4LJ5A

Clpb nbd2 from t. thermophilus in complex with adp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
331
structure length
320
Chain Sequence
b'MEVTEEDIAEIVSRWTGIPVSKLLEKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 97
structure length 320
sequence length 331
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj5A01
5EJEA 1Z5ZA 2RGEA 4FCVA 4IOJA 1CRPA 4BLPA 3RRYA 1QVRA 1KJZA 1BH2A 3MJRA 4XVQA 2WWIA 2RB4A 2NG1A 3SJAA 3WBJA 1ZM7A 2REOA 1Z6XA 4G01B 4LUCA 3RS2A 3OEHA 4X8OA 1SXJA 3A6PC 2OEPA 2D3WA 1U99A 1ZU4A 2BMEA 1VG8A 4KVGA 1G7TA 5AUPB 1HY3A 5H8WA 4X8HA 1I2MA 3D6TB 2QAGC 1E79A 2J7KA 3VQTA 1GKUB 5TDHA 2B8WA 3GPLA 2A2ZA 3B13B 4R2HA 4NCKA 4TT3A 1EK0A 1T8TA 2IF0A 3K0EA 1CF4A 3U3JA 4NP6A 1E2LA 5GVRA 4HLUC 1E99A 1MKYA 3CX7A 3OF5A 3EZ2A 5KO2A 1C1KA 1XPUA 1VCNA 1R7RA 1MO4A 2F6RA 1YZKA 3M4YA 1V5WA 4QGHA 1DOAA 3TR5A 4B3BA 1U8YA 2ODNA 2FZ4A 1KZGB 2PMKA 1HT1E 2ZRHA 3BH0A 4B32A 3WP1B 1XEWX 3IHLA 1SVKA 4TTQA 4A0GA 2CHQA 4IXMA 2JGNA 5CB8A 4E5UA 3CNOA 4JT2A 4PAQA 5FPHA 3QY0A 2E9SA 2W6ID 2ZRIA 4GOJA 4HLQB 2JATA 2WJYA 3RS7A 1W2HA 2ANCA 1N6HA 1VG1A 2NO9A 2ZJ8A 3L43A 4RY2A 3UATA 1G3UA 2OSBA 5FL7A 4A4DA 1ZD8A 4LBVA 5TVKA 1KI8A 3CB4A 2FDCA 1R0ZA 3HU3A 4PHGA 1AS0A 1QHIA 2QBYA 4WW0A 3IHWA 4IW3B 4M21A 1IONA 4HUQA 5E3HA 3Q7PA 4JBXA 4N0EA 1N6OA 2ZUCA 5FBWB 3MHVC 3SU8A 3SC3A 1NVUQ 2CJWB 3E70C 4RFSB 1UEIA 3R9IA 1NI3A 5FOTA 4B35A 1XD8A 1W0KA 4G5QA 1G4AE 1OFTA 3DKPA 1SKQA 1GRRA 3GLGB 1IAQA 4Z8XA 2IXFA 1KO4A 2YHSA 4PSAA 4Q66C 4PC6A 5BW8A 4F93B 2QI9C 3VU9A 3OIWA 2FOLA 4ZI2A 4JSYA 1PUJA 3LBNA 4M9ZA 3V4RA 5TARA 1XXHE 3ZS8A 2DWPA 1CJMA 4NZYA 5CJ2A 3U44A 3B1XA 3QXXA 2Q3FA 3T12A 4B34A 2YWGA 3L0OA 4PX9A 1ZYUA 4BFYA 2VYFA 3AQ4A 3OZXA 3A1WA 5IK2D 1GNPA 3AB3A 5L8VA 3NKVA 3OESA 1LV7A 1R0WA 1X8KA 4HAUA 4LYJA 1IXZA 1OIVA 1D9ZA 5M04A 3CRQA 4MH0R 4H1VA 1BKDR 2A9KA 2FEOA 4Q1EA 4AG5A 3KJGA 3OFNA 2CEAA 3R8FA 4TL8A 4B2PA 2QU8A 2FN4A 5JBQA 3FDIA 4A3VB 3T1QA 3RHFA 1W49A 4FI3C 3SJBA 1TX4B 3F0TA 2IYUA 1GUAA 1OPXA 5CYOA 4PHHA 4QFMA 2IS1A 2JIZA 1E0AA 2QAGA 1Z63A 4FWHA 1ANKA 1AZTA 2DFTA 2DR3A 4U7DA 3NG1A 4OK5A 4DBLC 5G53C 4HAWA 4Q01A 5HKKD 4DCNA 1OLOA 4ASUD 4NYJQ 2XNDD 4KFTA 2AR7A 4HLUA 4CEIB 1Q1EA 1JEEA 1EX7A 2OG2A 3CR8A 3ZVLA 1NSFA 1XU4A 1QHNA 1WXQA 3DO6A 4KSCA 5EZ6B 4XJXA 5J47A 1XXHB 1KDTA 2JLYA 3CPJB 2HF8A 4AKHA 2P3SA 4F4CA 1HQCA 2V7QA 3GQBA 3LD9A 2BM0A 1U2RA 2W00A 3S1AB 4DHEA 2C99A 2WMNB 1J8YF 2O8EB 1T5LA 1EFTA 2JJ2A 3OEHD 1G19A 1IN8A 1A7JA 3AVXA 5A5GA 3Q5EA 5E95A 1GRNA 4D4KA 2J0SA 4BLOA 3GLIE 4RZ2A 1FUUA 1IBRA 1GILA 1QZMA 1Z3IX 2PMDA 2IS4A 2JLQA 4H1UA 4Q9JA 1XTRA 3BWDD 4WXPA 3HU2A 1Q21A 3UWKA 2QNRA 4IOMA 1S3SA 3FB4A 1RVDA 1KTVA 2IF2A 1GL7A 2W58A 2A5FA 2CK3A 4TT3D 1W4BA 3RRZA 2ZSDA 4DUGD 1DARA 1P2VA 4GITA 4MKGA 2BKUA 2GAAA 3TNFA 5FTKA 4XD7D 4PC3A 3IIKA 2WVJA 1G16A 4A82A 4B74A 5F9FA 3OE7D 5DYIA 2JLSA 3O8RA 1FW6A 5JJIA 4PFSA 1GDDA 4IDPA 1HEIA 1F2UA 4PPNA 3KFXA 4DT1B 1KKLA 1RJ9B 1TL7C 2BMDA 3CPHA 2WOJA 3NTUA 4J0QA 1G5TA 4Q7LA 2IYQA 2KBEA 3KJHA 3X1WA 4A92A 3L0IB 3ADKA 5BN3A 2QMEA 3VR4A 1KHTA 1X1SA 5C4MA 1X8LA 4Q47A 2JAQA 3B9QA 4KV9A 3GP8A 4PAMA 1W4CA 4ESVA 2OAP1 2WIAA 3HDTA 2VA8A 4Q4JB 3NHAA 3A1TA 2O8BA 2XXAB 3I61A 3LLMA 3AEZA 5TY0A 4Z1MA 1YZNA 3BFVA 3RWOA 2QMHA 1ONBA 1E2MA 2J1LA 4ACBA 5KNCA 3I1FA 4C7OB 1Z8FA 3PG5A 5J4KA 2HYDA 4Q18A 1CR1A 3L8YA 1QHSA 1UBGA 3RSLA 3TMKA 2WM9B 3GLIB 2R2AA 5DE3A 3PVSA 1E9BA 2KB0A 2FJUA 4G5RA 1R0YA 2VHTA 3PEWA 1OIXA 2DWQA 2BBWA 2YZ2A 2ZSBA 1AKEA 3K0AB 3MMPA 1KO7A 4M22A 4D2IA 4AC9A 2YYZA 2WSMA 2VRWA 4FIDA 5FI1B 3TJZA 4URVR 4EIWA 4TLBA 1UFQA 4TYPA 4BZQA 2AXPA 1KK1A 2O8DA 4JLPA 1W46A 2C96A 2ATXA 2IYRA 1FP7A 2EYQA 1UDXA 2AK2A 2HT6A 2QRNA 4OL0A 3AF3A 2AX4A 3LBIA 1T0JB 2CE2X 4L15A 1FOEB 1U9IC 3GJ5A 1KSHA 1Z0DA 3M6AA 4BFXA 1I4DD 1AIPA 4TWZA 5F2EA 4OI4A 4OQXA 4PC7A 2ZE8A 4IDQA 4EKDA 2CBZA 2GJAA 4M1TA 4ZPXA 1KAOA 5C4GB 2P65A 1M2OB 5KOYA 3T34A 4YMTA 4B3GA 2IYYA 1YR7A 3EARA 4P4SB 2G1JA 4NCIA 5G3YA 4P32A 3FE2A 3WNDA 3OFND 1DAFA 1GP2A 1NKSA 1TF7A 1UBEA 2EWVA 2XTMA 2JLRA 1Z2AA 1IHUA 2ZRDA 1Q20A 3JZMA 2ZS9A 3H86A 3CRRA 1M8PA 1OYYA 1P7CA 1G3RA 5DHFA 2QMUA 4PPQA 1BYIA 1E9AA 2PEYA 1HT2E 4IHQA 3WBKA 4M9QA 4LRTA 3QF4B 1ZUIA 1M7GA 1EG7A 4U00A 2GVZC 4RD1A 4BECA 5IF9A 2IYLD 5JS8A 4B43A 2OXCA 1CRQA 3T1OA 3P4XA 4M2LA 3GJ7A 1QHHA 3C4JA 3I4LA 3TH5A 4F4IA 1DEKA 3P26A 4LC1A 1FMJA 2ZANA 1Q1QA 4GMXA 3B5JA 5HPYB 1MV5A 1P2TA 3DOEA 3EIQA 4HB2A 621PA 1G64A 2SHKA 1H8HA 1KI7A 1UPTA 1VCMA 1W44A 3KKPA 1E9DA 1R5NA 2OCPA 2WWWA 2VHJA 1KI1A 1E2KA 2GA8A 4I1VA 4MDEA 3CBQA 4G5OA 1YR8A 1MO5A 4ESHA 2LWIA 3RSOA 2GKSA 1N5IA 2ZRLA 3QIAA 3ZYCA 2IEZA 2HXSA 1P5ZB 3U3MA 4ZIRB 2FG5A 4MUAA 3SFZA 2WPDA 3FGNA 4HI0E 4TLCA 3EPHA 4XSGA 3SS8A 4FCTA 4LJ5A 5BQ5A 2YOHA 4IDOA 3IKJA 3AM1A 1PLLA 4TTPA 4JVNA 1JXMA 2R6DA 3MAAC 4JL6A 3ADBA 4XTRA 4G1UC 5FBRB 1LB1B 3WYGA 4BLTA 2XTZA 3KXIA 1E2HA 4MKHA 1DPFA 1VYVA 2GF9A 2AKAB 4V0LA 2O5VA 2WJGA 4AD8A 3K0FB 4URZR 4RCYA 5FOUA 3AUYA 3FMPB 2G9NA 3W90A 3C15C 4DCVA 2FGKA 3T1VA 1XCPA 2AXNA 4DJTA 5TB5A 3ND8A 1EFUA 3VFDA 2VP4A 5HZHA 1KK2A 3Q9LA 1X1RA 4MGYR 