4LJ5A

Clpb nbd2 from t. thermophilus in complex with adp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
331
structure length
320
Chain Sequence
MEVTEEDIAEIVSRWTGIPVSKLLEKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
molecule keywords Chaperone protein ClpB
total genus 97
structure length 320
sequence length 331
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj5A01
4LYAA 3GJ6A 2GJ8A 2WZQA 3KQNA 2LKCA 1MT0A 5EP2A 5DHFA 2RGNA 1S2MA 3QOFA 3U7GA 3B7GA 4QXAA 2J87A 3C7KA 4HDQB 1N5LA 4KBFA 3SBEA 2O8FA 1ZVQA 1W0JA 1T8UA 3HJNA 3CZPA 3VR4A 5DN6A 2GETA 3DHWC 4RCZA 3THXB 3RWOA 5HR5A 3EIHA 2DFNA 3BB3A 1XMJA 1G7RA 1G8HA 3VKHA 5LBIA 4US1R 2KI5A 5FTLA 2F43B 2LCFA 2HT1A 3BBPA 3FDIA 1FOEB 3WBJA 2EWVA 1N6OA 2ZREA 1GZSA 4JVNA 4MA4A 4JKYA 5FTJA 2YC4C 1LW7A 4JJZA 1FP6A 2QP9X 4MITA 3BS4A 4TWZA 3VNUA 2BC9A 4OQMA 5JWRA 1XTSA 1OXTA 2WKPA 3IQXA 2GCPA 3WYGA 3P32A 4ZDJA 2QORA 4B2LA 4BQSA 2GKSA 2HYDA 2OBNA 2H57A 4IOMA 4BLOA 1LFDB 2VP9A 4D0NA 2ZPTX 2F43A 3UMFA 1G5PA 4GSYA 2JJ8A 3GLGB 1A82A 2K5UA 3D31A 4EPRA 4QGAA 1JAIA 4I99A 1SXJE 2OLJA 2WICA 2Q21A 2CEAA 3U5ZB 1FQKA 2ZJOA 3LH5A 1LV7A 5FOUA 3ZD6A 2BKEA 2R6DA 1AM4D 3ADDA 1II9A 4EQ6B 4LHWA 1XB2A 5CJ2A 1NVXQ 3AEZA 2FSFA 3NHBA 4Q9IA 3QEJA 4LV6A 4ARZB 2ODWA 2QBYA 4DB4A 1A2BA 1P61B 2BCJQ 2I3BA 4HAVA 5SZHB 2QPTA 3NWJA 2JLWA 2FX3A 3FFBA 4HAXA 1V5WA 4ASUA 1Z08A 2HJVA 3VR6A 3N2EA 4G01B 3E70C 4MYHA 2HYIC 2WPDA 1VYUA 4B76A 1KGDA 4QJ5A 2EFEB 3AVQA 5KU1A 3GLHA 4A6XA 3IO5A 4XWOA 3CH5A 2O5VA 4JSTA 3BXZA 2O8EB 1H8HA 4P4SB 2W0SA 2Z0MA 1SVIA 3UANA 2PJZA 5TMPA 1WP9A 4BECA 4Q1DA 4CT5A 5DISB 1E1RD 1Z2CA 2AR7A 5E4FA 5G3ZA 2D7CA 2O0JA 1HY3A 2AD5A 2ZUDA 4Q7JB 4GRAA 4A2PA 4ACBA 4B43A 4CIDA 1W48A 3B1XA 1N6HA 1OYWA 1DVRA 3Q85A 1NJGA 2FFBA 4WZBE 1KO5A 2QPAA 4LRSA 3EARA 3OIUA 4BRUA 1C9KA 1HT1E 1G5RA 4JVMA 4PAOA 5FPKA 4RKFA 4A8JB 1E2DA 1LS1A 1II8A 2WIAA 4DXAA 1JXOA 1TF7A 4Z8YA 4JLPA 5H68A 4C7OB 3QG1A 5A4JA 1FTNA 1UEIA 2FGKA 4NP6A 2ZE5A 3L0IB 3P4XA 4HLCA 2VF7A 4HLUC 2FU5C 3ASYA 4LUCA 1KSJA 4PHGA 3K9HA 1G16A 4YDHB 3LDAA 4FXPA 4CRWB 1CULC 1FW6A 1VCOA 3CR7A 1Z47A 2AK2A 2AKYA 3OESA 3WYFA 1K5DA 4L16A 5EE0A 1SVSA 5HE9A 2OCBA 4JVLA 4F93B 5JCZA 2JJ1D 4YMUA 4XVRA 2G0NA 2FSIA 4JT2A 4XD7D 1G41A 2EFDB 3MGCA 1QBKC 2IYVA 4R7ZA 4G5RA 3HR7A 5AUOB 5L3QA 4M1MA 5AR1A 3CF0A 3I62A 4D80A 2XITA 3OF5A 1MRSA 3U6BA 3AVYA 2XNSA 5BN3A 3PQCA 3HR8A 4BE7B 1IN6A 2V55B 4GMDA 5HTKA 1XWIA 2QENA 1ZINA 3K0AA 2C96A 1E9AA 2WAYA 2CCGA 3BGWA 3K0CC 2O0HA 3TMKA 1OFUX 3OEEA 5FOTA 4ZCLA 4P4TA 4A3VB 1XCGB 3B1WA 4MKGA 5FL3A 4B6EA 1PV4A 3TQCA 5DLQC 2AD1A 1GNQA 4B71A 3AVPA 4GT1A 4MYTA 3ZVNA 1KK1A 1NN5A 1KMHB 1E2MA 2QG6A 1OE0A 1CF4A 1UEJA 2NIPA 5CK4A 2QI9C 1P2VA 5FFMA 1X8JA 3TLXA 4FIDA 2VP2A 1QHIA 1KNXA 4PAMA 1G21E 2PX0A 4D82A 2XNDD 2FV8A 2WV9A 3LLUA 2GCOA 3B1ZA 5B30A 3GJ4A 4LX0A 4AKIA 1K8RA 1Z0DA 4IW3B 1VPLA 3L0OA 2W2TA 3IHLA 4Y0VA 1P73A 1JQLB 4V0ME 1M7GA 3Q7QA 1JAHA 3ZQJA 4CEIA 2CL0X 3UG7A 3X2SA 3LW8A 1W47A 1N25A 4HAWA 1KY3A 3NC0C 4JSYA 2DY1A 5FPYA 3EX7C 3I3SR 5EP4A 1E9SA 3V9PA 1G19A 3NBXX 3BFXA 1JR6A 3AP1A 1KSHA 1ZNWA 4S35A 1W0KD 2XNDA 4YONB 3UXMA 4FINA 2J0UB 1E9EA 1U0HC 2HDNB 1SVOA 4DDUA 1E79A 1U99A 1R2QA 3PXGA 1OXVA 2V1UA 2R6AA 4CEJA 4AURA 1E9FA 2VSFA 4BFWA 4IEIA 4GMXA 3TRFA 3KQKA 2MSEB 1NNEA 3ND9A 1YR7A 3CNOA 2ZSFA 1MOZA 3GFPA 1E2KA 4BZXA 3KTAB 3TK1A 1XF9A 2A5FA 3MMPA 4GBMA 4FMCF 2NO9A 2JJ2A 2QAGB 4BFZA 3O8BA 1ZBDA 1GNPA 1TQ6A 3QUSA 3VX3A 1UKZA 1P2SA 2YC2C 3H1TA 2BBOA 1UKYA 2IYRA 3LA6A 3ETLA 3GQBA 3CZQA 3CWZA 3Q9LA 4LJYA 2IXFA 4TYPA 1GP2A 4L4UA 1JXMA 2RGNC 4O2LA 4Q4AA 4LRTA 2VO1A 2KJQA 3PEYA 4J0QA 1XEXB 4NH0A 4G5SA 4FMCB 3W5JA 4P31A 1EK0A 5G3YA 1GUAA 2BEJA 1G7CA 1US8B 4URZR 1V43A 4HAUA 4OI2A 1MO6A 3TVTA 1M2OB 4LI0A 2G3YA 1A7JA 1W36B 3FWYA 4OHXA 1Z0IA 3A4LA 1OKKD 1U9IC 2ZRFA 3MG9A 5BYKA 1EFRA 2GJSA 3VR2A 4PQRA 1ZIPA 4KSCA 4MUAA 1MO5A 4QC2A 4XTCS 1XZQA 1NG9A 1W36C 1ZJ6A 4JLNA 1VECA 3RANA 4M1TA 4NYJQ 1E4YA 4B34A 1E0KA 3C5CA 4ZPXA 1Z6XA 2WMNB 3D6TB 2AK3A 2QMHA 4II7A 3THYB 5FOXA 2Z83A 2DWPA 2XZLA 3LV8A 3EPLA 4A0RA 2IHBA 1GRRA 1A2KC 1IAQA 2EFGA 2NQ2C 2V1XA 4IDNA 3QF4B 2GXQA 3RSLA 4N3NA 2OCPA 1W2HA 2ZR9A 2AX4A 2GILA 2Z4SA 2XTMA 4D4LA 5BN4A 3GD7A 3GP8A 4NCIA 4L9SA 3U4QA 1IOZA 4PQYA 3CF2A 1XXHB 4B3FX 3CUEF 2ORWA 4GOKA 2BOVA 3TKLA 1P60A 2IF2A 4TMZA 5FUWA 2ZANA 5D3MB 2ONKA 2P5SA 1N6IA 3LBNA 2R2AA 4DRZA 3LX5A 1JEEA 4ITRC 1OFIA 4FW9A 1COWD 2QE7A 4Q19A 2A78A 4KI0A 1JNYA 3K8YA 2VHJA 2OO7A 4DSTA 4LV5B 3T12A 1IN5A 2ZRDA 2P2LA 3OEHA 4DCVA 2DVWB 1CJMA 3U3RA 5KSOA 2Q9AA 2RGEA 3BRWD 5FBQB 1MO4A 4PZYA 1Q1ZA 4RZXA 2QMUA 2QEQA 2ZYTX 3ZZ0A 1W49A 1UPTA 1BYIA 3K0CA 2ZJYA 3WP1B 4AYXA 5J4KA 1D2EA 3NXSA 4BFVA 3OZXA 1WA5A 4OHYA 1E69A 4EPXA 2GAAA 3I8XA 4M1SA 3GEIA 4M53A 1EFTA 5JFGA 3B85A 1TAGA 4IXNA 3GJ3A 1I2MA 3O47A 4KXFB 1NN1A 3VR5A 4B6FA 2FFHA 4CEHB 4PSKA 4C4PA 3ZLJA 4HAYA 4D0LB 2J7KA 1P72A 1Z2AA 1Z28A 1JEDA 4BLTA 1QHGA 5L3QB 2D3WA 2OXRA 4BLRA 2O8BA 3BH6A 1W5TA 4BFUA 1PLKA 4AC9A 5HKKD 4DT1A 1KDPA 3OFNA 1D9ZA 1G8GA 4DIDA 1KJWA 4Q03A 2JLUA 1NY6A 1XPUA 4G5GA 2DZOB 1BO6A 1ZM7A 5G40A 