4LJ5A

Clpb nbd2 from t. thermophilus in complex with adp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
331
structure length
320
Chain Sequence
MEVTEEDIAEIVSRWTGIPVSKLLEKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Chaperone
molecule keywords Chaperone protein ClpB
total genus 97
structure length 320
sequence length 331
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj5A01
4JYBA 2Q0HA 1KK3A 4JBXA 3BB3A 4HDQB 1QHHB 2R6DA 1E2HA 2W2VA 2W6JA 2YZ2A 3EWSA 3NEJA 5FR2A 3ZQ6A 4QRHA 4QHTA 3EZ6A 1PV4A 4Q18A 2FG5A 1CP2A 1I4LD 3QEJA 3LQRA 4XWKA 2OXCA 4UNSA 3SC3A 3PIRA 1S8FA 4KFTA 4Q47A 3IKJA 4NU0A 2AX4A 1A2BA 5CM9C 4ILEA 3L8YA 3EZFA 4GDFA 3EASA 1GL9B 4ABYA 3IBYA 3RWOA 2HDNB 1ZINA 3AKEA 1GL6A 3V4FA 1FMJA 2JLYA 3AP1A 3GEHA 1NN5A 5J5CA 2FNAA 1Z07A 5DI9A 5AJXA 1VCOA 3TJZA 2CE2X 4FD2A 3X1ZA 3IHLA 1KI2A 1OHHD 2CK3A 1P72A 2MSCB 2A30A 2EYUA 3WYFA 1BMFA 2D2FA 2QQ0A 3GJ7A 2YOFA 3BH0A 3B1ZA 4HAXA 4D81A 3T1TA 4FWHA 3RSOA 2WV9A 3D8BA 2VEDA 4JKYA 1M7BA 4WXRA 4UXJA 4M1KA 1SXJA 4GP7A 2PX0A 1N2CE 2BBTA 1KO7A 3PUXA 2VTKA 3FMFA 1LW7A 3KB1A 821PA 3PUYA 1QBKC 1Z0IA 1J7KA 2H5EA 2E87A 5F3WB 1CF4A 4PHTA 2IXEA 3FKSA 2JLZA 1TNDA 1U0LA 4OHWA 4TL6A 4V02A 1YR8A 1FQKA 3DM9B 3CH5A 4M9QA 1RZ3A 3EA5A 2VP0A 3OIWA 2PEZA 1NVVQ 3U7GA 4RY2A 2GCNA 2R44A 1ZBDA 5F9FA 4JKIA 3P4YA 3QEOA 4DDTA 2J46A 3IHWA 1QG2A 5CDFE 221PA 1D9XA 1LF0A 2KBEA 1R8QA 3THWB 1T5LA 1KIMA 4OQXA 1Z8FA 2JATA 2P6NA 2NO9A 1XJQA 4B43A 3UIEA 3C8UA 1E69A 1H65A 2ZEJA 4UJ5A 4ZKDA 1E96A 3CX8A 2VF8A 4LYAA 2FEMA 2DFLA 1J90A 1MRNA 3E70C 1KZ7B 1T3HA 4B3CA 1NVVR 2QA5A 3U3JA 3BOSA 1E2GA 1XF9A 2H57A 4PANA 1DAHA 2PLFA 4BLSA 4Q4LA 2QPOA 4O2LA 1XEWY 2IF2A 2NIPA 3VR5A 2GXQA 2OV2A 1O87A 2C99A 2DFTA 5JFGA 3GLFE 3QSYA 3DM5A 1NVMA 4ZO4A 3K0FA 2CHQA 2RKOA 4A8JC 4B73A 1YZTA 1W44A 1JJ7A 2W0SA 5JRZA 2QP3A 3WNBA 2RGNA 3AJIB 1W2GA 1D2MA 2FSGA 2ZSFA 4M1SA 4CT5A 1CJVC 2H16A 1NSFA 5C4GB 1IQPA 4ESVA 1NVWQ 5AWFC 2QUZA 2O8EB 3THXA 3I5XA 3RANA 1OYWA 1JPJA 3QIAA 2GEUA 3Q9LA 3RRZA 4TTQA 3EC1A 4BEBA 1W4CA 1R2QA 2F6RA 4G5SA 4LHWA 4WZBE 3KKMA 1AIPA 2CLSA 1G3IA 2IX3A 4QHSA 3DVLA 4Z51A 2HCJB 4B3BA 2B6HA 2KSQA 5TXGA 1CLUA 4L8GA 1Q22A 1S9HA 2CVFA 2JLQA 3LAWA 3NG1A 1GFIA 4ERNA 1G3QA 1DAKA 1ZUHA 4GSYA 5DN6A 4DSOA 2VSOA 1E2LA 1Q21A 3N5CA 4HB2A 5CIQA 3SJZA 3LNCA 4PQFA 4QG7A 2BCJQ 4IVPA 1WE2A 1HT2E 1G9XA 4JBYA 2HUPA 2AFHE 5A5GA 5JCPA 2QPAA 2JLWA 4CF7A 1C1YA 4FMCF 2EFEB 2PX3A 4KBFA 4EQ6B 2ZRFA 3FPAA 4U5XA 4QHYA 4WZ6A 5EE3A 2ZAOA 2JGNA 5JWHA 1ZUIA 5A0FA 3QF4B 4MA4A 5L3SA 3QXSA 4MITA 1AZSC 2REBA 3TUJC 3Q7PA 4KV9A 3TRFA 2EQBA 2QMUA 4TWZA 3K0FB 3MD0A 3MFYA 5LDDC 4EJSB 4DT1A 4Q9KA 1TQ4A 5AJZA 1U90A 3B60A 1YZGA 4Q9LA 1GM5A 1VG0B 3D3QA 2GKSA 3N2EA 4KJZA 2HF9A 3R7WA 5JRJA 3CKLA 1G20E 5AUQA 1P2UA 1YHNA 2EFHB 4LHXA 3QOFA 4G0NA 1VTKA 3KFXA 4ON9A 1P61B 4OHXA 4LCBA 4HEJA 4LWZA 4FW9A 2OLKA 3TBKA 4PAMA 4L4UA 2O0HA 2R6FA 1E2NA 4BZXA 4C9BA 2XXAB 1G6OA 2UVQA 4OYHA 3B1XA 4DIEA 2JCSA 1Q44A 3B82A 4LV5B 5BW8A 2ZYWX 2WBLC 1GG2A 2OFXA 4HYYA 1N0WA 5FI0B 2CVHA 3DMDA 1E0JA 3ZS8A 1W0KD 4G5GA 1OXVA 1EWRA 2WVJA 4DLTA 4EPTA 3B78A 1B23P 2VYFA 4NYMR 3HPRA 2ZYUX 3SN6A 1XFAA 1G7TA 4NYJR 3E5HA 4D6PA 4DJTA 2DZOB 4AYTA 2GJ9A 4HLCA 1ELOA 2RGAA 3NKVA 1VYTA 3WYAA 5EE9A 1Z06A 2BHRA 2BMFA 3EZ9A 4RFVA 1XD2B 2R6GA 3FE2A 4DCTA 1R5OA 2QPTA 1CR2A 2WJIA 4XVRA 2GRJA 3F0TA 1DG1G 2VH5R 3I92A 1E0AA 3VR1A 1DARA 2OZEA 2ZRPA 3DKVA 3Q7QA 2B7BA 4TL8A 1IXZA 4Q00A 2WJYA 1D2EA 4XIGS 5FBQB 2PBRA 3SU8A 3K70D 5FOTA 1BS1A 3IQWA 2C98A 4QNMA 4IVRA 3OZXA 5HR5A 5FTMA 3ZVNA 5EE1A 2F43A 2FN4A 1E6CA 3AF2A 1LFDB 1KK2A 3IIJA 4OI4A 2XEXA 3X1DA 4BFUA 4ACAA 3K9LA 4Z54A 3QY0A 3M0EA 2QBYB 1GITA 1KGDA 2N1BA 4KYUA 1TEVA 2IS4A 4WAUA 3TAHA 2JDIA 1KDRA 4HUQB 1C9KA 1GAJA 2V55B 3BFKA 1X1RA 1L4UA 5TVKA 4GI7A 4UKDA 4LI0A 1UPTA 3U44A 3EW9A 1AQUA 1E2DA 1SHKA 4A9AA 3NBYC 2ASEA 2PLRA 5LBIA 3KQNA 3GLHB 3K8YA 1YRBA 1LVGA 1US8B 1FP6A 4A4DA 3WRXC 2C9OA 1VCNA 1KNXA 1YZQA 2J3EA 2FA9A 3BJIC 3E2IA 3GFTA 3LY5A 5TMPA 2IYZA 4JMPA 1YJ5A 1QHHA 2CLDX 4JVLA 4RVCA 4IXMA 1U0HC 1QRAA 1V43A 3WHLA 1SXJC 4DLXA 621PA 2G3YA 2VIIA 4OKSA 3LDAA 4DCUA 3B7GA 4OL0A 4MRVA 2LCFA 1VIAA 2A7QA 2FSFA 4IDQA 2CJWA 3AF1A 1EFRD 2J41A 2QN6A 4CZ2A 3KZ1E 2IWHA 1OW3B 3BK7A 1JR3A 3IO3A 1KSHA 3DZDA 1KNQA 2YHSA 3IGFA 3B1YA 4PAOA 4M2LA 3SEAA 4QKQA 1FZQA 4C7OB 1X37A 4PFSA 3A1VA 2E1RA 3CRQA 4Q4HB 3RVBA 4IXNA 3K0AA 3WBJA 4L5BA 5J4LA 3EPLA 2AK3A 4OQLA 4TLDA 2FFBA 1N3BA 1AK2A 3TSZA 5A4JA 1L4YA 5HCNA 4M53A 2IA5A 4Q9IA 2FE4A 3WRYC 1SQ5A 2GJSA 4D0NA 4OHYA 4NCKA 3ZD7A 1EWQA 4IRUB 5GJCA 3THYA 4DLRA 4HLUC 3JZMA 1Z0DA 2CBZA 3OEED 3QF7A 2WSMA 5SZIA 3T35A 4PC1A 2C95A 2CE7A 4PSKA 3CW2A 1PLLA 3B1WA 1OIVA 4BPBA 1DAEA 3TE6A 4KODA 1W47A 1FPMA 1Z2AA 2CMKA 3ZS9A 2Z4SA 1KMHA 5AJWA 2EU8A 2I1VB 1SULA 2OG2A 1MOZA 2YC4C 1NJGA 3AVWA 2WM9B 1OIWA 4ITRC 2PT5A 2HXYA 2Q3HA 1XMSA 2H18A 4HB3A 4JS0A 5CLLA 2WPDA 1XXHB 3O8BA 3G0HA 1KJYA 3PG5A 1E2EA 1JI0A 4ARZA 3AVTA 1Z6XA 1XEXA 4HI0E 5TV2A 4MYCA 3PEUA 2QAJA 4WW0A 1IOZA 4MGIR 5AK0A 2Q3MA 2GF9A 4M1YA 5GJVC 4P3YA 4TLAA 4Z8XA 1KI6B 2BM0A 4GOJA 2F1IA 4L15A 