3V9PA 2EFEB 1JECA 1U9IA 4KXFB 4A0HA 3NBZC 4OHXA 4QBHA 1S2MA 4E07A 2DYKA 4BLSA 2ZXUA 2D7DA 4RKEA 1ESMA 2JASA 3TVTA 4XSHA 5HZKA 3IEUA 2G0NA 2OUKA 4D26A 4A9AA 1GL9B 4LJ4A 1JJ7A 1ZUHA 2FZLA 3AH8A 1NY6A 1KKMA 2BHRA 1IXSB 4HUTA 1ZUNB 1OXTA 1LNZA 4L9SA 1QG4A 3GFPA 2LKDA 3GLFE 3B1WA 2BJWA 3NH9A 3THWB 3SBEA 1E2IA 4ZCMA 3SOPA 1J99A 2R62A 5GADl 1FZQA 2ZPTX 2GTPA 4GT1A 2ZSFA 4C3ZA 1S1CA 1Q12A 4EFMA 3QXCA 3DL0A 3L82B 4B71A 2J59A 1CBUA 5E7IA 1KGDA 4HDCA 4Q1DA 2IUSA 5K8UA 3I3SR 1IN6A 3F3YA 4IFEA 1DAMA 2XX3A 1GRQA 4EDHA 5JRZA 3N2IA 1JQLB 4URYR 1XX6A 3UXMA 4HSEA 4RD4A 2XOKA 4X8LA 2F9MA 5ANRB 1FX0B 2D2FA 1FL9A 1J7KA 4H9GA 4JLDA 1AGRA 4KJZA 4MRRA 2JJ1A 1XJQA 2ZR7A 3OHMA 4M1YA 1PLJA 3REGA 4BUJA 1RKBA 1RRGA 4M53A 4PO8A 3N70A 1H8ED 1TQ4A 3EZFA 5EXSA 4EJSB 3AF0A 2Z0MA 2ZE6A 1R4AA 1U0LA 2YVUA 5FR2A 3KQLA 1TUIA 3LRPA 4A0RA 4B44A 3U61B 4LJ8A 4DDUA 1G9XA 2ANBA 5CYPA 3IPXA 2H7VA 4QGAA 2QZ4A 3T06B 3RVBA 3W9YA 1G21E 1NVXQ 4LYHA 1ETUA 3CZPA 2F1RA 4GRAA 5CIWA 4LI0A 5FI0B 3CKLA 2NO7A 1G41A 3B1ZA 3RS0A 3TW8B 3QKTA 3NWJA 4CYMA 3THXA 3KW6A 2HXYA 4JVMA 2CLDX 5JSZB 1G1MA 1R2QA 2O8FB 4ZDJA 3CF0A 4I1UA 1XMSA 2OCBA 3C5CA 2NO6A 1CP2A 4MITA 2HEIA 2H5EA 2OFOA 2P0EA 1CJKC 2QP4A 4ZCIA 2W0SA 3K70B 1RRCA 1RRFA 1OKKA 3KFVA 4K46A 1R10A 3BH6A 3N5CA 3TUJC 2ZRPA 2UZ3A 1Q0UA 2N1BA 2G6BA 3SYNA 1ZCBA 2FMXA 2JCSA 1Z6YA 3CW2A 4URUR 5IDVA 1E4VA 5FTNA 4UXJA 1PUIA 4WZ6A 3ZQ6A 1S1MA 3QEOA 1CKEA 4XH9B 2IWHA 4YDSA 3ICQB 2PL3A 1SXJE 2PBRA 1XD2B 1ZVQA 4FN5A 4L4UA 1ZM3A 4OI1A 1L4UA 4NH0A 1E2DA 4L9WA 1KSGA 1II8A 4LHYA 1TQDA 5BXQC 1Z6TA 1XEXA 4M1WA 2PZGA 2VP0A 2QENA 4D81A 3MGCA 2ZAMA 1Z0KA 4Q9IA 1NG9A 4BFVA 3TGPA 3SYKA 4BFUA 4TYYA 1NBMD 1G7SA 1GITA 2BBTA 2N42A 1FUKA 2WWFA 2KI5A 2B7CA 4IDHA 3FHTA 3AVUA 3NEYA 5FBVB 1D8TA 2GZDA 4C0SA 4EPVA 4NYIR 3W6OA 3LQRA 4PZYA 1IN4A 4A8JB 3QF7A 1XPRA 2W6IA 2VP5A 1EXMA 4QRHA 5DI3A 3Q8XB 5B57C 2ZI3A 4BLQA 4HZUA 5DH9A 1H65A 3VX4A 4QJ4A 1QBKC 2IBMA 3D7MA 3A1UA 5LPNA 1G7RA 1MOZA 2HDNB 2OILA 1VG0B 3QXHA 4Y0VA 2ZYTX 2B8TA 3W3AA 1KSFX 3AVPA 1UF9A 5KDDA 1J90A 1IJEA 1TEVA 4Q5IA 1XTSA 2ZRAA 3AKCA 1E3MA 3ZD6A 1K8RA 5AJWA 3V4FA 2GXAA 2ZSAA 1JB1A 1CXZA 4C0KA 1SXJB 1GSIA 5JS7A 4FMCF 1L8QA 3NH6A 3MWJA 2JLWA 4WOPA 1W36B 4B3DA 1R8QA 3GCGA 4GMDA 2G77B 1E94E 2X19A 3AKEA 2NPFA 4B3CA 1JJVA 4LJ9A 1HE8B 1QF9A 3UG7A 5KYKA 3HYRA 1C4OA 5DSZA 5JJLA 1U81A 3OIUA 3BE4A 1OIWA 4LV6A 4CVNA 2A7QA 1KO5A 2O0HA 1DADA 1KDRA 4JJZA 4W5WA 5KNDA 3ADCA 4V0KA 1MO3A 2D06A 1RPZA 2ZI5A 2V55B 1JNYA 4G3XA 3O47A 4NHOA 3GEHA 3OIYA 1JR3D 3VMFA 4IFBA 1T3HA 1OXSC 5EE1A 3VKGA 2VQSA 3QI2A 4KFUA 1YU9A 2QPOA 2NZ8A 4OI0A 4K81B 3NIBA 3A37A 1JXOA 5D3MA 5C46F 2VF7A 2ZYWX 1TQ6A 2FNAA 2CE7A 3BB1A 2F3RA 1DELA 3CWQA 4WIAA 3LWNA 1N5KA 4M1MA 1MRNA 3IPYA 4MRNA 3WXMA 1W4RA 4OQNA 3X2SA 1P2SA 4HUQB 1OV4A 1GTVA 4RSGA 2O0KA 2PJRA 3E1SA 4PANA 4A2PA 4TSFD 3B1VA 1OYWA 1N25A 4JVSB 5BWMA 3AKDA 3WY9A 5BN4A 1R6BX 1P73A 3VX3A 5HKKA 4O0MA 4ASUA 3MRSA 2WAYA 4HLCA 4TMXA 3RAPR 2GRJA 5KSZA 1G291 1Z22A 2XNDA 2QPAA 1A82A 3ASZA 5CIQA 4EPTA 3VU9B 3U3OA 2ZS7A 4GSYA 1OKKD 2Q6TA 4DLYA 1K5GA 4LK2A 1E9EA 5BYJA 5DIFA 5J4YA 3KQNA 3U44B 4RZXA 5FR1A 2IYXA 4LPSA 4O25A 5C1BA 1FMLA 4QHYA 2NZJA 5FOVA 4DSOA 1HTWA 3CF6R 2ZIAA 4Q02A 5KU1A 3T35A 1Q22A 1YZUA 4Q19A 2OAQ1 5GVSA 1OFUX 2RH5A 3U4QB 3OAAD 3EXAA 4TZ6A 2WIBA 2GEVA 4V02A 4DDWA 3SI7A 3ZVNA 1K6MA 4DUGA 2Q0HA 5FUYA 4QJ3A 3THYB 3NBYC 3PUVA 4XD7A 2WBLC 4QBGB 4U5XA 1R0XA 3CRVA 4YQFA 3ZVMA 2W0MA 2HCBA 1AN0A 3OE7A 2W2XA 3LY5A 3BK7A 5JHHB 2AN9A 2BJVA 4TQUS 2QTVB 4HB0A 3GJ4A 1EWRA 3PUWA 4B48A 2ZJZA 4DLVA 2H17A 1P61B 1RE0A 2Q21A 2QAGB 4U02A 4NYMR 4BFTA 2VP2A 4GP6A 1WB9A 5E7MA 2J46A 2QGZA 5FBLB 4NKRA 521PA 1HV8A 1ZP6A 3KKOA 4A1FA 2GZAA 1E2QA 5B64A 1LS1A 2KBFA 2WJVA 1F6BA 2FU5C 4FXPA 4JKIA 1OH8A 1W1WA 1CS4C 3JVVA 3EAQA 1WP9A 1TTTA 3ZZ0A 3SQWA 3ZVRA 1FQJA 1YZGA 3T5DA 1XTKA 3PQCA 4TZ0A 4DLZA 3TLXA 2EFHB 3QEJA 4QKQA 1YR6A 2DFNA 1VHTA 2YKGA 2F1JA 4N0DA 3OIVA 2VIIA 4Z51A 1YJ5A 4JMPA 3HJNA 3PITA 3VNVA 4LCBA 1RRPA 3JZAA 3P20A 1NMXA 4O3MA 4I1SA 5L3QB 1WF3A 4QBIA 1GM5A 4DCUA 4OHZA 4NONA 2ZE7A 2TMKA 2N46A 4JT4A 2ZJYA 2BM1A 2V54A 2XZPA 4QM7A 2O52A 5J5CA 1DBSA 1T6NA 3PUXA 4MRSA 4KO8A 2IYVA 3RDPA 4FWIB 2MMCA 3BXZA 3NVAA 3RRNA 3W34A 4LHXA 4AKGA 1F2UB 4IVPA 4BWYA 2D62A 3W8NA 2RGNC 1JAHA 1FTNA 1Z6AA 3K09A 3R9XA 2FFBA 1P6XA 1SVLA 1OH6A 1E9FA 2GDJA 4QHTA 2FF7A 5AWFC 3B85A 4WVFA 4MKIA 5KUTA 2C9OA 1F60A 1G8GA 3K8YA 1N6IA 3SE0A 2O8BB 1N6RA 4IOKA 4XWOA 4D25A 5CLLA 5F98A 2HT1A 5UKDA 1NVVR 3C16C 4LBWA 2IHYA 3DOFA 1BIFA 4PO9A 3VTKA 2OBNA 2WJIA 2WMOB 1OXVA 1IY1A 2BIFA 2QROA 5FH9A 4ZI3A 4Q9HA 1UEJA 2A5YB 3AUXA 3R9WA 1XTJA 1KMHB 1MO6A 3GJ0A 3B82A 4IVRA 4EQ6A 4QG7A 4W5HA 3U7GA 3TKLA 2D7CA 2VPPA 1N3BA 3SN6A 2O8DB 1Q1BA 3CONA 3CZQA 2CVFA 2HF9A 5DLQC 2WJHA 2IUUA 1P60A 4PQRA 2HCJB 2CHVA 1Q1ZA 3CPEA 5B58C 4YXWD 3KTAB 1XP8A 3ZQJA 1P62B 2BBOA 3QKSA 3W3ZB 4LJ6A 4QC2A 5FL3A 4YMUA 5KPJA 4Q4AA 4FD2A 2ORVA 3B8HA 3H1TA 2WZQA 2GJ8A 2GVDC 4GZLA 4AKIA 4RFSA 1FQKA 1JBKA 2RHDA 3CO5A 2GK7A 2CL0X 4RFVA 5LBIA 2GCNA 4LJAA 2ZRGA 1FP6A 2IW3A 3H2YA 3GLGA 4N1AA 