2FPMA 4D81A 2VBCA 4OHWA 1ZCBA 1R6BX 5AJWA 2OXCA 3JVVA 4BZPA 1U94A 4D4JA 1VMAA 2GXAA 5CYPA 3BFKA 1KZGB 4L15A 4F4CA 1E2QA 2ZJ2A 4B2IA 1ANKA 1G20E 1IY0A 3T61A 4B75A 2DFLA 2QMOA 3KB1A 3PJRA 4LWZA 2CHVA 1YVDA 3EAQA 1G6HA 4OJQA 4TZ6A 4OKSA 5CM9C 2IYYA 3ZJYA 4GOXA 2F55A 1M34E 3W3ZB 4WOPA 2GCNA 2OAQ1 3AP3A 2CK3D 2ATVA 3GLFB 3CF6R 1KAOA 4Q9KA 3RS5A 4M1KA 1WF3A 1JBKA 3SYKA 1QG2A 5L8VA 2J0QA 1GIAA 4NU0A 3M6AA 1KI2A 3LD9A 4LZZA 4XSHA 3VU9B 3C4JA 4MQBA 3RRNA 1HTWA 4DDTA 3AP2A 3P20A 5EUMA 1SXJB 5EXPA 2ZSEA 1OW3B 2ZRKA 4Q7LA 5JWOA 1KDOA 2AXPA 2FSGA 2YHSA 2V6IA 1ZD8A 1VHLA 4JN6A 5UKDA 1NSFA 2JJ1A 1XD2A 1RVDA 1NI3A 2QQ0A 4EFLA 4P0TA 2QTVB 1NVMA 2DCUA 2WBLC 4P3YA 3ZQ6A 3EIQA 3BB1A 1E2EA 2ZR0A 4LYFA 1KI9A 2CXXA 3DKPA 1LVGA 3QY0A 1XZPA 4Z8XA 1MV5A 1W4BA 5AJZA 2YOHA 2FPLA 4FMDB 4OQFA 2VTKA 4PC7A 2X2FA 3SHFA 3FKSD 3PUWA 1TF5A 3CLVA 4HI0E 4A1FA 4F4IA 1XEWY 3SHWA 2ZEJA 2P67A 5EP1A 2ZM5A 1TMKA 2TMKA 4PC6A 3LLMA 1VCNA 5EUQB 4HB3A 4PHFA 4ZIRB 2V3CC 1TF2A 3LVQE 3EZ6A 1OHHD 2C04A 1RJ9A 1R8QA 2ZU6A 1OKKA 2FE4A 4LJ5A 4R9UC 2EW1A 5EE3A 3SYNA 3R9WA 3ADCA 1UBCA 5EZ6B 3BH0A 3EA0A 1XMVA 3DKVA 3GLHE 1GOTA 3MJRA 4LJ6A 1YHNA 1E1RA 3AUYA 2IUTA 5DSZA 1NSTA 1NIJA 4V02A 1FZQA 2W00A 1E1QD 1Z0JA 3JVUA 4KV9A 1ZP6A 4HLQB 1E6CA 4IVRA 3U7FB 3I5YA 4YMSA 1R7RA 4AY2A 1BYUA 1GRNA 3SNHA 4FCTA 3K0FB 3K1JA 4ZCIA 2FGJA 2VP6A 4ABYA 1AGPA 1HH4A 5AJXA 2PBRA 1PVOA 2BV3A 3QXCA 1YZKA 2IXEA 1G3RA 2F9LA 1G7SA 4QM7A 2HCJB 4I1SA 4R2IA 3IPYA 3TR5A 2D62A 2GEUA 5SZKB 3QKTA 4EIWA 4KFUA 4PTLA 4DCUA 1FMLA 1NY5A 2X77A 4Z54A 1Z6AA 4Q4HA 1WB9A 2B8TA 3NEYA 1NLFA 4AKHA 1QG4A 3I73A 3CB4A 4Q4JB 5B57C 4E07A 4IJMA 4D2IA 5LDDC 1QHSA 2VQSA 1N0UA 4RD1A 2CK3A 2QGNA 3KDSE 3CRW1 4Q1CA 3A1WA 4TTQA 1KI6B 2OV2A 1PZNA 2YWGA 1IN4A 3HYTA 4ZIRA 4HB4A 3K0AB 5CYOA 3RS2A 4M9XA 3F3YA 4B74A 1Q3TA 2GAOA 1Z83A 1X37A 2C5LA 2J3EA 1VG1A 1ZCAA 1FFHA 4A8JC 3PEWA 2XOKD 4KVAA 2ASEA 2JEOA 4M9QA 2OLKA 2RMKA 5CIQA 3CONA 4QBFA 4NZYA 4TL9A 5JJLA 5JLJA 2ZE7A 1UDWA 2W2XA 2VLIA 5AUPB 4Q5IA 1GKUB 3QXHA 4NL4H 3TE6A 3K09C 3VKWA 4QNMA 1YR6A 1EX7A 5DN6D 3RC8A 3MLEA 4C0HA 2P0EA 1ZNXA 2WWXA 4M1WA 2CL7X 3WMFA 1Q1BA 4ZCMA 1LY1A 2IHYA 2V9PA 3MRSA 1Z0KA 3C8UA 3GEEA 3I4LA 2Z4RA 3W9YA 3X1XA 2GZAA 4B47A 2J7PD 3B9PA 1DADA 3J81k 3AF2A 3R20A 1N5IA 2B8WA 2ZRPA 221PA 4CEHA 1J2JA 4PPNA 5FR1A 4BWYA 3BORA 2QT0A 4QGHA 4LY6A 1AS0A 4IDPA 5CLLA 4EJSA 1ESMA 3NBZC 1GKYA 1CR2A 3F5FA 1MABB 2IYZA 2NZ8A 4A15A 1KK3A 2N42A 4RSGA 4BLPA 3PVSA 1Z6YA 4ERNA 4IOLA 1RYHA 2HF8A 3RRMA 5EXSA 1PUJA 1ZM2A 1TX4B 1P6XA 4HUQA 4DLSA 3FE2A 3KQLA 1DO2A 1JECA 1MO3A 1KNQA 2BDTA 4W7SA 4YQFA 3RS4A 3ZZTA 1DARA 5A0FA 5JZVA 5M04A 3P27A 1N3BA 3QF7A 4K8OA 2ZE6A 4TMWA 1XCPA 1YE8A 4EJSC 5KUTA 1IY1A 1QF9A 3C41J 2P6RA 2F1JA 2PZFA 2J59A 3GPLA 3IEVA 1Q44A 3UKDA 4DDWA 3EIEA 4DCNA 2IWRA 4MGZR 2A3RA 3QKRA 2QN6A 4GI7A 2XXAA 3QBVA 3DZDA 3FTQA 5DO9A 1XMIA 1AKEA 4LRWA 4C30A 4DCSA 2RAPA 4NTZA 1SXJA 4PSVA 3DM9B 2FFQA 2OZEA 2JLZA 1QRAA 3K0SA 3ZIAA 5F2EA 3T1VA 1NLYA 5TV2A 4C0SA 2X1VA 1XCMA 1GILA 2QGZA 3SN6A 5BN5A 2R62A 2C9YA 4JLOA 5JJKA 1OJLA 3L8ZA 3OE7D 2Q9BA 2QA5A 2ZSDA 5C4MA 2V54A 1CTQA 1CJVC 2WVJA 2W0MA 1XU4A 4FMBB 2BMDA 2LKDA 2PZEA 1HV8A 4A4DA 1TQ2A 4IFBA 4DCTA 1CLUA 2VHUA 1NVVQ 3AVXA 4LK2A 5H70A 5C46F 1QVRA 2DYKA 2IW3A 4ILEA 2A30A 3VLFB 4XVQA 1G4AE 1P2UA 3TH5A 1F5NA 2IF0A 3QVUA 4ASUD 5A5GA 4GDFA 2YOFA 4C0JA 1RFLA 3QF4A 2NTYC 5JBQA 4JL8A 4BUJA 4MRRA 5J47A 4I1UA 1E2NA 1WQ1R 3SOPA 5F98A 3GFTA 1NKSA 4R71A 2H8KA 3K70D 1WXQA 3CRQA 1CR4A 1NIPA 1VTKA 3O8CA 1IN7A 1XRJA 8OHMA 3RS0A 2D4HA 5GADl 1D9XA 1S3SA 4NCNA 4HUTA 5C2JB 4KHZA 2YYZA 2JA1A 2DR3A 521PA 4URUR 1G3MA 2EU8A 5C1BA 3FHTA 1II8B 1UJ2A 3WNBA 4B33A 4PANA 3KX2A 2OM2A 1AA9A 2FNAA 2XZPA 1L8QA 3O8RA 4NYMR 1B0UA 1RRFA 4TQ9A 2IBMA 1YZNA 1SHZA 3D3QA 3PR1A 2CBZA 1S0UA 1EFCA 1DPFA 2H17A 2CMKA 3EA5A 3Q72A 5E7MA 4PR0A 2EFHB 4Q1BA 2F3RA 4A82A 3P26A 1KO4A 3PEUA 3KTAA 3AKDA 3GLGE 1UF9A 1KSFX 3KQHA 4PSAA 1HQYE 2ODNA 3GLFA 1XMSA 2O8CB 3F8TA 1NBME 2J5XA 4KODA 2WWHA 1Z6GA 3B1YA 1DTSA 3ONWA 4A6PA 2ZXUA 1KIMA 1TADA 2GJKA 2DHRA 3FGNA 3E5HA 4FD2A 4HAZA 4CEJB 2ZU0C 1R4AA 4Q4HB 4GL2A 3CM0A 3KFVA 4TLCA 2FEOA 2QSZA 3MD0A 1LF5A 3GJ7A 1R5NA 3MUFA 4TTPA 3X1DA 1UFQA 2WWFA 2XGJA 3H84A 4A36A 2IYTA 3AGPA 2QMEA 2ZYVX 4NCHA 4MRPA 2FOLA 1VG8A 3NC1C 4DHEA 1YZQA 4WXPA 1D6JA 4NDZA 3QJYA 2WKRA 2RCNA 2XB4A 3R9XA 2PCJA 1R0YA 1ONBA 4DT1B 3DMDA 1NBMA 1W46A 4KAXA 5DGXA 3C14C 2XB2A 3M4YA 1E0JA 4JBWA 1ZU4A 5DIFA 1T3LA 1U90A 3THYA 1CEEA 1U8ZA 2ORIA 1W5SA 1YQTA 3WNDA 3CH4B 1P2TA 2IL1A 3SZRA 2CVHA 1E94E 1X1SA 2ORVA 4BGDA 1C1KA 3X1WA 4Z1MD 1GDDA 2VEDA 4URXR 3KB2A 3MWJA 1AS2A 3PIRA 2VF8A 2AFHE 2UVQA 1TQ4A 3TW8B 4DUGA 2DFKB 2N1BA 4QFMA 2PMKA 2FZ4A 1X3SA 3EC2A 4US2R 2IS6A 2ZI4A 2EFCB 3KUDA 2MSCB 3E1SA 4OK6A 5LD2C 3ZVMA 4WIAA 3Q7PA 1VDZA 5AK0A 1GL9B 5CK5A 4ZKEA 5SZJA 1GL6A 2ZJ8A 3TAUA 1H65A 1G9XA 2V6ZM 1NVUQ 2DZNB 4MGKR 4EAQA 3WHKA 4K46A 3THOA 2AHOA 3UIEA 2X2EA 3QG5A 1OFHA 1Z63A 1TUEA 3NH9A 2BWJA 3U7EB 2GZHA 2QAJA 1E2HA 4Q4AB 2GBLA 2QM8A 1SKYB 4GZLA 5FBVB 3TGPA 2WJYA 1AQUA 3BWDD 3LY5A 4LYJA 3B1VA 3W90A 4WA7A 