4LJ4A

Clpb nbd2 from t. thermophilus, nucleotide-free
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
332
structure length
319
Chain Sequence
HMEVTEEDIAEIVSRWTGIPVSKLLEGEEKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 101
structure length 319
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj4A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj4A01
1UEJA 1NVVQ 4P4UA 1RFLA 4OI2A 1S9HA 2KBEA 1GTVA 2FSGA 1E79D 2GAAA 2DPXA 2JIZD 3FTQA 5FH9A 4MKHA 4W5JA 3CB4A 4RD0A 5FPSA 1TQ6A 2REOA 1OB2A 4B2LA 5KNCA 2Q3FA 4M1TA 3WMGA 5KSOA 4IOLA 5ELXA 2EYQA 2HF8A 2ZJYA 3OIUA 2C04A 1JR3A 3I32A 5AJYA 3FMPB 2HJVA 4WZBE 5GJCA 1RPZA 1XCMA 3BB1A 4JL8A 1XTSA 1T3SA 1CULC 4AYWA 1W4BA 5F3WB 2UVQA 5L3SA 3CZQA 4TL8A 5FBWB 5J5CA 4WVFA 2FSIA 4URUR 1IM2A 4AY2A 1GILA 2W83A 4RZUA 5L3RA 3ADDA 1XEWY 1Z63A 3AEZA 1UBCA 3IKJA 5CM8B 3AKEA 1MRSA 5FI1B 2F43A 4B43A 3AUYA 3MLEA 3SJZA 3UKDA 1XD2A 2IXFA 3U2QA 4MITA 3K9NA 3CX6A 2CL0X 3QXSA 4HZUA 5E95A 5KO2A 3ZH9B 1P2SA 4UNNA 4H1VA 4OBEA 2F3TA 3BWDD 4FCVA 3RRNA 4U5XA 1GVNB 1J8MF 4LYJA 2QPOA 3C5HA 5KNDA 3QKRB 1UM8A 1E98A 2J41A 2WOOA 4X8LA 1HEIA 3U5ZB 4Q1DA 3NKVA 4TN1A 3W34A 4C3ZA 4CF7A 2WSMA 5KYKA 5LPNA 3LWNA 2WSSA 4D4JA 4MRSA 2XTZA 1ZMXA 4FIDA 3WYGA 4WXRA 2RHDA 2BM0A 2ZROA 1G16A 3ZQJA 2ZYTX 3NH6A 2J5XA 1G64A 2NO7A 4UNRA 4XD7D 2GJ9A 5LD2C 2ZRDA 4GZLA 3ASZA 1KK1A 2OCBA 3UWOA 1G8GA 3BB4A 3TAHA 2BM1A 4DLSA 1M8PA 3LX8A 4R98A 4OYHA 4C0JA 3K0CC 4NE2A 3U3OA 3QE0A 1WBBA 3SR0A 4OHXA 4NCNA 1E4VA 3JZAA 2X1VA 3OEHD 2GHIA 1E2EA 4L9WA 4U02A 5GVSA 3B1YA 4Q4HB 4YC7A 1II8B 5EZ5A 5BN3A 1II9A 2GEVA 1VIAA 4PHHA 1EWQA 1A7JA 3Q5DA 1X1RA 1K8RA 4JLPA 1JQJC 2RGEA 1G18A 3VR6A 1U9IA 4TSFD 1T0HB 4QBFA 2ZRFA 3W6OA 5JRJA 1ZYUA 1M2OB 4CEIB 3PUWA 4A8JB 2DVWB 3EPJA 3PG5A 2N46A 4PSVA 2WAXA 4YLGA 3REFA 1N0WA 4G1UC 1P4SA 3P20A 2WIBA 4XWKA 1N5KA 3X1WA 1XRJA 4UQOA 4MGZR 1NF3A 3KFVA 4ON9A 3I1FA 1Z22A 1Z0FA 4PFSA 3RYTC 4CEHA 4PXAA 2IYVA 2QRZA 1G8HA 4PAQA 4HAXA 2QAGA 4TL9A 4TT3D 5DSZA 4NONA 2O8EB 1E9CA 2J9RA 3D3QA 3AF2A 4UNQA 3ZVMA 3GLHB 3P4YA 4IEEA 1NVUQ 4KBGA 2ZI3A 4QJ5A 4DWJA 3GLGA 4JJZA 5AJZA 1KMQA 3QG1A 4ERNA 1KK3A 3THXA 3REGA 1MABA 3KKMA 3NEJA 4FI3C 2PCLA 4IDPA 2IYYA 1F48A 1U81A 3QKUA 4FD2A 1U0LA 1Z07A 4LX0A 5DHFA 4ARZA 2DFTA 3PJRA 4RFSB 5TDHA 3CO5A 2V1XA 4KVAA 1Y63A 4F93B 1FTNA 3EASA 4RSGA 4QBHA 3AH8A 3UG6A 2V4ZA 4DLYA 2GJ8A 3ZZ0A 1E2MA 2H57A 4KXFB 4PPNA 1Q12A 1U8AA 2VTKA 2EFCB 4KO8A 1WDTA 4O2RA 4GOKA 2VYFA 4E07A 4JZKA 1W0JA 4DEYA 1MH1A 5BN5A 4MRRA 3LLMA 1ZM2A 4FCWA 3KX2A 3LXXA 1UBEA 4A82A 2GXAA 1E1QD 4Q19A 1QHXA 2ZAMA 1DELA 3NDPA 1J99A 4OHZA 3THWA 2B7BA 1MV5A 2O8BB 1AS0A 2QPTA 3GFOA 1GRQA 2Y8EA 3LX5A 3RC3A 3ZZTA 4KI0A 3PUVA 4AG6A 4Q4JB 3GJ7A 1FL9A 4A0HA 1DBSA 4QM6A 4R2HA 2G3YA 2CNWA 1S9DA 5LBIA 4Q01A 2JLSA 4UXHA 1YKSA 2F1HA 3RS2A 1KAGA 4B73A 2IBMA 1XJCA 5H68A 5G53C 521PA 2AD1A 1VYVA 1AZTA 2IHBA 4ZV4A 4JS0A 2HUPA 4LJ7A 2WV9A 3K0AA 3V4FA 3FHTA 1GFIA 1QG2A 1PUIA 5JCZA 5G3ZA 3IHLA 1BYUA 1GL7A 3SS8A 1TU3A 1ZC3A 2N1BA 1G7SA 1NKTA 1KJYA 2CBZA 3RWMB 1GIAA 1U9IC 2QM7A 3BOSA 2ZJ2A 3GJXC 5EXPA 2D4HA 3A6PC 4GBMA 3ZYCA 4B76A 2CHVA 3T5GA 3MJHA 1IY0A 4QNMA 2B21A 3GEHA 4GPTA 1KY2A 1XMSA 2MSCB 2KSQA 3K0EA 1LTQA 3OE7D 5FI0B 1F60A 1E0AA 2L0XA 1RIFA 2XB4A 4I99A 2MMCA 1RRGA 1LS1A 1GWNA 1GKYA 4E22A 4ZDIA 1R5BA 4NCKA 1ZW6A 2DFKB 2PCJA 5FPHA 1P3JA 3H0KA 4NBSA 4ESVA 1WCV1 4X8MA 3A37A 2GK6A 2Q3MA 2OCAA 1NN5A 4M9ZA 4TLBA 3S1AB 3BXZA 1RC8A 5FTLA 3PEYA 1CJKC 4AIIA 4ESHA 5K8IA 1BIFA 4NTZA 2FF7A 2WJJA 1R0YA 4DSUA 1IAQA 2VHTA 1IN4A 1XWIA 2ZJ5A 3EIQA 1FX0B 5TARA 3GJ3A 1MO5A 4WIAA 4Q9JA 1E96A 3TW4A 1Z0DA 4KVGA 2P5TB 2XITA 3I73A 4AURA 3AP2A 4AG5A 4B3DA 5LD2B 3MD0A 4KLZA 3HYRA 4TMKA 4L16A 4L4UA 5BXQC 1EFTA 1Q57A 1YZQA 5HKKA 4XTRA 2RAPA 3U3RA 1KAOA 3L8YA 1RJ9B 4X8HA 1ESMA 1NLFA 2G0TA 3C8UA 4GOXA 5FOWA 2QUZA 5EE1A 4KJZA 4KFSA 3SQXA 1P5ZB 2ZTSA 1XTJA 2OAQ1 3SNHA 1XDBA 3G0HA 2FEMA 3B78A 1KJZA 3UATA 4TZ6A 2QE7D 1Z5ZA 2CCJA 4G5SA 5JLJA 4NYJR 4ZKDA 1G3MA 3TUZC 4MYTA 3W3ZB 4G5OA 3MCAA 1XPRA 2V7QD 3RSOA 2CL6X 3NBXX 1XEFA 4E03A 3RABA 3B1ZA 1KK0A 1YR9A 3VX3A 1J8YF 1SVSA 4DJTA 3LDAA 1E2IA 2VP2A 4RJLA 4TTQA 1GG2A 5E7JA 4I4LA 1EESA 3SJCA 1TF5A 2ECKA 2O8CA 5GJBA 2WHXA 4QHYA 4FWDA 3N2IA 3C5CA 1SXJA 2EVWX 3NBFA 2BOVA 4G5QA 5L3SB 1VDZA 4D0GA 1NJGA 1SHKA 1YRBA 2HEIA 4CDGA 4C0BA 2JEOA 2ASEA 3PEWA 4W7SA 1GNRA 1Z6XA 2WKQA 2IHYA 1FQJA 2AWOA 5BQ5A 1CU1A 3R7WA 2FPMA 1NIPA 4LUCA 1HE8B 1Z0IA 3NIBA 2PX0A 3DOFA 1XD2B 1DO0A 4D6PA 3I8XA 3OESA 2BJVA 2RKOA 1HURA 4NMMA 3WYFA 4HZUB 2OHFA 2WOJA 1TEXA 1HQCA 3X2SA 4TTRA 1KGDA 1C9KA 4URZR 3I92A 3VHXA 4OHYA 2WVJA 4PTLA 1ZD9A 4RZ2A 1DG1G 5FBRB 2ATXA 2Q9CA 2QL6A 1OJLA 4LC1A 3PQCA 4UNSA 1CP2A 1W4CA 3A1SA 1R8QA 2IYTA 2BEKA 1EX6A 3IBGA 2OILA 3OFNA 5CYPA 2NZJA 1OFTA 4QG7A 1NLYA 4TYYA 1ZNXA 5C2JB 2QM8A 3TJZA 4OQNA 4BLRA 2WJVA 3PEUA 4C2UA 4A1FA 3B9PA 2HYDA 2BKUA 2YVUA 1ELOA 3NEYA 1KDOA 1ONBA 5KPJA 3LRPA 1J70A 1SZPA 3VKHA 3SI7A 4HZIA 4ASUA 2WZQA 3I5XA 1NN0A 4R2IA 3GQBA 2JLVA 2FU5C 4IW3B 1ZNZA 4PZYA 4WA7A 3QKRA 2EQBA 3K70C 2NOAA 3L8ZA 1E2DA 2G1KA 4BEJA 5B58C 