4LJ4A

Clpb nbd2 from t. thermophilus, nucleotide-free
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
332
structure length
319
Chain Sequence
b'HMEVTEEDIAEIVSRWTGIPVSKLLEGEEKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 101
structure length 319
sequence length 332
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj4A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj4A01
4EPTA 2DZOB 1TL7C 2J7PA 2G1KA 4A2WA 1AGRA 3GEEA 5L3VA 2NMVA 3BFXA 1TQ6A 1KYIA 2QE7D 4TSFA 3AM1A 4ESHA 1TNDA 1P62B 3AKEA 1CJMA 2FPMA 2IYQA 2QP3A 5CYPA 3GJ0A 2ZETA 5EE3A 2MMGA 3HPQA 4OHZA 2K5UA 2FSFA 3T61A 1S9DA 3EZ7A 3NHBA 6Q21A 4RCYA 2JEOA 3CF2A 4Q4HB 5FUWA 5EZ5A 3ADCA 4AKHA 4DZZA 4A8JA 1HE1C 1ZCBA 5L3SA 2XSZD 3T1QA 1BIFA 3Q7QA 2ODBA 1UF9A 1W2HA 2CCJA 5E3HA 2IYYA 1HT2E 4HEJA 5K8IA 3U4QA 3F8TA 4DIEA 4P4SA 3JVUA 3MGCA 4F4IA 3QKUA 3ASYA 1OKKD 1HQYE 5FBWB 4JVSB 1G21E 1KO8A 4U00A 4BLTA 2DWQA 1XCPA 2WJJA 2XJ4A 1XTSA 3RWOA 3V4FA 2WHXA 3RS5A 4C0BA 1T8TA 1U90A 1OIVA 4RD3A 3QQ5A 2O8DA 2PT5A 3EA5A 4FMCB 3WP0A 4LV8B 1SVOA 4D4KA 1A1VA 3TJZA 1ZYUA 4JBXA 1MRNA 4AURA 1KAOA 4B71A 1UM8A 3WMFA 2OZEA 2J1LA 3QF4B 3QENA 1ZC4A 2X2FA 5F9HA 3DL0A 1B0UA 2DZNB 3T06B 4BUJA 2GJAA 1KI9A 2FFQA 4OL0A 4C0JA 2JLZA 1WXQA 3I5XA 3TGPA 1J99A 1F2UA 2EWWA 4LV6A 3L82B 3NBFA 4AYXA 1RC8A 2QP9X 2C2HA 2DVWB 1IM2A 5TY0A 1EFTA 1PUIA 2BKEA 4QHYA 2GILA 5AJYA 1P73A 5KSZA 3THYB 2O8CB 3KW6A 2H7VA 1E9DA 4KFUA 1N6PA 1N6RA 2W58A 2WBLC 3CX7A 1VIYA 2ZI3A 5G41A 5EP2A 3VLFB 2A3RA 1XU4A 4DEXA 1G3RA 1AKYA 3CRRA 3NKVA 1P9RA 4Q1AA 2VLIA 3MMPA 3K09A 4EPYA 4BECA 4GFDA 2OXRA 2NZJA 2ZUDA 2ZYTX 3W3AA 4GMXA 4XSHA 5DO9A 3B1XA 3TSWA 1OW3B 1W5SA 5EP4A 2BMFA 1C4OA 2YWGA 1F2TA 4Q01A 1J2JA 2IHBA 1US8A 2PJZA 2XTZA 4MRVA 1Z6XA 3NHAA 5CM8B 4ZCLA 2CVFA 3SI7A 1HTWA 3OFNA 4PZZA 2XXAB 2ZU6A 2DB3A 2ODNA 3TMKA 1M74A 1NSTA 1W0JD 4NKRA 1KDRA 1PV4A 2OT3B 3LXRA 3ZD7A 1P2VA 3FKSD 4I99A 2Z4SA 3SFVA 4Q18A 2IS6A 4A3VB 1OHHD 3CX8A 2VTKA 4JKIA 2QRZA 3AVUA 1X1RA 4MDEA 3ONWA 3NH9A 4A92A 2AFHE 4WW0A 4KYUA 2EFDB 1MABA 2VQSA 5EXTA 3FFAA 3KJEA 4TMVA 2GHIA 4WZ6A 3LD9A 3PCRB 1W36C 5SZIA 2WKRA 3V4RA 3EW9A 3CIOA 4L16A 3D6TB 3OIWA 4NMMA 4TL7A 2ZREA 2WTUA 4CEJB 4AKEA 3AVTA 4C30A 4RJLA 3RSOA 1M7BA 2BOVA 4B33A 3VU9A 1G7SA 4AYWA 3QKSA 3AKCA 3EA0A 1U94A 5IDVA 3MSXA 2GVDC 4PQFA 4JLBA 3U3MA 1KMHB 1LS6A 1U0JA 1Z0KA 4CYMA 3AEZA 1SVIA 3C5HA 3CRMA 2D2FA 1G5TA 4HYYA 3V00A 4KHZA 2QMEA 3M1IA 4DCNA 2RMKA 4EDHA 4D0GA 4GT1A 5AJZA 5C2JB 3U7HB 4CEHB 1P60A 4FCWA 4CEIA 1IXSB 2EFCB 2J45A 1RPZA 5FUYA 1E1QA 2XOKD 2DPXA 4D4MA 1NMYA 2ZYVX 1XCGB 2FF7A 4AKIA 5E7MA 3HPRA 4ITRC 4QG7A 2WJHA 2PZFA 3CPEA 4RFVA 3DDCA 2GWHA 3AVOA 821PA 3IEUA 2SHKA 4LC0A 2P6NA 3A6PC 5JWOA 1MO6A 1NNEA 2WKQA 3QKTA 1CR2A 1NI3A 4BFXA 2RAPA 2F3TA 4NCIA 3AF2A 2B8WA 4LYJA 1FUKA 4S35A 1SXJA 1H8ED 1IY2A 4EPXA 2VHUA 2GA8A 3OIUA 1W4BA 5BW8A 3QPWA 4XIGS 2RHDA 4NYMR 3U6KA 3OIYA 2N1BA 2BJWA 4Q9KA 1E98A 3EARA 3HJNA 4IEEA 1T3HA 4DUGA 1Z0DA 3B1ZA 1TQ4A 1UKVY 4FWHA 3QEOA 3REGA 1Z2AA 5HZHA 1ZUNB 3DMDA 4M4SA 5AJVB 5JCPA 4M9ZA 3T12A 5FPTA 2Q9CA 1E2HA 3GLFA 1AK2A 2QPTA 1JR3D 1RJ9B 3LAWA 4D4LA 1G4AE 3HYRA 1NY5A 1WB9A 4DLRA 4MYUA 2F1IA 1P2UA 4D0NA 2NO1A 1C1KA 5JWRA 1W36B 1YZGA 2NO0A 4H1VA 4P31A 3VR6A 1N0VC 1ESMA 2ZJ2A 2FPLA 2HF9A 4RFSA 2ZRJA 3AVWA 1TAGA 4EFMA 2GZHA 3J81k 1XCMA 2IXEA 4ZDIA 4E5UA 1WF3A 3SYLA 2G83A 2WAXA 1FQKA 2ZSAA 3TAUA 1KI3A 1G17A 3SFZA 4WAUA 1G8YA 2ZJ8A 1Z6GA 1RRGA 2J41A 2ZUCA 4JLKA 4S2EA 3KKNA 3B9QA 3OAAA 3SE0A 4DT1B 1XZQA 2F9MA 2AHOA 3FDIA 4X8MA 4TTRA 3ZS8A 2PJRA 3GJ3A 2JJ1A 3A36A 2QA5A 1UFQA 4EJSC 3TKLA 5GJVC 1IN7A 3NDPA 4PX9A 1MR3F 1A2KC 3IPYA 3QOFA 3WXMA 4YMVA 1BOFA 4M1YA 3D3QA 3L8ZA 1JR6A 5KTYA 1PLKA 4TZ0A 4TQAA 4NYMQ 3H4MA 3B82A 3W3ZB 4MRSA 1E6CA 3AP1A 4PQYA 3I72A 5FR2A 1SZPA 4DBLC 1IHUA 4Q4HA 5CLQA 4Z1MD 3ZLJA 5D3QA 2G0TA 2X77A 4EQ6B 3RS0A 1Z6TA 4YDHB 1II8B 1B23P 3FMIA 5DI3B 3GJ4A 2VYFA 2I1VB 5DHFA 1GILA 3ZDQA 1E9CA 2REBA 4FN5A 2CLDX 2ZRFA 3BORA 4C2TA 2GK7A 4B34A 2FMXA 1BKDR 3B2EA 4Q4AA 5J4LA 4DC9A 1E2FA 4IDOA 3Q8XB 3CRVA 3IO5A 4CT5A 3AGPA 1M6NA 3I61A 3OIVA 1FUUA 1P72A 4POAA 1KDTA 3OEED 3ZQJA 3RWMB 2ZEJA 2GTPA 4JT4A 1ANKA 2IYRA 2EQBA 2G9NA 3SJAA 2KE5A 2O0HA 4KI0A 3EZFA 2VPPA 4W5HA 3BH6A 4GITA 5EXSA 1TU4A 3T1OA 2FA9A 4DDUA 1JXOA 2WWXA 5FPSA 4A8JC 2CCKA 2HJGA 4EFNA 4DSOA 4X8LA 4V0OA 3ZVNA 5LDDC 1X1SA 2IYWA 1X37A 2N42A 5J4VA 5DLQC 4E03A 4GNKA 2ZI5A 1PVOA 1NN3A 4ACAA 5DISB 2ZR9A 4ESVA 4A15A 3BH0A 1R5BA 3LV8A 4Y0AA 2IUTA 1KSJA 5E7JA 1QZMA 2XAUA 3GFOA 4ZI3A 3A8TA 4ARZB 3CR8A 2R65A 1F3OA 1KSFX 4XD7D 2A5YB 3C15C 1G3IA 1XD8A 4HUTA 4TMKA 3FB4A 4A9AA 4FMDB 2OCYC 1AZSC 2ZRDA 4DEYA 1SHKA 4TZ6A 3W6OA 3F5FA 3GJ6A 4D25A 4URXR 1ZC3A 2OBNA 3GFPA 4UXIA 4GRAA 1Z28A 4FIDA 1K5DA 4G5QA 2LKCA 4PHFA 4TLBA 4WVFA 5GVRA 3KB1A 4FWDA 1Q12A 4E09A 4H1UA 3B8HA 1Z47A 4RD6A 4FMBB 1KK2A 2PMKA 4HAXA 2W0SA 2PBRA 3C4JA 1KJWA 3H1TA 2OCAA 2FGJA 3RNLA 4R2IA 1X3SA 1QVRA 4OBEA 4RSGA 5E7IA 4ASUD 1W36D 3VHXA 4N1AA 5KU1A 5KDDA 2EU8A 1E69A 4LJYA 4PPNA 2QBYB 1Q1QA 4I1UA 5SZHB 2RGDA 3TQFA 4M8NE 1P2TA 2VIIA 2YHSA 1KGDA 2FJUA 3ETLA 