3EPJA 3K1JA 3A4LA 1YZTA 1XEWY 1W36D 2CVHA 4AI6A 4JYBA 2H57A 2J7PD 2P6RA 2OO7A 4LHZA 1YE8A 4LZZA 2IYSA 4L5BA 5SZIA 5FUXA 3LW8A 1TPZA 3K0CA 2G3YA 4A36A 1Z47A 5JECA 5KPDA 4LPKA 2GXUA 3PEUA 4M9XA 1PVOA 2BMJA 2IK8A 5EUMA 3ZZTA 3TW4A 3BORA 4HB4A 3JVUA 4LRSA 4R71A 3KX2A 4B73A 2GEDA 1S9DA 4AIIA 1QHHB 3WNCA 1KYIA 1DG3A 1SKYE 3DPUA 4DLUA 1DVRA 1ZD1A 4XIGS 2VHUA 3SHFA 3SBDA 5J4VA 2XGJA 3CM0A 5LDDC 1OB5A 2O8CA 3ZH9B 3I72A 5LB4A 3QUSA 2RGNA 4QOSA 2P2LA 4KAXA 1ZJ6A 1OF1A 2ZRFA 4CT5A 5F9HA 4IOLA 4MYUA 4RVCA 3KXLA 5DHAA 2XZOA 2ZM5A 2ZRKA 4DC9A 721PA 2X8AA 4C0BA 3QVVA 3VLFB 4EPYA 1FTSA 2OHFA 3TR0A 2XZLA 4JBYA 2P6NA 3EZ7A 5L3SA 1M7BA 421PA 4B76A 4LJ7A 5FUWA 4PC2A 4MDFA 1G8YA 5EXPA 2OFXA 1AJEA 1KNQA 1UKYA 2CLCX 2R8RA 2IWRA 3ZIAD 4QNRA 3NC1C 1XBTA 2FSIA 4DSNA 5FPKA 4CEIA 1PV4A 1KI6A 3K9LA 2MMGA 4DDVA 3IILA 3U3KA 5EP1A 2Z43A 3FKSD 2WAXA 3S1AA 2IT1A 3BOSA 1V43A 2H92A 5L3RA 2F1IA 1P4SA 1Z0AA 3K53A 2O8EA 2IEYA 1G20E 1H8EA 2YC2C 4C2TA 4DZZA 4IXNA 4CEJA 1GVNB 3SQXA 2PJZA 1F2TA 1F5NA 1SKYB 2VTKA 3GJ6A 3RRMA 1SVSA 4WZBE 2ERYA 2DHRA 5EE0A 2J0QA 3CLVA 2D74A 1N0VC 1ZCAA 3DM5A 3AV0B 2FE4A 3UMFA 3WHKA 4HAVA 1N6LA 2A78A 2ZYVX 3DZ8A 2VEDA 5AUQA 4A0FA 3WMFA 2GILA 1VKJA 1NN1A 4FMDB 4CIDA 1US8A 2CXXA 3B7GA 3LA6A 3QPWA 4HAYA 4CRWB 1DAKA 1Q44A 4BGDA 3MFYA 4EAQA 3FFAA 2DFLA 1CULC 1XF9A 1GOTA 2OFWA 1VIYA 5F3WB 1XMVA 2C2HA 3U2QA 2ZU6A 3CRW1 3A4NA 1W48A 5KDOA 1TEXA 1Q57A 1ZM4A 3WYAA 2QG6A 4B3FX 4I4LA 1NIJA 4JN6A 2VSXA 2GJSA 3OEED 2ZJBA 2HJVA 2ZJAA 1WDTA 4BPBA 4MGIR 2QE7D 3IIMA 4C2UA 1BO6A 3I62A 1MH1A 1QVAA 5EP3A 4JSTA 3LV8A 5JEEA 3EPLA 1NVMA 3ASYA 1K5DA 5JHGB 5A4JA 5KSPA 3Q5DA 3I5YA 1LTQA 1NJGA 2J87A 1ZNXA 3GFOA 1SVOA 1NBMA 3QXSA 2BDTA 4Q21A 2CDNA 4US0R 4R2IA 4O2RA 3VAAA 2EWWA 2PH1A 3U7HB 1GFIA 2DZNB 1P9NA 3RC3A 3ZGXA 1NLZA 4DVGA 4YDHB 3W6PA 2B6HA 1S9HA 2R44A 1AM4D 4D80A 3B6EA 4FWDA 2QEQA 3A1SA 5J4HA 3A36A 1G8PA 1MABA 2HUPA 1AQUA 4QGGA 1A4RA 4US1R 3ICEA 2VHQA 4PR0A 1CJTC 3T15A 3Q3JB 2WSSD 1XWIA 2ZR0A 3THXB 1VECA 1ZRHA 3SZRA 2UKDA 4UNRA 1XNJA 3REFA 3X1YA 1QG2A 3EIHA 5B2ZA 2Z83A 1Q3HA 4Q03A 3DHWC 4TMTA 2XB2A 3C41J 1ZU5A 3GJ8A 4DSTA 3VR3A 1M7HA 1U90A 3CNLA 4KITB 2HLDD 1SGWA 4MQBA 1VCIA 5G40A 1Z0FA 5SZHB 1OXUA 2VHCA 3UANA 4Z54A 4OKSA 1WE2A 2IUTA 5JZVA 4Q9LA 3B2EA 2Y8EA 2WWGA 2VH5R 4QGFA 4YMSA 2OCYC 4CEHA 1LS6A 4Q7JB 1WBBA 2B92A 1QDEA 3C14C 2ZRNA 1Y63A 3G82C 4FINA 4P3YA 821PA 3ZDQA 1II8B 5SZJA 1UADA 2EFCB 2H1LA 1RZ3A 1UDWA 3B60A 3QF4A 4TQ9A 1A2KC 1N0UA 2Z4SA 1AQYA 1XEXB 2JDID 3MD0A 4Y0AA 2J3EA 2IS6A 2GETA 4E09A 1D6JA 4KSBA 4PSVA 4V0MA 2NQ2C 4NYJR 4XOIA 3MCAA 4PHFA 3WYFA 3QG5A 1JR3A 4BQSA 2DZOB 2ZR9A 1G18A 4ILEA 4XVRA 3BB4A 2HJGA 1P3JA 5HCIA 5FOSA 3EW9A 1NN3A 3L0PA 5G41A 2QMOA 4TMWA 1UBFA 2EQBA 3GD7A 3QENA 1TMKA 3HPQA 4M1KA 5CK5A 3U6BA 1KJWA 3GFTA 1ZMXA 3GJXC 2H18A 1N0WA 1TADA 2LCFA 4HZUB 5FUVA 3Q72A 3CX6A 3IO3A 2NIPA 1Z0JA 4UNQA 4Q9KA 1JPJA 3C8UA 4ZO4A 3NEJA 5FPSA 4ZIRA 4A15A 3DM9B 4TSFA 1QZXA 1IN7A 2C04A 1E69A 5CK4A 3CH5A 1JEDA 1PJRA 3E5HA 3NHBA 4KBGA 1G5RA 2ZVPX 2J9RA 2XJ9A 5EZ5A 2Q9BA 2QSYA 3BC1A 3KUCA 1SZPA 1P75A 2UZIR 4BE7B 3QKRB 5DGXA 3GLFB 2FH5B 3AF2A 4K8OA 1A1VA 4IRUB 2GNOA 2ZRMA 1OXXK 2IYWA 1X6VA 4JLNA 5AJXA 4ZDKA 1NP6A 3FVQA 1O3YA 1G6HA 3R7WA 2R6FA 4D6PA 4LGMA 2OCAA 3NBXX 1DS6A 3RANA 3ECCA 3K0FA 1CU1A 1CR0A 4RZUA 4JL5A 4YMWA 2GEUA 3KL4A 4BZPA 3LBHA 4OQLA 5CJPA 3AGQA 5EUQB 1VHLA 1WA5A 3LX5A 1I2DA 5H68A 4DLWA 1RC8A 4JIMA 4ZDIA 5JI2E 2BMFA 1BMFD 2GZHA 2BEJA 1GZSA 3IO5A 1R8SA 1NKTA 1A2BA 1JALA 2YOFA 2ZRBA 3OAAA 5P21A 3TE6A 1MR3F 1P2UA 2H16A 1KNXA 3J81k 4Z8YA 1N6KA 2P67A 4QNMA 4BFZA 4NCNA 1PZNA 1GG2A 2ONKA 4KI0A 5D3MB 4YONB 2EW1A 3SFVA 3TSZA 3K9GA 1GKYA 1E98A 3HR7A 1XCGB 4PSKA 5LD2C 3KDSE 2GJ9A 5AJVB 1IOZA 4E03A 3B9PA 3CWZA 2RGDA 3LW7A 1VPLA 2K5UA 2DCUA 4FCWA 3BD9A 1VMAA 1TQ2A 1Z08A 4PO1A 2NTYC 4EFNA 3THWA 2F9LA 4ZV4A 5JMTA 4JZKA 3KKQA 2CL7X 4RD2A 2GXQA 3B78A 4PXAA 2I1QA 3IQXA 4BRUA 2RCNA 3EPKA 1NL3A 1QHGA 3IBGA 1NY5A 3QBTA 3GEIA 4NBSA 3RS3A 3K9NA 3KZ1E 3T61A 2GWHA 2YWEA 3DEFA 1AS3A 3U7FB 3BERA 3TUZC 2R6GA 3HPRA 2DWZB 1SVWA 4MYCA 5IT5A 3MWKA 2KSQA 3KQKA 4DB4A 1XMIA 2A5GA 1CR2A 1U8AA 2IYZA 3H84A 1UBCA 4UXHA 4TYQA 4EJSA 2J45A 2ZUBA 4BRWA 1SULA 1KDOA 2Z6VA 5JJKA 3EWAA 3HP1A 3GLHA 2C9YA 4IVQA 3I5XA 4MRPA 1E2JA 1U8ZA 4DXAA 1SHZA 2QP3A 2F1HA 4Q4HA 1JPNA 2W2TA 1XFAA 2G0TA 2ZRCA 2QQ0A 2A5DA 2ODWA 4QHSA 2X77A 4TMVA 1BS1A 3LH5A 2ONJA 4B47A 5KNBA 4RKFA 3LQQA 3UMRA 4F38A 3ETLA 5J4LA 4TLEA 3DMDA 1DAGA 1YRBA 3BFXA 2I4IA 4GP7A 1KI3A 5JSZA 3U7EB 1TAGA 4DDTA 3IBYA 1GL6A 1VYTA 1VTKA 4FW9A 3CF2A 4HB3A 4II7A 4Q48A 4US2R 4IJMA 3UWOA 1P9RA 2YWHA 2YC4C 1NMYA 2HV8A 4D0NA 3SEAA 4KHZA 4Q1AA 1BOFA 2AFIE 1GAJA 5JCPA 4HEJA 1G8FA 1XRJA 3W6NA 3FWYA 1W5SA 2RGGA 1GIAA 4D4MA 5EXXA 5EP2A 1XMJA 3H4MA 4B75A 4NTZA 2ZTSA 3RNLA 2QBYB 5HE8A 1T0HB 1W7AA 1NLFA 2CHGA 2VBCA 3KQHA 1NLYA 3LX8A 3QVUA 2NPIA 4WA7A 1VG9B 2ZJ5A 5DO9A 1L2TA 1NJFA 2GCOA 2YOGA 4LYFA 2Q9AA 1CJVC 4RD6A 1RIFA 2NMVA 1Z0IA 3CUEF 4QJ5A 1C9KA 4I81A 4KODA 5KTYA 2V3CC 3P4YA 2W83A 3M0EA 3EZ6A 3K09C 3W5IA 2QT0A 1IM2A 5L3VA 3FFBA 