4LJ5A

Clpb nbd2 from t. thermophilus in complex with adp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
331
structure length
320
Chain Sequence
MEVTEEDIAEIVSRWTGIPVSKLLEKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
molecule keywords Chaperone protein ClpB
total genus 97
structure length 320
sequence length 331
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj5A01
4Q66C 1X8LA 4B6FA 3CRW1 5DYIA 2OCBA 4HAWA 3U3KA 3QF4B 4YMWA 3SEAA 4Q4AA 3H4MA 2IXFA 2GJ8A 4B43A 1KI2A 3F3YA 3U7HB 3A58B 2VHUA 4QG7A 2O8EB 1TQ4A 1NN0A 1XBTA 4QBFA 3RRMA 2PJRA 2QAGC 3AGQA 4C0SA 1F2UB 2JIZD 5KPJA 2C9OA 2H8KA 3V4FA 1XXHE 5E7IA 3TVDA 4CEJA 1DG3A 1JALA 3AF3A 2VHCA 5JJKA 1UADA 2QMHA 2BM0A 3O8BA 4JZKA 4P31A 2GESA 2W0MA 3A4LA 1TTTA 4QM7A 1ZNYA 4BLOA 3C8UA 1KDPA 1QHYA 2IX3A 2JDID 3KW6A 3LWNA 1D9XA 2FFQA 1XD8A 2QE7D 2ZRJA 2GBLA 4G5GA 5CK4A 3SZRA 3PEYA 4NZYA 4EPTA 3ZVNA 3HU3A 3K0AB 3LO5A 4PC1A 1IY1A 1OLOA 2GZAA 3U60B 4OL0A 5JWRA 2WSSA 3QI2A 1U0HC 4LZZA 2NO7A 4YQFA 1CR2A 3ZH9B 4HLQB 4TLCA 3S1AA 5JMTA 3DPUA 3UPUA 2B8TA 4IFBA 4Q7KA 1XCMA 3W3ZB 3WXMA 1R10A 1CRPA 2F43A 3Q7PA 2AD1A 1CJTC 4PAMA 2XNSA 4EDHA 3OE7D 3ASYA 2D62A 2WOOA 4O0MA 2ZM5A 1OHHA 3REFA 3JZMA 1P2SA 2JLWA 4MYCA 4D2IA 1RC8A 2OCYC 3CLVA 5J5CA 1ZC4A 3LQQA 5FTKA 4BGDA 4MGIR 2ONJA 1E2MA 1N0VC 4QKQA 5D3MA 4QNRA 2I1VB 4HAXA 1HH4A 5SZHB 3RWOA 3U61B 3QPUA 3NC1C 4NHOA 4IXNA 2DYKA 1EGAA 4S35A 2B21A 2ZITA 4XWAA 4TMKA 5F9FA 2CL7X 2WIAA 2IEYA 3K8YA 1Z07A 1P61B 3E5HA 5FI1B 2VP0A 3K9NA 2FNAA 2FGKA 2GF9A 4HB3A 4ILEA 3QKSB 4D4KA 3WYGA 5BW8A 3FMIA 1GKIA 3J81k 2V6IA 4IDQA 1KDTA 1GNPA 3PUWA 5GJCA 1NVVQ 1Q44A 4ARZA 1KK1A 1VMAA 2FPMA 4JSTA 2VP4A 3TSWA 3KFXA 2G6BA 3AV0B 1G291 3KQKA 2HDNB 4TN1A 3KXIA 3CH5A 4IW3B 721PA 1YZKA 1OXSC 4EFNA 4ZDIA 4Q47A 4BFVA 4OQXA 1Z0KA 4D81A 1E79A 4KFSA 3KFVA 1W36B 2C99A 1GVNB 4RD3A 1ZUNB 2ZRGA 2C77A 2BV3A 3GLFA 4C30A 4B73A 3MWJA 1QHXA 1II9A 1U81A 1NIPA 2W2VA 4NKRA 3AUYA 1MH1A 3W6OA 3Q72A 2Q21A 2RMKA 4F4JA 2ZJBA 1GUAA 3FMOB 2OXCA 4NYJQ 4PQYA 3SE0A 1SGWA 3GJ3A 4TLBA 3CZPA 2J87A 2OG2A 1WA5A 1AZTA 2JLVA 2FZ4A 4M53A 1XTQA 1MO5A 3LW8A 4XWOA 3I61A 5LD2C 4KJZA 4V0KA 2VO1A 2YZ2A 1FUUA 3MD0A 4Q4JB 2F1JA 3KKPA 5FPYA 3T5DA 1AA9A 1JAHA 2ZUDA 3GJXC 2XB2A 1DADA 2GCNA 2O8BB 1ZNXA 4R2IA 5BN3A 3VNUA 4WZBE 3A37A 1U94A 2YINC 2VEDA 4DDUA 4JKIA 5A4JA 3TUZC 1ZYUA 4URXR 2VSFA 4GDFA 2Q9BA 2YYZA 1EFHA 3DHWC 3IO5A 3ADCA 4NCHA 4PPNA 4NBSA 5LPNA 4Z8YA 4OJKA 4ZI2A 5AK0A 1ZCBA 3E1SA 2DVWB 1G3IA 4MUAA 2D7DA 3A1SA 3P1JA 4XIGS 2HV8A 5AJXA 5JLJA 1CR0A 2GNOA 3T5GA 1KZGB 5JI2E 1TQ6A 1WRBA 3BERA 4GBMA 4OKSA 4HAZA 5L3SB 3UKDA 1D2NA 4QHTA 3MSXA 3MHVC 2QPOA 2ZJAA 1P9NA 4HLUA 3V00A 2UKDA 2XXAA 4QL3A 3W8RA 2BBWA 2ZRFA 5EQTA 4TSFD 3T34A 1KI3A 4DXAA 1IN7A 3PVSA 5FUWA 1ZD9A 2JLUA 4DDWA 4BFSA 5E4FA 2ECKA 1XRJA 4LK2A 4JVLA 4Q4JA 4Q1EA 4WXPA 1G9XA 1YR6A 5FUYA 4BZPA 1E9BA 3MRSA 5FOSA 4A1FA 2O8BA 2NO1A 3ECCA 1Q21A 1CJUC 3CX7A 1QDEA 3CF2A 1RFLA 2ZYVX 3B85A 4ZPXA 1VDZA 2C95A 3AF0A 2W6IA 1J90A 2PMKA 3OEEA 3RC8A 1XJ0A 1G6HA 5FPHA 4LOAA 2VL7A 3BFXA 3V4RA 2R6AA 2ZRAA 2JLSA 4EUNA 1XPUA 1DAEA 1K5GA 2FWRA 2OBMA 3OF5A 1C9KA 1EX6A 1G8YA 2PT5A 2FE4A 4Q1FA 3WRXC 4RD0A 1LB1B 3VX3A 4TWZA 3NHBA 2WBLC 2WSSD 3PV0A 3QXSA 2BCGY 3EAQA 2CVFA 1BH2A 1HUQA 1W47A 3R8FA 5EE3A 1OIXA 1XCPA 4LYFA 5CIWA 4DT1A 4XVQA 3UK6A 1X8KA 2WICA 4B2LA 4B47A 5FOUA 2DCUA 4EFLA 5J4YA 4LHXA 3GD7A 1P4SA 4LJ9A 1M8PA 2BMFA 1KDRA 1KI8A 5LB4A 5LD2B 4A92A 1MO4A 2QMEA 2ATXA 3U7GA 3LH5A 3TK1A 5KO2A 2FFHA 4AC9A 2HYIC 3IHLA 4MRRA 1KAGA 4BLSA 4BFYA 2ANCA 2AR7A 1NIJA 1M7GA 3QKSA 2ZI3A 1G7TA 2A5JA 2ZSBA 4QJ4A 1W48A 4C0LA 1Q3TA 2H5EA 3QF4A 5IHPA 4AKGA 2MSCB 5E95A 4RCZA 3WBJA 4HAUA 1Q12A 3K0FB 1PVOA 1G8PA 3GPLA 2H18A 4Q01A 4LBYA 3R8CA 1Q20A 1S96A 2GILA 4M1YA 4TTRA 3ZJYA 4G0NA 4G5RA 3TIFA 2ZS8A 4DUGD 2IS6A 2GWHA 1NJFA 4KI0A 4QGFA 2RGXA 4CT5A 5F9HA 2AFIE 3B60A 2ZJZA 2KB0A 2R65A 5DHAA 1C1KA 2CJWB 4L9SA 1VYUA 3WP1B 1YZUA 3LAWA 2WTUA 1CIPA 3SYLA 2ZJOA 2QBYB 1G4UR 4RSGA 2IYQA 3NBXX 3EZFA 3FHOA 1IHUA 1UDXA 4DZZA 1ZU4A 4MRVA 2F7SA 4F7WA 3R9WA 5UKDA 3IDQA 3WMGA 3QXXA 4WAUA 4KITB 5JJIA 3K9HA 3K09A 1XX6A 2Q9CA 3AVVA 3Q3JB 1G16A 2WJVA 3DZ8A 2A2ZA 1NSFA 4Y0VA 1W4RA 1IN5A 1XTSA 3X1XA 1RKBA 2C96A 2JDIA 1SULA 1N6RA 4JS0A 1CR4A 3TRFA 3VU9A 3THXA 4GITA 2V6JA 5FR2A 1XMIA 3CIOA 4ON9A 2QTVB 5HKKA 2OFOA 4FMBB 3LFUA 4OI0A 4EIWA 4FWTA 4BUJA 4LUCA 1ELOA 3CW2A 3AVOA 3Q7QA 4Q4HB 2BBSA 2PL3A 4JMPA 3SQWA 5FTJA 2WJGA 4OK6A 2F3RA 1K5DA 2C8VA 4I1VA 2GJAA 5FR1A 4JIMA 2OFWA 4O2LA 1BMFA 1JJVA 1KNQA 3KQNA 1ODFA 3QOFA 3QF7A 5JRJA 2QM8A 4FWGA 1XTRA 2QN6A 4LV8B 3THYB 1W2HA 1LVGA 4H9GA 4A36A 1JEDA 4CRWB 3BD9A 4TYYA 4LRSA 4ESVA 1WBDA 2RGDA 2OXRA 2ZANA 4MKIA 421PA 4D82A 4DDTA 3L0PA 2QBYA 2DBYA 3AP3A 2UZ3A 3ZZ0A 1XEFA 2WV9A 5KSYA 2I1QA 4TMZA 4DLYA 5KDOA 3KB2A 3ZVLA 2VSXA 1OFUX 3RWMB 1ZNWA 3K70B 4HYYA 4P4SA 4GZMA 3RS0A 4JLDA 4NYJR 3CF0A 4MYHA 4Q5IA 2JA1A 3L0SA 2YC4C 3VR6A 1UBEA 1T4GA 2NG1A 4UNPA 1E94E 3SFZA 4PSAA 1KO7A 4IDNA 4JBXA 1XU4A 2HF8A 4HDOB 4TMXA 1CJMA 1Z08A 3L82B 1GSIA 1X8JA 2IYTA 1T0HB 5AUNB 2H16A 5JS8A 5FBVB 