1KIMA 3ZVRA 3Q85A 4G5RA 2GBLA 3KKMA 4LBYA 1GM5A 1UBEA 2IF0A 5KUTA 4M22A 1NN1A 2DFTA 2VHCA 2WV9A 3A4MA 3FMFA 2VP9A 4M1SA 3R7WA 2IYSA 2QN6A 1P9WA 1NJFA 1CJKC 1IOZA 5HPYB 3PEWA 4GMDA 5CB6A 4O25A 1DVRA 4HAYA 4KO8A 2MSCB 2C8VA 2B8TA 1M34E 3QBTA 4LYHA 2V7QD 1OIXA 2P67A 1G64A 4BFYA 3OE7D 3DVLA 4LWZA 1W49A 5ANRB 1V5WA 2KBEA 3KX2A 4ZDJA 1ZIOA 1KMHA 2DBYA 3KUCA 5FPHA 3UIEA 4HZUB 2E87A 2WM9B 2GAAA 4KBFA 4OQXA 4W5JA 3EPKA 2CJWA 2B7BA 4W9MC 4PC6A 2FDCA 3DMNA 3G0HA 4LJ7A 2J0SA 1A2BA 1YR7A 1NVUQ 3RS4A 4CEHA 3L0SA 4HB0A 3BXZA 4B6EA 1OB5A 4O2RA 4IRUB 3WHKA 4TWZA 3WBKA 5AUPB 2XB2A 4PZYA 2HXSA 1G9XA 2YWHA 3TW4A 2JIZD 1VECA 4JZKA 1NIJA 2VP0A 2OCPA 3C41J 3RC3A 1IQPA 2XB4A 4M1OA 1U8ZA 2FE4A 2FV8A 1YZQA 2D3WA 2YV5A 3T35A 4PC7A 3PUVA 2P5SA 1QZXA 1I4DD 1UEJA 4NL4H 2VSOA 4R7ZA 1G8GA 4JSYA 3SEAA 2ZI4A 4LOAA 4Q1DA 2ECKA 4TQUS 3CH4B 1M7GA 2WWIA 3UXMA 4N0DA 2QAGB 3KQNA 4V0ME 2HF8A 4IOKA 2CK3D 4TYYA 1U8AA 1HV8A 2JLUA 3U6BA 1YZUA 3MJRA 1IXZA 3GJ7A 1E2IA 1G291 2WMOB 1Z08A 1MO4A 2ZRNA 1KNQA 1BH2A 3OEHD 4B2LA 3THXB 5FTKA 2V54A 1TEVA 3KQKA 1ZCAA 4BZQA 4NCNA 1BMFD 2ZRKA 1W44A 3I8XA 4OI0A 1IONA 1JALA 3SBEA 3TSZA 2KWIA 1U98A 4C4PA 1IXRC 3LDAA 4BZXA 2C99A 3SU8A 4C0LA 2WOOA 4UXJA 2IUSA 2KB0A 1EXMA 1J8YF 2BCJQ 2ZITA 2ORVA 4JIMA 4WXRA 5FL3A 2BC9A 5FOVA 2VP5A 5CJ2A 1CR0A 2Z4RA 1W0KA 1QHNA 1G8FA 3K9LA 2RGAA 2H57A 4FW9A 2RH5A 2VP4A 1JQJC 1S2MA 1LF5A 3PR1A 1N6HA 1RZ3A 4F93B 1JJVA 1R4AA 3LH5A 4RD1A 3GCGA 1EFRD 3E70C 4GPTA 1DS6A 4JLMA 2QMHA 4YMTA 1FOEB 1SQ5A 1X8JA 1EFUA 2PZEA 1JB1A 4TLCA 4TT3D 2JJ2A 2H5EA 5F9FA 1TUIA 4R2HA 4AC9A 2O8BA 3VX3A 4EAQA 2J7PD 4JL8A 2O0JA 3RLFA 4GDFA 2R6DA 1S1CA 1UBFA 2F1HA 2PCJA 3LQRA 2BBWA 1T4GA 4BLOA 2F6RA 4GSYA 4B35A 1GRRA 4F4CA 1KY3A 2QSZA 2QM8A 5AJXA 5HKKA 5B58C 1A7JA 4OHYA 3SS8A 2XZOA 2XTMA 1OXSC 4OHWA 4GL2A 3X1ZA 3VR5A 2ZRAA 2PX0A 3KXIA 4MKIA 4KLZA 4HB4A 2GCOB 2W00A 4JVLA 2F43B 5B2ZA 3TNFA 1AIPA 2DWZB 3LLUA 1G18A 5DI3A 5JJLA 221PA 1YRBA 2RCNA 2AK3A 3NH6A 5AWFC 4OHVA 2YZ2A 4ZI2A 4CGZA 3BOSA 2VHJA 2ZQ5A 4O0MA 5IT5A 3KFXA 3O8BA 2HEIA 5DGXA 4IXMA 3WNCA 3P26A 1OE0A 3DEFA 1AS0A 1E9FA 2XNSA 3CZPA 5KYKA 5LB4A 1II9A 4M21A 5C4MA 1XMVA 3LW8A 5TMPA 1RKBA 4XJXA 4BFWA 1CR1A 1AQUA 3W8NA 2R6GA 2ZIAA 4RCZA 4ZIRB 1AN0A 4QC2A 2RKOA 2B21A 1FMLA 4YMUA 2QMOA 3PITA 3CF0A 1OXVA 1Q21A 2D2EA 3WYGA 5JWHA 4TLEA 1I2MA 3B5JA 2ZYWX 1S3GA 2QORA 1LNZA 2UKDA 3T1VA 3W5JA 4QM7A 1U9IA 4AK9A 4Q03A 1JNYA 2GKSA 1OH7A 1XFAA 3PUXA 5DNYB 2BM1A 5JEEA 3L43A 2WIAA 3LBNA 2AL7A 4OQFA 1N2CE 2VH5R 3QF7A 1AQYA 3L2OB 2RGXA 2OO7A 5FTLA 1ZU4A 1I2DA 1S96A 2ZSFA 2ZS7A 4K46A 4B3CA 4BFUA 2ZTSA 5AR1A 4FWTA 1G3UA 1D5CA 3V9PA 2A5FA 1FTNA 1DAFA 3EC1A 3FTQA 2V6ZM 1Q3HA 3CLVA 2W2XA 2KRKA 1Z2CA 4OK3A 5KDLA 1L8QA 1FMJA 5K8TA 1CLUA 3U3RA 3HU1A 4UJ3A 2OFXA 2J0UB 4HAZA 3W5IA 4FCTA 1P7CA 1N6KA 5KOYA 3ADKA 4TL6A 3K9HA 5E95A 4DLSA 1YJ5A 2P2LA 2NO6A 3EC2A 4AG5A 2ZE5A 4DVGA 2BEKA 2IW3A 1MH1A 5CLLA 1F5NA 3A1SA 2ASEA 3X1WA 4BEBA 5TVKA 2QBYA 3KDSE 2GJSA 1H65A 1Z6YA 2BDTA 4GOKA 5KHOC 4RZ3A 5KO2A 2WSSD 4EPRA 5FOUA 3K9GA 1GP2A 4MYHA 1D2NA 4KV9A 4DLWA 5FI0B 3H0KA 3RHFA 1CJUC 4JLDA 4TYQA 1Q20A 2BKUA 4D26A 4B3BA 4TMWA 1EX7A 1CS4C 5CK5A 1T0JB 5UKDA 4CW7A 5JMTA 4JLAA 3SZRA 3PQCA 2PX3A 4Q1EA 2QZ4A 4TMXA 2IYVA 2GEUA 2O8EA 2C78A 2VF7A 3K0CA 4RD4A 4KFTA 2ZROA 2QT1A 3JVVA 3W90A 2GESA 3K0AA 1E2EA 2BBTA 2OXCA 1S9HA 3OZXA 4HLDA 4PAMA 1XTIA 1YVDA 5L3RA 1E9AA 1MOZA 3W34A 2PLRA 4B47A 1ZM7A 1OFHA 2J0VA 2W2VA 1DAKA 1S3SA 2EFGA 1DELA 1NMZA 4RVCA 5BYJA 3D7MA 1E3MA 4IOMA 2GBLC 1G20E 4JVMA 1TX4B 4QGFA 1OYWA 1AS2A 3QXHA 3LFUA 4B3GA 2WIBA 2D06A 1E1RD 1XMIA 1JR3E 4I1SA 5CDFE 4M1TA 3G5UA 1G7RA 1Q1ZA 2FZLA 1W48A 2RB4A 3FWYA 3RRNA 3NDBB 1XF9A 1COWA 4LSGA 3PFIA 3QKRA 3MG9A 4ZKEA 3MAAC 4KJZA 3AH8A 2GRJA 3BGWA 1GRNA 1RIFA 1ELOA 4MRRA 1XEXB 5C46F 4RY2A 2AK2A 3VFDA 3ZIAA 2QENA 4D82A 1GAJA 5GJBA 3EZ2A 1E9SA 1HUQA 4HLCA 4TL9A 2Q21A 4QBIA 1G4UR 2A78A 3GD7A 1W1WA 4WZAE 2G77B 4LJ8A 1LB1B 721PA 3QNUA 4FD2A 4LHXA 1JJ7A 1UKYA 4TLDA 4M9QA 3SDZA 2QAGA 2ZXUA 3VAAA 4IDNA 1TUEA 4TTPA 2FSIA 3FFBA 1YHNA 4MGZR 4WA7A 2AFIE 3AVYA 4V0MA 2ZU0C 2GNOA 2D7DA 3I8SA 4FCVA 3AF4A 5DYIA 1FX0B 1KNXA 3THXA 2H92A 1CEEA 2PMDA 4LYFA 3QPUA 4NCKA 3FKQA 2QE7A 2Q3FA 1X8LA 1XBTA 1ZM3A 3O8DA 5H8WA 1YZKA 1KI6B 2C77A 1XD2B 4PSVA 3GP8A 2P6RA 4PFSA 2NOAA 4BLPA 4ZPXA 2X2EA 1GRQA 1YZTA 3B78A 4O2LA 5IF9A 1E0JA 3BERA 4LBZA 2PT7A 3ZS9A 2NPFA 4NCHA 1U2RA 5EP3A 5FL7A 4QBHA 2IEZA 4MUBA 4HLQB 1DAHA 1SVMA 2BBSA 1QRAA 1OLOA 1QG4A 1T3LA 2ZR0A 2G88A 4QGAA 4LUCA 2HCJB 1KY2A 2QU8A 3IIKA 2GF9A 2C03A 2XSZA 1KKLA 4DCTA 4IFEA 4Q1CA 2W6ID 1ZUIA 2YWFA 3H86A 2C96A 1QBKC 2A7QA 2OE2A 4C7OA 4LDJA 4YONB 4BQSA 4ZO4A 1W4RA 4D2IA 1OKKA 1S4QA 2ZUBA 3TQCA 4M1WA 3DKPA 1CRPA 1UKEA 3C14C 4IVQA 5FPYA 3U3OA 2VO1A 3K0FB 3T34A 4CZ2A 4LK2A 4QHSA 1NG9A 3GQBA 1NL3A 3GLHE 3AUYA 4V02A 5DIFA 4C0QC 5TARA 5EUQB 3O47A 3CPJB 2JJ1D 2DHRA 4XVRA 2IK8A 2NIPA 2Z6VA 4P32A 5A0FA 2BJVA 3GLHB 4JLJA 3WRXC 2ZAMA 3HU3A 1GKUB 4WZBE 5FTNA 3HWSA 1E2DA 5FBVB 2R2AA 5A5GA 5LBIA 5LD2C 1G1MA 2IL1A 4V0KA 3RS7A 2CNWD 1ZRHA 2KSQA 3VNVA 2GCOA 1CR4A 2DCUA 