4LJ5A

Clpb nbd2 from t. thermophilus in complex with adp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
331
structure length
320
Chain Sequence
MEVTEEDIAEIVSRWTGIPVSKLLEKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
total genus 97
structure length 320
sequence length 331
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj5A01
2A3RA 4YQFA 4KXFB 4IKEA 2BV3A 4HAUA 4HAZA 2RGEA 3ZJYA 5JBQA 4UNSA 2R2AA 1NLYA 3K0CC 2DY1A 5CK5A 5DI3B 1CTQA 1XTKA 2BDTA 5CB8A 1JB1A 2QM7A 3EA0A 2WMOB 3QF4B 3BBPA 1XPOA 2AHOA 2IXEA 3B82A 2X2EA 4B6FA 3AVOA 1WMSA 4M8NE 1E1RA 2J3EA 1WF3A 4AKIA 3OEEA 1KK3A 3PEWA 4L16A 4D2IA 1KO1A 4ZDJA 2HUPA 4YDSA 5LDDC 2BC9A 2KBEA 3EPKA 1VHTA 1XXHB 4OQXA 3WBJA 1CJVC 2IYQA 1JR3D 2ZE5A 4D0GA 2ZI6A 2F3RA 3QSYA 4JVNA 5FUXA 521PA 2R9VA 1R4AA 2PJZA 4RKFA 4YMTA 3D3QA 2ZRKA 5CITA 2V54A 1T9HA 1UBCA 1G7RA 4PQRA 3A58B 4QJ5A 1E79D 1P4SA 2NPIA 3HJNA 4KVGA 4KSBA 1PLLA 2IF0A 2ZYVX 421PA 2RGNA 4OQMA 1S1CA 2ZSBA 2B92A 3F8TA 1EK0A 2DYKA 2WWIA 4D4MA 1YZQA 1G3QA 1NIJA 4JLOA 3DZ8A 3I5XA 2W6ID 3EC1A 3CR8A 3B2EA 3F0TA 4DIDA 1JR3E 4JBWA 1W5SA 5SZKB 4TSFD 1CR4A 1COWA 4BFWA 4F91B 5JSZB 1CF4A 1E2JA 4BEBA 3NKVA 3K70C 3MCAA 3DOFA 1NBMD 4PHGA 4CEHB 4AYXA 4N0DA 4WZ6A 3THOA 1D2NA 1OB2A 3A37A 4LC0A 3A6PC 2QE7A 4V0MA 1XU4A 2ANBA 1HE8B 2O8DB 1ZUIA 1EFUA 2DFKB 2BIFA 3QF7A 1U8AA 3C4JA 1P5ZB 3BB3A 5E7JA 2GJ9A 1G16A 4O25A 1DAKA 2DHRA 3FKSA 4BLTA 4EQ6A 4Q48A 2VSOA 1GSIA 1EFTA 3CF2A 2OESA 3LNCA 4M1OA 1E0AA 3UMRA 1UKVY 1LVGA 1SVWA 2ODEA 1N6HA 1TQ4A 3PR1A 4LY6A 3KUCA 1WCV1 1DBSA 3GLFA 1TAGA 1WE2A 1AGRA 5FBWB 5KOYA 1NBME 1TF5A 2QNRA 4FINA 2IYRA 2FFAA 5HPYB 5HTKA 4C3ZA 3SBDA 2D2FA 3OAAD 3GPLA 4WA7A 1NSTA 2G88A 1VDZA 1AM4D 1ZVQA 4XJXA 4KFUA 4JKYA 1YR8A 1U0JA 3BH0A 4E07A 1JQJC 5BN5A 2CK3A 3VR5A 5CJPA 1NLZA 2JA1A 4G01B 3VLFB 4PXAA 1W7AA 1TQ2A 2OBNA 4QBIA 1ZCBA 1N2CE 4M1YA 2ZSFA 1UFQA 3EG5A 1HUQA 4GOXA 2GAAA 1KSJA 1CJTC 1U8ZA 3B9QA 4B6EA 3AJIB 3AV0B 4HDQB 2ZRNA 3N5CA 3EPHA 1SKYE 2QBYB 3BIFA 1TU3A 1AA9A 4OK3A 2P5SA 4X8MA 1X3SA 4Z8XA 5CIQA 3ZQ6A 3PUVA 1T3SA 3QENA 1KAOA 4DT1A 5KHOC 5FI0B 3A4LA 3K09C 4V03A 4RCZA 4CYMA 4IOMA 1ANKA 2AN9A 2H92A 4KV9A 1XD8A 3AF0A 2GEUA 3H84A 4C7OB 3TBKA 1VYUA 4Q7LA 1G5TA 4NKRA 1FTNA 4M2LA 1P9RA 1G5RA 3L0OA 2XOKA 3CX8A 1SQ5A 1GAJA 2VHJA 2EFDB 4C0HA 1KI1A 1EX7A 2HLDA 4MRSA 3H2YA 4I1VA 4LGMA 1VIYA 1E0SA 2IUTA 1CP2A 2GETA 4Q4HA 1XMJA 3U6KA 4HB3A 4LCBA 1KO8A 3I32A 4IDPA 4MGYR 3VX3A 1E2LA 4YC7A 2HT1A 2RKOA 3SHFA 1YE8A 2H16A 5C4GB 4M1MA 3UG7A 3KQHA 5E4FA 2REOA 3UANA 1ZCAA 3BWDD 4LRWA 3W8RA 3AKCA 5J4HA 3GEHA 4I81A 1KKLA 1A7JA 4DB2A 4IEEA 3KQLA 2PEYA 2ONJA 8OHMA 4LYAA 1T5IA 2NO7A 4Q4JB 1ZNZA 1LTQA 4TL9A 5FL7D 1IBRA 4A0GA 3OHMA 5IRCD 3CLVA 4WAUA 3AF2A 2O8FA 4FCWA 5AK0A 3R7WB 2IXGA 1KSHA 2MSEB 1GNQA 4KBGA 1D9XA 5FBVB 1NN3A 2GAOA 1GVNB 2JLQA 1VYTA 4JVMA 3SOPA 3CM0A 3QXSA 1IN7A 3SZRA 1GITA 1KIMA 2CJWB 1X6VA 4DLVA 3LBHA 4UQOA 5CYPA 2IUUA 3A4MA 4MGKR 2BBOA 4B35A 1E1RD 4L15A 1E1QD 1IJEA 5JWHA 3OEED 5EP4A 4PQYA 1MO6A 3HPQA 4R9UC 1N6OA 5AJYA 5DH9A 1X8LA 4QG7A 2PX0A 2QRZA 2RB4A 5DYIA 1W0KA 5BYJA 3T1VA 4BFZA 1SVLA 5BW8A 5JJLA 4LRSA 2CCKA 4G5OA 2IYVA 4IXNA 1F5NA 2F3TA 1BKDR 1N25A 2NOAA 2WICA 1XMIA 3RS5A 2H57A 1II0A 1UEJA 2CEAA 4WOPA 3FMPB 2QZ4A 1VCNA 4TTRA 2W2TA 1K5GA 4OK6A 1KHTA 4YMSA 1KNQA 3GFOA 3CH5A 3OESA 1EG7A 5AJZA 3UMFA 3PEYA 2HJVA 1XCGB 4QJ3A 2ZROA 3RSOA 1I2MA 1JALA 2OFXA 3V00A 2HXSA 1B23P 4G5QA 4P31A 2VPPA 2ZETA 3DZDA 3C8UA 4EPWA 5BWMA 1COWD 4NYMR 1M8PA 3TGPA 1OYWA 2OFWA 2D74A 3CF0A 1QHYA 2ZRFA 1Q44A 2WVJA 2Q9AA 3SNHA 3DO6A 2QE7D 4CZ2A 2ZRJA 5DNYB 2WKRA 1ZNWA 1KAGA 4JJZA 4PC6A 4PO9A 1G4AE 4Q19A 2Q0HA 3MRSA 2VTKA 4A92A 1G18A 3ZDQA 3L43A 4Q18A 1T4GA 3RWOA 2CXXA 1U94A 3FKSD 1G3UA 2DVWB 3FHCB 3THYA 1LB1B 2NO1A 5E95A 4ZCMA 3TSZA 1G8HA 1OFHA 3KB1A 3KL4A 3ZYCA 4TYYA 3RS7A 3FKQA 4B76A 2O8BB 5JHGB 5TARA 4CVNA 2Q6TA 3NWJA 1NLFA 2W83A 4C0QC 3Q7QA 1GFIA 2GF9A 2WZQA 4H1VA 4BPBA 4A8JA 3EPJA 3U7EB 1HY3A 4HDCA 4JLDA 4PPQA 2GVDC 1TU4A 1KDTA 221PA 3DKVA 1ONBA 4YMVA 2JJ8A 3K0SA 1ZW6A 4JBXA 1S9HA 1Z2AA 2AKYA 1ZM4A 3T5DA 4EUNA 1GP2A 1RJ9A 3CPEA 1E98A 2CK3D 2F43A 1HE1C 1WP9A 3CZQA 4M4SA 2BEJA 4C0JA 2ZI4A 1E9RA 4QHTA 2WIAA 3C41J 1A2BA 4DUGA 4DDVA 5FPKA 3PJRA 1GKIA 1KO5A 2AL7A 1Z47A 2J0SA 2B8TA 1ZD1A 1RVDA 3AUXA 1KJZA 2JEOA 3LLUA 2A7QA 2BHRA 3QIAA 4GRAA 4XSGA 3SEAA 2HYIC 4G0NA 2FEMA 2N1BA 4CEJB 3IGFA 2WSSA 3GLFE 4OI0A 3R9WA 1KI8A 2EWVA 3IPYA 2C99A 2BBSA 3RABA 2FH5B 2DPXA 2QMOA 2FG5A 3FMIA 4QHYA 3FWYA 2O8EA 1E9DA 3MJRA 4MA4A 3R8FA 2CL7X 5H8WA 1YRAA 4QBGB 1IY1A 4Q9KA 4QOSA 2WPDA 2C2HA 1P2SA 2QQEA 2F6RA 4HUTA 5J4LA 2XOKD 1OFUX 1L7VC 4MGZR 4PO8A 4Q7JB 4NONA 1G8FA 1O87A 1H8EA 2ZJ8A 1GTVA 2W0MA 4AKGA 3X1XA 1SZPA 2HLDD 1P9NA 3SHWA 4BZQA 4PPGA 1MH1A 1IY0A 4ITRC 2O0HA 4UKDA 3TKLA 2ZREA 4DCUA 2ZSAA 1OH7A 2VP9A 1OH6A 3C14C 3GEIA 2RGXA 2CHVA 4LJ5A 2WBLC 3KFXA 1CJKC 2R8RA 1Q3HA 1W4AA 4NMMA 1G7CA 1C4OA 3C16C 1ZD8A 2YV5A 1FZQA 1QHHA 3Q8XB 2NPFA 3EIHA 3GLHB 4A9AA 1D2MA 2OXCA 4JT2A 4JLAA 1QBKC 1YZNA 1G3RA 1H65A 4EKDA 3CRRA 2ZJAA 4LV5B 3B1WA 3VMFA 1R5BA 1ZNXA 1OB5A 