3C5CA 2WVJA 3AP1A 2AFHE 1FX0B 3QIAA 5L3RA 4LHWA 1LS6A 3EW9A 1OH6A 2ZUBA 1GIAA 4W5HA 2WKRA 1CP2A 4A0HA 3I5XA 3TW4A 3EX7C 1VG1A 1PLLA 4HATA 5HZKA 4PPFA 1E0SA 4Q7LA 4BZQA 1YR7A 3WNDA 1R8QA 2AN9A 4HDCA 2VHQA 4TZ6A 3GJ4A 1IJFA 3SBEA 4F4IA 3TW8B 2QP9X 3W5IA 2CHQA 1AGRA 1N5JA 3VNVA 2FG5A 1VG0B 5FBLB 1N3BA 2QGZA 1HURA 1NY5A 1OFTA 3SS8A 2NOAA 2ZRKA 5EUQB 2W58A 2FEOA 4YXWA 3HWSA 2NO0A 4DLZA 3MJRA 2XNDD 1OIWA 5AUPB 2QM7A 2CLCX 4HDQB 5HE9A 1XD2A 3I8XA 3THWA 4JT2A 1G3MA 4B71A 821PA 2R6CA 1D6JA 2I4IA 2J7KA 4G1UC 4DCNA 2XSZD 4N0EA 3OESA 1QVRA 3THXB 4BFZA 4FWDA 1H8HA 4HLCA 3ZGXA 1DARA 3MCAA 2VA8A 2VF7A 1SXJD 4JJKA 2WWHA 5TY0A 1E9EA 4V03A 2HYDA 4ERNA 1W44A 3KJIA 3LVQE 4I1OA 1COWA 5KYKA 3B9QA 1F60A 4C9BA 4XD7A 2J0UA 2VPPA 5P21A 5IT5A 1NVMA 1YHNA 2WAXA 5CM9C 3EZ7A 1GFIA 4QHYA 2LCFA 3G5UA 1QHSA 2A5FA 1RYFA 5JHHB 1NBMA 3SHWA 2BIFA 2FV8A 4LJYA 5J4KA 3IEVA 2QSYA 1UBGA 2B92A 1Z6YA 3SI7A 4AYXA 1MRNA 1OXTA 4CEJB 4QGAA 2NGRA 3M6AA 4QBIA 3FKSD 2CBZA 1Z0FA 3Q9LA 3VR2A 4D0GA 1NBME 4NDZA 3RRZA 1TF7A 2HLDA 4RFSB 1BYUA 1EESA 1FZQA 1E0AA 1SXJC 4P4SB 4V0MA 3W90A 4D4JA 1NRJB 2I3BA 2C2HA 3TLXA 3U3OA 5BN5A 2GCOA 5DIFA 2G1KA 1RRGA 1ONBA 3NVAA 2ZRDA 4MRNA 4L9WA 2FDCA 1GP2A 2YNMA 4OQNA 2ONKA 4M1SA 5DO9A 1W4CA 1G20E 2ZSFA 4OHWA 1AS3A 1ZIPA 4MKHA 3G0HA 3F8TA 2CCJA 5BWMA 3WHLA 5SZIA 1KDOA 4W5JA 5AUQA 2JLRA 2FSFA 4QHSA 4EQ6B 3IBGA 1BO6A 2HXYA 5EXPA 4V0OA 3W9YA 3Q5DA 2XZOA 2DWPA 2CMKA 2WJYA 2W6JD 5FH9A 5J4VA 3CX6A 2J0SA 1ZNZA 3HR8A 4B35A 4AG5A 2XZLA 5J40A 3KZ1E 1MABB 2EFHB 4PHFA 3VLFB 2Q9AA 2D3WA 2ATVA 4ARZB 1OH7A 4NYIR 4CVNA 2ZU6A 5FUVA 4PHHA 1V5WA 4EPWA 4MRSA 1UKEA 1Y63A 2GXUA 3ICQB 1FNMA 2WZQA 2QROA 4X8OA 4A4DA 2X77A 4WVFA 2WMNB 3WMEA 2PCLA 1KI6A 2GXQA 2QENA 1UFQA 3AVXA 1UPTA 4TZ0A 4DHEA 1DEKA 3GEEA 1NNEA 1KIMA 1U8YA 1A82A 5SZJA 1IQPA 4E22A 4NYMQ 5FOVA 4JL8A 1M2OB 1F48A 2WMOB 4LJ4A 1XEWX 4JVMA 1RZ3A 4JYCA 1G5TA 2LKCA 1GL6A 4II7A 1DS6A 2J9RA 2DFNA 2K5UA 5D3MB 2ZI4A 5DI3B 5GJWC 5JJLA 4X8HA 3TSZA 3IILA 1PUJA 1G5PA 2ANBA 3OIUA 3UMRA 4C7OB 3RHFA 1NVWQ 1T3HA 2WPDD 4B3BA 1SVSA 2HJVA 3BH6A 1E0JA 3NBZC 3TAHA 2AHOA 4RD4A 1W7AA 5FPKA 4ZO4A 3FFBA 2P3SA 1W0KD 4TT3A 3CWZA 4DEXA 5CK5A 2AK3A 4C0KA 2CE7A 4QFMA 4UJ3A 4JLMA 3B6EA 4XTRA 3RS4A 2ZRCA 3QKRA 4PZZA 2QI9C 2IYXA 2OAQ1 2QTHA 4FI3C 1XJQA 2CXXA 1R5BA 3EA5A 4M0LA 2BMDA 2F1IA 3FKSA 3AKYA 1ZUHA 4B76A 1E2KA 2B7BA 5BXQC 1OKKA 2IYRA 1E2LA 1HA3A 2IYZA 3IBYA 3RSOA 3KQLA 5A0FA 2XAUA 1L8QA 2ZJ2A 2XTZA 2NQ2C 2XTMA 1OPXA 1MOZA 1E1RA 4BEJA 2R62A 2JAQA 2HT6A 3NDPA 2IK8A 3VTKA 5D3QA 1BIFA 3KDSE 2EWWA 3U7FB 2BOVA 1FW6A 4JLVA 4A6PA 3GCGA 4GP7A 2NPIA 1FQJA 3LA6A 5DNYB 2OBNA 3WNCA 4OYHA 1GL9B 4XD7D 4PAOA 3A6PC 1COWD 4DLUA 5HPYB 1P75A 1E9FA 3NH9A 5FOXA 2ZR7A 1TL7C 1SXJA 4A6XA 2R6GA 4A9AA 4LJ7A 2EQBA 2WJJA 2ZAOA 3E2IA 1R5NA 2FSIA 1ZUIA 3KXKA 5JCPA 3T61A 2J45A 5CYPA 2XSZA 2OILA 4OHYA 4FMDF 2OCPA 4YDSA 5C2JB 5E7MA 1KTVA 2ZYTX 1OH8A 1MV5A 3IIKA 3NH6A 3ZQ6A 2N46A 3EZ6A 3GFPA 5CITA 3SQXA 4N1AA 1MRSA 2IA5A 3ICEA 2J7PD 3IUYA 4M4SA 3FOZA 2ZSDA 3CB4A 5H8WA 4JN6A 4KBFA 1Z2AA 1T8TA 4YC7A 3L0OA 3X1WA 2EVWX 2PEZA 4NL4H 5FFMA 2FSGA 4L8GA 3ONWA 2GJSA 3HP1A 3MUFA 5C1BA 2R6FA 3SYNA 1J99A 2DFKB 2GA8A 2VP5A 3IIJA 3U3JA 4TTPA 4ZIRA 1E2FA 2HF9A 1QF9A 3BORA 1W36D 3AVUA 1Q22A 3BGWA 4TLEA 1ESNA 2JCSA 5AUOB 2GDJA 5DN6A 1IN4A 1NLFA 4L5BA 3GLHE 1KI7A 3TQCA 4AIIA 2C9CA 3GLGE 5CB6A 2KSQA 3LXRA 1SVOA 4I1SA 1YKSA 2JJ8A 5CDFE 1VCIA 4FWHA 3CRQA 1TU4A 5SZKB 2OM2A 2AD5A 2B8WA 3ASZA 1ZC3A 2QP4A 2QL6A 3X1DA 4PPGA 3S1AB 3DDCA 4YONB 4D25A 2QRZA 2B6HA 2ODNA 4Q9KA 2ZRPA 1TNDA 2ZJ8A 2VSOA 1F2TB 3EIQA 5L8VA 4Q7MB 3ADKA 5HCIA 4A82A 4DSTA 2IYSA 2YJTD 3V9PA 4OJQA 3EPKA 4EJSB 1II8B 3AEZA 4Q9HA 1QG2A 5TARA 1TUIA 4CW7A 3SHFA 4TL6A 2QNRA 1ZM9A 4OK3A 2DZOB 1QVAA 1IXSB 4UQOA 2O0HA 3B1ZA 1DPFA 1Z0AA 2F9MA 2VIIA 1HEIA 2ZVPX 4IEIA 1S2MA 3M4YA 3ZYCA 4R2HA 3A4NA 3CRRA 2FFAA 4OI2A 2JLYA 3H86A 3O8RA 1YZLA 5DH9A 4DBLC 1II8A 1N25A 3U4QB 1UKZA 2ZPTX 3QNUA 3C14C 2XJ4A 4MH0R 1XP8A 1IJEA 3A8TA 1KO1A 4GI7A 2KBFA 3FB4A 3FDIA 2RHDA 2FSHA 3W6NA 3WY9A 1AGPA 1Z29A 1ZJ6A 4M9QA 4KU4A 2O8FB 1FMJA 2QU8A 1Z0IA 1VG8A 3BJIC 4FMDB 2D4HA 3PUYA 2SHKA 4TTQA 5C4MA 1XEXB 3BE4A 1KNXA 2XOKD 5KHOC 4WA7A 3W6PA 4U7DA 1Z8FA 3LNCA 3WYFA 3E70C 3X2SA 2J0UB 2YWEA 4D80A 4BZXA 2ZVQX 4EPVA 3DMDA 4BASA 3CZQA 4MYTA 1FP7A 2FF7A 1D2MA 1LS1A 3EARA 1D8TA 2JATA 3TKLA 1DO2A 4V0LA 1EWQA 2N1BA 2KWIA 2ZAMA 2X19A 4PZLA 5FTNA 2AK2A 1GM5A 1OYWA 5AJZA 1Z6XA 4OHZA 1HTWA 1GTVA 1XD9A 1I2MA 4ZCLA 3K0AA 4K81B 4PC3A 3UG7A 4BLTA 1G18A 3NBYC 2DR3A 2XX3A 2Z83A 2IUSA 2QZ4A 2FEMA 3LDAA 2J7PA 1HT2E 4PFSA 4GSYA 4QC2A 1WDTA 4M8NE 3VHLB 3VR3A 1A7JA 3MWKA 5L3VA 1LF0A 1SXJE 3ND9A 3R20A 1QRAA 4HZUA 5JEEA 2V55B 3NHAA 2WOJA 3DL0A 1NN5A 3B1WA 4BFXA 1E9DA 3K0CC 4CEHA 4DUGA 4TYPA 1F3OA 1Z47A 1GRNA 1KAOA 1T3LA 2JJ2D 4JLBA 3QEOA 1QHNA 2EWVA 1ZAKA 2BEKA 4LSGA 2QPAA 4UKDA 1W2GA 1K8RA 2WM9B 4URZR 4F93B 4JJZA 1FL9A 2CL0X 3K70D 1CTQA 3UG6A 4TQ9A 4BLRA 1GNQA 1CXZA 1DOAA 3C16C 3GLHA 2ZQ5A 1E2JA 1P5ZB 1Z6TA 3CM0A 5GVSA 4CZ2A 1Z22A 2WSMA 1J2JA 1N6OA 1GKUB 3BB3A 3BXZA 5JSZB 4XJXA 3PENA 