3CONA 2BMJA 2QPOA 2W83A 4PPGA 1LS1A 2QTHA 1UADA 3BB3A 2ZI9A 4B43A 1NG1A 5FTJA 1UBCA 5C18A 1VMAA 2JAQA 2NZ8A 4YMSA 3PJRA 2B7CA 3SQXA 4B3FX 1ZM2A 1KK3A 3HYTA 4LHWA 1W5TA 1FFHA 1SVSA 3LXXA 1KDPA 3AF3A 5EQTA 4Q7KA 2GEDA 3ZJYA 1CF4A 2BMDA 2OSBA 2ZJAA 4A82A 2GZDA 3IBGA 1Z83A 4NYIQ 1NBMA 2WJIA 1DBSA 1UKZA 1HT1E 3CUEF 3A4LA 4LRSA 5FOXA 4U5XA 3RRYA 3SJCA 2NGRA 4ACBA 2GK6A 2HUPA 3TLXA 1KI4A 1OIWA 2ZPTX 2W2TA 3KJHA 4P0TA 3TRFA 2TMKA 3C7KA 4A2PA 4QOSA 4ZCMA 2F3RA 4PQRA 5BXQC 2RGGA 2QTFA 1N5KA 2A2ZA 3VR2A 2QL6A 2WVJA 2XNDD 2D4HA 3BRWD 3FKSA 4HB2A 3F3YA 1OHHA 3GJ5A 3RDPA 5JRZA 4A0GA 5GVSA 1GL6A 1YE8A 2IYZA 8OHMA 2D7CA 1TTTA 5EXXA 2VP2A 5IK2D 1G7TA 2FFBA 4R9UC 1EK0A 1AGPA 4K81B 2IYXA 3UANA 3UWKA 1X6VA 1C9KA 1ZD9A 3NEYA 1NF3A 3P4YA 2Z0MA 4HLUA 4TYNA 4JKYA 3I4LA 4YXWA 1NVWQ 2BCGY 1KZ7B 3LWNA 4BRWA 2ERYA 2J0UA 2JJ8A 1ZP6A 2BEJA 5KSYA 1ODFA 1K5GA 1S1MA 4NHOA 4KODA 3ZQ6A 4ILEA 1RFLA 1FTSA 1R6BX 2WZQA 3KFVA 1F60A 1VPLA 4P33A 2I3BA 5JSZB 2HCBA 1GTVA 1AA9A 2ANBA 3MUFA 2IWRA 4L15A 3BS4A 1TQ2A 3HP1A 4LJ5A 4CT4B 2J3EA 1IJEA 1C1YA 1W4CA 5J4YA 4L4UA 3QUSA 4D0LB 4JLVA 4ZCIA 2HJVA 2XOKA 3WHLA 2Q6TA 3FHOA 4Q9JA 5FOSA 2ZJ5A 4DLVA 5GADl 1E9RA 4DCSA 1G16A 1Q3TA 1KSGA 4M1KA 3TUJC 1FPMA 1D8TA 4LX0A 2FZ4A 3GLIE 4LZZA 2V1UA 4DLXA 4G1UC 4WIAA 2VF8A 1XPUA 4I1VA 4YLGA 3DOFA 5K8LA 2CLCX 1GNQA 3GLIB 2PCLA 3SHWA 3IBYA 4UNPA 1F6BA 1XEFA 1XJCA 4KSBA 3M0EA 2ORWA 4QJ5A 1KMQA 2FWRA 1XJQA 2OM2A 1LV7A 5FBRB 3RANA 5JJIA 4MGKR 1KOFA 2ZI6A 3LBIA 1ZJ6A 3CRW1 5FTMA 2YOFA 3LRPA 2UZIR 1RRPA 2GAOA 1NY6A 2LCFA 3THWB 3QF4A 3BB4A 4QL3A 2P5TB 1R8QA 2XGJA 3F0TA 3U7EB 2ZJBA 1Z0FA 3K0CC 1XRJA 1JR3A 5CDFA 1OH5A 1EX6A 1XEWX 5L3QB 1Z63A 3B7GA 1AJEA 3AP3A 2XJ9A 1GKYA 4JL5A 4L5BA 4OI2A 3B1VA 1R0XA 3KJIA 1VCOA 3AF0A 3AF1A 3X2SA 4IDQA 1IY1A 1XNJA 1YQTA 1W4AA 3AB3A 4MQBA 2AN9A 4A0RA 4V0NA 1P5ZB 2EWVA 1KKMA 3THYA 2O8CA 1KO1A 1G41A 1OXUA 3FHTA 3PEYA 3DKVA 1N6IA 2GEVA 1E2PA 2EFHB 3CRQA 4JBYA 4TYPA 4EJSB 3QVUA 3JZMA 1YR8A 4AWXA 2MSDB 4Q9HA 3U61B 5EZ6B 1GFIA 2RGNA 3JZAA 2QROA 3TE6A 4PPQA 4J0QA 2XXAA 4KSCA 1FNNA 1E79D 4OI4A 4RZ2A 3NEJA 4MRNA 1DOAA 1FX0A 2G6BA 3RAPR 3MWJA 4ZDKA 3N70A 4U7DA 1VG0B 2GXSA 1AM4D 3EZ9A 4EPWA 3GFTA 4Z51A 4Q02A 1XTQA 4JL6A 3BE4A 5B30A 3EPLA 4A0HA 3QJYA 4BFVA 2I1QA 1VHTA 1T0HB 1XD2A 3C8UA 4A6XA 4Q4LA 1UAAA 1U0LA 3K09C 4JLNA 2XX3A 4Q4JB 3QG1A 4IOJA 3M6AA 3L0IB 3K70C 1DO0A 1R2QA 3C5CA 1KJYA 4Z1MA 1T5IA 1GWNA 4CEJA 2YOHA 2ZRHA 3BFVA 1KK1A 3B1WA 4EPVA 3QI2A 1UJ2A 1NRJB 1VKJA 3UK6A 1M1YE 2QT0A 1Q1EA 1AZTA 3RS2A 1E2JA 2E9SA 4LPSA 4A8JB 1W0KD 2ZRIA 3W6PA 4P4UA 5L3SB 5HCNA 4I81A 4XWOA 1CKEA 2VP6A 1DG1G 1S8FA 3NXSA 3U4QB 4MDFA 3H84A 2CBZA 3K0FA 2FH5B 1HH4A 2Q9AA 3OEEA 1KI7A 4IVPA 1OFTA 2FU5C 1JECA 2WWFA 1SHZA 4G3XA 2F9LA 2ZYUX 1OJLA 3GLHA 1GOTA 3HU2A 2IS4A 2ZS8A 1KZGB 5L8VA 1RE0A 2O8DB 1J8MF 3NBZC 4KLNA 4MUAA 3T5GA 4D80A 2ZRPA 2ZRCA 3UATA 3A58B 1FL9A 4YC7A 2HT6A 3CW2A 2F55A 2IS1A 3SHFA 2O0KA 4Z8XA 2HV8A 2QG6A 4US2R 2WJVA 2X8AA 4XD7A 1QHGA 2JLYA 2O8FB 1WDTA 5HKKD 1TMKA 1R10A 3L0PA 4CVNA 1GIAA 3SQWA 4FINA 4UKDA 5G53C 3UMSA 3I1FA 2D74A 3A1TA 5DH9A 3U60B 2DYKA 3A1VA 3VKGA 3Q3JB 4DXAA 2R44A 1K8RA 1TF5A 4CRWB 4NU0A 2JDIA 2ZR7A 2AKYA 1KO5A 1MRSA 3UMFA 2ANCA 2ZSBA 1RJ9A 1E94E 1E4YA 1ZNYA 4MH0R 3TVDA 3QEJA 4RD0A 4CIDA 2VHTA 3KXKA 1VCNA 3GJ8A 1SXJC 1KAGA 4ASUA 1KK0A 1ZINA 4FMCF 4MA4A 2OAQ1 3FVQA 4TLAA 3S1AB 1R5OA 4DRZA 4B76A 4URWR 1F2TB 3BK7A 2CL7X 2Q3MA 5CJPA 5J4HA 2AWNA 3DPUA 1XXHE 1N0UA 2WPDD 3RC8A 1NLYA 2XTNA 1H8HD 5BN3A 3E1SA 5JFGA 3BAFA 1CXZA 1XXHB 1WE2A 2R62A 4ZV4A 2P65A 4PC1A 5DN6D 2R9VA 4DWJA 3PEUA 4DKXA 3SC3A 1CTQA 2VBCA 1L7VC 3CNLA 3IGFA 5G3ZA 4UNSA 4DT1A 1MABB 4TMZA 3QIAA 1AKEA 4Q7MB 4ERNA 3IIMA 4XTCS 3BIFA 1IAQA 3VKWA 1RW4A 3K1JA 2V7QA 4LRTA 1NLZA 1P75A 2XZLA 1TQDA 4E22A 2IX3A 1D2MA 4LBWA 4NBSA 2OBMA 3SJZA 4GP7A 3FE2A 4KXFB 4PAOA 3P20A 3CX6A 4PTLA 1CRQA 4AD8A 1OYYA 3VU9B 3B60A 1UDWA 2ODWA 5JSZA 2AD1A 4HDCA 4A1FA 1E0AA 4XTRA 2H8KA 3A37A 3ADBA 1EWRA 3RS3A 1QHSA 3R9XA 4TSFD 5TB5A 1LF0A 3ASZA 3PG5A 5J40A 4B3DA 4QJ3A 5HZKA 5KNCA 3LVQE 1E2MA 3I73A 2E1RA 1P4SA 2RGEA 1GDDA 3QG5A 1G5PA 2Z5FA 1M2OB 2JIZA 4EQ6A 4C2UA 3WP1B 1II8A 1XD9A 2Q0HA 4IXNA 1SVWA 4Q1FA 3ZZTA 2YINC 3PV0A 4DSUA 2C95A 2G1JA 4LPKA 3GLIA 1Y3AA 2WWGA 3AP2A 1Z29A 4GBMA 4Q9LA 3TSOA 4BPBA 4KBGA 2PEZA 3AGQA 2JLVA 2AR7A 2WMNB 1Z3IX 4AKGA 3E5HA 1OF1A 1DO2A 1YR9A 4IOLA 4RKEA 1ZM4A 3DOEA 2J0QA 4C0KA 4HAVA 4OQMA 1LVGA 2QY9A 4JLOA 5HTKA 3DM9B 2DFKB 1O3YA 4NTZA 3THWA 4RZXA 1UDXA 3R8CA 3AVVA 3OEHA 2ZVQX 4OQNA 3W8RA 4OHXA 1BMFA 3BB1A 5L3QA 4PHHA 2J46A 3P32A 3K9NA 1YR6A 2VSXA 4ARZA 4HATA 1NP6A 4F4JA 2CDNA 4X8HA 3VTKA 4DSNA 2OUKA 3WYAA 2BM0A 3GLFB 3KL4A 4BFTA 4B2IA 4GZLA 5JS7A 4M0LA 2DWPA 3REFA 4HUQB 3DZDA 1EFHA 3SYKA 1OT3A 2OV2A 3KUDA 4QGHA 2R6AA 4US1R 1NVVR 1A5TA 4F38A 1NVXQ 1Z0IA 1NMXA 4EJSA 4RFSB 4LY6A 2GJ9A 1XB2A 2CVHA 3QE0A 2R6CA 5SZKB 1LY1A 3NVAA 3IQXA 4LI0A 2DFNA 3P27A 1KO4A 4LV5B 2NTYC 4JS0A 1EFRA 1RRCA 4WXPA 4NP6A 4P4TA 3LY5A 4OK6A 2W6JA 3GEHA 5F98A 4FWIB 4DLUA 5JEDA 1QHYA 3AV0B 2V4ZA 3CF6R 3LLMA 3K70D 1G3MA 3EX7C 4LYAA 4TT3A 