4URZR 1R0ZA 2HCJB 2NG1A 4HYYA 2ZS8A 1HQYE 2ZEJA 1ESNA 1Q0UA 5KNCA 1A5TA 1QG4A 1TMKA 1F2UA 1ZJ6A 5AJVB 821PA 4GL2A 2W2VA 3ZGXA 5C2JB 3GJXC 4W9MC 4BGDA 4C0KA 1SHKA 1FMJA 1XTRA 3RHFA 2IHBA 1S1MA 2R65A 1UKZA 3K0AB 3WXMA 1NN0A 3HR8A 5SZHB 3WNBA 4JN6A 3K0FA 4AWXA 4BUJA 1DAGA 2VQSA 4BLPA 2UZIR 5EZ5A 2QRNA 5HZKA 2XJ4A 2WV9A 2IT1A 4HZUB 5L3SA 1A82A 3EWAA 5UKDA 1W0KD 1TADA 3Q5DA 1NN1A 4PAMA 4Q7KA 1SVOA 4JZKA 4G5RA 3TSWA 1G9XA 4L8GA 3KXKA 1NKTA 1VYVA 4BFSA 2GK6A 2A2ZA 2QG6A 1XRJA 1XF9A 5JZVA 3PIRA 4XOIA 2OAP1 3BS4A 3SYLA 2IEZA 5EZ6B 2C95A 2MSDB 2G1KA 1RRFA 1P2VA 2VYFA 2WTUA 2OXRA 3RRMA 2XSZA 1PUJA 5DI9A 2PZEA 1E32A 4OL0A 2ZRIA 2QAGC 4NBSA 4GITA 1E2GA 5TV2A 4ZI2A 1JAIA 2J9RA 2MMGA 3AVXA 1KO7A 5EP1A 4LBVA 4AKEA 4URYR 4OHWA 5KU1A 5EP2A 1MO5A 3K1JA 1XBTA 4MKIA 3GLGE 2Q3FA 3F3YA 1E9CA 3I8SA 2R6DA 5TMPA 4IEIA 3VU9A 3U4QA 2J87A 2ASEA 3SQXA 5J4VA 3GJ7A 2J59A 1G20E 1D6JA 1BH2A 3FFAA 3BXZA 3A1VA 3JZAA 1QDEA 5LPNA 4NE2A 1W48A 4OJQA 3MWLA 4NHOA 2O0JA 3GFPA 4IDQA 4RZ2A 4EJSA 1F60A 4JMPA 4ON9A 1U9IC 1IQPA 3N2IA 1OXUA 2YKGA 2V6JA 3GLHE 2AWOA 4Z1MA 1E0KA 1P61B 1ZBDA 4N0EA 2VL7A 4A15A 2MMCA 2CLCX 2H7VA 1GWNA 3B9PA 2QL6A 4PC2A 2LKCA 3ASYA 2DFLA 4LJ9A 4IOJA 2P6RA 1AQYA 4KHZA 2EW1A 5HZHA 5IT5A 1QRAA 2XAUA 3LO5A 2HF9A 2IYTA 3GFTA 3NIBA 4G5SA 2WAXA 1E2MA 3K9LA 3B5JA 3T1QA 2AK2A 3BFKA 2W6JA 1J99A 4DLYA 2VA8A 4NCHA 1KI3A 2E87A 1B0UA 4IDHA 2XJ9A 3AP2A 3FMOB 1AQUA 2ATVA 5KDLA 4BFYA 3IQWA 4D6PA 2QP9X 2KWIA 4D4JA 3AB3A 5CM8B 4A6PA 4DUGD 4ZIRB 2WHXA 4B3BA 3GCGA 2FWRA 4BWYA 2ZIAA 3A8TA 3EW9A 4M1KA 2PJRA 1BOFA 1LS1A 2RGAA 1G19A 4S35A 3V4FA 4LC1A 4HLCA 1E9BA 5B30A 2BKUA 1KDRA 1NI3A 2OILA 2CHGA 1YQTA 3CPHA 1E3MA 2WSSD 3VQTA 1JXOA 1KI4A 2OCYC 2CNWD 4MDEA 2Q9CA 4ASUA 1XXHA 2WJHA 2XZLA 1Q1BA 4KFTA 2ZM5A 1N6IA 1NVUQ 1SULA 2WJJA 3GJ0A 3ZD6A 1E94E 2ZE7A 4LJ8A 2IF2A 2PZGA 2WJVA 1II8B 2OZEA 4QJ4A 4B44A 3QXHA 121PA 4KFSA 2WPDD 3KX2A 2JJ2A 3LXRA 4LHVA 5JCZA 4ZDIA 2JLYA 4AYTA 621PA 4MRPA 1XJ0A 4FMDB 1TF7A 4KCGA 1XJQA 2XTZA 4DLXA 5A5GA 2XTMA 1T91A 1N6NA 2OCBA 3TVTA 3WYFA 4PAQA 3EASA 1SXJA 4P4SB 5DO9A 3U60B 2BCJQ 1HT1E 4AY2A 1TQDA 3HYRA 2H5EA 4Q1AA 1KMHB 2IYYA 2V4ZA 1OXVA 4DLUA 1KK2A 2H18A 4JLBA 1E2EA 3WMGA 3AVVA 3TSOA 5KNBA 1W1WA 3AGQA 4DDWA 3I3SR 4XD7D 3P27A 3AKDA 4B71A 1PJRA 4JL5A 5JSZA 4QM6A 3W34A 1L4UA 2GBLA 2CCGA 2QSYA 3WHLA 4BECA 1XWIA 4B3DA 2PMKA 3AEZA 1SVIA 2PX3A 1W2HA 4RFSB 1Z06A 1V43A 2YJTD 3U2QA 3DVLA 2DBYA 4IDOA 5DLQC 2O8CB 4TT3A 1OHHA 3U3MA 5EP3A 2GTPA 2KE5A 1VG9B 1AS3A 2V55B 3KJIA 5H1YA 1X86B 2V6IA 4QKQA 3UXMA 3THWB 2GRJA 2PL3A 2CHQA 1N5JA 5B58C 3PEVA 2P6UA 1E9FA 5CB6A 5EUQB 4DKXA 1XPRA 3KDSE 1VCOA 3C7KA 3B1VA 3P32A 4PANA 5JMTA 5JWOA 3AH8A 5DSZA 3UG6A 2G83A 1QZMA 2FF7A 4EFLA 1NG1A 2LKDA 3NBFA 2TMKA 2NTYC 1TQ6A 4P0TA 3U7GA 1ZMXA 2O5VA 3B60A 3GD7A 3OEHD 4DBLC 4CGZA 1OIWA 4BQSA 3BE4A 4BRWA 1DE0A 4KLNA 1BMFA 3QG5A 2Q3HA 1QVRA 1UPTA 1VPLA 2RGDA 4GSYA 1IN5A 2R6FA 4MRVA 1A1VA 3TQCA 5FL3A 3G5UA 4WW0A 2V3CC 2OT3B 3LFUA 4YDHB 3RANA 5GJBA 1SKYB 2JDIA 3WP0A 5J40A 2XZOA 4Q9LA 3MD0A 3W90A 1G291 4Q1FA 3VX4A 4HLDA 1QZXA 2O0KA 3N2EA 3MMPA 3CH4B 3QUSA 5FR1A 3TW8B 4A0RA 1IONA 3PITA 5CDFE 1HEIA 1F6BA 1L4YA 2XSZD 2QSZA 3DMNA 4M1SA 4PSVA 4HLUC 3IDQA 4GZLA 3KKOA 2OCPA 4IOLA 2ZUCA 3RRZA 3RAPR 1FTSA 2GWHA 3OF5A 4O0MA 1FUUA 4MRRA 3HR7A 4URWR 1E2NA 2JLXA 3NH6A 2BMDA 1OW3B 3AGPA 1P9WA 1YZLA 2LCFA 2IS6A 2WKPA 2X77A 5EE3A 4D4KA 2CBZA 4EPTA 1E69A 3LH5A 1N0UA 3RS0A 4M0LA 4LZZA 1XD2B 4D0LB 2GCOB 2QMUA 1YR6A 4RFVA 3L0IB 2WWGA 4TQUS 1W44A 4ZCIA 1SVSA 4XVQA 4A36A 3EZ6A 3L0PA 4I99A 2JLWA 4CEIA 4A0FA 4D82A 3CO5A 5KDOA 3FMFA 1HH4A 2FV8A 2JATA 4HUQB 4ZCLA 4A1FA 3B1ZA 1MV5A 1Z6YA 5FH9A 4LPKA 2YVUA 3W6NA 4Z1MD 4Q1EA 1UDXA 4NYIQ 4B34A 2ZITA 1P6XA 3QKSB 5EXTA 2GEVA 4DXAA 4F92B 5GVSA 2GCNA 3TUZC 1A2KC 1P73A 5C46F 3IIKA 2FEOA 2EFHB 1R10A 1VKJA 1CR2A 1ZC3A 5HR5A 5GJCA 3CWQA 5DHFA 5AJWA 4D81A 1Z0IA 4HB0A 2PT7A 4GP7A 2FOLA 1ZU5A 1DAHA 3SJAA 5JI2E 4C2UA 2BM0A 1E2HA 4WXRA 4WZAE 3R7WA 1W46A 2J41A 3K53A 2QGZA 4H9GA 1Z0FA 4HEJA 4QBFA 2QPTA 5IDVA 1G3IA 1E4YA 1CBUA 1LFDB 2CJWA 2E9SA 3CBQA 1HV8A 2V9PA 4II7A 3TJZA 4U7DA 5FPSA 1O3YA 1DADA 5BXQC 2DZOB 3R9IA 2FZLA 4J0QA 4Q7MB 3U44B 4ERNA 2ZRBA 4GDFA 1YRBA 4ASUD 5JI3E 1WXQA 3KJEA 4TLCA 4HSEA 2B7BA 4E09A 5ELXA 2G3YA 2OBLA 3IEUA 3Q5EA 5FTLA 1OH5A 3NVAA 5DN6A 3O8CA 4Q1CA 2CE7A 3B1YA 2XXAA 5D3MA 1DARA 2FGJA 2XTNA 2ZR7A 1ZM9A 5KDDA 1TPZA 1UKEA 2IL1A 1PLJA 1AJEA 1HTWA 2LWIA 5CJ2A 1QHGA 2BJWA 3ZVNA 1CRQA 4RCYA 2WSMA 2FSFA 1SXJD 3M4YA 4JT4A 1S3SA 1W47A 1YKSA 3JVVA 3PV0A 3VR4A 5GJWC 5TY0A 1ZIPA 3WNCA 1IOZA 3CZPA 1KTVA 2WMNB 1E2PA 4PSKA 4AD8A 1I4TD 2GXAA 4PC1A 3T34A 1W36D 1N6RA 1WQ1R 3B1XA 3RC3A 4IVRA 4DSTA 1IHUA 2P2LA 2EQBA 3LLMA 1ZD9A 3KQKA 4QGHA 3T35A 2OBMA 3IEVA 4TYWA 1AK2A 3QVUA 2FNAA 2QAJA 4URUR 2FN4A 4KLZA 5FBQB 3KXIA 4Q00A 1AKYA 4FN5A 4LI0A 4PR0A 3O47A 1I2DA 1OHHD 1YR7A 1YR9A 5CYOA 4R71A 2G0TA 1SXJE 4G1UC 1Q1QA 2Z5FA 3QBTA 2ZI3A 1ZIOA 2ZXUA 2QTFA 3ONWA 5CLLA 3QE0A 2ZQ5A 4PFSA 5BYKA 4KVAA 3THXB 5KNDA 4JBYA 1AGPA 1LS6A 4RJLA 1Z22A 2D7CA 4DLZA 1DO2A 4EFNA 1ZUNB 1K6MA 