5KSPA 2QL6A 4DJTA 2W0MA 4JT4A 1N6OA 3V4FA 1FPMA 4QGGA 1TQDA 3QE0A 4KAXA 4OI0A 1YZLA 1XFAA 3PITA 1E2MA 1HURA 5FOVA 5CK4A 4TMKA 2R6AA 2GILA 2R65A 2GWHA 1NMYA 2VQSA 4Q1FA 4LCBA 2WSSA 3RC8A 4GI7A 1MABA 2A5GA 2G0TA 2QM7A 2ZS7A 3UMFA 1OXTA 1J99A 3M1IA 4LYHA 5JMTA 2JLVA 3L0IB 4U02A 4D6PA 3WHLA 3CM0A 4I99A 1GDDA 3WP0A 4A8JB 3BORA 2D06A 3NC0C 2Z0MA 4GMDA 5BN5A 1NF3A 4OHWA 5DYGA
chains in the Genus database with same CATH superfamily
2CY0A 5EZQA 1XLTC 4WL0A 3PUHA 3IALA 4FHCA 3R7DA 4DLAA 2Q21A 1AKYA 5IDQA 5C18A 2QUZA 2LVBA 5EJ4A 2NV0A 1ZONA 5DASA 4PTYA 3VNUA 1SKYE 1ZSNA 2YX1A 2VAWA 2Y27A 2ZOSA 1GGMA 4ND6A 5G0WA 4W8OA 4QOFA 4EGJA 4C3UA 5FWDA 1K89A 5AK4A 4NAVA 1AHNA 2OOKA 2UUAM 3ZVLA 3PEYA 1RJFA 4IDHA 4MYCA 3RG8A 1EXMA 1NMEA 3GMTA 3FSGD 1P2TA 3LW8A 4N7BA 3TM5A 1EHYA 2RKOA 3LP6A 4R8RA 4TYMA 3U6CA 5DF1A 1SKYB 2J32A 3DNFA 3QV1A 4CMEA 1JDUA 5FUWA 1U1IA 2AWOA 1FFEA 2QRUA 1FU7A 2WFLA 2WU1A 4G5RA 1DQZA 4HB4A 4M7RA 4OBBA 4RS4A 3IQFA 1VJDA 4AW9A 1G16A 5CHYA 4YJGB 4ZANA 3R09A 3GGOA 2VHYA 3OCZA 3I6YA 4WY5A 3ZS8A 1B0PA 3ND8A 3RRXA 3DT8A 5ER9A 1U2GC 1PLLA 1OOEA 3WVNA 4BQRA 3EGXA 2D7EA 4MWEA 2VDBB 3IODA 5ANRB 1UM8A 2B7CA 2HUPA 4H3HB 2H2FA 1J8YF 3DTVB 4JP1A 2PSHA 2UXDM 4FYPA 4K05A 5K3SA 4MRSA 2ONJA 1ISGA 5HUHA 3CXUA 4ZTZB 2ZIZA 3MT8A 3ORRA 3RM3A 3H8SA 3V1LA 3A4TA 3RYIB 3ZVKA 2XNKA 3G89A 2FJPA 1Y1SA 5DXAA 3V8VA 2VIIA 3RTCA 1NNI1 3CX8A 4KMSA 2Q50A 5ALDA 2IS4A 3VNAA 4U7JA 4CT0A 1Q84A 2DJIA 5EZ6B 1DI0A 4FYVA 4B4DA 3F5QA 4WP2A 5EIEA 3EZYA 3RYCA 4XGIA 2X8BA 4A36A 1RLIA 4ZHQB 1ARZA 2ATVA 2GB4A 3CE9A 4X92A 1SB8A 5TF4A 3SYNA 3AU9A 4EO9A 3EOAI 4X54A 5MDHA 2AFRA 4BHTA 4D96A 1V8ZA 4GDMA 2BFPA 3VA7A 4RVSA 2G72A 2XZLA 4ZCLA 3T1NA 1N2ZA 2Y99A 3FB1A 4EZBA 1ZO8A 3HA3A 3UJ8A 1O8CA 2JNWA 1TE2A 1I4DD 1XCGB 3Q5GA 1FYXA 1ZD1A 3GLGA 2UVPA 3C70A 4JI2M 4GQAA 3INGA 3AEXA 3TZCA 3JQFC 3WIEA 1A7KA 1S6YA 3DT6A 1G3MA 4ZHQF 2DETA 4ALKA 4U6SA 4IW3B 3S40A 4YAOA 3RRZA 4UM9B 2CXUA 2Q4TA 5IHXA 4LF8B 2ZBVA 3KTOA 4G4OA 1K3WA 4RA6A 4F8EA 1Z2PX 2XGMA 3HR4A 3INYA 3O1HB 4L6CA 3AVTA 4D9FA 5D3MA 4DY4A 1GFSA 4EGAA 5LP1A 2L18A 3GN1A 3IB3A 3AF1A 1TDHA 2FUG6 2JATA 3RTDA 1JT2A 5HBGA 3STWA 1N34B 2D7DA 1Z0SA 3OIVA 1LPAB 2OQ2A 4O2BA 2MR9A 3ERCA 4D0NA 4K28A 4QGSA 2ZSFA 4L51A 3PLRA 4IXNA 5K3CA 