2YVUA 3IEVA 2EFEB 3EASA 2R6FA 4LHYA 4BASA 4QKQA 1E2GA 3OFND 1PJRA 4A36A 3QPVA 1KO7A 1GNRA 2GXAA 2IUUA 5HR5A 3MFYA 3ZD6A 4PC2A 1YZNA 4HAWA 4Z8YA 1EWQA 4LCBA 3TR0A 2QGNA 4Q4JA 1G6OA 2DY1A 2JA1A 2P0EA 3PUYA 3WNBA 4A0FA 2RGNC 1YRAA 5TXGA 4B48A 2QTVB 2PL3A 1TEXA 3PEVA 1SKYE 1GL7A 1VYTA 1CP2A 3UG7A 3NC1C 2QRNA 3TH5A 5JECA 3DO6A 2ATXA 5FL7D 5H70A 4LJ6A 1K6MA 1SKYB 5H1YA 1G5RA 1HE8B 3DM5A 5B57C 1E9EA 3UMRA 1UPTA 4HDOB 3TUIC 4V03A 4HZUA 5JJKA 3AVXA 5EE9A 3HR7A 4C0HA 2GDJA 4R98A 1RYFA 4AI6A 4UJ5A 4QXAA 2QM7A 1QG2A 2GCPA 3AKYA 1GVNB 3AKDA 5CIWA 4BEJA 4HAUA 1FQJA 3LX5A 4GP6A 4NCJA 4WOPA 2IEYA 2WJYA 1D9ZA 4Q4AB 2HLDA 4ZDWA 4FXPA 3ICQB 1NVVQ 4NPHA 1ZD8A 1E0KA 5F3WB 1Z5ZA 3W9YA 1O87A 1D6JA 4AY2A 5FBLB 4G5GA 1ZVQA 3N5CA 2P3SA 2FGKA 5FR1A 3PENA 1NKSA 1E1QD 1XTRA 1R0YA 3AUXA 3EIQA 3CWZA 5EE1A 2EYUA 4KCGA 3C16C 2I4IA 2V9PA 5HE9A 2MSEB 2AXPA 2IC5A 2O8FA 1CIPA 2A5DA 1PZNA 2JGNA 2PLFA 4QNMA 1SGWA 3U5ZB 4OJQA 1J90A 3VX4A 3DZ8A 1MT0A 1JPNA 1YZLA 4L9WA 5CK4A 4BZPA 3QVVA 1DAEA 1OB2A 5FOWA 3CH5A 5JLJA 3TIFA 3NTUA 4H9GA 4XVQA 2IHYA 1EG7A 4B74A 3BBPA 1SXJD 3EWAA 1JEEA 2ZE6A 5AK0A 2V6IA 1WBDA 2FNAA 2CL6X 4PAQA 1NN0A 4UXHA 1VTKA 1E2LA 3TAHA 1OFUX 1XEWY 2KI5A 3IPXA 4QRHA 2ZSDA 1L2TA 5KPDA 3CM0A 2JCSA 4DUGD 3X1XA 2GETA 4Q7JB 3X1DA 3CWQA 1AS3A 2GXQA 4D4JA 2REOA 3ADDA 3KKPA 2B92A 2GCNA 2RGBA 4B2PA 1NBMD 3FGNA 2OFWA 3S1AA 3SOPA 5IRCD 1GKIA 2WWYA 2IT1A 4TN1A 1A4RA 3LX8A 5FI1B 1G7CA 1TADA 1DEKA 1Z06A 3GJXC 2FOLA 2WSSA 2CHQA 4NYIR 3T1TA 3NWJA 1VHLA 2G0NA 3DHWC 1QHHB 4JLPA 1Z0AA 4OI1A 2Z43A 2CMKA 2ZE8A 1XXHA 3FMPB 3CBQA 3LA6A 3KZ1E 1FZQA 1Q57A 1KSHA 3ND8A 1Q44A 3TK1A 3QXXA 3VR4A 5A4JA 2L0XA 5JZVA 2ZJYA 1HEIA 2GF0A 3OF5A 1NSFA 1ZAKA 2CHVA 3U2QA 4XOIA 1ZD1A 4FMDF 4MKHA 1E2QA 2HXYA 4QBFA 3LO5A 3R7WB 1Z22A 3CZQA 1LTQA 1GUAA 3KQUA 2QSYA 4JN6A 4KAXA 3MLEA 4NDZA 3CPHA 3OAAD 5BYKA 3Q9LA 2DFLA 1VCMA 4YXWD 1YKSA 5EXPA 4UQOA 2J5XA 1HQCA 2C9YA 4QBGB 3SNHA 1II0A 1NVMA 2A5JA 3KKOA 5DHAA 5AJWA 1WQ1R 1RYHA 1DADA 2IXFA 1E1RA 2QNRA 4PSAA 4ON9A 2D62A 1VDZA 2F7SA 1NJGA 4PO8A 1N6OA 5KNDA 2CJWB 1WRBA 1JBKA 4BGDA 5JS8A 2F43A 2Y8EA 1GNPA 2IBMA 4JYCA 5C4GB 2HT1A 2CLSA 1CU1A 4M2LA 2BV3A 2P6UA 5BQ5A 3W6NA 4LHVA 4JJZA 1MV5A 1DTSA 2JATA 1ZIPA 2OFOA 2Q3HA 1IJFA 1IN5A 4HDQB 1P3JA 1GG2A 2CCGA 4JBWA 4BFSA 1PLJA 5DSZA 4UNQA 3L0OA 4Q21A 5M04A 3A1UA 1OH8A 1IY0A 1CBUA 4NE2A 3PUZA 5CITA 1XP8A 1N0WA 3KTAB 1Z0JA 3BC1A 5HCIA 3VR1A 5EE0A 1M7HA 2AD5A 1DE0A 3QY0A 4ZIRA 1W7AA 1KTVA 1I4TD 2WWHA 4AIIA 1W0JA 4BLQA 4KVGA 4IW3B 2DWOA 3R9WA 3WBJA 3RYTC 1UEIA 1KDOA 3O8RA 2YJTD 1EESA 2LWIA 1XDBA 3A1WA 4DCVA 1OXXK 1ZBDA 3VMFA 2OAP1 4MYCA 5GJCA 3SBDA 1JPJA 4EIWA 4R71A 1G8PA 4M1MA 4MYTA 4KITB 4OJKA 5J4KA 1X8KA 4HUQA 4Q5IA 4V0LA 4DLTA 1XTJA 2HDNB 4OYHA 2CHGA 1E2KA 2IYUA 5JHGB 2ZM5A 5D3MB 4I1OA 1WBBA 1BYUA 2BBOA 2W6IA 5GJWC 4TL8A 1ZNZA 5KNBA 1N5JA 2FN4A 4HSEA 2WSMA 1KI2A 1N6LA 3VQTA 1IN8A 1U9IC 1QDEA 4OQLA 5JBQA 3QSYA 2VHQA 5KDOA 1N5IA 4DJTA 3ZH9B 1XX6A 4WBSA 1PLLA 4B73A 2BWJA 2REXB 4CF7A 2VSFA 3LBHA 5FOTA 1P61B 2EW1A 2ZI7A 1GZSA 5LD2B 4G01B 4PR0A 2PZGA 4BLSA 1CJVC 1NLFA 2O5VA 5BWMA 1CULC 2C04A 4Q48A 4AYTA 3FOZA 1U81A 4GZMA 4Q00A 3E2IA 4RD2A 1R0WA 1HYQA 621PA 3GLGE 1Y63A 3I5YA 3IILA 3EPJA 4PO9A 1P6XA 2XITA 4URUR 4LRWA 2W0MA 2V6JA 1VCIA 2QEQA 2O8BB 5JCZA 3GLGB 3KB2A 3MJHA 3NC0C 4A4DA 3BWDD 4L9SA 3G82C 2WWWA 2CNWA 4QGGA 1N6NA 1H8EA 4URVR 3PIRA 3KKQA 5KSPA 1DAIA 1TF2A 3LQQA 4IVRA 4Q1BA 3TW8B 5JHHB 1L4YA 1J7KA 2ERXA 5G3YA 2ZAOA 4LJAA 2H16A 3Q7PA 2O52A 2B6HA 2JASA 5KSOA 3I62A 2FX3A 4LJ9A 2ZRBA 2JLSA 4FWGA 1LW7A 5J5CA 4C0SA 3RABA 4F7WA 1V43A 4L8GA 2VL7A 4F92B 1U99A 2IXGA 2YC4C 2IYTA 2ONJA 1E9BA 3EAQA 2FEMA 4BE7B 3ICEA 3R20A 121PA 1OH6A 3TUZC 4BFZA 4YQFA 4DLZA 1XEXA 521PA 1BS1A 4BLRA 4I4LA 1WP9A 4B32A 1MKYA 1XPRA 2XNDA 1W46A 4NZYA 1ESNA 2YWEA 4AG6A 4Q9IA 1JAIA 4N0EA 3IHWA 2C98A 1DG3A 1N25A 2OLJA 2J59A 1JQLB 5DYGA 1U0HC 3T5DA 5KPJA 5IK2A 4HI0E 3Q72A 4TTQA 4Q7LA 3N2EA 1SVKA 1OFIA 1G19A 4PSKA 4PPFA 4NYJR 1A82A 3BH7A 3I92A 5FH9A 3U44B 1YU9A 5P21A 4LJ4A 3H2YA 2GVZC 5G40A 5AUQA 3EWSA 2IS2A 1T5LA 2XEXA 4IDPA 4W5WA 4EKDA 2H18A 3U7GA 1DAGA 4QNRA 4ZKDA 3EPHA 3PVSA 4XVUA 1QF9A 4DB2A 3KJGA 3I32A 4YMWA 3WNDA 3ND9A 3VNUA 1KHTA 2AXNA 4PC3A 3D31A 3LVRE 2Z83A 3FHCB 4KFRA 3NG1A 1KI6A 2AKAB 2ZRLA 4FI3C 3K0EA 4KU4A 2JDID 3WMEA 2H1LA 2CL0X 3GPLA 4TQ9A 2CXXA 1SULA 4TYWA 2MMCA 2QAGC 1R7RA 3EG5A 2IYLD 1IN4A 2J7KA 2QUZA 1D2EA 3ZVLA 1E96A 2QAJA 2X1VA 4DIDA 2KBFA 1OPXA 3TR5A 1MO5A 1QHHA 4F91B 3I3SR 1IN6A 1DARA 4BRUA 4KFSA 4UNNA 1T6NA 2OEPA 1T9HA 1U8YA 4JJKA 1P2SA 3VHLB 5ELXA 2H17A 1G6HA 1VG9B 1HA3A 3THOA 4EUNA 1XPOA 2FEOA 4DCUA 1Q0UA 3BD9A 2JLXA 1X86B 3L8YA 4QJ4A 4LGMA 1N3BA 5FUXA 2RHMA 3R8FA 1FP7A 3IO3A 3ZZUA 4U02A 1T8UA 4MKFA 4A2QA 5C1BA 3B85A 1JAHA 3BFKA 2F1RA 3KQLA 2O8EB 4P4SB 5JI3E 3MRSA 4KYIB 4UNRA 5EE5B 1KJZA 3WRYC 2NO9A 3WY9A 1NKTA 1WA5A 3K0AB 1NIPA 1P9NA 1XMJA 3HR8A 1ZM9A 4JSTA 4NYJQ 1QHXA 1Z8FA 3WYFA 2R8RA 2JJ2D 1ZNXA 2WJGA 5E4FA 4PO1A 5CM9C 3NBXX 2OG2A 1OSNA 3AVQA 4KVAA 4PZLA 2FFAA 2DR3A 1MO3A 4Q66C 2V3CC 3O8CA 3MWKA 2UZ3A 2YC2C 2WKPA 