2C9CA 2PJZA 2VSOA 2PBRA 1R4AA 2YC4C 4JVNA 1II0A 1L4UA 5G3YA 5AR1A 1W7AA 1NVXQ 3QI2A 1KMHA 5E4FA 2EW1A 1G3UA 1OKKD 1PJRA 1SVKA 1GAJA 4V0LA 3QF4A 3L0SA 1FUKA 3Q3JB 3TLXA 1SGWA 4B35A 2GCPA 1IBRA 2NGRA 2ZRGA 4LJAA 2FN4A 1CS4C 1PLKA 1E0SA 1H8EA 1HUQA 5KPDA 1SKQA 5JHGB 4JBYA 2OLJA 1NY6A 2ZPTX 2GCOA 4TLEA 1LNZA 2ZRLA 2VPPA 1E1RD 2DBYA 4MRNA 3ZD7A 2P2LA 5FPKA 2MSEB 1Z3IX 4CEHB 2W0SA 2R44A 3W5IA 2ODWA 4EPWA 2QMHA 3O8BA 4DDVA 5DO9A 5JWHA 3ND9A 1Z47A 3H2YA 4N0DA 5D3QA 4CT4B 5KUTA 2P6UA 3RS4A 3GLGB 3KKOA 2GJSA 3THXB 2AXPA 3BC1A 1MABB 1RRFA 1A4RA 4HAUA 3RHFA 1OIWA 4G5RA 4LY6A 1DAFA 5EZ6B 3HPQA 1ZM9A 3EZ7A 4QRHA 3MAAC 4Q1EA 4PPFA 4A8JA 3OIWA 1N0VC 1ZCBA 3CBQA 3GJ8A 4XVRA 1LY1A 2ZR0A 2PMKA 1QHGA 4FXPA 4EAQA 2DFNA 4M1MA 1MO6A 3HU1A 1EFRD 2FZLA 2W00A 3G5UA 4NDZA 2ZRJA 4DUGA 4K8OA 3I4LA 4TMTA 2IW3A 2W6IA 3U7FB 1YE8A 3U6KA 3UK6A 3QBVA 5HR5A 5C18A 2HCJB 3PV0A 4D25A 3AGPA 1N6RA 3KFXA 2HJGA 1P6XA 3GLHA 4NCHA 2BCGY 3UXMA 1AIPA 1JAIA 1NBME 5ANRB 3QPUA 5IRCD 1P9RA 1BO6A 2QTHA 3D6TB 1P62B 2G1JA 3IIMA 4NYJQ 5G41A 3ZVRA 2PJRA 4C2TA 1KDTA 4WZ6A 4JL6A 2ZR9A 1Z2CA 1WMSA 4ZIRA 2O8DA 2WTUA 4M9SA 3IILA 2IT1A 2XOKD 3E5HA 3MWYW 3E1SA 4AD8A 3GJ5A 5B57C 2GBLA 4PPQA 5JWOA 2ODNA 3KXKA 4BEBA 2V8OA 1D9ZA 1JJ7A 1P75A 3LW7A 5JJLA 2WWFA 1DADA 1OHHD 1XB2A 4V03A 3H1TA 3K0AB 4Z54A 2CHQA 1HT1E 3GD7A 3RNLA 2R8RA 4BFTA 3DKPA 2AHOA 4MRPA 1XTIA 1JB1A 621PA 2OXCA 2BKEA 2O52A 2HCBA 2A30A 2B7CA 2OZEA 1R6BX 2WMNB 2F9MA 4HSEA 1QVRA 3MUFA 4KSBA 4AYTA 2IS4A 4CYMA 1FPMA 4OHWA 5FR2A 4OK5A 4W5HA 1S3GA 4ILEA 2OLKA 3U7EB 2EFGA 3FMOB 2SHKA 2CCGA 1N5JA 4L9SA 4EIWA 1RYFA 2ZEJA 4C0QC 1BMFD 5AUPB 4I81A 4XVUA 1SKYE 2AFHE 2FG5A 4CEJA 1W46A 1H65A 3OZXA 1S1CA 4I1OA 2RB4A 1W4RA 4NH0A 4B75A 1MO4A 4N1AA 3B8HA 4PZZA 1RRPA 3BS4A 4JBWA 1JEEA 5BW8A 3PUYA 4DLUA 4MGYR 2XZPA 4DCNA 2Z43A 2C9OA 1OT3A 2BV3A 4PQYA 4MDEA 1L2TA 1NY5A 3A4NA 1E3MA 1VCOA 1C1YA 2GXSA 3P26A 1E2HA 4JLDA 4PO9A 4QGHA 1RE0A 4A8JC 4Q9LA 1SVOA 1E94E 2JDID 2P0EA 5BN4A 5JEEA 1X8JA 221PA 3BB3A 5L3QB 3EIHA 4LBWA 3B85A 5CLQA 2HXSA 4F91B 1JJVA 3EPKA 3FGNA 3SYNA 1W0KD 2OFWA 4IOJA 4B48A 4Q4AB 4HUTA 1RZ3A 2ZRPA 2YZ2A 5JZVA 2QI9C 4M22A 4KU4A 4R9UC 3NWJA 3CRQA 5FTKA 4OQXA 4DLVA 1DAKA 4EJSA 1ZD1A 2MSDB 2NO0A 2BJWA 2XSZD 3B5JA 2ZJBA 3R8FA 4PC1A 4M53A 1QBKC 3E2IA 1HY3A 1M1YE 3K53A 1WE2A 5FFMA 1E9SA 3K70B 1E79A 1N6IA 2GNOA 2JIZA 1PV4A 4LV5B 2GEUA 4V02A 2CJWA 1ODFA 3AVWA 3VKWA 3FHCB 3UANA 2XX3A 1OLOA 3CW2A 4QL3A 2DR3A 3RS0A 1DPFA 4Q4LA 4IOMA 5CIWA 2GBLC 1N6NA 2E87A 5A5GA 1TX4B 2ZRIA 5F9HA 1UADA 5CK4A 1JQLB 4URVR 2ZUBA 3O8RA 1KO5A 3GPLA 1WA5A 2WKRA 5D3MB 3M4YA 3SU8A 2I3BA 3CZPA 3UMSA 4V0KA 4GOJA 5JS8A 2OFOA 3NH9A 1RJ9A 4TZ0A 5EP1A 4Q9HA 2D7DA 2F7SA 3LXRA 5KOYA 4QFMA 1JI0A 5F2EA 1G5RA 2NG1A 2FGJA 2YV5A 2OT3B 2C03A 3TRFA 1P2TA 1YZUA 1CR0A 3RC8A 1G21E 3UWKA 3LQRA 4B34A 2HF9A 4GITA 2VBCA 4XJXA 1KHTA 1A2BA 4DBLC 1NLZA 4B3FX 1GSIA 1N25A 2VHCA 1JR3E 3MWLA 4A15A 1T91A 4OQLA 2OV2A 3KJGA 3R7WB 4QC2A 4N0EA 4TYPA 1KI8A 1HTWA 3A36A 4HB4A 3T1OA 3KJHA 3Q9LA 1DS6A 2G0NA 1X8KA 2NQ2C 3K1JA 3PVSA 3SYLA 1F2UA 4MKIA 5EJEA 2HXYA 2J59A 3B7GA 3QY0A 5CIQA 1E2NA 1G5PA 1NG1A 2PZGA 3B1XA 4DT1A 1JR6A 1PLLA 3EWSA 2VP4A 5AUNB 5LB2A 4Q02A 4BFZA 2IF0A 3GEEA 3SOPA 2KWIA 2GJAA 2ZRBA 3FMIA 3GJ6A 5H1YA 1ZM7A 3T06B 4XD7A 4D4LA 5J40A 3A1UA 1G6OA 1XEWX 2AD5A 3BD9A 3Q7PA 3CRW1 2AK2A 3ETLA 1U98A 2G83A 3AUXA 2CK3D 2BHRA 1P2UA 4ZDKA 4LJYA 4D81A 1O3YA 3R20A 3C14C 3LFUA 2R62A 1COWD 1Q21A 2A5YB 2DY1A 3KXIA 1Z28A 4EJSC 3EAQA 1W36D 4DSOA 3QKSB 5SZIA 3OEHA 2C95A 2WJYA 1R7RA 4M0LA 2A5GA 1KI3A 5FOXA 2JATA 1EGAA 1UKYA 4OJKA 1XZQA 2BWJA 3K09A 2JJ1D 1KO8A 2PEZA 2E1RA 2RMKA 4G5GA 5JS7A 4US2R 1FQKA 4TSFA 1KMHB 1U0JA 1P60A 1RW4A 2GF9A 3BFKA 3F3YA 4RZ3A 1T9HA 1W5SA 4L15A 2QGNA 1E2PA 4C4PA 1L4YA 3BJIC 1G8YA 2UKDA 3QF4B 2YWHA 3QKTA 3TR0A 2C2HA 3TNFA 3LQQA 2IYZA 1DOAA 3VU9B 1G8PA 5J4LA 4QHTA 4QOSA 5DYGA 1OYYA 4IDQA 3NG1A 5EE3A 5EE0A 3X1ZA 2LCFA 4UJ5A 1ZU4A 2LKCA 2ZSAA 4MYUA 1X3SA 3LBIA 3BH7A 4WOPA 1VG8A 2GCOB 2Q3HA 4TT3A 4Z51A 3QBTA 3MJRA 3BFVA 1E32A 2XJ9A 3IGFA 2VA8A 2FGKA 1XEXA 2AKYA 1CBUA 4MQBA 3X1XA 4RD6A 4TQUS 2OBNA 4K81B 1ZIOA 1E9RA 2VHUA 1TAGA 4EFMA 4EPRA 1JNYA 3VNUA 4JYBA 1XXHB 4DLXA 4OQMA 2Z6VA 5IT5A 4PHFA 3DHWC 4E09A 1MOZA 3EPLA 1AKEA 1UEIA 2QT1A 4TQ9A 4GP7A 1RVDA 2YWFA 4PAMA 1ZVQA 1VCMA 4HDOB 2QP3A 1R0ZA 2VP6A 3EPHA 2A9KA 1BH2A 1IJFA 1KSHA 3NHBA 4A0GA 2EWWA 3BE4A 3CUEF 4TTPA 1AK2A 3DKVA 3QIAA 1AGRA 2FSHA 5SZJA 4BFYA 3B6EA 2IWHA 3ONWA 3PFIA 3GLGE 1J90A 4PSKA 1E1QA 4QHSA 2VP9A 3RWOA 2GVDC 4URWR 1DAMA 4JLNA 4Q66C 5AK0A 4MYCA 1KO7A 1IN6A 2H7VA 2OEPA 5GADl 1YRAA 2IC5A 4BRUA 1T5IA 3TE6A 4ZDJA 3FFAA 4MYHA 1IOZA 1DTSA 2O8FA 2Q0HA 1WB9A 2B6HA 2FPKA 4TYQA 3TIFA 2VSFA 3QVUA 1EG7A 1GKUB 1VG9B 2FFHA 1GP2A 1W49A 1Z29A 2QAJA 4M9QA 2KBFA 4TMXA 3HJNA 3EX7C 4KAXA 1RYHA 2V9PA 2IK8A 2YJTD 5DGXA 2C8VA 1G3IA 4RD2A 4Z8YA 1TUIA 5FBVB 4ZIRB 2OUKA 2O8DB 3A1TA 4DDUA 4D80A 1WQ1R 3CH4B 2VP0A 2H1LA 3KDSE 3K09C 1DO2A 5TB5A 2CEAA 4EPXA 1JPNA 2XZLA 4H9GA 1M74A 2H5EA 4Q9KA 3MHVC 1IXSB 3LD9A 3TBKA 2XB2A 2OG2A 2PH1A 5B64A 2WIAA 2IYUA 