2HCBA 1E1RD 4HAYA 4LPSA 4YMTA 2Q6TA 2BMJA 5DE3A 1YQTA 2J1LA 1ZD8A 3U7EB 3THYA 1TADA 4PC2A 1XCGB 3KUDA 1R0YA 3JVVA 5LB2A 4LBVA 1EK0A 5CLLA 1XXHB 4IEEA 1E2HA 3NTUA 1NF3A 1R0ZA 2YWFA 4Z8XA 4TT3D 4LRTA 2X2EA 4PPQA 5DISB 5HE8A 4CEHB 2CCGA 3I72A 4ZCMA 2ZXUA 1GKYA 3C4JA 3PR1A 2WAYA 4B34A 4OBEA 4PTLA 4LGMA 1WF3A 2RGBA 3BH0A 3I62A 2DY1A 1T91A 1E9RA 4Q03A 3PEWA 3RS5A 1KK2A 5JECA 1R5OA 1OSNA 3DM9B 4A2QA 4P32A 3LQRA 3LD9A 4YMVA 2C5LA 3L0IB 1E0KA 1FP6A 4Q7JB 1QBKC 3ZVRA 2AWNA 4FINA 3ZS8A 3VR1A 4HB4A 5M04A 2ERXA 2G9NA 2BKUA 2ZS9A 3VHXA 4XH9B 1NKTA 5EZ6B 4KFUA 1KMQA 2RHMA 4BPBA 2ERYA 3U5ZB 1NMZA 4PAQA 5AJVB 5FBWB 3ADDA 5B2ZA 3QJYA 3FHCB 2ZETA 1R6BX 4C0JA 2P2LA 3DOFA 3CNLA 4XOIA 3VQTA 5TXGA 3EPHA 4JVSB 5CIQA 5GJBA 2P67A 2NTYC 1EFRD 4TMVA 2X2FA 3CR7A 4LHVA 1SQ5A 3UMFA 3KKOA 2ZEJA 4FCVA 3IPXA 4AY2A 4IRUB 4GL2A 1KSFX 1ESMA 1HY3A 3CKLA 4DVGA 3KL4A 2JLZA 4OHXA 1XB2A 2W6JA 2V4ZA 1TF2A 2IWRA 2ZRLA 4HI0E 3KKMA 4IOMA 4MDFA 1MT0A 4ZV4A 2PX0A 1XEWY 1P3JA 2WWGA 3M1IA 1HYQA 2IUTA 3Q8XB 1AKYA 2IWHA 4BQSA 5KDLA 2CK3D 4GP6A 1HQYE 1DAIA 1R2QA 4URVR 3GJ8A 3TE6A 4B32A 5DYGA 1BKDR 1P73A 4ZIRB 3QUSA 5G3ZA 2GCPA 4Q4AB 1H65A 2F6RA 4RKFA 4V0NA 3CWQA 1OFHA 1OFIA 1KMHB 2QQEA 3GEHA 4E5UA 4K8OA 4DB2A 4C2TA 2BC9A 4JLOA 3GLIB 1M34E 3BH7A 5EE5B 1ZINA 2YOHA 3K0SA 5CLQA 5F2EA 3K0CA 3I3SR 2CJWA 1YRBA 2XB4A 4Q9JA 4B33A 4QBHA 3QEJA 1I2DA 2FFBA 2FGJA 5KNDA 3SOPA 2DWQA 2OT3B 5FUXA 5HCNA 5EJEA 4GMDA 2X1VA 3A1VA 2YWHA 1O87A 5JSZA 3T12A 1KK3A 3K53A 2PZFA 5ELXA 1VTKA 2QAGB 3H1TA 2IYYA 1TMKA 3KTAB 4KAXA 1JPNA 3PUVA 4LI0A 3TGPA 1T5IA 1PJRA 4M9SA 1E6CA 1Q1BA 2AWOA 4EKDA 1XNJA 1RJ9A 1BS1A 4Q9IA 2UVQA 1OXXK 1Z6GA 1QHGA 2IS2A 4B3GA 3QG1A 2BJWA 4DSNA 3AJIB 4MRPA 2QGNA 3DO6A 3LX5A 1YR9A 4UJ5A 4DCTA 4KHZA 5DI3A 3KKNA 3HU2A 4URYR 4DSUA 1ZW6A 1XWIA 1FMLA 3RNLA 4A0GA 4DT1B 1NVXQ 1N6PA 1G5RA 1CR1A 1ZIOA 1XPOA 1ZVQA 3EC1A 4GOXA 4Q1AA 3U6BA 1Q57A 4U5XA 3BBPA 4ACAA 3RC3A 2OESA 4ASUD 4US2R 3OAAA 1V43A 2ZSEA 1KZ7B 1E9SA 2FA9A 1TEVA 1N6KA 2O0JA 3VX4A 3A36A 1ZM7A 3NXSA 3FVQA 4O2RA 1A4RA 3A1UA 5BYJA 4MUBA 5JWHA 3L8ZA 1EFUA 3OEHA 3RRYA 4AKEA 3FMFA 4B3FX 1KJZA 1RVDA 3W8NA 5CB8A 3BWDD 2LKDA 4A8JB 2AX4A 2XZPA 1U8AA 1OHHD 2RGNC 5DSZA 4ABYA 3PJRA 1G3QA 1RE0A 3P4YA 4QOSA 1GAJA 3K0FA 3NEYA 3NEJA 1J70A 4IDHA 1G21E 4LV5B 3QPWA 1KSGA 3ND8A 5FPSA 4DRZA 1NJGA 4MGZR 4F38A 3TR5A 4OI1A 1A2BA 5KPDA 3QVVA 2JEOA 1ZD1A 1Z3IX 3VFDA 1XDBA 2RGCA 1S9HA 3KX2A 4TL9A 3SDZA 4QRHA 2EFEB 1A5TA 1QZXA 2JLQA 2QQ0A 2YHSA 3PEUA 1D2EA 1GWNA 3B13B 2P5TB 2ORVA 2QE7A 1Z63A 5F98A 1C1YA 3F0TA 4MYUA 1Z6AA 2QPTA 1KI6B 4GOKA 1G6OA 4M22A 2OBLA 1CLUA 1SVLA 2G88A 4F92B 2GXSA 2O8CA 3W5JA 5DLQC 2FU5C 2D7CA 4LX0A 2GKSA 2WWIA 3LV8A 2RCNA 2UZIR 5FTMA 3D3QA 1CU1A 2GF0A 3UATA 5KSOA 1KI4A 2JIZA 3QPVA 4PHGA 5A5GA 4LRWA 2CDNA 3IO3A 1RRFA 1EFCA 3R7WB 2OV2A 1GDDA 1EG7A 2BJVA 4LY6A 2IC5A 5KNBA 2A30A 4DIDA 2W83A 4KFTA 4YDHB 3HYTA 2ZSAA 1OF1A 1XZPA 1K6MA 2REOA 4IHQA 3F5FA 1ZRHA 2P6UA 1YZGA 5IRCD 2NZJA 2JASA 2NZ8A 3UMSA 1GITA 2IYVA 1KKMA 1W0JA 3TBKA 4D0LB 4DEYA 3TNFA 3LBNA 2JGNA 4I81A 2YVUA 1WBBA 4TL8A 1U90A 1CJKC 1E2PA 2CNWA 1W0JD 3RANA 2CHVA 2GEDA 4HSEA 1E4YA 4NCNA 4AI6A 4AKIA 4QM6A 2VF8A 3ZS9A 4ZI3A 2AXNA 4FWIB 1H8EA 1Z28A 3QBVA 4PXAA 2OAP1 1BMFD 5EZ5A 1E3MA 1FNNA 2JJ1D 1VCMA 3NKVA 4LYHA 4QJ5A 4V02A 4CIDA 2ZE6A 4ZDWA 2PT7A 1KI1A 4HEJA 5AR1A 5FOTA 4KYIB 1QHIA 4Z51A 3ZD7A 4LV6A 1N6NA 1GL7A 1Z5ZA 3QQ5A 1NN3A 3LBHA 3ZZTA 1VIAA 2OLKA 1T3SA 2EYQA 4TQUS 3SR0A 4A8JC 5HKKD 1I4DD 4JKYA 4R9UC 2V9PA 5G53C 2F55A 2F43B 4X8LA 1IAQA 4YMSA 1FTSA 3KXLA 1C4OA 4AWXA 1T8UA 1YZNA 1M7HA 2VP6A 2ZR0A 1GG2A 2GBLC 4MGYR 2IYWA 4B3CA 3KB1A 1BYIA 1T5LA 4GOJA 2VP9A 1W5SA 1KMHA 4IVPA 1AS2A 1JJ7A 1VECA 1VHTA 2BDTA 2JJ1A 5K8UA 1GNRA 5ANRB 1R0XA 1DAFA 1JR6A 2RGEA 1VCNA 5FI0B 1H8ED 4UNQA 1ZP6A 2D2FA 4POAA 3BC1A 2W00A 4FN5A 5C18A 5CYOA 5KSZA 4JSYA 3BFVA 4GPTA 1US8B 4PSVA 1LF5A 2CCKA 3G82C 4KCGA 4C0AC 4DB4A 1E2GA 521PA 1W4AA 2RGNA 4Q21A 4NPHA 2Q3FA 2VLIA 3HU1A 4HUQB 4Q48A 1N0WA 2F9LA 2WWYA 4IJMA 4U02A 4E07A 4NTZA 1JXOA 2QMOA 4URWR 2N42A 1OJLA 4CF7A 2PBRA 3OEHD 3IKJA 4HUTA 1RJ9B 1MABA 5JRZA 1A2KC 3K1JA 2OHFA 4J0QA 2FH5B 2D2EA 3IGFA 3OHMA 1QHHA 2H7VA 3H84A 5KUTA 3HPRA 3SJCA 1IM2A 5GVRA 1E9AA 3AKEA 3PXGA 4FIDA 1DTSA 2VQSA 3N70A 5JS7A 2F3TA 2IHYA 3OAAD 4Q9LA 4G5SA 1NN1A 5HZHA 4LJAA 4NE2A 2ZREA 4XTCS 3M0EA 3RABA 1E96A 4NYIQ 3QXJA 1NI3A 4UNSA 2QA5A 4RZ3A 1DE0A 1TEXA 5HR5A 2GCOB 4EFMA 4C4PA 3VR5A 5J4HA 4BFTA 1S4QA 5TVKA 5JHGB 3FMPB 1XEXA 3B78A 5BQ5A 5TDHA 3H2YA 1G4AE 4FD2A 4LJ6A 1FOEB 5JEDA 3I92A 1LFDB 2C9YA 3AH8A 3MG9A 4D6PA 3U44B 1RRCA 4Q00A 3T06B 4S2EA 1ZU5A 2MMGA 1U2RA 1W4BA 2IF2A 1PLKA 5FL7A 2OE2A 4C2UA 1DAHA 5TB5A 4KXFB 5G3YA 4Q02A 3GMTA 2O5VA 2Z43A 2ZU0C 3OZXA 3UIEA 1G7CA 2XJ9A 2PH1A 4RFSA 2RGAA 1OE0A 3SNHA 2H57A 2O8DA 2O8CB 4DLWA 2OZEA 1GILA 1AJEA 4D26A 1KOFA 1AM4D 5IDVA 5JWOA 3LXXA 4PO8A 3CUEF 3ZIAD 3OEED 3IQXA 2W6ID 1KSHA 4BLQA 3H0KA 3N2IA 4QGHA 3ZQJA 1KJWA 4JYBA 1KJYA 4HLDA 2BCJQ 4IOLA 4GNKA 1CF4A 2BMEA 3OFND 2BVNA 2GJKA 2QP3A 2GEVA 2O8FA 2V8OA 1SVWA 2REXB 2GVZC 5TMPA 4CGZA 1UKYA 4BRUA 