3QG1A 1T5IA 4DEYA 4A8JA 3O8CA 3WNBA 2WJJA 3AP2A 4MUBA 5CDFA 4JJKA 3EIEA 4KCGA 1ELOA 1X86B 1KDPA 1XCMA 2NO1A 5FTLA 4YXWA 3EA5A 3EWSA 1UKVY 2EVWX 3QNUA 4DCTA 4POAA 1VDZA 2XTNA 3AP1A 2ZAOA 2CLSA 3PUZA 4PTLA 1E2GA 3GMTA 6Q21A 2BVNA 3CRMA 1YQTA 2OESA 4A6XA 1ZAKA 1OW3B 2JLZA 2C98A 4HLDA 4OHVA 1M74A 2W6JA 2QP9X 1E0KA 2J0VA 4WZAE 3TVDA 1OH5A 2IS2A 2IHBA 3I32A 2GCPA 4OI2A 3NBFA 4EFLA 3F8TA 2P5TB 2XSZD 2PLRA 1EX6A 1MT0A 4HDOB 2J7PA 3SNHA 3MUFA 2OE2A 4EUNA 4AYTA 4TL6A 3GLGE 2GESA 4ARZB 4OK3A 4UNSA 2F55A 1T4GA 4G5GA 4ZCLA 2C5LA 1W0JD 1W2GA 1DTSA 3PEVA 4AYWA 1OHHD 3SJZA 4PPFA 1PLKA 4KVAA 1DAHA 4R7ZA 4KFSA 4TMKA 4A6PA 5GJBA 1U98A 4MKFA 3VHLB 4KYIB 2PLFA 1Z83A 3BIFA 3LXXA 4DKXA 2WICA 2UVQA 1S4QA 4M1SA 4OK6A 3QPVA 4EQ6B 4TYNA 1XJCA 1L4YA 1D2EA 2AFHE 2FEMA 2WWXA 1E6CA 4C30A 1Z29A 2BV3A 1N2CE 2ASEA 3PIRA 5H1YA 3QSYA 1RFLA 2CCKA 5FOWA 1RYFA 1SVMA 4UKDA 4M1OA 3ZS9A 1F3OA 4W7SA 1T3SA 3BH7A 3R8CA 3QKSB 2F43A 1EESA 1OSNA 4Q4AB 2DBYA 2MSCB 3K0CC 1E32A 1I4TD 2C95A 4GFDA 4P31A 4PZLA 2WWYA 1FNMA 3EC2A 4AURA 1E1QA 2CNWA 4YLGA 2QAJA 1KO1A 2J0UA 4HZIA 1G4UR 2V9PA 2O0JA 3I73A 3LXRA 4LWZA 3VKHA 4D0GA 4DRZA 5DNYB 1IY2A 3KKNA 2QT1A 5KSOA 4W9MC 1UKEA 3E2IA 3ZIAA 2C78A 4KLNA 4TYWA 1NMZA 2ZJ2A 3C7KA 5CITA 1I4LD 4IKEA 2REXB 4G5SA 3QBVA 3FKSA 1COWD 2VO1A 4JLMA 3K70D 3H0KA 5EE5B 4GBMA 1FNNA 4JLJA 3U3RA 2DFKB 1E1RD 2EFGA 1AKYA 3HU1A 3HR8A 2RAPA 4PAOA 1Z07A 3NDPA 2GBLC 4ZKDA 2ZREA 3D3QA 3LLUA 1XD9A 5SZKB 1NF3A 2PCLA 3A58B 4PHTA 4OHYA 2EFDB 3TSWA 2L0XA 3U4QA 4XVUA 1Y3AA 5C18A 1T9HA 2AD1A 4MYHA 3KB2A 3KXKA 2FSHA 4YMVA 2O8CB 5DN6D 3ZJYA 1C1YA 3MSXA 2OLJA 4ZDWA 3THYA 3GJ3A 3X1XA 5JWRA 2NGRA 4C9BA 1UM8A 4AK9A 3IIJA 5GJCA 1EFRD 1E9CA 2G83A 1TUEA 3LVRE 1XZQA 3DZDA 1AS2A 2OM2A 3PUYA 4JYCA 1SVIA 2CL6X 3UIEA 2FPLA 3WMGA 3TIFA 1E4YA 1IY0A 4C0QC 1GWNA 3AVQA 1E96A 5CM9C 4ARZA 2BKEA 4DEXA 5L3SB 1DG1G 4LC0A 4AG6A 3TQCA 3ADDA 4WBSA 5J40A 4DSUA 4LV8B 3P27A 3OEEA 1UJ2A 1EWQA 3D31A 2Z5FA 3FKQA 1EFHA 1M1YE 5E7JA 5FPTA 1JR6A 3FHOA 221PA 4QL3A 2QE7A 3AP3A 4S35A 2WTUA 4FWGA 2JLXA 1KI6B 2F3TA 5AR1A 1ZC4A 3Q7QA 2RGXA 4R98A 4MA4A 2CJWA 4BZXA 3GEEA 4RD3A 1A5TA 4MRVA 4BFSA 3CH4B 1DO2A 2BWJA 2VF8A 4LV5B 4LHWA 5HTKA 2JEOA 3L8ZA 4LRWA 2W6JD 2R9VA 4NMMA 2FWRA 1SXJD 4CEJB 3KB1A 4TLDA 3IDQA 1M6NA 1F2TB 2ZVQX 4BASA 1NBME 4XWAA 5FFMA 1M34E 5K8TA 5L3QA 4BLRA 1VIAA 1F48A 1W5TA 4LBYA 1E79D 2A30A 1GKIA 2GXSA 2KWIA 4IEIA 4I1OA 5IRCD 3BFKA 5EXTA 3FYHA 3RLFA 1T91A 3MG9A 5TMPA 1KK3A 3EC1A 4JS0A 1DO0A 2WSSA 1E2EA 2V6JA 2B21A 2OXRA 4CDGA 1XPOA 2XB4A 1B23P 4WAUA 2FSFA 3VR5A 3EG5A 2QQEA 4F4JA 4P4TA 1US8B 1SHKA 2WKRA 1G7CA 4V0OA 4HYYA 2FFQA 2YNMA 3MLEA 4EPXA 2NO0A 2WWHA 2QN6A 2HLDA 1N6PA 3HYTA 1G8HA 3B1YA 1JI0A 2WKQA 4GOKA 5AJZA 3SR0A 5KDLA 4CZ2A 2C03A 4Q4LA 2OV2A 4R9UC 3X1ZA 1D2MA 4HDQB 1G3MA 3KJEA 1OB2A 1WCV1 1GNRA 5FL7D 2GHIA 2GBLA 5A0FA 3DMNA 1HYQA 1B0UA 3BGWA 4N3NA 1DE0A 2X2EA 2J41A 2AK3A 2V8OA 1NNEA 1E1QD 2CNWD 2JDIA 1D2NA 1AA9A 4L16A 4AWXA 4C4PA 5HE9A 3EZ9A 1E0JA 1ZNYA 2MSDB 1QRAA 2CCJA 2Q3HA 1RYHA 1W0KD 1ZW6A 4KLZA 2FPKA 4RD0A 4I99A 1P9WA 2GAOA 1KMHA 1LW7A 2XNSA 4KU4A 4NU0A 4UQOA 2BCJQ 1HQYE 1AZSC 2ZYUX 2WKPA 4TMZA 4V0ME 5JWOA 1XXHA 1OE0A 2NOAA 4ERNA 3LFUA 1HA3A 4JL8A 3LDAA 1Z28A 4BEJA 4NYIQ 1JR3E 4JVLA 2FGJA 2IA5A 1TU3A 1S3GA 2ZI6A 1L7VC 4PPGA 4OBEA 4EPWA 1MABB 1HUQA 2FSGA 4PQYA 2QA5A 3K9HA 2IYTA 3F5FA 4NL4H 1CR4A 1OT3A 5E4FA 4D82A 1G5PA 3KTAA 5FOXA 4DIEA 1T3LA 3IGFA 3BRWD 1KAGA 3TBKA 2PCJA 4DIDA 1UAAA 3UPUA 2BBSA 2REBA 5JCZA 4ON9A 1OFHA 4JLBA 2EYUA 4NCJA 3CX8A 1CJUC 4PC1A 1N6NA 1JAIA 4W5JA 4MGKR 2CMKA 1QHYA 1NN0A 3KUDA 2HYIC 2V6ZM 1NG1A 1J2JA 1P72A 2FA9A 3O8DA 1II9A 4CEHB 4GNKA 2QY9A 2XITA 4JLVA 5TV2A 3RABA 4LBZA 5EP4A 3C5HA 2IXGA 4F92B 1G3QA 4DT1A 1ESNA 1RJ9A 5K8LA 5JEDA 1CIPA 2KRKA 2PZFA 2JIZD 3VHXA 3RYTC 2VLIA 2AKYA 5CB6A 4DWJA 3TUIC 1KY2A 2FFHA 3VR2A 4Q4JA 5DI9A 4D4JA 4E22A 3DDCA 1KMQA 1BMFA 4NCHA 2RMKA 2XXAA 2ZETA 2MSEB 3FHCB 3CIOA 2JA1A 2PT7A 4NDZA 1NSTA 1ODFA 1N5LA 4O2LA 4GOXA 4KBFA 4C7OA 2IC5A 1S96A 1SQ5A 1ZM2A 2V7QD 3AVOA 1X8JA 2DWOA 4F91B 3GLIA 1ZC3A 3P32A 4HAXA 4UNPA 3G5UA 1D5CA 2IX3A 2JJ2D 4CT4B 4D0LB 2ZE5A 2CCGA 2GF0A 5HCNA 3I8XA 1G6OA 3K0AA 3G0HA 3TK1A 2GJKA 4TL7A 2FX3A 3VKWA 1Z06A 3NDBB 1CLUA 3A1VA 4CW7A 1E2PA 4Q1FA 5B30A 4FMBB 3WMEA 1UKZA 3PCRB 4LY6A 4M8NE 3THOA 2E87A 3U6KA 4Q00A 2CK3D 2QSZA 4B3XA 3TRFA 4V0NA 3PR1A 3QKUA 2AD5A 3PXGA 4C0LA 3AVWA 4D4LA 2ZEJA 4FMDF 4HATA 1XDBA 2JJ8A 3L0SA 2ORWA 1TF5A 2C8VA 3R7WB 4Q1CA 1ZM9A 5IHPA 2X2FA 2PX3A 3A8TA 4C0HA 2PZEA 4P4SA 2R6AA 1CTQA 3KQUA 3FMFA 5LB2A 3K0SA 1ZBDA 1YVDA 2R6CA 3EASA 1YZQA 2ATVA 4WXRA 4YC7A 3MWLA 1IQPA 2G88A 5TXGA 3ND9A 2VP6A 1NN5A 1LVGA 2LKCA 3VR1A 4IDNA 4XTCS 4Z1MD 4OYHA 3VNUA 2V1XA 1LF0A 2ZI4A 2Z4RA 3GLHE 4A2QA 1KI2A 1WMSA 3V00A 3D8BA 5JLJA 3FTQA 3KKMA 1MRSA 2R65A 1KJYA 2A3RA 1T8UA 2D4HA 3UG6A 4ITRC 3UK6A 2V6IA 1E9SA 3AKYA 1S8FA 2RGAA 3TAHA 1R5OA 1O87A 2RGBA 5BYKA 3LVQE 1ZD9A 3KJIA 1HURA 1KO8A 3AF1A 1KY3A 5HR5A 3AVYA 1XZPA 1XTIA 2QM7A 2QRZA 2X1VA 2AWNA 2V1UA 4AY2A 4ACAA 2FPMA 4C0AC 4EJSC 4UNNA 3DKVA 5DI3B 4JLKA 4F7WA 