3SJBA 1JPJA 4UXIA 4II7A 3CX8A 4JSYA 1OH8A 4IXNA 1OFHA 1ZNYA 1G41A 1PLJA 3DEFA 5DHAA 3DZDA 2HYIC 5JJIA 3GMTA 2R6FA 3OE7A 4M8NE 1G7RA 2OBMA 2ZS8A 3ICQB 1GITA 3RDPA 4BECA 4HLQB 2IUUA 4I1VA 1G20E 3P4XA 1Z6GA 4A36A 1DAGA 4FWTA 3FMFA 4US0R 3RS3A 1VMAA 1E2JA 5KDLA 4BZQA 4P33A 3M6AA 3BGWA 3DL0A 3TMKA 4WZAE 2J0UA 4CEJB 2CE7A 2NO9A 1M7HA 3L43A 1W2GA 3TAUA 1PVOA 4X8OA 5C4GB 1TU4A 1KNQA 2YWGA 1DAEA 5J4HA 2KB0A 1IY1A 3IQXA 5FPTA 3A8TA 2ZYUX 4HDCA 1P61B 4URYR 3WBKA 2FA9A 2A5FA 4Q1BA 4UKDA 4PR0A 1VHLA 3K0FA 4Q1FA 3U3MA 4IHQA 1P9NA 2I1VB 1LF0A 1KKLA 2WWWA 4QJ3A 3I8SA 4JSTA 4MUAA 4YXWD 2HLDD 2IS6A 1FUUA 1IJEA 2C5LA 2GZHA 4OL0A 4A3VB 2XNDD 1E0KA 3RSLA 4GMDA 3NVAA 1NN1A 1U90A 3BFXA 1TUEA 2QG6A 5AJWA 3FE2A 1S96A 3B60A 4LRTA 1UAAA 1ZM4A 4EJSB 4EFNA 721PA 2OESA 2XZOA 1FOEB 2ANCA 3NDBB 2FH5B 3FKSD 3K9LA 3F0TA 1R8SA 4FCTA 2EFHB 4C0AC 2GVZC 2QE7A 1OXXK 3PENA 4LHYA 4PPGA 2KJQA 2X2EA 2ZSEA 2CJWB 2PLRA 2A5DA 3LW8A 1YZKA 4HUQA 2V7QA 4LC0A 4MRVA 4W5WA 4A6XA 2UZIR 1OYWA 2IL1A 5L3QA 4JN6A 2QZ4A 5CB6A 4B2PA 1L8QA 1JECA 2YKGA 4TYWA 4DC9A 1U2RA 5C4MA 2QMUA 4JLMA 4B71A 1GOTA 2DCUA 2X8AA 3GLFA 2J1LA 4JL5A 4Q7MB 4TL6A 4Q4AA 3OHMA 3IQWA 1QHYA 2J7PD 2WKPA 5B2ZA 2DZNB 3FOZA 2PT5A 2P6RA 1YQTA 4QBIA 3VNVA 1GNQA 3FHOA 4M1YA 3IO3A 1XTKA 2Q6TA 1CXZA 2GWHA 4IDHA 4M1WA 4EQ6B 1YZNA 5J4VA 4Z8XA 2CLSA 3KQKA 4NHOA 3EIEA 4OJQA 3GLIE 3OAAD 2BC9A 3THOA 2O0HA 3CRVA 4HLDA 4KHZA 2J0SA 5K8LA 4ZO4A 1K5DA 2TMKA 1R0XA 2ZREA 2WPDD 3P32A 1KTVA 3KQNA 1FNMA 4Q1AA 1NL3A 2H16A 2P65A 4D2IA 5HTKA 1CTQA 4AYXA 5FL3A 5IF9A 1E6CA 3FDIA 1OXSC 3GEIA 4QM7A 4V0NA 3VKGA 2VLIA 2A2ZA 4LYFA 4C7OA 1SXJE 1F2TB 1G5TA 1QHHB 2D2FA 3RRMA 5JBQA 1UFQA 5D3MA 3QNUA 2GXUA 4B74A 4LBYA 1F6BA 1F2UB 3QXCA 5FUWA 3KKQA 1GL6A 3UMRA 4DT1B 1KI6A 1ZUIA 1TADA 1N6HA 2F1RA 2K5UA 3AKYA 2JLRA 4FMBB 4M9XA 4BLSA 2YNMA 2ZI6A 4A2WA 3MMPA 4HAZA 1YZLA 2IUTA 3ZQ6A 1Z8FA 1CR1A 3BBPA 3SJAA 4US1R 2BCJQ 4LDJA 5UKDA 1UDWA 4PQFA 4AKEA 2ZJAA 3SBEA 3DMDA 1NN3A 3AB3A 3CWZA 4HAVA 4Q18A 4BGDA 2RCNA 1Z6AA 3UMFA 3RRZA 3H84A 3NTUA 2WAYA 3PXGA 4J0QA 4YMTA 3CNLA 3AKCA 3EA0A 3K0SA 5JMTA 2IYLD 2W0MA 1AKYA 1ZUHA 2XEXA 1OKKA 1R2QA 1XF9A 2ZITA 4LHXA 3QVVA 5EUMA 2J87A 1RRCA 3M0EA 1QF9A 3ZS8A 4B3CA 1U8YA 1CF4A 4OI0A 2NMVA 1YR6A 3HDTA 2VO1A 2ZI5A 3U4QA 5HZHA 3N2EA 3HU3A 2D06A 5DN6D 1D2NA 4QNRA 4CVNA 4ACAA 1VCNA 2DWOA 4CW7A 4FWGA 2ZSFA 5JCPA 2RH5A 4AK9A 3TSZA 4OI4A 2W58A 2IS2A 3UPUA 1E1RA 1HV8A 4LHZA 3QKSA 4Q21A 2GJKA 3MG9A 1UKVY 1I4LD 4P32A 3KW6A 3BH6A 4OI1A 1ZRHA 3SQWA 4GMXA 1XEXB 4A4DA 3F8TA 3AF1A 1X37A 1OFUX 4EPYA 1TNDA 3H86A 1H8HD 2QSYA 2ERYA 2IYRA 2FPLA 4HAYA 4AC9A 3KQLA 4BPBA 4JVMA 2FMXA 1CEEA 1KO1A 3KB1A 1D2EA 1W47A 1NMXA 5GJVC 2ZIAA 1VYUA 4JT2A 3HWSA 2WWIA 4NZYA 4BUJA 4MDFA 4LBZA 4HYYA 1Q44A 3AGQA 4PX9A 3HU2A 2XAUA 5HCIA 4U7DA 4ZKEA 1P7CA 1TQDA 2VF8A 1HQYE 3VU9A 1E69A 3U3JA 4PHGA 5HCNA 3SZRA 1EFRA 5EXXA 1KK2A 2OAP1 4A6PA 1E99A 3WRYC 2IF2A 1ZM3A 4MA4A 1XCGB 2A78A 3EC1A 2MMGA 2RGAA 4RD4A 3BH0A 3WHKA 4A0FA 3KTAA 2R6DA 3U7GA 1S3SA 5FOTA 2C96A 2QT0A 4ZI2A 4LJ6A 1NVWQ 4ZDWA 3VLFB 2PZFA 4C30A 4BFVA 4AKHA 4HAWA 3KKNA 5JI2E 1XXHA 2O8FB 3B82A 2NZ8A 4TMVA 1OSNA 2XOKA 1B23P 3WNDA 3TUIC 5F9FA 1V43A 4LJ5A 2AK3A 2V54A 1ZJ6A 2DWPA 4Z1MD 5FOUA 2ZUDA 2FOLA 1KI9A 4V0MA 4Q7LA 2IYWA 2EYUA 5CDFA 1CLUA 1OHHA 2BDTA 4GZMA 1OF1A 2GETA 2RGCA 3DMNA 3CF2A 5E7IA 4C0HA 4C0KA 4E5UA 4URXR 3U7HB 1KSFX 3GLHE 3SE0A 2KI5A 4LRWA 1G19A 2GZDA 2F1JA 3TSOA 2P6NA 3FYHA 4BLPA 5CB8A 1F3OA 5KNBA 2G6BA 3DZ8A 2PX3A 1ZP6A 4GNKA 1S1MA 4Q00A 4HLUA 2QPAA 2H18A 3BORA 3Q72A 3AVVA 4KYIB 1UF9A 3FWYA 2H92A 2I1QA 1G17A 1N6PA 4YMWA 4D4MA 1YU9A 2FV8A 1XBTA 2DYKA 2FE4A 4EPTA 2J45A 2UZ3A 1SVLA 2FFAA 1XTRA 5AJXA 4XWOA 1NMYA 5BYJA 4B6FA 4EUNA 1BMFA 4PO8A 2V6ZM 1M6NA 2FDCA 4LGMA 1XPUA 2YOFA 4BFXA 2C98A 2CHGA 1N6LA 1NI3A 2QBYA 3CIOA 3ECCA 2CL7X 3PITA 3HPRA 5FUYA 1U8ZA 5EP2A 1Q3TA 1L7VC 1KZ7B 4IDNA 2J0UB 3CRRA 1E9FA 4IVPA 1Z0KA 4CT5A 1W4AA 2G77B 3VTKA 3SFVA 1KIMA 4DIEA 3N70A 1FNNA 121PA 4IFBA 2WWXA 2VH5R 4DRZA 2IYSA 4RCYA 5KTYA 2FEOA 2XTNA 3CNOA 2N42A 3QPWA 3DM5A 3IEVA 2JDIA 1X6VA 3DPUA 5EUQB 1X8LA 3A1VA 3VR4A 2JJ2D 3AP1A 1XMJA 2AWNA 3QUSA 1GRNA 3K0FB 1W0KA 5LB4A 2ODEA 2ZUCA 1JAHA 2YINC 4XTCS 3J81k 1ZU5A 4TWZA 5KSPA 2CLDX 4KBFA 2OM2A 421PA 1TMKA 2ONKA 1QHSA 3NXSA 1B0UA 3WP0A 4AKGA 2XSZA 3X1YA 1UKEA 4Q03A 2FFQA 4NPHA 4FWHA 4M1SA 3SHWA 3W9YA 3O8DA 3CRMA 3KQUA 3AKDA 2KRKA 4XSGA 1VTKA 2BBTA 1RKBA 3OEED 5TMPA 2GKSA 3NC0C 5FTMA 3TKLA 1Q0UA 1S8FA 1XMIA 4LBVA 3FKQA 4KODA 2AN9A 2W6JD 2Q9AA 3IHWA 3KKPA 4HUQB 1YZGA 1M7GA 3CNNA 1OXUA 3AM1A 4NKRA 4O2LA 4IOKA 4XIGS 4B47A 2OO7A 3C4JA 1T8TA 1KI4A 1NBMD 4Y0AA 3GCGA 3GLFB 4DCTA 4AKIA 1E9DA 4HB3A 3LAWA 1S2MA 5CJ2A 1OE0A 3NC1C 3D8BA 2P5SA 4LHVA 1Z6TA 5CITA 4HLUC 1G7CA 4O0MA 1KI2A 3QENA 3CF6R 5TV2A 3T15A 2QEQA 4PAOA 2PL3A 5IK2A 3CPHA 4BE7B 1LFDB 3AVUA 4GFDA 1FW6A 2QA5A 2IYXA 3VR1A 1YR8A 1C1KA 1XJQA 2DB3A 1CIPA 2WBLC 4IXMA 2B92A 4NU0A 4TLAA 1NVMA 3ZJYA 1HT2E 4D82A 4LCBA 3BERA 1A5TA 1G9XA 4RD3A 5LDDC 2WWYA 1KI1A 3CLVA 1QHNA 1T5LA 4PQRA 3F5FA 3QG5A 1GL9B 2D3WA 1FP7A 1K5GA 3PIRA 