4IDPA 4Q18A 2D74A 4KLNA 3KJEA 2V3CC 1X86B 2VYFA 3QXHA 2WWXA 5B64A 4B2IA 4ASUA 1UDWA 3NBFA 1E98A 4FW9A 4TSFA 3EC2A 4K46A 4OQMA 3A1WA 4US0R 3I5YA 4DKXA 3BB1A 4PANA 1XMVA 5HTKA 3CH4B 4W5WA 4AK9A 3B82A 3FHTA 1RRPA 4MITA 2R44A 3I73A 2H17A 3KKQA 3IQWA 2GTPA 1XPRA 1F6BA 1P9RA 4EPYA 1CRQA 1JNYA 1UBFA 2EYUA 2MSDB 4GRAA 4JLPA 4LBWA 3T15A 1P6XA 2BWJA 3TMKA 4U00A 5FBRB 1DELA 1EFRA 3DKPA 3P27A 3FE2A 4QXAA 2O8DB 5DHFA 4JLJA 2J46A 1E2QA 1G8GA 1ANKA 2ZROA 4HZIA 1G7SA 4IVQA 2GHIA 2XGJA 2VP2A 3EWAA 221PA 3T1TA 2MSEB 1VPLA 1IY0A 2QEQA 4L4UA 5G40A 4IFEA 1FFHA 3IHWA 2RKOA 3SJBA 1KSJA 5KNCA 3GLGA 3C41J 5AJWA 3I8SA 4I1UA 1KY3A 4CEIA 2EFGA 2OUKA 1M74A 2RGGA 2FPKA 5EXTA 4JL5A 4OI4A 4R7ZA 1CBUA 1GRQA 1XTKA 3MLEA 4KV9A 1VKJA 2IXEA 1KYIA 4RVCA 2C78A 4C7OA 1P2TA 2DB3A 1XFAA 1Z83A 2O52A 3PUZA 4Q1DA 5EP4A 4GT1A 2G83A 1PV4A 1B23P 1X3SA 5JBQA 2O8EA 2YWGA 1OXUA 1X37A 1OYYA 3FTQA 1VYTA 4KO8A 2AKAB 3EWSA 1SKYB 1Q3HA 4A2PA 1Y3AA 1E32A 1N5KA 1G7RA 1JQLB 3LLMA 4H1VA 4RKEA 1IN8A 4GMXA 5KTYA 8OHMA 3GLIE 2CK3A 1E79D 4G3XA 3EASA 1JR3A 4RD1A 4ACBA 4FMCF 4P33A 4TQAA 1VYVA 2IEZA 3HYRA 2KE5A 1IONA 3FKQA 2PZEA 3SC3A 5EXXA 2QORA 2XXAB 1J8YF 3U4QA 3WP0A 4A0FA 3VAAA 4DCVA 1JR3E 4WOPA 2HT1A 1Q0UA 2FN4A 3O8DA 3A1TA 1NP6A 3RS2A 3IEUA 1L4YA 1NKSA 1UKVY 2ZR9A 3LW7A 2ASEA 2CLSA 4Z1MA 3W3AA 4RY2A 3AGPA 4UNRA 1FTNA 4O3MA 4Q1BA 4RD6A 3EPJA 3DM5A 3EPLA 5L3QA 2BBTA 3MFYA 4B3DA 5KU1A 4RZ2A 1E99A 1N2CE 1OXVA 5C4GB 2YC2C 5TV2A 1IN6A 3T35A 4EJSA 2J5XA 5EXSA 4N0DA 3C15C 4D4LA 3CF6R 3AB3A 4IDOA 3VMFA 4EPRA 4HAVA 1DBSA 1ZBDA 2JJ2A 2QAJA 2VBCA 2ZJYA 1G3RA 3TH5A 2QG6A 3CRVA 3GLFE 3KQUA 1J7KA 1MO3A 2PX3A 5K8TA 1X1SA 2IYUA 3AF2A 3L8YA 2QT1A 3OE7A 3NG1A 3SBDA 5KOYA 2NMVA 1XTJA 2HJGA 4RZXA 2PLFA 4BFUA 4MKGA 4C0QC 1JQJC 2D06A 2V54A 4MGKR 2Z6VA 4AURA 3VKGA 4LYAA 1UBCA 3BFKA 3RAPR 5EE0A 1LW7A 2GK7A 4TYNA 1EXMA 3K09C 2WWWA 4JLAA 1TUEA 1FQKA 2QRNA 4LYJA 5EP3A 3FGNA 4WZAE 3RS3A 4DLTA 4FXPA 4JT4A 3B1YA 3SYKA 1WQ1R 4KSBA 4TLDA 3GFOA 1NLYA 3QBTA 4A15A 2QTFA 2ZE8A 1Q1ZA 2HCJB 5E7JA 2ZS7A 3R9IA 2GAAA 5EUMA 3B2EA 3QKUA 4DIEA 4AG6A 4BECA 4EAQA 1SHKA 4KBGA 4XWKA 4IOJA 4RFVA 5IF9A 4D0NA 5LBIA 1SKQA 1DVRA 1JECA 3C5HA 4MKFA 4E03A 5LDDC 2XOKA 3FPAA 4I4LA 3AF1A 3GLGB 2P6NA 2IS1A 4M1WA 2P6RA 1AK2A 3T1OA 3DMNA 1FUKA 1YZQA 3AP2A 4BWYA 5AJYA 2A3RA 3CNOA 1MO6A 3I4LA 4H1UA 3GP8A 4JL6A 2PCJA 2Q3MA 3RSLA 4KODA 3PEVA 2ZJ5A 1W36C 1KKLA 2ZYWX 1HE8B 2REBA 3QVUA 1MR3F 1RIFA 3X1YA 2ZRIA 2A7QA 1OH5A 3B8HA 1E1QA 4QNMA 4ESHA 2KJQA 4A2WA 4KYUA 2JLXA 3REGA 5K8IA 4HB0A 4B75A 1Q1EA 4I99A 2J41A 1IY2A 2R2AA 1S1CA 2CVHA 3DEFA 4BEBA 1E2IA 1VHLA 4ZDJA 1NVUQ 4A8JA 5FOWA 2Z4RA 3GLHB 1W46A 3MWLA 3D6TB 2R9VA 3PIRA 2KBEA 3LRPA 2W0SA 3I1FA 1AZSC 621PA 1G17A 4PR0A 3QKRB 4HLUC 2B7CA 4NH0A 1DAGA 2CLDX 2CEAA 5L3QB 2QMUA 4LCBA 2GZHA 4F91B 1S0UA 3PFIA 4KLZA 1I4TD 3AKCA 2AL7A 5H1YA 3PQCA 1S3GA 2E1RA 3CO5A 1XJCA 2ZIAA 2BKEA 1ZM2A 2GJ9A 3PITA 1B0UA 2R6DA 4M9XA 3U3RA 1D5CA 3BB4A 3VU9B 3CONA 4RCYA 5F3WB 1PLJA 2L0XA 4OQFA 3QE0A 1L2TA 121PA 1G19A 2ODWA 3QENA 4WZ6A 2CL6X 2C98A 2HXSA 1U0JA 2R8RA 4DDVA 2NIPA 3VR4A 3I32A 1GOTA 3BS4A 4C3ZA 3LBIA 1ZMXA 3D7MA 4Q1CA 1OV4A 5FBQB 3JVUA 2WKPA 1T9HA 4M1KA 3EZ9A 4KVGA 4LWZA 2X8AA 1J8MF 3D8BA 4MDEA 1TU3A 3L43A 3ETLA 4ZDKA 1RYHA 1CEEA 3U44A 1YZTA 1JAIA 4LC1A 3HJNA 2LWIA 4KFRA 4P3YA 2OO7A 3QSYA 3X1ZA 3TR0A 3OIVA 5JZVA 3ZDQA 2V7QD 2G0TA 1UM8A 5FTLA 1LNZA 2QUZA 1U9IA 1T6NA 1TF5A 2ZYUX 4PZYA 5EE9A 1IXZA 4PO9A 2WHXA 1NSTA 4LHZA 1WE2A 2NO6A 2YV5A 1TX4B 3O47A 1KHTA 2IS4A 5K8LA 2W2XA 1EX7A 3ZLJA 4W7SA 4QGGA 4UXJA 1II0A 4C0HA 1E1QD 4L15A 2P5SA 3FWYA 1G3UA 1NLZA 1QHHB 2FZLA 2PEYA 2Q3HA 2XITA 4PC6A 1U8ZA 3TSOA 3UWOA 4UXIA 2FMXA 4LJ5A 1JPJA 2ZRHA 3AVPA 4NP6A 3SJZA 2H92A 1EWRA 2Y8EA 2GK6A 4UNNA 3ZZUA 1I4LD 1L7VC 1S9DA 3GEIA 4V0ME 3T1QA 2NO9A 2ZI7A 5BYKA 4M2LA 1A1VA 3KJHA 3IIMA 5EE1A 2DHRA 1NMYA 2PLRA 4KVAA 1YR8A 2J0QA 2XEXA 1P72A 2VHTA 4F4CA 4B48A 1YVDA 5CJ2A 3SU8A 1U0LA 2GRJA 1SZPA 3DVLA 1W49A 5FPTA 1OKKD 5J4LA 5DN6D 4RJLA 2YOGA 1N6HA 4TMTA 1YE8A 3AVTA 1E69A 4TMWA 1SVMA 1TPZA 4FMCB 5CJPA 2E87A 4EJSC 1Z06A 5B30A 5DI9A 4B2PA 1OT3A 1P7CA 3HPQA 5CDFA 3C7KA 1W0KA 3BRWD 1VCOA 4B6EA 3EIEA 1DG1G 3THWB 1E9CA 3FYHA 2Z4SA 2WPDA 2RB4A 2IHBA 2Q0HA 4HUQA 4DCUA 3AVWA 2ZUCA 2F1HA 1XMJA 3EIHA 1XZQA 1ZM4A 3PUXA 4PO1A 3RDPA 5IK2A 4MQBA 4MA4A 1OB2A 2YOFA 1WMSA 1KO4A 1VIYA 4NCIA 2ZRBA 1UF9A 1IBRA 2CHGA 1Z0DA 2WWFA 4AKHA 4PC7A 2XTNA 3RYTC 5B57C 4PQRA 2OLJA 4B74A 1JB1A 2BEJA 3B7GA 1AQUA 1KI9A 2BHRA 2C04A 3KUCA 3Q5EA 4DLSA 3CPJB 2J59A 2O0KA 4KSCA 2ZI5A 3O8CA 4E09A 1LV7A 4WW0A 4DJTA 4CT4B 3B9PA 2W2TA 4W9MC 4M1MA 4Z1MD 2VTKA 1G41A 3TQFA 1R4AA 1HT1E 3AQ4A 3WHKA 1XD2B 4DLVA 2QT0A 4AD8A 2RAPA 2NPFA 4EQ6A 4PHTA 1OIVA 3ZD6A 2IL1A 1P2VA 2ORIA 2ZRMA 3VKWA 4JBWA 1JR3D 3CBQA 1ETUA 4PX9A 2EFCB 4IVRA 3CNNA 1AKEA 1IOZA 1M1YE 2DWZB 1JBKA 2VH5R 3AVQA 4LC0A 5JCZA 3TVTA 4M9ZA 4JBYA 2DZNB 4R71A 1E2DA 1CULC 2VHJA 3CX8A 4TLAA 1TQDA 1XF9A 1X6VA 3RVBA 2ODBA 4IOKA 3LX8A 3K0EA 1R8SA 4DWJA 2GEUA 3GLIA 1BOFA 3AKDA 3W34A 5GADl 1Q1QA 1EFTA 2EFDB 4GFDA 1HV8A 3KJGA 3B1VA 4LBZA 2DFTA 