8OHMA 5KHOC 3IUYA 4NYMQ 1ZINA 5AJYA 2QM8A 5AK0A 1R5BA 4AKEA 3AVVA 4OQFA 5CLQA 4V03A 3SHWA 4QBFA 4M0LA 5DISB 3UKDA 2A5JA 2IXEA 3MWYW 5JWHA 2ZQ5A 4Q7KA 4GL2A 2ZU0C 2RKOA 1EFCA 4RJLA 2BEKA 1YR9A 4JKYA 1KI4A 1WBDA 1XJ0A 2QTHA 4C0JA 4Q1BA 4P0TA 3EA0A 1CEEA 3QOFA 3ZZUA 1YKSA 4URXR 1WQ1R 5JFGA 1GNQA 4QXAA 1VCOA 2XAUA 4URWR 1OJLA 5FPYA 3QQ5A 2QPTA 3TSOA 3K70C 1E9RA 3GLHB 2VSOA 2ZS8A 2OT3B 2G1KA 4PZZA 2AL7A 4Q4HB 1D9XA 2OZEA 4DLRA 2JLVA 4EPRA 4OHWA 1WRBA 5EE9A 5G3ZA 1KOFA 1DAIA 2OLKA 3MJHA 3W8RA 3R20A 2C9CA 1XB2A 2AHOA 1Z2CA 2YWFA 4TL9A 2FFAA 2WOOA 2P5SA 4B2IA 2F7SA 1XEFA 4M4SA 5CDFE 3HWSA 2XEXA 5CM8B 5BN5A 4LYAA 2DY1A 3N2EA 3NC0C 1E0SA 1Z6GA 1X3SA 3SDZA 3WP0A 2DB3A 2B7BA 5AUNB 1U0JA 3FPAA 3A4MA 3LO5A 3P1JA 1H8HD 2ZITA 4GI7A 3T5GA 2VL7A 2QL6A 4FMCB 4GZMA 4B2LA 1ZNZA 2QTFA 3RC8A 3RS4A 1IXRC 1YZLA 5ELXA 2XSZA 3QPUA 4IEEA 3NXSA 4TLAA 4DLXA 2BOVA 3PV0A 4NE2A 2ORIA 3FOZA 1KIMA 2ZRJA 4A8JC 2YV5A 4MGZR 2KE5A 2DVWB 1TU4A 1QHXA 3PJRA 3SYLA 2H8KA 3O8BA 1FFHA 4LDJA 5GJVC 1W0JA 2OBMA 5FTMA 1TNDA 2EU8A 4OJKA 1YHNA 3DVLA 4RZ3A 1OHHA 2J5XA 2WPDD 2ZI9A 4QM6A 2JLUA 1IN5A 1NVVQ 3AF4A 2GCOB 4Q7MB 5EE3A 4AYXA 3I8SA 2WHXA 4OJQA 5JI3E 2ERXA 2RGCA 2YINC 2I1VB 4M9SA 2BCGY 2BC9A 4LSGA 2AWOA 3SJCA 4UJ3A 5LD2B 1FX0A 3LNCA 3ZLJA 4KYUA 3PFIA 2XJ4A 4DLTA 4XWKA 2QUZA 1LF5A 3QXJA 4X8MA 1SXJC 3FMIA 1Q3TA 2ZROA 5K8IA 3RWMB 4GDFA 1W36C 1G3IA 1OFIA 1J8MF 2ZI7A 5C2JB 5H70A 1N5JA 1AK2A 5JRJA 3W5JA 4TQAA 2VP9A 2GK6A 2PEZA 121PA 1ZNWA 4B6FA 2QGNA 2I3BA 1BYUA 5D3QA 5EQTA 1NIPA 1OH7A 1J70A 1W4AA 4DB2A 2W2VA 4TTRA 3AVTA 5AUOB 1LY1A 1U94A 3BJIC 1U0HC 3QJYA 2ECKA 1TF2A 3CNNA 3VR6A 4ABYA 1HE1C 4FWTA 1W47A 1ZIOA 1EGAA 4JLAA 2D2EA 2P6UA 2ZJOA 3QKRA 4S2EA 5FBQB 3GLFA 3UMSA 4BEBA 3AGPA 2O8FA 2Q9CA 4DLSA 3WRYC 4NPHA 1LFDB 3BBPA 2DPXA 3BB3A 4TN1A 1COWA 3EX7C 3TAUA 3T1TA 2WV9A 1KZ7B 4L8GA 4UXIA 4CGZA 1E1RA 4P4UA 3IEVA 4LHVA 1HH4A 2ZUDA 3U5ZB 1S0UA 1KSJA 3I92A 2Q3MA 4LX0A 3U60B 5DYGA 5IK2A 2ODEA 1AGPA 4RCZA 3WHLA 3CR7A 1XD2A 2ZSEA 1JQJC 2FV8A 2ODBA 5FTJA 2PX0A 4PQFA 4B6EA 3ONWA 3WRXC 2XOKD 3ZD7A 4P33A 3Q85A 1X37A 5GJWC 2QORA 2PT5A 1IJFA 5DN6A 4OQMA 2V4ZA 4KFRA 4JLOA 2JJ1D 1YRAA 4GPTA 2YJTD 1RW4A 4LJYA 3X1DA 1II0A 1KK0A 1ZIPA 4BFWA 1DAEA 4ZKEA 1EFRA 4B33A 1VYUA 3IQWA 3L2OB 1KI9A 3M1IA 2IL1A 4UJ5A 4G0NA 3BAFA 5KSYA 1XTQA 3BS4A 1NVWQ 4JBWA 2F43B 4HAZA 4DCSA 1E2FA 2E1RA 4LOAA 3AJIB 3QE0A 4MYTA 1E2NA 3FMOB 1NRJB 2J0UB 2KJQA 3TQFA 3PEYA 3LAWA 2OBLA 3PENA 1FPMA 2C77A 1G17A 4CF7A 4A2WA 2VSFA 3RS5A 2RHMA
chains in the Genus database with same CATH superfamily
5EJEA 1ST2A 2LDBA 4RETA 3FJYA 1XAHA 4Q05A 2REOA 1Z6XA 3RS2A 4ZXPA 10MHA 4NICA 5KOHA 4ZREA 4OQZA 3PC6A 1BDMA 1FK8A 2D3WA 4E2YA 4XM1A 2PUHA 1Q0PA 3DZKA 1GKUB 2R5WA 2FHSA 2BFBB 4NCKA 4HNAA 1CF4A 1A8IA 1Z6ZA 3CNBA 1PL6A 4YJFB 4E6PA 3DTTA 1V5WA 5CNMA 3N86A 3PKZA 1Z18A 1I30A 4Z0PA 5AXAA 1RWWA 3O0TA 3HYSA 1TTQB 1G3UA 2H5LA 3OTWA 1KRXA 1AF7A 4JBXA 3ZWBA 1N6OA 3RASA 4ZAXA 3SC3A 1UEIA 3NWOA 2FKAA 3AM4A 2A9RA 5DM0A 1WABA 3LG2A 2N3ZA 4Q66C 1JQDA 4F93B 5D7BA 4GBGA 2IELA 1SBHA 2I4RA 3GCWA 2RB5A 4B6QA 4DBLE 1MORA 2Z5LA 4H1VA 1MX9A 2YY7A 3QELB 4PBRA 4AQYB 4CODB 2X0DA 4B2PA 2JIQA 1ADGA 5KPTA 1NXOA 2O4CA 4BEVA 1T4BA 1E0AA 4ES6A 5M29A 1ZXXA 4YUWA 4GVLA 1J8FA 7ADHA 4OK5A 2CXPA 3R7AA 3OE1A 3ZV4A 4Y2SA 5J47A 3GZNB 4BLWA 4UHEA 2DAKA 3SICE 2BM0A 4QVKA 4YT8A 4DHEA 5HGXA 1J8YF 2KMLA 3T5MA 2ZTLA 1RYZA 3GLIE 3FKEA 1DJOA 3MCWA 2O2EA 2IS4A 2CY0A 4OUKX 1KMMA 2WAAA 4C6RA 2GPSA 1XHLA 2PUWA 3VAYA 3GLSA 2QUKA 4KQHA 1NVFA 2COEA 2C88A 1SXGA 5KB3A 4B74A 3Q3GE 5EIAA 4JYAM 4IDPA 4LXTA 2WP0A 4LIPD 3AG6A 4RQUA 2QMEA 3ORRA 2C2OA 4G0ZA 3KPYA 2FAXA 1G2QA 3WAGA 5CPBA 1ZN9A 1LRJA 3TMKA 3QYPA 1E9BA 1DL5A 4G5HA 3SSMA 2YZ2A 3K0AB 3ONDA 1JDZA 4EIWA 4TYPA 4DR6B 2FK8A 1MRZA 2O8DA 2QM3A 3LXUX 4HF7A 4DKJA 4L15A 4OI4A 4EI7A 2FMFA 2P65A 2CWWA 5ITXA 2G1JA 4E30A 1VSQA 3TO5A 4OW0A 5H4GA 1IQRA 1A72A 1UBEA 2JLRA 2J3JA 5INTA 8ADHA 1GA4A 4N49A 3FFXA 2Q3JA 2A3NA 4BECA 3TLYA 3FFWA 3SHVA 1J00A 1YQ9A 3QX3A 4UEWA 3C97A 3ICWA 4OSPA 2BRUC 4I1VA 1C7RA 3ENWA 8LDHA 1HNZM 1AHHA 2GA9A 5AH0A 4XSGA 4YCNA 1UMDA 1FRFS 1AUVA 1PLLA 1BHO1 4W8GA 4PQEA 1SXIA 4V0LA 3LQ4A 4D6YA 3C6ZA 3CMCO 5B6PA 1L7OA 4I7EA 3S81A 1PWEA 5LA6F 1N9ZA 4J0GA 1K89A 4PCZA 5ER6A 4FNGA 1W5AA 4RPJA 3D7NA 3C6QA 3CZRA 3AC0A 4DJAA 5LP1A 3M4XA 4L9SA 3ET4A 5KJ6A 3THWB 2FUNB 3IAAA 1FTYA 4IBCA 2REQB 5E7IA 1QQTA 3W0LB 3JQDA 3CZ5A 2F9MA 2DH6A 1FNBA 4MRRA 2ZR7A 3TJRA 4BUJA 3JD1A 3DE0X 3DTNA 1S7GA 3RVBA 1ETUA 4F6RA 4LI0A 3UYKA 4DV4B 3G7SA 2XDYA 4EG0A 4CDRA 2YJGA 3D6HA 2WJPA 2OCBA 2HEIA 2FJ0A 4POOA 1WR8A 4MV9A 3VDPA 2UZ3A 5KWSA 1SXQA 2N1BA 4E70A 4QYIB 1Q3BA 1WZIA 3K6JA 2PV0A 1RAFA 4OI1A 4NH0A 4LHYA 1B74A 4O8CA 4IKOA 3VU1A 3W7AA 3MJCA 3TPFA 1K06A 1FUKA 4IBFA 2D1FA 1PRBA 3RT7A 5ITTA 3T3EA 3ND7A 3AUUA 3R3VA 4KGXA 2VP5A 1U2ZA 2OV3A 5A0VA 3CB2A 3DLTA 5LPNA 2N47A 5IJZA 1W88A 5JXHA 3W3AA 4UM7A 1UF9A 4BO2A 2Z6QA 1P7WA 2VAWA 3CVJA 1WOMA 1FQOA 1RWPA 1KE1A 2CMGA 2E21A 4F4DA 3FA2A 4RTNA 4N12A 5IXSA 3B70A 2P0YA 2CXQA 5BV7A 1SBNE 1U2QA 1H5UA 1DBPA 3QFSA 1QIEA 2WF8A 