2JY6B 2QQFA 5CA1F 1JBKA 4IIHA 4RDHA 1DINA 4NBSA 3ZHUA 3FRJA 1D2MA 1FTGA 4JUIA 5EI5A 2PMWB 4B4KA 4BWFB 2JGMA 2WQ7A 2I1QA 3VK7A 4ZOEA 5BORA 5KNBA 1MCZA 4Y18A 4GM0A 1TAQA 4YJ3B 5AKIA 1NPTO 2PLAA 1GZUA 4UCWA 2J3KA 5BV1A 3LXMA 1H1LA 1B15A 3H9JA 1CU1A 3WYGA 2WRZA 3HPQA 3PL1A 3QMWA 2QB5A 4V38A 4GOMD 3BL8A 1SR8A 4B4VA 3IHKA 4ZWNA 4RMIA 3DOCA 4BAZA 1LBSA 1QHNA 2E4AA 1A71A 1UBKS 3AEKB 1Z5BA 2Z7JA 1RP7A 1XTQA 2JRLA 2XE4A 3O9MA 2A9QA 1C1XA 5JV5A 1DIRA 5K0CA 4J3JA 1RADA 3A9VA 1QRDA 3PGKA 5GM1A 1KSHA 4HEA6 2PKCA 4HQNA 1GADO 2IEBA 1E3IA 1VJRA 5EIFA 3MUOA 3W2EA 1Z34A 3O8BA 3RQSA 4DT1A 3CO0S 2R0QC 2OR3A 2R7NA 4NBLA 2JCSA 4UQOA 4LF7B 1B76A 5AKJA 2HCRA 1C0PA 4V0MA 4Y1FA 5EESA 2ZSKA 2R7AA 2NPOA 3KC2A 4HEJA 4U2DA 2HWUA 3D6TB 2BCJQ 2PD6A 1XKTA 3A7EA 3CUYA 4JUDX 4Q21A 1GNSA 2P9YA 3RU2A 3K70D 1ZNXA 1U65A 2VPZA 4EHKA 1EVKA 3OX4A 4G0OA 2IEZA 3MLEA 4X71A 5HHTA 4BKMA 1GUZA 3H65A 2GHTA 3TE7A 2FR8C 3ZU5A 4QUIA 2CHEA 2PBLA 4WKBA 3I34X 3A7DA 2H2HA 5FI5A 3TAXA 4K6OA 2LVPC 2WLSA 4GZ5A 3CCCA 5C7LO 1JEOA 3QPBA 4ZZ1A 1E8MA 4DCTA 4RIFA 4DUZB 4Q02A 4YMWA 2AW5A 4Q4JA 3CVVA 1L4BA 3I04A 4FOTA 2KW5A 1KIFA 1XE3A 2QKYA 4CFSA 2Y1FA 3LH5A 3UCFA 2X3UA 4D5GA 1AF7A 4ZHQA 2I55A 1HNNA 2IXBA 3PXXA 3U1TA 2Q5FA 4RXTA 5LQDA 1Y37A 1P4GA 3VPSA 3PC7A 3PFKA 2KNAA 4EBBA 5FOQA 3B6KA 2IW3A 1ZAYA 3PGMA 5ICEA 2PKQO 3UWSA 4UHCA 2BFNA 4FOLA 1ZIXA 2HV8A 3VTZA 3LT0A 3WBJA 3L4JA 3ZQJA 1TFRA 1ISJA 2PLRA 3WYEA 2O8CB 4C7JA 3QKSB 5EOVA 4ZV4A 1Y5NA 3D3NA 5HBRA 4JP2A 3DDUA 3TRFA 1U3GA 4MYUA 2Q46A 1PFKA 5HZHA 5GONB 1E3WB 2MSEB 4DPLA 1ZESA 4LFAB 5FTWA 3EVEA 4NMXB 2HK7A 3OCUA 3DLPX 4DR4M 1CS0B 1B0ZA 4GOKA 5AOVA 1WXEA 1T1JA 1CR4A 2G4LA 3H7AA 4LECA 4UFPA 5CVUA 1ORVA 3VSCA 3IOBA 1R4NB 2FFHA 4FZRA 4DILA 2JLBA 2WT9A 3JSAA 1QVAA 3OOEA 1OCEA 5K8VA 3JQPA 1TADA 5AKLA 5K0JA 3FLMA 2H1FA 2B2CA 1DDIA 2BEUB 3BE8A 3L07A 3UMYA 4POAA 3BGWA 1KO5A 1X8JA 3CN9A 1WNFA 3NOQA 3MPOA 4F3TA 3P52A 1GPWB 3P2YA 3VZBA 2QAGB 1T43A 2EWMA 3JD4A 1Q92A 3I53A 4HDQB 2BM0A 2QN7A 1G6KA 3FMIA 1O5OA 4RACA 3OEWA 3TI7A 1YDGA 3M5WA 2FDRA 2YZGA 1PHPA 5CBPB 1W47A 3GH3A 3FUWA 2E3JA 2QM0A 2B78A 3HCOA 5DGCA 1JR3E 5B3JA 3FTDA 2J59A 1HT3A 3EARA 4Q6BA 1GRCA 2C7GA 3LC2O 4FDMA 5E8RA 1M8JA 3WRYC 2HO5A 2A6PA 1GA6A 2X49A 5B30A 2I3BA 4WOPA 5A71A 