1MO3A 3KKMA 2QQ0A 1ZU4A 3O8DA 4OYHA 1KSFX 3RSLA 4QRHA 2D4HA 4EQ6B 3Q85A 2WJYA 4N3NA 1Z0KA 1W0JA 1TTTA 2QUZA 2VF7A 5B64A 3FGNA 3SI7A 2I1VB 1TUEA 3Q7PA 4LJ6A 3SU8A 5L3QA 2Y8EA 3AP3A 2W2XA 1KI9A 3LQQA 3SQWA 3T06B 2G9NA 2JDID 1Q12A 2ZJOA 3SJZA 3GLFB 4M9QA 4RY2A 2IWRA 5FBRB 2UZ3A 3VKWA 3RNLA 1KI6B 1EWRA 2QEQA 3CPJB 1IN6A 4ZKDA 2XNDA 4D26A 2JJ1A 5FOXA 4LYJA 2HEIA 3VAAA 3D7MA 3TRFA 4NU0A 2PCLA 4TZ0A 4KYUA 2FPMA 5JEDA 4IHQA 1JEDA 2YWGA 4TYPA 3MJHA 4LBYA 3ADBA 1RRCA 1UDWA 5FOVA 1T3HA 1T0JB 2RAPA 1E2KA 2GZHA 4QNMA 3BH6A 2C5LA 2DWQA 4RZXA 5FUWA 4CW7A 2GHIA 3ZQJA 2D2EA 2Q21A 3I73A 1IXZA 4DCTA 2C9OA 1XFAA 4CT4B 3LV8A 2ONKA 3MUFA 4IVQA 3GLIA 3QG1A 1RYHA 2DR3A 3U7FB 3P1JA 1ODFA 1E2QA 4LJ4A 1OXSC 4NYJQ 1XDBA 3EWSA 3LBNA 3Q72A 3K0EA 3TH5A 3QKUA 1DAIA 1GKYA 4Q21A 3TVDA 5IHPA 1U9IA 2JAQA 4BZXA 4OHVA 3GJ3A 1XEWY 2EFEB 2ZU6A 3BFXA 4DEXA 3PUWA 5L8VA 2F7SA 1CIPA 4M1TA 4AK9A 1FP7A 4YMUA 3PXGA 1UADA 4PC7A 1KY3A 2RGNC 2F1RA 3V9PA 4IFBA 1KKMA 1Q3TA 1E99A 5CIWA 6Q21A 2NQ2C 2VHCA 2F1JA 1PUIA 4C0SA 2ZI7A 5TXGA 2KRKA 1EFCA 5BN3A 1RE0A 1UJ2A 3AKEA 3HP1A 3DM9B 1Z0JA 3UWOA 1JBKA 3X1WA 1WBBA 4TN1A 2ZJZA 2FFHA 3CF6R 3QOFA 4M9SA 4P4UA 3C5CA 3OE7A 1UBGA 1JNYA 2XX3A 4F7WA 1D5CA 3I4LA 2ZRHA 4V0ME 1N0VC 2IBMA 2QU8A 3BB1A 4TZ6A 1DG1G 4B2IA 2EFGA 1MKYA 4U02A 4IDNA 3RC8A 2YC2C 3CNLA 3VR1A 2GXSA 1OJLA 2ZVQX 1IXSB 1BO6A 1JEEA 2F1IA 1MRSA 5G53C 2FX3A 3CRVA 4Q9JA 4GMDA 4ARZA 4F4JA 3ZVMA 1NG9A 2VP4A 4MDFA 3QJYA 1P72A 1NMZA 4HZUA 1Z6GA 3WRYC 2CLDX 2QAGB 1NVVR 1OIXA 1AZSC 1CKEA 4EPRA 5SZIA 4AC9A 2EWWA 1GUAA 5DN6D 2CMKA 1R2QA 3CRW1 3W8NA 1ZM2A 4R98A 1U8YA 3IBGA 1VCIA 4OKSA 1H8HA 2VSXA 2FSGA 2ODBA 2VH5R 4Q1DA 3FTQA 1Z0AA 3GLGB 1JPJA 3CNNA 3H1TA 3L82B 3R20A 4V0LA 2QN6A 2GJKA 2VEDA 4E5UA 3FHTA 1EESA 1DAFA 1ZRHA 2ZANA 4MYUA 1XEFA 1XPUA 5FUVA 4B2LA 2RGCA 4LHXA 4P3YA 1K5DA 1RIFA 2XZPA 3CW2A 3KUDA 3DM5A 1P62B 2F55A 5KPJA 2JLSA 4LV8B 2SHKA 4ZO4A 1RPZA 2CVFA 1E2FA 3MWKA 4B75A 3AVPA 1IM2A 5JS7A 1M7HA 3BB4A 4ZPXA 4LJAA 1QHNA 3ECCA 4FWHA 3FFBA 4PHTA 3VHXA 3D31A 1ZAKA 1DELA 1FL9A 4Q03A 4BLQA 3WMEA 3BAFA 2ZYWX 4C9BA 1KY2A 3FDIA 4Q4AA 4V0KA 2FSIA 3G0HA 2DZNB 3FHOA 4FMBB 4URVR 3OIYA 4MYCA 1NVXQ 1PZNA 1MR3F 1Z83A 2RH5A 5FFMA 4D25A 2ZSEA 3O8BA 3QPUA 2EVWX 2DFNA 5JHHB 4EDHA 2I4IA 3K0CA 3IKJA 1R5NA 1VG8A 3B13B 2QMHA 1IAQA 1E4VA 4OHZA 1CR1A 3K9GA 4CRWB 5HE8A 2REBA 4W5WA 1J8YF 3W5IA 4IVPA 1Z29A 1P2UA 2PH1A 2B7CA 2FDCA 2R62A 4XIGS 2AD1A 2HXYA 2RHMA 3FOZA 4ZKEA 1G6HA 1W0JD 3LDAA 2RGGA 1AZTA 1FNMA 4L4UA 4TMWA 3RRNA 4EPVA 5JJKA 1KI7A 1RZ3A 1GKUB 4OHYA 1S8FA 4FIDA 4CIDA 4LRTA 4U5XA 3PUZA 5C4MA 1Z63A 1R5OA 4GP6A 4FWTA 3CR7A 2WWHA 4MQBA 1G17A 2IA5A 2ZU0C 5ANRB 2KJQA 2HYDA 3U3OA 3VKHA 2C96A 1G5PA 1N5LA 3CWZA 3GJ5A 4HB4A 5K8TA 2KI5A 3I1FA 3EPLA 2XNDD 3NC1C 4BFXA 2JJ1D 1VIAA 1ZNYA 5JWRA 4AIIA 4FWIB 4QBHA 2A78A 3AVQA 2IW3A 4DSOA 3SN6A 4JVSB 1OYYA 2YWFA 5DGXA 1RJ9B 1I4LD 4AI6A 3LVRE 2QGNA 1LNZA 2REXB 2F43B 4W5JA 5CLQA 2A30A 4C0BA 4AYWA 4QM7A 4XVUA 1M6NA 1FOEB 2W58A 1FNNA 2G6BA 2IYZA 3NDPA 2R6GA 3QEOA 1F2TA 4LUCA 5H70A 1R6BX 2BVNA 4JLMA 2NMVA 2OSBA 5AR1A 1VG0B 4OJKA 4JYCA 5FTMA 1RC8A 2H1LA 4JLKA 3M6AA 4UNNA 1SKQA 4XWAA 5DE3A 5L3VA 2WWYA 2MSCB 4LHWA 3X1ZA 1JR3A 1MABB 4QHSA 4QGFA 2O8EB 3ZH9B 1XTSA 1GNPA 4Q1BA 3AKYA 4OQFA 1GZSA 5K8IA 3LX5A 2GKSA 4O2LA 3AVWA 4LSGA 4NL4H 5FBLB 1AS2A 1NVVQ 5AWFC 4DSUA 1L8QA 1Z6XA 2DWPA 1XMVA 4XWOA 4URXR 3PVSA 4ABYA 4HLQB 4RZUA 4TL8A 1G7TA 1RYFA 1GL7A 1TNDA 1XEXA 2OEPA 1KZ7B 2N46A 1KJWA 4LWZA 1XEWX 4QGGA 3KKPA 3PFIA 1N5IA 3KTAA 3IO5A 3EA5A 5FR2A 4PTLA 4DCNA 3GLIE 3CRMA 4HAVA 4JKIA 4NP6A 3ZD7A 1AN0A 2ZRMA 2PBRA 4Q02A 1NVWQ 3I92A 5IF9A 4TLEA 4TL7A 3T5GA 4IJMA 2VP2A 2X2FA 2J0UB 1R0WA 2FPLA 5FTKA 1P75A 1TUIA 2ATXA 1LF5A 1PLKA 4MRNA 4ZV4A 1T8TA 2R6CA 3S1AB 4X8OA 3T12A 3ADDA 4D80A 1CR0A 1N6PA 2ZJYA 4PX9A 4D0NA 1Z07A 2BMEA 3OE7D 1XMSA 1KI2A 4Q4LA 2C8VA 2G1JA 5EJEA 5J4KA 4TMTA 3VNUA 2EU8A 5JS8A 4HAXA 3MWJA 1F2UB 1J70A 4RD3A 5KSPA 3A4NA 3OZXA 4LBZA 1ZC4A 1Q22A 2IYWA 4OI4A 1GRRA 4HI0E 3RS4A 5DI3A 3E5HA 1NJFA 2HCBA 5J47A 3QXJA 4FW9A 2IXFA 1WBDA 1CULC 3I8XA 3QF4A 1BYIA 3TW4A 3BD9A 3ND9A 2OAQ1 3KKNA 3K9HA 3QKTA 3U3RA 3SDZA 3GEEA 4BLSA 4HAYA 4W7SA 721PA 4TLDA 2CDNA 2YINC 3U61B 3L8ZA 5KSZA 3ICQB 1AS0A 2QT0A 3K09A 4F4CA 3BERA 1ETUA 2BBWA 3LAWA 2GCPA 2PLRA 3QPWA 1GL9B 4JS0A 5TB5A 5L3SB 2ERXA 1H8HD 3RLFA 3LBIA 4A8JC 1FW6A 3VNVA 2P5TB 3A1SA 1BS1A 2ZJ2A 3E1SA 3UATA 4B48A 2A5FA 1Z08A 3VR6A 1T6NA 4IW3B 5KUTA 1G4UR 3VR2A 1VCMA 3ZIAA 4NYIR 2GA8A 1YJ5A 1U2RA 2B21A 1KGDA 4MUBA 1H8ED 1G8GA 1GOTA 3EAQA 4UNRA 2Z6VA 3QXXA 4LK2A 1NIPA 5G40A 5C18A 1XCPA 3EZ2A 2D06A 3E70C 4RSGA 1XP8A 2IYXA 2W0SA 1YZUA 2HDNB 3Q9LA 1TF2A 5EUMA 1DAMA 4IXMA 2XB4A 5FPYA 2HV8A 1GG2A 4TTQA 3CRQA 2GCOA 1RRGA 3W6PA 2FFQA 4OI2A 1MO4A 3NC0C 3LQRA 4A3VB 1NMXA 4CF7A 3P4XA 2YOHA 3CX7A 2RMKA 1NF3A 4CEHA 2X1VA 3O8RA 5GADl 3VU9B 1U0LA 1QHXA 1W4BA 4HUQA 3VHLB 1LF0A 4YLGA 4QC2A 2O8DA 1JAHA 1I4DD 4ESHA 4YXWA 4KODA 1EXMA 3EC2A 2BJVA 1NL3A 3NEYA 3SJCA 3CKLA 1U81A 4LHZA 4EJSB 3W3ZB 2VP0A 1YZGA 1SHZA 1VMAA 1YZKA 5KSOA 5JRJA 3U6BA 3UIEA 4KI0A 