2J46A 4C7OB 3D7MA 3K9HA 3ADBA 3QEOA 5FR1A 4ACBA 1CJTC 4DB4A 2YYZA 2JJ8A 4QJ4A 3T1QA 3CONA 2WMOB 3T35A 3A4LA 3ZVLA 3CPJB 4DLRA 5CYOA 1KI6B 2BBOA 2QY9A 4LJ4A 2NPFA 2DHRA 5C46F 3MWJA 4EQ6A 2IEZA 4O25A 3O8CA 2CK3A 5E3HA 1XJ0A 5JHHB 2Q21A 4KFTA 3L0PA 1TQ4A 2QTVB 1G4AE 2PMDA 2ZJZA 1COWA 4P4SA 2J7KA 3ZDQA 1SVMA 4RY2A 2CDNA 2H17A 2EU8A 1P2VA 5JECA 2RHMA 3PEVA 5FL7D 3GFPA 1CJUC 3QEJA 4M21A 4S35A 3KXLA 1E4YA 2HDNB 3SBDA 3VAAA 4DIDA 4QGGA 4LPSA 3VR5A 3KB2A 3MWKA 1P73A 1XX6A 1LF5A 4HLCA 2Z5FA 1KNXA 1SQ5A 3KQHA 1NKSA 1F2TA 1QHHA 2ORIA 3WNBA 3TGPA 2IWRA 2JJ1A 4QXAA 1A1VA 1E2QA 2HV8A 3CH5A 1ZD8A 3U61B 3IPXA 2WJIA 3O47A 3W8RA 4PC2A 1E2GA 4M1KA 1QZXA 1TPZA 4FWIB 1T8UA 1DVRA 3CX7A 2BMFA 1XFAA 3CR7A 2O0KA 3U4QB 1MKYA 2CVHA 3TW8B 2NPIA 2XNSA 1EX7A 3L82B 3SDZA 4YMVA 4PHTA 1QHIA 3RVBA 4D4KA 4YQFA 4XH9B 4RKEA 1HH4A 2AL7A 3W5JA 3WXMA 2JLYA 2FSFA 5DI3A 4LRSA 3U6BA 2ZRMA 1S0UA 4YDHB 2JLQA 4JKIA 2QMOA 2ZRCA 3TK1A 1CJMA 1XNJA 3CR8A 3IO5A 4GI7A 2WWGA 3LBNA 4GRAA 1N5IA 4UJ3A 1KZGB 3ZIAD 1R10A 2JLZA 1MR3F 2Z0MA 2HT1A 3KL4A 1D5CA 2D2EA 4QGFA 1KY3A 2V6IA 3FB4A 5J47A 3TVTA 5H8WA 1ZIPA 3ZGXA 2PLFA 2QNRA 2D62A 3U44B 2WWHA 3BRWD 1A2KC 4DB2A 2GAOA 1UJ2A 1FFHA 1EFUA 3R8CA 3EZFA 4HB0A 2ZSBA 2YWEA 1TQ2A 3A1WA 4B3GA 2GDJA 1TF7A 4XSHA 1J7KA 4QKQA 3JVVA 1EXMA 3AVPA 1ZNWA 2AKAB 1UPTA 2Q9BA 2WJHA 4ZCMA 5A4JA 5L3VA 3VFDA 2A7QA 4A2QA 4ABYA 4P3YA 1JR3D 2QN6A 4DLWA 3PUXA 3AV0B 1CR4A 2RGBA 4IJMA 1EFCA 3KTAB 5CJPA 5HE9A 5IDVA 3JZMA 5DH9A 2REBA 2VHJA 1VG1A 1IXRC 1JBKA 2QSZA 3MRSA 3EWAA 4Q1CA 3RRYA 2ZU0C 3CPEA 4DKXA 2EFEB 4DCVA 1K6MA 4MH0R 1SHZA 2DWZB 1W36C 3TQCA 3ZD6A 4CGZA 1E2FA 1OIVA 3NBYC 4CZ2A 3GP8A 3EZ6A 2QRNA 4DSTA 4QBGB 5TY0A 4MKGA 3U60B 4PC7A 4LV8B 5C1BA 3HYTA 2RGNC 4NL4H 1NP6A 3THYA 2E9SA 2WICA 1ZCAA 1DG3A 1BKDR 4B3XA 1PUJA 4BZPA 4ZI3A 5JRZA 1IONA 4JLJA 4KCGA 4RFVA 1Q22A 3WNCA 5HE8A 2C78A 2FZ4A 1SULA 2GTPA 3QXHA 4FMCF 3VMFA 2GZAA 3QF7A 2F3RA 2VRWA 2IXGA 3SC3A 1R5OA 3D31A 1NSFA 3ZZUA 2WSSD 2ZRKA 4W9MC 2EWVA 2A5JA 1WBDA 1JALA 4L8GA 5DIFA 3R9XA 1G3QA 1XD9A 2GESA 3T1VA 3I62A 1YVDA 4MKFA 2IYQA 2KE5A 4IEIA 2ODBA 4AWXA 2IX3A 3A58B 3KUDA 3ADKA 4JLAA 1AS3A 4NCIA 2JA1A 1SVIA 2QBYB 1Z06A 1XPOA 1ETUA 3AF0A 4BASA 5IK2D 5L8VA 1JEDA 2CXXA 4FMDF 2IA5A 1O87A 2XTMA 4HI0E 1E0JA 5K8UA 2ZE8A 3R9WA 1S4QA 5SZKB 5IHPA 4FMCB 3LVRE 2QP9X 1OH5A 3G82C 4U00A 5KDDA 2D7CA 1Q20A 4JLKA 4B2IA 1AZSC 3EZ9A 2GILA 1KI7A 4FW9A 3BAFA 4DEXA 2FNAA 5TXGA 2HT6A 4B33A 2VF7A 2X77A 2HLDA 4YXWA 4ZPXA 1PZNA 1XZPA 3PR1A 1Z0JA 2ZI4A 2VQSA 2XNDA 1WXQA 2AFIE 2OCPA 3KZ1E 4C9BA 1E9AA 5CK5A 2GXQA 5AWFC 4HEJA 1A82A 2BMDA 3RANA 2JLUA 2ZSDA 2R9VA 4DLZA 2I4IA 4LHWA 3FKSA 3IEUA 1U94A 2IS1A 5AUOB 2ORWA 3GJ0A 4K46A 4ZCLA 4FMDB 4LV6A 4LYAA 2Z4RA 1J2JA 4RVCA 5JSZB 2ZJ8A 4KLNA 4OHVA 3WBJA 3W6NA 3QXJA 3K9GA 1AGPA 2QMEA 3WRXC 4O3MA 1Q1EA 3AVYA 1AN0A 1NIJA 1DE0A 1W1WA 4LJ8A 1I2DA 3OF5A 2GA8A 1QDEA 4MGIR 2BEJA 2BVNA 4JJKA 1MT0A 4KFUA 2J7PA 3UIEA 2XXAA 4AI6A 5FPYA 1FP6A 1BS1A 2EFDB 1GNPA 4F4CA 4WAUA 1XMVA 1P9WA 5FTJA 2X2FA 2ZU6A 3KJEA 4NCJA 1KOFA 1JXMA 4NP6A 4L5BA 3B13B 3DOEA 3C16C 1KJWA 1DAIA 1IN5A 4JLVA 5J4KA 4LI0A 5SZHB 1ZC4A 2BBSA 5J4YA 4DCSA 3WP1B 2XGJA 1SKYB 3OAAA 1W0JD 2ZYVX 4RCZA 3TQFA 1ZINA 1QVAA 4LOAA 1IQPA 1ZUNB 2WM9B 3B2EA 1NJFA 4JKYA 2WPDA 2IUSA 3LNCA 3ND8A 2OSBA 3PUZA 1AQUA 2QGZA 1G7TA 3GLFE 1VCIA 3KUCA 1KO4A 3I3SR 2FFBA 2X19A 2G88A 1CKEA 3EA5A 1UDXA 2GF0A 2ONJA 1OFIA 2ZVQX 4PC3A 4Y0VA 2CNWD 1OXVA 1T3HA 2QAGC 5DLQC 6Q21A 2ZS7A 2ZQ5A 2QQ0A 4LWZA 4TMZA 5DNYB 1OW3B 1GDDA 2DFLA 1XTQA 4KYUA 4Q7KA 1US8A 3EARA 1T4GA 4JMPA 3W6PA 5JWRA 3LBHA 1UKZA 4IVRA 3IBYA 1IXZA 3QSYA 4DDTA 3FFBA 2V1UA 1X86B 2ZXUA 4A92A 1UBFA 2F55A 1TF2A 4DSNA 3OIYA 2ZM5A 2VL7A 4CRWB 4NYMR 2JLWA 3CF0A 4YMSA 3QPVA 2LWIA 2PZEA 1FMJA 4B32A 4GSYA 2J3EA 4OK3A 3B1VA 2DZOB 5F98A 4P4SB 4DVGA 5TVKA 1W36B 2CLCX 3CKLA 5EP3A 3A4MA 3ASYA 3NBZC 3DVLA 1G8FA 4JVSB 4LSGA 1GM5A 3P1JA 1LV7A 4N3NA 1BYIA 5KSZA 5DYIA 1E2LA 2QQEA 3MFYA 1NG9A 1LB1B 2OE2A 3SHFA 5CLLA 4EPVA 4D0NA 3I61A 4LPKA 4GDFA 5DN6A 3SYKA 3ZLJA 2J0QA 3GLIA 4F4IA 2YHSA 5EQTA 1MRNA 3C7KA 5GJWC 2JAQA 2ZS9A 4DLTA 5FOVA 3EG5A 2P3SA 3V00A 1OH7A 5KDOA 2YOHA 4WBSA 1GUAA 1BOFA 5EP4A 3HP1A 5DI3B 1XP8A 2XJ4A 1EFHA 1VECA 1YHNA 1GZSA 4HB2A 4Q47A 2PEYA 5HKKD 4RD1A 1H8HA 1T6NA 2W2VA 4XOIA 2CMKA 1Q3HA 1ZBDA 1D8TA 2ZRHA 3OIVA 2O5VA 2FJUA 2QTFA 3LVQE 4I1UA 2YOGA 4H1UA 4NYIR 4IVQA 4TYNA 1OXTA 1N3BA 2IXEA 4JIMA 3K70D 1Q1ZA 5EE9A 5FUVA 1Z2AA 5JFGA 4GP6A 2ZVPX 2GCNA 4XVQA 2F43B 3FPAA 1I2MA 1FZQA 4BWYA 4YONB 3JVUA 2ZE6A 5DE3A 3DO6A 3AP3A 3W8NA 3QQ5A 4P4TA 1F5NA 2ZI7A 5EE5B 2V6JA 5AUQA 4OKSA 1NRJB 4JVLA 1LS6A 2JGNA 5B30A 3AVXA 2V3CC 4KFRA 4Q7JB 4R71A 3E70C 1VKJA 4G3XA 4I1SA 3QXXA 4JYCA 4A9AA 2C9YA 1IY2A 2ZJOA 4TLCA 2NO1A 1CR2A 4BFUA 4JBXA 4R7ZA 1GKIA 4D0LB 3L2OB 3WHLA 1M7BA 5FBQB 1C4OA 2ORVA 5EXSA 3Q85A 3H4MA 4BFSA 2JASA 1SXJD 2QU8A 3L0IB 1Q1BA 2P67A 5DISB 1ESNA 1X1SA 5HPYB 1XU4A 3U44A 2ZYWX 1R0WA 4Z1MA 1QRAA 3CM0A 1AQYA 1Y3AA 3ZS9A 4RKFA 3LO5A 4CIDA 1YR7A 3QJYA 1D9XA 4PZLA 1KSJA 5H70A 3VHLB 1MO3A 3LA6A 3SEAA 1ANKA 3PCRB 1AA9A 3THYB 