1XKXA 4OX9M 1GZ5A 3B1VA 2BSQA 5BWMA 4ASUA 3NVKI 3Q7TA 4FKMA 2DERA 5L95A 3UJ8A 3B89A 1XZIA 4EPTA 3VNAA 3FYTA 3H8VA 2CDCA 2VRNA 2IYXA 3KQPA 5FOVA 3L29A 4QQRA 4UTOA 1OFUX 3EXAA 3HC7A 1DEOA 1EUZA 4UM5A 4R7GA 3NIGB 2WYWA 3CISA 3VJMA 3FMGA 3THYB 4N5MA 1ZVKA 1NTRA 2OXFA 5AVYA 4Y7CA 3UK2A 4XFDA 4OYRA 2O7VA 3ZWMA 1YDEA 2J46A 4N7JA 3ZQKA 5IM5A 1BQ4A 5B64A 1AD2A 1LS1A 4B8ZA 4NX2A 3HJ8A 1IL0A 4G36A 5IZCA 4MB0A 4CGYA 2ZBEA 3RODA 1I14A 1NR5A 3R23A 3GQ3A 1PBNA 3HJNA 3LDHA 4XB2A 1XELA 3JD3A 4JT4A 1SFRA 3GDFA 3P9IA 3U31A 3GHHA 3A6JA 3K09A 3R9XA 1RXVA 3WB2A 1E5LA 1N6RA 5D00A 5CLLA 3BWYA 1I3NA 3NRJA 4DJEC 3NJ4A 2D7JA 1XMXA 1OXVA 4B3SB 4F04A 2ILTA 4NOMA 5AW3A 1N3BA 3NV7A 3MJ5A 3KTAB 3O0DA 4F06A 4K6CA 3V33A 4IHAA 4AM8A 1UJMA 4JI3B 5F12A 3TNJA 2XUJA 1EFPA 4O2BA 4RFVA 4ZYWA 5LBIA 3PGKA 3RUIA 4N1AA 3VSCA 3N7TA 5LXTA 3ZE6A 2HK6A 4AU1A 4L5BA 1KPGA 3UJBA 3IDOA 1BKYA 5IZ7D 4XWYA 5JVDF 2B4YA 4PTZA 1V7QA 1ZOIA 4Z86A 2VHUA 3E5MA 2XGJA 3I72A 3KPWA 3ABSB 3EVBA 5KYXB 1XDSA 2P2LA 3TAXA 5F9HA 3W5DA 3KXLA 1QVWA 3LC0A 4HS4A 4C0BA 4JUBA 3S55A 2XZLA 4GGPA 5LQRA 5IAGA 1U9CA 3EMBA 3FGZA 2HTEA 1AJEA 1M1NA 3M5PA 4MJXA 4DSNA 1O03A 2ZSKA 3IILA 4U9UA 4NQRA 1ICEA 2X1HA 3DE5X 3RE8A 2C4HA 3SQXA 4CEJA 1K9SA 4LZOA 1RRVA 1SVSA 4KRYA 3S5JA 4TROA 2X5XA 2FE4A 3DYVA 3RYCB 1OTXA 2QSUA 4ZA2A 1NN1A 3L93A 4HAYA 1ENZA 4P5PA 3O3CA 3FFAA 5LJLA 2JPDA 1RCTE 3GRUA 1NDQA 3B7NA 3U2QA 4QPDA 4RSRA 4B3FX 4QASA 3FSJX 2DMRA 4ZC8A 1JSCA 4L08A 3GNQA 3FDFA 5JEEA 3HHEA 3I4FA 4PCVA 3GCZA 3HNPA 4CV0A 4WY2A 4C7KA 3U7HB 2AZTA 1KEUA 4JGIA 1PW5A 4OP2A 1FYXA 4AKSA 5J4HA 4FWDA 3A1SA 4ND6A 3D8TA 5CLGA 1AQUA 5F2OA 3RH0A 3T15A 1ODIA 3MGGA 2CHUA 2MOKA 4JP8A 4C21A 4DSTA 1EE1A 3VR3A 1M7HA 5JPDA 4FQ7A 2G4CA 2FFJA 1HSZA 4R1MA 4B6PA 2XADA 1ZN8A 1KAMA 1U3DA 1LS6A 4Q7JB 4R8VA 3VOSA 1QH0A 5F3DA 1UADA 3EHDA 3SZUA 3MD0A 2CGEA 1EDBA 2NQ2C 2I3ZA 2JLAA 5P8WA 1JR3A 2I4OA 1GGEA 3KJZA 1YO6A 4L76A 4JWKA 3RI3A 2I2XB 1C29B 4C22A 4P3OA 3V42A 1WAMA 3TTTA 4ZO4A 4G1VA 4ZIRA 2F3PA 1P4AA 4X64M 1FXSA 4EWLA 5AJXA 2VJPA 5KHLB 2R6FA 4TV8B 2OCAA 5ESRA 1T2FA 1SA0B 3ZNPA 3R7SA 4YT5A 3LBHA 3LX5A 4N8EA 4DLWA 5TIIA 3IVXA 2C5EA 4GLOA 3J81k 3TNLA 5FA8A 2WVHA 3GPIA 2Y76A 3KDSE 1FFYA 5TS3A 1QC5A 1YB5A 3BD9A 3O4GA 4YHHM 1H05A 4BDTA 1NW6A 3UMJA 1Q7EA 1VFPA 1VB5A 5CIYA 1R66A 1E7WA 4ZZIA 5GZ6A 4B46A 2BEVB 4KAJA 2HA7A 1TM7E 2QLLA 3PPXA 5JAHA 3DMDA 3BFXA 2OC9A 5ICGA 4EOGA 4MZDA 2V4UA 1ADYA 3RHSA 3AF5A 2YWHA 2WD7B 1OLXB 5C7IO 3EOBI 5TGZA 1E3EA 2VZLA 2P3LA 4D4MA 4WY5A 3GR6A 5KWIA 4RZHA 5CDHA 4E3WA 4GKBA 5BSGA 1J9GA 5HUJA 4TMFA 3QLUA 2Q9AA 1AOXA 2VRCD 3KOXA 5IJ0A 4PRLA 3K09C 4MSUA 5AM0A 1T35A 1T5IA 4MVJE 3O8CA 4H17A 2ZCUA 5EINA 5LUAA 1X86B 2LRHA 3EVEA 2K2QB 3GMTA 2NVOA 6Q21A 1XTVA 3W9SA 4AJJA 4HLDA 3VC7A 1L5ZA 3VYVA 2IHBA 5ELLA 4JXKA 1R0CA 1TC2A 3RFTA 1MT0A 4YRZA 3MUFA 4LXQA 2V6FA 4TL6A 3E9QA 2MYTA 1RS0A 3K16A 4LFAB 1W0JD 2DAMA 2C4VA 4WOCA 4QICA 2A0YA 1PF7E 4M1SA 3OZAA 1L4YA 1PBTA 2ZYIA 1UBRS 1GPMA 4JHLA 4U3JB 4Q4AB 1E1QA 3RV3A 2QAJA 1IY2A 4W9MC 1UKEA 5C8YA 1GABA 4TYWA 1C4WA 1A50B 4AJ2A 3UOWA 5IPFA 2VO1A 5EIFA 2GPTA 2RGWA 5CVCA 3PC4A 4LRSB 1N0IA 3TSWA 2QD3A 3ESYA 4D5GA 4FHZA 3U4CA 2V98A 1FJGB 2QLFA 5E8JA 9ABPA 1T2EA 4UVIA 4WNAB 2G83A 3WL5A 4QVGA 4H18A 1H9CA 2XI4A 4DMKA 4HWRA 2NVUA 3CXUA 3N2GB 4RF5A 2AVNA 3OEEA 4YUAA 4LC9A 1R0SA 221PA 2F3TA 1ZC4A 4ARIA 2YQ4A 1GSOA 4QXQA 2WJ6A 4RD3A 3ML1A 2Y1FA 1DO2A 2JEOA 4NMMA 2FWRA 2E4WA 2ZVQX 4AULA 1YB1A 1BQ3A 5E6UB 2YRWA 4RHXA 1YULA 4IEIA 2A30A 3W06A 3GOQA 2LP4Y 5TMPA 1YUMA 3QWFA 3LFTA 3DHYA 5B3JC 3ME5A 2BEUA 1GTZA 1H3FA 2RARA 4GOKA 4I2VA 4CZ2A 4R9UC 3SY8A 3OPXA 1T9KA 4D57A 3EXEB 3GNTA 5BNIA 4QYMA 2QLMA 3WYBA 1YB2A 1E1QD 2NTEA 1Q6YA 2Y9MB 5EMKA 1ZW6A 4NU0A 5EN4A 2WKPA 5JWOA 3CEHA 3A6FA 2DAGA 1YR2A 1SD5A 1S3GA 4PQYA 1XRMA 4D82A 1XWWA 1QO9A 4BX8A 1EUCB 1TIKA 2EYUA 3MOIA 1F7VA 1C9NA 2EHDA 5BWBA 1WVGA 1PZXA 1RI4A 2QY9A 5ENVA 4XQGA 4N54A 2W9XA 5C0OE 5BP7A 4GQBA 4ER7A 4UHKA 4LF8B 2XXAA 1XZBA 5K99A 2IE0A 4QDJA 2H1SA 3JAWA 3GVHA 4CU2A 1UWVA 5HKBA 1ZEJA 1VLZA 3RFUA 1Q5PA 1U2DA 3NDBB 3M1AA 3Q6NA 1EZZA 2VTBA 1CF9A 1CVIA 2AI3A 3QKUA 1RABA 4DNQA 5LC1A 3ASVA 4X95A 1U6JA 1BA3A 3H04A 5F5LA 5JLAA 4WXRA 4UASA 1XV5A 5EGNA 4MAMA 2XVAA 4UARA 4EMBA 2QJTA 2PH5A 3BWEA 1WMSA 3N8KA 3V00A 1GNSA 3KKMA 1HXHA 3OJWA 5L8RF 1LW6E 3X3HA 4O2AA 3HDHA 1KR5A 4X7RA 1HURA 3LP8A 4ACAA 2FPMA 2O59A 3HBFA 4FYIA 4ZRNA 3I83A 1UK8A 3HBMA 3JQGB 4GGOA 5JWHA 5CDTA 3R1IA 3KSDO 2XNCA 4EG7A 2IU3A 5EWLA 1E1LA 1C7QA 3HS3A 3EEOA 2OT3B 1GG8A 4Q4HB 1A98A 2OZEA 3IHPA 3SKXA 3HKEB 4OHWA 5G3ZA 1JU9A 1YDHA 3TZBA 1ZRNA 2K87A 1VG5A 3F4LA 2XXBA 2XUGA 5EZQA 4LYAA 1S8AA 2OD7A 4L4SA 2RK4A 2BUCA 2VHWA 3NDJA 1U0JA 2ZJ0A 1E3QA 2AZMA 1GRCA 1IBSA 2XSZA 1KIMA 2QG9A 5GJVC 3HB7A 4Q34A 2JLUA 3AF4A 4B9EA 3BILA 2O05A 3JCZA 4S3MA 3HFJA 2BWEA 1MHTA 3H83A 4R8MA 1EVLA 3MQ2A 4W4TA 3KKLA 4QDXA 1Q77A 5H70A 1VEKA 1FYEA 4HEA6 3JVDA 2JIOA 2QGNA 1N1MA 2JBAB 3O74A 1N7IA 2PTGA 2ECKA 1W73A 3PS9A 3NTVA 4DR2M 3G23A 5EPUA 5GINE 3TAUA 2J09A 1SIWA 2WV9A 1U8UA 1E1RA 1FSZA 1Z5AA 1Y5IA 5EJ7A 5DYGA 1JA9A 