1FQJA 3V4RA 4DRZA 3GJ8A 1Z6AA 4Z51A 5C1BA 2V8OA 4PZLA 2VLIA 4QL3A 1T0HB 4F93B 5AUOB 2ORIA 4NZYA 4GPTA 2IYUA 3U5ZB 2AXPA 2ZE6A 3EZFA 4EIWA 3BH7A 3FYHA 2XITA 4OK5A 1C9KA 5LB4A 2ANCA 4US2R 1QF9A 3IILA 5FL7A 3SC3A 3H4MA 2JLUA 2L0XA 3CB4A 2HJGA 2ORWA 2Q3MA 5JRZA 3A1UA 1U90A 4PAOA 3KZ1E 3WY9A 4DLTA 2V7QA 3IUYA 5B57C 5EXSA 3UK6A 4BFVA 2CVHA 2VHQA 4PZZA 2GJAA 1QHSA 1N6LA 1DEKA 4AURA 4EPYA 3I5YA 3U44A 1T8UA 3L2OB 2IS1A 1OIVA 2FGKA 2ODNA 4DZZA 4FMCF 1HQCA 1UF9A 5JFGA 3GP8A 4B32A 1NY5A 2YOGA 1C1KA 4JSYA 3LY5A 4XWKA 3AP1A 2QBYA 1E1QA 2YWHA 3OIVA 3LXXA 3QPVA 1FP6A 3HDTA 4Q66C 3JZMA 2C78A 3TUJC 2WKQA 3WP1B 3HU3A 5EE1A 4V02A 3FVQA 3BOSA 4XSHA 3K70D 4BZPA 2NO6A 2FPKA 4TLBA 2CL6X 2ZRCA 4C7OA 2QY9A 4UJ5A 1Y63A 3IHWA 4BLRA 1AKEA 3SYNA 2C9CA 2ZRDA 3BRWD 4P33A 1JI0A 4KSCA 1RW4A 4LYHA 2ZE8A 3C5HA 2ERYA 5FOTA 3WBKA 4A6XA 1OSNA 1TX4B 1E2IA 1G1MA 3H0KA 1U0HC 2Q9BA 4F38A 4I1OA 1GM5A 5P21A 2DWOA 2EFCB 2OG2A 4JLNA 2XGJA 2WWFA 2EYUA 5E7MA 3CNOA 2ZTSA 1SXJB 2IX3A 3RVBA 2VP5A 4DVGA 4PC3A 4GNKA 2YYZA 1S9DA 1XJCA 4X8HA 2GVZC 2PT5A 1OF1A 2Z83A 2NZJA 2ZUBA 3IHLA 3N70A 4LJYA 4TMZA 1US8B 3WHKA 1NSFA 4EPXA 1W36B 5F9FA 1T3LA 2DB3A 1UM8A 3AVTA 1N3BA 4GT1A 4NCNA 2YNMA 3EZ9A 1RFLA 3GQBA 3B78A 2FE4A 2BBTA 2PMDA 2GESA 2E1RA 2QI9C 2C9YA 3SJBA 1E96A 1ESMA 4Q4JA 1XTJA 4RZ3A 1Q1ZA 1S0UA 3LWNA 3THXA 2J0QA 3UMSA 1FX0B 5EE9A 5HCIA 4P32A 2JLZA 2W6JD 5EE0A 4DCSA 1Y3AA 1KDOA 2ZS9A 3ZLJA 3QKRB 4WXPA 1F3OA 1XTIA 2C77A 1GRQA 1QG2A 2FSHA 2Z4SA 1OXXK 4KITB 1NN5A 4UNQA 2R6AA 5FPHA 3AVYA 4FMDF 2ZRPA 4EJSC 4M21A 3DL0A 4MKFA 2ZSDA 4B43A 2OLKA 1SVKA 4NYJR 1NRJB 3DMDA 3QNUA 5FOUA 2WOOA 4UJ3A 3I61A 4TL6A 2AFHE 2ECKA 2DWZB 1JECA 4JVLA 1KI6A 2KSQA 2JLRA 4BFTA 1X1SA 2QENA 2JLVA 1Z0DA 2AK3A 4QXAA 2OV2A 4LDJA 4US0R 1K8RA 3REGA 2JJ2D 1E9EA 2WWXA 1M1YE 5LB2A 3ZIAD 3GJ4A 4Q5IA 4R2IA 4JL8A 4E22A 4B3XA 2C04A 1IJFA 1NVMA 1UBFA 1Z2CA 2JGNA 2WAYA 3MAAC 3REFA 1WRBA 1OE0A 5G3ZA 4BRUA 4ACAA 2GXQA 4O3MA 3ZZUA 3NTUA 1GIAA 2Z0MA 2P65A 3AM1A 1UKYA 2PCJA 1OFTA 1KJYA 1XXHE 2D3WA 2X8AA 2OUKA 4C4PA 1HURA 1XNJA 1KZGB 1FFHA 2OE2A 3QBVA 1BYUA 3EIEA 3ETLA 1JPNA 5DYGA 3NXSA 3KQNA 1DOAA 1JJ7A 2IS2A 1JQLB 4TTPA 4Y0VA 3NDBB 2NIPA 2A5DA 3KB2A 3RYTC 4KJZA 5IK2A 4LX0A 1XZPA 4NTZA 4OQLA 3RWMB 2HT6A 5EE5B 2V1XA 4L5BA 4V0OA 3TR0A 4JYBA 4TT3D 5AUQA 1L2TA 4PSAA 4YXWD 4NCIA 4ILEA 2XNSA 1J2JA 1NMYA 1Z6TA 3DOEA 5DHAA 5E3HA 3BJIC 3CIOA 5GVRA 4CEIB 3RRYA 3WRXC 1XD9A 1SXJC 2GXUA 5HKKA 2BMFA 1U99A 5HE9A 1OPXA 1KO4A 4A4DA 3A36A 3PUYA 4ZDWA 4TYNA 2O8BA 4RD4A 2BCGY 3R8CA 1S2MA 1W36C 5A4JA 1W49A 2I1QA 4DWJA 2WJIA 3K8YA 1BMFD 2FA9A 3A1TA 2GBLC 4XH9B 4M53A 2NGRA 4ESVA 4E03A 2GZDA 3ICEA 4GBMA 4DIEA 5M04A 4B33A 1N6KA 2OO7A 3NBZC 1NNEA 2G0NA 2V7QD 3L8YA 4PHFA 1DTSA 2C98A 2CE2X 3DKPA 2ZS7A 4Z8YA 4UXIA 3H86A 2I3BA 3JVUA 5L3RA 3W3AA 2J45A 2QAGA 4K46A 1KK1A 3BC1A 1GL6A 1G6OA 3MLEA 4MGIR 3TQFA 4CT5A 5DISB 5FUYA 5LBIA 3U3KA 4CEJA 3RDPA 1WA5A 1C1YA 4Q01A 3KXLA 2XB2A 1XTQA 1KSGA 1PV4A 4LV6A 2V6ZM 4L9WA 4JLJA 1YZTA 3SFZA 4G5GA 2UVQA 4GFDA 4RVCA 2VIIA 1JR6A 3GLGA 2QTVB 2NZ8A 2XXAB 3KFVA 5D3MB 5HCNA 4A2QA 4DT1B 2O52A 3NG1A 2VRWA 3M0EA 3AF1A 4B3CA 2D7DA 1W4RA 4K8OA 5AUPB 4JLVA 1BIFA 4PQFA 2W00A 4XTRA 2GEDA 3WMFA 3AF3A 2P3SA 2VO1A 1NY6A 1EFRA 2PZFA 1DVRA 4XTCS 4M22A 4PO1A 2VP6A 1CLUA 2AKAB 4YMWA 4DLRA 5G3YA 1N5KA 1G7SA 3SS8A 1G64A 1ZP6A 1W2GA 3GLHA 1M7GA 3G82C 2Z4RA 4X8LA 1R0XA 2K5UA 4S2EA 5DIFA 2IWHA 3T1OA 3VR3A 4DLSA 1NJGA 3KKQA 4Q4HB 2PEZA 1G21E 1EFHA 2FJUA 3L0SA 3B6EA 1KK0A 5FTNA 4DC9A 1U98A 2KBFA 4GI7A 3TR5A 5B2ZA 1S4QA 1R8SA 2CLSA 2JCSA 2F9MA 1XZQA 4RD6A 4DSNA 1KDPA 1RKBA 3EZ7A 4Q9HA 3NHAA 4DEYA 4BEJA 5JECA 2BMJA 1R0YA 2KB0A 4EAQA 4P4TA 1S3GA 2XEXA 3U7HB 1OKKA 5SZJA 2JIZA 3TUIC 3RS2A 3ZZ0A 2VHTA 5FPTA 3K0AA 3DDCA 5F9HA 1CEEA 2BEKA 2OCAA 2ZYUX 4MITA 3T1TA 3PENA 3KW6A 3LD9A 1D8TA 3MSXA 2O8FB 3NBYC 5G41A 2IYLD 2IC5A 1IN4A 1KMQA 4EFMA 4U00A 3BORA 1VECA 4MKHA 4FI3C 4V0NA 4RKEA 3KQUA 4TMVA 4HB2A 3QEJA 3P26A 5L3QB 5J4YA 1IN8A 1AIPA 2WWWA 5H68A 4GMXA 4DB4A 3R9XA 2J0VA 3U3JA 3E2IA 4AG5A 1P3JA 2QTHA 2AD5A 4UXJA 4AG6A 3VTKA 3LW8A 2NO0A 3IIJA 3Q3JB 1XB2A 4HATA 4WBSA 4DHEA 1TL7C 3CX6A 3A1WA 4JLPA 3ZS8A 1VG1A 3ADKA 2J7KA 3TMKA 1G8PA 4B47A 1KNXA 5FOWA 1X37A 5KPDA 2ZJ5A 1CXZA 1N0WA 4I1SA 4TWZA 1J7KA 3ZVRA 1IY2A 2DCUA 3W9YA 3LW7A 2CNWA 2P6NA 1ELOA 4TMKA 3W5JA 4PPNA 1D9ZA 2RCNA 3DEFA 1QHIA 1MABA 5E7IA 3TE6A 4WVFA 3PCRB 2AWNA 2ZJBA 2VSFA 1TEXA 2IK8A 2QPOA 3OFNA 4HAWA 5F3WB 1EGAA 1Z5ZA 1ZM7A 2J7PA 4IOKA 3WYAA 1M34E 3GLIB 1X8KA 4PHHA 4C30A 1J8MF 4LBWA 5IK2D 3TAHA 1OXTA 1TEVA 1Q57A 5JLJA 3HU2A 2GK7A 2QP4A 4MH0R 3LX8A 1OLOA 4KYIB 4RD2A 2VBCA 3ASZA 4M1WA 2J5XA 5JJIA 4UXHA 1Q21A 3B8HA 1Q20A 3MHVC 2QROA 1LY1A 2P67A 3K9NA 3BFVA 5HKKD 1FPMA 1UEIA 2OHFA 4KU4A 1E9AA 4PPFA 3BK7A 4BFUA 1YHNA 2BOVA 4XD7A 4Q9IA 1CRPA 4ACBA 2BWJA 4NCJA 2J0UA 2J46A 1YVDA 1R7RA 4A2PA 1KOFA 3HU1A 3EXAA 2HF8A 3THYB 2ZAOA 2V1UA 2QP3A 2IUSA 3S1AA 4POAA 1VHLA 2QA5A 4W5HA 1D2EA 2G77B 1GRNA 3HYTA 3SE0A 1UBEA 1EWQA 4GOKA 1ZYUA 4MKGA 1CJUC 2AXNA 4A8JB 4OI1A 1A4RA 3B7GA 1XCMA 2P0EA 2QT1A 4BE7B 3OIUA 