2ERXA 4V0OA 1W5TA 4TLDA 5EXTA 1UBGA 2A3RA 5E7MA 1OB5A 3TSWA 5M04A 3RS5A 1IN7A 4WW0A 4F7WA 2JLXA 2VSXA 3CWQA 2QENA 1XXHE 3EW9A 5K8TA 2ZI9A 1OPXA 4YDSA 5HZKA 2ATVA 2H8KA 2AR7A 2RGDA 1VG0B 2F1IA 4UNPA 1DAHA 4EDHA 1N6OA 3VX4A 3OFND 3RS7A 3Q7QA 4V0ME 2ZRNA 2BMJA 5CDFE 3V4RA 5KSYA 1XD8A 4OK6A 3UG7A 2ZRAA 1HE1C 4WXPA 2CE2X 2OBLA 1CRQA 4A0RA 3V9PA 1SXJC 2GEDA 1NNEA 4BLOA 1P72A 2ZR7A 5GVRA 5BYKA 3U3KA 1E9BA 4ASUD 1NSTA 1CJVC 2ANBA 2QP4A 1Z0AA 4Q4HA 2QAGB 1II8A 4P31A 2VIIA 2JCSA 3T12A 4DCUA 4IDOA 3TUJC 2OCYC 2F9LA 1G4UR 1W2HA 1CRPA 4NYMQ 2JJ2A 5JEDA 1NMZA 3T1TA 1D2MA 3X1DA 5FTNA 3AF3A 2FX3A 3SFZA 2VP5A 1NVVR 3LV8A 5G40A 3WMEA 2J0VA 1VHTA 4ARZB 4LYHA 4CEIA 1HA3A 1WRBA 2R65A 3IIKA 1TL7C 2AX4A 5A0FA 4KV9A 1ZAKA 1AS2A 3GFTA 5FUXA 2PT7A 4G01B 4C0SA 3L0OA 3IIJA 1HYQA 1N6KA 3AQ4A 1FTSA 1H8ED 1WP9A 1LW7A 4ZCIA 4D26A 2NIPA 2W2TA 3OEEA 3HR8A 4IKEA 3T5DA 2G9NA 4BLTA 4F4JA 4EFLA 2O8EA 5JJKA 3Q8XB 2YC2C 5P21A 3THWB 1U0HC 3VQTA 2W6JA 4DDWA 4TMWA 1OH6A 1G3RA 4IRUB 2ZANA 1KSGA 3WY9A 4PANA 2ZETA 2WJGA 1N5LA 3ADCA 2GRJA 3AVTA 4RFSA 1Z08A 3TH5A 3IDQA 2V55B 1NBMA 3MSXA 3WYAA 1T0JB 3R9IA 2XXAB 4BLQA 1N0UA 3ICEA 2R6AA 4B44A 4C0LA 4TQAA 4PSAA 2GK7A 4DZZA 1I4TD 1QZMA 4HDQB 1G291 3AVOA 4BRWA 4Q48A 1XCPA 4PC6A 1QG4A 4B3BA 3AJIB 4FN5A 4HATA 4JT4A 1R5NA 1IHUA 4JLOA 5KHOC 1Q1QA 1E2KA 4NYIQ 1Z83A 1DARA 5JSZA 4DUGD 2Z83A 2O8BA 2W6ID 2W2XA 3T61A 3W90A 3AF4A 2O0JA 3LLUA 4S2EA 5KU1A 1WF3A 4Q4JA 1KKMA 1VIYA 4DHEA 2REXB 4P0TA 2QROA 2C99A 3NHAA 3C15C 4POAA 1FMLA 3DM9B 4KITB 3KJIA 1VPLA 1D6JA 4M2LA 4YMUA 2DWQA 4TL7A 4DXAA 3DDCA 1AM4D 3ZVNA 1M34E 3B9QA 1KDPA 3IUYA 3K8YA 3QOFA 2IEYA 2QORA 2NO6A 4B6EA 1US8B 1VYTA 3LY5A 1G1MA 3IPYA 2CVFA 1KYIA 1TTTA 1EWRA 1GRRA 2BBWA 4MGKR 3N5CA 3Q5EA 3B1WA 4M1OA 4KSCA 4UXJA 2B8TA 2OFXA 4XWAA 5BWMA 1N2CE 4M4SA 5FL7A 4FINA 3EC2A 3SN6A 4ITRC 2R6CA 4MUBA 1I4DD 3P27A 1SVWA 1W44A 4LK2A 2BIFA 5DI9A 3RAPR 4BFWA 3BK7A 4Q5IA 3LH5A 3EZ2A 4F92B 2R6GA 4JLBA 5AJVB 3HR7A 2Z4SA 5FOSA 1T3LA 1YZTA 3RLFA 1W48A 2LKDA 3S1AA 1E9EA 4LJ9A 2VEDA 3EXAA 4IFEA 1G6HA 2AXNA 1U99A 5FBLB 3AVQA 1OIXA 3VR2A 4Q9IA 3VR3A 2R2AA 2F6RA 4BZXA 2ZAOA 2FWRA 1IN8A 1FX0A 2C77A 4PO1A 3GLIB 3C41J 4F38A 2RGXA 4GT1A 4BQSA 3FVQA 3I5YA 2ZE7A 3M1IA 1LVGA 5JI3E 8OHMA 2OXRA 3GJ4A 3WMFA 3W3AA 4GL2A 1YJ5A 1KDRA 2NTYC 1JXOA 3BIFA 3T34A 2RGGA 2VHQA 2CCKA 3TR5A 821PA 5CM9C 4G0NA 3ZIAA 2O8CB 2B8WA 1OV4A 2ZE5A 3K0CA 3TVDA 3MGCA 2RGNA 2BMEA 1V5WA 1SXJB 1EK0A 4EKDA 1AJEA 1Z6YA 3I72A 4RZXA 1DEKA 4QGAA 4A2PA 4OQFA 2D74A 4LZZA 1TEVA
chains in the Genus database with same CATH superfamily
3FJYA 3JQAA 4RD0A 1QKJA 2FPIA 4IOLA 2I34A 2VJCA 1ZITA 1CULC 3LG2A 4TL8A 3SARA 3VPDA 3IP3A 2X4AA 4I55B 2O1SA 1XD2A 1UFOA 4CF5A 4MUGA 4S2UA 2FS1A 4IIWA 5JNRA 1ZA2A 2CVZA 1AKTA 2QPOA 3C5HA 1ACMA 4Q1DA 1YXMA 3LWNA 2R8OA 4IXWA 4QRIA 4REQA 3U9TA 4M7PA 3ASZA 3BB4A 3G5TA 1XA4A 1J5EB 1M0EA 2YQ4A 1WBBA 3KKKA 3O8NA 4DWOA 1RFGE 4L9WA 4JR2A 4N03A 2VKTA 4UTVA 1E3WA 3ZBPA 4XM0A 3A4IA 2EP7A 4FSHA 5BXYA 4A7PA 4N12A 2DVWB 3PG5A 2A9QA 2ZTLA 4MGZR 3TG8A 2X5NA 4F2GA 3VPXA 3FKEA 4CEHA 4MA5A 1W88A 3Q4GA 2WUFA 2V7UA 4EARA 3U80A 4ERNA 4EZBA 2ZJ6A 1N2GA 1DU4A 3F7OA 4AO6A 5KYVA 1BROA 3QYPA 4TSKA 1QP7A 4CCAA 4W5NA 3UG6A 2H31A 1Y9EA 3CT6A 4P7JA 4Q3LA 1RAIA 5K5EA 5KVSA 2DQYA 3M33A 1J99A 2B7BA 4FGUA 1N5OX 4R2XA 1U2ZA 2Y8EA 3RC3A 4KI0A 1THZA 3DDOA 5EMJA 3TLGB 2CNWA 2H4HA 2JLSA 3RS2A 1XJCA 4MNTA 1FVOA 1GG8A 4B3TM 1VYVA 2EG5A 2VDPB 1TLLA 3H13A 1GFIA 3KUXA 2O6HA 1HDYA 3BULA 3MMZA 5J2TB 2W6OA 3WLFA 5AKEA 1SXIA 1H1LA 3ZKAA 2QLBA 1V16A 3GBPA 4AUMA 3UJ6A 3UC9A 3ASVA 2JJMA 2AVDA 1RRGA 4U7FA 1R5BA 2CJXA 1V37A 4KTTE 5FPHA 4PHCA 4ESVA 3GRYA 1WCV1 3JQ6A 1PL7A 4KYTA 2DP4E 4TTTS 4QQ8A 3EXG1 1MVNA 2ZJ5A 1QH9A 3D64A 3D3KA 2JI7A 2VAMA 1ZSYA 1KJIA 2VLBA 3K1TA 4F2WA 4QD3A 1BOOA 2FQWA 1YOVA 2VATA 1HXHA 1J39A 4FDAA 4A73A 3GVXA 3P7MA 1NVAA 2H11A 1HDOA 2PWBA 2PS0A 1V11A 1VBNA 3NBXX 2D7HA 1KK0A 4RJLA 4I4LA 2D1SA 2WYHA 4DSZA 4LW8A 1OI3A 1QO9A 4CDGA 4DHWA 1IZ8A 4M46A 5LQRA 1S89A 3R74A 3PEWA 2OZLA 1M8FA 4MJXA 5J58A 3ITDA 4OHYA 3G2HA 1OJLA 4OUKX 4G4QA 1QYRA 1MORA 3MJ4A 1OFTA 4W63A 5KTTA 4JI2B 4XCQA 5AHOA 3PZBA 3A3KA 4MPJA 1ELOA 4G65A 4C6HA 1TXGA 3MTIA 1RLUA 4J76A 4JVNA 1J21A 1L4UA 1PR9A 1GQYA 1JG4A 4F12A 3HACA 1G3UA 1JLRA 3TRKA 3P45A 1U63A 2KZSA 1QZZA 4J8PA 3LYUA 2C4HA 4RPHA 4Y67A 3NU1A 1ZJ4A 4OLBA 2FOIA 2OLJA 1CR6A 4BVLA 4TLEA 1Z68A 5KTSA 4RVSA 3TFOA 2SKCA 3J81A 1VHWA 5H81A 1M2HA 4PPYA 4B3HA 4DUZM 4LY6A 2I6SA 5FADA 1BMTA 2UUCM 4DA4A 3HVUA 2B98A 1XO1A 3ZCQA 4DUZB 2JAPA 2I91A 3FCSB 5EI5A 8ATCA 3I4LA 3NFRA 2W6IA 3CCCA 1IUNA 5HR5A 1HQKA 4NCHA 1M76A 2PXHA 2PJRA 2D3TA 3C3MA 1RWWA 3MWYW 2W2KA 1NONA 3EXEA 1D9ZA 4IPTA 1QGUB 2LV8A 1PFKA 4DLLA 3E5RA 3C3AA 3L7NA 3RNLA 1JB1A 4J16C 1D1SA 4D1YA 1Q0HA 1NUHA 3O0DA 4KSBA 3IULA 3ZN2A 3SKYA 1H9AA 1PEDA 5JYCA 1RQ7A 4O4IF 4JITA 2AN3A 4PZAA 4XVUA 4RK0A 2C5HA 4TVSA 4O4HA 3BIWA 4E5KA 1W4RA 4YI5A 1DB3A 4PZZA 3DTVA 2YMQA 4PLGA 3EQ2A 4E0BA 2B8NA 4AXBA 2GZRA 4PO9A 4JLDA 3G13A 3AK4A 3EPKA 1JQKA 4H6PA 3ILVA 1OX6A 4KU4A 2JIOA 5FTKA 2A0YA 3B5JA 3NJ4A 