2DB3A 3KUCA 3CW2A 1AIPA 1JR3D 2G83A 2NO7A 4RY2A 1XPOA 2C2HA 3DOFA 4OL0A 3GEHA 2ZRJA 3W3AA 4XOIA 2V7QA 2IEYA 1DG1G 3C16C 4NONA 2J1LA 2JIZD 3WMGA 4BASA 2QAGA 1GITA 4GP7A 1I4LD 5KTYA 1OH6A 3D8BA 4TQUS 1G8FA 4UKDA 1OPXA 3GCGA 3NBFA 2F1RA 2IUSA 2G1KA 3GJ5A 4ZI2A 2PZGA 2RGDA 1UKEA 3IEUA 3WBKA 4Q18A 4EPVA 5HE8A 2IXGA 1KO8A 1N0WA 2X19A 4TT3D 1NVVR 3B60A 1DBSA 3SYLA 1CS4C 1N6NA 2NGRA 5F9HA 1EGAA 2IYLD 3TSOA 1RRGA 5DYGA 3ZVRA 4DEYA 2QSYA 2OFOA 1SVMA 1BIFA 4V0OA 1UKVY 4NBSA 4PZZA 2VHTA 1C4OA 1OYYA 3MWKA 4F38A 1NN0A 2NO0A 2C03A 1VCIA 1TPZA 2WOJA 1CP2A 3K0FA 4JBXA 5FTNA 1M1YE 4LHVA 2I1VB 2YWHA 3UMRA 3ICQB 4FWIB 1ZD9A 2O52A 3TVDA 1GTVA 1AKYA 5IF9A 4CEIB 4C7OA 1Z29A 1OIVA 3RC3A 4QHSA 5FUVA 3EPJA 1N2CE 4BRWA 4M9ZA 1GRQA 4NCKA 2WWGA 3IUYA 3IHWA 4Q9JA 4LSGA 5DI3A 2XAUA 2ZIAA 4PO1A 2MMGA 2NOAA 1U0LA 4OBEA 4EQ6A 3LWNA 5HCIA 3A8TA 3B5JA 5ANRB 1KI6A 2OBLA 5IK2D 1E9CA 1RJ9B 4KCGA 3X1YA 4YXWD 2ZSAA 1GL7A 3MFYA 3A6PC 1X8KA 4KITB 1CIPA 5LD2B 3LFUA 4B48A 2SHKA 1HYQA 3MSXA 2NMVA 5DI3B 1J70A 4P33A 3NG1A 1G8PA 4R98A 5JEDA 4CYMA 4DLXA 1C1YA 1SKYE 4G5OA 1G3UA 1SXJD 4RZ2A 2JLYA 2NZJA 5KNCA 2V7QD 3B13B 3LX8A 2GRJA 4RD0A 2O0KA 4MGIR 2W83A 3K70B 3GJ8A 1W0JD 1CR0A 3BOSA 5CM8B 3WY9A 2IC5A 4V0KA 1WE2A 4N1AA 2BHRA 2ZRBA 2YINC 5FL7A 4JIMA 1O87A 2Y8EA 1FMJA 5E7JA 1JB1A 2OT3B 1XD2B 3L2OB 4QBGB 1EWRA 2W6JD 3ZS9A 2CLSA 5F9FA 2XJ4A 5TDHA 4EPWA 4YMVA 3W6OA 2FEMA 3NH6A 4EPTA 3CKLA 3KXIA 1CJTC 2PCLA 3A37A 4LC1A 2IT1A 3FOZA 4JBYA 4A2QA 1H8ED 2GF0A 2IYUA 3TBKA 1XTIA 4V0NA 1M8PA 3OAAA 4TMXA 2JLVA 4P4UA 2F1IA 3T35A 2F6RA 4G1UC 5TY0A 1XEFA 3QIAA 4MH0R 3C5HA 1N0VC 5BQ5A 2X8AA 1T4GA 4WZAE 2BKUA 1N6RA 3LQQA 4PZLA 1JR3E 4QGGA 4ESVA 3U61B 2G9NA 2MSDB 4EFMA 5KPDA 1R8SA 1WCV1 1DS6A 2IUUA 4AYWA 2G1JA 3AJIB 1U0JA 1DAEA 5K8UA 3AVUA 1TUIA 3H4MA 3UG6A 3FMPB 3BH7A 3MJHA 5JCPA 1G4UR 4IXMA 1G18A 5JI2E 2Z43A 4BPBA 3IDQA 4GZMA 4QGFA 5FI0B 1B23P 2OCYC 4LDJA 1FUKA 4POAA 5TXGA 1AS3A 4QOSA 2IYWA 2Z6VA 4M1OA 2NO1A 5SZIA 3KKQA 3ZVLA 3KKOA 4A0GA 2XTZA 4DLYA 1FNMA 3SQXA 1GWNA 1YU9A 1BOFA 3DOEA 2J7PA 5JRZA 1XEXA 3SC3A 1ZRHA 2RKOA 2RB4A 1EX6A 1VYTA 2HLDA 2OUKA 4D4MA 1G17A 1SHKA 5KSZA 2QT1A 4G5QA 5FUYA 5HZKA 3QXXA 4C0LA 2XEXA 1NKTA 1DAFA 3UMSA 3SEAA 4RFSA 2WSMA 5GVRA 4B3CA 4JMPA 3W34A 2ZJAA 4KFSA 2RHMA 4JLJA 4PQFA 2CCKA 1A1VA 1QZMA 2XOKA 1OXXK 2Q9CA 5BWMA 1F60A 1JPJA 3DPUA 4IHQA 3LAWA 1CRPA 3U7HB 4ZV4A 1HQCA 3AKYA 4A0HA 4UNQA 1T91A 4GFDA 4DLRA 3DL0A 3SU8A 3BE4A 3ASZA 1WBDA 1NLZA 4QBIA 2C95A 1SZPA 4I1VA 2QM7A 1DAKA 3IQWA 2LWIA 5G41A 3JZMA 3VNVA 3GJ0A 2C9CA 4QG7A 4LBYA 3R7WB 4XVUA 2HUPA 5H8WA 3AVTA 3G82C 4GNKA 1K6MA 2ZRIA 3DMNA 3U3KA 2PLFA 2DWQA 3V4RA 2O8CA 1P75A 3OIYA 4IVQA 5D3MA 4LCBA 4PX9A 4M21A 5KDOA 3LQRA 4Q47A 3EZ9A 2PMDA 1XXHA 2ZE8A 4H9GA 4TLAA 5E3HA 1QZXA 3U4QB 3CPJB 2DWOA 4YMWA 3KXLA 5TARA 1YZLA 4QNRA 1DAHA 3AH8A 4IOJA 2RGGA 2ZROA 2JAQA 3QXSA 5ELXA 1J7KA 4LHYA 1JI0A 3K0EA 2ZITA 3KFXA 4I1OA 4TL7A 5CB6A 1EESA 4QBHA 3H2YA 2KE5A 2D7DA 1E2LA 1HURA 2A5YB 1AZTA 4M9SA 1IXRC 4URYR 4C2TA 5FI1B 4RKEA 3PUYA 3I5XA 3BC1A 2GJ9A 4B3DA 2G0TA 2GNOA 3W6PA 4EDHA 4LPKA 1CJUC 2DPXA 4HUQB 1Q1EA 1QHHA 4H1UA 3A1UA 2WJJA 4MRVA 5P21A 2XJ9A 3G0HA 1W36D 3TIFA 1X8LA 1HUQA 1SKQA 2Q3FA 3PEVA 2CJWA 4EJSB 4FCVA 2D06A 4BLSA 3TSZA 4LPSA 4Q7MB 5EXTA 1YKSA 1KJZA 3QEOA 1Z22A 2VYFA 4JJKA 2FN4A 4HYYA 2R6GA 4DWJA 1EWQA 6Q21A 2WTUA 2ZVQX 4W5HA 1GVNB 4F91B 4HB2A 5CDFE 4TLDA 4BEJA 4DVGA 2WAXA 5C4GB 3ECCA 3SJBA 3EPHA 4QRHA 2EWWA 4FN5A 2JDIA 2PEZA 4N0EA 4RZUA 3OHMA 3K9GA 3ADKA 4MRSA 1KK0A 1VG0B 2BBTA 5JHHB 4LBZA 3T5DA 5LB2A 3HU2A 1VIAA 2HLDD 4U02A 4PC1A 2Q6TA 4MKHA 1BMFA 1OXUA 3QKSA 2ZRHA 4TYWA 1RPZA 2CDNA 4IVPA 2YZ2A 3K9NA 2C77A 2E1RA 1IN8A 4DSNA 5B64A 2OBMA 5K8TA 2NPFA 4RD6A 1OSNA 1RZ3A 1Z06A 3VHXA 5D3QA 1NMYA 4PPQA 2VA8A 5J40A 1GM5A 2H5EA 3IBGA 1E9BA 1JALA 5KNDA 1E98A 2ZI7A 2V6JA 3KJHA 3PUZA 2Z5FA 2EQBA 2CNWA 1G291 1Z07A 3PENA 3A36A 3VX4A 3TSWA 3W5IA 4LGMA 4OK5A 4KBGA 2F9MA 1L4YA 3VAAA 3X1ZA 5CITA 3WRXC 3W8RA 3RWMB 4OHZA 621PA 3UK6A 4O0MA 1MRNA 2KB0A 3SJAA 2FZLA 3AM1A 2CNWD 3PFIA 4UNSA 4RCYA 1SVLA 4URWR 3AUXA 3LW7A 5JWHA 2W6JA 2UZIR 4LV8B 1IONA 1W2GA 4OI0A 1NN3A 4FWHA 2N46A 2UZ3A 1IJFA 4V0MA 4KFRA 4DEXA 3FHCB 1LB1B 2OFWA 2QUZA 4HZUA 3O8DA 5E7IA 1VCMA 2A5DA 2XTNA 2RGXA 4C9BA 5J4VA 2R8RA 4C0AC 1CKEA 2QU8A 2F1HA 2HEIA 3THWB 3CRRA 2HXSA 4CT4B 3OFND 1N5JA 5C18A 5DNYB 3LBIA 3QVVA 1FTSA 1MABA 3RHFA 2WJVA 5L3VA 4TSFA 4DB2A 1MH1A 1Q57A 4TYQA 2QPOA 3LXXA 4JS0A 4JYCA 2AKAB 2BM1A 2D74A 1U81A 2WIBA 4FI3C 4G0NA 4IDOA 4HEJA 4JVSB 4MGYR 4X8OA 5JSZA 3T1TA 1Z6TA 1LF0A 4XH9B 2I1QA 5EQTA 2B6HA 3RDPA 4L8GA 4Q7KA 2BM0A 4E09A 3H0KA 3CRVA 4DSUA 4DSOA 4Q9HA 1Q0UA 3T5GA 1BH2A 1M7HA 4L5BA 1OXSC 1HT2E 1FQJA 4RD4A 3E2IA 1SVWA 3T1OA 5JI3E 1AK2A 4JLVA 3T34A 2QRNA 1OLOA 2ZYWX 2PT5A 3LO5A 4KVGA 3KJGA 1W4RA 3P4YA 2WM9B 2FJUA 5JSZB 4PPFA 4JKIA 2XSZD 3EWSA 3L82B 4YDSA 1JJ7A 3EZ7A 1M7BA 2IK8A 1IBRA 3PCRB 3AF4A 4Q48A 2VP5A 3HU1A 3U2QA 1LS6A 4QHTA 4ZO4A 5EZ5A 4AD8A 4DJTA 5EJEA 2CHGA 2EYUA 3DM5A 4OQNA 4B3BA 1UBFA 3HYRA 2E87A 4QHYA 4XTRA 3EG5A 3T06B 4Q01A 1W44A 5L3SA 5GJVC 