1F48A 3MFYA 4DLWA 2RGBA 3P4YA 4I4LA 4NYMQ 3F5FA 1LW7A 3LVQE 4ZIRA 3TAUA 1E2DA 4MUAA 4WIAA 4HLUA 4B73A 4D4LA 5CDFA 2ORVA 3T15A 2EYQA 2WIBA 3IQXA 1ZUHA 4LJ7A 3LA6A 3OEHA 2IYSA 4QFMA 4O2RA 4ARZB 1G8YA 3D6TB 3GJ6A 2GDJA 3EARA 1KYIA 2FU5C 4JSTA 1M7BA 1V5WA 1X8JA 3EIQA 2BKEA 3I72A 4LHYA 4B74A 4NCKA 1CS4C 1W5TA 4FWDA 1II8A 2VHUA 5FOSA 1P2TA 5TDHA 2DFTA 4FD2A 2ZRLA 5EXXA 4KAXA 1Z3IX 3QXCA 4QNRA 1DPFA 3AF4A 4IFEA 5JEEA 1Q1EA 2C03A 1P7CA 1M2OB 1VTKA 2OM2A 2WM9B 3X2SA 1HA3A 2H17A 1NP6A 4TQAA 5J5CA 2ZPTX 3MGCA 5TVKA 3NBXX 4P4SA 2YOFA 4LPSA 1P60A 3VKGA 3D8BA 3TNFA 4Z54A 4N1AA 3HWSA 4HZIA 1E79A 1EFRD 4JL6A 4R7ZA 2D62A 3SFVA 4JJKA 2R44A 4PZYA 1KMHA 5F2EA 3EX7C 2IS4A 5LD2B 1UAAA 3NEJA 4DDUA 2AFIE 3LRPA 4M9ZA 3CONA 2WJGA 1ZM3A 4DJTA 4TMXA 1W4CA 1IXRC 2BM1A 5KO2A 5AJXA 5KTYA 2YWEA 3TK1A 4G3XA 3WYGA 2A5GA 2CL0X 2W6IA 4H1UA 4KBFA 4TQ9A 3P20A 1CU1A 3SYKA 3ND8A 4RFSA 4FXPA 5CK4A 4MYHA 1QHHB 1HT2E 2ZI9A 1R8QA 3UWKA 2O8CA 4TSFA 3TLXA 4HDOB 1II9A 4TYQA 4FMCB 1JXMA 4GZMA 4Q4AB 2ZVPX 4M9XA 4F4IA 1ZINA 5GJVC 1QVAA 3THWA 1OH8A 3C15C 1SGWA 3PUXA 4NDZA 2GJSA 4FWGA 5EQTA 1NBMA 1LV7A 2YZ2A 3IBYA 3J81k 5D3QA 1OKKD 1E6CA 1S96A 1FQKA 2JIZD 4Y0AA 3AQ4A 4QGAA 2GJ8A 2ZRAA 3HPRA 2RHDA 1T5LA 1GNRA 2YC4C 3AVUA 3PEUA 2WOJA 4I1UA 2GNOA 5FI1B 4MYTA 1G3MA 4FCVA 3IPXA 4RD1A 1OFIA 2ZI5A 4LYFA 1MOZA 4BASA 2ODWA 2JASA 4B3FX 2PLFA 1X1RA 2QORA 3K0FB 2FFBA 5KSYA 2CCJA 5FTJA 2FZ4A 4US1R 4ZDKA 4OQNA 1PVOA 4A82A 2YHSA 3SBEA 2H8KA 4FCTA 3QVVA 3GMTA 4ZI3A 1E0JA 3WNDA 1CJMA 2A9KA 4NH0A 4K81B 1DAEA 3OAAA 2GILA 2VF8A 2NO9A 3PG5A 2ZRGA 5F98A 4B3GA 5CM9C 3FPAA 4AKHA 1MT0A 1DG3A 4IRUB 4YONB 3SR0A 4WZBE 3IIMA 4JIMA 3FE2A 3ZZTA 4KO8A 1OT3A 2F1HA 2QMEA 3UKDA 2Z43A 3B85A 2GF0A 4C0AC 4DCVA 2IHYA 3X1YA 4BLOA 4XVRA 1GILA 3T61A 5JCPA 1F2TB 1J90A 3I62A 1OV4A 4A2WA 3OFND 3CUEF 3KJGA 2A5JA 1XX6A 2ZR0A 1RRPA 3PQCA 2J7PD 4TLAA 3AUYA 1GDDA 2B8WA 4GOJA 3MWYW 1XD2A 3IO3A 3TIFA 1FUKA 3FB4A 1EX6A 1MRNA 2GZAA 1Z28A 3DHWC 5A0FA 3QI2A 3K70B 3OIWA 4NPHA 5K8UA 4C2TA 1WDTA 1YU9A 2AX4A 2J1LA 1NKSA 1E9SA 2N42A 4B2PA 4KFRA 4OHXA 1DO0A 4Q47A 2A5YB 3NHBA 1DS6A 1Z8FA 3U4QB 3VFDA 3KJHA 2QM8A 4C0LA 5K8LA 2X19A 3DPUA 1WB9A 1G41A 1US8A 5LD2C 5AUNB 2F9LA 3NH9A 3ZVLA 1XEXB 3QKSA 3MG9A 2IEYA 5KYKA 4OBEA 3UPUA 2FMXA 1HYQA 2ZR9A 5BN4A 3KTAB 4L9SA 4CDGA 4A0HA 2ZAMA 2AR7A 2B6HA 1SVMA 4DDTA 2ZYTX 2OFOA 1M74A 2OLJA 1JJVA 1FX0A 1FMLA 4R2HA 2QPAA 3BGWA 3M1IA 2ZUDA 5EXPA 3QKRA 4RD0A 3QY0A 4UNPA 3ADCA 3X1DA 3QQ5A 3W6OA 2UKDA 5BQ5A 3RS3A 3ZS9A 4LOAA
chains in the Genus database with same CATH superfamily
5KI6A 3I3OA 5JXJA 2JB9A 3QLUC 1YQXA 4X24A 1CTQA 2P2GA 3MF4A 4Q3KA 4NX2A 7MDHA 3BSWA 1GGVA 2V58A 4TKUA 3OEEA 1KK3A 2FQQA 3MSCA 5LDDC 4OQXA 3AX6A 2G28A 4K2HA 3FD8A 4AZFA 4BO7A 2Z57A 5FUXA 1J0AA 5CITA 2V54A 4PQRA 3TI9A 5DJ5A 3AEYA 1NKVA 2DWUA 3TAXA 3JVEA 1A7UA 3CR8A 4GM4A 1W5SA 1XV5A 1CQPA 2IFTA 4N5NA 4KQCA 2ILTA 1Z5UA 1E64A 1LLCA 5JAHA 5SYMA 4OLHA 2IITA 3GP3A 1NVTA 4FBLA 5KC9A 1PGQA 2ANBA 1MIOB 2DFKB 3GN1A 4KO2S 2Z8ZA 2OESA 2ONCA 2B1GA 5GKNA 3PTLA 3N8HA 3AYXB 4NCXA 1V26A 5A3VA 5KMGB 2IYRA 5HPYB 7GPBA 2FUG1 3OAAD 4Z7JA 3GPLA 2G88A 4KFUA 1KH3A 3N3AC 3L6RA 4JP2A 1H94A 2P7HA 1I7NA 4X6UA 3AV0B 2FLWA 3N5CA 5HJ7A 1GY8A 2PFKA 1EIWA 1TW2A 2ZWAA 4Z8XA 3IOMA 4PF1A 4PSDA 3Q4GA 3CJQA 2I91A 1LPOA 1H2AS 4NSRA 2O2XA 3EVDA 4MVJH 4MMZB 5KJFA 1BQ4A 5LQJA 4I1VA 5M2QA 1YNSA 4ERXA 2GETA 4GLLA 5ITTA 4QTYA 3LHIA 4X20A 4MUXA 4PHCA 3J27B 3AKCA 3IDAA 5B2EA 1A7JA 1WOYA 5JO9A 2HPHA 2WZJA 2Q0QA 2I22A 4BO4A 4JX8A 4A0GA 3DE0X 2GHRA 3ICOA 1TEHA 2FFRA 2AN1A 1GNQA 2VKQA 3QWLA 3KSAC 4D46A 3GDOA 4Q1VA 1GITA 4NU6A 5CYPA 1G42A 1P3QQ 3AL3A 1M6EX 2DAGA 4RMGA 2XCRB 2PX0A 4BFZA 4QUBA 2IYVA 1BKDR 2WICA 1XMIA 1F20A 5G0TA 3WQBA 3R8XA 4WH0A 1GV0A 4OK6A 3AM5A 3GFOA 3OESA 3ZI7A 5BYAA 2ZROA 3HZHA 3AEKA 2L4EA 3WLLA 3HXPA 4XX1A 2WVJA 2Q9AA 1KAGA 1MEJA 3F9CA 5CH8A 1YQQA 1VPVA 1KP9A 2FN8A 4X64B 1TT7A 3ZYCA 4AZSA 5CDHA 5HP4A 3ZN2A 1M2NA 2VWHA 1QP8A 1RWOA 5F7XA 3ROFA 3PZBA 3A1FA 4JK3A 5FQOA 2RIPA 2EKQA 3QWFA 1DQZA 2CK3D 4E2XA 3GZNB 5A3RA 3AY6A 2YWBA 1P7WA 2GPWA 2J3HA 2FEMA 5D86A 3ABOB 3TOSA 3ZCTA 4MA4A 3KRTA 4RSMA 5HXAA 1BWSA 3KZKA 4E1VA 2W6OA 1P2SA 4HUTA 4RUKA 1WETA 1HDZA 1O87A 4NONA 4DA0A 1I4EB 1IY0A 4HXFB 1G2PA 1JDBC 3TG2A 1IWBB 1K4MA 2YV5A 3SDBA 4JLAA 2ZJAA 3B1WA 3VMFA 1C9DB 2F3PA 1FFGA 3VVCA 3F2IA 5AM0A 4Y2RA 4EHNA 2NV0A 1TMKA 1QG4A 1ZJ6A 3X44A 2YWXA 1GPJA 2FPPB 1Y8RA 3PX3A 2R65A 1AGYA 3WXMA 2AUTA 3ZOKA 4CG2A 1Q50A 4PN3A 2WU4A 5K3OA 3CZ5A 3Q5DA 3PX7A 4GAEA 1LLQA 2R00A 3GLSA 2QG6A 3U6SA 2MTBA 3PGVA 3PIRA 4EK9A 5I9SA 2Q3BA 4D4GA 2XSZA 1J1ZA 5TV2A 4ZI2A 1TGYA 1QFMA 2QQGA 2V6FA 1ILWA 3F7MA 2JZOA 5KU1A 4BU1A 5BW4A 3RUHA 1W52X 1Z2PX 4MWTA 3I8SA 3W5HA 3EFEA 4P83A 2CB9A 1LPMA 1Y6JA 4F5ZA 4JUCA 3L25A 1JIXA 1Z2NX 1QZUA 4IEFB 1BEZA 4J2TA 3B53X 3FWHA 2WAXA 3Q9UA 3WAGA 4BFYA 3PXAA 3B7PA 2WHXA 1V8ZA 5GM2A 3A8TA 3PYXA 1A4UA 4U0KA 1JHVA 1NURA 5T8KA 5DNWA 2Q9CA 4X6YA 3NAMA 4IIHA 2LBPA 1N6IA 4XYMA 2B2XA 2PZGA 4RDHA 4KFSA 2RJOA 3I5AA 1QDLB 2JLYA 1KDVA 3SSNA 3O90A 3D4BA 2EKBA 3L7NA 1XJQA 3IP3A 