4ND7A 1L8OA 2PIDA 2QMYA 3AVWA 1D0VA 5EJ4A 2J33A 3H18A 5CIWA 1KF0A 1UADA 1DTEA 4F8EA 1I24A 1RRMA 3LP8A 4V0KA 2X7HA 3NH9A 3IBFA 4RQUA 3UJ9A 4F4DA 2POCA 4OHBA 3TRFA 3RC8A 4L2IB 1GSIA 3FE3A 5CU7A 4WJLA 4BNGA 2OV2A 3TQOA 4RDCA 5DTMA 1DS6A 2G0NA 2OO5C 1N34M 3V7WA 2BUBA 4Y1RA 1NR7A 4QUJA 2P11A 4INOA 4B17A 2AD5A 4IKOA 1AMOA 4U7PB 4NAHA 1DKNA 3IDZA 3RIMA 2DWUA 3IBCA 3OEHA 3KT0A 3H8SA 1T29A 5E8RA 3U6PA 5FYDA 2O5RA 4G9EA 5F1PA 1YA4A 1DRUA 3MTEA 4CMGA 5JS7A 3A70A 4O4JA 3VPAA 1W85B 2YWHA 3FUXA 3IAFA 1VDLA 1SZDA 4P84A 2FG6C 1WZ2A 1OYYA 1GT91 2GOYA 5DCWA 3HCDA 1E32A 2H0RA 3MSCA 3KWFA 4TQUS 3N05A 5HM8A 3ZY2A 2B9VA 2PH7A 3ZY6A 3EXIA 1QE3A 2G9QA 1UEIA 2QT1A 4WNAA 4HDOB 3H2BA 2IDJA 2A9KA 5MN4A 1FFYA 1C5KA 4QUAA 2GVDC 4Q66C 1QE5A 1RYNA 5GADl 3HTXA 2Q0HA 3NBKA 3ZCTA 3CJTA 2O7SA 4RYDA 1LSOA 3P2IA 4Z8YA 2PZAA 3BX1A 2O8DB 9ABPA 3DUWA 3UGTA 2AOVA 1DO2A 2D8MA 4QGSA 5CBPA 2X0FA 2H5EA 3LD9A 3II6X 3ZGYA 4DR7M 4PSDA 3RE1A 5DHAA 1DFGA 2O7VA 3LVBA 3GQ3A 3VNRA 2VBFA 1M5TA 2B4TO 3FGOA 4MRMB 3JRXA 1P44A 3L43A 3LDFA 4P82A 2L09A 3BGVA 4Q1FA 3HKCB 2I1VB 2HKJA 2ZYIA 1LF0A 3WKDA 3OCVA 1N7HA 1YUBA 5F23A 3ZD8A 1L4NA 3BFXA 4R0NA 8MHTA 3HX3A 2IELA 1ZM4A 1FOEB 2VXBA 2FH5B 4C0AC 2GVZC 4UBJA 5JROA 3ROPA 1DKOA 2JF0A 1NVMB 4Q7QA 2QZ4A 3LX6A 4MP3A 4TL6A 1YGYA 2PT5A 1G66A 1WB6A 4CG3A 3UB3A 1YMUA 2XBLA 5J4VA 3EIEA 1T36B 4OREX 4OYRA 4HLDA 4P08A 4YGXB 1TCBA 2H16A 3WGYA 2XT9A 1Y3IA 3AUUA 1XN4A 4JQSA 3CLUD 3EQ7A 5SV2A 2IOHA 2OORC 1YB4A 4GXQA 5KOHA 2IRWA 2OO3A 4HAZA 1Q5PA 4BP9A 1ZSVA 3HXQA 3C98A 1V4NA 5D85A 1QCZA 3DV2A 1I7LA 4MVJM 3CUKA 4C21A 1A97A 4INPA 1OAKA 4D8YA 3IE2A 4UTPA 4ZHQF 3KD2A 1JXQA 4CVNA 1I4WA 4LQCA 5LKAA 2W2PA 1HV8A 3SM9A 4Q21A 4D9JA 1NURA 2WU3A 3ASUA 3N0RA 4B9AA 4P32A 4QYXA 1HYHA 3BH6A 3FTFA 3QH4A 4IQFA 4HNGA 3OPXA 2IYRA 3CZ5A 4CI9A 4G5HA 2EKFA 5DHQA 4PEVA 1X7DA 3H5LA 2Z3XA 1B8UA 4H0CA 3E7PA 3ITKA 4L4SA 3CA8A 1I01A 4C29A 3KKNA 3PFKA 1G38A 2NLOA 4G0XA 2JKZA 4OL9A 2WJ4A 4R5MA 3ANXA 4PG4A 4ZAFA 3DZ8A 2QW1A 4YMWA 1H2AS 2ZQYA 4X62M 3W2IA 4NMHA 4PO8A 2VP3A 4BFXA 1U8ZA 5EP2A 4G37A 1VJ1A 3L40A 1Z0KA 4RTNA 1Z17A 2WWXA 2X2PA 5HOQA 2FEOA 3DKKA 4DV4B 2ZTHA 4IIJA 3TINA 4MZDA 3RVDA 5JV5A 4GE0A 1PWZA 5H3HA 1ARZA 1QH0A 4BNFA 3QI7A 1XQ1A 4MHOA 3ACBA 4TMFA 4FWHA 3SHWA 3X1JA 2V4MA 5HBGA 2FWNA 1PFWA 3CLHA 3IOBA 2Q3BA 3AINA 3IHWA 3TCNA 4ENTA 4XIGS 2OO7A 4HB3A 3D8BA 1P7PA 3CF6R 5C7IO 3CIFA 1ND5A 2R0IA 1RKVA 3FAZA 1P0IA 2QA5A 3K5IA 3ZCSA 5B4VA 4WESA 4XFJA 4YHBA 2WBLC 1SC3A 1PJ3A 2IZZA 1P31A 4DIOA 3D3EA 5FR1A 4HV4A 5E6RB 3ZZMA 2QY9A 1G63A 1WCYA 2FN3A 4QG3A 3DAHA 1COWA 3T7SA 1H2HA 4RY2A 5JFOA 4CF4A 4PTZA 1DIHA 4DIDA 1EJ0A 3FWZA 1QZXA 2O7QA 4E08A 4RE5A 3SGLA 3GL9A 5EIFA 4EKEA 2ZRMA 4TV8B 1WXHA 4YDHB 1NDQA 4UQLA 4GI7A 3P0RA 4OB6A 2JLZA 3LQ4A 3ODGA 3FB4A 1B1CA 2QL5A 5GM1A 2PLFA 2QNRA 1AUAA 3TTXA 1EBFA 1KYYA 1DAOA 4QO8A 1EFUA 2HSDA 4QOHA 3E9CA 5G0SA 4UDOA 3FDJA 1EXMA 3VFDA 2RGBA 2WSIA 2ZPAA 4DSAA 3HKBB 4YTEA 1WU7A 3TQCA 2C94A 2VYVD 1POWA 2MINA 4YBRA 1NP6A 4M7RA 3TGLA 1DG3A 3PHLA 3HV0A 1CQWA 2Q1UA 2YR0A 4OX9Y 3WNCA 2DULA 1SUEA 5KYYA 5BOSB 2EJTA 4YRSA 2WSSD 4OQYA 3ZU6A 4RHCA 5FLEX 4UEKA 5T67A 2XVXA 3WISA 3UK2A 2HOQA 1R4ZA 4IINA 3BBLA 3T7TA 3TJRA 1FLNA 3AF0A 3OE4A 1JEDA 1W52X 4FMDF 3AR5A 3HDHA 2W6MA 4XRRA 3UJ3X 1RQ2A 4TPKA 3DE3X 4XPIB 3K30A 4Y7DA 1YT5A 3VR6D 1JW9B 1TIKA 2F1KA 3EZGA 4O5AA 3TQSA 5K0CA 3PFWO 4E2YA 2Q5EA 3E22A 4KXMA 2ZJ8A 3W6NA 3NP7A 5LLTA 3IX7A 2Z2IA 2QTNA 4INAA 3G9TA 1U7UA 7ABPA 2BEJA 3N6XA 5IT4A 3MA0A 1P9WA 2YIMA 1K8XB 3H3FA 4F1WA 3N9IA 1CHDA 4H16A 2QRPA 4C6TA 5ETJA 2WM9B 5E7QA 5BMOA 4EBBA 3PE6A 5DASA 1UDXA 7YASA 4N3BA 3CSSA 3EEOA 2BGMA 4LRQA 2PUAA 4YX9A 5IANA 4CM8A 5F64A 1SNYA 3LBHA 1RWPA 2X86A 1TF2A 4R3WA 1BU8A 4R8KA 5ICEA 4TN5A 4AO8A 1E1NA 2J3EA 2DZOB 3KQOA 4DIUA 4DVGA 3U0BA 1X38A 5MFPA 4PM4A 5DYIA 2HQSA 4DA7A 4HZGA 2A6PA 3KVNA 3A2LA 3UFXA 2ZYHA 2P3SA 3V00A 3RJZA 1OH7A 5KDOA 4TWRA 4D56A 4DG8A 1RM0A 5ILGA 5E6JA 2XNJA 3OCZA 3E9EA 1Z3CA 4G8CA 1ACJA 2D5AA 2BCEA 3WK4A 1OXTA 4UUBA 3G79A 1QU2A 4N3GA 1WY5A 3AP3A 3QQ5A 4P4TA 1TM3E 2V6JA 3RT1A 3ZWYA 2JGNA 1EHIA 1VKJA 3O0TA 4LQ4A 1WUKS 3OQVA 4JBXA 3DL4A 2EARA 3UPDA 4CCWA 4BFSA 2VTBB 2BFFA 2DUMA 1CE8B 4O02B 1CY6A 3VHLB 2DT8A 4A1OA 1J5XA 3F5SA 5ED0A 4EG8A 4LA4A 4HX5A 5LA6A 4E4RA 5H80A 3B5IA 4IRXA 1KEVA 3FKJA 4M1QA 4HRYA 1DAHA 5AKZA 5CDFE 1L7EA 1NUQA 1JSZA 4BO7A 1PT9A 1HE1C 1VSVA 1H2YA 4IHJF 3ZGOA 5BYKA 1X19A 2X3UA 1BH6A 1II8A 4ZCPA 3EMKA 4ZYXA 3KEOA 1KFCB 1I3LA 3WMEA 5EHZA 2Y6UA 1ZN8A 3O91A 4MX8A 2DAPA 3FR8A 3GFTA 4QQKA 2PT7A 5EPOA 3WLAA 4O4LF 2G9VA 4RGQA 3OEEA 2Q49A 1O58A 3QMPA 5LMZA 4JC4A 1KSGA 3E8SA 3JWHA 1CRLA 1D7AA 4PSAA 1XLTC 3I5MA 3PGVA 3WGIA 3CB2A 1IM5A 4P7BA 3WWOA 1VMIA 2O8BA 1XTBA 3EMDA 3PP8A 3G2LA 4UUNA 4LVNA 3WLSA 4B6JA 1BQ4A 1JEQB 4KXQA 1R15A 3FTNA 1SBIA 2HRZA 1JBEA 1OLUB 3GJRA 2FUKA 2KW5A 1JLLA 5F12A 4LXXA 3OCXA 4MUBA 3P27A 5IG2A 1B4DA 3U1BA 5DM60 4PX2A 3RFXA 3VKUA 3MWDB 4JB0A 5BSWA 3ZWKA 2DAMA 1W48A 3RVNA 2LKDA 3S1AA 1EGQA 3H42B 2BZ0A 4RMHA 4KQ1A 4BQRA 2WKSA 1P81A 4OHKA 4AJJA 5KO3A 1LVGA 2I2CA 1Z2NX 8OHMA 2OXRA 3W3AA 