4LJ5A

Clpb nbd2 from t. thermophilus in complex with adp
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
331
structure length
320
Chain Sequence
MEVTEEDIAEIVSRWTGIPVSKLLEKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLILEGLQKGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGLVFAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Chaperone protein ClpB
publication title Elements in nucleotide sensing and hydrolysis of the AAA+ disaggregation machine ClpB: a structure-based mechanistic dissection of a molecular motor
pubmed doi rcsb
source organism Thermus thermophilus
total genus 97
structure length 320
sequence length 331
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lj5A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4lj5A01
2KJQA 3O8BA 2RGBA 4DSNA 2V6ZM 1QBKC 3SJBA 4A36A 4TYWA 3VR6A 4U02A 3V4FA 4QHSA 2OBLA 2JJ2A 2AD5A 2WJYA 1P7CA 5CIWA 1E94E 1GKYA 3VNUA 4MH0R 1GOTA 1P3JA 3LW7A 1R10A 3P27A 2ZAMA 2BMFA 1R4AA 4JMPA 5AWFC 3SBDA 3SR0A 4BEBA 1W5TA 4PC6A 3TAHA 2W0MA 2ZRAA 1XDBA 2RGGA 2DWOA 2XZOA 4HZIA 3KKOA 1E2KA 2FNAA 3U60B 4WBSA 6Q21A 5HKKD 4D81A 1F5NA 2YKGA 1ZM7A 2DWPA 3FFBA 5GJVC 1ZJ6A 1SQ5A 1MH1A 2AXNA 4BLPA 3F5FA 2J0UB 1GRNA 3BH6A 3AP2A 1FZQA 3WNDA 5JSZB 4XOIA 1K5DA 3U61B 1KDPA 4IFBA 2GF0A 1GNQA 5DNYB 3K0CC 1X86B 3AJIB 3OFND 3LLMA 2FFAA 2QTFA 3W8NA 1DAKA 1KMHA 1JR3A 3D8BA 4OQFA 2IX3A 2KWIA 4DB4A 2GAOA 3IILA 3PG5A 5AUPB 4GMXA 2ZITA 3AKCA 4BQSA 3VU9A 2NO1A 5JFGA 1RW4A 1YJ5A 4A8JC 4DLTA 2WWWA 3THYA 5FPKA 1F2TB 4KFTA 3BE4A 4J0QA 5F9FA 2OCBA 3AVQA 1IJFA 1UKVY 1WRBA 2WWGA 1G64A 2BHRA 1A4RA 4DUGA 5J47A 1XPOA 5KNBA 4JL8A 3WRYC 3MGCA 1R8SA 1XTIA 5FPTA 1HA3A 2B8TA 4CDGA 2LKCA 5GJBA 3QJYA 1YRBA 1NP6A 5B57C 4WW0A 3F8TA 4LI0A 3K0AA 3OE7A 5AJYA 2IYUA 4KHZA 3SJAA 2JIZA 4WAUA 2F6RA 4LK2A 5C2JB 5AJVB 2QP9X 5JWOA 1TUEA 4TL6A 1E3MA 2VSFA 3U2QA 3IHLA 4DEXA 1YKSA 2EW1A 4US1R 4UNPA 3EIHA 2QROA 2ZI7A 4QBIA 4FWIB 5AJZA 3WP0A 2GJ9A 4OQNA 4IXNA 4QM6A 4NKRA 1A82A 1AIPA 1T5LA 1FFHA 2VP2A 4XSHA 4O0MA 4R71A 3LD9A 4DCUA 5FI1B 3FMPB 5DIFA 3GLFE 1LF0A 2F9MA 3FMIA 4POAA 4P0TA 2ZETA 2VP9A 4UXJA 4D80A 1CR2A 1F6BA 2FX3A 3GLHE 2QRNA 2H5EA 1KK0A 1XTRA 2YNMA 3H86A 