4U7DA 1KK2A 1II0A 1Y63A 2KSQA 3D7MA 5IHPA 5FPSA 1WDTA 1OV4A 2XSZA 2PLRA 4C0BA 1G5TA 4TMKA 1RC8A 2QTHA 4OHVA 3Q8XB 1XXHE 2P5TB 2RGBA 5LPNA 1NRJB 1ZUIA 2AL7A 4D0GA 1AQYA 1JQJC 1VHTA 1ZMXA 1DO0A 2H1LA 4B32A 4NYJR 1I4DD 1NMXA 2PJRA 1XNJA 4O3MA 1E3MA 1U98A 1FNNA 721PA 5IT5A 1U9IA 3TW4A 2JIZA 2A5JA 2ZETA 1P9NA 3NDPA 1P9WA 2KBFA 1MR3F 1E2JA 3AGQA 1T3HA 2JLXA 4DC9A 3SJCA 3TAHA 1R5OA 4ZKDA 3U3MA 1QHXA 4TSFD 3RS3A 4KLZA 4JZKA 3ND8A 4C0KA 1G1MA 4YMTA 1HA3A 4M4SA 1TU4A 3OIWA 4OI1A 5HPYB 1UBEA 2YKGA 3B2EA 3BAFA 4DZZA 3N70A 4XIGS 3MAAC 4JLKA 2WWWA 2CCJA 3ZS8A 1N6LA 5JS8A 1ZUHA 5KDDA 1CBUA 4OK3A 4PHTA 2ODEA 2W2VA 2FPKA 1KI1A 2O8BB 2ANBA 2C8VA 4Q02A 3RLFA 3ADBA 1T5IA 4LJ4A 4JT4A 3GLGA 3CPHA 3TUIC 1CRQA 4A8JA 4RJLA 3OIVA 4MKIA 1E9RA 4LJAA 2BMJA 4TL6A 3TR0A 4Q1AA 2GTPA 2O8DA 3NKVA 3KKPA 1P4SA 4R2HA 4B2PA 2AWNA 1E0AA 1ETUA 4MKFA 4DKXA 3U3OA 2JASA 4A9AA 2BBSA 1ZU5A 5FOVA 3VTKA 3P1JA 4TN1A 4KYIB 1UM8A 3B6EA 3CNLA 1J99A 4UJ5A 3GMTA 1NL3A 2L0XA 3NVAA 2OFXA 1MKYA 2ZI6A 3REFA 3QKRB 3VR1A 3GJXC 1KY2A 3UWOA 4LHXA 2BJVA 1OIXA 2R6CA 1YR8A 4RZ3A 5CIWA 4ACAA 4XWKA 5H1YA 4GP6A 1F48A 1LTQA 4PAQA 1XFAA 5JJIA 4TL8A 1YZUA 1VG9B 4AWXA 1WRBA 1W0KA 1YRAA 4JL5A 1TEXA 1CR1A 3VHLB 4CW7A 3OAAD 5EXXA 2GBLC 2JLQA 3FHOA 2HJGA 1KJYA 1OIWA 4PPGA 4KYUA 1W7AA 4QM6A 2GCOB 4W5JA 1DOAA 5L3SB 3NBYC 4TMTA 5L3RA 4WZ6A 2WJIA 2PL3A 1NP6A 5FBWB 2DWZB 1E2PA 2GA8A 5HKKA 2EYQA 3TJZA 1KMHA 3SR0A 1UADA 3A1TA 3SJZA 5GJBA 3PUVA 1OB2A 3VQTA 3Q5EA 2OEPA 3VU9A 3A58B 3U44A 4LYHA 3IO3A 5IRCD 3AVWA 3K70C 1IXZA 3NHAA 3KJEA 4UXHA 5EE9A 1SGWA 4NE2A 4M1YA 1Z0AA 4WVFA 4NPHA 3FB4A 821PA 1SVKA 2VL7A 5EE5B 4DLZA 4CF7A 4PXAA 2R44A 3DO6A 4I81A 1IY2A 5FTKA 1T0JB 2BMEA 3BERA 2JCSA 3R7WA 1CU1A 3EWAA 1Z5ZA 3OEED 4GITA 3U60B 4RFVA 1Q3HA 2REBA 3EZ2A 4MYCA 4X8MA 4YXWA 4BFTA 3S1AB 2W58A 1RE0A 3QQ5A 2ZR7A 4LJ7A 1NMZA 1W4CA 1YZGA 2P6NA 3OEHD 3RRZA 2C99A 1FX0B 5BXQC 2IX3A 3KL4A 4WBSA 2HF9A 2BCGY 2HV8A 3LVRE 1SXJC 1EFHA 1XJCA 3ZD7A 1WMSA 3EZFA 4LJ8A 4G3XA 4P4SA 2IS4A 1GAJA 2GVZC 1YJ5A 5JRJA 2EVWX 4KU4A 4S2EA 5GJCA 4D6PA 1WBBA 4IRUB 1FL9A 2JLRA 2BBWA 4NYIR 2JATA 3KXKA 3LBHA 3QENA 2RH5A 4EKDA 4KJZA 2ONJA 4Q00A 1P62B 2YJTD 1ODFA 4V0LA 1AGRA 3MWYW 2YWEA 3FPAA 5IDVA 2GEVA 2C78A 1U8AA 3BD9A 3SBDA 4HLDA 3RNLA 1E1QA 4UJ3A 4NYMQ 2G6BA 4OI4A 1AZSC 4UQOA 5AJYA 2OE2A 2REXB 4M2LA 1DAMA 3N5CA 3BJIC 1S3GA 1F2UA 2H7VA 3KQUA 3WHLA 1ZW6A 1SULA 3ZIAD 4ZDKA 5F3WB 1XD8A 3B8HA 5CB8A 1Q20A 5EE1A 2QAGC 2OG2A 4E22A 2NPIA 1AJEA 4PO9A 4ON9A 1M6NA 3G5UA 1EFRD 1Q22A 2XZOA 2QROA 4Q4JA 2YNMA 1XBTA 3K9LA 3QBTA 4MRNA 4HSEA 1NG1A 5LB4A 4A2WA 4WW0A 4JLBA 1Y3AA 2ZRNA 4Q66C 4U5XA 5J4LA 4ZDIA 2JGNA 4AIIA 5FTMA 2GXUA 3FYHA 3HU3A 2GHIA 4IKEA 4IEEA 4LBVA 5KPJA 3VMFA 3IIJA 2REOA 2ZUCA 1E32A 4HATA 3UATA 5DE3A 3LNCA 1IM2A 3CNNA 3FMOB 4ARZA 3CX6A 3L8YA 3GLIA 2WOOA 3WMEA 4NCJA 2OCAA 1K5GA 3U44B 1R5BA 4XWAA 2P65A 1IJEA 1DEKA 2VHQA 1ZC3A 3HP1A 4QL3A 4ZDWA 3PITA 2QTFA 3QKSB 3W8NA 4D25A 4E5UA 1TEVA 5FBRB 1BKDR 4DIEA 4Y0AA 5AUQA 1ZAKA 4C2UA 3A4NA 2NG1A 3WNCA 5KOYA 2OAP1 4MDFA 1L7VC 1T8TA 2JJ2D 4OQXA 1S4QA 1ZM4A 2B92A 1VIYA 4F4JA 4TYYA 4Q21A 1XJQA 2QY9A 4W9MC 4AK9A 1RYFA 5GJWC 1ELOA 3T1QA 2B7CA 2ZI3A 4LHZA 3SE0A 3I61A 1G3IA 2Q3HA 3PG5A 1KZ7B 4M0LA 4M8NE 3RYTC 3UWKA 4CVNA 5J4YA 3ZDQA 1D8TA 2G77B 1FPMA 1ZIOA 2R6FA 1UAAA 2VIIA 1DG3A 1XTKA 2E9SA 1QHYA 2BMFA 4QJ4A 3PV0A 1X6VA 3NIBA 3THXA 3QNUA 2ERYA 3CRMA 2C98A 3CWQA 3ZGXA 2GJAA 1RW4A 2XX3A 4MYUA 4JLDA 3RABA 2O8FB 4PO8A 4ESHA 4W5WA 5JMTA 1E2FA 1ZC4A 3FFAA 3QPWA 1NBMD 5KSYA 3CX8A 3QI2A 3TUJC 3AF1A 4MUBA 3AF0A 2WWYA 1OH7A 3K53A 1GNRA 2YVUA 4X8HA 5GVSA 1S1MA 1R0ZA 3CO5A 5KSPA 4HB0A 4ZI3A 3IBYA 2FSHA 1OT3A 3F0TA 1ZNZA 1QHNA 1E96A 3GFOA 4RVCA 1RRPA 2WHXA 1Q1QA 1HEIA 3L43A 2FG5A 4CZ2A 3Q3JB 3ZZUA 1J8MF 1HE1C 3A1VA 3HDTA 3L0PA 3TQFA 1VKJA 2PX3A 1EXMA 2DBYA 1KO1A 2J0VA 1A4RA 3HPQA 1E99A 2F3TA 4WXRA 1L2TA 5BYJA 4U00A 2ZS7A 1JJVA 1AN0A 1OF1A 1NJFA 3HPRA 2O8DB 1OH8A 3KJIA 1YZTA 421PA 4JYBA 3WYAA 2AN9A 1UDXA 4C3ZA 3I8SA 1Z3IX 4TZ0A 2IS2A 1XDBA 1E9DA 1GKIA 3RS7A 2IS1A 2BIFA 3BFVA 2QP3A 2V8OA 2J45A 4XSGA 2GZDA 3R9IA 2ATXA 1S1CA 1S96A 2WJGA 3I92A 1I2DA 4A92A 3B78A 2ZS8A 4RFSB 2QL6A 3FVQA 4AI6A 1NVWQ 4XJXA 5FOSA 3EPKA 1IQPA 2QBYB 2CE2X 3MHVC 2J41A 1GSIA 2FDCA 2RGAA 2WJHA 3M0EA 1T9HA 4BFYA 2QNRA 3AKEA 2YV5A 3U6KA 4EUNA 2D2FA 1D2MA 2PT7A 1A5TA 2IA5A 4AG5A 1PLLA 4LOAA 4KSBA 2KBEA 4AG6A 4B3XA 4DLWA 1XTRA 2YOGA 2QQEA 5KDLA 1NF3A 3AQ4A 4H1VA 5EP3A 2MMCA 5E95A 1P7CA 1DAGA 2CJWB 3JZAA 4FMDF 1OHHA 1KDRA 1RIFA 3I72A 3AVVA 1Q12A 2ZAMA 2CE7A 2VP4A 2ZTSA 2KRKA 2FWRA 4US0R 2WKQA 3PUXA 5FPTA 2A2ZA 1R0WA 2OESA 4E03A 1G6OA 2YWFA 1KO7A 1O3YA 1QHHB 3CPEA 1KAGA 1N6PA 2ERXA 2UKDA 4IFEA 3B9QA 1VYVA 4NMMA 4WAUA 2HXYA 1XEWX 4P32A 4BFXA 3NTUA 1YR9A 4RD2A 4K81B 4TLBA 3SFVA 4UNPA 4LJ9A 2ZJZA 1JR3A 2KWIA 1ZYUA 4UNNA 2IEZA 2ANCA 3QPUA 2R65A 1M74A 3BB4A 1EG7A 3HWSA 4EFNA 3KW6A 1DE0A 1T0HB 5DH9A 1IXSB 2ZYUX 5FUXA 4JL6A 4M22A 5FPHA 4URVR 5JEEA 4QJ3A 4AKGA 3EXAA 5KYKA 1YRBA 1E0SA 2WSSD 2CLCX 1KSGA 3SDZA 2GEDA 1S9DA 1KYIA 4HZUB 3Q5DA 1N6KA 5CJPA 4I4LA 3NEJA 3R8CA 