4DLBA 1NBIA 1EQUA 1P0QA 5C8VA 2LWIA 1USGA 1RXEA 4KH0A 5HZKA 3G2JA 4TYPA 3S6JA 1XRSB 4DBVO 3I8SA 1U8XX 3WO1A 1E4VA 3DXXA 3IQXA 4IIBA 1YE9A 4PBRA 1XEXB 5F77A 5SY9A 2YJGA 1IG0A 4MQFA 3IHWA 3RK4A 1IYZA 1P19A 3MB5A 3NHLA 3H3XA 3V4SA 4EMUA 1ZR2A 4BXOA 1UKYA 5CT4A 1YDWA 1B6TA 4I1OA 4IBDA 1ECBA 3O7MA 3VNBA 4M36A 4C4PA 1NJFA 4KO8A 2UDPA 5CLQA 5TMDA 3QPUA 1DHRA 2BSXA 3RVJA 1OV4A 1Y63A 1X7XA 1CT9A 2VXCA 2JFOA 5K3DA 2XIQA 3R6GA 2OB2A 3GCGA 1CJKC 3RKUA 1T36A 3IPXA 5K20A 4NCIA 3NHZA 2W6QA 3FI9A 4JI3B 2UZ1B 1U7XA 3FDFA 4AZFA 4JLBA 4NFYA 4Q66C 2XDYA 5HA5A 2VTVA 3SR0A 3WNVA 3ZCQA 1ZOIA 4BYMA 4Z53A 3OJEA 3WTCA 1I8TA 1OYYA 4R6XA 5K4AA 3TE6A 1BN6A 1M0SA 3EUEA 4AAYA 2ICAA 3WQSB 3RS9A 4Z3KA 3PFBA 4O2AA 1FL9A 3KSAC 4FVTA 4BB6A 4XLLA 3ZU3A 1KDTA 2C84A 2IE8A 5DW0A 1MQAA 3A1VA 1LC3A 2E87A 2P9QA 2OHIA 4B47A 5AVRA 3A6DA 5IT4A 3UWMA 3WLAA 3ZDFA 1X80A 2YZ2A 3CBGA 4O63O 4P22A 4QTUB 2H1OA 2BP7A 2XTNA 3A2KA 5TARA 1ZH0A 4P3PA 5JH7B 3G2PA 3NPAA 4MRVA 4W7SA 1BYIA 4IBIA 2DKFA 4HUQA 4EGSA 3RYFA 4ZZ0A 4LE2A 1DKNA 4RHFA 3WAJA 4X65M 9LDTA 5JEDA 3SQLA 4DR7M 4AYWA 3FOCA 4I1RA 1SZDA 1LTMA 1NKTA 1E9DA 3DDHA 4HNHA 2I9KA 3BN3A 3EXHB 1ZLYA 3H18A 3LQFA 1N0HA 3OLXA 1QDTA 1RJ9B 2AT1A 2W8BA 1BRTA 1CSEE 2CSUA 3GUCA 3LC0A 3UMCA 3V8EA 2JLWA 3K0SA 4RJIA 2I6QA 5EWMA 1JEAA 2EF1A 3CLTC 4JJ4A 5ELLA 2JD2A 5DBOA 2ZPTX 1M0TA 1ZW1A 5BSVA 1P1HA 3HBNA 2ZIGA 3L5OA 2V3WA 2IIQA 4PLYA 3FDZB 2OD9A 3AR5A 3PF9A 4RA9A 1NVEA 2C42A 1SELA 4YB8A 2GEBA 1EWTA 2IX3A 4UEQA 4FGSA 3HEAA 1ML4A 4YUWA 1E3MA 2PS9A 4ND1A 5EJGA 4TKUA 4MJXA 4JQCA 4ER5A 1RRFA 4QJBA 4ZYWA 4IDNA 2GPJA 3GLGE 3LDGA 3WOHA 3LFUA 1N2SA 1QDEA 4P93A 2OCGA 3P5BA 3SSMA 1KMIY 2RHMA 1CVRA 2WUGA 4B7XA 4HX9A 3REFA 1QU3A 3E4RA 1JLHA 1RM3A 2QRGA 3LAWA 4BX2A 2WC1A 2C4MA 4Q1AA 2GAJA 4DBLE 1X14A 4IILA 2ENUA 3PRJA 4BEBA 5DI3A 3OPYI 1D7OA 1U7HA 3B6MA 2D8AA 1Y33E 3UGKA 4ZGGA 4D6YA 3PA6A 3I8OA 5TJ9A 1TQHA 4URZR 3B9BA 3M6UA 3SDBA 1OAKA 4O2BB 2IP1A 1ZN8A 4F04A 5EXSA 3ICPA 3QFHA 1YZFA 2CDRA 2V7QD 2HRDA 3R7AA 5JNVA 1O0BA 5EIBD 4IL5A 5HTOA 4RK0A 1ZK0A 1O9BA 2VUSA 4XSHA 3ONFA 1D1QA 3FYDA 2RGCA 4JWKA 1LPSA 2I2DA 5INTA 4F9FA 5AICA 1WXFA 5KOHB 4MI3A 1GKYA 1MABB 4AWAA 5KU1A 1OWNA 1VJCA 4WJZA 5A2GA 4MEBA 3IEPA 4UHBA 4COOA 4Q47A 1ENPA 4I3GA 1EFAA 2FN4A 