2Q3FA 3U3RA 1XMVA 4HAWA 5CDFA 1E9AA 1XCMA 3OEEA 4TL9A 1NNEA 1AA9A 2ANBA 3SYNA 3KXIA 1HTWA 2ODNA 1W0JA 2ZM5A 4DSNA 4MUAA 1OIXA 3TAUA 3NBFA 2O8FA 3AVYA 4EIWA 4NHOA 3GLHA 2I4IA 1FX0B 3CLVA 3P32A 4JL5A 4G5RA 1ONBA 3KQHA 3VU9A 1OXUA 3PEYA 3TSOA 4BFTA 4YMWA 1ZVQA 3UWOA 3VHXA 3ZJYA 4IOJA 1KK0A 4IKEA 2VHTA 4U7DA 1IHUA 1ZC3A 3FKSD 4EFNA 3LVQE 1E79A 2F9MA 2ZI5A 1NMXA 2QBYA 3B85A 1KMQA 4TYQA 2D62A 4URVR 4LRTA 1Z6AA 2IBMA 3IIMA 1AQYA 1G6HA 1AS2A 2OAQ1 3W5JA 1CXZA 3I72A 5FUYA 4LUCA 2V6IA 2DVWB 1JB1A 3ZIAA 4RD0A 1G3RA 5JWOA 4V03A 2QT1A 4EJSC 4ZDJA 3ICQB 2Z0MA 1P2TA 3REFA 3NC0C 3QPWA 4A8JA 2HCBA 2K5UA 2C96A 4B2PA 1T91A 2B8TA 1HA3A 2FZ4A 1X86B 3TQCA 5IRCD 1K6MA 4RCYA 1E9SA 2WWIA 2GVDC 1M2OB 4PPGA 4BUJA 2GEDA 3FMOB 1OSNA 2BMDA 5DO9A 4BE7B 1ZM3A 2QP9X 3AKYA 5CB6A 3ONWA 3LWNA 1GTVA 3MRSA 1T8TA 1G19A 3GEIA 3MWJA 1U2RA 1D5CA 2DWOA 3GLIE 4UNNA 4U00A 4X8OA 4UNRA 3CRMA 3W5IA 1HQYE 2BWJA 3TKLA 3FHTA 1LNZA 5F9HA 2EYQA 1JAIA 2ZJOA 3BBPA 4FMCB 3KQLA 3HJNA 4XD7A 4MYHA 4F4CA 1WBBA 5FPKA 2WAXA 3VKWA 2ZRMA 3OFNA 2YWEA 4NPHA 1YE8A 3P26A 1G64A 3Q8XB 1YZNA 3GLHE 4JBWA 3EIEA 3DHWC 4C3ZA 2XSZD 3THYB 2OHFA 3VR4A 2XNDA 4G1UC 1ZNXA 4NYMQ 3X1YA 3IO5A 4LHZA 4EAQA 4CEIA 1F6BA 2G0TA 2OAP1 3C5HA 5JHHB 4I81A 1X6VA 4B32A 3CM0A 1RFLA 2LKDA 4GBMA 4JVNA 3L43A 4TMWA 4D0LB 2FMXA 2DFKB 3NBXX 4RJLA 2NGRA 3BAFA 2DPXA 4A0RA 2QT0A 3EAQA 1S0UA 2C5LA 4QGAA 1SXJD 4TMTA 1KSGA 1ZIPA 2DZNB 1E1QD 1UBFA 2ZJ2A 3L2OB 1ZM4A 1BIFA 3QENA 3M1IA 1YVDA 4G3XA 3VU9B 1JEDA 2AN9A 1Z6TA 1L2TA 2XJ4A 1GIAA 4UXHA 3RS2A 4Q9HA 2IS6A 2EFCB 4P32A 3NTUA 1Z0FA 4JLMA 3CNOA 1AGPA 3R20A 3N2IA 3AVQA 2CNWD 4IDOA 1W36B 3CO5A 2P0EA 1MV5A 2EFDB 3H86A 3I3SR 2IC5A 2QI9C 2XOKA 2XX3A 3OIUA 1Z22A 1TU3A 2JJ1A 1XTKA 1R4AA 1XZPA 3A4NA 3F3YA 4QFMA 2YWGA 5C1BA 4ZI3A 3GJ3A 2G83A 3LX5A 3B13B 2A5YB 5DH9A 3EPHA 4TZ6A 4I1UA 3A1WA 2O0KA 4DHEA 5HE8A 2HYIC 3LW7A 1UADA 3HYTA 1US8A 4NE2A 4RZUA 2J9RA 4EPYA 4KYIB 2WAYA 1GVNB 4OQFA 1UEIA 4ZPXA 1OLOA 3DKPA 1IBRA 2JEOA 1W36C 1OFTA 4D4LA 3OHMA 2P67A 2P3SA 1DOAA 4YLGA 4Q1FA 3WNCA 4JL8A 3BORA 3QKSB 2UZIR 3AVVA 4ZIRA 4Y0VA 4V0ME 2C9CA 1R6BX 3SYLA 3AKCA 1II8A 2JJ2D 1YKSA 2YKGA 2FPKA 2BKUA 4PHFA 4POAA 4M1MA 1N6HA 2ZREA 3RWMB 2W6ID 4DLUA 2AKYA 3WP1B 5FR1A 3M4YA 2KI5A 4MGYR 1SVMA 4A1FA 3CH4B 1XD9A 5K8LA 2DB3A 4TSFA 3U60B 1S1MA 1F2TA 2OUKA 2AFIE 1YR9A 3GJ6A 4AYXA 4E22A 1OFHA 2CDNA 2GBLC 2OLJA 4MKFA 5KUTA 1U94A 2QRZA 4Q48A 5FBVB 4C0SA 5KPJA 2J45A 4XWOA 5HKKA 2IL1A 1G7CA 3UK6A 5JSZB 1Q1QA 2ODEA 1GDDA 1EG7A 3CZPA 2EWVA 1ODFA 1JEEA 3LH5A 3I32A 1M74A 4FWDA 5IF9A 4NDZA 4JLDA 1U0JA 1T0JB 1IN6A 2KBFA 4TLBA 2QM8A 1XPOA 4JLAA 4CEJA 3KL4A 2WWYA 3KKPA 121PA 4MKIA 3PFIA 4TYNA 4HUTA 1SVIA 4WVFA 1E2KA 2O8DA 1DE0A 3AB3A 3GJXC 3EWAA 1FTNA 3J81k 1PLKA 2ZI9A 3Q72A 1W5TA 1NG1A 1OXSC 4EFMA 5KPDA 1DADA 5FL7A 4AURA 8OHMA 2HV8A 3TR0A 1LY1A 4DUGD 4XOIA 1W5SA 2WSSD 1X8KA 5E7MA 5KNBA 4EPVA 1CJKC 1OYYA 1Q1EA 1QHNA 3U61B 1QHSA 3SE0A 4O3MA 3ASYA 1U81A 1NN3A 5EP1A 3CB4A 3CRW1 1W4BA 3UMRA 2RGBA 2ORVA 4GZLA 3AP3A 4QGFA 4B3GA 2WOOA 2P65A 1RRGA 2WMNB 4MGKR 2NTYC 2NPIA 4IHQA 2X19A 1E98A 4LPKA 4MH0R 2G88A 5BN5A 2IK8A 3U7HB 4MRRA 1XWIA 1W48A 1F5NA 1ZNYA 1G1MA 1KDPA 2F7SA 3IDQA 3NBZC 3SR0A 3T12A 1E0SA 3TGPA 2ZRNA 3AUXA 1CULC 4A6PA 2YNMA 4JLJA 2AKAB 3RDPA 1F60A 3ICEA 3MCAA 2ZJ8A 4MKHA 3H0KA 4AD8A 1GKUB 3O8DA 4DRZA 1OB5A 5CK5A 4QBIA 2IYTA 1BYIA 2VBCA 3GEEA 2IYSA 5TB5A 4ZCLA 4B6EA 4FCVA 2J1LA 3DMNA 2GHIA 3L0PA 1N6NA 1Z6GA 2ATXA 5BYJA 2VA8A 3BH7A 3R8FA 2NOAA 4P31A 4Q4AB 3RC8A 1IN4A 3UPUA 2IUUA 2HLDA 1VYUA 4FIDA 4RD1A 1CJTC 1G8HA 2F1HA 4G01B 3T1OA 2XB2A 1LTQA 1S9DA 5D3MB 1N5JA 3QKRA 4Q02A 5L3QB 1KK1A 4K8OA 2ZPTX 4YONB 4DDVA 1MT0A 4HUQA 2R6CA 4OBEA 1KOFA 1E0KA 2CCKA 4B2LA 2A78A 2AWNA 5BN3A 4OHVA 1WP9A 1SVOA 5FI1B 1SZPA 4DUGA 3LV8A 3THOA 3W6PA 5C18A 5FOSA 2CEAA 5JHGB 1J8MF 3WHKA 2KWIA 2FU5C 1FQJA 3PUVA 4TMKA 4IDHA 4CDGA 4HB4A 2ERYA 1N6PA 5CJ2A 1NI3A 2FEOA 2ZI4A 5DGXA 3P1JA 4XTRA 2CL6X 2GCPA 2GTPA 2I1QA 1V5WA 3B9QA 3VHLB 3W6OA 4YXWA 4U02A 2O0JA 5B30A 2JLUA 1E1RA 3R9XA 2J0UA 1E2QA 3MHVC 2GZAA 2WSSA 3PQCA 4GFDA 2CL0X 4JT4A 4FCTA 2QAGC 2VSFA 2ZRGA 4HLQB 3AH8A 1GNQA 1I4DD 2ZRAA 2ZUCA 5EQTA 1ZD1A 2OBLA 4PO9A 4GMDA 5CLQA 3A1TA 4LGMA 4BWYA 1QDEA 2PCLA 5FOWA 2OBNA 1KI7A 3TVTA 4PHHA 4OK3A 3QXCA 4GNKA 5E4FA 3RAPR 2MSDB 5DNYB 5EP4A 1T3SA 1N6RA 2AD1A 4MQBA 5AJVB 3VR3A 2XZPA 1OV4A 3EC2A 5KDOA 3LLMA 1E79D 4NL4H 5DI3A 1I2MA 2BEKA 1PVOA 3TQFA 3C5CA 4LYFA 4TLCA 1QZMA 3RS3A 3ZDQA 1KY3A 2R2AA 4MRNA 3ZIAD 3OIYA 1P9NA 2ZU0C 3THWA 4ARZB 3FWYA 4Z8YA 4JZKA 3H4MA 3TH5A 2OM2A 4ZCIA 1G8YA 2W0MA 5B2ZA 2IXFA 3T34A 4PPQA 1JECA 2V1XA 5FTLA 1NIJA 1UFQA 3QKTA 2JJ2A 3QF4A 1CBUA 2IYRA 1IJEA 4LRWA 4TTPA 3T5DA 1XEFA 2GDJA 4I99A 4IEIA 1KMHB 1OF1A 3AVOA 3IIKA 1VG9B 4WXPA 4C0HA 4JLPA 3OF5A 5H1YA 1G3UA 4V0NA 3KX2A 2Q6TA 2D3WA 5G53C 4KSBA 4R71A 2D4HA 3W3AA 5FPYA 3QPUA 5BXQC 5KSPA 3PXGA 1G291 4B76A 3PEWA 2AHOA 4LZZA 3T61A 1N0UA 3AF4A 4EDHA 4F7WA 1HY3A 3SHFA 5EP3A 3A58B 2QTVB 2XITA 1AGRA 3OEHA 3WMFA 4ACBA 2C77A 3MUFA 5ANRB 5GJWC 1M1YE 4NCJA 5G41A 4CEJB 2W58A 2QROA 3CNLA 2XZOA 4LOAA 