3BTVA 4OHPA 2YH2A 2C2YA 3I6MA 3SIRA 1PG0A 1DRUA 5JAIA 1KI9A 4Q39A 2IXBA 3JQAB 4IJKA 2G06A 1J24A 1MENA 4MYTA 1H4QA 3P45A 5JYBA 3OEYA 1N32M 1Y3FE 4CV1A 1QAQA 1ETHA 4X41A 3F6PA 4PYMA 2ZW9A 1U0RA 1FVFA 4FCVA 3SYMA 4XX0B 2AXQA 5T4HA 5D3KA 5CLHA 1P7ZA 3DG9A 1FW8A 1MLDA 5GM2A 4PM4A 4ZZ2A 3VI3B 4BKMA 2QAGC 3V8BA 1C5KA 1ML3A 4FJ2A 4WLOA 4TT3A 3P9KA 3PFGA 6REQB 1T5OA 1XPUA 4HMPA 1U8YA 2WMDA 3KQWA 4YNBA 2ZRIA 4TV9B 3L43A 4ARZB 2NO9A 4DL9A 3UN1A 5TVKA 4PHGA 1USKA 2QSFX 5E3HA 2W48A 3EUWA 4B7GA 3CTMA 1GFZA 4LF6B 4CIZA 4B4UA 1XO1A 5NULA 4S05A 1EVIA 5CURA 1FP2A 4WI1A 3VU9A 3UC9A 4RPKA 2PUBA 2WM2A 2IXDA 3ZV7A 2R96A 1UOOA 3A1WA 1N7HA 1GNPA 3V8PA 1UZMA 1KYVA 3COVA 4NY1A 4CQMA 2R18A 5CEFA 3HB0A 4AG5A 1EI9A 3NDRA 1O57A 3R8FA 4TL8A 3D4IA 3A98B 3W9UA 4FI3C 3TL2A 4GR4A 4KQKA 4CKWB 1OFGA 1SUPA 4U7DA 5SYAA 3NM6B 4TKVB 4PRYA 4ETMA 3NCTA 1RKUA 2AR7A 4HLUA 4EHKA 2O06A 1QHNA 2P3SA 3SLKA 1HL3A 1SIUA 2O2DA 1NQ5A 1U2RA 2PA0A 3F67A 3AHIA 3PC8A 2C7GA 1GILA 4S1TA 1SHJA 2PMDA 2DX7A 1RKVA 5FXMA 2QNRA 3CCBA 1S3SA 3NW9A 2DAPA 4TT3D 2UYCA 1X9IA 1W4BA 1SXPA 3Q7RA 4QU8A 2ZSDA 3RRZA 2CP8A 4GITA 4MKGA 2ZJ3A 1VJRA 2J48A 3BXXA 3OE7D 1YC5A 4DT1B 1G5TA 1T2DA 5I8WA 3K5WA 3MB5A 4KLAA 4OD0A 3LLMA 3AEZA 4I3FA 5G0VA 4YPFA 1Z4IA 1EAYA 3FVVA 2WM9B 3L0CA 4X6XA 4RMGA 2FJUA 5ALZA 3PEWA 1ODCA 4LWPA 1V1RB 1UXIA 4EMSA 4M22A 2W6QA 1D0VA 4ER3A 1OA0A 1UFQA 1QB8A 1WCIA 3H4VA 4YCBA 1GNLA 4XWTA 5F2EA 1I4WA 4PC7A 3GXBA 2I7CA 1XVAA 3JATA 2HRRA 3F92A 1ZJZA 3EARA 4ED9A 4BGVA 3AJAA 4WEQA 3SZOA 3H86A 3AOEC 4AVYA 2HRBA 1C2YA 5FPQA 4K8RB 1N5MA 3AEQA 3E8MA 2IYLD 1WDMA 4P6VF 3AUKA 2AZXA 4P08A 1PNTA 2P7IA 3ISTA 4F4IA 3BE5A 1WNTA 1P3Y1 3T5TA 4EG8A 1SKMA 4DJDC 1VCMA 2HGSA 1S6YA 2CDBA 4MDEA 4NG4A 1E2KA 2QWXA 3RSOA 1HEUA 4OLHA 2WW8A 4MQEB 4BNYA 2FG5A 4HQOA 3VTFA 4HI0E 4TLCA 2O2YA 4DTCA 3EN0A 3GWGA 4Z0TA 2GF9A 2AKAB 1U8FO 3FNQA 4NENB 4X1KB 5AKJA 5E6JA 4DCVA 3NHRA 1GVNA 5TB5A 4P16A 3U7RA 1JHRA 1QIKA 2WF5A 4AXBA 2G3QA 4UEOA 4HXFB 3A0RB 2UVPA 1LPSA 2CKDA 2J9GA 1GT91 5E6RB 3H5WA 4AW9A 1GL9B 2EERA 3OOWA 3NH9A 1M75A 1LLDA 4X93A 1U0TA 3F5SA 2GTPA 1S1CA 5GONB 2CZCA 5JRZA 3PD0A 1JQLB 1JWAB 1DTWA 1J20A 4JIGA 4KJZA 4MTLA 4DG8A 1DEXA 3PYMA 4M53A 2H6EA 1T2VA 2ZBFA 3AF0A 3TL3A 5JNLA 1U0LA 5EIHA 4R9NA 3LPMA 4HDKB 5CIWA 4YS6A 2F1RA 3SYRA 2HXYA 3OLYA 3ZV3A 4I1UA 3DUWA 2H2DA 4A5SA 3ZD9A 1DIHA 4DMRA 1KFEB 4H7EA 1QONA 2JLCA 1NOIA 1OXBB 1MX3A 3OU7A 1XKLA 3EH2A 4C14A 1KKUA 5U1PA 4LY0A 2PZGA 4D81A 1C9DB 1MT3A 1NW7A 4G5FA 3RVNA 3VZCA 1G7SA 2AI2A 1GZ4A 1L7QA 1D8TA 3GPPA 2GZDA 1K27A 3LHIA 1EXMA 4QAQA 5F7OA 1G6KA 2ZI3A 4HZUA 2Y05A 3VDNB 1T1RA 4Y0VA 5DBEX 3CNQS 5CX1B 2DFPA 1J90A 1IJEA 2H48A 4XK8F 1X74A 4ZEWA 3CPSA 2RHOA 1CXZA 5D87A 4L85A 3IP6A 3GGPA 5JJLA 1K4YA 1DADA 1PX2A 1XTUA 3LPNA 4NEGA 3OHSX 3FYUC 1F20A 4EARA 2PS1A 5E9QA 3DOOA 3D3WA 4TWBA 2HEGA 1MGPA 1CUAA 5C46F 2ZYWX 1GTL1 1DELA 2PVSA 1X7XB 5CCBA 4M1MA 3NYQA 3ZE1B 3DDSA 2IP1A 4MEBA 4AZ0A 1S4MA 3T5BA 4TSFD 5HHTA 1I7PA 2XV1A 1TJ5A 1VC2A 4EGSA 3HVJA 5LWQA 1ZVJA 1M6YA 3FUXA 4KUEA 5KTSA 3SBXA 2ZS7A 1K5GA 1A9OA 1SK9A 3FYDA 2N35A 3I23A 1HTWA 2NZ2A 4V3CA 1Q22A 3RIGA 5LYYA 3ZV6A 1QK4A 4NJEB 3DZFA 4B87A 3ZVNA 2R0QC 1K6MA 3U5TA 4U5XA 1KETA 2ZIVB 2ZQYA 3L4JA 4NSOB 3IHTA 5JD6A 2FJPA 3U5ZA 1N3IA 4CLXA 2AEMA 4NKRA 1JS1X 3SGLA 3HEMA 3CNEA 3ILYA 2I6SA 4FXPA 2O3TA 3SAWA 2OK8A 4HDRB 1E0DA 1YZGA 3T5DA 4IX1A 5ALIA 2F1JA 3ONVA 5FNVA 3FSGA 4ME6A 4EABA 4U2GA 1YE3A 3CZ9A 5E1OA 5CAEA 2ZE7A 1C3OA 4ZVTA 2WILA 1E3SA 2GOYA 3AILA 4YJ2B 1P1BA 3ITNA 1F2UB 2D62A 3C3YA 1JWLA 4MJ3A 2GT1A 2E4VA 1XQVA 5DCLA 4CTMA 4Y2PA 4L2IA 2I6XA 3I9KA 5KUTA 1PK7A 1JG4A 4R4JA 2HT1A 1NVVR 1ZMVA 2ZATA 3JQEA 1LBIA 3O75A 5SY9A 4PO9A 1J9EA 4X24A 3DOAA 2WD8A 3PDWA 3U7GA 2PSJA 2H00A 5IBPA 1KERA 2NQ8A 5DLQC 1NNUA 4AJOA 3W5HA 3S8MA 5FL3A 4FD2A 2GJ8A 1CIVA 3W2HA 2SCUB 1K3WA 2RHDA 3CO5A 2CL0X 1QLWA 3E9EA 3F7NA 4CKBB 2V4MA 2FRVA 1YZTA 2NXEA 5KYNA 1KGSA 2IYSA 3LKDA 2H9AA 2UV8A 3U81A 1RQ7A 1Q3KA 3ELBA 5JECA 4BX3A 5EUMA 4FUQA 1M8JA 3PR3A 4U7GA 3KX2A 3Q3VA 2GEDA 1QHHB 1DBVO 3OJXA 1JHYA 4UATA 1KVSA 3ZH9B 3I2HA 4AX4A 1WIWA 3HYLA 3WQQA 4HXYA 4EQZA 1BAPA 4BP3A 4ZTUB 5BOSA 1Y42X 1MO2A 4YRMA 1BD4A 1M7BA 2HAKA 3RREA 4U0KA 4BQFA 3C4VA 3DE1X 3C9PA 2RCYA 2G9ZA 2WKWA 2O8EA 4C2TA 4CKEA 4FN4A 1JEQA 1RXUA 2PJZA 4LDPA 5BMVA 4PYNA 3GJ6A 1MBZA 3UJPA 5EE0A 2ZB4A 3KG2A 4BPRA 2W43A 3HCEA 2B8JA 2VEDA 4FFBA 4AZTA 2NZXA 4K6FA 2BH9A 5CXXA 3HJHA 4KMRA 4MKXA 4XJSA 4G4SO 3RUAA 1KP9A 4C20A 1ECPA 1LDBA 3KDAA 1ODTC 5JE8A 1QVAA 2RHHA 2IY8A 1HLPA 1WG8A 1B41A 3ZE2B 1Q0QA 1L5HB 4C87A 4D1YA 2WT8A 5JROA 2OECA 2JFZA 1R5LA 2WFAA 4D6XA 4HFJA 3IE1A 1G8PA 2HUPA 3PLRA 1XWIA 1VMKA 1ZRHA 1YL7A 3REFA 1J6UA 2BPOA 5HJ2A 1RKXA 4ALKA 3H5VA 2ZWIA 2QUBA 2AKEA 2Y8EA 4LOJA 2GFIA 1YQQA 2F62A 3QF4A 1X15A 2IS6A 2EFYA 4EUFA 3BUSA 4EH1A 4CUJA 1CRLA 2ZWMA 3LDGA 2QMOA 4DUZM 1TMKA 3Q9NA 1KJWA 5FUVA 1FPQA 2XGMA 1X77A 3DTVB 2EGGA 3PNQA 3OA2A 2AI1A 1E7YA 3KOUA 4EA8A 4O4JF 2AUNA 2J9RA 2XJ9A 1RHUA 3WSVA 3LUJA 1KOGA 1P0IA 1VHWA 2PSFA 4UMFA 3L1HA 2P0AA 1RWNA 4MWCA 3CW9A 3OJOA 2R3SA 3IO5A 1AU9A 2ZIXA 