2NXNA 3IAM6 4G0UA 2ZT6A 1SUFA 2CL0X 4JLKA 1CHDA 4FXPA 4MRRA 4RADA 3UHAA 2QN1A 3DGFC 3HDTA 8LDHA 3RROA 3T6PA 1MN6A 2AC4A 2AI3A 1EBBA 3AJRA 3RC7A 5LKAA 4FFVA 3V4PB 3L92A 4YAEA 5CVCA 2GCEA 2J87A 3G68A 5C3MA 4FI3F 4IXDA 1XLTA 4BZPA 4P38A 2H5IA 4S1WA 3WGLA 4BX9A 1KC1A 4K03A 2QN6A 5T8KC 3L0CA 4S3MA 3VDRA 5BMVB 3O0DA 1EDBA 1GPYA 3TLBA 3IP7A 1IOWA 1A3CA 2A8YA 4BFTA 1HF3A 2L69A 2PO7A 2XHZA 3FWZA 3NIGB 3C3KA 4MA0A 5EKUA 3R9KA 4D02A 4B73A 2EDCA 5G4KB 5MN4A 3UN1A 4P7JA 3TD6A 4CKCB 4PG4A 1SWVA 4G8JA 1W34A 4QU5A 1BROA 1DGHB 1IZ7A 3RHTA 1WD5A 3BD8A 4PGAA 3ZNOA 5L3QB 1WDKA 4R7TA 2JNHA 2DBYA 4DJAA 4KAFA 2IT1A 4ENPA 4QARA 3CLVA 3IAUA 4CMJA 1KO4A 3KPVA 3WK7A 4NS1A 3K1AA 4HWTA 1ZDMA 4TXMA 1PS9A 3SHVA 2VK2A 1DKUA 1HTBA 3NV9A 2BL4A 1YZNA 4V0ME 5EHNA 3RKRA 3TBKA 4JSRA 2X41A 3AVPA 4YI5A 1OI7A 3TW4A 1TUBB 1Z47A 4YBZA 1UQUA 4I9NA 5HE8A 5CH8A 3U3RA 1Z68A 4C4TA 1PV4A 3WYCA 5H83A 1TEVA 4RSRA 2JLSA 3RT9A 1ZXLA 3HH8A 1WMFA 1KVTA 4LNUA 1N1EA 1YS1X 1OHHA 2ZI6A 3PKJA 4R68A 4KHPB 1SHUX 4YJGA 3OA0A 3BYZA 4B08A 2APJA 4XCQA 3OCWA 2P2ZA 4WK4B 3BMOB 4M38A 2B8TA 4N3CA 1X7ZA 1NVMB 2FAXA 3WLOA 5KTRA 5TEVA 1SG6A 1X1QA 2EZTA 4IEFB 4IQ0A 3QF4B 4KUHA 2BYTA 1EGMB 3K9GA 3RVPA 2JWSA 3BICA 4KL8S 5B2EA 4BUCA 2O2JA 1EBFA 1OXVA 1CRPA 3T7AA 1YB5A 3QUTA 5ALWA 2XRZA 1NM5A 2A3NA 5ITQA 2JAOA 3STYA 1A5TA 1ZGJA 2AYZA 3EQ7A 3T7DA 2YWDA 1N2HA 3QX7A 3FCEA 2WVGA 1CZHA 1T3SA 4Q7JB 3ZJTA 2ZS8A 1W59A 4GKKB 4KYUA 2PBRA 2P9JA 4I08A 2ZU6A 1QIIA 1O5TA 1O6FA 2HHAA 4QIHA 4R9VA 3RRBA 4K9QA 4LI0A 1F4PA 4W63A 1W1WA 1ZM2A 2EWWA 3GG9A 3L7BA 3WNQA 3ZIAA 5JQGA 1OIXA 3HRHA 4X9XA 2B36A 2X9LA 2DMRA 2VOJA 2YV3A 4PNEA 1NOIA 4R9SA 3ZOKA 1Z5AA 5BV2P 5TMPA 3CCFA 3G13A 2OHFA 4PG6A 1TCAA 2QT1A 4N6GA 5ICMA 4EEKA 2ZAOA 3Q2OA 1HUQA 3QNMA 5M04A 2O2IA 1AUAA 1WMAA 2FV8A 2W6CX 3FDXA 3HVIA 4OB8A 4X6XA 5MN6A 2HOQA 2BCGY 1JA0A 2G80A 4M60A 3RSZA 3U7QA 3DCJA 4WZ6A 4EUKA 1XZBA 1BXZA 1FUYB 3G8CA 3VU0A 1P72A 5IKXA 3MAJA 4LC1A 3M6AA 2B83A 2ORYA 3LQQA 1VZ3A 3WB1A 2ILVA 1FX0B 4YRAA 4IQGA 1M2GA 3BXPA 3CWCA 3LMKA 3H9BA 3QJ5A 1H8HA 1K97A 3AEZA 1Z3IX 4NABA 3T52A 4L5IA 3W68A 4H7KA 3ED5A 4DNFA 3E6AA 2P27A 3FHTA 4MGZR 4RK7A 3HG7A 4H0FA 2HSWA 1C1YA 2I7VA 3AUFA 1KRHA 2P67A 1TU4A 1VE7A 3HV0A 4PSCA 1FSSA 2NV2B 1DBRA 4LPKA 3WBFA 2FMHA 