4URUR 2CE2X 1G8HA 2PZGA 1P9WA 1NG9A 3P26A 2A78A 1P62B 2Z5FA 2GAOA 1P2UA 2BBOA 1TQ2A 1UEJA 3GJ0A 1SVKA 2PJZA 5G41A 4LPKA 3ADBA 2IXGA 1QG4A 1YU9A 2ZI6A 3VKHA 3TUIC 2A5DA 2QAGA 1SKYE 3NDBB 3DZDA 1AIPA 1NG1A 3U6KA 2DPXA 1M6NA 3LY5A 5KDDA 2H1LA 5JFGA 1VG9B 1R7RA 4NONA 2A5YB 1AQYA 2OEPA 1S3SA 4N3NA 3BK7A 2ZRNA 3WRYC 2DWOA 2J0VA 3NIBA 5KSPA 5BN4A 4M1TA 3A4MA 2F1RA 4Q4LA 4OHVA 1UEIA 1XMSA 3TAUA 4P4TA 5DGXA 3WBKA 1NMXA 4CYMA 1M7BA 3LLUA 4M1OA 2KRKA 3FFAA 4RZUA 1L4UA 4YLGA 2ZTSA 1D9ZA 3AUXA 3B1XA 1AN0A 1Z2CA 1GRRA 3QKTA 5IK2D 2P0EA 2ORWA 4C0BA 2IBMA 1H8HD 5H68A 2TMKA 1O3YA 5C46F 4X8MA 1UAAA 3KQHA 3QXCA 6Q21A 4JLNA 1LTQA 3OFNA 5CM8B 2OSBA 2OCAA 3GJ5A 1W1WA 4JVNA 4Q4HA 4A3VB 2AXPA 2ODEA 2QY9A 4XSGA 3SFVA 3GQBA 2XNDA 2IT1A 4O25A 3WYAA 1SVIA 1P60A 1KK0A 4YXWD 3BIFA 3ZIAA 1RW4A 1G1MA 1NVVR 1US8A 3T1VA 4CDGA 2G0NA 2V1XA 2MMCA 3EXAA 4NU0A 2AKYA 4XSHA 3TJZA 4EPXA 5JI3E 2HEIA 1ZM3A 4NYMR 1N6IA 4IXMA 3R7WA 1N6LA 3SJAA 2HLDD 3HDTA 4L16A 4IKEA 4UXHA 2DFLA 3WNBA 4RD2A 1OB5A 3SN6A 1E2NA 4ZKEA 1E4VA 2GXAA 3K70C 2BM1A 1SHZA 2EU8A 5AWFC 4OQLA 2V6ZM 2VRWA 3Q85A 3B5JA 1AS0A 1N0UA 2WJHA 2C03A 5FL7D 3NC0C 4PQFA 4NCKA 1Z0JA 1YJ5A 4G5OA 4Z54A 4NCJA 1NBMD 3U2QA 1S8FA 4ITRC 3PG5A 4BRWA 2A9KA 2IF0A 1N5LA 2IYLD 2WKQA 3GJ7A 4P0TA 4DC9A 4D4MA 4LJ8A 3EA0A 3MMPA 1ZCAA 4LDJA 1SXJB 1F2UA 4CEIB 2ZI9A 3PCRB 4DLRA 2V1UA 3GLFB 1CS4C 3AF4A 5B58C 4QJ3A 4AYTA 3P4XA 1S1MA 4Y0AA 4B44A 2Z0MA 2FJUA 1KGDA 1MKYA 4QBGB 1NY6A 3QY0A 3N5CA 1PZNA 4US1R 2QSZA 4DCSA 5EP2A 2PMDA 3AVYA 1LY1A 2J3EA 3ZVMA 1F5NA 1WP9A 3CPEA 2GVDC 3RLFA 4PSKA 3K9GA 2V7QA 5L3SA 1HE1C 3R9XA 1NL3A 2G1JA 3EG5A 1CKEA 4HB2A 1YRAA 3OIYA 1TAGA 3MJHA 3MWYW 2FX3A 3NWJA 4JLKA 2KI5A 3BAFA 4HZUB 1T0JB 1KO8A 1JI0A 3CPHA 1XTIA 5EP1A 1CJVC 2ZE5A 1WB9A 4M21A 3MGCA 1W5TA 2HUPA 2IW3A 1KY2A 2EW1A 4P4UA 3P20A 3UANA 4DLXA 3OIWA 3RRNA 1IXRC 3GFTA 2WJIA 4TL7A 2GETA 2RH5A 4YMUA 4TYQA 4B3XA 4FCTA 1R0WA 3GJ6A 3P32A 1HQCA 4BLPA 5J47A 3UWKA 3WMFA 1KO5A 5H70A 2IUUA 1N5IA 1PUIA 3U3MA 5FL3A 1DO0A 1F2TA 1UJ2A 3EZ2A 3HR7A 1U99A 4FCWA 3QG5A 3TUJC 4NMMA 3IPYA 4BE7B 1GZSA 4AYWA 2OFXA 4BFWA 1FX0A 2YKGA 4LHYA 3AM1A 1X1RA 3K9LA 1U9IC 4ZKDA 4Q19A 4G01B 1G64A 3RS7A 2A5GA 3DKVA 4WBSA 3D31A 4ZCIA 2FOLA 3UXMA 3DOEA 3L2OB 3KTAA 4G5QA 4R98A 1RPZA 5GJVC 2GZDA 1E2EA 1FPMA 1JXMA 4WIAA 2G3YA 1XXHA 4GZLA 2WIBA 4XVRA 4A0RA 1U98A 4WXRA 3LVRE 3CRMA 1DAKA 1QZMA 1OW3B 3MAAC 4DSOA 2G77B 3JZAA 5E3HA 1G8FA 2CNWD 1WCV1 1WXQA 2E9SA 3CR8A 3BOSA 1DAMA 2P65A 3N2EA 3THOA 4XVUA 4TYWA 4OK5A 2FPLA 2ZE7A 1JEEA
chains in the Genus database with same CATH superfamily
4Q66C 2LNHC 2GKOA 3W06A 2XCUA 3P5SA 5DYIA 4HNSA 4MHSA 1K06A 4YMWA 1L1FA 3NTQA 3FYTA 2X6TA 4ZN6A 5IP5A 2IXFA 3AXSA 1BDHA 2GJ8A 3BCHA 4O5AA 4QYXA 4BO7A 3VPGA 1JHVA 1HLDA 1WNFA 4PVDA 1C7FA 1V16A 4KQJA 2VYVD 2VHUA 5DVZA 3TL3A 3KJXA 3CIFA 5JRDS 4JGBA 3D0KA 3QPDA 2ZQZA 2QAGC 4XPIA 1L4MA 5A05A 3SS9X 4C0SA 2Q28A 2V7TA 3V33A 1W2WB 4O4LA 2C9OA 2R46A 3TD9A 3V4FA 3CF4A 5IG2A 1LK0A 4PE5B 1ZW1A 2QJWA 3RF6A 3UK7A 2D8MA 4YCDA 1M2GA 4TTAA 4UAJA 5EKTA 1XFDA 3R0ZA 1U2DC 3H2SA 4H7DA 3AEXA 4JZKA 3FPHA 1WSAA 2GESA 1F4LA 3HDJA 1KFVA 3A4LA 2AGVA 4F84A 3E84A 3VV3A 3FCXA 3PKJA 1SOUA 3C8UA 1BSVA 2V7BA 3KS9A 4IH1A 4R68A 3UTCA 1T8SA 3WADA 1GTZA 1HC7A 1P45A 2FR8A 4C6HA 4JH0A 3Q8LA 2YMPA 3E3AA 3FAZA 1JA1A 3B5EA 3VPFA 2ZSUA 1C7YA 3AU9A 3ZUGA 4MUKA 2A9RA 3ZJ4A 2ESRA 1PD1A 2ZRJA 3K2BA 3C6BA 3JWPA 1I1OA 1IHXA 1UMCB 4NZYA 3CE6A 3SZRA 4C7BA 3KVRA 3SAUA 4J4BA 3LO5A 4PC1A 5ENDA 1IY1A 1OLOA 4GPAA 5TIIA 1ZL2A 4UMVA 4OL0A 4CTOA 4ER6A 1ODIA 1T36B 4RF0A 2UUPA 4NAVA 2WSSA 2NO7A 4ISBA 5DULA 1LI7A 1BWPA 1FCJA 1CR2A 3UXHA 2WF8A 3IDSA 1U02A 4EMUA 1L7OA 1N2SA 5HP4A 4XM1A 3LLVA 3M6LA 3GQ5A 2O20A 2ZT7A 1DG9A 4IFBA 4Q7KA 3AR2A 4CMIA 4LMPA 2AD1A 3ROTA 2V6GA 2HGSA 5FV4A 3ASYA 2BHLA 5DYNA 1OHHA 2REQA 3JZMA 5KOHA 2QTAA 2OPFA 1K8QA 5KMGB 1SK9A 2VHZA 3HR4A 3MT0A 2Q2QA 3KSDO 3SARA 3GPPA 3SYRA 1KPGA 2QU7A 4BAZA 4AUMA 2ZR8A 4BGDA 4QKQA 4HRVA 2I4OA 4MVJG 4QNRA 4YY3M 1HH4A 3KIPA 3K1TA 5SZHB 5H3LA 4UUBA 1UC4B 2UZ1A 3DLCA 2O5RA 2C83A 1G6KA 4AQDA 3SAVA 4JR2A 2B21A 3AY6A 3DEIA 4R7GA 4P5DA 2I8LA 5F9FA 3ZWMA 3VTFA 5CBPA 1JYEA 4YI5A 5FI1B 2DWLA 1U28C 4RQUA 2FNAA 2GF9A 4EHNA 4BQOA 1G0OA 5JVDF 3FMIA 4GKAA 4R2WA 1ABBA 1E63A 4D3FA 2PD3A 3QLTA 4CKCB 1KDTA 3UYKA 1GNPA 5GJCA 1Q44A 1Q91A 4RQBA 5BSHA 1KK1A 1DRVA 4KYTA 3JD4A 4JSTA 4XGQA 1CB7A 2LIPA 1HYGA 2AOTB 2RHOA 2Z8YM 4DLKA 5KYYA 1F4VA 2J4FA 2HDNB 2NYAA 5LQNA 2WU1A 3EXEB 1YZKA 3VR0A 2H29A 3W0LB 5KQDA 3LHIA 4YJFA 4BFVA 2GN2A 2P7HA 1Z0KA 1E79A 1C30B 3HZRA 1IY8A 3I4FA 4KQCA 1ZK4A 2NAFA 4JI7M 1PIWA 1VMIA 1ACJA 3GBSA 4P3KA 4RVHA 2AKEA 1C41A 4ALMA 3KYDB 2PO7A 2BV3A 3GLFA 3B20A 4LXHA 3IXQA 4C30A 3ZDYB 3V1LA 4FGUA 2AMJA 3OF2A 3FOEC 1XDZA 3H5LA 4Z3DA 3VYTB 2Q21A 3SC2A 4DR4M 3ITNA 4BO3A 4YRZA 3SE0A 2YS6A 4J07A 3UMCA 4TLBA 3CZPA 1ZUWA 1RKUA 1WA5A 5ECGC 1V39A 1MLDA 1I6KA 4TRNA 1PG0A 3ILXA 1Z0ZA 2B4KA 2W4QA 1TU0A 3AERA 4LZWA 1FUUA 3MD0A 3ZKWA 4LDZA 1W29A 3LTEA 9ATCA 4YUYA 2H59A 2KM1A 1A9XA 2P9TA 3NS7A 3GJXC 1ZNXA 2C9ZA 5JCJD 1P7VA 4LFAM 2XUZA 1A4IA 