4D4KA 1I4TD 4LBWA 1ZM9A 3IGFA 2FA9A 2VP0A 3SFZA 3I1FA 1KKLA 1OH5A 2ZRLA 4CDGA 1D5CA 2A7QA 4JLAA 2ZS9A 3CX7A 4HLUA 2ZSBA 3T15A 3U3JA 1ESNA 4DUGD 1US8A 5JHGB 5KO2A 3KZ1E 4TTRA 1T3SA 1E79D 2ZVPX 5HZHA 5BW8A 4KFTA 3TUZC 1KDTA 4Z1MA 4IDHA 1F2UB 5J5CA 1XPRA 4F92B 3RSOA 2ZRCA 1FP7A 3IPXA 5KHOC 2RHDA 2O8EA 4Q1FA 4NKRA 4BFSA 1R0XA 1KTVA 1R10A 5DHAA 1J90A 1T6NA 1TTTA 1H8EA 1SQ5A 4OYHA 4CGZA 3AVOA 4TYNA 1KI8A 5JS7A 4B3GA 2NO6A 3R8FA 1GFIA 3NDBB 3V00A 4AKEA 3QPVA 3ICEA 1BMFD 2IYQA 2B21A 3FMIA 1RKBA 4FWGA 1QDEA 3C15C 1XD9A 4N0DA 3AF3A 1CXZA 5FL7D 1OB5A 1T5LA 1G3QA 2JDID 1GG2A 1DELA 2GDJA 3BK7A 121PA 2H92A 1P5ZB 1P3JA 3QE0A 4EPYA 3QKUA 4OQLA 4PFSA 4FWDA 5FR2A 4L9WA 1BS1A 3CIOA 1TL7C 2PH1A 4KLNA 2IWHA 1E4VA 1FX0A 3AB3A 3EW9A 1W4AA 2P3SA 3FKQA 3M1IA 4DBLC 1U8YA 2ZI5A 2AFIE 3ZH9B 1HE8B 2GK6A 2ZI9A 3WXMA 3KKNA 1XTQA 2J0UA 3AV0B 1ZUNB 3SS8A 5FH9A 3TNFA 2IYXA 1KKMA 4OJKA 2CHQA 2W6ID 4TLEA 1TNDA 5IK2A 4DLTA 5KNBA 2GVDC 1XTJA 2WMOB 4IDQA 3VR3A 4DDVA 4FCWA 2HCBA 2GXSA 2C9OA 2QP4A 2BVNA 1COWA 2QE7D 4BZQA 1XJ0A 2JLSA 2I4IA 1D2NA 4NYIQ 4BEBA 2H18A 2J46A 3EASA 5K8LA 2GF9A 2VPPA 4GPTA 4XD7A 2ZRMA 4BLQA 3K09A 4UXIA 1PJRA 2FMXA 2VH5R 4RD3A 1UBGA 3UPUA 1X86B 2CL6X 4O2RA 2P6UA 2ZAOA 1E2GA 1XP8A 2BEKA 4Q4LA 1S8FA 2A9KA 2WSSA 1EFUA 3I32A 3W6NA 2R9VA 3DZ8A 4O25A 4AYTA 2HT6A 2A5GA 3EC1A 3THWA 2ZQ5A 1G64A 4A0FA 3DEFA 1KI4A 2GESA 3KKMA 1TQDA 2QZ4A 1DAIA 1OFTA 1RRCA 2AWOA 1IHUA 2WWIA 4TMVA 1PUIA 1W1WA 2J0SA 3LXRA 4Q9LA 2FH5B 1LNZA 4PHHA 2ZUBA 3A1SA 2VHCA 2XXAB 4D26A 3SI7A 1Z0FA 3MWLA 4B35A 4TT3A 1N5KA 4Z51A 2GK7A 2OILA 5FBLB 3RAPR 1FUUA 2AXNA 1G8YA 3QXJA 3OE7A 3BIFA 4C0QC 2ZJBA 4HDOB 5B58C 1J8YF 5J4HA 2CVFA 4KO8A 3B82A 4HZIA 3DDCA 2J9RA 2OHFA 2Q0HA 1KOFA 4V03A 3N2IA 1XX6A 3DVLA 4B73A 4DLVA 2GWHA 2V4ZA 4YC7A 4FWTA 2FF7A 1H8HD 2OSBA 3FMFA 1JPNA 1KHTA 1F6BA 4LC0A 1KMQA 3VFDA 2H16A 2VSOA 5AJVB 1ZNYA 3MCAA 1CJKC 3A4MA 3V4FA 2WPDD 3IKJA 3QSYA 5DYIA 3SQWA 2G88A 3LRPA 5K8IA 2VRWA 5CDFA 2F7SA 5FOWA 2BJWA 1F2TA 3L0SA 4DLUA 4YLGA 5AWFC 1G7TA 4TQAA 4F7WA 2VSXA 5CLQA 4PC2A 3FKSA 2RGCA 1F2TB 1Z8FA 3GLFE 4X8LA 3GLIB 1ZD1A 4QKQA 2Q3MA 5TVKA 4GOJA 2PEYA 4HDCA 4JLMA 4NHOA 3IIMA 3RVBA 3IILA 1L4UA 2IYSA 2ZJ5A 1X1RA 3WP0A 3CR8A 3IIKA 3H86A 4PC3A 5TB5A 3S1AA 3VKGA 2D2EA 1PLJA 1Q21A 4Q1EA 5G53C 4B44A 5AUNB 3GLIE 2B7BA 3CBQA 3REGA 5JECA 1QVAA 3ZYCA 1TU3A 1U2RA 2ZRGA 1P9RA 2CLDX 2ODBA 4MDEA 2FFAA 5B2ZA 1E2IA 1KI7A 4UXJA 1S9HA 5HCNA 1KI3A 4IOKA 3WRYC 1ZM3A 2W6IA 5DI9A 2DFTA 2QRZA 2ZRAA 3GLHB 3RRYA 3AKCA 4UNRA 1F3OA 2ECKA
chains in the Genus database with same CATH superfamily
1K75A 4LYAA 4AMYA 3GJ6A 2GJ8A 2WZQA 3KQNA 3CUWA 4KXMA 5FA5A 4LF4M 3DZJA 4EO7A 1SBIA 4RKYA 4B3HA 5J4YA 1QYIA 5K1ZA 3KKLA 2VJAA 4KPUA 1KBOA 1VJDA 4GI2A 5C7LO 2W9XA 2QL9A 2VTEA 4BNVA 1M0WA 1Q7GA 1TF0B 3V2IA 1T6OA 1DWPA 1IHPA 1U2EA 3CLHA 3GX1A 3QIVA 3QVLA 1ZVQA 3SBEA 1GTZA 4ZO7A 1Y9AA 3WL3A 3ZV4A 5DN6A 4YFVA 1DKUA 5I9TA 3ZXUB 5SYMA 3S27A 4P34A 3UV3A 1RWPA 5HR5A 3EIHA 2XT0A 1CP3A 1UCFA 3AY0A 3JQBA 1G8HA 3L4BA 2WZBA 2ZK7A 4DWOA 2PUFA 3VKHA 1T9BA 2C5AA 5LBIA 1I51A 2H48A 4Y8VA 1GR0A 4US1R 2A5LA 2KI5A 1N9GA 1ONSA 2F43B 2HT1A 3FDIA 4L78A 1Y3HA 2EWVA 1N6OA 3U56A 4KSYA 4JVNA 2EDCA 4CT0A 5DRTA 1TVKA 3BWXA 4KE8A 4WXMA 2HRQA 5ITXA 4R3UC 2YC4C 2H52A 3CKKA 1UBLS 3DA8A 4MITA 3BS4A 2IPAB 3LKBA 3BN3A 3OE1A 4OQMA 4TWZA 4JP1A 1XTSA 2Y1FA 3VNUA 4EGAA 1YLAA 1E7MA 4P2GA 2HFJA 3P32A 4ALIA 4ZDJA 1YOVA 4PGAA 5DGCA 4B2LA 2C2MA 4BQSA 5CB0A 2X13A 2W71A 2NUPB 3SF8A 4CMIA 1GAXA 4D0NA 2ZPTX 4JBHA 4JQCA 4W7IA 1N9GB 2F43A 3MM4A 3UMFA 3GLRA 4ZYWA 4B4OA 1P0IA 1PHRA 3ASVA 1YT5A 2A0UA 2CFOA 2K5UA 4EPRA 2PXCA 1JAIA 1MORA 1QS0A 1SXJE 2OLJA 3B1FA 3BULA 2FX2A 3CE9A 4S1NA 1FQKA 4URFA 3VKFA 1WKCA 3ZD6A 4RYDA 3EDRA 1TJ4A 1SCKA 1D09A 1U5BA 2VRCD 3OOJA 1AM4D 1II9A 1L7OA 4TWAA 4I1YA 4RWZA 3SVZA 2Q8QA 4F2HA 2FJPA 1PFVA 1SIOA 2D13A 2BY4A 5CJ2A 2CDRA 4Z99A 4EHFA 4KQXA 4A0SA 4KRFA 3P9SA 4LV6A 4IF4A 4RIGA 4UBJA 1QGED 2CHEA 4W1QA 4ZICA 2XFTA 1OFUA 4LOJA 4AG3A 3KZKA 2GBPA 1U63A 3PDCA 1JMYA 4R8VA 5CFNA 3DTVD 4ASUA 2OL4A 4MGIE 1SC4A 3N2EA 3E70C 2B2CA 3R0XA 3QUAA 4W99A 4B76A 4PN3A 4A6XA 1UFZA 4KYVA 3GC6A 4PF1A 3IO5A 3CH5A 5KVSA 3DUFB 4HQRA 4D0RA 2XCIA 1TJNA 3BXZA 3SLRA 3D6NB 3UGKA 1R6TA 4OQEA 1BSVA 2W0SA 1ES9A 1C7ZA 1ND5A 1XP5A 2Z0MA 5EMJA 1NGSA 3UANA 1UEXC 2ZP1A 4K0KB 4BECA 3H2BA 4CT5A 4C29A 4HZGA 1Z2CA 4NICA 5FADA 5G3ZA 4A2PA 2D7CA 2O0JA 1DCFA 2ZUDA 4ACBA 4CIDA 2BTEA 2WSEF 1W48A 2YQ5A 4D5EA 4XB6B 5A7HA 2OZPA 4K9MA 1OYWA 4DNOA 5G1OA 3Q85A 1WQ4A 2EJCA 3V1KA 5FYQA 4DA0A 4WZBE 1KO5A 2QPAA 2LIVA 4QXMA 2FSVA 3OIUA 3ILSA 1EB9A 1ORTA 4PZ0A 1G5RA 3FZYA 1T8WA 3QA9A 4JVMA 2QLLA 4HXEB 4HGPA 5FLXA 3ZEIA 1TFRA 1XK7A 2CNDA 3EXFB 1II8A 1G63A 3BGIA 4Z8YA 1VE5A 3B1JA 3WOVA 5AI6A 5ECDA 3RTEA 4EQZA 3UUFA 2CNKA 1A4IA 3PQ7A 3FPFA 3VISA 4A0HA 1U9JA 2DOKA 1KYXA 3FSJX 5EWMA 2ZE5A 4LFBB 2ZT7A 5IDYA 4RPIA 5DW3A 3OU6A 3PFWO 4HLCA 3TOVA 2ZWVA 4BNDA 4BOYA 1GRVA 4Y1GA 1KY4A 2H65A 3P2IA 1LGYA 4PV7A 3JQ6A 3FUWA 2ZTCA 3LDAA 1RI2A 1CULC 1FW6A 4IYJA 1UOQA 1OXBB 2DKOA 4CNQA 4II3A 3PLAE 1SHTX 2AK2A 2AKYA 