4DMMA 2GBPA 5ARBA 1D03A 1LZLA 2PX8A 4Y6LA 3AR7A 4S0XA 2YWXA 1C4XA 2XTMA 4UU0A 1U04A 1IN4A 1Z63A 3ZDEA 1H2RS 2YJ3A 4BPRA 4HJXA 3DMFA 1B7GO 4NOOB 3KQPA 4ENSA 3OFND 1RS0A 1TL7C 4JBIA 2ZYUX 5AUNB 2R8OA 3DB1A 3ZGVA 5AOAA 4RMGA 4C7VA 3J80A 2PE5A 3ED1A 3SJBA 3RABA 1J7JA 1V16B 2A9OA 2VA8A 3SAUA 1J06A 2YTZA 5KC9A 1V25A 2MSNA 1DTEA 4BNLA 3QU9A 4RQAA 3N8DA 1WGNA 1YKSA 1GSIA 4YMIA 3SVZA 1CF4A 3IIEA 3LVBA 5KMGB 4LJ4A 3KOZA 3CF6R 5A3JA 2D2IA 3LT4A 4QELA 1N3IA 3N0RA 1D9XA 1CJBA 5CB4B 4WLUA 4XDGA 3FJOA 5A05A 3WHPA 5A9SB 3WA7A 4P34A 1V35A 4M1SA 1BWSA 4UTRA 4NXNB 4TSFD 3B70A 3E1GA 1UADA 2J6IA 2RG1A 4CQLB 1IN6A 3EZ7A 2QVYX 3SGLA 4UHFA 2DG2A 2WZBA 2F5PA 4S2EA 3ZTYA 4W5JA 3BXHA 3W5UA 2Y1GA 2DVMA 3JZAA 4WGGA 1X0XA 2REXB 1PL0A 2GHQA 1XXLA 3QYFA 5DBGA 3C1TA 4BNXA 1R0CA 3AINA 2JCBA 3MTAA 3GWGA 3OFNA 3ZU2A 4NRVA 1HDGO 4XZ3A 2NX2A 4RPIA 4PNHA 1JJAA 1U2EA 1T9CA 4LVNA 4ESOA 1ODSA 4XAQA 1AGNA 2FI1A 3TQOA 3TBHA 4A6EA 1SOAA 4WNAA 4Q3BA 4ER0A 3GJQA 3IJRA 2HBRA 2QRHA 3G6KA 4WEQA 3NVKI 1Z4MA 2BFBB 3HO6A 3OM8A 1W5TA 1OFTA 1QHGA 4IIVA 4YGYA 3LX8A 3Q9NA 4GFDA 1CUZA 5EHIA 2J8ZA 1P7WA 1T24A 2J5RA 4L75A 3GEPA 3JTMA 4BLVA 1U7TA 3C4JA 3W9SA 3KB8A 4ZVPA 1P45A 1X1TA 3JVDA 3IAM1 3VPCA 3H4MA 2PJUA 4CM4A 3TN7A 3V55A 3CPEA 3H5VA 4DV0B 3GPLA 2OHXA 3CGGA 4HL6A 2NSJA 2PGLA 1K6MA 4LCJA 2B4YA 4AN4A 4DR7B 4CNQA 1IBCA 4PLTA 3L46A 5IG2A 5JBNA 1DC5A 3ONWA 1M7HA 1R0SA 5ADVA 4R2LA 2EERA 1P2UA 4OH1A 4PSVA 5G1PA 4EPWA 4CRWB 2XHEA 2ZUWA 2A1TR 4L7VA 3QJGA 4HXGA 2AE2A 4MDYA 3WLHA 1QM5A 4M86A 4KRGA 1WXQA 2JANA 1N6IA 1BJRE 4O08A 5J5AA 2HF2A 4B6RA 5KDOA 1BFKA 1YOBA 3BTUA 2JDIA 4L4ZA 4YI3A 5DT9A 3GPYA 2G28A 4LVCA 2KHZA 4C0JA 7REQA 5JPDA 1FNNA 1BU8A 3EXIB 3TPFA 4LDZA 2W2KB 4LF9M 3BB3A 3NHKA 1IHOA 4I5GA 2XWPA 2I0FA 3ZV4A 3Q6IA 3QW4B 3NUQA 1L8OA 3HFJA 2BKAA 1C29B 2DTEA 2QRVA 2WU3A 4Z4CA 4UVDA 4G01B 4CU2A 1DAFA 1PFGA 1U1EA 4D0LB 4OKNA 5JJIA 5H3LA 4CI0B 2PT6A 4BWVA 4YWHA 3IVGA 1H2BA 2N3ZA 3LCJA 3OQ1A 4CGYB 1JA1A 1EXWA 2H4JA 4DS3A 4EL0A 4X1KB 3TR5A 2FFBA 5E2IA 1V1JA 3AC0A 4KI0A 4NOKA 1OY1A 2H1WA 4OSOA 1L5FA 3B48A 4C87A 3U6EA 1U3VA 2J6BA 2BMFA 3S70A 4BCDA 3Q3HA 2HM7A 2XDWA 4RWZA 3DM9B 3TPCA 4KR3A 5IVIA 3MINA 1TGYA 4ZQBA 3I2IA 1F2UA 2G63A 5CXXA 1IEQA 1W96A 3BIXA 3T1YM 2ZGVA 2ZS9A 3PPXA 