1CK4A 4AWAA 2CCKA 1AKQA 1MUUA 3QEMA 4D6XA 2O8CB 2EKZA 3MGCA 1SXJB 4GKAA 4RZXA 4IEFB 4FZVA 3NTQA 3RGPA 1PRBA 1U3VA 2JIZD 1C30A 1UBHS 2QF7A 4CR6A 3BWXA 4ZJZA 1WF6A 1W6UA 3OIUA 2PX4A 2HA2A 4FR2A 3IUSA 1XEWY 1MRSA 2IXFA 5IULC 3LPMA 3WA7A 3D8NA 1RWVA 4PG5A 3VDPA 1DKQA 2C7OA 2Q8PA 3TB6A 3R5FA 4CKCA 2HB6A 2YRXA 5A3SA 2NO7A 4NR0A 3BJZA 3KCQA 3CEHA 3OWHA 4NE2A 4F56A 4L4YA 1Y8GA 2Z3VA 3FMVA 3Q5DA 4G0WA 4NZOA 1R0CA 2HPVA 1G18A 2DBZA 1B42A 2Q1WA 2LVPC 4BLVA 3EQZA 3GFVA 4YRJA 1LFAA 4GGMX 4D97A 3ZK9A 4G1UC 1Z45A 2GAJA 1Z22A 1K8YB 3RODA 4HHEA 1BE1A 4NBRA 4KBYA 4QJ5A 4C76A 5F76A 3A1DA 2EJSA 3QG1A 2KNAA 2Q7DA 4RMIA 1YVUA 3RSHA 4DYDA 2HKIA 1TOAA 2QMZA 1K5PA 4DR5B 3DZCA 4LDPA 2VYFA 3MUEA 1VL0A 1ISRA 2P2GA 4CCYA 1P3DA 2GXAA 3Q8XA 3D0OA 1DELA 4X1OA 5CHYA 3JQCA 3NWOA 3PUVA 1KXJA 3GJ7A 3WLIA 2JEZA 1PGOA 4L85A 2ILVA 1C7YA 2M1ZA 3FHTA 3GZNB 3PTLA 2ZSIA 5D87A 2JY7A 1HDZA 4G6ZA 4DC1A 1VEJA 1GN9A 3T5GA 3LY9A 5FI0B 5JAPA 4PZEA 3AHJA 4E22A 3OE5A 4EWLA 3I4VA 1PYOA 1CZNA 1CJKC 2JFOA 2W2OA 3D4NA 3OM1A 3EXHB 5CIYA 3GARA 2VHTA 1FX0B 2XYVA 4WNYA 1WZIA 2ZAGA 2A1UB 3YASA 4AG5A 3A32A 2Q50A 3RADC 1JQ5A 1XZMA 4HAIA 2NTJA 5K3SA 2QTTA 3HCBA 2FEMA 5DLYA 4TZ6A 5DHRA 2PKEA 3W3ZB 4BC1A 1GFZA 1XEFA 4DV5B 1DIOB 1SA0A 4G5QA 3K1YA 4H7FA 3RKRA 4AFNA 3SX0A 1PQWA 4FDLA 4JFRA 4PRYA 4NEGA 3VYVA 1KBOA 3DVRX 4YQEA 2NSLA 2Z30A 1FY2A 2PX0A 3DOFA 2XA2A 3TZCA 3BQ9A 3WIEA 1S4MA 4URZR 1PJQA 4Z7JA 2NTNA 1ZD9A 3HN6A 2VI5A 3TKAA 2I4TA 1ESZA 1CEXA 2C2WA 4PW0A 2QVCA 1JVBA 5MHTA 4E5SA 2K87A 3CVXA 3PEUA 2HO5A 4OO3A 1N75A 1MEOA 2P4EA 2O2SA 1SIUA 3SI7A 2E89A 4YRLA 3ABSB 4R83A 4H6XA 1U5CA 3GRCA 5AKKA 1XVIA 3PYMA 3TCKA 3T7CA 3EGIA 3N1UA 3ENZA 1DC5A 5I7VA 3GJYA 2DBYA 2ODWA 3RHTA 1WBJB 2LH0A 1Z47A 2OD2A 2GBPA 4BNKA 1CPYA 3LQYA 3RHFA 4JVOA 1N0VC 3D0RA 3ESYA 2BNKA 5JNWA 1VFNA 3O83A 2FDRA 1BDHA 7MDHA 4D25A 3O84A 3IUJA 1GTG1 4OVZB 4JI8B 3LRTA 3ZVRA 4BNYA 3K9OA 3AEKB 4J3NA 4HDRA 4NQRA 3RVPA 4L9RA 2WTUA 4C7BA 2R97A 2XOKD 1FTYA 2VNKA 2DQSA 3GFFA 1UP6A 2JHPA 4G4SO 1T0IA 4EI9A 4ABTA 4CKZA 1TW2A 2W6QA 3HB4X 3WGQA 1KJ8A 3UJAA 2WM2A 1ZD4A 4E46A 4BNJA 5L3ZA 4Q6WA 4DDHA 1N5JA 4S04A 1U2SA 2V5UA 4MIOA 1RSZA 4QWWA 1E3MA 1OT3A 3HJQA 3HBLA 4YJ3F 2DTXA 3P26A 2JDID 3I30X 5L3QB 2I3AA 2HXSA 4YXFA 4OIFA 4X3OA 3RVJA 1P3QQ 1ZGGA 1AQIA 2MSDB 4PC1A 4Y2GA 3LO8A 3K1AB 5BOVA 4CIWA 2X8JB 3PEFA 1VZ2A 3G0OA 1QG6A 1EYZA 3V1LA 1ORRA 4EY5A 4HNHA 1Z8NA 4QPPA 1S2GA 1Z16A 1JG2A 1ZIYA 3T3DA 4YFVA 3GPLA 5JTUA 5LDHA 2VSNA 5KOYA 3T1HM 1NOIA 3AHDA 1XWWA 3ETJA 1ZN2A 5CXQA 1ECFA 3R7WB 1SOUA 3T1OA 5JJCA 4IXTA 5BQOA 2YZ7A 3HCFA 3IQGX 5DWQA 3PVSA 1SPBS 3SDSA 1L9KA 4YIHA 5C7OO 2HI0A 3JQ8B 1FTWA 3T06B 4XD7A 1RQGA 4D4LA 3LT1A 5JJ5A 3T3GA 3LY7A 2BHRA 3IB6A 3AL0C 4K40A 5ECDA 1Z28A 4MVJE 1QIKA 4OYYA 3R7LA 3ZV3A 2PANA 4IDDA 1UPUA 1Y1RA 5I8PA 3FCXA 1ZZGA 1RP7A 1BWSA 1W5SA 2QGNA 3N2KA 1L4YA 5FPPA 3VU9B 3NIFB 2X4DA 4QOSA 3LQKA 4IDQA 3H2IA 3LBIA 5ISMA 4L22A 3OZ7A 4Q0MA 4HEHA 2P5YA 4RD6A 2ZYGA 5B1SA 4WA8A 3KZXA 3A6JA 3A27A 3MYRA 2WA1A 4EPRA 1ADCA 4UHKA 1XNQB 3GJSA 4TQ9A 1ZH6A 1DXQA 4PAMA 5JCOA 1OAIA 1QE0A 4LXGA 2RG7A 1YC2A 3MOGA 3ELWA 5DX8A 1DC3A 1SN7A 3KLPX 2FLVA 1P29A 3E35A 2G70A 4EYSA 1V7QA 2H7VA 5BQXA 3MB8A 1DWQA 1E18A 5CYFA 2KBFA 3DT8A 1S2DA 1M2FA 4YDRA 4MV5A 2ZAYA 3A1TA 5FEUA 3I0ZA 4RY9A 3SHOA 1IYZA 3KDSE 5IC4A 1H2BA 1M74A 2XXJA 2C1ZA 3IQEA 4UFPA 1V7ZA 3GLUA 3DUFA 3BTOA 5M29A 5KHLB 1QTIA 4YP1A 3GGSA 4RZQA 4EA9A 4A36A 1DV2A 1XMPA 1Z4OA 5KDLA 3PK0A 4P33A 4RF5A 4CEJB 2Z2KA 1PVOA 1H9BA 4YJHB 4RELA 1KJJA 1RWXA 3WHPA 2FA9A 1T0PA 5JNSA 1CZUA 4KQMA 5EYPA 5HF6A 4J7UA 1O0CA 3I8SA 4L0DA 1DDGA 2Q5CA 1FUUA 3L0ZA 5K0EA 4DR4B 1P3Y1 1M83A 3I28A 4MUYA 2ISSD 4HJXA 1NU8A 3QW4B 1IOVA 4Z6KA 1JZSA 5CB6A 1JECA 1DOHA 1UT5A 4B71A 1EP9A 4C4YA 1NPTO 3CV3A 2R7NA 3WQSB 1A27A 5DV9A 1SBYA 4B3RB 3OQJA 3DZFA 4RWZA 4HPXB 4D0SA 4MP8A 1USWA 3PF9A 1ZKMA 4DJFC 2ZW9A 1K5DA 2XT6A 3P32A 3KQNA 1M1UA 4RZSA 3NHUA 3NNSA 5IF9A 2A2ZA 1VJDA 1F2TB 2MJ5B 5BR8B 2LVAA 1J9EA 1B16A 4NC9A 5G4LA 1NE7A 2UXDB 4QJBA 5HNKA 3MMPA 2IHKA 1WSAA 5LMNM 3KP1E 1JU4A 2E85A 1NN3A 4BGDA 3A04A 3FCAA 5EL0A 3U4HA 3QBDA 4WLNA 4QU0A 2AJCA 3H84A 4R9RA 2FW8A 2FRDA 1L5GB 3OZDA 3NETA 2PYDA 2QLMA 4FFDA 4B3CA 3K2LA 3U4QA 2QRGA 3B12A 3BICA 1I51A 3EG9A 2VNSA 1AC5A 1D1TA 3USZA 3SNKA 3AF1A 4K6KA 2ERYA 1N1GA 1QBGA 1G9TA 3O7MA 4QTTB 1XDZA 1UQUA 4HYYA 4TWJA 4PX9A 2GERA 4Z53A 2VF8A 4WJKB 1GQSA 3VTFA 1Y3CE 2ARKA 4RWEA 1BG6A 2MROB 1QYVA 2PD3A 1S3SA 2QT0A 5DJ5A 2VWQA 4BFVA 3RVSA 2HBZA 2YN4A 1Z37A 3B3AA 4EL0A 1OSNA 1H93A 2HCRA 4JJGA 2IYWA 3BKXA 2ZIVB 5E7IA 1A9XA 1K3XA 1FW8A 4NBTA 4IQ8A 1SCNE 3OT1A 4KMOA 4BVFA 3AVVA 3Q72A 3BORA 4UAJA 2IH5A 4U2DA 2J45A 3HCEA 4MI9A 2Q0QA 1OTXA 2C4KA 2CC2A 1QX3A 3AOEC 1A9ZA 1E9FA 2L82A 2P4SA 2HLHA 3GT3A 3KNZA 3L02A 2LGJA 2X1MA 3TNLA 5CEFA 3IEVA 4CMEC 1UK7A 4KR9A 3P2EA 4PS0A 1ZK3A 3GPUA 4JUIA 4XTCS 1ZU5A 2QX9A 5T8KC 4JB2A 5TC4A 3NXSA 4MRMA 1NW5A 4Q03A 4NPHA 1QDUA 2PL9A 3KQUA 3KOZA 4HNAB 1JWLA 1IEXA 1FSSA 1Z8DA 1PQUA 1XMIA 3C3YA 4HNRA 3FOFC 2HWWA 4Q6BA 1KBQA 3LAWA 4EBFA 2RHCA 4NXNB 1EWKA 1UM9B 1YJBA 1ZUNA 