4LXIA 5JQGA 1P7ZA 1KVRA 2X3FA 2VDKB 2GD6A 3GQ4A 1A4XA 3C5WP 3WDSA 1ZSNA 1W93A 2DC1A 3EN0A 1Q02A 3PI6A 1HM5A 4C76A 2XD9A 4XVRA 1HYEA 3L7KA 4MW9A 2V97A 4TMYA 3ZHZA 4R7ZA 4FHFA 5IKXA 1KZYC 3E48A 4XSVA 4IZ6A 5L3QA 3IT1A 4M1MA 2XDWA 5AR1A 3QW4B 1PWXA 5EESA 1MC5A 3ZD9A 2AQIA 1CZUA 2XNSA 4X24A 5BN3A 3VR3D 2OQ2A 3FPKA 3PQCA 3HR8A 3WHPA 1WQ3A 4BE7B 4LDPA 2G70A 3ITKA 3BA6A 4O29A 4TXMA 2M6KA 3SQLA 4D9JA 3UYLA 1ZINA 2FPIA 2BKLA 1M75A 2EF0A 3GBSA 1E9AA 2C4MA 2CCGA 3K0AA 1YB4A 3GNLA 3JD1A 3QVXA 5FOTA 4P4TA 4DMCA 4U0JA 1ULBA 2H9IA 3P5SA 3DAGA 4OG2A 1WPGA 1L4KA 4B71A 1VZ2A 1NMQA 1ULAA 3HDHA 4GT1A 1TVMA 3ZVNA 3A1EA 1E2MA 4YJGB 3AEXA 1TH2A 4DCGA 2EBWA 4CTOA 4YRIA 1UEJA 2I1LA 3HCNA 4JI0B 1P2VA 2F8SA 1O95D 1VJRA 2O20A 4AXBA 2PGXA 2XNDD 2WSLA 3GZNB 2FV8A 2GCOA 5A04A 3F98A 3N0WA 1SEPA 3JQQA 4M9CA 4B9AA 1VA5A 1PR2A 3DMTA 1UZUA 3G8BA 4IJKA 4WY5A 5E3JA 5FX2A 5LJLA 3OHSX 5HUHA 3H5VA 1GZVA 1CUYA 5F3RA 4Y0VA 2QX4A 2WTAA 3C1TA 1H6BA 1JQLB 1E9VA 2X1MA 3GGSA 3HA5A 3U4AA 1M7GA 3W4KA 4W6ZA 3ZQJA 4K28A 1ZKMA 2CL0X 3PVZA 4DN6A 2IP2A 2HI0A 2APJA 3OLCX 1X94A 5AJTA 1UANA 4U7TB 1JKJB 5NLLA 5FYDA 1FFEA 2ZYGA 4E3ZA 1IK6A 4CM9D 4X44A 2QR5A 4HDMB 4AP5A 1YQUA 4G2NA 1G19A 1BXGA 3RG2A 3IAS1 4FFDA 4YCJA 1MNQA 1MX1A 3WI7A 4AU1A 4RNDB 1TUBB 3FTCA 1PP4A 5ICCA 4S35A 5ERGB 2GWRA 4AMGA 2JBAB 3K71B 3UXMA 4XWTA 3C3BA 3G7NA 3H97A 3BIJA 1JVSA 3FVVA 1XHFA 3OJEA 3HUEA 2Y1DA 2G76A 4LTDA 1FP4A 1OXVA 2V1UA 3R3ZA 4PEVA 4X61A 3DKKA 4WK6A 4CEJA 2OM6A 1YMVA 1DP4A 1DJOA 1LPBB 2VSFA 4GMXA 3OX3A 3PC2A 3CISA 3E8SA 4ZVNA 3QEAZ 1DBPA 1UC8A 1NNEA 3CNOA 2C8JA 2DBVO 2BNKA 3S6JA 1NXOA 1J7JA 1Q1GA 2P2NA 1V34A 3GFPA 3KTAB 2ZWAA 1XF9A 5CLGA 2QYSA 5GONA 4D8VA 3D0OA 1BFUA 4GBMA 4IH9A 4QVIA 3JV7A 2C3OA 2QAGB 3FNEA 1GNPA 3M4ZA 3GZTB 1GNLA 1EFVA 3F6SA 2IEDA 5EY5B 3KB8A 1XQYA 1YBMA 2ZT6A 5HBRA 3V55A 1Z2EA 2OHJA 1T13A 4KQJA 2R6ZA 2IHTA 4Z2YA 2CKDA 2BI8A 2OV3A 2IYRA 2WILA 3O1HB 4I4NA 3GQBA 4W9NC 2PL9A 1V95A 3CZQA 3CWZA 3MJVA 3Q9LA 4LJYA 4U3JA 4D9EA 2IXFA 3I28A 3ICCA 4MVJI 5FRDA 4G4RA 5T4HA 4DR2B 2RGNC 4Q4AA 2KJQA 4K6KA 4UU0A 2L17A 5ADUS 5IU6A 3ZDZB 1WUHS 3WNQA 3A28A 1L5OA 2PR2A 3U37A 4FMCB 3HQ4O 2BR4A 4RNCA 4WUVA 2KDLA 1IWBB 3DLHA 4IBEA 1JSXA 3AY3A 3RH0A 4OW0A 1GUAA 2XOXA 5IAKA 1BXZA 2VH1A 1LSJA 5BPVA 1US8B 1H0KA 1M1YA 1V43A 2WUWE 4R0VA 4J1SA 5JH7A 3F5DA 3PUJA 5EFZA 2BFMA 5AQEA 1MO6A 2ORYA 5BW4A 4LI0A 2QLNA 1X3LA 1C9DB 1QGOA 3A4LA 3AXTA 3GGOA 1KP2A 1OKKD 2ZRFA 3K9OA 5IVDA 1FW8A 4WRRA 4N40A 3ZQUA 4DV1B 4MUJA 3IA7A 1N2IA 4P7JA 1Q7TA 2JLCA 1E3SA 1XZQA 1B73A 5THXA 5U9CA 1NG9A 2Y99A 1XTBA 1W36C 4CV1A 1PD1A 4YUZA 4JLNA 3E46A 1VECA 1D4OA 1XZIA 2WKWA 3S5UA 1V4VA 3T7JA 3TRDA 3SVLA 3D1VA 5G02A 3CS3A 2L6OA 1QDUA 4B34A 4CE6A 2QL5A 3C5CA 3FJ1A 3IX7A 3M2PA 4B79A 1UFRA 4II7A 4OCZA 1SCNE 5FCDA 1ORIA 4QQKA 3SF0A 5BQ3A 3F9IA 1GRRA 3TLXA 5F2NA 2HSEA 4HP8A 2L42A 4P5EA 2OCPA 1W2HA 2XLBA 5FQOA 2AX4A 2FKNA 5JMOA 1M66A 2J9GA 4U8HA 2IELA 5L45A 5A0TA 3U4QA 4L9SA 1X9GA 4GX1A 4B3FX 1SU6A 2NSHA 3PBKA 1P60A 3GGCA 1LBTA 3ZWNA 2HU2A 2CVQA 1URPA 3TYXA 2P5SA 3A2MA 4JQYA 1Y6GA 2G09A 3IUPA 2BFBB 4AX8A 4CDMA 2DHYA 4ITRC 1H3EA 1OFIA 2QRUA 3O73A 4E2ZA 1YC5A 2VN8A 3RYCB 1AKTA 2O6LA 3UXEA 3MHTA 2A78A 2J67A 3K8YA 2PGAA 3U4DA 2H2DA 5JNVA 3T12A 5JD4A 1PG0A 4PG8A 3R3UA 4YAFA 2P2LA 4ZTBA 2FW8A 2QIOA 2DVWB 1CJMA 4AUKA 1OOEA 4F86A 2Q9AA 1GTL1 5DTRA 5BPFA 1WSWA 3BDAA 3LZDA 1MOQA 4GSKA 4C43A 4J16C 1Q15A 2VJMB 2ZYTX 3LIIA 5BW6B 4F3RA 4G84A 3G8AA 1I13A 1F8YA 9LDTA 3TZKA 2Z56A 3K0CA 4DEVA 2P9EA 1DIGA 4FNAA 5G4KA 3NXSA 4RVUA 1F3LA 3DHVA 5FNVF 3X0DA 1QRUA 4OHYA 1J21A 1N36M 5EWJB 3ESZA 2P2SA 1GZDA 3JWIA 2C07A 3B85A 1Q39A 1TAGA 1YB2A 3B9RA 2CMDA 4UE2A 4O4LB 4Z7NB 1I6LA 2PGOA 3EGVA 1I2MA 3K32A 1H3NA 4WERA 4QGSA 2C9MA 2AQ8A 3F1LA 3SM9A 3Q7TA 4EEXA 4PSKA 4C4PA 2FAXA 1FSZA 3ZLJA 3O2QB 1P72A 2Q27A 1I0ZA 1FFXB 4H6XA 5AW9A 4DRXB 2VZ8A 3MT9A 2OXRA 4DE5A 4BFUA 5JD5A 1V8PA 4AC9A 3U19A 5HKKD 4DT1A 4YPOA 1KDPA 3OFNA 1R9NA 2X2PA 2Y0DA 4DIDA 1U2SA 1XGKA 2WIDA 2WUDA 1NY6A 3QFSA 2DZOB 2R6HA 1NLUA 1ONNA 1ZM7A 3I8OA 5G40A 2FFRA 2O7RA 4RAQA 2VBCA 4OHWA 3KT8A 3MN1A 3EQ6A 3QTTA 1ABEA 1CDEA 1N2XA 3JVVA 4IJQA 5AJWA 5HJ5A 3G02A 1C30B 5IHXA 4B09A 3GPXA 1G1AA 1L3CA 2GXAA 5CYPA 2X5JO 1KZGB 1RU3A 3DV0A 4Q15A 2J3JA 4F4CA 3N0XA 2P2CA 1DGQA 4WEQA 3QVMA 4M54A 3I04M 2PXAA 3T61A 4B75A 5TJ9A 1J0CA 3OF3A 4MZDA 3JTMA 2DMRA 4LIPD 4BMZA 3EAQA 2O23A 1LDMA 1R8JA 5IJ9B 4UHBA 3B8EA 3BTVA 4FGWA 4OKSA 5KNBH 3DZBA 2VXBA 3H5RA 1RM4A 4GOXA 2SBTA 4BKMA 4D3DA 3M6MD 1I1NA 4M1YA 1EM8A 4WOPA 3G9XA 4YCBA 2D0DA 4YLYA 2CK3D 3R7FA 2ZBDA 4Q34A 2P2GA 5E9QA 3RS5A 1JLLB 4L28A 3O2JA 3K9BA 5CT8A 3UH0A 1XR3A 3ZHUA 1I0LA 1ZD5A 3FZNA 4MPJA 3ANTA 3IP7A 2NU7A 3M6AA 2UUBM 2EKBA 4HFRA 2WF6A 1XHEA 4XSHA 1IHXA 5ALRA 4EJ0A 1ZKDA 4MQBA 3RRNA 3BWBA 5CFPA 3VDXA 2N9UA 4QUDA 2Z2JA 4ENTA 3D2LA 3O38A 1A4UA 3M3HA 4NBKA 4WLVA 3S55A 1CV2A 4AQYM 1YUBA 1PGJA 2GPYA 4J3NA 1KDOA 2FSGA 3L1VA 5JT1A 5JWOA 3PJFA 1ZD8A 3FOCA 2PZLA 3BIWA 4JN6A 4OL9A 5CT9A 5FWDA 3PWSA 4G4NA 4UFOA 1RVDA 1U3DA 4GXTA 1B15A 4BGUA 4B5KA 2QTVB 3G59A 4BV3A 2HRRA 2V6FA 3ZQ6A 