3FVQA 4Z1MD 1GP2A 2YVUA 2Z4RA 2W2TA 3QKRB 3SHWA 2J0QA 1RRPA 1GL7A 2KRKA 3B5JA 4X8MA 1P60A 3SFVA 5J4YA 1OPXA 2ZI3A 1T8UA 3ADCA 4A15A 1T5IA 3DZ8A 2ODWA 4Q1EA 5JS7A 2R9VA 3PR1A 3SJCA 4BGDA 3THXB 4YMUA 4IOKA 5FUXA 4YXWD 1UBGA 2BC9A 3ZQJA 4O0MA 3P4XA 4NH0A 4FCWA 5DIFA 5CB8A 1P75A 2JIZA 5KSOA 4B48A 3VQTA 1KSFX 2H92A 2ZROA 3NXSA 4RFSB 2O8CA 4TMVA 1FX0A 1P3JA 3LX8A 3MAAC 4BLRA 5J40A 4GRAA 4PZZA 3W8RA 5JS8A 4HLUA 1CU1A 5HKKD 1W2HA 1AS0A 3IUYA 4D0GA 4KCGA 4K81B 3FB4A 3K0SA 3TUIC 2JA1A 4A92A 4F4JA 5SZKB 4IDPA 4DKXA 4JVMA 3LBHA 4JN6A 1SKYE 3BE4A 3FMIA 1BMFD 1K8RA 2W83A 3CF0A 1R0YA 3CRVA 1MO6A 3KXLA 3O8CA 1WB9A 2GEVA 2CXXA 4BECA 4PO8A 2ZJYA 4CIDA 1P7CA 3FDIA 1JR6A 1XDBA 3KB2A 5TY0A 1D6JA 3GLGB 2IYYA 4URYR 4IEEA 4PO1A 1E2PA 5FTKA 1JXMA 4EPXA 5KOYA 3UMSA 2I3BA 1KO8A 2OBMA 3NC1C 3KJEA 1AJEA 4PZYA 1E9BA 2NG1A 4IJMA 5L3QA 3BFXA 5AUPB 1NJFA 4DLVA 1AZTA 2QAGA 3C14C 1TF2A 3QG1A 3EA0A 4L16A 2WKPA 3GMTA 4URWR 4BFWA 2J0UB 1H8HA 1L7VC 2ECKA 4H9GA 1AN0A 1M7HA 2G77B 1R0ZA 1RYHA 1PUIA 3V00A 4ZDIA 1Z2CA 3MLEA 4C30A 1S3GA 1Y3AA 1YQTA 3OAAA 3Q3JB 4OI0A 3VAAA 3K0AB 3TVDA 1DELA 4PC2A 5GVSA 3CPJB 1ETUA 3RRYA 2V4ZA 5G40A 3AVUA 1A7JA 4Q21A 1EFCA 1CR0A 2GK6A 3C41J 2IWRA 4P4SA 4PPNA 2DR3A 2RCNA 3K0EA 5CYOA 1OH8A 4KBGA 4NCIA 2ZRHA 4I1OA 4N3NA 4Q1CA 2V1UA 1U98A 4YMVA 4BLPA 2P6RA 3O8RA 4TYYA 4YC7A 2AL7A 3QKSA 3CONA 3VFDA 1TU4A 1XEWX 1FNMA 4B74A 4ZI2A 1GRRA 1ZD9A 3ECCA 3LBIA 4HZUB 2WJHA 3SI7A 2FWRA 2FSHA 2Z43A 2BJWA 4RZXA 2QQEA 3QG5A 1F2UA 4TSFD 4AI6A 3CR8A 1R5NA 4A0HA 4RSGA 3ADDA 2KB0A 4G5QA 4NP6A 3Q5EA 5FOXA 1KKLA 2CK3D 2B8WA 1E9CA 4EKDA 2QTHA 1E3MA 3R7WB 3SBEA 5EZ5A 2XTMA 4D4KA 3CF6R 1O3YA 4M21A 5JECA 4FINA 1H8ED 4JLKA 2FX3A 2FOLA 1OKKA 4XJXA 4NMMA 2WIBA 3B2EA 5GJBA 2OCAA 1YR7A 4KFRA 4DCVA 4TLEA 1HV8A 1MH1A 1IN5A 2ZSEA 1A2KC 1E9FA 2OEPA 4DT1B 3AM1A 3G5UA 1G3MA 2EFGA 5DYGA 4OJKA 3A1UA 3A37A 3IBGA 4LDJA 4QOSA 3PENA 1Z83A 3GLIA 5FL3A 4ZIRB 1TMKA 2C78A 5HE9A 1AS3A 2IF0A 1G5PA 3DL0A 3KUCA 4LSGA 1J99A 3SQXA 2ZUBA 1E9DA 2OCYC 421PA 2BKEA 1KI4A 4CYMA 1M7GA 3EIQA 2WZQA 2ZRDA 3IPXA 4Q1AA 2QTFA 4BRUA 2QZ4A 1G8PA 4DXAA 2ZR7A 4HZUA 4KU4A 1TTTA 2OESA 4JLNA 3UG7A 3L0SA 3MSXA 1HE8B 2CL7X 3BGWA 5K8UA 2J7PA 3GD7A 3MWYW 1H8HD 1X8JA 4S35A 3F5FA 2ZITA 3NWJA 4DLYA 4P4TA 1R7RA 1F2TB 1RRFA 3AUYA 4W7SA 1ZC4A 4KITB 2O8CB 1NKSA 4DEYA 2QNRA 1PJRA 4O2RA 4R2IA 3R9WA 2Q21A 1GZSA 3TLXA 3HU2A 2NO1A 3SYKA 2ZRLA 1LV7A 3MGCA 3K9GA 1PUJA 4PHGA 1SVSA 3RS5A 4KI0A 3LO5A 2GJKA 3EARA 3CX7A 1QHYA 4GPTA 3BH6A 4MRSA 4RKEA 4TTRA 5DLQC 1KKMA 4C2UA 2E9SA 3MWLA 5FOVA 1SKYB 1HT1E 3TSWA 5E7JA 1KSJA 5IT5A 2N46A 1H8EA 1UDXA 3RRNA 4Q7MB 4Q5IA 4NCNA 4CEHA 1TF5A 1E4YA 1YU9A 1PZNA 3U4QB 4HAUA 2ONKA 3EXAA 4FWTA 1G7SA 2FH5B 4XH9B 4YMTA 2ZJZA 2BEJA 1OH7A 1KAOA 2BM1A 5CYPA 3REGA 1XXHE 4DLWA 4UJ3A 2GNOA 2H7VA 2IW3A 2ZRIA 4OK5A 2QU8A 1P9WA 3DPUA 1CR4A 2IYXA 1ESNA 3GCGA 1G8GA 2MSEB 2ZS8A 3IPYA 1W49A 4JL6A 1X1SA 5LD2C 2NO7A 3LD9A 1XTSA 1SVLA 3QKUA 2VL7A 2WHXA 2J7KA 4NTZA 1ZNZA 2Z83A 2JJ1D 1WCV1 1ZCAA 2O52A 4B35A 2BCGY 3CF2A 4RCZA 4C0JA 2HF8A 2H17A 3JVUA 2ZUDA 4RZ2A 3GLFA 2RGEA 4Q66C 4E07A 3A4LA 4JLVA 5C4MA 4PQRA 2GF0A 4QBGB 4URUR 4YDSA 3TIFA 2RGGA 1NY6A 1OT3A 3ND9A 3CNNA 3U7FB 3CRRA 4BLOA 2GAOA 3SZRA 4DZZA 4LJ4A 4D4JA 5FPTA 4V0LA 2ZAMA 2ZYTX 2BOVA 4D80A 3U3OA 4B6FA 4DDUA 1ZM2A 2HYDA 4TQ9A 4LY6A 1K5DA 4D2IA 2C2HA 4CGZA 3BWDD 3RS4A 5JEEA 5B64A 3SS8A 1A82A 1ZU4A 2BMJA 2ZE6A 4OI1A 1VG1A 1F3OA 1W4RA 1W1WA 2FF7A 4Q7JB 4TQUS 5G3ZA 4DC9A 5EXSA 1XJCA 4F93B 5DN6D 4RFSA 1RYFA 3MJHA 3L82B 4BLTA 2SHKA 3A36A 2BDTA 4LJAA 5LB4A 2IUSA 1XNJA 1JR3D 3BFVA 4XVQA 4YQFA 2WJGA 1HH4A 1EX7A 2O5VA 2FSIA 4B34A 1YR6A 2BMEA 1KZGB 2O8FB 4XTCS 1NN0A 5UKDA 5HTKA 1S96A 2VHQA 4PR0A 4GMXA 4HDOB 4JJZA 521PA 3WY9A 1P6XA 1OH6A 1MABA 5JMTA 5BYKA 1T6NA 2RHDA 1R5BA 5AJYA 1FTSA 1IM2A 2XTNA 2ZXUA 4DCNA 1RC8A 1HQCA 4HAYA 1QVRA 3UANA 1NY5A 1JR3E 4PX9A 3KJHA 4M9XA 3VR2A 1N25A 4BFYA 1FOEB 1N6KA 1Q1BA 1Q3TA 3HWSA 1WDTA 4Q4JA 5EUQB 1TUIA 3SFZA 1W0KA 4TZ0A 1P2SA 1CJMA 4NKRA 2Z6VA 3CBQA 3L0IB 2YYZA 4CVNA 1KI6A 3VMFA 4AKGA 3BRWD 4JJKA 4W9MC 3CUEF 3PJRA 1JALA 1QVAA 2NO6A 3OE7A 4R2HA 2F3TA 1N5IA 1F2UB 1XU4A 3C4JA 4CT4B 4KXFB 3I8XA 4LX0A 3HP1A 2PT7A 2N42A 5LB2A 2YC2C 1KJWA 3HR7A 3ZZTA 3ZVMA 1I2DA 4GOKA 1N5LA 4GITA 3SNHA 4ASUD 5FPHA 1HURA 1GSIA 2BV3A 4GT1A 5H68A 3WMGA 1XMIA 1G5TA 1SKQA 1RVDA 3G82C 1G17A 3AGPA 4DBLC 1TF7A 1EESA 2FV8A 2ZVPX 3GJ5A 4V0OA 1HYQA 1LB1B 4LBWA 3VX3A 2V9PA 4AIIA 3FHOA 3RLFA 1BKDR 2A2ZA 2XB4A 5CITA 2A3RA 2XNDD 3T1QA 4QJ3A 3W6NA 3TUZC 5ELXA 1TPZA 4FWIB 5JI3E 4LYHA 3RSLA 4TMZA 1EXMA 1R10A 3DDCA 4PTLA 2OCBA 1D2NA 2X77A 4JLOA 4A2PA 2A5GA 5K8IA 4R98A 3QNUA 1RW4A 1GRQA 3LLUA 1E1QA 1K5GA 2JAQA 1P9RA 1DVRA 4JVSB 1DTSA 2QGZA 2IEYA 2IHYA 3KKQA 5EJEA 2REXB 4B71A 3NHBA 1XD2A 2D74A 5JZVA 3ADBA 3LVRE 3VKHA 1KO5A 3GQBA 4Q7LA 1Z0AA 1XCPA 2BVNA 3B9PA 3B1VA 4TYPA 4H1UA 2VLIA 3SQWA 1NKTA 3D6TB 2OSBA 4EUNA 3KQUA 3NEYA 3KW6A 2P5SA 3KFVA 5KHOC 4Y0AA 2XZLA 2BBOA 2ZE7A 4DCSA 3QJYA 2C03A 4Q4HA 3GLIB 5IDVA 4LC1A 1S3SA 1XPUA 4TQAA 1NN1A 2OFOA 3GLGA 3FFBA 4MKGA 5E95A 1NP6A 1KI8A 