1EFLA 4S04A 1M2KA 1SO8A 1BW9A 5F78A 5K9ZA 1W76A 4H0FA 2VEDA 4P82A 4JKIA 3LUPA 4JC0A 4QQKA 4DDUA 4LWOA 3WRVA 1M2OA 3ZCRA 1UWCA 3O8QA 2AOVA 1J39A 2PU5A 5M3BA 1VDDA 3Q3HA 3HXPA 4EG0A 2NU8B 1EFHA 1OPRA 1SOMA 2NUTB 2PANA 5FI3A 4IWNA 1Q95A 2G7MC 1PI3A 4PPNA 4B31A 1ZVKA 4OJKA 2L18A 4UZFA 3GGGA 4ZVLA 1VSBA 4PS1A 2X14A 3AESA 3R40A 1G3IA 1KJJA 2HJ9A 4MUAA 2HCTA 3VPBA 2D7DA 3U09A 1JH8A 2V3WA 4Q7EA 1PEKE 2XCTB 2FZEA 1CR0A 3GH1A 5C0OE 3UOGA 5ED4A 1UT5A 3UVEA 2HHAA 1HNWB 3L6DA 4OKSA 1K97A 3BBZA 3P2IA 4FDTA 4C01A 2WVHA 2CLHB 4G8CA 2H9IA 5B12A 1D8AA 3MD9A 1Q19A 1GGJA 1I3OA 4TV9A 4QL3A 3W8RA 4IY1A 4L78A 1E4EA 2GVNA 1Z16A 3EMVA 3EQ2A 4I46A 4JI3B 4DXAA 1R0SA 3WMXA 4CQMB 2C00A 4GLLA 4PINA 2G4LA 3CU5A 1XRQA 1WXWA 4DDWA 3MAJA 3D8RA 2ECKA 2MSKA 4HDKA 4UFPA 1YKGA 1PGOA 4X65M 1QMPA 4LK2A 4H1HA 4ZVOA 1QGUA 2O9JA 1YR6A 3A3YA 2I6UA 1C3XA 2LRHA 2QN3A 1Y1TA 3K2IA 5FI5A 2UVPA 1WMDA 3CZ4A 1N7JA 2VHVA 3NALA 4YT2A 4HK4A 4Q37A 1IATA 1Q21A 1RFLA 1V9CA 5AK3A 3OU2A 3AUTA 3BVPA 3CR3C 1JG1A 2W6IA 3O03A 4HH3C 4EYSA 3E3OA 1QIDA 1WUKS 2UYGA 3RC8A 2E4VA 1I5RA 4MLZA 1VOTA 2EHJA 4DV5B 2ZRAA 3DDNA 1O57A 3OEWA 1ZGJA 2N35A 3OF5A 3C39A 5K03A 3FE3A 1G8YA 1DFIA 2FE4A 2PT5A 4RD0A 1N92A 4LF4M 3ES9A 4YRQA 4IKOA 4Z6KA 5JNWA 1IIRA 4RKQA 2Z56A 2PUJA 4ZT5A 1VP9A 1NQWA 1UQTA 3G85A 1NLUA 4BMNA 8LDHA 1BH2A 2Q3JA 2IEDA 3OF3A 5E6JA 4H0NA 2ZZNA 4FFVA 4Z6YA 2HNAA 1QYRA 3QYFA 3W05A 4DT1A 4Z7NB 3UK6A 3FVWA 1Z7GA 2L69A 2WICA 5AHOA 1PNTA 4DPLA 3DNPA 2LE0A 2QSJA 3CLTC 3N86A 2JBHA 2QG9A 4G1VA 4QYWA 5JADA 2DCUA 3DV0A 4BV2A 4EFLA 3R7SA 4HTFB 4XJVA 4D9BA 4LJ9A 5LMNM 5GMOA 4YT8A 2P11A 4MXDA 1NA5A 1KI8A 2D7HA 2G8NA 5LMCA 4RTMA 2BWEA 3M6IA 1VB3A 1MO4A 2ATXA 1G5FA 2DP4E 3ROPA 3LH5A 4HQFA 2YWDA 4EG1A 3TK1A 5IBCA 3TQTA 5KO2A 2FFHA 2HYIC 3IHLA 4F1WA 4FN4A 4BLSA 5L7YA 2K6BA 2ANCA 2HBZA 1RRVA 2AR7A 2FB9A 4IHJF 1Q0HA 4F5ZA 2B1JA 1PR2A 1QFJA 2BZGA 4QJ4A 1Q3TA 2H5EA 3NRBA 2YY7A 4H7PA 1TZMA 2XW6A 4RYLA 3DBHB 3OOSA 5E95A 3V8EA 2WG1A 3WBJA 1Q12A 5T8KC 1Z56C 3GPLA 2COUA 4FFLA 2GBIA 1Q20A 1S96A 2XWQA 4OHMA 4FHCA 4IWYA 4ZEXA 2Q0SA 2ZRQA 1FSPA 3O7MA 4DUGD 2JJMA 1JI3A 5F1OA 5LOVB 2O57A 3SMPA 4DJEC 2AFIE 5DEOA 4D3DA 2CJPA 2CSUA 3HVKA 5BRNA 3C7TA 2R65A 2IYOA 4PLCA 1VJGA 1L9XA 4IIBA 3STVA 1U0SY 3I6BA 3BTVA 3SE7A 4BLVA 2QW8A 4IBEA 3SYLA 2QBYB 2ZJOA 5KB3A 5HKLA 2PLWA 1CZUA 4CQMD 4UOZA 3EZFA 4QDXA 3W79A 1KJQA 1UDXA 3LSYA 3LF1A 4PD2A 1ZU4A 4DZZA 5KNLA 4F7WA 5DTIA 3F8SA 2VC2B 5UKDA 4HGRA 4ZQHA 1QYWA 4WAUA 1XP5A 3BX1A 3PICA 4L5AA 2PX2A 4H1WA 3X1KA 3A4IA 3OUUA 1KJ9A 3Q3JB 3ZV7A 4CI0B 4FLEA 4CGYA 1SUSA 1DKUA 4G1MB 4LE1A 4Y0VA 1W4RA 4Z53A 1KEKA 1XTSA 3LUCA 3HNPA 3VC3A 1ML4A 1VLQA 4QO8A 1RKBA 1MU0A 3I9MA 1WHSA 1SULA 5DYYA 3ICOA 1N6RA 4JS0A 4RDHA 5AM4A 1TCVA 3KQSA 3ELDA 1CR4A 1VLMA 4PBRA 3TFQA 5CFQA 3THXA 1UZAA 1NKVA 2CLOB 3I6MA 4L08A 5B6JA 2IHZA 2V6JA 3EOAI 3Q8KA 3SWWA 2QTVB 3ECAA 4RXUA 2OFOA 4JP1A 3BSSA 4BUZA 4OI0A 5J43A 1VE5A 3O2QB 4YJ2F 1ELOA 5E8JA 2KZUA 3CW2A 3NDJA 1G71A 1CUDA 1L8XA 1MJHA 1T2CA 3CN7A 5A9TA 1MC8A 2WJGA 3M1AA 3OKPA 1MA3A 4PZPA 2WPNA 4I1VA 2O2EA 2IUEA 3AHIA 1L2CA 3IUJA 4UBJA 4ZU3A 1Q7EA 4U2EA 1ODFA 2JC3A 2FHPA 3BWYA 1HXHA 1JKIA 1W2HA 3DWIA 3DR5A 1KJ8A 2IHVA 2V65A 3KUKA 2O8CB 4DIMA 2RH4A 4UHFA 1XYGA 4AJEA 4IQ0A 1V3VA 3K5PA 5K0JA 2OLEA 2QJOA 2VPZA 1JN0A 2ZANA 2JGRA 1U7XA 1X42A 421PA 7REQB 3BXXA 1MG0A 4NBKA 4F6RA 2DBYA 2ZBRA 1KE1A 5AM0A 3ML1A 3PI6A 1XEFA 3ZZ0A 4CFSA 2OP0A 3UHJA 3P2MA 3D0QA 5KREA 3WAKA 1PGJA 2H51A 5F7XA 4DLYA 1M6VA 1KXJA 1VM6A 3D8HA 3KB2A 2VP3A 4LDNA 4IBJA 4PX3A 3IL2A 3RWMB 1ZNWA 4ER3A 1YS1X 2H5IA 2P79A 3G9ZA 1FRQA 3I6ZA 5KU7A 2A9VA 1N32B 3VVLA 3RS0A 1EVZA 2IYFA 2EBFX 3WWEA 2F3QA 4HXFB 1N8SA 2HRBA 4MYHA 4FHFA 2JA1A 3L0SA 5H0IA 1ZG3A 3VR6A 4UNPA 2W2KA 1WKVA 3CE9A 3SFZA 1HI9A 4EKNB 2X0NA 4Y28F 5ERXA 2AF3C 2DQ4A 3IQZA 5E9WA 3GT7A 4J49A 3R5SA 5CNMA 1GSIA 2P9GA 4YHBA 3EAFA 2HNBA 5GV8A 3U62A 5INTA 5DNDA 3UAZA 5FBVB 5A2QS 1NZFA 3C5CA 2WVJA 2YVAA 4PW0A 4EW2A 4ZI7B 1SCIA 3OLVA 3R4VA 5L3RA 3ZHYA 4IWXA 4ABTA 4NFLA 4OQPA 1TO2E 4RA6B 5H02A 1KDZA 4UTNA 3I5XA 1VG1A 1PLLA 1YZVA 3CNQS 5HZKA 2QQ8A 1U63A 1NASA 4BNFA 3V8PA 2BHSA 3SHGB 2NNWB 1NZJA 2AN9A 5EY5B 3WNDA 3KKKA 4K9KA 5EHNA 4PSDA 4ZEWA 1EYZA 3KT3A 2DETA 1LDNA 3SM3A 1UIMA 2Z5LA 2EKLA 3HCFA 3U60A 4L02A 1ZHFA 4YFYA 2QP9X 3SBEA 1P2BA 3MGKA 1NTOA 1QGDA 3TLZA 2XXJA 1SCUA 1N5JA 2CVPA 3ZJTA 1CIJA 1VI2A 4C89A 1VG0B 1EWVA 1K7CA 1EDZA 3UWSA 3BXHA 1NY5A 3O1HB 1Y6ZA 3FJYA 4FNAA 4OBXA 4W1RA 3BMCA 3AUUA 2LDBA 1X7ZA 2GX6A 1NJ1A 5CDUA 1CUAA 1RI3A 1PFVA 3RQSA 4FUTA 1ATZA 4JT2A 1TVEA 5JZSA 3D8SA 4ZEVA 1I8TA 2IP2A 3GCWA 1D6JA 2ST1A 3A7DA 2XSZD 4N0EA 1V96A 1QVRA 1RJWA 1BWSA 2PUHA 2W6QA 3A9CA 4HDSB 4UULA 4BFZA 5K0FA 1Y4SA 1T4DA 2XE6A 3IP7A 3PRYA 4AZTA 2AQKA 5HWSA 3KSUA 1DARA 3MCAA 5C1DA 3RJ5A 3ZCSA 1CP3A 1H1LA 2VF7A 2HSGA 2PYIA 4KMRA 3LZ6A 5G4KA 2WWHA 3B74A 1VRCA 2X15A 3CVJA 4V03A 4CU2A 3QU9A 1KVTA 4ERNA 3LA8A 5FKJA 3KJIA 3TZCA 2ZUEA 1COWA 2HMWA 2P6PA 4QRDA 2C2YA 2FUKA 3HBMA 3JQ8B 4X20B 1Z8NA 2ECPA 1GNVA 1RYBA 3ELYA 3B7ZA 5FTWA 5IT5A 1YHNA 1V6CA 2AC4A 3IVAA 4EGCB 5DXJA 4ENPA 