3R9IA 1E99A 5FUVA 4GOXA 3PXGA 1WMSA 1ZW6A 3QKRB 1W47A 1F2UB 5FFMA 1VYVA 1ZUHA 4K8OA 1JXMA 2A9KA 1VG8A 4TMTA 5DE3A 3K8YA 5IHPA 2QMUA 2C9OA 4RKFA 5CB8A 5TDHA 2Q9BA 2NG1A 2FG5A 3IIJA 4ABYA 3IKJA 4DDVA 4JVNA 4MKGA 2YYZA 2FPKA 1GL9B 4P3YA 2QQEA 2QPAA 2FFHA 3OESA 2VRWA 3KTAA 4G5SA 4IKEA 3QXSA 5J47A 2BVNA 4YDSA 1G8HA 1E79A 1JEDA 1XMSA 2ZJZA 3QBVA 4LBVA 2N46A 4GI7A 3K70B 1XJ0A 5LPNA 4GOJA 4O3MA 1M8PA 1PUJA 1QHIA 1US8B 2IWHA 5JI2E 4EFLA 4E07A 4NH0A 2YNMA 3GEIA 3X1YA 1S0UA 3RRZA 4OK5A 1ONBA 2V1XA 2GXUA 5JRJA 3MWYW 5K8UA 4HB3A 1R5NA 2ORIA 3HDTA 4JT2A 2PEYA 1T91A 1CJTC 1G3QA 4XWKA 4M9XA 3B9PA 4MRPA 2ZSEA 1WCV1 4LC1A 3P4XA 3ZGXA 2JLRA 4G5OA 1VYUA 3RVBA 5B64A 5D3MA 2A30A 2G3YA 4DSTA 4XH9B 5FPKA 3CNNA 5BN4A 5H68A 1SKQA 4DB4A 4LHZA 1KI1A 2AX4A 1FW6A 3SR0A 3TBKA 4CDGA 2KJQA 2BMEA 3Q5DA 3OE7A 3IDQA 3T15A 4D6PA 1EFCA 4RZUA 2ZE7A 5EUMA 5F2EA 3SYNA 4QFMA 3M4YA 1R0ZA 3SN6A 1E0SA 2WICA 1D9XA 1UBGA 3TVTA 1VIAA 3UKDA 2ODEA 4IJMA 3CNOA 3ZVMA 4II7A 5TV2A 4PHGA 4DDTA 2UVQA 4C7OB 3QKSB 2BIFA 3KXLA 1TPZA 3ECCA 3Q5EA 2WOJA 2YOGA 3B1YA 2IF2A 2FSHA 2ZRMA 4Q47A 2RGCA 3EIHA 4HLUC 2EVWX 5LB2A 421PA 3WMGA 1BO6A 2W6JD 4PHTA 3RSLA 4Z54A 4DHEA 2C9CA 4PANA 4B75A 2PH1A 2OESA 3CR7A 1L4UA 4G0NA 4IEIA 2NO7A 2OILA 1XZPA 3IQWA 4US0R 4CEIB 1DPFA 3ZYCA 3IHLA 2GJKA 3GLGA 1R8SA 3K53A 4C0AC 2CEAA 1FNMA 3MD0A 4MITA 3ZZ0A 2OCBA 2J9RA 2X19A 3N2IA 3LW7A 4W7SA 2GZAA 5DI9A 1ETUA 3K0SA 1GSIA 2OBLA 2AWOA 2C5LA 2CE2X 3EZ6A 1SXJE 1XTKA 4HZIA 2CK3A 3CO5A 4IHQA 2J87A 1NN5A 2NQ2C 2QQ0A 4N3NA 5AUNB 4QHTA 4PXAA 1SXJB 1QVAA 1TF7A 3CB4A 4X8OA 2QGZA 3VR3A 3FPAA 2NPIA 3PUWA 1E2NA 2XZPA 3QXJA 3UPUA 2BHRA 3NBYC 4NONA 2ZS9A 2OHFA 3GMTA 1T3SA 3QXCA 1NBME 4IDHA 2VA8A 4QM6A 4DLYA 1SVLA 2QI9C 4MGYR 3U3KA 1FP6A 4B6FA 3GLFE 1HY3A 3FMOB 1RRFA 2YKGA 2A5GA 3B6EA 2VEDA 1N5LA 3FYHA 5FBQB 4B44A 3LNCA 4C3ZA 3EXAA 2JLQA 3BJIC 3U7FB 2OLKA 2HLDD 1COWD 1LFDB 2ATVA 3SJBA 1E32A 3AQ4A 3U3JA 3D8BA 1OV4A 4OKSA 3CKLA 5SZJA 3IUYA 2WPDA 4Q19A 1I4LD 1H8HA 3A4NA 4JMPA 3ZIAD 2IA5A 2LKDA 2ONKA 1XWIA 4URYR 3AJIB 5AUOB 2F1JA 3UG6A 4MGIR 1VG1A 2FSGA 5EP1A 5CIQA 3OHMA 5DN6A 1EGAA 1RVDA 3U44A 2ZRGA 5HE8A 1TU3A 5CYOA 1J70A 2ZVPX 4M53A 2JLWA 2ZANA 1KI8A 4D81A 1Q1BA 4IFBA 4XWAA 2WAYA 4Y0VA 3VKHA 3MCAA 4JYBA 1Z6AA 5EJEA 1IBRA 4A6PA 4C9BA 3B13B 1ZU5A 2V55B 4URZR 4XSGA 5BN5A 2GJ8A 1ZMXA 3MWLA 3P1JA 1DAMA 1JI0A 4DDWA 3UWOA 2QP4A 3KQHA 3AVPA 4BWYA 3RRMA 2EYQA 2ZJOA 1HURA 1Q22A 2HYDA 2HYIC 1F48A 4B3XA 3MHVC 1GITA 1Z07A 3EIEA 1OXTA 1W2GA 4M9SA 3NIBA 1BYIA 1ZNWA 2V8OA 2CE7A 1E4VA
chains in the Genus database with same CATH superfamily
3BGVA 3N59A 1YJ8A 2QMQA 4J0GA 3LVBA 4LMRA 2JZOA 3CTMA 2YZGA 3HPQA 4RCYA 4JY7A 1E2UA 2YJ5A 5EZ5A 3QE4A 4WKGA 2X0RA 5A9SA 5E3HA 5K8IA 1XTUA 4CLRA 2DQSA 2K6GA 4OHRA 4MS4A 5BORA 3LGXA 2AEJA 3WP0A 1JHQA 1I5EA 4D0SA 1SVOA 1A8SA 4B80A 4AZ0B 3EZLA 2HCTA 3T99A 1DBVO 3A9SA 2N1MA 3REQB 3HUDA 4OREX 3HTXA 2C4KA 4UTOA 2H7VA 3HS3A 4OXNA 4QXOA 2B94A 3GDGA 3FIJA 2DTDA 4CE6A 1WLYA 1USKA 4GQAA 5DVZA 4DTIA 2Z5LA 1KY4A 3Q11A 3NW9A 1Z6XA 1L4EA 1KERA 1NSTA 1W0JD 4ZAFA 1HDCA 3FOWA 1P2VA 2HF7A 4PHCA 4JKIA 1GAWA 4B0PA 7GPBA 1X1RA 2DLDA 1JYSA 1MABA 1H5UA 3N8KA 2DM6A 5DCUA 2ZBVA 4BX2A 3EW9A 5EXDA 5EXEA 4MA0A 2JJQA 1M7BA 4V3CA 4HN9A 5E8JA 3RHSA 2NUAB 2L4FA 2DAMA 5KB3A 1REQB 2UV8A 3ZXSA 3C8ZA 4NEQA 4D4MA 3N0VA 2ZK7A 4RLSA 2DUMA 2RCYA 4ZT4A 4V38A 2EP5A 4YCJA 4ZMSA 1OZAA 4WESA 5JXJA 1UKVY 4YRSA 2DULA 3S2ZA 2NNWB 4R2JA 3PIDA 1M6YA 4H6WA 4GLLA 5JVDF 1U5BB 1PD0A 4F2HA 4PYQA 4ZVOA 2RH4A 3VR6A 2ZJ2A 2YJ4A 2L2DA 3ZDYB 3LHDA 2LH0A 2IXEA 3DAYA 3FUUA 4MP6A 1PQYA 1FQKA 3E21A 2XGNA 1J22A 3WQHA 1T43A 4OQPA 3BXFA 1QXSA 4UPVA 4Y9RA 2H2AA 1Z8DA 2XVZA 1TCCA 2PJRA 1R5LA 3SBOA 2HWWA 4OTZA 1ULHA 1B76A 3QOFA 3UJCA 1JR6A 1XAGA 2I22A 2RK4A 3VHQA 3L40A 4CKCA 5EJ8A 1VP3A 2VVTA 3BWYA 5KNDH 2XE7A 2W71A 1ZXXA 3RVOA 4IR7A 4FN5A 5K3SA 4AY4A 4IAOA 4F6CA 5TF4A 3RWMB 2IYRA 4BWGA 3JVDA 3MIIA 2ZOSA 3SP1A 5CVDA 1MF7A 3PPYA 5KTMA 3FPFA 1BHQ1 1Y8GA 4FFNA 1E7YA 2LPMA 4J8PA 2R65A 2NQ8A 5E4YA 4EUEA 2GHQA 3FB4A 2C4TA 2B4TO 3MGKA 3D0KA 3LJKA 4TZ6A 3GZNA 1Y0BA 3GFPA 4ALIA 1NUQA 1H1LA 3FD8A 3PGMA 3H1TA 3O74A 1SXPA 3WIDA 2V7WA 2VS1A 3SF8A 1HZJA 4NF2A 3OQIA 1MOPA 1SUAA 4D9IA 2Q7OE 1KGDA 2FXIA 3R77A 3NVMB 4LBYA 4ZPJA 1T6ZA 3GELA 1NN1A 3FMFA 1QYXA 2HO5A 5ALOA 3N28A 1Z7BA 1RZRA 1B74A 2MSCB 3LK6A 3SSMA 3QBTA 3IKMB 2FR1A 4WADA 5K2MA 1V5WA 1NQTA 3UKJA 1CFZA 2ARKA 4XYGA 4KBFA 3EPKA 2X1HA 2DKNA 3BXZA 4MQFB 2A58A 3DTVD 1U4SA 2ZIWB 1ZAEA 3MW8A 4L0CA 1V5FA 4PC7A 1OQYA 1MJ5A 3D8SA 4FHDA 3EN0A 3TBHA 3KJXA 2ZTHA 5ITUA 1EDDA 3WLFA 1HV8A 2J9GA 3JZIA 4JJGA 4BZQA 4TXLA 1EEXB 1IONA 4BX9A 5BSVA 2VJAA 3P2KA 1Z82A 3LDAA 1H4TA 3SKVA 1EI9A 4DL9A 4OAOA 2XWPA 1LK5A 4ZCPA 3QRWA 4IZIA 2RH5A 2VP4A 5GMOA 4DA7A 5IAEA 3PR1A 3RV3A 4PZDA 1XC8A 3KOWE 1EDEA 4GPTA 1JZQA 3ADPA 4OXYA 4MAFA 4C5AA 4ENWA 1WMDA 1O97C 3ZC7B 3S2YA 3VPSA 4EGQA 4IGEA 1XF1A 1A7JA 5TEVA 3H2SA 4WD3A 4FB4A 1TKBA 2X0NA 4JVLA 4NFSA 3OBIA 2GBGA 3AIKA 2BEUA 3HCFA 2XNSA 2R7NA 1JTFA 2Y93A 1PEAA 5E6SA 3KYCB 5FP0A 4YAFA 2ZIAA 1VSVA 3GMDA 4YT8A 5CVTA 4PS1A 