1QGAA 5HKOA 4Y6RA 4DF3A 1HT1E 4PG4A 4UTZA 1SCIA 3PFCA 4GYKA 1KK2A 4O0LA 4DDWA 4B6GA 1XMXA 4DOMA 4BO3A 3MUOA 3OTIA 1QIKA 2X7JA 2ZBPA 4HH1A 2DBYA 1IZ7A 1OHHA 1VHJA 4FVMA 2KE5A 3ODPA 1DKPA 3KD3A 1E9FA 4W8HA 4X6XA 4C3UA 2XLCA 1XHBA 2KW0A 5DSZA 4ODIA 1MXHA 1OIWA 2C4HA 4RH0A 3FUCA 4ARAA 1AQJA 3RANA 1CUAA 3IEMA 1N5MA 5EIFA 3PLAE 1RBZA 4AM8A 3FHJA 3M1YA 5EWLB 5THQA 5MFZA 2I2WA 3WBFA 1HEIA 4FU0A 5DFAA 2VWQA 3P52A 1J24A 5SICE 1ZRSA 1WUKS 1P8JA 3SK0A 1SOAA 4UBKA 2FQYA 1FTSA 4JGBA 4MRRA 4Y18A 4BY9E 3AGPA 1OW3B 1YZLA 3CXRA 4D0LB 4ZVSA 2QMUA 1YR6A 3G8DA 2X4DA 2A14A 2YYAA 1Y80A 1CHDA 3RRXA 4S1OA 1FP2A 3FH0A 5ENDA 2QX7A 4PZUA 4X7MA 3EY9A 3E9MA 4A27A 5E3IA 3IDFA 3KR2A 2GEVA 2WUEA 2IX9A 1VIMA 2HJRA 3WA7A 3WX0A 5AJWA 2C5HA 5KYXB 3WGKA 4FT2A 3DTNA 4E21A 2EZ8A 1QONA 6ADHA 2EBUA 5D01A 1L4BA 4ZA2A 2B7BA 2YUIA 4J03A 2Q3JA 5EHIA 5JDCC 1TPZA 4AJKA 4FX2A 3JW8A 3PV0A 1FBTA 1KTVA 3V1KA 4PSKA 1GYPA 1ADBA 4JFAA 2VPWA 1W36D 1INLA 4PZCA 1ZD9A 1V41E 2VTBB 2RGYA 3H2HA 3V4LA 1H6BA 4M86A 1IXKA 4BNVA 4ZAZA 3PDCA 1AQNA 1KSFX 4WADA 2NXEA 4WP2A 3ORQA 2Y8EA 3O26A 1UOOA 4PD2A 2CLOB 5ALKA 1Q12A 3F8WA 1HXHA 2IWRA 2PUGA 3H9CA 4N5LA 2FUCA 1QG0A 4A5SA 4WK6A 1ADYA 2GZHA 2C5LA 2XQKA 4CT4B 1QK3A 3LV8A 3QG1A 2YMLA 4IXWA 4MROA 1JHPA 4Q7JA 5CFNA 3SPXA 2QX9A 3PIDA 1Y3CE 5K3SA 5KNCH 5FOQA 1VEGA 2ZU6A 2DKOA 3I30X 1MRZA 1GU1A 2FZCA 4G1MB 3BWXA 3KOZA 1Q3TA 1NX9A 3T9DA 4C0SA 4HOYA 1OKSA 4HDSB 1N9GA 3B52X 2D0IA 5ULLA 4QQ8A 3O9MA 3MT7A 3TIVA 2MOKA 3DEKA 1K8YB 1WCIB 1N0VC 5DF1A 4P5PA 2X9QA 4K9SA 2YC2C 3FG9A 2QTTA 3C48A 4IZIA 2YV4A 2FP4B 1X77A 3CB2A 4MW6A 4RIGA 3Q11A 2H3EA 4XR9A 1OIXA 1B16A 2E6KA 2I7NA 3JV7A 3M49A 5ITUA 2DPYA 5BPFA 3GLGB 1XKXA 2G6TA 1KYXA 3RAJA 4X71A 2XZPA 5F35A 3I4YA 2JLSA 4KRFA 2WD7A 3DHNA 2CVFA 2ZZMA 1LBIA 1E2FA 4GPAA 4B7AA 3E5NA 3ZQUA 5IANA 1AUPA 4HAIA 2JHCA 3FDIA 4UPVA 2J4FA 4URVR 1SPBS 4PG6A 3NV7A 4MYCA 5KYUA 4CM8A 2XGMA 4L27A 1LRKA 2OUIA 3K0CA 2H29A 3MS7A 4H4EA 4N3AA 1I7DA 2F17A 4ARIA 5BV8A 1KZ4A 2ZUVA 1IWPB 3HV2A 2AMVA 3GX1A 2BGJA 3B70A 1TVMA 5K0CA 3VR6H 2ISQA 5GWXA 5JWRA 3EEIA 3W8EA 4A0QA 1O5IA 4A7PA 4OHMA 1W88A 1NLMA 4YEDA 3VKUA 1FOEB 4MICA 3NATA 2R6GA 4GUAA 4LDNA 4RTMA 2PPLA 5DE3A 3FPFA 2O8EB 4OQFA 3TPCA 3JPWA 2DLCX 4W5OA 1DRWA 1NO1A 5JYEA 1L8QA 3R0JA 1HWYA 3BF8A 4ABYA 4HLQB 3EVGA 3G2LA 5LZ7A 1KZ7B 3L26A 5C8XA 4DCNA 2D2IA 4INZA 4NP6A 1PO7A 1EWVA 1D4AA 1A9SA 1PLKA 4E2WA 4ZV4A 4AN0A 5L7WA 1XQVA 4UAUA 4MW2A 1JZTA 2AI2A 3PFNA 3EVBA 4G1EB 4RDXA 4A8HA 2QJOA 1J2RA 1BWQA 2I80A 4BB0A 5J47A 2IKQA 1PX0A 3KKNA 4KQJA 4PX3A 1B1AA 2PSSA 1UWVA 2PLRA 4FGKA 1XWWA 2A5FA 3QITA 3ZIAA 1YJ5A 2FWIA 1QPBA 1QH1B 1Y9EA 4LK2A 2XYQA 4WZZA 2W0SA 1AKTA 4R8SA 2XB4A 3A3PA 3Q0TA 3LLCA 4IFTA 3GNTA 2FFQA 5K3CA 3FZEA 3HB1A 3HI6A 3GLRA 3GDGA 5K6AC 3B6KA 3O8RA 5JSHA 1Y1RA 2CL5A 4MQ5A 5KQRA 3NHZA 2LHGA 1AN9A 1DJLA 2UDPA 5D3KA 2VP0A 3BILA 2WJAA 4XDHA 2DAEA 4TRNA 3VKVA 3DHEA 2IYUA 1PGJA 2XITA 2ANCA 1DZIA 4NH4A 4RQUA 4PAOA 2GI4A 3LVBA 3UB2A 1F0KA 1VRCA 3X1MA 3L1KA 4QWWA 2RGOA 2CDRA 3VDPA 4BVBA 4MLDA 3GI1A 2UAGA 4DUPA 1V5EA 1G21A 4HG2A 2VUUA 1GAWA 1G1MA 1M5TA 2FDXA 3ZWKA 3GVHA 3S1SA 4FMPA 5CG2A 2ZUBA 5HUHA 4P3NA 5K3EA 1R6AA 1ENZA 2EZ9A 2DQYA 1L5ZA 1FSZA 2FE4A 3T1YM 2ZJ4A 2PQ0A 4DAOA 1Q1ZA 1D7AA 1Y3AA 1OFUA 4QOGA 4C5CA 3KAKA 2Z4SA 3ZUPA 2WSBA 3L4KA 2P4EA 2ZRPA 4E14A 4M21A 2NP7A 1IHPA 2P0YA 2PAAA 4CV3A 4UTOA 3GARA 1QZZA 2BTQA 4YRLA 5B55A 4FEYA 2HSZA 4W1SA 1T0UA 4RLHA 3JQAA 4KP7A 4MR9B 1CZHA 3TXXA 5EWMA 1LBTA 1MB4A 1PL6A 3U1TA 1XVUA 5A5DA 4NICA 3CBGA 4F9FA 2X4IA 2VAVA 3R7AA 1DJPA 2PCJA 1X7XA 3HBAA 1WSDA 4E70A 2CZCA 1SUCA 3LZCA 4YASA 3S0JA 3KLNA 3IR6A 1Z75A 3TR0A 2ZRQA 2B5OA 4RHXA 4PSAA 4ILEA 4YP1A 3B1JA 4CEIB 3LCJA 4YREA 2O2YA 1W29A 3AR5A 3C4QA 4TTJA 1TM2A 1SUEA 1EUYA 3DZGA 3G5AA 4BAZA 2JFNA 3UW3A 7ABPA 3JQCA 1JQ5A 3AYZB 3JVUA 3DZFA 3RDPA 1DKOA 2BR5A 1O96A 3CIFA 3IRUA 3U31A 2WEKA 3F90A 2NZ8A 5CXSA 5HBRA 1GZ3A 3WR5A 3AF1A 3E7XA 3HFJA 5ABPA 3OPYA 4XTRA 3G2OA 3BD8A 3C3WA 2P3SA 2VO1A 2ZIUB 2V5UA 2ZUEA 3EYWA 3UOGA 4DCPA 2Z4RA 4DLSA 3DMTA 2QRKA 2YWCA 3TLKA 5BNTA 2BKLA 4X54A 2MU1A 3NHAA 3HKBA 4EYQA 3U7HB 3OQBA 3G7NA 4LE0A 2X5JO 1V1MB 3DDCA 3ETGA 1CEEA 3T1TA 1DBRA 3EQ8A 1DCMA 3BORA 4WZBA 3VH2A 1G8AA 4MKHA 2YYSA 4F5EA 3TFQA 4BCDA 5AFSA 1AIPA 3TRHA 4RIHA 2PL5A 1W9HA 2DE0X 4C89A 4B40A 2Q4OA 4N9QA 1WDWB 4LF5B 1X37A 2OQIA 2FFJA 2NU7B 5CCEA 1CZOA 4V2IA 5TX7A 5MGNA 4QSHA 2W71A 4NNOA 3EISA 2ZWIA 1TUBB 3ENWA 1FU8A 2OV3A 4YFYA 1KVQA 3ESCA 4B81A 4Y2HA 2JBAB 1TKCA 3KC2A 1TEVA 1DRVA 2BGMA 2J5XA 2BF7A 1Q20A 2P67A 2PUDA 3PKJA 1E9AA 2JFXA 3DV0A 1YVDA 2Z3ZA 4X62M 4M0WA 4KQHA 3WVNA 1GRNA 3SE0A 2ZATA 1HDGO 1BQ3A 2WSYB 1AZLA 2ZTLA 4NYMQ 1MX3A 4ENTA 3TAUA 1VZ3A 4GGMX 2CMGA 1ZUHA 4PW0A 1PM5A 3VKFA 3T9FA 1AKUA 4L57A 3PPVA 4ER0A 3C3BA 4TMFA 2VHUA 3A06A 4QDOA 2FRDA 4EITA 1H93A 3IERA 1VTKA 4JEHA 3JPYA 5BQFA 3UK0A 4CIBA 1N77A 1YJQA 2YOFA 3CEHA 4G0MA 4JFRA 5ICSA 3I9V6 1T8YA 5IS2A 1YONA 1FDVA 4N4AA 1E3TA 1QRDA 3D64A 4H1UA 5CBPA 3SYKA 3ND8A 4QU8A 3FNBA 1E1CA 4HDOB 4TYQA 4FMCB 3EIWA 2YZ2A 1Z8DA 3J81k 3EEFA 4YR7A 4PNEA 2X1MA 3NHMA 