3M6WA 4N47A 2N0SA 2OOKA 1QHSA 4RKRA 3O7WA 3T54A 4X5OA 2QTRA 3NLLA 1NBMA 5F5LA 5FUBA 5JHHB 4X64M 1ZSVA 2IE8A 1LLQA 3GN2A 3LL7A 1K2WA 1BA2A 4LJYA 3MF4A 4DL9A 2PUAA 1QQWA 1UBGA 3CF4G 1FP2A 5AI6A 5BN5B 1DKOA 2XOEA 2JGFA 5A1TA 1T43A 1I80A 5J2TF 3REQA 1YDFA 1OXTA 2YWXA 4MGYE 3HBJA 5KYTA 1ADBA 4FBLA 3NEPX 3PD1A 4GWKA 2NGRA 2Q5QA 1GQQA 4TSKA 3K96A 4QBIA 3N7UA 4HFRA 3FKSD 3Q9LA 1Z0FA 4COKA 4DUYB 3H2IA 5AH0A 5E1BA 1DKNA 4LE0A 2UZ0A 4CTJA 3FD8A 2DJ5A 3TLBA 2OZVA 4HDRB 3HUDA 4RFSB 3UGKA 1XO1A 3OOJA 3MAGA 3PNOA 1P0PA 5CTAA 1XUOA 1G5IA 5JCOA 1SXJC 1F14A 1YFZA 3GEPA 3KEFA 3R1IA 3W90A 4D9MA 1MXFA 1NRJB 4YP0A 1QRUA 4E13A 4MJ7A 1N2XA 2FFRA 4LYDA 4JGGA 2PV0A 3U3OA 2ZYHA 1A7KA 4A26A 1Q6ZA 1DUVG 1ZCZA 4WZAA 5EJ4A 1M54A 2R1ZA 4PN7A 4YYZA 4X62B 2AEEA 1RRGA 3NVAA 2ZRDA 2E5LM 4G56A 5P8WA 1YB4A 2JZ1A 1KC1A 4L9WA 5AKKA 5JY1A 5EZQA 1YL6A 2YNMA 3GD5A 5TJHA 1KDVA 4X7MA 2ONKA 5CGQB 4UD2A 3IV9A 4P1ZA 4LNHA 1G20E 4FJ0A 2NN3C 1AS3A 3Q8WA 4QT0A 5E38A 2MINA 4EJFA 2CMGA 4GKJB 5J5AA 2G7ZA 5ALZA 1KDOA 5SZIA 2FP3A 4MRAA 2WWVD 5KJCA 1U2QA 1E5VA 3IBGA 3T9BA 3SMVA 2VF2A 1SUPA 3UW1A 2YBDA 3FRHA 3A6FA 2XIJA 4WGGA 4C05A 4D1YA 1RKVA 2ZTUA 1HR0M 2DWPA 3LC2O 4C4AA 1PVDA 1Y98A 2W6JD 5J4VA 2PH3A 3MB5A 4B35A 4X24A 3Q98A 5J40A 1UXIA 4U7FA 5JO9A 2PRKA 5HRAA 1V33A 1X74A 2EFHB 2M9MA 3IECA 4PHFA 4BGEA 3DAPA 1RAGA 4D9CA 3CLUC 5J3JA 3Q12A 3W78A 2H4YA 2ZPAA 3T1HB 4NEGA 3SASA 4EPWA 1AG9A 1Y63A 2OZLA 2GXUA 1ZK1A 5JQGA 2DR2A 4MEAA 1R88A 4X93A 1UJBA 4GBJA 4HLQA 3C7AA 1ACMA 2HLNA 2WMNB 3Q1LA 2GK4A 3AC0A 3WI7A 2AQHA 2QENA 3P94A 5CAEB 3WMEA 3AVXA 1UPTA 1JLLB 3CA8A 4R5HA 4DHEA 3L6CA 4I8XA 4LWQA 1EUQA 5DNWA 4PRLA 1EQ2A 4MMYB 4REOA 2PHZA 4UVEA 3TCKA 2HU5A 1RAFA 4E22A 3G8BA 4A10A 1I3CA 1HMPA 3CO0S 4QT4A 3OO1A 1P8JA 1Z2PX 1FUIA 2EDCA 1ORTA 1MOSA 1GLVA 2XMSA 3GRFA 3KOZE 4UPDA 2ZT6A 4EB8A 1V8FA 1F3LA 2WDPA 1MGPA 1DS6A 3KV1A 4FFMA 3HB4X 1TDJA 4WCFC 2K5UA 1HDEA 5DTEA 3TQOA 2PFGA 4NH4A 4X8HA 3TSZA 2MYNA 4DPKA 1SBCA 3T7JA 2ANBA 4Z49A 1HZZA 5F1PA 1SQFA 2C57A 3IP1A 3LWDA 3NT4A 4G0QA 2WPDD 2WF5A 3VZCA 4MUGA 4OG2A 1SVSA 3DBRB 3BH6A 4AWAA 1YBFA 3NBZC 3JASB 5BUZA 5LLSA 3LBYA 1XA4A 3E18A 2C31A 1UM9A 5CEEA 3IUPA 3KLNA 3DQPA 3VISA 4G9EA 2J3MA 4S0XA 3RUDA 3RYFA 2JI6A 4TT3A 5E1DA 3HM9A 1FFEA 2FWIA 4DEXA 5KQRA 1CQXA 3O9ZA 2WAAA 3FPKA 3L01A 3EVEA 5H9WA 5JJ5A 5MGBA 4UJ3A 1XI2A 1C1DA 2J3QA 3I2KA 1TRHA 2ZRCA 3QKRA 5DNYA 1BXGB 4JLMA 2QI9C 1UK9A 4XTRA 3G8AA 4MTCA 5CRIA 3TSCA 3MHPA 3EVCA 1A8IA 1R5BA 2X6QA 2BH9A 2FZCA 3TB6A 3AJAA 4R5MA 3ZDRA 2Q0QA 1E2KA 1NUPA 2R8OA 4DV1M 2B7BA 3I37X 2IYZA 3IBYA 4LRYA 3OJLA 2ZJ2A 3SLRA 8ABPA 4RIHA 5LMNB 1QLHA 3HADA 3Q10A 4KPGA 1H2FA 2E4UA 4COOA 2EOAA 1ISRA 4BEJA 1AA6A 2JAQA 4JOSA 1Z7YA 3C1UA 4DPMA 3Q2OA 1T24A 4H1TA 3PFBA 2XTJA 4A8TA 1L4BA 2IK8A 1RBMA 2FZ5A 3OJFA 4OTZA 4JUIA 2EWWA 3V32A 1FW6A 4JLVA 1RCFA 3PJFA 3RU7A 2NPIA 2H8GA 3LA6A 2DKLA 1NONA 4YRAA 2IODA 3QQPA 4OQ4A 2FXIA 4DLUA 5F51A 5ICCA 3WL7A 2QTTA 1ISSA 1OKSA 3NH9A 5FOXA 5T64A 1TL7C 5LC1A 2ZLBA 4HVCA 1G5HA 4A6XA 2R6GA 1KYZA 4JQYA 4A9AA 4GP9A 4DC0A 2YJ4A 4OAOA 1I2BA 3FYDA 3DTVA 7CATA 1ZUIA 2FSIA 3FN4A 4R40A 5IPFA 5AW7A 4BVKA 5BR4A 3VSCA 1SH7A 4P7FA 2DLNA 2HWXA 1KMCA 3IOBA 2J45A 3WSVA 2XSZA 3GZ4A 3KZXA 4FNMA 4LX8A 2OCPA 4PQEA 4NNJA 1WB5A 1OH8A 2ZSKA 3OPYB 1NJSA 4UCQA 3RSCA 5CITA 4AO6A 4X6YA 3EDYA 1MRSA 1PZGA 2HF7A 2IA5A 3C43A 1CDDA 2LCQA 4EY6A 3ICEA 3F96A 2I7CA 1ZGCA 2WV7A 3CB4A 5H8WA 5L6LB 5L6MB 5ITQA 1Z2AA 1T8TA 3MUEA 3QMMA 4OA5A 2VJQA 1R4ZA 2QVBA 4NL4H 4K6KA 1OAOA 2FSGA 2J3KA 4BMOB 2BKVA 4KWIA 2JLBA 5IUNC 3ADPA 1XQWA 3HP1A 5C1BA 3MUFA 2XCOA 2GA8A 2XT6A 3TO5A 1JSCA 1Z8HA 4ZIRA 2HF9A 1RTKA 1QF9A 3BORA 4G0MA 1Q22A 4BQEA 1ESNA 2I22A 1OV6A 1UR5A 2GDJA 5DN6A 1WCWA 4Q4CA 5I51A 1NLFA 4L5BA 4AIIA 3P19A 3HJSA 2VTEA 3ZQUA 1YR3A 4YUWA 1XMXA 1ZGBA 4RUKA 2KSQA 1EE9A 3T0IA 4I1SA 2DEUA 1ODLA 1YKSA 2JJ8A 3U40A 1D6MA 1K08A 3OIDA 5B3JA 3GROA 1EJ6A 2Z98A 3PCXA 4N40A 3LI2A 4YIKA 3RUAA 4ARAA 4PPGA 5FADA 1Y3CE 2LW7A 3N0WA 2FW9A 1QKIA 3LFHA 5I9TA 1UJ5A 4OH1A 5K0TA 2A58A 1SK8A 4BP8A 5DW3A 2RHGB 1NXSA 3KFLA 4J2OA 1FNDA 4YCCA 1QG0A 5AW9A 1T10A 3VBEA 1V7QA 5A5VA 3ADKA 3O8QB 4JOQA 5CVCA 4ZRNA 3PD7A 2I6QA 5EZYF 2EWMA 3TKAA 1ISIA 4QOGA 4EJSB 5LL6P 2Y9PB 3QKIA 3PPIA 1V3UA 3D7RA 5F1KA 5C7OO 2YZGA 3H8WA 4Y2JA 1GDTA 1PX0A 3PGKA 4JIGA 3UJBA 2FEPA 4HH0A 2OOSA 4KZPA 3SHFA 4TL6A 3JYQA 1ZM9A 2IVZA 3FXAA 2QNJA 3K0SA 1ZSNA 3OX3A 4O2BA 2PPVA 1RQNA 2Q5IA 4ENWA 3A2LA 5FQNA 3RE1A 3B1ZA 4N6OA 5C5DA 1CE8B 3OJXA 2C5SA 5CFNA 4HSGA 3M4YA 3KTOA 3BWEA 1SG6A 1IUKA 4FDUA 1TM7E 4R2HA 2BFBB 3HVJA 4WASA 4U4AA 3SS7X 3DQQA 2W48A 4YJ2B 5J23A 5G4LA 1R0RE 3O8RA 5EWJA 2ACWA 4WOBA 5DH9A 1BVUA 5JDCA 3CG0A 4NBRA 4DDHA 3H9QA 3DKIA 4Y2RA 2ZPTX 3P2KA 1XP8A 3TQSA 4DNXA 4YAWA 1KO1A 1K4YA 3DE4X 2EJSA 4CF3A 1X3LA 1EUCB 2PSJA 2KBFA 3FDIA 4IIYA 4J0HA 5EQDA 4EMBA 2PGJA 4INOA 3KLPX 3WY9A 2X9LA 1ZJ6A 4QARA 2QU8A 1NNUC 3WHIA 5HIAA 3BJIC 1VG8A 2PH5A 2XAAA 3DYVA 3I6YA 3C4QA 4F5WA 2XA2A 5C4MA 1FNCA 1MEJA 1T8PA 1KNXA 4U3JA 4BNTA 3W6PA 1Z8FA 4QXQA 3JQBA 2H1IA 4OIMA 3DF7A 3WYFA 4CL2A 3EUWA 4Z7JA 4C1NA 4PBSA 