1TLLA 1U9IA 2I3ZA 2P8JA 1Z35A 1GUZA 3ESQA 1VKNA 3DUFA 2G08A 1U0EA 5HKOA 1H0SA 1N2CB 5E4JA 1PJAA 4MVJD 3U3RA 1YL5A 5LXTA 3E8MA 1N1EA 4H15A 4DVGA 3RNOA 4HC4A 1QMGA 2VN8A 2D0DA 5KO2A 2DTEA 2V9CA 3SYMA 4UHFA 2D7HA 2I03A 5ES3A 2PANA 3NBUA 3AHEA 4RD4A 4NOMA 4FILA 1OLSB 4AU1A 1XYVA 3CVXA 1MOSA 2RGYA 2J0VA 1PL0A 3E05A 3AK4A 3D7MA 4FZRA 1QS0B 2D06A 3NDBB 2D3TA 1VE6A 3ST7A 1R0CA 4IHKA 1P0PA 1N36M 3RVJA 1XQWA 3IJEB 4TL9A 3UAOA 4Q9AA 1P1CA 4V3BA 4M0PA 2IP1A 4RPIA 4EVIA 1V1MA 1TUEA 4TTPA 3R7SA 1G8SA 3A04A 1YHNA 4WA7A 4X1KA 4HG2A 2GNOA 2FN8A 1FXWA 3SASA 3GPYA 3KHSA 4CQLA 1C30B 1RWQA 4DR2B 1GQRA 2Q3FA 1BWSA 3HMKA 3GP8A 1YFZA 1HBJA 2QX6A 2PT7A 1NQ5A 3ZS9A 4LNUB 1U2RA 4MUBA 4KIFA 2R48A 5LQNA 3HR4A 4W9NC 3G2HA 1MH9A 5AKZA 1K7SN 3RR2A 1JEJA 5DN9A 3I34X 1O9HA 1TAHA 3A2LA 2ZJ4A 3DFUA 3URKA 2M6SA 1EBUA 1QO0D 3ZHQA 3LX4A 2Y68A 4P32A 3GLHB 5JNUA 2ZAMA 1ZFNA 1I10A 4AW4A 3IQHX 1GRCA 3QAUA 1YCDA 4IH9A 2IIPA 3L7YA 2QTHA 1CNFA 3MB8A 5AI6A 3SQXA 1ZM2A 1UPFA 1WZEA 1KDPA 1CF4A 1Y81A 3UBTA 4ERXA 5EJCA 3I45A 1HT1E 2FPRA 1ADCA 5K4GA 1BTOA 3TLXA 1IEWA 3V8NA 3P5SA 3OP1A 3C7KA 2C7QA 1G5FA 5EY5B 5M34A 1XTZA 4YROA 2Z9DA 5IKOA 4HB2A 4L57A 4Z4FA 3ZQUA 4Y2VA 4QU8A 2H31A 3PHLA 1Z13A 5DNUA 4V0QA 3HGTA 3NEYA 1J0BA 4CKBA 2Z0MA 2GPSA 2HX1A 1CUVA 4X84A 2EKBA 1UDAA 2BEJA 3MS4A 1J5EM 1RFLA 1YIAA 4MR9B 4BO1A 2BFNA 3QUSA 5LQMA 3VKUA 2PV0A 3ETGA 1D8TA 1X80A 1M6EX 2FZ4A 5IJ0B 2PO7A 2PIAA 5LUBA 1XEFA 1UCFA 4X20A 2WM3A 1KOFA 3EH1A 4DV4B 4R8VA 3RTDA 1X92A 4OLAA 5D84A 1XRJA 5B3JA 3FPHA 4FHGA 1GKYA 3B1VA 4CM7A 3X2SA 4ZYVA 4MQBA 4NVRA 2GUGA 1N6IA 3DS8A 1GGJA 3ZX5A 1X9IA 4MV1A 2ADFA 2BEWA 1FJ2A 4FEGA 1GGHA 1JU9A 2LNDA 3N05A 4G25A 3HABA 2D1YA 3QG1A 3L0IB 3U7JA 3OU6A 2WLTA 1KYQA 1O5TA 3OY7A 4G9EA 4M0DA 3BFVA 1KK1A 3KYIB 3OC6A 2QT0A 2NP7A 1VQ1A 2LHCA 3EGCA 4O4HB 5FA8A 4K9MA 2E1PA 3P2JA 1YB1A 1RD4A 4MDFA 3UJ9A 3IKTA 4LOLA 2IPLA 4XKJA 4RHYA 3ESZA 1BQ3A 4H3VA 4CJ6A 2H85A 3OT1A 2QLNA 4I4TB 4KLNA 5T6BA 2DQZA 2X8AA 2V0NA 2ZWPA 1MJGA 2SECE 1GIAA 4LRUA 4Q7EA 4X90A 4CM4A 5C8YF 2PWPA 3AOEA 1TF5A 5JOQA 3CE6A 1P19A 1AHHA 1PJZA 4EW3A 3IV9A 4DILA 3QFSA 4CGYA 3OMXA 4Z3KA 4I55B 3E61A 1ZINA 1R5OA 1NXQA 2I29A 3UN1A 3IALA 4FS8A 2HJ9A 2UYHA 2F90A 4QATA 1Y6RA 1E89A 5AVYA 4ZT6A 2R62A 1PR9A 5FA6A 3AETB 2YXEA 4Q7MB 1FX1A 1P75A 1L5NA 2KW0A 2QX7A 4ZT5A 3KQTA 1Z37A 1VI6A 1E0AA 4XTRA 3AG6A 1P8AA 1OX4B 3WFIA 4CMIA 1EFVB 1USVA 3OKCA 3A9CA 2X0FA 4MW0A 3OZGA 2JY5A 3RQSA 1Y3AA 3LLVA 1KYWA 4WXMA 3OO1A 4DCPA 2C3OA 1W85A 1EM8B 4RDXA 5KYGA 1DO2A 4UEJA 1LVGA 3JW8A 3PLAE 1O3YA 2IUFA 3PJFA 1M5TA 3NNNA 4Q9DA 2WDZA 1R12A 4FC6A 4PHHA 3FYCA 1QVVA 2VWQA 4HATA 4PN7A 3VTKA 2HN9A 1AUQA 2D0IA 2CZQA 3ESRA 2BGTA 2B37A 1EFRA 2GD0A 2XGOA 4IIDA 2WIDA 3TTSA 2GEBA 5ELMA 1YFJA 5LU9A 3KDAA 3OZBA 3PWTA 3DBHA 2FMHA 5CDYA 5GKNA 3OM8A 4W1SA 2KLHA 4NC6A 2JIQA 3TLEA 1MAHA 1NUSA 3DEHA 1KL7A 3AFHA 4RL6A 3KPJA 4NBVA 1KRWA 4Q3CA 1RYFA 3IELA 2XFSA 2CEKA 2BDUA 4G0UA 1RJFA 5BV1A 3OMLA 3SE7A 4GP6A 4EO4A 3K9FC 1ZD8A 4GGPA 4P92A 2Q0QA 3H1GA 1D6JA 4YFYA 1T8RA 5FBLB 5HE9A 2IH2A 4FGUA 2JGNA 2JVJA 2PLFA 2DJIA 1B6SA 4MARA 5CK4A 3NLLA 3CH5A 1T6BY 2M60A 2FUKA 1XKLA 4NZOA 4UXHA 3HCBA 4MV9A 1ISRA 1O0BA 3X1DA 3DR3A 3PL5A 3R5JA 2IT1A 3JATA 2B0CA 2CHQA 2DKFA 2G0NA 2V59A 5A4AA 2CMKA 3C8HA 4H16A 4ENVA 3TW0A 3DAGA 3T7KA 4LZWA 3V4SA 4YRBA 1V41E 2P4UA 2P9BA 3NDRA 1J9ZA 3U9LA 1Z5UA 3Q9LA 3IG8A 2DFLA 5F1KA 3E27A 1MZVA 3FHLA 2XFTA 1RYHA 1UBJS 4N01A 1NJGA 5TLSA 5DOVA 2MJ5B 3AFGA 2Z3XA 4CG1A 1VIDA 2XKAA 2P6UA 1I80A 3M9XA 1ZIPA 3VDNB 5LQDA 3NBKA 1GG2A 3GH3A 4BVLA 2A9JA 5JJCA 1LSOA 4MLDA 2HSDA 3VTZA 2FDXA 1KTVA 4QUEA 1J49A 4KVGA 4ZTUB 1Z4QA 5E1BA 1Q1NA 2YJTD 3GQVA 1GKLA 2WU3A 4D8VA 2AEMA 5J4KA 4IQ0A 2C84A 1DEHA 5D3MB 3MOSA 1VL8A 4JC5A 4XD2A 4ENTA 4GE3A 4RMHA 2CV2A 4NAVA 4A8TA 3L1IA 4YP1A 3GFBA 2VHQA 1J33A 5EJ9A 1NATA 3O75A 1HC7A 4MQEB 3HB9A 1L5QA 4NEGA 1JQBA 1GADO 5FOTA 3KFLA 2ZBQA 1JSXA 4BLSA 5D87A 2M9MA 4Q48A 1JXAA 1WPRA 4REQB 3P0HA 4JHXA 3VSBA 4LRWA 5F1PA 3GPIA 1T5TA 3G82C 3OJ0A 2CNWA 2P1DA 2AV6A 4L76A 4URVR 4D3XA 4P9NA 5KSPA 3O3MB 3I2GA 4AECA 4MICA 2WFAA 2ZAOA 4P5PA 1PZFA 3TO5A 2B6HA 5JBNA 1M10A 3PJEA 4GOOD 1PK9A 1V43A 3MWGA 2Y4NA 2IXGA 2X5KO 3FF1A 4B7CA 2M1ZA 5E2BA 1ZQ9A 1ZK0A 5IVKA 3W5VA 3LKDA 4HI0E 2JJYA 5ICEA 4PS0A 1A5AB 1IQUA 1FUEA 4LJ4A 5JMOA 3A6LA 4G2NA 2FHSA 1VBMA 2CNDA 2ODPA 1DAGA 4AN0A 3TXAA 2WZCA 3DCNA 1AH2A 3SPXA 4KFRA 1QDRA 2JDID 4TVBA 5AXAA 2CVZA 5F2NA 1L7QA 3WIVA 2KBFA 1FVOA 4U4AA 1IN6A 1T6NA 1T9HA 4YJ3A 4ARUA 1Z4PX 1M2GA 2YL2A 3EAGA 5TMDA 3HWX1 2FEOA 4BNTA 5NLLA 3QMPA 1XYYA 1N3BA 1QP0A 1T8UA 1X7XB 4DYHA 4B3IA 3O4GA 4I2VA 2LP4Y 1ZM9A 1Z8FA 2R8RA 3ENVA 3PKZA 1JAXA 4P7KA 3LVWA 1U0FA 2ENWA 1KPGA 1EHCA 2W6ZA 1RVV1 1WMSA 4TWJA 4DR4B 1ZUHA 4OFXA 4UPEA 4RKFA 1NW7A 3FAKA 3C97A 2C5AA 3T1HM 5BNWA 2YYZA 3VH3A 7CATA 3PC4A 4LFBM 5E9AA 1E79A 1XMSA 3K70B 2HWYA 4KEAA 5LOVA 1SHJA 4XR9A 2RGWA 3II6X 3JAWB 2B5VA 2ORIA 1J1IA 2VC2B 2M98A 3ZGXA 4G5OA 3B7ZA 5F51A 1KAQA 5BN4A 2ZPUA 5H68A 5TC4A 3Q5DA 1MXHA 3LGSA 3KQSA 4X1IA 4WX2B 1ESCA 2G0AA 4HN2A 3AV3A 3Q9UA 2W6JD 3LUKA 4KQIA 1R6DA 