1Y63A 1XB2A 5SZHB 1CRPA 1G8FA 4W5WA 2GJ8A 1JPNA 1L8QA 2DHRA 2NZ8A 4H1VA 4Q19A 5TARA 2XGJA 3EG5A 1OH5A 1D9ZA 2DFNA 2ZTSA 5FFMA 5EUMA 3SBDA 3BB4A 1JQLB 1JAHA 1G7RA 3UATA 1Z47A 3FFAA 2L0XA 4RD6A 1VCMA 2NQ2C 3Q5DA 2R8RA 2RGXA 4QGGA 1TQ6A 5IK2A 5FBWB 1RJ9B 4M1OA 5JLJA 4QJ4A 1FUUA 5KU1A 4OJQA 2F1JA 3KTAB 4BQSA 3NHAA 1VKJA 2QORA 3EZ2A 3NVAA 4IFBA 1KDOA 1P62B 1GWNA 4M8NE 2FDCA 4B2IA 1XXHA 1CS4C 2RAPA 2JJ8A 4D82A 2GILA 2WWXA 3C15C 1VG8A 3M6AA 4C0QC 1FL9A 3GP8A 1LF5A 1ZMXA 1MABB 4NBSA 3N70A 1TUEA 2REOA 2LKCA 2EWWA 2XSZA 2KE5A 3LQQA 3UXMA 5JJKA 2CJWB 2GBLA 1BOFA 1II9A 1UM8A 3SDZA 1GOTA 1R0WA 3CPEA 3W3ZB 4AK9A 1F48A 3B6EA 2V7QA 5FUVA 2H1LA 1KY2A 1NBMD 1Z6YA 1MO3A 1XRJA 4UXIA 5FL7D 4BFSA 4XVUA 5J4VA 3OIVA 2OT3B 4BFZA 3LRPA 4E5UA 3RNLA 3ETLA 1VPLA 4TN1A 1GNRA 4C4PA 1OB2A 3P20A 1ESMA 1UF9A 2Q9BA 1NIPA 1G4UR 4PQYA 2V54A 2QAGB 4WZAE 2G0NA 1VIYA 2ZJBA 1E94E 1P5ZB 4OQMA 4LJ5A 2P2LA 4PSVA 4QM6A 4DIDA 3SJBA 4RD4A 4NYJQ 4BRWA 5IHPA 1VHTA 3DO6A 3W90A 2PCJA 3DEFA 4LBZA 3TK1A 4IW3B 5KNCA 1KO4A 3C16C 3QBTA 2YJTD 4A36A 2IYUA 2WKQA 5HCIA 1VYVA 2WWHA 5CM8B 2QP4A 4B47A 4P0TA 2O8EA 2RGNC 2CCJA 4URXR 5AUNB 1UBEA 2XTZA 3WYGA 1CKEA 1R0XA 3GPLA 1T9HA 2NZJA 2VP6A 4I1VA 3CPHA 1TAGA 2JLXA 2CNWA 1ZM7A 1Q0UA 3FGNA 3H84A 2O8BA 2B92A 1E2JA 3EZ7A 4M0LA 4Q4JB 3OE7D 4L9WA 1YZLA 5LPNA 2ZS7A 2WPDD 2OE2A 1QHIA 1EFTA 3AGQA 2QE7D 5AR1A 2QY9A 2PH1A 1WA5A 3DOFA 3AKDA 2UZ3A 3K09C 2FGJA 3KJIA 1X8LA 4FMDF 4NZYA 1COWA 4LJ6A 2GZHA 1G4AE 4B33A 2JIZD 3ND8A 1KAGA 4JSTA 2DBYA 1XTJA 1EFUA 1MO5A 2A5JA 2FFHA 2QEQA 4LBVA 2ZRCA 2ZR0A 3PEVA 2ERXA 4O25A 4LHVA 3AVPA 2GZDA 3BIFA 4K46A 2FFAA 3PITA 5JJIA 4LHYA 1VCIA 2GJAA 4J0QA 4DEXA 2GCOA 3QI2A 5BQ5A 2FPLA 2QM7A 2OXRA 1P73A 1WQ1R 3NIBA 2ZU6A 4UQOA 3MJRA 1FNNA 5H70A 1ZUNB 1W0JD 5CJPA 2WKRA 4V0KA 1NBMA 3NH6A 5KNDA 2W2XA 1AKYA 3TR5A 2QENA 2VP5A 2HJGA 2OCPA 4QBHA 1WBDA 2ZS9A 4C0AC 1S2MA 3ZGXA 4E09A 4P33A 1N6OA 3AF3A 3I62A 1AKEA 5FUWA 1LS6A 1T0HB 4PSAA 4M9ZA 2W6IA 2MMGA 1KHTA 3U3MA 1ZRHA 3QVUA 4FWGA 4B75A 1E4VA 3TMKA 4KFSA 4Q4AA 3O47A 3RHFA 3GFPA 3I1FA 3QBVA 3C7KA 3VX4A 2AXNA 1Z3IX 2QE7A 5TDHA 3T06B 4EPWA 5FH9A 2GK7A 2C9YA 2R65A 4US2R 2HT6A 1E99A 1IXSB 3CWQA 1E32A 4N1AA 4NONA 2RGCA 1NBME 2GCOB 1E1RD 5G3YA 3PVSA 5DI3B 4KLNA 4MRPA 3HYRA 4A0GA 2ZQ5A 4LK2A 2HXSA 4BFVA 2XXAA 1OE0A 2RHMA 1NVUQ 1IY0A 4LJ8A 1YZKA 1T3LA 1SGWA 4AG5A 4BFXA 2HEIA 5D3QA 4AG6A 1S4QA 4WBSA 4CW7A 3NDBB 3X1XA 1NF3A 1C4OA 1DBSA 3LXRA 4KO8A 4Q1BA 2ORWA 4E03A 4B44A 2ODBA 5DSZA 3ZVLA 4N0DA 3I4LA 4WA7A 3VR6A 5KO2A 2Z5FA 1I4TD 3GJ4A 3FOZA 4FI3C 5DISB 2MMCA 1IN8A 2IYQA 2WWWA 4QJ5A 3A8TA 5BN4A 4R7ZA 4CEHB 2PJRA 2O8BB 4FN5A 4D25A 3QE0A 1NMYA 1XCGB 1UDWA 1XX6A 2G1JA 2X1VA 3A1SA 4HDCA 3FYHA 4M1WA 4Z1MA 3X1WA 3PV0A 1DAIA 4LRSA 1PLJA 3BC1A 3I73A 2ZI6A 1OXXK 5L3SB 5AUOB 1XEXB 4RD2A 1EK0A 4I4LA 1RRCA 1DO0A 5HPYB 1IN7A 2DY1A 4W5JA 3TW8B 2VHUA 2J0VA 1XPRA 2IHBA 1C1KA 3ZZ0A 2YV5A 2RB4A 4OQNA 4QGHA 2BBWA 3ZZUA 2XAUA 1HUQA 4NCHA 3GLFB 2VQSA 2WTUA 2AR7A 1CRQA 1UKZA 5FPSA 1Q57A 4CEIB 3KJGA 1RE0A 2YINC 3FHCB 2J0SA 1FMLA 1W46A 1ZYUA 3UMFA 3RS7A 3EX7C 2QGNA 1JBKA 3IQXA 2HLDD 5HZHA 2AWOA 5E3HA 5JI2E 1D8TA 1G41A 2VSXA 1N5KA 1Z0JA 1U8AA 2RGDA 2PMDA 1EGAA 4II7A 5KDLA 6Q21A 3AVXA 2WICA 1KI9A 2QSYA 2RH5A 4XWAA 1TQDA 2D7CA 2TMKA 4R9UC 4AYWA 4AWXA 4LJ7A 1KJZA 2P6UA 3SJAA 4B3DA 1II8B 1JJVA 2EW1A 1IONA 2JLSA 2ZSDA 3K70C 3WNDA 3UG6A 3HPQA 721PA 1DPFA 4HZIA 1SHZA 2ZSBA 3L0OA 4ZDKA 5KSZA 3KDSE 1RKBA 4B3XA 1QHXA 2J59A 3NDPA 4GOXA 1RJ9A 4LV8B 1KO1A 2IYWA 1DEKA 2CCGA 2BBSA 1P2VA 3CWZA 3EPKA 1G18A 4JYCA 2WJJA 3Q85A 4JIMA 3UWKA 2AK2A 1X3SA 2GXAA 4BEJA 1EFHA 4ZDWA 5FOUA 1ZIOA 1GKYA 2KJQA 2IYLD 3K53A 5JCZA 4F4IA 3IEUA 5B58C 4WIAA 3RABA 4DWJA 2YOGA 3AV0B 2LWIA 2VP2A 2C04A 4LPSA 1M6NA 5KTYA 1ZW6A 5KDDA 4YDHB 2AXPA 3QPVA 3I5YA 1EX6A 2VPPA 3U4QA 4FMDB 1DAMA 1CIPA 2X2EA 4HB0A 2EVWX 1GKIA 2QL6A 4W5HA 5CIWA 5P21A 5JBQA 2WWFA 1UKEA 2O8DB 1M34E 3S1AB 4DB2A 1Z0KA 2VO1A 1KI1A 3WBKA 2IT1A 5GADl 4TMXA 2G9NA 4QM7A 3KTAA 1ZCBA 2XJ9A 3U3KA 3NH9A 2G6BA 4M4SA 2PZEA 4P4SB 4BASA 1COWD 3K9NA 4US1R 2J87A 4G5OA 4IFEA 1E9EA 5EE0A 1UKVY 3R9IA 3U6KA 2JLRA 3AEZA 1MRSA 1Q1ZA 4MGZR 1E2MA 4DSTA 1JXOA 2R6AA 3LFUA 4M9SA 3QXJA 5FBRB 1XBTA 5C2JB 3U5ZB 4QBFA 1XTRA 1R8SA 2PZFA 1IXRC 4PZLA 4A82A 2HT1A 3QUSA 2IS1A 2V6ZM 1DS6A 1UAAA 1SXJB 3RRMA 2CLCX 2ZJ5A 4D26A 1TADA 1RIFA 5JJLA 1FFHA 4IDNA 1S1CA 3OESA 4TT3A 1XP8A 1J70A 1XTQA 3H2YA 3RYTC 5C46F 3R8CA 4JT2A 1XD8A 1AM4D 4V0MA 1W36D 4NYIQ 2Q9AA 2ZE5A 4C0BA 4A0FA 3QXHA 4F92B 4XD7D 5HZKA 3QVVA 5EXXA 1ZD8A 2PEYA 4AKEA 1VHLA 5DE3A 3LBNA 4KHZA 3K0CC 3QXXA 2A5DA 2JLVA 1J8YF 1RPZA 3ADKA 4IOLA 5JWRA 5EXTA 2PZGA 2W00A 4B3FX 2V8OA 4MDEA 1U9IC 2Q9CA 3KKNA 3WMEA 2D2EA 4OHZA 1G16A 4CRWB 3I8SA 5EE5B 3P27A 1N0VC 1DAGA 2FFQA 4PAQA 4GZMA 2FGKA 4AKIA 1ZU5A 1MKYA 2IUTA 2PL3A 2IS2A 1U99A 3OEHD 2RMKA 4ZCMA 2UKDA 3ZD6A 3MG9A 4A8JB 5B57C 2GESA 3W8NA 3T5GA 3U44B 2FZLA 5L3RA 1UEJA 2F55A 4RKFA 1BH2A 1SVWA 4MUBA 4XSGA 1W4AA 3U7EB 5LD2B 4QNRA 1ZM9A 4KLZA 1DAFA 2G1KA 2BIFA 3A4MA 2GAAA 2DWZB 2QMOA 3UKDA 3ZH9B 5L8VA 1NLZA 1WF3A 1NMZA 2VRWA 1IY1A 