3X1DA 3ZZUA 4Y0VA 4HUQB 1IN8A 3QUSA 2QG6A 4BFTA 3LDAA 2OLJA 1KZ7B 2AXPA 4DDWA 4MKGA 1LV7A 3E2IA 2REBA 4FCVA 1YR9A 3AGQA 3NBXX 2VP0A 2OHFA 4MA4A 3OF5A 4A82A 4AYXA 4B75A 1XD8A 4JSYA 5F3WB 1J99A 1QDEA 4P4SB 3GCGA 3AKDA 4IW3B 4HAVA 5CITA 3HP1A 4JLOA 4PPFA 3PXGA 1MABB 3Q3JB 2WPDA 4MGKR 4QGFA 1W48A 3GEIA 1VKJA 2JIZD 4LSGA 4ACAA 4I1OA 3SBEA 5IF9A 5K8IA 1HE1C 1ZNWA 1K8RA 1B23P 1XZQA 3K0FB 1ZUNB 5FH9A 5FTNA 4OJQA 2VEDA 2ZSBA 3NC1C 3KUDA 3FMFA 1US8B 3MSXA 1WE2A 1G5RA 3GLIB 2EFCB 1QHSA 4DLRA 4XVRA 5EUMA 3Q8XB 2GXUA 1DTSA 2HJGA 1OH6A 1XMVA 3AVPA 3GJ7A 1NN1A 1E1RA 1XTJA 1UADA 2BKUA 1KYIA 2GILA 1II8A 2HV8A 3DMDA 4LHXA 1AKYA 2J59A 1KDTA 1SVWA 2NO6A 1NY6A 2JDID 1Z0FA 4O2RA 1JPNA 3PENA 3TSZA 2WIBA 4LOAA 1D5CA 2NIPA 4EPVA 4QBHA 5IHPA 3OAAA 1KDOA 2FA9A 2FSFA 4NCNA 4ZPXA 4KO8A 3FKSA 3AP3A 3CRRA 1R0ZA 3NDBB 3QE0A 3EC2A 1IM2A 2XJ9A 4DDTA 2P67A 3RAPR 2C78A 3DOFA 4PX9A 4D6PA 4F38A 1N6RA 3FDIA 1VYVA 1MO6A 5G3YA 2WWFA 1VTKA 5JZVA 2QBYA 2PEZA 4WZBE 3ZLJA 1OJLA 4NYMR 1LTQA 2GXSA 3ICEA 2PZEA 2WWXA 3ZD7A 2WICA 2R6GA 4LBWA 4TMVA 2IYYA 4NBSA 4TWZA 3L43A 4B47A 2ORVA 2WJHA 1OFHA 4RKFA 4P33A 1PZNA 2OESA 4TLBA 2MMGA 4Q9JA 2VYFA 3WMEA 2CHQA 5EP3A 2OBNA 4YC7A 4RFSA 2JEOA 2F1HA 2FPMA 4P4UA 3T35A 4B3DA 2AX4A 3SYKA 1UKYA 3IUYA 3EARA 3A8TA 2E1RA 1KHTA 1CJTC 4YQFA 4I4LA 1JXOA 4GP7A 1S2MA 1VMAA 4Q4JA 1KI8A 1TEVA 3TUJC 5UKDA 4AURA 4X8OA 3ADCA 2X2EA 5H70A 4LYHA 8OHMA 3F3YA 1G19A 1ZNZA 1XB2A 1Q20A 2HYDA 4LRWA 5KYKA 1GRQA 1KO7A 2QEQA 2ZS7A 3HPQA 4NMMA 3O8CA 2ZTSA 3U3JA 4LWZA 3QI2A 1WDTA 4DZZA 1JI0A 4G5SA 2JA1A 2QI9C 4KVAA 4L16A 4TTPA 5AUOB 5KUTA 1KI6B 3SOPA 1E9BA 5JRZA 4DC9A 5J4LA 3RS7A 3MAAC 4LC1A 5KNDA 1TL7C 4M8NE 1NBME 2BC9A 3I92A 1M74A 4M1SA 1XTKA 2DBYA 5DE3A 1YZNA 1AZSC 1P2TA 2YC4C 4ZDWA 4C3ZA 1Z3IX 3HYTA 4X8HA 5FL3A 2CJWA 4LC0A 3AF4A 5B30A 1JAIA 4Q7JB 5C18A 2G3YA 3HJNA 4OHYA 5G53C 2QAGA 2W83A 4X8LA 2EVWX 2XGJA 1TTTA 2XSZA 1HY3A 2ZSAA 3IKJA 421PA 5M04A 2ANBA 2JLUA 2O8BA 4ILEA 3NVAA 2OUKA 1Z2CA 3F0TA 1LW7A 3LX5A 4DDVA 1S9DA 2MMCA 1U9IC 3DKVA 3DDCA 1Q1ZA 2CDNA 3Q72A 5HTKA 1GZSA 2A9KA 4E5UA 4PSKA 3DZ8A 3I62A 4MITA 4P4TA 5FI0B 1NMXA 2JGNA 1XTSA 1R5NA 3ASYA 1WA5A 1CLUA 5JS8A 2CL6X 2V9PA 2OCAA 1R0YA 3PUYA 