1UBNA 3OCUA 4MWCA 2EKQA 3ZZ0A 3FXAA 3BE6A 4TOIA 3UCXA 3VOAA 3M33A 3ANLA 3LW7A 2B20A 5CBPB 1T13A 2XWBF 1ENZA 3OPXA 1B0ZA 1I0ZA 3F6YA 3V1KA 3WLJA 2G4VA 3EVCA 1QOQB 4FHFA 2BHSA 4RA9B 4DLBA 1TPYA 3B3GA 1HG0A 2WP0A 3SZGA 1B6GA 3ERCA 4DRXB 2DH6A 3D8LA 1E32A 1DC5A 4OW0A 4EFDA 2FSGA 2HHHM 1EGAA 1RVDA 2A0FA 1TU3A 4OYLA 3WX0A 3JQCA 4IFBA 1LBTA 1Z6AA 4A6PA 3FW1A 1D6MA 1LQUA 1HURA 1Z07A 1NLMA 3U40A 1PGPA 3CINA 4BVBA 1UJMA 3SVLA 3BFXA 3ZKWA 3ETDA 1X1CA 2F8SA 4WZZA 4FNGA 1M76A 3C85A 2R0QC 4BMOB 2B83A 1OA0A 4OHZA 1YZFA 2BFAA 2V45A 2ODBA 3CNHA 1YL7A 3T1HB 3SS7X 3F8TA 5JYCA 1HQYE 2ZUTA 3ASUA 4LFBB 1XTSA 3K6SB 1T8TA 4LF6M 1VE7A 3TJZA 1DPGA 4B71A 2QN3A 3GPCA 2CN1A 3NP9A 3F5DA 4EVRA 2DZNB 4QPJC 4BUJA 2LCIA 3JARA 5B37A 1RC8A 3CH7A 3CX7A 1J24A 3FPGA 3QW2A 1G3RA 3DZIA 3HCDA 1I3LA 3CRRA 3BBLA 4IIBA 8GPBA 1ZJYA 3IP7A 2NZJA 4D97A 2QYOA 1KIFA 3IQIX 4JI2M 4YJHA 3VR2D 1KDRA 3S3TA 4C14A 4ENSA 1HG1A 3C6BA 3PCRB 4ARBA 4RM2A 3VC7A 3E9SA 2C3YA 3AYXB 1JA9A 4DF3A 2DXIA 4A3SA 2AZTA 3BVPA 1Z0KA 1EK6A 1SVIA 3CRMA 3CN9A 5KSWB 3CA8A 3X43A 2XCLA 1L5HB 4KXVA 4OP1A 1DJPA 3CPEA 3DDCA 1A8IA 2QYTA 1WIWA 2UXBB 2HHHB 1EXDA 3G85A 2ECFA 1RZUA 4HQRA 4Z4IA 1CPYA 1F3LA 3C1TA 3QPWA 1R6AA 3FCSB 4MWZA 5DX1A 1FDRA 5KTKA 2UXDM 4D3YA 4G26A 2KNZA 5JCPA 3GA5A 3T12A 4UEQA 4L95C 2F1IA 2RHOA 5BV2P 4B3MM 3RSQA 4P31A 2FSVC 2XA2A 1ESMA 4TLLB 2VNJA 1ZCJA 2GBPA 3I0ZA 5CHEA 5L53A 4ZDIA 2XB9A 3IERA 1YU6A 1OXMA 4OUDB 5C1OA 1GQOA 4JLKA 1LTHR 3B9QA 5EWJA 2I3DA 5EHZA 1MPTA 2BKAA 3L49A 3C3AA 1IN7A 1MIOA 5B7PA 2QTVA 2OZLA 4DZRA 2H1WA 3FYUC 1YQGA 3B82A 1U7UA 4MRSA 1RM4A 1SEVA 1U1EA 3F7TA 3EG9A 5CVEA 4A5SA 4YVFA 3HYCA 4YQEA 3NFYA 2O07A 3D1JA 1JWLA 5EKTA 1P1FA 3OIVA 1P72A 1K5PA 2FW7A 4TRJA 4W5HA 2MT9A 5FPSA 2BI8A 1XYGA 1Q0QA 4IQGA 1X1SA 2ZI5A 3D0QA 4MS3B 1VGRA 4XB1A 3OZWA 4QD3A 4Q3NA 5CHYA 4ZI3A 2VR1A 1G3IA 2C0QA 4TMKA 2OCYC 4RWZA 1V6SA 3CO0S 1QLHA 3G8DA 5ABPA 3HLTA 4UVGA 1RAAA 4MLPA 4P6VF 4MV0A 5DTMA 4LSMA 3ZCQA 3EXIA 2W0SA 1W76A 1YV9A 3CCCA 2FGJA 1RKXA 1Y7HA 1Y48E 5E7IA 4KDFA 2Q9UA 3TCNA 3PC7A 1E69A 3V6LA 2A0KA 4GLOA 1P2TA 3ETLA 1ZGHA 1P7VA 3M6FA 1O58A 4L4RA 5IFKA 1N7HA 5JNSA 2WG2A 4HAYA 3L3BA 2YJ3A 3PLRA 2PYIA 3HI4A 2I71A 3ZHOA 3H97A 2XMZA 5B1EA 1CUGA 5FPHA 4B46A 4HZUB 2WM9B 2CJWA 4PC6A 3OM0A 4KTTE 4YJDA 4PBRA 4CG3A 1WBJB 2YWHA 1SH7A 3CLRC 4O59O 2XB4A 1NBOA 3T52A 4NL4H 1I4DD 2E82A 4P83A 1QGOA 1V8DA 4Q1DA 3T3NA 2XYGA 3KQNA 1T4CA 2Z2IA 3V7FA 4QRIA 3SEFA 3WLRA 4QUAA 4YCBA 1NOJA 1MO4A 4RXTA 2EHJA 1IBCA 5FTKA 3GFQA 3QM1A 4YJGB 3ADOA 3VRHA 2Q8PA 1IXRC 2BM9A 1HNXB 4UXJA 2H7CA 5C7LO 2D1RA 2X5JO 4RQTA 1LLFA 2HDOA 3BJMA 2PWAA 2BM8A 3WGVA 1N6HA 1X42A 1RZ3A 3FI0A 3EXFA 4DCJA 2FPSA 4X65M 3GCGA 3E0XA 4FJ2A 4YMTA 2XNHA 1L4LA 3LSTA 1TUIA 4JT9A 4ZGGA 3HU5A 1UXJA 1S1CA 2BBWA 1F17A 2PL9A 1QZTA 3L7OA 1TYAE 1QTRA 3SVZA 4KLZA 1D0LA 2RB5A 3TNFA 5AM5A 4F21A 2Y6UA 2WR8A 1F4LA 2I2CA 2ISCA 1G9TA 3P26A 3TINA 3V4ZA 3W04A 3RYCA 1AS0A 1I0IA 4M21A 1RKBA 4BJ1A 4ZIRB 5C1IA 1OZ0A 3CVYA 3E0QA 3JQFC 1Q21A 3FUVA 3QHQA 2DAGA 1RM3A 4LY0A 2GKSA 5DNYB 4RLHA 5EZYB 2AL7A 4J0EA 1R27A 2VH5R 2RGXA 4OBWA 4QLOA 3UAXA 4ECAA 5LP6C 1NMEA 3U3XA 2BW0A 3GJRA 4UJ3A 4D96A 2F4VM 4GRDA 1YBAA 1YJ5A 4UCFA 1PK8A 2QT9A 3BD8A 2QBYA 1MT3A 4L2IB 4MYHA 4KV9A 2O7VA 2Q62A 1WXHA 3V1MA 3I64A 1QJCA 3IP9A 5CK5A 5UKDA 1JKXA 3DOAA 4HEQA 2GEUA 3DOHA 4C0WA 1PEKE 3TL4X 3K3PA 2J9FB 3VH2A 1E2EA 3KSJA 3VSEA 3LWDA 2KYRA 3AM4A 2O8NA 2W2VA 4OFWA 1D03A 1NMZA 2PYZA 1YRLA 3ONNA 3H5IA 3ZW8A 5E9JA 1HDRA 4X3PA 2PGAA 5KX5F 2CB9A 3WSVA 2XLBA 5EMNA 1OLXB 1QORA 721PA 4QWWA 3WKAA 3C3DA 5U9CA 2V6BA 1E3JA 3MINA 2XDAA 2D7DA 1C0IA 1QM5A 1SUEA 3IE2A 3OH8A 2OWDA 4G3OA 2O01F 2H29A 2YJ6A 1U04A 4HGOA 3AUTA 1GFWA 1X8LA 2I7VA 3V8BA 2Y1GA 3HV0A 1AUPA 1F6WA 3H1AA 4QT4A 5FL7A 1E5VA 1D1PA 1DAHA 2ODQA 1ECCA 1T3LA 2XUKA 1XNQM 2AMJA 3WL5A 1EZZA 5KPTA 2C96A 3EVEA 5F7ZA 3N0RA 4IINA 2HLPA 5LMNM 2OQ4A 3RAFC 2W8BB 1SU4A 2AN4A 4CF5A 4OM8A 4DXDA 5EJGA 3KOWA 3L4JA 3GQBA 1WDKA 3RVDA 2YWBA 3I1JA 4J0HA 4PG5A 1LPNA 5BWBA 2BR5A 3NTQA 4WZBB 2ZWIA 2BJHA 5AIBA 3OWXA 1N32B 2GAFA 3ZCTA 2QPOA 3E9RA 4WV3A 1A77A 3KKKA 3WK6A 3QI7A 2HHAA 3KP0E 2PIDA 5AI4A 4CT0A 4MKXA 2OSBA 2DNAA 4NYIQ 3RRYA 2Q8QA 2NGRA 5CB4B 2RSLA 1OIWA 3TRFA 2JAHA 4KYVA 4G65A 3ROGA 1E8NA 4HXGA 3GO4A 1E5TA 5DCLA 3KWFA 1Z33A 3I4LA 1I94M 3UCFA 4N8EA 5TMBA 4MPJA 5KSYA 1U2GC 5IASA 4Q3BA 1VPLA 1SXIA 1RHQA 3KXEC 3MUFA 3LFTA 4QUIA 4G0YA 4LJ5A 4L4UA 4KQGA 4D0LB 2WZJA 3DMGA 4OCZA 2RHWA 3DTVB 3TUJC 3T54A 3E4RA 1FPMA 4DMLA 4JR0A 4YP9A 1XQ1A 2CBGA 2PX4A 3DVQX 2CLCX 3UWPA 4QJ5A 1LV7A 3IMKA 4MGKR 1F8XA 2C2XA 1GLNA 5E8RA 1RRPA 3THWB 2QCUA 4QL3A 2GD1O 2QRVA 3D81A 2GN9A 4XARA 5DM60 5L3QB 1Z63A 4JL5A 3Q12A 4YCCA 3CF4A 3KJIA 5T4BA 1YQTA 4WE3A 3G2OA 2JCXA 2P79A 1VLLA 2VTEA 5J2TA 3E35A 4EGJA 4F9FA 4YV1A 2MSDB 2YIVX 2Q5LA 3H5TA 1PJ4A 3L1UA 2OV1A 1FNNA 3G7UA 3I2YX 4DJ5X 1GCIA 3D7LA 1YE9A 4Q02A 4F0JA 4LTMA 4ND1A 4KIUA 2I1QA 1T0HB 3U6QA 1MPXA 3DSRA 1PWZA 5CA1A 1FYXA 3AFIA 1R2QA 3ZHSA 2YZMA 3V4VB 3JALB 2PSFA 3T95A 2ZRHA 3ER8A 3IRVA 2ZUSA 2H5IA 3BL8A 1KJIA 1Z5VA 4WERA 2H9YA 3IUJA 2GB4A 