4IIJF 2OCIA 5LC1A 4Z49A 2ZR0A 3L28A 1CS0B 1LBEA 2CXXA 2ZTUA 4R1NA 3QY0A 5AVUA 1PS0A 1ZL0A 3KYCA 1XZPA 3IP8A 4EG0A 4RHTA 2YOHA 2R8PA 3DGFC 3TOZA 4FMDB 4L0CA 4AMVA 3SHFA 1RZRD 4UCFA 1AUQA 3USZA 2JEZA 1ILWA 1E6EA 1TMKA 2TMKA 2WTBA 3LLMA 3PE3A 5KYXB 1P29A 3A04A 4FHDA 2TSYB 4HB3A 1HQKA 5EUQB 3ASUA 4RF0A 2GO7A 2I2FA 2I65A 3KYJB 4M36A 4UEKA 2QRQA 3TJRA 1ODLA 4ZOQI 1BU8A 3ZY4A 2Z1DA 3FCYA 1JU4A 3J7AS 1PHPA 3BBZA 4LOLA 1V6SA 1QFMA 2C04A 1QB7A 1RJ9A 1VA4A 4R9UC 3MB5A 1MIOA 3BBLA 3EC7A 2WY2D 1Y7HA 3RBVA 1UBCA 1Q50A 2I76A 2JAPA 3VJLA 3AR8A 4J7AA 1F8GA 3X3HA 3TQTA 3GAAA 1XMVA 2Y1XA 1IMJA 3GAMA 3QWFA 2HNBA 4FZVA 3O4VA 3WIVA 1GJTA 1Z0SA 3WB0A 2D5IA 1RHJA 1WCYA 5JH7F 4LJ6A 5IF3A 3WGOA 4QUJA 5DSZA 4DLBA 2PAAA 1P7YA 4OSPA 3PQ2A 4V02A 1E1QD 2XUIA 2O0LA 3VH4A 4KV9A 1DUSA 4BP9A 5ALJA 3RF6A 1GHTA 2JP7A 1DC3A 1ZOSA 4BL5A 2YRFA 4QO7A 5EIBC 3UV6A 1MO2A 1GT91 1RLIA 3K0FB 4MRMA 2VP6A 3WFJA 1INLA 1HH4A 4EKGA 4IQ4A 2IPLA 5AJXA 2PBRA 5D3KA 2PX2A 4IIHA 1AVTA 2BV3A 1YZKA 2IXEA 3E7WA 4QD3A 1PVOA 1F51E 2C7QA 3TSCA 3GFSA 2FB9A 3MWFA 5JD3A 1D2GA 3V8QA 2GEUA 3OUTA 1PR5A 1H6AA 1LWNA 2DGDA 4PTLA 4LC9A 1FMLA 1KHHA 2X77A 5BVHA 3M6UA 4Z54A 1Z6AA 4K87A 3T7EA 2OY0A 3U80A 1FLDA 3II6X 3Q2OA 4JI6B 1OREA 3K4QA 3NEYA 1NLFA 4AKHA 3CB4A 3ENQA 4MVJP 1K6XA 2Y0CA 4BVJA 4IJMA 4D2IA 2ZDHA 2VQSA 1OROA 2CK3A 2AOUA 3OJWA 5HJ7A 1GPWB 3HYCA 3NHZA 1ZRSA 1L7RA 4JB8A 4O1HA 1UJ6A 4Q1CA 3KTOA 1RHRA 5CEFA 1P9LA 1Q91A 3Q0EA 4MV4A 2WWRA 3OWOA 3EZXA 3TBFA 3PNMA 3JW8A 2ESRA 5IMSA 3D1JA 3B6JA 4IHJB 3FDFA 1P1JA 4HB4A 1PDWA 1GPNA 4P08A 3R09A 1D04A 3S44A 1YVRA 3D3WA 4CBVA 4M9XA 1BS9A 3PHGA 1HNZM 3N2KA 4I7EA 4YLEA 3T41A 1YRLA 3H8JA 2PRJA 4Y67A 2C0PA 4GGPA 4UASA 2GAOA 1X37A 4FVTA 2J3EA 4YAKA 3E3MA 4KQKA 3O2NA 1VG1A 1ODTC 5C52B 2XOKD 1YA8A 5ENVA 4M9QA 4U39A 2BGUA 1GZ6A 2FWAA 2RMKA 1CZRA 3R3WA 3HHWA 4LF6M 1FQOA 5E6UB 3RJMA 2JGAA 2VPIA 1RXVA 5JJLA 4ZANA 3WDKA 4IF6A 4F84A 3EXEB 3F71A 4Q5IA 2HA7A 3QXHA 1Y8AA 2K2WA 3ROTA 3VKWA 2OHIA 1EX7A 4R1LA 1BJRE 1XLWA 4DWWA 3HHPA 2DAGA 4TV9F 5F7JA 3TL2A 2C29D 2C88A 2BSQA 1XT6A 3OQIB 1GZ3A 1RXSA 3C8UA 4M0PA 1WTCA 1HTBA 3QV1A 4FYKA 3GEMA 4C4SA 4CCYB 5ALSA 1ZR2A 2D0PB 3DE7X 3EFBA 3PK0A 4TM7A 1L3BA 4U4AA 3W9YA 4B47A 5FWXB 1V37A 2H7YA 3AF2A 3J81k 2AUNA 5C7YA 1GQ2A 1U1DA 2B8WA 1M67A 4L0QA 3T3IA 1TJ5A 4AZWA 5HWSA 1NA5A 3KEMA 3UENA 3Q8GA 3AWIA 2R1TB 3F5MA 4M0MA 2NU8B 2XUJA 2J09A 3WGUA 4UHHA 4BWYA 1FP4B 1P5HA 1OY1A 4TWBA 4QAQA 3M1AA 3O74A 1P1IA 2GEKA 4BO9A 4GOLD 4EJSA 2XVAA 1J5EM 2F59A 3HNOA 1FNBA 4WCFB 3TXYA 4RTQA 5G4KB 3DGEC 1Z9BA 2NZ8A 4A15A 4WN3A 1KK3A 2YZGA 4NATA 2PA0A 1PBNA 3MK6A 3L27A 2QW0X 4FGZA 2ST1A 4NBWA 2DAEA 1M6VB 4OU4A 4P4GA 5IW8A 3RRMA 3ZXIA 1ZI9A 2H1CA 4IJ5A 1TX4B 1ZM2A 4DLSA 4OD0A 3KQLA 3FE2A 3FH0A 3SKVA 3UT5B 1DO2A 1JECA 1M2VB 1WNFA 3HX3A 1MXFA 1Q11A 4L95C 4YQFA 2PUWA 2YHBA 1TQ8A 2ZIUB 1DARA 3W6ZA 3ZZTA 5CBPB 5M04A 4ZJPA 4RTJA 3OO0A 3USES 1HI9A 3IP3A 1O1YA 3QF7A 1MU0A 4QTXA 4PWYA 1XTPA 4Y6PA 1YE8A 3ZHBA 5JBIA 4G4SO 2P6RA 2RH4A 2D1FA 3DFUA 3IBTA 1GNSA 5E8JA 1AQLA 1Q44A 3IUJA 4UUBA 4DCNA 4CIBA 2Q2WA 4HGQA 1VL8A 3PWKA 4RKRA 2IWRA 1QFSA 4AL4A 5T3YA 3OTHA 1A5BB 2EKZA 4BP1A 3HEMA 3OQBA 2A3RA 3RU2A 1ZQ9A 2I4MA 2JIQA 3K0BA 5JPCA 3L7AA 3VYRB 1NJ5A 2YNMD 2W2LA 1ZAEA 3J7AC 4C30A 4ZMBA 2IZ5A 1NJ1A 1NRIA 1R1DA 1RAHA 4KLCA 2JY7A 1GPKA 3KT6A 4MIEA 4BP8A 3OMLA 3W0FA 4OO3A 8ADHA 1JFSA 1RWXA 4PSVA 1YGPA 3CMMA 3ROFA 1QRAA 3GFQA 5F2EA 2IPMA 3FX2A 3LOPA 1VE6A 3OIFA 2AHMA 1NLYA 2AV6A 3PT5A 4L07A 3EJWA 4N65A 5TV2A 4ILKA 1RPJA 4TXHA 3HFGA 4G9GA 4DLPA 5BN5A 3A32A 1U65A 4UUNA 1CEQA 1TLFA 2CJFA 4JLOA 1UL1X 3JQRA 3JAMA 2Z8YM 1FDRA 1UC5B 4AF8A 3ZYZA 4BKQA 2OQRA 5ALHA 4I08A 1TQ2A 4KDCA 2FXIA 1MPXA 1NVVQ 2ZJ6A 4QDZA 3AVXA 1PJQA 1QVRA 4ZT5A 3A3PA 1CQIB 1WHTB 1DFIA 1G4AE 1P2UA 3Q15C 3R77A 5F77A 3ONDA 4ASUD 2XA9A 4EHIA 4O1MA 1WDMA 2NTNA 3HXLA 4CCYA 1FVFA 4QXQA 2AB0A 1NC3A 4YRZA 1QAOA 3LT1A 4WV3A 4CV3A 3UAGA 1PW7A 2JS7A 5H16A 4DDKA 1YQDA 5JBQA 3NB0A 4BUJA 4MRRA 5KQRA 1UKAA 3SOPA 4OIMA 1FJXA 5F98A 3GFTA 4R71A 2GPWA 3TL4X 3GGDA 1WXQA 1QQWA 1VPEA 2WINI 1CR4A 4LJKA 5H9VA 3T1YB 1XRJA 4MO9A 3BT7A 4X85A 1T6ZA 1WCWA 2BFCB 2D4HA 1D9XA 1S3SA 2AJ8A 4KHZA 4LYYA 4DQLA 3EEFA 1SC6A 2EU8A 1KZ4A 3LT4A 4URUR 1NC1A 2FPXA 4MQLA 4NAUA 1II8B 1J2TA 3OSUA 2ZYIA 3JQAD 1JU9A 1AA9A 3DMGA 3UTCA 2XZPA 4RKQA 2FZKA 1ITZA 1JDBB 1MQ9A 1QR2A 1GJRA 3NM4A 4OGKA 1DPFA 1QYCA 3Q72A 4ZMRA 4R3DA 4YJ2A 1RXUA 2F3RA 5IBQA 5FA6A 5J58A 4HC4A 3BHNA 1GPAA 3RLIA 1CHDA 2IVZA 1Y1SA 2IZ1A 3E4CA 1QE0A 3IALA 3R5XA 4FK8A 2RI0A 3L40A 1HQYE 2ZAGA 4NK5A 3GLFA 5DWVA 3R8XA 3KQHA 3Q7SA 4LE1A 5K51A 4GUAA 3N53A 4MIOA 1O5IA 1A8UA 2WWHA 3CA8A 3ONWA 2ZXUA 2YZNA 1WABA 5ARBA 1JIKA 4MPPA 5AH0A 5A3VA 5DGDA 4QDTA 4CEJB 5C8XA 4Z0TA 2PDAA 3CB2A 4U9HS 4GL2A 1OFGA 1OX5A 2Q2VA 1VFPA 2C7GA 2FEOA 2ADFA 4DMFA 3MC1A 1XZJA 2ZVDA 3HJRA 4J0GA 1R5NA 2PLNA 3F96A 1JYSA 1T3GA 1OAAA 4Y2HA 4KYTA 5B6JA 2YDYA 5KO3A 1XTUA 3SX0A 3HN6A 1YZQA 3UT5A 3DHNA 1PS9A 4WXPA 3QJYA 1MDFA 5D2CA 2RCNA 2XB4A 2XNHA 5L6LB 2ZBVA 3IV7A 3KDPA 2C1EA 5B12A 1YHZA 5HG0A 4CLRB 5HRCA 1EE8A 3LUCA 1NBMA 