2ZSJA 4BE7B 1E1YA 1FW6A 1ORWA 3VR1A 2VJNA 4XWGA 1NVMA 3B3JA 3IVAA 5TMEA 1OFGA 4I5DA 4RD3A 1BAPA 4EW2A 1X7XA 3D7MA 4HQLA 3X1KA 3S27A 2YYZA 4UUPA 3A4LA 1H6UA 2WV7A 3LP5A 1N57A 3ESDA 3MWJA 4O25A 3LUDA 1T36A 2QRKA 3L0PA 3WK8A 1QPBA 4ODIA 1PNOA 4DQ0A 4S35A 3BL8A 4HLCA 1KNXA 4HWPA 5LVAA 2A4MA 3SZGA 5CFRA 5CFMA 4GYJA 2OQ2A 3J7AS 3JW8A 3U4MA 1MH9A 2Y4NA 5KJ6A 1GZUA 3R3ZA 4FWIB 4E5PA 2J4CA 4LTNA 3U3XA 3DJFA 1NVDA 5FQNA 2CVHA 1WLSA 1U3UA 3L82B 3IESA 1HH4A 5DI3A 1QG0A 1OXBB 1U31A 1XNJA 3OQMA 1D5CA 2EA0A 4QXOA 5FB3A 5LYJB 2HTFA 5G4KB 2XUZA 4CR8A 4B4WA 2MJLA 5C5IA 5A4JA 2Q9BA 1T4CB 1H4SA 2YS7A 3C58A 4ABYA 3A6HA 1CR4A 4B2YA 4DEVA 4J4HA 3BTSA 4DCVA 1K6MA 3RTGA 1Y6JA 4CGZA 4IKPA 1BKYA 3KQVA 4KC0A 1Z5CA 3GUUA 4KCGA 4RFVA 4MUIA 1TF0B 4MEBA 2LDXA 1KQPA 2Q5HA 4CUZA 3K2IA 4MVJD 5JVDA 1V6SA 2WR8A 4L5YA 3AI1A 1NVTA 1GPLA 2M98A 2WZCA 2BP7B 3OX3A 1WIWA 3KUDA 3CE6A 1XPOA 5L8VA 1L7QA 3GRPA 3QU7A 4L0MA 2BDUA 2XHEA 4FMCB 3BN3A 4KRFA 5IZCC 1OH5A 2F00A 3N7UA 3KG2A 2OXTA 1A7UA 2RI6A 3WK9A 4NVRA 1AE1A 1SCUA 2I6FA 2CHEA 3FZEA 1AD2A 2W7TA 4FNAA 2HGSA 1WV1A 2Z4RA 1J2JA 3CZRA 3DS8A 4LMRA 3QXJA 1AN0A 3QE9Y 3GI1A 2VTEA 3ME5A 4DJ5X 4Z0NA 3UIEA 3I9LA 4YUXA 4P7FA 5FIUA 1SC1A 1QH1B 5A5VA 4ESOA 3FNEA 1DAIA 3ICWA 4B3TB 4ZAWA 4RK5A 1NVKA 1OBCA 4LOAA 2QS9A 3B2EA 1UDAA 2I2WA 2FR1A 3IDSA 1G7TA 3GLFE 2ZBPA 3SSAA 3WR5A 3SC4A 1R0KA 4LWZA 1ZPDA 1XTQA 4JMPA 4ER6A 3CLKA 4K7JA 5F2KA 4BXOB 4TTVA 2V1UA 2JA2A 4AMGA 2KDLA 3V3TA 3EEFA 4WBXC 5KAMA 2IU3A 3VVMA 3V76A 3ND6A 5BV1A 1RC0A 4JVSB 3SVZA 1UZLA 3AERA 1RKUA 1CUEA 4MVWA 5K4HA 3WRYA 4H0FA 3IOYA 2Y1LA 5DN6A 2J0QA 3JD4A 4Q1VA 3UW1A 3OTIA 4I1RA 4XVHA 1FXSA 1VHJA 5KNDH 4TSRA 1GUAA 3NX4A 3KYJB 4YRGA 4Q47A 1NW4A 1O97D 3IP8A 2DFDA 2QQ8A 2VT6A 3IB3A 1CY2A 1Z2AA 1ZONA 5GKNA 2FI1A 3T3HA 1NZFA 1YS6A 3TL6A 3OH8A 5FXMA 1M33A 4NENA 4G3XA 2I54A 1ZL2A 3PFNA 4JXXA 4Y7CA 1QHEA 1I7SB 1M7BA 1NQAO 4CMIB 1QKIA 2P67A 5K05A 4L8WB 2OZPA 5HIAA 4R51A 3KJXA 4E5VA 5IYZB 1YR7A 3A6DA 3STVA 2PSJA 1Z4PX 1LPOA 3QELB 5M04A 1T5HX 2ZI9A 4M0WA 5HZKA 3C1UA 1QVZA 5LQMA 1VG5A 1QUTA 3AMVA 4EDHA 3OFND 3SIWA 4O2BA 1SBNE 5E4TA 3R7DA 1P9OA 2Y93A 4KE7A 1SXPA 1K7CA 3K15A 2VUTA 3CVOA 2YIVX 1NSTA 3D3JA 1E6UA 2PV0A 4Q4HA 4P31A 2VIIA 3RUDA 1U0RA 4RTRA 3B6JA 5BOSA 3PI7A 1D2MA 4ISCA 1P4RA 3LDUA 3COWA 2UUCB 4TKMA 2HGZA 3HR8A 4RXUA 3SJ7A 5AD1A 4IV8A 1UT6A 2QAIA 1WETA 3WK5A 2P2DA 2RBEA 4XPIA 4RFSA 3TH5A 2V55B 2W2LD 2H7CA 1R6TA 3ABZA 2JAUA 1R5NA 4JLOA 4GI1A 5KHOC 4OHFA 1Z83A 2YFHA 3AF4A 4EF5A 3ZBQA 1NAIA 3L77A 1L8XA 2C99A 5CM2Z 1DKPA 5B12A 1XHLA 1D6JA 1AM4D 2QGFA 2VK1A 1DGFA 4YRFA 2QYHA 3S2EA 1ZOSA 2AFHA 2GPSA 1GCOA 2EBHX 2B8TA 4D8WA 4CMKA 3EC2A 4HLNA 4IIVA 5DI9A 4HCJA 1KL7A 5HS6A 3TTVA 2WFLB 5BSVA 5EJ5A 1ADFA 1IN8A 1Z5VA 1C4WA 4PO1A 3GLIB 3IH5A 2BFCB 1JQBA 5CUQA 4WQMA 3RHZA 2Q7OE 2VHQA 2X7XA 3PRHA 5IXYA 3MTAA 4U7TB 2FPPA 1QGZA 2FSGA 4W9RA 4EI8A 2GAAA 1YQDA 2DERA 2Y1CA 5LIRA 3KEMA 1X1EA 3PE3A 2JGDB 4WZBE 1PM5A 4S1PA 2NXWA 1CB0A 3SF0A 3VJMA 1N34B 1GAEO 1ZMTA 5LP6C 2GK4A 4ZZ2A 3AUYA 3ZDEA 3KAQA 2QM3A 4MI1A 4BQFA 3OVMA 5IVDA 5FA6A 3WSTA 3CJRA 1GKKA 2WQ6A 4Z4IA 5DHTA 3DOUA 3BXOA 5CT5A 2VTBA 4PLWA 1EM8B 3ZQJA 3JYLA 4L6V6 4W1RA 1MU0A 1ZOPA 3TAHA 3TNJA 2A5LA 4LY3A 3WQQA 4EZIA 4S12A 3LWZA 5EZ5A 1II9A 4PHHA 4IBFA 1A7JA 3HSSA 3IXMA 4ETWA 5ULLA 3CGGA 3KT6A 4XRGA 3TGWA 1HFKA 3QYFA 3F1KA 5IKMA 3M3DA 4GSLA 1C4KA 4PAQA 3WAKA 4UARA 2WIKA 1KBZA 3SQOA 2YV2A 4IDPA 3D3WB 4QBHA 2XR1A 4D3SA 4W8GA 2V59A 2VTKA 5GIPE 4E07A 2E4AA 2GNPA 3QVOA 3NASA 3GGPA 3OURA 4MQ5A 4Q19A 5EINA 4OHZA 3PQ4A 3VZRA 2JBAA 3G1UA 1S3IA 5KCMA 2RK6A 4DR7B 4PX3A 1EGMB 1VMKA 5FWYA 5H68A 5REQB 2HRCA 4JS0A 5E9AA 2WV9A 4NXMM 1IVYA 1K88A 3IHLA 4CJXA 5L45A 3DLAA 1R4NB 1IY0A 2VCYA 4RMJA 5BMVA 1RM4A 2JI9A 5HQJA 4CGYB 3R5KA 3GR6A 4Y98A 1ZLXA 2LIPA 4BE4A 3JSXA 4EW1A 4H59A 4TLBA 2FCRA 4M9UA 3IQHX 3EUEA 4NTZA 3UH1A 5TARA 2V98A 3HZJA 3ZHRA 3GPBA 2IX9A 2BLNA 3B9BA 2RKBA 4XTRA 3MWDA 5A3VA 2PQ2A 3TQIA 3BEDA 2CN1A 4QOFA 4BUCA 1ESMA 2G0TA 4JCCA 2ZTSA 3D9QX 2BR5A 2PZJA 4QDTA 2IIVA 3NNDA 1I6KA 4E03A 2XADA 2E6KA 2GBGA 1AUXA 5G1NA 1GPAA 2O8CA 4DV6M 2ECKA 1CETA 3C4VA 3N2IA 1SXJA 1SHKA 1YVPA 3LLSA 1ZNQO 2JEYA 4W7SA 2VT3A 1I30A 5HFJA 1FQJA 4C07A 4WXEA 3VYTB 1C7ZA 3WLKX 2DWMA 4RS4A 1CF2O 1HQCA 2YZKA 2O01F 3I01A 1ODSA 3VHXA 2WVJA 3B6ZA 5LZ2A 4PX5A 2NP6A 1SU8A 3USES 4LF5M 2HDWA 3FNHA 3ROGA 3TJZA 3Q40A 3B9PA 1B1AA 3V33A 2DY0A 1ONBA 3ZPXA 1J2YA 5A03A 5T4HA 3VKHA 3PLRA 3PL1A 1BGWA 4PV7A 1NHGA 2RIPA 2CWWA 2C4TA 2GQ0A 3PHIA 3ZE1B 5H59A 2VHXA 3KQYA 1GGJA 3K70C 1BDJA 2NOAA 4XQCA 1EHCA 5DW3A 3ND7A 1XHFA 1KMHA 1ENYA 3HWX1 3RUAA 3NBIA 4BJ6A 1YZFA 2GCPA 2GUGA 3V6LA 1XQWA 4RF0A 2H48A 2YFKA 1NY6A 2G04A 5HW0A 5BPHA 2IIPA 3M6FA 2XD4A 1E5VA 3F3KA 5DVZA 2W0SA 4DDVA 3RUPA 3NHMA 2OMEA 2P6UA 2Y77A 3T1NA 1YS2X 2IX3A 4LKOA 1XDSA 3G2OA 5E6UB 3CVVA 3ETGA 5I47A 3UUFA 3RJ5A 1NW7A 4DUGA 2C7QA 3QVGA 1SOAA 2BCGY 2BGLA 1P9RA 1I1QB 3O82A 2G1JA 4X62B 4M9RA 3E5HA 4L95C 4Y1EA 2GBLA 1Y4SA 4IGKA 3F6RA 3BIXA 2AHOA 3OHSX 3TOZA 3K20A 2ID4A 2HCBA 3ES9A 5JZOA 4OK5A 1Q19A 5KPTA 2CCGA 1VCHA 1BMFD 4UEOA