4QL3A 3ZVRA 4C7OA 2ZANA 4D4MA 4C2TA 2Y8EA 2F43B 2ZIAA 2ZRKA 4PC6A 4XSHA 2GETA 3KUDA 1QF9A 4A6XA 1QG4A 3CR7A 2J7PD 1TEXA 4DDWA 3A6PC 2ZVQX 1BYUA 3U6BA 2VP9A 3CIOA 1B0UA 2WOJA 1YZUA 4ASUA 2WIAA 5SZJA 1KTVA 2A5FA 2IXGA 2X2FA 2YWFA 1UBCA 4M1TA 3HU3A 1IY2A 3VKGA 1J2JA 1A5TA 1ZAKA 3JZAA 4Q7KA 1CJUC 1OXTA 3K09A 3B8HA 5M04A 5K8TA 1OHHA 5E7IA 1SVKA 2W6JD 1EFRA 4BZQA 1E2FA 3PUWA 2V3CC 1WXQA 4UNPA 4DLSA 3GJ0A 2ZE8A 1W7AA 1XJ0A 4EJSA 3OAAD 2GVZC 3VNUA 4RD3A 2IYVA 1SXJE 3K9HA 1IAQA 2WMOB 4ESHA 3K0CA 2QMEA 1N6IA 4QC2A 4BZPA 1E9RA 4N0EA 3LW8A 4OI2A 1Q20A 2VHCA 2A9KA 4IVQA 4MYTA 4DSUA 5KSYA 1FUKA 5JEDA 3JVVA 1M8PA 1ZNWA 1KYIA 1N6LA 4KSCA 4KFUA 5EZ6B 3QQ5A 3V4RA 1ZJ6A 2ANCA 2F3RA 4HAZA 4HAVA 1U8ZA 4HATA 2OFWA 2PMKA 4Q03A 5EP2A 2YWHA 4PC7A 2BJVA 4F38A 2B21A 5DYIA 1OKKD 1Q3HA 2FPMA 1NLFA 3BERA 5DHFA 3AQ4A 2DWQA 1GRNA 1XTIA 2WWGA 1TX4B 4IOMA 4MDFA 3HR8A 4PXAA 3W34A 2HJVA 1HEIA 1XMJA 4UNQA 4DLZA 2P5TB 1MO4A 1UKYA 3HDTA 5GVRA 3VNVA 3E1SA 2GWHA 1II0A 2GXUA 1CTQA 4HLDA 5FTJA 3OFND 4A2WA 5H8WA 5BWMA 1OFUX 1Z63A 1ANKA 3MMPA 2V6JA 3AF0A 3K1JA 4PC3A 4KAXA 4EQ6A 1CEEA 3RC3A 2OO7A 4QXAA 5FTNA 5IK2D 1TQ2A 2IEZA 3AP2A 3FMPB 3FTQA 3U2QA 2ZETA 3ZYCA 2F1RA 2VHJA 3W9YA 3X2SA 4LJ9A 3TNFA 1DG3A 3BS4A 2GA8A 1A4RA 1ZP6A 5D3MA 2VP4A 1NG9A 2H8KA 2ZYVX 5F98A 4AKHA 4GP6A 2QRNA 4JSYA 4X8LA 5J4KA 2GXSA 2D7DA 1A1VA 1GNPA 2ZJAA 4FMBB 1JQJC 4LJYA 5DHAA 1NLYA 2QG6A 2NMVA 2CHGA 2ONJA 4KVGA 1YRAA 1NVXQ 3VTKA 2VF7A 4OK6A 3PCRB 1FP7A 3LXXA 2ZRBA 2XOKD 4PPFA 2C8VA 2ORIA 3BB1A 4RZ3A 1KDTA 2WJVA 3PUZA 4LBYA 3MWKA 1Z28A 1BO6A 1Z5ZA 4TT3D 4Q9JA 1WMSA 2V7QD 4ZV4A 2JDID 1LS1A 4YMSA 1NRJB 3V9PA 3K70B 1NL3A 3KXKA 4M22A 1CR1A 1Q12A 4DB4A 4I1SA 4NYIR 3IEVA 5CK4A 2ZRJA 1MR3F 3GLGE 3FKQA 5KYKA 1Z29A 3HU1A 1XZQA 3SOPA 1DO2A 3T15A 3WP0A 2YOHA 4C0LA 1T4GA 4GL2A 1VMAA 1WRBA 2QMHA 2F9LA 3CZQA 1JNYA 2CHVA 3DOEA 3ZLJA 1G21E 3T1VA 2NPFA 5F2EA 1E2IA 4ZKEA 3TW4A 4Q1DA 2B7CA 2ATVA 1U8YA 4A2QA 3WXMA 1FW6A 2XNSA 3EPJA 2NO0A 1OFIA 5EXPA 2FJUA 2D06A 1UJ2A 3BD9A 4KVAA 4C0KA 4P4UA 2ZI7A 2OILA 4EFLA 4AC9A 4LC0A 3VLFB 3D7MA 3GJ8A 1TL7C 1G5RA 1U9IA 4A3VB 1Z08A 4S2EA 5L3VA 2PJZA 3ASZA 4FXPA 4BLQA 3RS0A 1QZXA 4DVGA 2JASA 1P4SA 3I61A 1HE1C 4WOPA 4X8HA 5J4HA 2X8AA 1NSTA 4HSEA 4MYUA 1OJLA 3H1TA 1VDZA 2DCUA 3EIHA 1QHGA 2R62A 3CX6A 3IILA 1GILA 3L8ZA 4LV6A 4AY2A 3BXZA 3LA6A 5JSZA 2ZR9A 1VECA 5FBLB 4TL7A 3GFOA 4US0R 4URZR 4Q01A 2DYKA 5J47A 4LYJA 3S1AA 3D31A 1GUAA 2QSZA 4JLBA 3KQKA 2ZSAA 2AD5A 3KKOA 3F8TA 4F91B 4L9SA 4TYWA 1KI3A 4EPRA 2J5XA 2DWPA 1IJFA
chains in the Genus database with same CATH superfamily
1EVZA 4KOAA 1KK3A 3VYVA 4JBXA 3BB3A 4HX9A 2R6DA 1K92A 5GONB 1EA7A 1T2EA 1LPAB 4YMIA 3WLKX 4QHTA 3U61A 2POQX 2E55A 2VBIA 4H16A 3ZQ6A 2FG5A 1JEYB 4Z53A 1SD1A 2E2WA 3OOSA 2OORC 5JS2A 1X77A 2CWBA 3GY0A 4UNSA 3KR9A 1GARA 1S8FA 4KFTA 5ENZA 4XWKA 2IY7A 3IKJA 3M2TA 5CM9C 1A2BA 3SYTA 3PR2B 4PNZA 4QU0A 1XZFA 3PTLA 5CAEB 3L0CA 4CJXA 3IHKA 3L8YA 5C8VA 1DGHB 1IWPB 3EZFA 2Q7OE 3VDXA 2VUUA 2JXNA 1C3VA 3M4XA 4UMEA 4B7CA 4YRMA 3KYCA 4GKVA 4GVPA 5I5EA 4G86A 1CD5A 5KKNB 2I2CA 5IVHA 2GLTA 3RWOA 3FYCA 1Y98A 5DM1A 4IIJA 5KNDH 1N4DA 2EG5A 2OV4A 3HSSA 5EHXA 3AKEA 3ROPA 1EE1A 4YJHA 1G8KA 3V4FA 4UCXA 3ENVA 4QOHA 3LPAA 2Q5QA 3D6JA 4KIFA 2FNAA 3FE3A 4H7PA 3KEFA 4HQFA 3DOOA 1TW2A 4MS1B 2CE2X 4FD2A 1FFDA 2FRDC 3AW8A 1TAHA 3AZPA 1J0BA 3CE6A 1C9YA 3G2KA 3EVEA 3IHLA 3KS9A 4RIIA 2MSCB 1P72A 1U1FA 5F1KA 5DP2A 2EYUA 3D6UA 1TI7A 4DBZA 4EENA 1KH3A 1SCIA 2RJNA 2HGZA 4ZAWA 3GJ7A 2YOFA 3WGVA 3MWEB 5ICEA 4HAXA 3HKCB 3D3JA 3T1TA 4JKYA 4JT8A 4AM8A 3RT1A 2P1RA 1HLFA 4QUBA 2KHHA 3KSZO 1T9AA 1TVEA 3DBRB 2QZ9A 4OX9Y 1O89A 3T3IA 2EJSA 3M3HA 4TXLA 1AV7A 1EDBA 4GM1A 4AP5A 4AS2A 4D1YA 1QBKC 2JS7A 5ED4A 4E94A 1EFPB 4MDYA 2AMFA 4HWSA 4XVHA 1J7KA 4OYRA 2CNLA 2C83A 2AQIA 2E87A 1L7EA 2HU5A 3P2JA 3PC8C 4PHTA 4QPCA 5KYTA 1CF4A 5DV9A 1A8UA 3FKSA 3WAJA 3GG2A 4UTVA 3TDNA 1U0LA 2JLZA 3RIEA 2R18A 1DX4A 1XC7A 2BAGA 1PJLA 3DM9B 1GGKA 1GADO 1NMSA 1XEAA 3EOBI 3AHGA 3IVMA 2DBRA 1HDRA 3NHSA 5D86A 2VP0A 5AQEA 5T4EA 2PEZA 1NVVQ 1NPDA 1JIUA 3QYPA 4N40A 4FXOA 4RY2A 2IDMA 3HDVA 1S02A 3FOEC 2C82A 3D5TA 2J46A 5EGSA 3WLOA 3DOJA 5A4DA 4QU9A 3S2FA 1PP4A 3VO2A 1KH1A 4OQXA 2JATA 3JZFA 2NO9A 1XWFA 3I4VA 3COVA 3F49S 1XJQA 1L5OA 3MSCA 1UDBA 1QIDA 4LMBA 7AT1A 2PZLA 3G1WA 3PGXA 3NHUA 4YUWA 4AZ0B 3R09A 1JIQA 1V39A 1RXCA 1N34B 2VF8A 1NJ2A 3HYLA 2P41A 3OQBA 2PUAA 2FEMA 3S5JA 1J90A 3RKRA 5CA0F 1VMKA 1F4VA 4B3CA 1NVVR 1I0ZA 2I8LA 3KLOA 5D85A 5CBPA 1LQUA 1UBSB 4K9DA 5GIPE 1RC1A 1N2XA 5TNXA 3OPYB 4KO3S 3W05A 3BWEA 1QDLB 3R0IA 1IG3A 4MUYA 1AU9A 4NBUA 4UBKA 1SZCA 2P3QA 5KTOA 4ZI5A 3KXEC 4O2LA 1XEWY 2IF2A 2WZJA 1E4OA 2ODAA 3GDHA 2OV2A 3B6ZA 3LPMA 5JFGA 1PEDA 2DY0A 2VK8A 5JDCA 3O9MA 1O08A 4A8JC 2Q8PA 4ECAA 2P9EA 3PC2A 5JQWA 2XUHA 1O1YA 3TJRA 3NASA 4CDMA 2Q4EA 2QP3A 5JRZA 2RGNA 4IR7A 2C5AA 4M6WA 1U9CA 1YOVB 2G80A 1RKVA 2WSIA 3JSAA 1IQPA 3F46A 1NVWQ 4XCQA 1D0IA 1LPMA 2QX6A 2PRJA 3SE7A 2OHXA 3KKLA 3L46A 4KN9S 4V0SA 3THXA 3SIRA 1OYWA 2BLLA 3AR9A 4ZVOA 1UOOA 2CNBA 3EC1A 4ARAA 2D0OB 4BIIA 1P1RA 4KTTE 3SPXA 