4D80A 3DGEC 5MF6A 4KQEA 4BASA 1H2XA 5JXGA 1D2MA 1HK7A 3EARA 1Q84A 4DARA 2JATA 4JI8B 4V0LA 4CT0A 3HNOA 3H11A 2RGRA 3HKDA 2H4XA 1Z12A 4PZLA 1U7DA 3I9KA 4QREA 3TN7A 5AJZA 4QLBA 4NBVA 1XD9A 1U2SA 3U6PA 2Z5VA 3K0AA 4K81B 1CFJA 2C94A 2Z83A 5AIBA 3RE8A 4Y2GA 4B6RA 4YUXA 1PR0A 1WKCA 4XGIA 2FEMA 2J7PA 2O7VA 3TIXB 5AM3A 1B1AA 5EMKA 5ITZB 1PNRA 1WDTA 3VHLB 4EHLA 4CM9D 1A7JA 3MWKA 2ODPA 4OLFA 1LBHA 1SXJE 1GQYA 3UOWA 3IIIA 1M2HA 5J63A 3H1PA 2QSUA 4G8JA 4YGYA 5THXA 4OU5A 4DJDC 5LQDA 1N33B 3OUZA 2Y3IA 1DEOA 3B1WA 1RJFA 3ZOZA 2I99A 4XX0A 1H1DA 1OCEA 4X94A 3TZ6A 4YAJA 4JSRA 4AZ3B 1EHCA 1ODKA 4DG8A 1Z47A 3E4DA 1FY2A 2ZGVA 3DBIA 4RVDA 3STTA 5BVHA 1H3EA 4UTRA 4UKDA 1W2GA 4F93B 1V1MA 4LA4A 1NQVA 3OQIA 3UG6A 4TQ9A 4LTNA 3O4GA 3VM6A 5IVIA 3PNBA 1T0UA 1EFPA 2WTNA 2XIQA 4UUPA 1UMCA 3GLHA 1VBMA 2YJNA 1FFXA 1K63A 1PM5A 4CZ2A 2C2GA 3VAZA 2GCIA 4CHTB 1Z22A 2P5YA 2CYBA 5I7SA 1J2JA 3FGOA 5I7EA 4NOLA 4B4DA 1SHUX 4L7QA 4QG3A 4HAYA 2HK6A 1FFSA 4LPSA 2Q6TA 4GPD1 2IZ7A 3T7KA 4E5NA 1JDBC 4OXIA 5DBIA 5DE3A 1YQTA 1AXGA 5FNVA 4FPXA 4RENA 3ZY3A 1D09A 4RPIA 4ZWNA 3U4HA 3CLHA 3D7LA 5F5XA 4Y98A 2VDUE 3JVVA 4V2UA 1WHTA 4LBVA 4BNDB 1BHO1 2C3OA 4CUJA 1PQWA 2YQZA 3L4BA 4MH0E 3VVMA 1CB0A 3M4XA 1R0ZA 2A1UA 5D6OA 2BZSA 4Z8XA 1Q83A 2FH0A 3O38A 4G0ZA 4NJEA 1GZ4A 1P4RA 3EGEA 3HB0A 4J4HA 4MQEB 2HD4A 3SXUB 4FYYA 3WSWA 3I72A 2SKEA 4ZCMA 1SRRA 5CAEA 1GKYA 5CNKA 2ZXUA 4KLAA 3ND7A 1SQ6A 1ZMVA 5ITTA 2WAYA 3ZHBA 4AN0A 1JIXA 2QTVA 4D9GA 3VKFA 4Q03A 3UICA 1LBSA 1F0NA 3PEWA 4G0XA 1KK2A 3RS5A 5JECA 1OSNA 1O89A 1Q0ZA 4A2QA 1DTWA 1K6XA 4H7EA 4P22A 4OHOA 3RVKA 2JAXA 3TLJA 3ZLVA 3ZU5A 4BB0A 4CV0A 4YXFA 5CA1F 4HL4A 3VA7A 2VJPA 3CLUD 3SC4A 4FINA 3ZS8A 2IEBA 2OL4A 3VR1A 1UQRA 5CXUA 5M04A 4I4CA 4WBXC 4K9OA 3O1JC 2VF4X 3DZGA 4RSHA 1PK7A 4ADSG 4XH9B 1M6YA 3BULA 4P2GA 5EZ6B 1JUDA 2RHMA 4EG7A 4RKUF 3U5ZB 3QW2A 3LYUA 4HTAA 5C1PA 3VSAA 1NMZA 4AX8A 2A5LA 1CUVA 1DXQA 3QJYA 3EJWA 2WC1A 4QUAA 1DMSA 9GPBA 4L4XA 4XOIA 3I9NA 3DE6X 3NHFA 3PEFA 4RJKA 4WK2B 3W3AD 4IO1A 3EPHA 5CIQA 1A5BB 1A72A 1JLSA 2P67A 3QYJA 4GLOA 5AI4A 5IS2A 2ALJA 3CR7A 4DSAA 2QM0A 2Y0PA 2K9DA 5EA2A 4KQWA 4GGOA 3WRYA 4WEOA 3DZHA 2EJWA 4IRUB 1RLIA 2W2NA 4AY3A 4DVGA 3W7AA 4OHXA 1Z33A 2W6JA 4BV9A 1O9GA 1TF2A 4KX3A 4HI0E 3KKMA 3DMHA 3OJCA 2C3YA 2OXTA 2PX0A 3B5IA 4KQ2A 4X6UA 1O0SA 2WWGA 3M1IA 1L7EA 4BQSA 4HWGA 2X9VA 2XWJI 1IWOA 2CK3D 2BM9A 4AJLA 4I9GA 4DADA 4GP6A 4P53A 3C7DB 1HQYE 3IRVA 3ZV4A 2IPLA 3KELA 3NWPA 4AMBA 3UGJA 6REQB 1Z5GA 4HC4A 4B32A 4BBJA 2L42A 3LXMA 4CN8A 5IH3A 4FE7A 1QOQB 1PN3A 2GCPA 5G3ZA 1H65A 2F6RA 1MFZA 2NW6A 3CWQA 4WKBA 3ZW9A 4E14A 1QCYA 1OFIA 2QQEA 5ALIA 1CJSA 1VSUA 3WK9A 1C3OB 3LT0A 4MQ6A 4C2TA 2BC9A 4JLOA 3E1KA 3H9CA 1ZINA 2PR7A 2YWJA 3R8XA 1BFUA 1XQYA 5CLQA 5KQSA 1L5OA 2OXFA 3RSZA 3I3SR 4MW5A 4Q9JA 2QQGA 2I3AA 3MHTA 3AB7A 2DWQA 5GY7A 5HCNA 2JRCA 4GMDA 2X1VA 2I3GA 5B2EA 1O87A 3AL2A 3L8EA 5JSZA 4NE7A 4PDIA 3DEAA 2PZFA 3HVUA 3K53A 3C3MA 1YVRA 3NM5A 3DWFA 1C2YA 3MGAA 4HN9A 4R41A 5K3OA 3GGDA 4AZWA 1M83A 3KP1E 1J09A 1X7DA 1T5IA 1BDMA 2BP7A 2WJAA 3TGPA 1UC5B 5ALEA 4FB4A 1WLYA 3REOA 1E6CA 2OFFA 2AWOA 5EYPB 2P62A 4JI6B 1M2VB 1XNJA 1RJ9A 4RK5A 5BPHA 3HHEA 1RM3A 3OJEA 3QLVC 3QVLA 1DLJA 3BREA 4PHCA 3ETNA 3ZCQA 4LJRA 1VPEA 3L8FA 3G89A 4G1CA 4BEVA 3DC7A 1UC8A 2ZPUA 1PGNA 3FR8A 2AF4C 3RHTA 3OKFA 3HU2A 1MUUA 1NE7A 1J8FA 3I9FA 4J43A 4URYR 5J59A 4DSUA 1XWIA 2QZPA 3TR6A 1XELA 3UV3A 3EXIB 5AM2A 1C80A 1OWNA 3DYIA 3CVXA 3BZWA 1QP4A 3U6BA 5MHTA 2HO4A 4R1SA 1Q57A 3EEQA 3RC3A 4RTNA 1Y1KE 1X70A 4ER0A 3MIZA 1AMOA 5IM5A 4OEHA 4AQYM 1E9SA 4HX5A 1PG5A 1TEVA 2EG9A 5KAMA 4L07A 2XKBA 2DTEA 3G9QA 3PEEA 4O2RA 2GBPA 2Y27A 1BE8A 2GZ2A 2PV7A 1FUEA 2O8NA 4C6TA 2IZ5A 3L8ZA 4ZEMA 5T8KA 1EFUA 4FFBA 4WRRA 3FMFA 1FDSA 2YJ3A 2P9HA 3SX2A 1KJZA 1RVDA 3BWDD 3ICPA 2LKDA 4NMXB 1Y6QA 4M0PA 4N54A 1KYXA 3JR5A 2Z2KA 4D9EA 1AGNA 5KKNB 2RGNC 3BZBA 4IQGA 1POWA 3CZRA 1H4TA 1G3QA 2IQ5A 4ABYA 1A7UA 3HYSA 3ZS9A 3NEYA 3NEJA 3F7TA 1J70A 3TB4A 4FYMA 2FOIC 1PT5A 4RTRA 3AWDA 3QVGB 3BGDA 1R00A 1CQWA 4CIBA 3WMWA 3WJAA 1NJGA 3WWDA 4F38A 4DA6A 4OI1A 1A2BA 3D43A 2Q8PA 2WZBA 1W87A 4DREA 2PPLA 1LPNA 4KO1S 4FEYA 5FQOA 4R54A 4EP1A 3KX2A 1VJ0A 1AGYA 1O97D 2QQ0A 1K7EB 3FNFA 1JHAA 3E48A 4WE3A 4ND2A 4AO8A 2NQTA 1E77A 5MDHA 5A4FS 4Y7CA 1Z63A 1AQ6A 1GSHA 2AC2A 2RHLA 5BMVA 1A95A 1W19A 1KI6B 2QPTA 1NJ6A 1CZKA 1G6OA 2GEBA 2OBLA 2J7OA 4H31A 3DKKA 1RBZA 2R8EA 4TUYF 2JKZA 4BU0A 3A1NA 3IAHA 3G8YA 2O8CA 3L77A 1YXMA 3OX1A 4KK4A 3JD1A 4TOIA 3DCNA 2BGUA 2NYVA 4QLAA 1JV2B 2FW6A 3LV8A 5KJ1A 2W6MA 2Y71A 2J6HA 2O5CA 1ZQ1A 4I55B 3OPQA 2OPHA 3ZBPA 5B55A 3L7DA 3QPVA 3MJVA 4PHGA 1UDAA 3IO3A 1EFCA 1RLJA 4RV5A 2C5RA 1VEJA 1L7DA 1EK5A 3SG0A 1GG8A 4NSRA 1R6AA 5EVJA 3PVZA 4M8KA 3ZTYA 5A7FA 4I3HA 3SIPA 1FS6A 1M67A 3JCZA 3HACA 4GSLA 4L8WB 4BTLA 4I1PA 5LQKA 1UOOA 1XZPA 1K6MA 5T4FA 4LF9B 3EBLA 2RBEA 3KT6A 2P77A 3J7AS 1ZRHA 1XLTA 2O1WA 4ITVA 4YV1A 1H6DA 1QX4A 2DT5A 1P1IA 1XTTA 2HNKA 1DX6A 2NZJA 4R2JA 4X7BA 1W0JA 1O8BA 2JCYA 1K82A 1HFKA 2C3PA 5DEIA 1B14A 2JGNA 2W6NA 1EA7A 1I9CA 3THGA 2I87A 4K8RB 1KP2A 1GPAA 1YHYA 2YVUA 1U90A