2P67A 4QBTA 1MZVA 2Q4TA 3MD9A 1EDZA 1TVMA 1E98A 4BNMA 4B7AA 5AJVB 4EM6A 2HIHA 1GYRA 1OBFO 3ZWCA 3L0BA 1XCOA 3ID6C 2XMGA 4TSKA 3D3KA 2R1VB 4DR1B 1PJBA 1AS3A 5JO0A 2YHBA 2J3HA 3O4RA 3WB1A 4BJ5A 1Y8GA 4UUPA 2RHGB 5A6SB 2VF5X 4F38A 4QEKA 1OXMA 4JI2B 2PJDA 1TYCA 2RBEA 4II3A 1GAQA 3WLMA 1LVHA 3G2IA 1EDOA 2QW8A 1P9RA 4Q1AA 3OU2A 2F8SA 2OP0A 2HN9A 2QTAA 3NOQA 2DLDA 5IHXA 2HA6A 1ZLYA 3Q0IA 2A9OA 4DM4A 5GMOA 1C9JA 1YJQA 3IOEA 1HI9A 2QUAA 1VG9B 4JJEA 1CDEA 1UWCA 3GT7A 5J2TA 4V2UA 4AZVA 1FLAA 1QTQA 1FU4A 1L8AA 1ELOA 5DHRA 2YZMA 5AVRA 4A0SA 1W87A 4WNYA 2FE8A 2XMZA 2OA0A 2G04A 3M9XA 1L4NA 4K9MA 4KRGA 2MINB 1W9HA 1T4GA 1BDIA 1PSZA 4QTTB 4Z1OA 2VDJA 5JAMA 3V7NA 1U98A 2OGZA 3SKVA 2NTJA 5EKSA 4C30A 4UM8B 4O6VA 1WW3A 5FOWA 3D8RA 4DV2M 4RVFA 4MIYA 3ZHBA 4GC9A 1I4TD 4HP8A 3KVVA 3ZG6A 4X84A 1R5JA 2X1LA 2WRZA 2GBFA 3A6LA 5IF3A 3V5NA 2ZJ2A 3FCSB 3PHGA 4WQMA 1ZVMA 1FNNA 4PAOA 4YRAA 5E8RA 4NPCA 3BK1A 3LKVA 2O25A 3L7OA 1J1ZA 1K9VF 2XQVA 4QXMA 2I87A 4RKQA 1AS2A 1E1CB 2PAAA 2EQ5A 5TT1A 1M2NA 2AQKA 2GUGA 2Q1YA 4L51A 1ZMUA 4DSUA 4K88A 4PV7A 1EWQA 4BOYA 5DULA 4MWEA 2YJZA 4QL3A 5FV4A 3BD8A 2DKFA 3I9MA 3O3OB 3WGOA 1Z4PX 3VZQA 2BKVA 3GD5A 4R6WA 2HQ1A 3BD6A 2POQX 4KR7A 1TFUA 4AICA 1QH9A 1E58A 3E48A 5K03A 3NTRA 4GG1A 3K31A 2FFQA 2HU7A 3E2MA 3ZDBA 1OWMA 2EIXA 2WKQA 1U0NA 1LQTA 3TPZA 1GFSA 1EUDB 1IG0A 3MLBA 5AD1A 3PXXA 5CCXA 2W98A 4W1SA 2JKZA 1QTNA 3EZ9A 5A7GA 2YV2A 1LW7A 4KU4A 2HSWA 4PAGA 2Y4OA 3PYLA 1VI2A 3FPHA 2JLBA 1TU3A 5ALEA 3V4ZA 3TLMA 3ZXUB 4AFNA 3IP7A 1B93A 2QJOA 2W2KB 4B7FA 4YRNA 4HPXB 5CYFA 4KQEA 3VZBA 2IYEA 3WJ1A 4RNAA 5IBCA 5K51A 2ADFA 3M2PA 4BFCA 4LBZA 2IRWA 1VJ5A 2R2GA 5EI5A 2QR2A 2Q7OE 3L18A 1DHTA 2AF4C 2L09A 2G76A 1WSDA 4A91A 3G2PA 1ODFA 4O2LA 3GUYA 2GD0A 4FFVA 3IA2A 4F91B 3WE7A 1PJIA 2CCGA 5HCNA 2EJSA 3TK1A 3KLPX 1YONA 4PGHA 5JAUA 5B5SA 1E2PA 3WAKA 1MEEA 2HHCA 4Y2JA 1FMCA 2X8JA 2ZKIA 3VSDA 5AKIA 1DBRA 2QNIA 2RJ3A 1K8XB 4FMDF 4HJRA 4LCJA 1RRMA 1NAHA 4A6EA 4KMOA 5EFOA 4YAUA 4AQDA 4AJLA 2DTEA 1A9XA 4YC7A 1JKFA 1NZDA 4IIJF 2QJWA 1NN5A 4ZK6A 4YFYA 3FIUA 1B42A 3ZPXA 1O0CA 2LV8A 2M1XA 2O2SA 2GPJA 1MRSA 4B4VA 1ID1A 1C2TA 1RPNA 5AOVA 3TAHA 3M82A 1H1TA 1O87A 1IOVA 4UBNA 4G0YA 2WUWE 4U9HS 1RQRA 3SHWA 5ALJA 3QUAA 5KJ1A 3LRXA 3HYNA 3UKDA 4GIPA 2A5JA 3HZZA 2VAXA 2RKOA 1EFCA 2BKLA 1KL7A 4AWBA 2YXPX 3GMDA 5K05A 5DXJA 3GMIA 3D8LA 1D9XA 4L0DA 1KQ3A 1CCWA 1GKLA 1MQ9A 1USGA 3JWEA 3WWDA 5HFNA 4KVFA 1Z37A 1DIOB 2GUWA 3P1JA 4W7HA 4B2LA 4E5NA 5ELXA 4UC0A 1JEYA 1U4SA 3TMAA 4D74A 2PM8A 4MMYB 5LZ7A 4ATNA 2YV5A 3G49A 3B36A 1RP1A 4IDGA 1ZQ1A 2I1VB 2JFGA 5U4QA 4FEEA 2A0FA 5LBUA 4N3BA 1YOVA 1MXFA 3AJ9A 3JWGA 1O6BA 2VAVA 4YMIA 1OZAA 2D8MA 2IBTA 2VDQB 4ZZ3A 1TF2A 1WEHA 3PA6A 4NMWA 1EX9A 4YRRA 3T4XA 3LBFA 3BRSA 2P4UA 4DLBA 4EF5A 2G6TA 3L79A 1NPDA 3HHYA 3D0OA 3PXBA 1W0CA 4LX0A 3DQPA 4RA9B 3A6ZA 1A9TA 5HEKA 2ODEA 4E7PA 3LQKA 3HGQA 3I28A 4YUXA 3QY9A 3TZLA 1ZGGA 3GPDG 1D7OA 4DR4M 4KFRA 1GAXA 4ZKEA 1SCNE 4LF7M 3AJIB 4BVAA 4M9UA 2OBLA 5THXA 4QYTA 3MPUA 4G9BA 1BH2A 1NUQA 2D5AA 3VPBA 5H3LA 4M8SA 1UK7A 4DV5B 2FMUA 3LCRA 5K0TA 2J7KA 5FULA 4BKQA 1QSGA 3PWZA 3L8CA 3T3OA 5TQ2B 2D3TA 5CA1F 3J2PB 3U3JA 2R1TB 4GM1A 1R7RA 1FFCA 4E5YA 1GDTA 3VU0A 1R88A 1L1TA 4QEDA 1I7LA 5GADl 1M0SA 4X60A 2FDCA 3UBMA 3GAMA 3W3AD 5DTRA 5G4KB 3PRJA 1P19A 3S7ZA 1W0KA 4DPMA 2GB4A 5C37A 2YHSA 3RG8A 3Q6IA 3OOHA 1BKSB 4YTEA 4BWFB 5IXYA 5K0NA 3TEJA 4O4LB 2ZUVA 3B1XA 2CFSA 4B34A 3DBHA 1XDDA 3TD9A 3TOVA 3LY8A 3OESA 2OGUA 5GKNA 1UKCA 2CEAA 2EF0A 3RIYA 5EMHA 1N7GA 4OQEA 3GFBA 2OV4A 4ASUD 1ICIA 5JZOA 3CR8A 1EX7A 3ANNA 2GHRA 3RSSA 4QPJC 2AMVA 2EKQA 1Z82A 3JQ6A 1J5XA 1IHPA 3ISJA 4KUGA 4IRMA 3SMVA 4CMEA 4OLBA 1G16A 2CFRA 1KP2A 4CG0A 1E2UA 4EKNB 1SWWA 4B3TM 4IWNA 1W1IA 5A05A 2BMDA 2KBEA 1KHTA 4Q47A 1TM1E 4BRZA 4MUGA 4GBED 3G0OA 1C1XA 3GLIB 1TGVA 4S1NA 1R0YA 1KAQA 3H97A 5A2GA 2VTVA 1HX7A 3OCUA 3G17A 5E4JA 3AIIA 3T9CA 2P3OA 3JAMA 3AF3A 4YP6A 2AX4A 4F1KA 2O7QA 5IFLA 1S01A 3T99A 2CBZA 4YFVA 1DGHA 2H59A 4KO2S 4Q6WA 4QDOA 4KYTA 1NQAO 3S2UA 1Q14A 3NU1A 4V38A 3ZTWA 2OV1A 5EJ9A 1I94B 3VC3A 1BYIA 1ILEA 1E9AA 4M0CA 1CY0A 1RJWA 4ZOCA 3PTLA 2KNAA 1ZUIA 1EG7A 3DA1A 4UE6A 5JSHA 2YMMA 3EW7A 3GLRA 2R4EA 3NTLA 4P86A 3ZJUA 4D8VA 5BVHB 2GA8A 3CBQA 4G5OA 3AESB 4KYVA 3QIAA 5C1OA 3IPRA 5JQGF 2BNKA 4HL6A 3RJMA 2D6FA 5DRYA 3NP7A 2UUOA 4TLMB 2PXAA 4CL0A 5I7UA 2NUAA 2Q5HA 4I9HA 2YFYA 3K0FB 3FMPB 3KTFA 1G9TA 4NBKA 2WU3A 4G0PA 3TZEA 1EFUA 2KNVA 4E13A 3K94A 4S24A 3UJDA 1JECA 3ZH2A 4QXRA 2OR3A 2EZUA 4P82A 2V6GA 3H1FA 2VBGA 4JJ4A 3EY4A 5CXQA 3T0IA 4MS1B 4V1CB 5KZMB 1N36M 3LMMA 4BEWA 1PQUA 4HUTA 3V1YA 3FTNA 3D5TA 5JCOA 1XMQM 4C7MA 3COWA 3TCNA 4UD2A 2XCTB 1PHPA 2ZSFA 3D3NA 4C3ZA 4B71A 1HDZA 1CBUA 1IN6A 4ZVRA 3LVBA 4HSEA 3QVGA 3W7BA 4IY1A 1XJQA 1Y5RA 4WZBA 3REGA 2F1OA 4DA4A 1O96B 3GQVA 2L7HA 4LJ8A 4Q9AA 4QGAA 4NARA 2OK7A 3B9BA 4MIOA 4MYRA 4KR0A 2WIGA 3UAZA 2NO6A 4KOAA 2P0EA 3UT5B 4JROA 3Q0TA 1NM5A 5LMUM 1ZK0A 1YUBA 2JCSA 4YRBA 5IDVA 4AB1A 3TN7A 4IBEA 3HVRA 4UHBA 2C5SA 3GRPA 2JZ1A 1PWXA 1Z4JA 2QM0A 2IY7A 3GIWA 3NEYA 1Q7TA 3W6OA 3K9PA 3LZ6A 4PZYA 4QOGA