2XZUA 2PZBA 4PO3X 3SR4A 2AC2A 4JZYA 4LHWA 2KX7A 3QKIA 1I33A 1BNCA 3SZMA 5IJ9B 4S1TA 4MB7A 2W6PA 4P0QB 5HZGA 3DVLA 4W7HA 4RABA 4B3BA 5BVHA 2LHCA 1FS5A 2EZUA 2HMAA 1Q83A 3H3XA 5DM0A 3VSAA 4N5NA 3K32A 1CLUA 2PO5A 2CDBA 4PN7A 1KMIY 1NFFA 2WY2D 3LC2O 5A5EA 1XCBA 1S9HA 4RETA 1GUFA 2E4UA 1GCUA 1ZUHA 3I2HA 1KZ4A 4GSYA 2Q50A 1PQUA 1KAEA 2M1XA 5DN6A 3IMGA 1U3FA 2VSOA 4C04A 1LDMA 2X86A 4AZ3A 4QG7A 4ND8A 3IRUA 4IVPA 1K06A 3EJ6A 3PL1A 4EKIA 4BXOA 1Z4JA 4JBYA 2HUPA 1XI2A 2CMHA 2DXIA 4IH9A 5K4GA 3ELDA 4FFRA 5FUBA 5ILQA 5F1OA 4P4GA 4UUBA 1N1GA 3FPAA 1VA4A 4U5XA 4QHYA 3E7WA 1TDZA 5F21A 2JGNA 4U6SA 4UE2A 3QF4B 3RHSA 3TEJA 2WAAA 3IC5A 2FWAA 2CJPA 2Q5FA 2FCRA 2REBA 2LE0A 1TRHA 4P6VF 3QLVC 4G67A 2A0KA 5F3DA 3WJAA 4YEDA 2QMUA 3V1MA 3K0FB 2YCLA 3DE6X 4C4SA 3NBUA 1QMPA 5C0OE 1JKMA 2A1IA 4WXHA 4R3UC 3GVCA 3B60A 4WJLA 1P7VA 3ZK9A 1VG0B 2ZPUA 2FJPA 5ALRA 3WLAA 1RT9A 3UW1A 1L1QA 5ITSA 4KJZA 1DU4A 4K3VA 1ZG3A 1T3TA 2JY6B 2HF9A 1ZEMA 5JRJA 3CKLA 3J7AC 1FJGM 3RT9A 3TRIA 1Q17A 3DZKA 2EEZA 1E9VA 5KYUA 3PLAE 2YWDA 3WISA 4PIVA 2EFHB 1ULSA 2OYRA 4XX1A 3WTCA 3G5TA 4LHXA 3PUJA 1O9BA 1P61B 2YMMA 1P2GA 4LCBA 1FYEA 2VF4X 5EJ8A 2UZ4A 4OMDA 2J3QA 2QVCA 4OXIA 5IUJC 3CGWA 5IVPA 1USWA 4S12A 4RLQA 2P6MA 1A9ZA 1ONPA 1CEYA 5LOVF 4UUPA 1E2NA 3VM6A 5JC8A 1RYNA 2AJBA 1JDNA 3OZVA 2SKCA 3PXXA 3L26A 3BD6A 5BSRA 4B3HA 2JCSA 1PU2A 2CWDA 5BW8A 2XUJA 1AX9A 2X5XA 1L4KA 2FN7A 3JASB 4TWAA 4ATNA 4EDFA 4HYYA 3HY6A 1ZCZA 4O8ZA 1UP7A 1JTFA 4MRAA 3ZS8A 2HAKA 2HGSA 1OY1A 1YFZA 4DLTA 2HA7A 4M36A 2B3TA 4C7XA 3RRJA 1CY6A 3WGJA 3PXEA 1ZHHA 3F7NA 3LYAA 4U2GA 4AYTA 3GNQA 5CVDA 4MWDA 3PE6A 1Y1SA 2BEVB 4HLCA 2RGAA 3WYAA 4L08A 1D0KA 4MV6A 5EE9A 1BE6A 2FPPB 5JNUA 2QRVA 3EZ9A 1T5OA 2HL6A 2R6GA 5LZ7A 1J9ZA 1O8CA 3DONA 4ZQGA 1R5OA 2WJIA 1CR2A 3LHIA 2GBPA 1IY9A 1DG1G 1LI4A 3B7WA 1JSCA 1PGNA 3JARB 1V5FA 4QQRA 3X2EA 2ZATA 4OFWA 3VR1A 1BHO1 1KOJA 4RTJA 3BGOS 4R40A 5F3WA 1CUDA 2B7BA 2HADA 2J5KA 1LNSA 2GQ0A 4ZVQA 2B7LA 3NT2A 1RHRA 5BSUA 3SU8A 3ZCBB 5MF6A 4HBGA 3LZDA 4QNMA 3OZIA 1QNFA 3FDXA 2H63A 4FOSA 4IVRA 3PUKA 5HR5A 1YC2A 3ZVNA 3K1TA 1O8BA 2RHBA 2YFYA 3FLMA 3HM9A 3U3ZA 2XW6A 1QX4A 4FFBB 2OC9A 4Z54A 2CMGA 1ZO8A 4DIKA 5E0KB 2QBYB 4YVFA 2AN1A 4ZV7A 2YH2A 3KJNA 1OBOA 2P2GA 1G9SA 4ZQCB 1OGJA 4CFSA 1GZVA 1AUAA 1MEJA 3E3AA 1RQ2A 1UBJS 4EX6A 4ERXA 5HZMA 4AJLA 1R9NA 3BFKA 4XK8F 3F6YA 1ZI9A 2GX6A 1L4UA 4ER6A 4E3WA 1AT1A 2HBRA 1MX1A 1UWKA 2PZMA 1OA0A 4GRDA 3DHYA 3EW9A 3HWX1 3M7IA 4LI0A 2AC4A 4UHKA 1DEOA 1SHKA 3P9IA 3T1NA 3V7NA 3GN1A 4GNRA 1DUIA 3SAUA 3OCVA 5IYZF 5LBIA 3X44A 2G4LA 3C97A 3EUWA 4A4DA 1FP6A 1J7JA 4N3CA 3WRXC 4AAYA 2O06A 2VYND 1M54A 4XJVA 1YZQA 1KDZA 3GP3A 2ZB3A 3J7AS 4OA5A 5K3FA 3MOSA 3LY5A 3V34A 3ZKWB 2IYZA 1NBWB 2Y0PA 1VGRA 2PL1A 5DHRA 5FQNA 4AMYA 3ONFA 3GFQA 4JMPA 2ZWMA 4WESB 3GOQA 1CEXA 4HQKA 1YJ5A 4OM8A 4QM7A 1P44A 4MWSA 3PEFA 3KZNA 4RVCA 3TI7A 1PT7A 3FPBA 1H3NA 3U6LA 2ZZMA 4IX1A 3MQ2A 4ZK6A 1NPTO 1PKXA 2VQFM 1U1DA 1NQXA 1XE3A 2AFHA 2G3YA 1ID1A 4J0HA 2QN2A 3LDAA 4HQ6A 4ZODA 2BFAA 9LDBA 3FR8A 2VHWA 4MRVA 5E6JA 4N9WA 2LCFA 5I8WA 1GGHA 2DENA 1DT3A 2A7QA 3E7DA 3P7MA 5D00A 1OTHA 3PGKA 2J3JA 2BP7A 3K92A 3AF1A 1ESZA 2GN2A 3DZJA 2N3ZA 4FNOA 3WL4A 3AR6A 3DOHA 5K6RA 1DQNA 2YXEA 4CN8A 1JR3A 1KSHA 2P62A 1CJSA 5JTTA 4EX7A 4AECA 2W2KB 1X1DA 1CY0A 3B5EA 4PFSA 3A1VA 2E1RA 2ACWA 4NK4A 5L45A 4IXNA 3PX7A 3BZWA 4K87A 3C1TA 2FFBA 1Y3IA 3PXBA 5CH3A 5AYVA 4JBGA 3R5KA 1UC8A 1R0RE 3H2SA 5HCNA 1T2FA 1AMNA 3N59A 1ECGA 2YYYA 4Q9IA 2FPPA 2DHYA 4ER0A 2GJSA 2HJWA 1YUBA 1VRWA 2WD9A 2ZTLA 4NCKA 4OSOA 1WIVA 2OV3A 3L7AA 4IRUB 3THYA 3ZGYA 5LNK6 3LVWA 1Z0DA 2CBZA 4UHHA 3UC5A 4Y28F 5I6DA 3NMUF 3O2JA 1X80A 2WSMA 1VM6A 1VOTA 2AGVA 4BLUA 5INTA 3OC0A 1IQUA 4FHGA 4MUMA 2CE7A 4PSKA 2QHOB 1Z88A 4XYGA 3JRXA 2Y2VA 3QVGB 3B1WA 4OHCA 5AM0A 1OIVA 5CLHA 2FPUA 2FKAA 2PMCA 2YMPA 4UQPA 4YRLA 5HVNA 3OSZA 5GWXA 3W5CA 3TE6A 1YFLA 5AW8A 2O05A 1FPMA 2JLCA 1Z2AA 5CX1B 5F3RA 3VZPA 3ZS9A 1KMHA 3AINA 5AJWA 1DQRA 1SULA 1NJ1A 2OG2A 3JCZA 3VPFA 2YC4C 1CEQA 5DW3A 1KMCA 3G49A 2JZCA 1X7GA 1UANA 2WM9B 4B7GA 2VQEM 2HXYA 4JS0A 2GEBA 2HZ7A 2BGNA 2OA0A 5LYJA 5ALIA 1S01A 5JSQA 5F7JA 3G0HA 2P6OA 3TW6A 5TV2A 4MYCA 5JNWA 5BQ3A 2PKEA 2GFIA 1GZUA 2IJGX 2R1ZA 4WUTA 3RTDA 2Q9UA 1MA3A 1R4NB 3QMPA 4M1YA 1M2VB 3IQHX 4P3YA 2WTMA 5B1SA 3WMXA 1B1CA 1KI6B 4M49A 4D9CA 5JSFA 1QM5A 4L15A 3AILA 1WCWA 2O7NA 4NOMA 3U3RA 4GOMD 5CDFA 1E9AA 3K8ZA 3V1LA 1Y89A 3CCBA 3A6FA 3AUTA 3ZV7A 1AA9A 1SHLA 1XPJA 1YZVA 2I55A 3NATA 1N7GA 1P74A 1LJ8A 2VAWA 3W2EA 2ZUFA 3CH6A 3GFSA 1WSBA 3C8ZA 5K5EA 3NTQA 4AICA 4DSNA 1A77A 5EWMA 1RI2A 3NBFA 4X6UA 1FEZA 4FZ3A 1WETA 2D5IA 4UU1A 4DCJA 1R15A 4KGDA 3VYUB 4JC4A 3GLHA 2NUPB 2V7EA 3A28A 3CQ9A 3KEOA 3P32A 1E6MA 2LGJA 1ONBA 1MTOA 1A88A 3VU9A 3TRJA 1KDYA 1PG2A 1A50B 3FBTA 1RKUA 2QRUA 3IJ5A 4W7IA 3UWOA 3VHXA 1YTUA 2F4VM 3KQOA 2WFAA 1I1NA 5JH7F 4TWRA 1W5FA 1KHHA 3S44A 1D2CA 3LVQE 1E79A 2IDKA 3GO4A 2Y0QA 5GP1A 1N3YA 1QB7A 2AA3A 4OEHA 3L9WA 3TQOA 2JWSA 3WO1A 2E49A 2QBYA 1RNLA 2PXCA 1PWEA 4PAWA 3VDMA 3Q9NA 4URVR 4LRTA 2HCTA 9MHTA 3GRAA 4ZARA 2EKBA 1NZFA 3NBMA 3RYFB 5CG1A 2D6FA 