4FCTA 4HMPA 1PU2A 5A9RA 5EY5B 4IVQA 3QIVA 4CMKA 1EEXB 1NQXA 4Z9YA 2R5FA 3VZQA 3C1AA 4B6GA 1V34A 3NU1A 3WGQA 1TNDA 1EM8A 4RNDB 6ABPA 3N2GB 1QMPA 1GGEA 3QVJA 2QBYA 2FXVA 3C3MA 3NM4A 3KHKA 2AGVA 1KI7A 5D86A 2EHDA 3FF1A 4R2WA 5LBIA 1XEWX 2H1LA 1K63A 1MVLA 4K3UA 4A03A 2WI8A 2HTFA 2BR3A 2R84A 2G04A 2JHAA 1HYEA 1MGOA 1YU6A 2OECA 1VBKA 3KQVA 3WKEA 3JYPA 4NSNA 3ZK9A 4M9ZA 4DEXA 5JD6A 5K8UA 1E3EA 1P17A 3UFXB 3MAAC 4B2YA 1RI1A 1U99A 3D7MA 4US1R 3JV7A 2IOHA 3DAPA 3L1KA 3TD2A 5K0NA 1NI5A 4HPXB 3EG5A 1HKHA 3KS4A 1G2IA 1DC7A 4URYR 2C5FA 5ALPA 2M98A 4Z4GA 2CF6A 2IV3A 2FMXA 2QD1A 2JVJA 5F33A 4U5QA 1I3NA 5KCZA 1J6UA 4IS3A 4R1TA 2FHSA 4EGFA 3H3FA 2E4YA 3ETDA 3AUJB 3TRIA 1IZ9A 2V8OA 2O2ZA 1WNTA 1V8FA 1E32A 2PXAA 2Q8PA 4OJKA 2IYEA 1MAHA 2GAAA 4OMFG 3JALB 1IOLA 3W90A 4D25A 1BQ3A 2I03A 1YASA 1ZM9A 2J5QA 3T34A 3I52A 2Z56A 5DN6D 3PUKA 2XNCA 3MLAA 4KLAA 4ND8A 4AJNA 1M83A 4RHYA 1NBAA 2HC9A 3OJFA 5I7AA 5TR9A 1AK9A 3D0QA 2GVZC 1G3IA 3PNYA 1XMXA 2Z2IA 1Z9BA 2QRZA 3F3YA 3OZWA 4OU5A 1GGNA 1JU9A 1T5LA 4NP6A 4ZQCB 1TF7A 1R6TA 2DNAA 1WDLA 2DPLA 3CZ5A 3EOBI 5DWQA 3RSSA 3PNBA 5CLJA 1J8VA 2H17A 2I3ZA 2DI0A 3DMYA 3IB6A 2H1IA 5CA1A 1ISMA 1GL9B 4QXAA 3TSZA 1ZWKA 1K8ZB 4R2JA 3FNIA 3VJKA 4B71A 2GFIA 1D8AA 1LLCA 4E5MA 1JG2A 5JLAA 5FI1B 3W8DA 3D6MA 3I6ZA 3IFSA 3DE7X 4NF2A 4Q3EA 2H57A 4CI9A 4MA5A 1FRNA 2IGTA 4QG3A 2VA9A 1NW4A 1H42A 5A4JA 3LYHA 4JI8M 1WLYA 1R5JA 1XZKA 2HMAA 2VH1A 4CCYA 3L1UA 1YJ8A 3K8OE 3OFKA 3UT6A 4XWAA 3FUXA 5PGMA 3TAHA 5L7WA 1VFNA 4B2IA 1GDTA 1U3DA 2MTBA 3NCTA 2DAMA 4TS1A 3VU3A 1ZU4A 4B0PA 4Z7QB 3D8BA 5KB3A 1D07A 3RNLA 4M0DA 3JTEA 3S2ZA 4PM4A 3TEJA 4DKJA 3FUCA 1PQPA 2M6KA 2CBGA 5C52B 2RI1A 2NUAB 1SXJB 3M0EA 3MRSA 3R5HA 1WKBA 4ND2A 5J5VA 2DPMA 2HDOA 3BJRA 4NOLA 4RPCA 4QM6A 4IM7A 4L74A 4NJEB 5IP5A 5HIKA 5JJLA 2Y1OA 4RCYA 4MVJI 1Y9AA 2JFUA 3ZK8A 5JTUA 4F46A 4DLLA 4BGDA 3I6BA 3H86A 4DKXA 2RGBA 2ZDGA 2V74B 4JLSA 1C4WA 2OCKA 4QRHA 1G5IA 1YA6A 4XUDA 1ZD2P 3T9CA 2V6MA 3C6ZA 3K2QA 3GRPA 4WBNF 1Z7GA 5EE1A 4FMCF 3TZEA 2GERA 2I5PO 2QTCA 1FP7A 1PQUA 2RCNA 4HXYA 3OLVA 2J0UA 3I2HA 4FINA 2LE0A 4K6MA 4P3YA 5EJAA 1CUDA 3ZHTA 5EJ6A 3EZ2A 1Z0KA 5DK4A 3VOTA 5BRAA 3OSUA 1Z8HA 4G25A 4DUYM 4KQFA 3TZ6A 3NBFA 4C08A 1FTNA 5EUCA 1J5PA 4QJ3A 2VDJA 3UEOA 5AM2A 3A6JA 