2PLNA 5L3SB 1JXQA 3TIXB 1TZCA 3WAJA 5T4EA 1JECA 5CX1B 2JANA 3X0DA 5J43A 4KR3A 1YS1X 1RE0A 1CZUA 7ADHA 1BDJA 1XZEA 2YV1A 3DBRA 3BQNB 4BNGA 1GY8A 4ND5A 2PQMA 1EVIA 2ZIFA 1C0LA 2BFBB 1F5SA 4U7GA 5CFNA 4CWAA 4EUHA 4L8YA 1Z4LA 4DCOA 5K45A 2QUJA 5CJPA 2KM1A 4F04A 1MG0A 4CN9A 2WLSA 3QYFA 4X7RA 2WPDD 4TRNA 2W6QA 3NUQA 1CXZA 5E3IA 4DANA 4PC1A 4ZAGA 3LVVA 4DKXA 3OLVA 3CNLA 3IGFA 3TIGA 2PXCA 5TX7A 3QIAA 2OCLA 5DX0A 3VKWA 1IAQA 3W77A 3K1JA 4I36A 2G9UA 4HFNA 2YIJA 2R68A 4NU5A 1MENA 1D0MA 4MDYA 1LV8A 1GPH1 1QHSA 2D5IA 5TB5A 2WAOA 3PG5A 3VSDA 2OPFA 1UBSB 2KQUA 1PG0A 3PFCA 3JQEA 3NBIA 1II8A 4H60A 2AVNA 5IN4A 3D6MA 3P96A 2BKVA 4KBGA 2PEZA 3VJKA 3AGQA 4IWXA 4KACA 4L6IA 4IOLA 3BIXA 1ZM4A 3ZCVA 2CHEA 1TO6A 4F86A 3OQJA 4N5DA 2A33A 2O1WA 4RZXA 3R8CA 4BDSA 3RBXA 2Q99A 3UK2A 5GPBA 2FPGB 1Q0PA 4EM6A 3GLFB 3GRKA 1YCFA 3LCCA 3C6MA 4TS1A 1R15A 5LZ8A 3OEWA 4B7FA 1UWLA 1Z0IA 1NMXA 4LY6A 2ZIUB 3RS8A 1FK8A 4FGLA 2XZDA 4YREA 4HMQA 1RBYA 2HFKA 4WXPA 3QHPA 3PQ8A 4JI1B 1G3MA 1HDEA 3D6NB 2EFEB 4CTNA 2R6FA 3Q87B 3DVSX 2Y6VA 4QIHA 3O90A 1EWQA 4Q4JA 2YWCA 3S29A 4HQLA 1YRAA 1GTRA 5TXGA 5B6PA 2DFPA 1Z7WA 1SPBS 4P36A 4LXTA 3NC1C 4HQ0A 2QIPA 5DULA 1G5RA 1ZD2P 1NZFA 1U3VA 3ZDDA 5EE9A 4C0HA 4PBTA 1GPJA 3ZY3A 5KIAA 4WCVA 1D9ZA 4DQVA 3A7DA 5F3WB 3R3ZA 2G70A 1MQ9A 2XT6A 1XZMA 1A95A 3NBAA 4YO7A 1G8MA 3C16C 4I4NA 1KS2A 4FYVA 3EZXA 4B6QA 3VX4A 4J2TA 5FOWA 2IHYA 2Y66A 1SXJD 3BE8A 1JEEA 2F67A 1H4VB 1YKFA 1NN0A 1VTKA 1SOWA 2IODA 1IE3A 5IM4A 2GXQA 1QE0A 1ULUA 3M6VA 2QTMA 3C8DA 3OPYA 1AKRA 4JU8A 4L0DA 4OVKA 4CKWA 1VSTA 4P93A 1ZAKA 3H5LA 2Q3CA 4EG7A 3N6RA 3QJ5A 2JI6A 2C9YA 1BRTA 5DHPA 2R751 4RCVA 2D62A 5A6SB 1KBQA 2FRDC 1DOZA 3KOYE 4CM8A 4N47A 3N2GB 4JFRA 1ULBA 3DXYA 2XMQA 2YJGA 2OFOA 2O3UA 2EV9A 3F2VA 2J6CA 2C5RA 3C45A 4BLQA 1Y8QA 1XQVA 4F5EA 3OX2A 4EG1A 4CG2A 3GAMA 5PNTA 1VHWA 3A1WA 1FLNA 1NHWC 4R71A 4MS1B 2DPGA 3NJRA 2HDNB 4MHOA 1DEAA 1U9ZA 5JHGB 4IGFA 1YDMA 1LBEA 2I80A 5JFOA 1QUFA 1YQ9A 4K9NA 2NW6A 3RC1A 1YCGA 4ENPA 4YLEA 4PR0A 4YCSA 1ZRMA 3E2IA 1R0WA 1HYQA 3EXEB 3EQ6A 1VC2A 1K4MA 1N6NA 2HK9A 2YW2A 1KF0A 1P4AA 1DAIA 1E3IA 3LOQA 1NAIA 4ZYYA 4J3NA 4R1QA 4HRVA 1FRQA 2G82A 3N39C 3CCFA 4R69A 1LW7A 5F64A 5JH7B 3B7QA 3ZHUA 1U2DC 2XVYA 4F92B 2VPIA 1R8JA 121PA 1IXKA 3HLYA 3AIIA 1DG3A 1U6JA 1JR4A 1L3IA 1U0HC 5IK2A 3E53A 3T1YB 1OFIA 4NYJR 2RG7A 4ZO7A 1Q74A 4DB2A 1Q0SA 5IDYA 2VUHB 1Z15A 4JYZA 2JBAB 1H0KA 2MOKA 4QTZA 5I7VA 4YT4A 1YRQA 1XPOA 2AVDA 1YONA 1HK7A 1S3FA 1X86B 3P4UA 3SKXA 1OTHA 1KYXA 2NPOA 1GL3A 2IPMA 4D3SA 2OCDA 1UKBA 1WA5A 1NKTA 1XMJA 3ZZNA 4LE0A 4DLAA 2WTXA 3BTVA 3AW8A 3MWKA 2YC2C 1ZW6A 2G6TA 5CT8A 4BQNA 5DP2A 3H3XA 4PDGA 1KE1A 3OCZA 1PL8A 2AG8A 2FFHA 2YW9A 3KLNA 2VRWA 3CXRA 4GPZA 2ZJZA 4XQGA 3EFOA 4NABA 4NU6A 4AS1A 1WR1B 3VOBA 1AKNA 1CDEA 4O4LA 3NUGA 3OZ7A 4C6TB 4XWKA 2I2XB 4LC1A 3HVHA 1NDHA 1VYUA 1RC1A 5EQDA 4RACA 1T24A 4HH3C 4DDHA 4QFMA 1FE8A 1MHPA 3VISA 5LQJA 4Y67A 4Y9DA 1C3XA 3OZIA 1DDOA 4CEIB 4DR2M 5DWVA 2OO9A 5BUSA 1EK5A 3Q3VA 4MEBA 1U11A 3EWNA 5A2GA 4E5NA 5KOJB 4W7SA 4JGIA 1PIWA 1ETUA 5D01A 3I23A 1Q2XA 2Y0TA 3EZ6A 1TK9A 4G6ZA 3MNFA 4GI1A 4QZVA 2XRZA 4G56A 4DOMA 4XZ3A 3ROTA 4BNJA 5JCXA 2H2GA 3QVGA 2ZIXB 3U3JA 1DQSA 1GZ5A 2CVPA 2GPYA 1I4LD 5AUOB 5F12A 4MVXA 1SG9A 3FRHA 2F8TA 5JYBA 4URZR 1PTJC 4YBZA 2H0RA 2FWIA 2ZJOA 3WYEA 4B3XA 2MIIA 1BQEA 4INAA 1GTSA 1R6VA 2DZOB 1SC4A 2C94A 3MCUA 3C1AA 2E55A 1XT6A 1A8PA 1P62B 1UWCA 2AEEA 1YF3A 5CYPA 1XZDA 5U1PA 1R00A 4Q3DA 1U2PA 3CS3A 5FUWA 5F76A 1HE1C 3UJ3X 3SQMA 3T1QA 1BD3A 2CCJA 3U4QA 1SG0A 4HNQA 2GHTA 4WCFA 4F5DA 2ZULA 3O3OB 4P38A 2PT5A 4TWBA 1LDNA 3OU7A 4CI9A 4ARSA 1ODJA 3H1EA 4OB8A 1K4KA 5EKXA 1N33M 4K9KA 3HYNA 4OL0A 3ORQA 3TGPA 2EWWA 3RUDA 3VYVA 5BRNA 3PC3A 1EFTA 1PUIA 2CGEA 3JAKB 2OSVA 2GILA 4HDMB 1U7TA 1AKYA 5F5LA 2VT2A 2D2VA 1RRVA 2ZUDA 4HWOA 2TMYA 3B1XA 2P2SA 4DV4M 3M6WA 4WBXC 3OFNA 3PWKA 3MT0A 1I7NA 5ALPA 7AT1A 2HRRA 3S7ZA 2L69A 4IHAA 2IHVA 1K08A 2FPIA 3FFAA 1KIAA 2AOUB 3KV1A 4E94A 2FG7C 2R4QA 4CMCA 1QTQA 1P9OA 3C6XA 3G0DA 4XXHA 5HTOA 2D2FA 4OA8A 5I7FA 3M1IA 1RADA 1HE4A 4PIMA 4MYSA 1YOVA 2H0QA 1QH9A 3T1NA 2CFOA 4QG7A 2PZFA 3U6EA 3AVOA 3DB2A 4RL4A 4WNAA 1SBCA 2WKQA 3ICVA 2F3TA 3AF2A 4DJAA 5CXUA 2OC4A 1O9GA 3HDVA 1SBNE 2GA8A 1OI7A 4YALA 4GEKA 1NW5A 2GD2A 3SHQA 2BJWA 3HJNA 4DUGA 3UYKA 3GLTA 3F3SA 5C5CA 3PCTA 2Q2VA 3EHEA 3GBPA 3BXHA 4MUXA 4H27A 4D0NA 5JWRA 2NO0A 1UODA 2FEWB 1JLLB 3AVWA 2B3TA 4EFMA 3JD4A 1GJSA 6REQB 4J1SA 3SMPA 5FBKA 2J41A 4RK0A 2ZIZA 1TCVA 2F9MA 3AHHA 4RNDB 4H7IA 1OY1A 2QNIA 3IPYA 1NHGA 4PZAA 3X1MA 4ZYUA 4OYRA 1QU2A 2PGLA 3ER6A 1PNRA 1K97A 1N33B 1A04A 2J48A 3K1AA 1Z6TA 3WLPA 2OO5C 3ETHA 1IJKA 2Q2QA 2HD4A 4C2TA 1E3WA 1RRKA 1RKUA 1IN1A 2BFOA 3OEED 2ZEJA 3SJAA 1XRNA 3EZFA 3BSYA 3NYQA 3ZVNA 5LDDC 2N42A 5F4ZA 2OGSA 2OCGA 3BH0A 5E9WA 1XLWA 3ICOA 4Q9NA 2V7PA 4P4GA 4RANA 4HH4A 1C3VA 1XD8A 2HUNA 3C2QA 1G2QA 3T9FA 2VQDA 3EEQA 4AMGA 1SHKA 1KFCB 2GERA 3PQ2A 4WKBA 1RS0A 4NS1A 4EBFA 1Z4MA 4CL2A 4LGCA 3C4JA 1KJWA 3D4PA 4AJLA 3UTDA 2QTAA 2X0KA 1UIMA 1W5BA 2I6QA 1F38A 5TGDA 3KAKA 2FJUA 2D00A 1NUPA 4M22A 4EEKA 5THKA 3R7WA