4HQLA 2OAQ1 4IJWA 3VDPA 3I72A 5FUYA 1KBOA 3SICE 4U6NA 2CVQA 2V6IA 3Q8LA 3P0FA 1Y9JA 1XL0A 1JSXA 1ST2A 4ZJUA 1JG7A 4RJ2A 5BVHB 2DKLA 1QO0D 2AZXA 1FXSA 1PHPA 3ZIAA 4YI5A 1G3RA 1PZEA 4V03A 4CG0A 3IQEA 3RKUA 4D9KA 4ZDJA 2G8NA 5KWVA 1D7OA 2EQAA 1RLJA 2XMSA 3VR6H 5BV1A 1ADYA 1YE9A 1U1EA 2JUJA 2JI8A 3B52X 4AU1A 1PFKA 5D6OA 5JNTA 1V6CA 4KIJA 3WGIA 3QPWA 4AULA 2K5UA 5AKGA 4X61A 4K6HA 4B2PA 3RVSA 5I9MA 1T91A 4ZYVA 1Y1LA 3TQCA 1CT9A 3OOHA 2FK8A 2WWIA 4PPGA 2H52A 4C3OB 4GBED 4BUJA 2GEDA 4COKA 1OSNA 4IXWA 3PD0A 3AKYA 3A9CA 1GNTA 3ONWA 2Y1GA 4LECA 1XP5A 1RI3A 4G4SO 3QW2A 4QVIA 1GTVA 3W7BA 4Y2XA 5FEUA 2WG1A 3JXEA 4L4YA 1SJ9A 3KLNA 4QTXA 5LYJB 2R48A 1L1EA 3QWLA 5ESWA 2GM5A 4BNJA 5ED0A 4O4IA 3HADA 4UNNA 1ZMWA 2YN0A 3OZRA 3JQ9C 4V3CA 5EFOA 4WRRA 3SGLA 3CRMA 3OTHA 4M8IA 4NV0A 2ZZNA 1HQYE 1GGVA 3FHTA 1EFVA 3OZCA 5T8KC 1V71A 1VMDA 3K15A 4ZV9A 2YUIA 3QUAA 4CI9A 1WGLA 2EGHA 3H05A 3BBPA 5CFZA 4O63O 2PGAA 2WQZA 4FMCB 5IJXA 3HJNA 4B3JA 4UM8B 4F4CA 4CMEC 1WBBA 3MCUA 4UN2B 4KMSA 2E4YA 1QP4A 2ZRMA 3V7FA 2H2DA 3E9MA 2Q4TA 2VK1A 2YWEA 1H2HA 4H15A 3UOAB 4YJFA 5E8RA 3Q8XB 3N8KA 4O2BA 2C5EA 3EIEA 2XSZD 3N1UA 3FUXA 2B34A 4B7HA 3THYB 2XNDA 3UJ7A 1G1AA 1RHMA 2VUTA 3I53A 4NYMQ 4B7UA 4KXNA 4LHZA 1WMFA 1OFUA 3IDOA 2P7IA 3ABRB 2JGKA 2D59A 2V96A 1Z62A 2BM9A 2QTMA 1YK1A 2LKDA 2WF8A 1NP7A 3CLRD 3TWMA 3GIWA 3JQCA 1T35A 3L43A 5DHUA 4CKBA 1Y5MA 1JP7A 1O2DA 2DFKB 2FMXA 1D0SA 1TA0A 2NGRA 1JIVA 3K70B 2DPXA 1HPLA 5JLAA 2R66A 3FTNA 3BZUA 5FNVF 3EXHA 3DMTA 4BNKA 2HAEA 2X0EA 1KSGA 1GU7A 8CATA 2DZNB 1UBFA 1C3LA 1SU7A 1ZITA 1DIRA 3QENA 3DTNA 1G5FA 1U7HA 3GBPA 3M1IA 5KQSA 3F9CA 2IS6A 1L2TA 2XJ4A 4P81A 4FBMA 4D4HA 4INAA 3QWBA 4P32A 5E3IA 3WADA 1T8PA 1Z0FA 4IDOA 1AGPA 4BQPA 4UM5A 5ITWA 2CNWD 4JI7B 3K3PA 1OIPA 1P3QQ 3CO5A 4H4EA 2I22A 2P0EA 5LZ8A 2Q1TA 4LF6B 1PZHA 2WJWA 1M5RA 2WYVA 4NXNB 4OP3A 3GUCA 3H86A 1L1FA 2NWQA 1YDMA 2P40A 4HG2A 1L5KA 1HL3A 2HREA 4OB8A 1Y5LA 1NVEA 2QI9C 1W76A 2XB8A 1Z22A 1U8EA 1ZCJA 4YHHM 4N03A 4BN0A 4KO4S 4B40A 5ICCA 4X0EA 5C34B 2DUUA 2VJCA 4AUKA 2VJOA 5AM3A 2Q3CA 2JHCA 3Q3CA 4E5NA 4ARSA 2LNHC 1RTTA 3E48A 4IDFA 4JOBA 4N4AA 4ZI3A 3H6HA 2G83A 1M3SA 4IBIA 1U28A 4G09A 4I1UA 1ADGA 1F1JA 3TQQA 3MJ4A 1DCKA 3UTDA 3W06A 5LQDA 3TLGA 3HYTA 1TYBE 4NE2A 2XUFA 2E4XA 1I6LA 2Q6VA 2QZPA 3H87A 3IUQA 2OECA 3W2IA 3ZTTA 4KNVA 3IP8A 2OGTA 5I9BA 4CF5A 1HSOA 4TZTA 4KQCA 1IBRA 2CYAA 4AZWA 3SS7X 3AYZB 2Y2UA 1O94C 5F4ZA 2P67A 4YLGA 1B8OA 1HLGA 3WX0A 3QFHA 1C30B 3WNCA 1D4FA 1MA0A 4JL8A 4AO6A 1X7WB 1RYBA 3ROZA 2HHHB 4HXFB 2C9CA 2ZVDA 4LTDA 3SYLA 1RI1A 3K9WA 1WVIA 3N76A 3S8MA 2I6UA 4C08A 4BQEA 2YKGA 3ZDXB 2BKUA 2OOBA 4PHFA 3U5TA 4M76B 1NVMB 3BSWA 4M1MA 2ZREA 3NT5A 1P5JA 5KPRA 2IOYA 2VNSA 2W6ID 4IZHA 3RWMB 3ZTYA 2DNAA 5BR7A 4WN9A 2KI5A 3PKZA 3RJZA 2LVAA 2DB3A 3AOEA 2VFAA 3WSVA 1S1MA 4IDDA 4OX9M 1OFHA 2CDNA 1AMUA 1PG0A 3P9XA 4MKFA 1L5LA 5IXYA 4C0SA 4ZCRA 1UJCA 3DP7A 1UH5A 3BRQA 3Q6MA 2VK2A 5DRTA 2EWVA 3AHCA 1M73E 4QTTB 1M74A 2BI7A 2G4CA 4LK3A 4NE9A 3DVAB 1DIBA 4UAJA 2QLLA 1U0JA 4JLDA 1JA9A 2FW0A 3O5AA 4Z5XA 4Y9DA 1ULBA 2IYFA 1ISIA 3P9KA 4HFMA 1A9PA 4QDTA 4QOEA 5AFSA 2IPOA 4I19A 5F9MA 4DBVO 4IHKA 3KKPA 5FULA 4YPOA 3N3AC 4JR2A 1FDRA 1YI0A 3PFIA 5IFLA 4AJHA 4DMHA 4YRZA 5CVUA 4FS8A 1E2KA 4P7BA 4BIMA 5L4NA 1YJAA 4UM9B 2QD3A 2RAVA 3Q72A 3K94A 1T8YA 2B4KA 1UK7A 3HDHA 3KBBA 4EFMA 1B74A 3HA2A 3QLUC 4L3OA 2W8BB 4M8SA 5JZBA 5KPDA 3JWJA 4KRXA 4J16C 1K6EA 2X0FA 2F4NA 1CNEA 3RYIB 4AURA 8OHMA 2FR8A 2M6LA 3TOVA 4KJXA 1ST3A 3PFFA 3MA0A 3B36A 1AKQA 3HBAA 1CUJA 4XOIA 2WSSD 5E7MA 3KM0A 4OW0A 4OO3A 2EATA 5DHSA 1RMQA 1Z34A 1Q1EA 3A11A 1AGNA 3M6MD 4EYQA 2HSJA 1QHNA 2VS1A 2Y68A 1LBQA 3SE0A 4BV8A 2VRCA 4O3MA 5D84A 3HKEB 1BRMA 2RGBA 3FM9A 5DBEX 3USCS 4EWLA 4MULA 4B3GA 2WOOA 3O7WA 1ML4A 3LVVA 1W35A 3U39A 4TV9A 1RLTA 3CVOA 3UGQA 1NYLA 1V9LA 3A05A 3GHYA 4IHQA 1YDEA 3DL2A 4LPKA 2FOXA 4MH0R 3Q10A 3TNDA 1SBYA 5KTNA 1DRWA 4KT0F 1HNZB 3T12A 3ICPA 4F46A 4JI0M 1PGQA 5AJUA 3LPCA 1UXKA 3DNFA 2UXBM 4B0OA 5LQCA 1VGQA 2I4TA 2C8JA 2Q1SA 1K4KA 2PUTA 3QU2A 4N12A 4JLJA 2DBVO 3H0KA 1N8SA 3O8DA 3QX7A 3RQIA 1T9CA 1RYEA 3E21A 5CK5A 5KSWB 3CW9A 3LBAA 4YWHA 2WHEA 1BYIA 3IBSA 1DDIA 2CZGA 4FCVA 2GPNA 1H6DA 3V1KA 3DMNA 3CLTC 4I6EA 1DV0A 1N6NA 5K8JB 4YFVA 2WUFA 2H7XA 1WQ3A 2NOAA 2IIVA 5GQSA 4BMDA 2R11A 2J4DA 2QQ8A 2XYRA 4S1PA 4MAMA 4BVLA 1XB2B 4RD1A 5AXDA 3HXMA 4Z4GA 1JEJA 2BN4A 4D74A 2I7TA 4G01B 4O5OA 4HGYA 1FRFS 4EHKA 3IG8A 2EKKA 1S9DA 1OBFO 1GPYA 1N5JA 1TCBA 3QKRA 4FW8A 1KK1A 4K8OA 4UCQA 3ZWAA 4DIFA 5L3QB 2UXCM 2QVBA 4L6IA 4YONB 1ZGAA 3RK0A 1CUBA 1MT0A 3TBFA 2GR9A 1B8PA 1TB4A 3KBOA 2CCKA 4TYMA 4WOBA 4B2LA 5EIAA 5CXUA 4X90A 3K5PA 1WXDA 4OHVA 1G8SA 1SOWA 1SVOA 1WM1A 2GFQA 3SASA 1RXYA 3H4TA 4U2DA 3DAFA 4ZVLA 4NWIA 2PLAA 1J21A 3VR6D 3JAWA 5JHGB 4CL0A 2PUBA 4R9NA 2ZSKA 3E53A 3Q2KA 1YOVA 4IDHA 3MC1A 3K6JA 5T6MA 3Q7EA 4B3SM 2KNAA 4HB4A 2ZT7A 1Q6YA 1SOAA 1TM4E 2DAGA 2BT4A 4M99A 3MUOA 4E5MA 5CJ2A 4KUHA 4DF3A 4RVGA 3P1JA 3VHLB 2CL6X 2GTPA 3B9QA 4MPTA 1QVZA 3CT6A 4LJRA 3KOUA 5EIFA 1TK2A 1L8LA 1R0CA 1RZVA 1JDBC 1RXSA 1VIDA 2O0JA 3QHAA 4GLBA 4H7JA 