3I04A 5DGXA 4XGKA 1OWMA 4ND7A 2CSXA 2HPHA 3V34A 4HV4A 1KWGA 2HH9A 2VAVA 1VBMA 4W82A 3TEJA 1ZU4A 4B7GA 1IY8A 4EPXA 1T3LA 3GF4A 3MJFA 5A4AA 3CO0S 1CEEA 4CN9A 1D1TA 1YQTA 2AN4A 4OLJA 3ZDRA 3JQGA 4KQEA 2P6OA 5LQUA 1P2TA 2P9GA 2IL1A 2XWSA 3L1KA 3SSMA 1E94E 2DTXA 4BGDA 1YRYE 3U6MA 2BGJA 2HWYA 2W6PA 4WKBA 3ZJVA 3DF7A 3RD5A 3KAJA 2IOFA 4O2AA 4RK7A 1GDDA 5GV7A 4D3SA 4Q1VA 3B6IA 3E3OA 2BEVA 3MWJA 4MV5A 1B93A 3QHQA 1IH8A 3K2EA 1C8LA 1TQ4A 3TW8B 3ZKAA 4DCMA 4KRXA 4EB3A 3ROPA 2N1BA 1T2EA 2WAOA 4QFMA 2KNAA 5EUBA 4Q3EA 1Q7CA 2ZI4A 2EFCB 1RRKA 2MSCB 1EBBA 1TM5E 3STHA 1XAJA 4OK6A 4X84A 2HL6A 4K9LA 1N5DA 4KQ2A 4WIAA 3Q7PA 5AK0A 2R7NA 1JHOA 2CVZA 5IDWA 4F04A 3RV4A 5SZJA 1G20B 3LGXA 1CHNA 2ZJ8A 1H65A 1G8AA 4J94A 1SKAA 2V6ZM 3EA4A 1ULHA 4WMLA 3D43A 4MGKR 3NQ41 2ZIZA 3ZDFA 3WHKA 3UIEA 4X1KB 4F72A 4JV5B 3EVTA 1VBNA 1XWWA 1ZY2A 3WWCA 5U4XA 3FKJA 2X2EA 4QYXA 2Q5IA 1L9KA 4IBGA 1NQOA 2PS1A 2V96A 5AHOA 3CKMA 3ROGA 3E9RA 2R8EA 4CQJA 2GZHA 1E2HA 4GBED 2J85A 4N3BA 4J91A 1W25A 3R3HA 1SG9A 4X7PA 3BWDD 2C4KA 3B1VA 3W90A 2M1ZA 1NNI1 1JR3D 4PIPA 5F4BA 1VDMA 4RY2A 5D1HA 3DXYA 1ADJA 2AOWA 2CZGA 3DKIA 2C59A 4AWBA 5B6PA 2Y92A 3GEHA 5D6OA 4OP1A 5E2IA 5EHQA 3FWKA 3TDKA 2ZQZA 3LSYA 2FRDC 2IPOA 1RACA 1L5YA 3DLAA 1NKVA 4RL4A 4BGIA 1CQIA 1WHTA 2YV3A 4GYWA 4U6SA 2JIZD 1GJSA 4BASA 4BKRA 1TMOA 1GITA 1IL0A 2D2VA 2UYQA 2PUVA 3I52A 3MINA 4GP7A 2HWJA 4YJFA 3E3NA 3NBFA 2QTWB 4NCXA 1Z5PA 1VLQA 3OKCA 4MI6A 3JPWA 1ZVJA 2VPQA 2CKMA 1D4AA 1JDSA 4Y6LA 2W98A 2H1SA 1YQ9A 4P16A 1T29A 1TXGA 1CW2B 2RGDA 3IEUA 1WUYA 2FN9A 3ZU2A 1OU0A 4OHUA 1ZL2A 1A8HA 4LGCA 4F1KA 1KO8A 1N0WA 2GRUA 4PSDA 5JYCA 4F96A 4N7BA 3O3MB 2JAUA 3W0LB 3B60A 1CS4C 2ZSHA 5GPBA 4ATNA 3QBDA 3L8CA 5F9HA 3UMGA 4PG4A 4E5KA 2FPSA 4LSMA 4X63A 4CLDA 1AU9A 1EP2B 5FEUA 5DYGA 1ACLA 1VHWA 1U2GC 3G2KA 3EGCA 3PJEA 2ZBFA 1JT2A 5AESA 5DTMA 3ELUA 4OU7A 1VCHA 2EG5A 1Y7IA 3ENNA 4UEWA 1H9CA 3AYXB 4KGDA 1MAWA 3RUHA 3F9CA 1NN0A 1VCIA 1BFDA 1TPZA 2HM7A 1JFFA 2O4CA 2QUAA 3K0FA 1ZGAA 3OPVA 1EJBA 5FTNA 1M1YE 4I55B 1ZV1A 4LHVA 2YWHA 4CV2A 4WXEA 1ZD9A 2DWMA 2IXBA 4V0QA 4XJVA 3IQHX 4C7OA 3KP0E 4Z4CA 1XU9A 3ZNPA 4QHSA 2FVYA 1QKJA 2JGEA 4NU6A 4H1HA 3EPJA 2KLBA 2O2DA 4NCKA 5AVVA 3IHWA 2B5OA 3PNKA 1OMOA 4HLNA 3OQPA 4DJEC 2MMGA 4FYMA 1U0LA 3OFVA 1OLSA 1FXWF 2HIGA 2J33A 2RBGA 3NR2A 5EINA 4F3TA 2PZ8A 3KO8A 3A8TA 3B5JA 1KI6A 5IBPA 5FI3A 1V33A 1XYGA 4LMPA 3ZWAA 1RJ9B 4KCGA 3X1YA 5ED0A 1D8AA 3I4VA 4YXWD 2CDCA 2ZSAA 3MFYA 2HQBA 3L6RA 3H2KA 3KQVA 4KWEA 5AT1A 3T5AA 2JFQA 1VB5A 1RI1A 1PFGA 1S8OA 3OZDA 1DRJA 3ZCSA 5LD2B 1XAIA 3V4PB 3JARB 5FAKA 1X2EA 1MX3A 3F2VA 3WC4A 1J9GA 1GNTA 4NBRA 2A0WA 1Z36A 1VRVA 2PL1A 3CGGA 3MXTA 4RTOA 2J3KA 3B7ZA 2OORC 1SKYE 2OR3A 4G5OA 4DLXA 5BN1A 1G3UA 4RZ2A 2JLYA 5JPDA 1UQRA 2OMEA 2CLLB 2GPBA 1H5QA 2V7QD 3LX8A 4LNAA 4TKUB 3U17A 4WXYB 3VR4D 3K70B 1SK9A 4IZOA 5CM8B 3INNA 1TRHA 4WLFA 2PSSA 2IC5A 4BJ6A 1WE2A 3F4KA 2C2ZA 4LVUA 2BHRA 5BY2A 2YINC 1IDN1 3L8MA 4KX3A 1BXRA 5JAZA 2PNJA 3UHFA 4J90A 3SE7A 1FMJA 5L7TA 5CCXA 1XD2B 3UHAA 3OUZA 3WB1A 1IMOA 4DR1B 3ZS9A 5LZ9A 2HGSA 2CFCA 4R83A 1WDLA 2EIHA 3BE6A 4EPWA 4YMVA 1XMXA 1IU9A 3DH0A 4X64M 3WA6A 1Z16A 1EHIA 1GPLA 1WPQA 1YI1A 2MYTA 3AIOA 3LBFA 2P4SA 4P7FA 4X7MA 1W8IA 2ZXFA 4L9AA 2PCLA 1LDNA 5JE8A 2YASA 4KOAA 1VHDA 4UCQA 3T94A 3WLIA 2GF0A 3CLUD 1KJIA 1DJPA 3E9EA 1M8PA 4V0NA 1PZEA 3NYWA 3A4VA 3JQ9A 1WV1A 3MNFA 3T35A 2Q2OA 4KUEA 2DZDA 5TY0A 3QIAA 2NSDA 1U8FO 1RR6A 2YDXA 5E9AA 5DASA 3QYPA 4WNYA 4WZAE 3LQQA 1N6RA 3C3CA 2WHEA 3HJAA 4QGGA 1U3VA 5KTMA 2YBDA 5F52A 4WUTA 4UD6A 1PFUA 1K7FB 3UJNA 2V9ZA 3FMGA 3PB3A 3PXBA 2IUUA 4AYWA 3QM1A 4FONA 3AJIB 1U0JA 3RHSA 4B0PA 5EIWA 2EJBA 1MZVA 4IHJA 2F3SA 3DWEX 3FMPB 3BH7A 1USWA 4G36A 3UUEA 1V9CA 1GGMA 1K8YB 1T34A 4TXJA 3T8YA 5FI0B 3G1UA 4TPKA 1Q7BA 2G9VA 2X22A 3QVSA 4POAA 4BMVA 2LXNA 1I14A 1BGXT 3AR7A 4JZYA 3OZAA 4OB8A 3KKQA 2I5PO 4Q7QA 4J76A 3RQSA 1ICIA 2VZLA 1NX9A 4LOHA 2BF4A 4P3OA 1GWNA 5ITZA 3Q6IA 4ZZ1A 1E3EA 1ZRHA 4QARA 3FOEC 1EX6A 2HLDA 3PPIA 2Z30A 4H7EA 4JYPA 3NV7A 2IV7A 3UWMA 2QT1A 5B2EA 5CNJA 4C4AA 2SCUA 4QOFA 3BREA 1AUPA 3CT4A 1NKTA 1QPZA 5EQJB 5A7GA 2HW8A 3F67A 2IIVA 3L6CA 2H3EA 3D0KA 4O4LA 2WSMA 1U9CA 2GNPA 2PKQO 2O9JA 5GVRA 4HVLA 3QX8A 1LQUA 2WD7B 2ZJAA 3DVSX 3L7DA 4OGWA 4KWCA 2PWZA 2VCEA 3W9BA 3GEDA 2ZAYA 3B1KA 1AKWA 2RC6A 3SDSA 1WB9A 1OXXK 5BWMA 1GARA 3E1GA 3LAWA 2WLSA 3WZ2A 1TYDE 4DV5M 1M1NA 2ZIWB 4UDOA 3G17A 3I34X 2V98A 2OVBA 1HQCA 1V8DA 1ZGGA 1X14A 3TDMA 3T4UA 2IZOA 1KBQA 3H2IA 1WBDA 2C5SA 3AERA 2QM7A 3GYBA 3A9TA 1DAKA 1AXEA 1S2LA 3IQWA 2P3QA 3JZMA 4WZBA 1L5HA 3VNVA 4GD3Q 2EW2A 4QG7A 4LBYA 5EHGA 3R7WB 4IDAA 1U04A 2B2XA 5H8WA 1AXGA 1T4DA 3G89A 4JI1M 2HADA 3L7MA 4C4TA 4OLBA 4AQDA 4YP0A 3VU1A 1XVUA 2PLFA 2DWQA 4OP2A 4EJ2A 3V4RA 3WKAA 3VYUB 1TR8A 4HL6A 5LJIA 4IVQA 1SBQA 4G4OA 1Z7BA 1COZA 4LCBA 4PX9A 4M21A 1XLTC 3T5TA 3EZ9A 4J4BA 3PRYA 2PMDA 3EIUA 2FPOA 3GJQA 3JTEA 2ZE8A 4IDEA 1PK7A 4OUDA 2XMBA 5E3HA 4F6RA 3U4QB 4ZAYA 3WNZA 3R75A 2BGTA 2C2XA 2PLWA 3U4IA 5TARA 4YRSA 5LIRA 3CTPA 4IOJA 1I5OA 4HPWA 2RGGA 1U1FA 1UMDA 2ZROA 2Q3DA 4NNJA 3KZVA 3QXSA 1J7KA