1PCXA 1ZI6A 4N9WA 4IGKA 5E2AA 1X19A 3ZV3A 3AHDA 1V7CA 2DX7A 4OQNA 4ZDKA 1Y5IA 1FSGA 1U3TA 1CUGA 3UB3A 2XMQA 3MOSA 4B3GA 3OC0A 4BJ6A 3FGOA 1N9ZA 2C7GA 4DQDA 4TWAA 5LMZA 1C9JA 4XWGA 3EXIA 4C2BA 4A2WA 2C5AA 3G5LA 5JU6A 3PYMA 4CMIA 1TLTA 4Q47A 4NMLA 3HVJA 1F6DA 4I9HA 1LJ8A 5ARBA 1WB9A 1Z8HA 4PZPA 4XM2A 4CTOA 1Q19A 2H4FA 4I5SA 2AEFA 3KOWE 1SVMA 4ZZIA 4DNQA 2ZUDA 3ZJ5A 2A6PA 3ZJVA 1SVUA 2ETVA 4G4RA 1TM7E 3OZIA 1E89A 4Z6YA 2O2JA 1KAEA 3KELA 1HYBA 3D6FA 4QTXA 2YS7A 4FFBA 3LYAA 1VMEA 4FE3A 3WNVA 2PGOA 2W2OA 1Z4KA 2HPVA 3EPKA 1VHTA 4YI5A 5I9NA 4RH1A 3DYVA 4TV9B 1WPQA 1XRRA 1E7YA 1E6KA 3D3NA 3O1JC 2ZRKA 3V8VA 3NV9A 4UCFA 3U4CA 2XPCA 4LZLA 1X42A 1WU7A 4L4SA 3U39A 2WU8A 5HSGA 2QD5A 4DUYM 1LDNA 3JX9A 1EWKA 4Q6BA 4P7BA 2JG3A 3PK0A 3OJXA 3OF2A 3HADA 1E2JA 3MCAA 2WF6A 4N0DA 1D2NA 1XRPA 3Q1LA 4V0MA 2XECA 5LA6B 5JRDS 3W3AH 1GLNA 4XUDA 4S05A 1E6EA 1GSIA 1XZKA 2C4MA 3NTQA 3QUBA 4CLOB 2FP3A 2HIHA 3FTCA 5ALVA 2X4LA 1TAGA 3RFFA 4FINA 4BMSA 3SBDA 4AJNA 1VDZA 4P0PB 2JGFA 1Y1KE 2C4NA 5JVDB 4CF3A 1NLZA 1HUQA 2GAAA 1U28A 4KB5A 5AW5A 3BIFA 1X3SA 4OFBA 4M87A 3S7ZA 4HJRA 4ZZ1A 3VM6A 2P4UA 1X80B 2A94A 5KJEA 2O7NA 1OXKB 3CX8A 3PQ3A 5IF3A 5EIXA 1RJWA 1T5OA 1T43A 1EX7A 1H2ZA 2XYPA 5KKNB 3U6KA 2UYQA 3ET4A 4LCBA 3C74A 4ZK2A 4ISCA 1YE8A 4IGIA 2Y92A 4AX8A 4I50A 4PT5A 4IEEA 2H1RA 1VP9A 1LUAA 4FGSA 3RFTA 3RD5A 2EERA 4FFWA 1QGZA 4JVOA 4ZFNA 5T6MA 2CJWB 4RTSA 5JCJA 1CCWA 2IXDA 5C7IO 3OEED 2DM6A 2LVAA 4BZWA 2HHJA 5K8CA 3OQHA 1II0A 2W2LA 1X1QA 4FGLA 3SZ3A 2W2TA 4UHEA 4IQ8A 2FPGB 4KXXA 1WMEA 2OPBA 2LD4A 3GGDA 3FPSA 4G63A 3VI4B 4C6TB 3TGPA 2RHCA 2F48A 4ANRA 2FEAA 3SNHA 1N1DA 3DO6A 5DNYB 4WY8A 1UBOS 1F38A 3ER6A 4WCDA 1VJRA 1TZMA 3TSZA 3KB1A 4KGZA 3CVXA 1NLFA 3Q7QA 3JASB 4QPDA 2ZLBA 1XDZA 3NR2A 1TC1A 2NSJA 3U7EB 2JHGA 1TTPB 1K3XA 1TYBE 2JJ8A 3T94A 4UVEA 2XTAA 1ZW6A 1IHOA 1TJYA 2HOQA 4RGVA 2AUNA 2F43A 1P1BA 2AXQA 1E9RA 4CXMA 4MK4A 5EEGA 3IAM1 3RROA 4NEGA 2GAFA 4EGAA 3L40A 4GRAA 3SEAA 3OHSX 4C01A 2XB6A 3CNHA 2BBSA 4ADSG 1OTHA 1VPEA 2CL7X 4FFSA 2ET6A 1YRAA 5AKLA 2QTRA 2AZDA 4G5YA 2F6RA 1YZHA 3ZOZA 4BNNA 3K9OA 2I4NA 4IQGA 4DCUA 4WFIA 3LE8A 2CHVA 3GPXA 1G7CA 3W8DA 4ND8B 2NPFA 1V9SA 4QYMA 4Y9SA 3RYCB 1H65A 4GOOD 2Q6IA 1CQWA 3ZWOA 3RBXA 1J39A 1GJSA 3L7OA 4EW1A 2J3MA 821PA 2DH6A 3GJXC 2PRSA 4RL4A 3ZXYA 4BGDA 4MCAA 2YHAA 3HR4A 4AWXA 2VQSA 3EF3A 1WHTA 5IBPA 1HG1A 1ACJA 2QV7A 3CZ9A 3TSWA 4F45A 1PGOA 1R9JA 5KO3A 3T3IA 5ELMA 3D1LA 4LNHA 1YB6A 5EZ6B 1EINA 5BWLA 4I50F 4V0SA 4BX0A 2KHZA 4NBSA 1X2EA 2IHJA 4QPNA 1YRWA 2HWXA 5F5XA 5EP2A 3QVWA 3ZNOA 5TT0A 3FFAA 3BL6A 1QDEA 1LDYA 2B94A 2W6ZA 2OMKA 3A4YA 2VL7A 1H2BA 3VSDA 3NEAA 3P2KA 1JHAA 5JH7B 1XO1A 3RAGA 2HNBA 1NV8A 1LLFA 2V7GA 3QW2A 2XJ9A 2CSXA 4GKAA 5D85A 1QQWA 2AOVA 1I10A 1K5PA 1J1IA 1H3EA 2FWRA 4BWYA 2ZTMA 2QQ5A 1E9BA 1KI4A 1OVMA 2WJHA 2GX6A 3EEYA 2CD7A 3MMSA 2JLAA 4UTRA 1YK0A 1VA5A 3ESXA 3ZWNA 4FMDB 2TECE 2XTMA 1J07A 2FMHA 4HH3C 2J5KA 1T9KA 4X9XA 4Q1AA 4GOMD 1RCTE 4IF4A 3FOEC 4MVJM 3SC2B 2GTHA 4XD7D 3CLSC 2H9IA 1PJAA 1B6GA 3ILXA 2EZTA 2HZ7A 5DBIA 2BAGA 2C2GA 3IHKA 3DVLA 4IDOA 1IMOA 2GN8A 2NSDA 3THWB 1VEKA 4JELA 4DKXA 4YUWA 1LI5A 1ISFA 1M8FA 1YB4A 1IY8A 3UXYA 3HHPA 1YQGA 4P0TA 3C1UA 1JPVA 3VSEA 4DBLC 2HH9A 1D0IA 1ZEMA 2B8NA 3TTUA 3CX3A 1O2DA 4Q9LA 4R9RA 3W90A 4P84A 3VX4A 5EZQA 4H59A 3K71B 2HU8A 4REQB 2XSZD 4ALNA 4GZLA 1VP3A 1I0ZA 1H1LB 1P0PA 2NQTA 4PTYA 2WWGA 1BOOA 3LYLA 3V8MA 5KNDH 4Z9BA 3T4EA 1NHGC 3KB8A 1HH4A 1D6SA 2C3UA 1L5GB 4P16A 3PF8A 3D0RA 5DCWA 3B9RA 4II3A 3ZGOA 4D96A 2EFHB 4DYDA 1ZC3A 3R3UA 4YJGB 3IMEA 4LHSA 1EGQA 1XZBA 1XCJA 4FOTA 4KR6A 4DSZA 5KKCA 2C7BA 3U44B 3AJRA 1MDBA 5J2UA 4BB6A 4G97A 1L1EA 2OBLA 3NYWA 3EZLA 4Q1CA 1RQ7A 5LP1A 3PGJA 1ZM9A 1PLJA 1YE5A 1HTWA 4D79A 4ARBA 1LSJA 3EGDB 4CKWB 2R11A 4UOEA 5JFOA 1N75A 2OO5A 2X2OA 1N6RA 3FSRA 5AIBA 1E5XA 4R40A 2QAJA 3A98B 5EQJB 5DMHA 1WLSA 4JBIA 4ZCQA 4W6ZA 4YH1A 1OHHD 3D7RA 2I3ZA 4L6AA 4D43A 1TU0A 4RJLA 4R1PA 3HX3A 4XJSA 5JDIC 3DC2A 4Q15A 3IL2A 4EQ6B 4P08A 3FGNA 4LJ6A 4A5OA 3Q2KA 1PAUA 3LQQA 2LBCA 1I4OA 4RHYA 3CPJB 3AONB 1DLJA 4YX9A 1BJRE 3VAAA 4KYUA 5FTWA 4IHQA 4RETA 1O4WA 3ZDXB 4KQWA 1B2RA 3EGIA 1TH4A 2D2EA 3I6BA 4ZQEA 4CISA 1ISRA 3PUJA 3HI4A 5GONA 1G9TA 4IDCA 5BR7A 3AR3A 2L18A 1CIPA 4UDOA 3CH6A 3Q8XA 4YMUA 2FQXA 2NXWA 3ZZMA 2B69A 2R4TA 4V0RA 2WKWA 4RQTA 3CURA 3VC3A 1VHQA 5DM60 3D8UA 3QE4A 3WLMA 3RVQA 5H7XA 3MPUA 4JI6M 2VHZA 5F3RA 2X9NA 2OM6A 2AX3A 5C8YA 4YWHA 2XE4A 5SZIA 5TQ2A 1N9KA 1KEUA 1GUAA 3F1LA 2XGOA 4OKSA 3LUAA 1VOTA 1DEAA 2FR1A 5P8WA 2GJKA 3Q15C 1EESA 3V7FA 1ZRHA 4LFBM 3IIIA 1GUYA 2FPXA 3MXTA 4LHXA 1I94M 3MA0A 1RXUA 5JY1A 2HCRA 2AJLI 3AVPA 4ZPXA 3USZA 3ECCA 3FAKA 1DELA 1ITZA 3AHJA 1FS4A 3OIYA 5T7BA 4ZVRA 5J2UF 2EVWX 2IQIA 2LVNC 4OHZA 1WUTA 4BU0A 3P19A 4FEEA 1VDDA 4TRJA 1V95A 5M7EA 3WGGA 1XGKA 1DO8A 1XZDA 2EGUA 4WY2A 3PUZA 1T4CB 2OQRA 4XDZA 2HYDA 2X5XA 4EB6B 1PKEA 2KI5A 2I2DA 3I1FA 3TN7A 2OB2A 4Z9YA 1GT91 3EB9A 2HWKA 4K05A 3A3NA 3VOSA 2QGNA 2PA3A 1ISPA 1QIEA 1JG3A 5CGZA 1H6DA 1F2TA 3V48A 5FTMA 3DD5A 5LQKA 1ZJ5A 5LMCA 4UNNA 1SKQA 4K6CA 2MSCB 1FRQA 2PZJA 2DJ5A 