5EKSA 4BNZA 4BU1A 3R9XA 2PSHA 1YJ8A 2GZAA 2W82A 1RWNA 4GFDA 5A4IS 2A86A 2WP8J 2ZRGA 2GSDA 3C70A 3FKJA 1GNQA 2ZUCA 3WA7A 3AM3A 5EQTA 1ZD1A 2OBLA 3J7BA 2DHCA 1JJAA 3A1TA 2O8NA 4LX8A 4BWYA 1OYOA 1QDEA 3OF2A 2M32A 5FOWA 5BP7A 1N5RA 1IJBA 3UJ9A 3TVTA 4MGZE 2DMRA 4A6DA 4DZRA 5E4FA 1H0RA 2MSDB 4RO0A 1XAHA 4GHAA 4XD2A 5FXMA 1S5PA 3BMXA 2F64A 1N6RA 1HT3A 2AD1A 1SD2A 3B70A 1OV4A 3EC2A 3RASA 1SEVA 3VR3A 3LLMA 1E79D 2Z7JA 3E9SA 3ELBA 2BEKA 1PVOA 1CHNA 1YJXA 5TJHA 2PJDA 4H77A 3HO8A 3RS3A 1KY3A 1E58A 3LOUA 5K6AC 1P9NA 2B9VA 4OXNA 3THWA 4OLJA 4Z8YA 2GUWA 3M81A 3H4MA 3TH5A 4I8XA 1GV0A 3I4YA 1N9GB 2QE6A 2V7WA 3CMCO 1G8YA 4WKCA 2W0MA 4KQMA 4R2MA 3T34A 2ZWPA 1IOWA 1JECA 3HZZA 5JROA 1KZ6A 5B3JC 2ID4A 2W98A 3QF4A 2WIGA 4Q7EA 2IYRA 1IJEA 1DDGA 2JNWA 2UUOA 2VWPA 3GPBA 4LRWA 4O1HA 3T5DA 1OF1A 4HDNB 4CU2A 1NF9A 1MNQA 1VG9B 2NZXA 4JLPA 4Y1FA 3HHEA 1G3UA 3HXLA 3BX1A 2JK1A 4NXMM 1TW3A 3CVXA 1QP7A 4YRQA 5G53C 5KJ6A 3D0QA 1RRVA 1LVHA 2D4HA 2XMRA 3D7KA 4BEWA 2Q27A 3FPJA 4W1SA 9ATCA 4CIWA 1XAGA 5TQ0A 2RHWA 1G291 4IGKA 5E4TA 4EHFA 4ES6A 3PEWA 3TD6A 4F1JA 3ZK7A 3SZ3A 2HH9A 5EKDA 1USGA 3MMXA 4UUQA 1HY3A 5IKEA 1J5EM 2ZZKA 3TRKA 4O5AA 2XITA 1AGRA 3RGSA 3V4LA 3MUFA 4NMLA 3GFGA 3SC2B 3QLEA 3STUA 3FYUB 1LRLA 1SBNE 2W58A 2QROA 2SCUA 3G7NA 3IHTA 3FVQA 4LOAA 1GP2A 3KOMA 4PQGA 4WY5A 1D6SA 2W2TA 3SHWA 2C7BA 3NC4A 5B7QA 2WB2A 1RRPA 3JQ6A 1UJ4A 3SFVA 5EIXA 3HH8A 2J0QA 4A10A 3IKVA 5J4YA 5CX1A 3ADCA 1T5IA 1F9AA 2GD0A 5I9NA 4MGHA 1J0AA 1WPQA 3PR1A 4YCAA 4MP8A 2X1HA 1TJ4A 4UHDA 2WLTA 3I42A 5FUXA 2BC9A 2R1UA 3P4XA 1L7MA 3ZV5A 5K0ZA 2QVXX 3DC2A 3NGXA 4CMGA 1KSFX 2H92A 4TT8A 2QSUA 4QFCA 4AJ1A 4RFSB 1Z3CA 1GA6A 1L7OA 5IASA 4TMVA 1FX0A 3LX8A 1ZMTA 2V74B 4CLRB 2RAFA 3EVNA 4E1AA 4GRAA 3W8RA 3HRIA 1P9OA 1RWXA 3CIFA 1SCDA 3M82A 4HLUA 5JS8A 1HGXA 3DXZA 1W2HA 4RLSA 4NS1A 4C7JA 1PR6A 1V45E 3WLPA 5HRAA 4IM7A 4X60A 1G66A 2W22A 4AP9A 4HQ0A 4JVMA 3SDSA 1NRIA 2IVFA 2VCEA 2Y9PB 4JN6A 3E9DA 1RPJA 2DULA 3G59A 3IAM6 2KLHA 1ADBA 1K8RA 2Q5JA 2W83A 3BE4A 1R0YA 3KXLA 1MO6A 3O8CA 3U49A 2XH9A 4I4TA 1VDMA 2O2GA 5CBKA 3NRCA 4PO8A 4L9AA 1Z5NA 1DXYA 3ZZNA 4B2YA 2H3HA 5TGTA 3OA0A 1L3CA 4HV4A 1YA4A 2X1MA 4QTZA 5C8XA 3V46A 5EIEA 3WB1A 2Z9DA 1W8IA 3G2LA 1E2PA 4CLDA 1I4WA 3F3KA 2I9KA 2C7VA 3ZYZA 1BFDA 4B4KA 1ND5A 4KQ2A 4HJRA 4M0KA 4REOA 2CXQA 3NX4A 4NZMA 1H4VB 1PUXA 5K1ZA 3QJ5A 3WL7A 2J3IA 4CPDA 1J06A 1D7AA 4ZANA 1Y4AE 4UTNA 2C29D 5ALOA 4ZMSA 4GDMA 1Z75A 1ONNA 2QAGA 1XELA 5B2EA 1XMPA 3C4QA 2WINI 3TZQA 1TF2A 1Q95A 1C1DA 3OPVA 2OZLA 1PX2A 3SY8A 3EA0A 2FOIC 4URWR 3RTGA 3WIOA 4BFWA 3O9VA 1A72A 4H9GA 3UA3A 2G77B 4BNUA 2AYZA 3KALA 1DC3A 1Z2CA 3JTEA 4H31A 1X7XA 1IUPA 4C30A 4CODB 2UXBB 1YQTA 3PSAA 4LMRA 5CG2A 2X0KA 1TLTA 3OO1A 4JUCA 3STTA 3UJHA 4W8OA 4XGRA 2PT9A 1VMEA 1EEXB 4FFWA 3OUZA 4DM3A 2O7QA 3CPJB 4LRTB 5E1BA 1EFPA 3ETEA 3D8TA 5G40A 4JI4B 3HO1A 1SOVA 5DX1A 2D0IA 1UIMA 3BHMA 1F5SA 4GE0A 3AVUA 1DKLA 4IBOA 3T9CA 5TMBA 1M2WA 2GK6A 4BMPB 3L4BA 2J48A 3MEQA 2DR3A 2CJYA 1OH8A 3EDOA 5FNVA 1SWWA 2CUTA 3MJCA 4ENUA 1DJNA 3E05A 1QGED 5CHEA 3AEQB 4YC7A 3QKSA 2EJVA 2R79A 1RQXA 4NABA 1VSQA 1QZTA 1UCFA 3LU1A 4PZEA 4ZI2A 1G0OA 2UZ1B 3FTCA 2DHDA 3E8SA 3DDWA 4HZUB 5FYDA 4CKEA 4ENQA 1QIFA 5LP6A 4GLLA 2J9GA 3UB4A 2GCGA 4O0LA 3LUFA 4S1NA 1I6WA 4D4IA 2Q5IA 3USES 3I28A 1R5NA 4UEOA 4A0HA 1U31A 1M1NB 4G5QA 1KKLA 4EKDA 3C6XA 2F00A 5AXCA 4L5YA 3WAKA 4XSVA 1BCSB 1K5PA 2CFTA 3B7NA 3CF6R 4M21A 5K0LA 3U40A 4CE6A 4CCYA 2G5CA 2O0MA 5JECA 3O21A 3FVVA 1H8ED 1ISMA 3PNOA 4XLLA 2FOLA 1OKKA 2RC5A 4TKUA 1W94A 4Y67A 1A9XA 3KOWE 1VZ3A 2JFXA 4CKZA 2RIPA 1MB9A 5JQGB 2OEPA 2YJGA 2YWJA 4JJFA 4KYVA 1Q91A 1N36B 2Z56A 4CQMA 3H75A 3A1UA 2FP4A 4J3NA 2FW9A 1QVWA 3FCUB 3PENA 4XRGA 1H1TA 3HMKA 4UHJA 5JNVA 4KXUA 1C3JA 4P34A 4AL4A 1USUA 2C42A 4KZKA 3MIIA 2O1SA 1AS3A 2IF0A 5JH7B 3R77A 4PZUA 4LSGA 5KOHA 3SQXA 2ZUBA 1M10A 2QYOA 2HFKA 1E9DA 4G56A 5ALVA 4AQYB 4P80A 4EP1A 1BHJA 4BMXA 4P3NA 2WU1A 5IYZA 1NE7A 4ZEOA 5ECYA 1M2GA 1IPFA 1W5EA 3IE2A 1TTTA 3GPIA 1M66A 1G2PA 4YMGA 3L0SA 5FADA 1X0XA 1XA3A 2CL7X 4LNUA 1FLAA 4EGQA 4PQRA 1IK6A 3BSYA 1GXSA 3AEYA 3GD7A 4KL8S 3CWCA 1H8HD 1X8JA 1H5NA 1VEKA 2G72A 5EQDA 4KB5A 3AVXA 3CMMA 2PGIA 2PN1A 3KZMA 4W7SA 1PJ3A 3AUYA 3HR4A 4PZ0A 2DT8A 5G4KB 1ODSA 3U6CA 4KXXA 2FXVA 2XDWA 3VJMA 5JT1A 3R9WA 3K5WA 5I8ZA 2Q21A 1H1DA 4Y7CA 1J20A 3HU2A 4NJMA 3ZWKA 4IGEA 1Y9DA 1E6UA 2J6BA 4MDHA 3FUVA 1IVNA 2ZB4A 3AG5A 1E20A 4NPAA 3I23A 4OUKX 1D2AA 4X3PA 3V4ZA 3RS5A 3A4IA 4Q4DA 3GEMA 3VR3D 5KNBD 2FW6A 2Y0DA 4R9VA 3EARA 4UBIA 3CX7A 4RKEA 1C7RA 4DYVA 4R7GA 1JZQA 4TTRA 1UMKA 5BUCA 3T9EA 3OLWA 2YFHA 4JI2M 5E7JA 1KSJA 4FFSA 3RRNA 1IL0A 1I9GA 1WMEA 3H1PA 4Q5IA 4Q7MB 3X1MA 4DA0A 3MBOA 3OFVA 4IY1A 1KYZA 3WXBA 1ISGA 1LPOA 1XA0A 1U28C 2ONKA 3PFGA 5CRIA 2CLHB 5GGYA 4AY5A 4FS3A 5KQLA 4FWTA 1OX5A 4AMBA 3J81A 1I5RA 5LXTB 5HP4A 4YV1A 4JXKA 4LCJA 1QQ5A 2BEJA 1OH7A 5CVTA 1F0KA 1KAOA 1NW3A 1PJBA 3JR5A 2I1WA 3IJRA 3WDMA 1V95A 2V0CA 2H7VA 1N33M 5G0SA 2QU8A 1EVQA 3MOIA 1E0DA 2MJ5B 3H5AA 1YS6A 2YICA 1OU4A 3WOHA 2NO7A 3KT8A 3LD9A 3U56A 3IKMB 5DF1A 3QKUA 1SCQA 2VL7A 1MZPA 4BHTA