1L8QA 3U6SA 2M1XA 1NVAA 4XJXA 4F2PA 4PC2A 1HXHA 2DY1A 4L0QA 3MSXA 4ITUA 1SQGA 3KVNA 1KQGA 2WLTA 1KQ3A 4QFMA 4AZ0B 5LVAA 2ZIFA 4YJHB 3FMOB 1HWYA 5I51A 2XECA 3AIMA 2ZXUA 2ZRMA 3IQIX 4RK1A 1U6KA 3CLHA 3EZ9A 3Q11A 3IUJA 1RQPA 3AUYA 1PW7A 3B1XA 1M1XB 4JU8A 1UFZA 2VDKB 1OSNA 3COYA 2ANCA 2ATXA 3IO5A 5GZ1A 4DR3B 1T3GA 3TQSA 4LBYA 2A14A 1D4FA 4W82A 1QKJA 3O8LA 1V3TA 2GZSA 4UMFA 3TKLA 3L8FA 4MQFB 4FGZA 1NC1A 4OV6B 4MQEA 1K2VN 3NVAA 3AEQB 2WDPA 4TRMA 2ODBA 1AM4D 1ZI8A 4PYKA 3G2QA 5KSZA 3WGKA 1CR2A 4D8YA 2CUZA 9MHTA 2I3GA 1GQ2A 3ABIA 1ZKDA 5AHWA 3V5NA 3PLNA 1MO5A 1WB4A 3VKUA 3G17A 1D2HA 3PKZA 4B1FA 1YB7A 3FTFA 4LJ5A 3M81A 2ZFUA 2FPGB 5EWLA 4X1KA 1TGVA 3OI7A 1QUTA 2IIPA 1O0CA 3AVWA 3BZWA 3R0IA 2ZVQX 5JZVA 1L1TA 1XZ8A 1USUA 2WWTA 1LSOA 3GZJA 4INOA 4IDCA 4CR6A 4RHTA 1QGUB 4MMYB 3ROGA 1KO8A 1L3IA 1VECA 3HZHA 4P54A 1X2BA 3ZGNA 3DBOB 4FOOA 2Q99A 2QENA 2UYOA 1QQWA 2B61A 2D5BA 4MYHA 1XYGA 2HWWA 4NARA 4C7XA 5JYEA 4ZDWA 4OI4A 1WGLA 1H66A 2GUGA 2FEOA 1WUYA 3KQYA 4HXEB 4JSYA 5A62A 4GKJB 1MIOB 3TMYA 5J4HA 1LKZA 2VP6A 3LWDA 4OB6A 4WEOA 5C4GB 2K5UA 1XVTA 3SSOA 1E59A 1U4SA 2W6JA 3BBLA 1ZEMA 2LHCA 4Q4AA 4J4TA 1OKSA 3ZDAA 2OWDA 1FSPA 4R98A 1AX9A 3RS8A 2NQTA 1XDGA 4MEJA 1FVHA 5K01A 4JB8A 5K09A 5BPVA 1TM2A 2QX6A 5DBHX 2OCLA 3RIYA 3JYLA 1E9AA 3E3AA 4MK4A 3UYLA 2HT6A 3GJYA 1OV6A 4Z9AA 3ITKA 3V80A 1JTVA 3PI6A 3C6YA 1E2LA 4G67A 4AP5A 1AJEA 3ZHBA 4DMUB 1IJKA 1OWOA 2CDNA 3ITDA 5K1ZA 3LD9A 3COJA 1AT1A 1VI6A 1NQTA 1Z08A 2XMZA 4QYXA 1ULUA 2UYQA 4C1NA 1J0BA 2G7MC 4PTZA 3T15A 4DQLA 2VAXA 3L6RA 1YVPA 2IOQA 3TMKA 3P9XA 1LQTA 4H7HA 5LZ2A 1L4EA 3MC1A 2WJIA 1S8FA 3F74A 1O6GA 4CL2A 4Y6SA 1DELA 4X64M 2HBQA 3FN4A 1KJJA 2WSEF 1U5BA 2ONYA 1DCTA 1UANA 1FBTA 1OPRA 1QE0A 3AR6A 5FBHA 4BP9A 5JNSA 1J2JA 5IU6A 3M4NA 1ZX1A 2F1HA 2DWNA 2C78A 3BFPA 3NGXA 2OUIA 2QLBA 2ZXEA 3V48A 3UJ3X 2NU7B 5GGXA 1X7WB 1QAQA 2XUGA 1L1RA 3EJWA 4BQQA 1YDMA 3L6EA 3R4CA 2WHQA 2QSYA 2BFDB 2BKVA 5DW3A 4Z2AA 1E1QD 4GIBA 2G70A 5IK2D 3BCRA 3B5JA 4UTOA 4ZCQA 4MYRA 3DMNA 2O2SA 1FX0A 2QZJA 4PLVA 2BONA 3FW1A 3FOWA 3CRW1 3A3YA 4DMKA 5HKOA 4FYJA 5EHZA 3AM3A 1Z22A 4IGAA 1WCIB 1R9JA 1O6CA 3HSKA 2X5OA 3GPBA 1OB2A 4ZQFA 4LW8A 4KR7A 3Q0IA 2HRCA 5H80A 2HSEA 4NSOB 4N76A 1GA4A 3KVRA 3TSWA 4DCCA 3E22B 1P91A 4KQKA 4PLPA 