4QOHA 4IIGA 3CKMA 3WIDA 5E9WA 2XB8A 1CPYA 4R0MA 4XWOA 4URXR 1NJ5A 5KU7A 1NGSA 3PFIA 2N9UA 3D6JA 1X9HA 3WYNA 2FY8A 4ZVOA 5FTKA 1TUIA 3S1AB 4EKYA 2NZXA 3RBVA 1E2BA 4HNHA 3OZXA 3RSFA 2OQ4A 1THZA 4I19A 1Z39A 1CULC 3THGA 3GT3A 5KCZA 2WP8J 3OCZA 1X9IA 5EIAA 4GVLA 4JN6B 3FTNA 5GONF 4DUZB 2YINC 3L8ZA 4FJ1A 1AS0A 2QT0A 2YV2A 2DHQA 4OSPA 4BB5A 2WE7A 3OTWA 4A8JC 3JQGB 1Z08A 1T6NA 1DRJA 2GA8A 1NRIA 3O4FA 2F5SA 1CZRA 5HRAA 1X7YA 3PD7A 3QA9A 5A71A 1MB3A 1QQ5A 3AQIA 4IXMA 2BTEA 2WAMA 3TEJA 1PZGA 1DDGA 4R51A 4GC5A 1KEEB 2GK4A 2YOHA 3DB2A 4CEHA 5C8YF 4HD8A 1U3WA 4F5YA 3FROA 3R0IA 3VHLB 4FDMA 3VC7A 3M1AA 3R7SA 4ZVMA 4YXWA 1XLTC 2PH3A 3O2JA 4NFHA 1H0RA 2ZIXA 1WS6A 4GPTA 4DPLA 3U5ZB 5F1PA 3OLWA 2HC9A 4UTVA 2JLUA 1T4MA 2HNKA 3KSXA 2ORWA 3MCVA 2BFMA 2VHQA 3I1JA 4AURA 5C34B 1UF9A 2QQ8A 5ED4A 3AP1A 2WFZA 4P34A 4LZWA 5DKFA 3BIOA 2ZB4A 4PO3X 3QSGA 1C7EA 1GA1A 2IYFA 4C7OA 2ZE8A 2P90A 3DOJA 4Y6LA 4DKJA 1U6KA 3RVBA 2YYZA 4A73A 2V8BA 3PCTA 4LVOA 2Z83A 2O5RA 1ENYA 4AKTA 3ZXSA 3MTAA 4XB2A 2GD0A 4NCNA 1VJCA 1XAHA 3DP9A 2QLFA 1S0UA 4KH1A 4P53A 1C3OB 2C31A 2QRQA 3JAKB 4HF7A 3WOHA 1IBMB 2GM9A 2FSHA 3II6X 1IQ0A 3LVWA 2V0NA 1QH8A 2AT1A 4G1VA 2YN2A 1JDTA 3G0CA 4MKFA 3DVSX 3SYTA 4EJ0A 2HQOA 2YXDA 1RRVA 2YRFA 3EOAI 4JI6B 2FSVA 3PNKA 3KE9A 5IABA 4M3NA 1KA9H 1KIAA 4U7GA 2VPZA 3G49A 1UXOA 4PNZA 1QB7A 3ZIAD 4JL8A 4OXRA 1UBFA 3GBPA 1OWOA 4Z3KA 4IMIB 5FV7A 4H7FA 1T8RA 3TLMA 2IEAA 5G0WA 5MFPA 4D3SA 1FJ2A 1XXHE 4C4PA 4R8LA 2EAUA 4IGFA 1JPNA 4E5DA 3DL2A 1ZIYA 4Y1RB 1CHNA 2IS2A 2XUKA 1I94B 1DJQA 4HQKA 5CYGA 2R7LA 3QW4B 4C06A 3SM9A 3IOYA 2HT6A 2UUPA 2GZRA 4MHTA 1PSZA 3ZCXA 3KFLA 5CA1B 4J3FA 2I6SA 4UOQA 2JFQA 3L01A 1SXJC 5FFFA 1Q1NA 5HKKA 4N01A 5HE9A 1IRXA 1Z5BA 1T2DA 2QZ9A 4JODA 3ZV6A 2I1QA 1F4VA 1ZJYA 2CKDA 3WLKX 1QK4A 4KXLA 1R27A 5JNTA 3AB7A 4GBMA 3FSJX 4B2YA 4WCFC 1NC1A 3DVRX 5TS2A 5JPIA 3QVOA 4EEKA 3GY0A 3HU5A 2FWNA 4X5OA 2DVMA 2RC6A 3EPPA 4KL8S 4RVCA 1JR6A 3ICPA 2JGIA 4J7XA 2XXAB 3KFVA 1A50B 3M0EA 3EEQA 4AAYA 4JLVA 1CLUA 1Y9JA 3JR7A 4B7HA 1I3OA 2PX8A 4X8LA 2QD4A 2JEZA 3GB9A 2PEZA 2VDWA 5A02A 1OIPA 2D3TA 1PZEA 1U98A 1R0CA 1DL5A 1VPDA 1P17A 1PS8A 5A62A 5JECA 8GPBA 4KG7A 3TUIC 4AULA 4G4JA 3WJ1A 3NGXA 2CBXA 3OD1A 3ABSB 3CF6E 4WLNA 7REQA 4ZVKA 3A2NA 3TCKA 5J4YA 3JQAD 2VTVA 2DKLA 1KDZA 2P5UA 4MRAA 4WBSA 3V6LA 2ST1A 2VUIB 1V3VA 1OV6A 4CL2A 2A35A 5EPEA 3WBBA 4IXDA 3TE6A 3K32A 5LN1A 4JSRA 2NVOA 3IV7A 2CNOA 4KYIB 4ZO7A 4B6RA 2FR8C 1ZBQA 1CDOA 1NFQA 2FS1A 1EUQA 3D02A 4XD7A 3EXAA 5D51S 1TOAA 3THYB 5DWVA 5JXIA 1EWQA 3X2FA 5CJJA 1PNQA 4AN4A 3RFUA 4MKGA 1R64A 4GRIA 3TEMA 3GYGA 4OBBA 5FPQA 3MFYA 3P4YA 1L4NA 2OGZA 5DLEA 2N47A 1SG0A 2Q50A 3PHJA 1TFUA 3U40A 3RUPA 3LA6A 3ZDDA 3LK7A 1CYEA 1KYIA 1ZVMA 3ANNA 3KSDO 1CS4C 1W5TA 1II8A 1ZXXA 5TMBA 1DPFA 2PUVA 3UYKA 1U65A 1UOEA 4G8BA 3MWEB 5C1OA 2A1IA 2D62A 2GM4A 2ZK7A 5LD2B 3Q8KA 3LRPA 4G0QA 4BO1A 1W4CA 4EA9A 2C2OA 2VJMB 4NV3A 1BCRB 1UK9A 4YMHA 4RHEA 1EDBA 2WZCA 4LTDA 3S44A 5BW5A 1PJ3A 4FUTA 4W1RA 2RHDA 5CD9A 3PA6A 2WOJA 2GNOA 4I1IA 3N0RA 3PP8A 5EZYB 3DDOA 3W7VA 1VLJA 2DPGA 2D7EA 3TB6A 2PGIA 3VPXA 2PLFA 3WG9A 1YR1A 1U0NA 2ZZNA 1ZG3A 2CXPA 4US1R 4PR3A 4MUFA 1BH6A 2VC2B 1CJMA 3M9LA 1H3FA 13PKA 3L4JA 5F7ZA 4EHIA 5REQA 2Q2EB 5GIOE 4QEDA 2BHTA 2ODTX 3ZE6A 3CLUD 2IHYA 1WHSB 2JGEA 2E85A 4A03A 4A2CA 3PQCA 3F97A 4TLAA 5AK5A 3IXMA 2M6KA 3ZWYA 3BHNA 3TIFA 2E4VA 3MINB 3B5EA 1VGVA 1USIA 3QUCA 1HEYA 4OHXA 5BSHA 2Q1TA 5AM3A 1GZ6A 2IHNA 1WNTA 1IG3A 2X19A 3TMYA 2OENG 1IN1A 4CDGA 3LQ1A 3R6GA 2GN6A 1YJAA 5L9AA 1JQKA 3Q87B 2WFAA 3QY0A 2ORED 1QRUA 2H9YA 2HJHA 5EL0A 2PQ2A 4UNSA 4INAA 3BGSA 2BDTA 1JB1A 2LP4Y 2LDXA 1DQRA 1JJBA 3ODGA 4XCVA 4L16A 2YTZA 3BMQA 1NXQA 3H1FA 3GT4A 4GH9A 1Q2UA 3QI7A 1IG0A 2ZB7A 1ODSA 1VHDA 5F2NA 4JVNA 4IGAA 2AKEA 1JEQA 1HSZA 2FMFA 2HK6A 3L4BC 2R00C 4WFKA 4MA0A 3D6MA 4TM8A 4U3JA 3F8TA 1YZQA 3E5RA 3ZI0A 5LLSA 2QVLA 1QOQB 4IIJA 4ROSA 2OD2A 2E3JA 3DE4X 3PI6A 1HLPA 3MELA 1ZD4A 5ILOA 3ZK9A 4ZAYA 4E15A 2GLUA 2VQ6A 2GJ9A 2WINI 4HWOA 4BLTA 4Q48A 1JDUA 3IA7A 3DLPX 4RZIA 1AGRA 3KYCB 4G4SP 4NBRA 1LW6E 3CEMA 4HNAB 2Z7JA 4PYLA 2JA1A 4QBIA 3DFKA 2B0CA 3K73O 1N7GA 2X58A 3EPHA 4Q7QA 3EFOB 3USCS 1TA4A 4EB0A 1DGHA 1P9RA 1I0IA 3EXG2 2G08A 4RAOA 2HGSA 3OA0A 3WK8A 4IWNA 4ZRMA 2VSQA 3OP1A 3D1VA 3ELWA 3L79A 1NAHA 1N2HA 4IICA 2FUNB 3AUSA 1CIVA 5C53B 4FHZA 3KOOA 1T6XA 1YAJA 1GGFA 3KHTA 3W7BA 3PGMA 3FCEA 2QTWB 4GS5A 1X6VA 4DLVA 3LBHA 4UQOA 3N8GA 2BBOA 5B4UA 5JWHA 1ESEA 2R1ZA 1IIBA 1NMQA 1FMTA 1VLMA 2QL7A 5A4MS 2CHUA 1SUSA 2H4XA 4J2HA 4N8SA 4X66M 5I7OA 1QAMA 3FMPB 1NVMB 4MVWA 2ZBKB 3CUKA 3IQHX 5AJZA 4ZC1A 5JFTA 3RSOA 2OGTA 3UK1A 3NOQA 4CQLB 1Q11A 1GFWA 1OYWA 4GZ5A 2R8BA 1QHYA 1CUKA 4HDMA 1Q44A 2HD4A 4M0DA 3Q8GA 1C3VA 2ZT8A 2WKRA 1VGQA 4PC6A 4R83A 5TQJA 4KIJA 3ZDQA 1T4GA 2XYVA 1G3UA 2WABA 5CA0B 3AI2A 3SIWA 4C0QC 1UT8A 2R7NA 2X7HA 2GVDC 4G4QA 1SQ6A 2D5IA 3W6UA 3T5DA 5J3JA 3HHWA 2AHRA 4IIJF 4DDVA 3FIJA 3ZW8A 1ZVJA 1G8JA 4XUEA 2IKSA 4D0SA 3R7LA 2C99A 2C9DA 3LC0A 4OH1A 4QHYA 3FWYA 5H8WA 3UENA 2VRCA 4QBGB 3GPUA 2GLTA 4OM7A 3SR4A 4LJSA 1OFUX 2HK9A 3EODA 4KWHA 2G70A </