1QFSA 4BMOB 2HPZA 3SBEA 2G6BA 3CTPA 1F20A 4F91B 2YICA 1AGYA 1RE0A 4ND3A 4FGKA 3R6TA 4DIEA 1YJ5A 2CLEB 3GRKA 4MW9A 1H05A 3VDQA 1ULZA 1C3OB 1F8FA 1LA2A 3KXEC 3J7TA 4TWJA 1MX0A 8OHMA 1Z0IA 4MCJA 1EG2A 2GA8A 5DLQC 5LCXA 1E0SA 3HL4A 4IG9A 3ILHA 4XUGB 3DOAA 1DRUA 1JLSA 4F06A 2HNAA 3SG0A 1GSOA 1YS9A 1AGRA 2FPIA 3HJGA 2QV0A 1QMGA 2DLDA 3OX2A 2CEKA 3JQCA 1WCYA 1I30A 2QEQA 1OTRA 3KPJA 2JY5A 3WL3A 4CBVA 2WZJA 1AN9A 2I62A 3SS8A 4DDWA 4JKYA 2VDVE 1OIWA 3NIFB 2YXPX 5LMNB 5IPFA 1W93A 2QYSA 2AWNA 3A6EA 3GL9A 2MJLA 2QCUA 1GAWA 2MMGA 4QXMA 4ZRNA 3ZGLA 4UNRA 4IDOA 1QVVA 2FSVC 2VP9A 3UJHA 4IJUA 3TNYA 4MGYE 4ENQA 3FE3A 1WHSB 2ZIXB 1ZD9A 4EGCB 3DZBA 4H1WA 2JIRA 5EXEA 1Z4KA 1PE0A 4FXOA 4NU0A 2VDWB 1Y1RA 4YT8A 2FXIA 2HGZA 3U09A 1KNXA 3D4BA 3OQHA 1QIJA 4RK6A 2CNKA 3K4PA 4DDMA 1J1ZA 3ELYA 3KZMA 1YHYA 2HBYA 3S4YA 2DHYA 4E07A 1H8ED 1W5EA 5LMNM 1MX1A 2I71A 4GP6A 2H16A 1AZLA 2EX4A 5DRTA 2YCLA 4PT5A 3FKJA 4MM3B 4KQ9A 1XL0A 4NG4A 1O8BA 1P39A 1UMBB 4PZ9A 2EBWA 3O75A 4GYWA 1ZSYA 1TFUA 1NPDA 1LU9A 2ZBQA 2VPYA 2ZBFA 1DMSA 3LQ1A 1DXYA 1E2NA 1RXUA 2ZI4A 3OZAA 4M8IA 4TMVA 1SCQA 1YC5A 2EJVA 4TRJA 5EPEA 1AC5A 2VOEA 2X8LA 1K5GA 1Y8CA 4AP9A 1H2FA 2Y9MB 4MV6A 2WHEA 1OVGA 1GQYA 3C7TA 3QF7A 4F97A 4NMWA 3WKBA 3HU3A 2UXCM 1RLOA 3QEKA 2B0CA 1FFAA 3RUDA 2RGRA 2X5NA 4FTWA 3V2UA 1PZHA 3BIOA 4C7KA 4G0WA 4MP6A 3QXXA 3SYMA 5J4KA 4JI4M 1JA9A 4OVZA 2VT7A 3SJAA 3I2JA 1P62B 1UOQA 1M2VB 3C58A 4GD3Q 3NW9A 4BEVA 4LY3A 5BWMA 4YRKA 4RLHA 2XWQA 5EHGA 3RSFA 5HR5A 2RH8A 3SS7X 4TXHA 1GZ5A 1PFWA 5TMBA 4CV2A 3WB0A 3WGOA 2RGHA 4Q9IA 2GQFA 3KZCA 3N5KA 5ENVA 4H6WA 5ARDA 2WABA 2Z2XA 3DMTC 4PHHA 5DX0A 1IPEA 2V7BA 5K51A 1X6VA 5J3JA 1Y5RA 2X40A 4DREA 2QT0A 4JI0B 4L28A 1JQAA 4A8PA 2E21A 4DFDA 3D2LA 1JDSA 1HC7A 5E95A 5GV8A 4AX4A 3BH6A 4DLPA 3MMXA 2ZVDA 2H63A 4I46A 5HW0A 2PMEA 3E4CA 1E20A 1GGHA 1NRJB 1C0IA 1TKRA 2FMIA 2ZRBA 2ZYTX 3KWJA 4JASB 3ROTA 3DUFB 4CKXA 4FD3A 4DRXA 3I12A 3U2QA 3BXXA 3OM9A 2Q29A 3A4MA 3SP1A 2ASVA 2YYAA 3KTAA 3KQKA 2FH5B 3BH7A 2HJSA 1STOA 3AKCA 4X00A 1BYUA 3NKLA 4P4NA 5IFLA 2GJ4A 2XVZA 5LQMA 2BMVA 3K9NA 2G9ZA 4AMGA 3AIIA 2NXCA 4ER6A 3GOQA 1K3UB 5TY0A 3E46A 2FK8A 1EE9A 1T3LA 1TJ3A 3JQGA 1N0WA 1FQKA 1Y1PA 2OKGA 3ONNA 4IOLA 3SFZA 2KXEA 2XIJA 1NMZA 1Q11A 2V4UA 1IVNA 1U7WA