1ZUIA 1ZCAA 2VHTA 2J0SA 1W4BA 4M2LA 3AF3A 3CUEF 4NPHA 1U0LA 5FOWA 1EX6A 2JLXA 3QKRA 2PJZA 1CU1A 5DO9A 5EXPA 3CWZA 4A92A 1ZC4A 1N25A 3NBFA 4DSTA 3WYFA 2DY1A 2C9CA 1M8PA 1KAOA 3FGNA 1IY2A 1Q1QA 5FBRB 3T5GA 1FMJA 3W6PA 2NGRA 4PZYA 3AQ4A 1QHGA 4QGGA 4RD0A 1VIYA 4MUBA 5C4MA 4LJ8A 3CKLA 5KSOA 1VG9B 2X8AA 5FUVA 4OQMA 1N6KA 4E03A 2O8FB 2R6AA 3EA5A 1Y3AA 3E5HA 5DYIA 2B21A 4EPWA 3GLIE 5B58C 1E4VA 2CK3A 1EGAA 1FL9A 1RIFA 3EZFA 4WOPA 4EPRA 3ZVRA 1Z6YA 1KO1A 3CNLA 3L0OA 4TL8A 3WHKA 2IWHA 1KKMA 2IS2A 1G6HA 1RFLA 2QPTA 1RPZA 1PLLA 3I32A 3RWMB 4B73A 4HLQB 1SKYB 1ZBDA 1GTVA 4PC1A 1R5BA 3B82A 1E2JA 4B71A 1E9EA 4A0RA 2WJJA 3B1WA 3C16C 3B85A 3ZS9A 4IOJA 4HLUA 5SZHB 1QHHA 2DFLA 1Q57A 1SZPA 1NLFA 1SVIA 3GJ5A 5A5GA 2OSBA 2W6JD 3TMKA 3WNCA 1JXMA 2QGNA 4B34A 4IDPA 1T3SA 1XNJA 2AK2A 5JCZA 1IXSB 3A1SA 1HYQA 1OFUX 5GADl 4D0GA 3DOEA 4NCIA 3B8HA 1QVRA 4O25A 1Q44A 2QUZA 3TUIC 1G3UA 1FQKA 1W4RA 1OH8A 4Q7KA 1XJ0A 3GEEA 3THXA 1EFHA 4R7ZA 4KVGA 2OCPA 3CPJB 3K70C 3EPHA 2ZSDA 2J9RA 4EPYA 3LAWA 3G82C 1M2OB 4AIIA 1D2NA 4AKGA 1UFQA 4A6XA 3V4RA 1X3SA 3M0EA 4Z54A 3REFA 4HAWA 1W44A 4AD8A 3V00A 2CK3D 4WXRA 5A0FA 4Q01A 3ZVNA 1Z5ZA 2JJ1D 4D26A 1Z22A 4Q48A 1XCPA 2QORA 2BMDA 1XBTA 3UIEA 4HLDA 2ZJ2A 1W4CA 4NU0A 3TVDA 3P4XA 2A2ZA 4M4SA 2X2FA 4BWYA 4JKYA 3R9XA 2WAYA 1JECA 1RYFA 2QMEA 3MWKA 4NCHA 4TLDA 2A5FA 5BW8A 1G5TA 2ZJYA 3P1JA 3LRPA 1P2SA 4TSFA 4XIGS 5TXGA 3L82B 5TV2A 2ZR7A 2DFNA 1TX4B 4YMTA 1YR7A 1KO8A 4TL9A 2DR3A 1RE0A 2GVZC 3LXRA 2F55A 4CEHA 3K0AB 3K0EA 3P4YA 3WXMA 4A0HA 2JLQA 5L3QB 4FMCF 1VG8A 4KITB 4FD2A 1E0JA 4FW9A 3AH8A 3JVUA 3THWB 3P32A 3PUXA 4KLZA 2GCOA 5DH9A 2ZJ8A 4ARZA 4KYUA 4BLOA 3GJ4A 2Q3HA 1XX6A 2C03A 1DELA 3DMNA 3KTAB 3GP8A 5GVSA 2Q21A 3OEED 4JYBA 5DISB 1HEIA 1KY3A 5JS7A 1G7SA 4QBFA 2A5GA 2NQ2C 3NG1A 4JL5A 3KX2A 4P3YA 3TW4A 1NN5A 1CJUC 3DM5A 4JJKA 4KBFA 3AV0B 3CM0A 3GJXC 4JLJA 4QRHA 2P6UA 2O8DA 2QAGC 2DZOB 5FBVB 1DS6A 5BN4A 2R8RA 2RH5A 3MMPA 2CVHA 1C1YA 3DL0A 2Z6VA 1ESMA 1L4UA 2GZHA 3GJ0A 1A1VA 3OEHD 3EC1A 3AGPA 2YV5A 4TLAA 1W46A 4D25A 3NTUA 5CDFE 3N70A 4V0LA 1UDXA 1YZKA 1S9HA 4OI2A 3U7FB 5DGXA 4MYHA 4GOKA 1DO0A 4UNQA 1TPZA 3NDPA 4E09A 1QHNA 1HURA 3EZ6A 4OI0A 3CX7A 2FE4A 2NMVA 1PLKA 4GOJA 2VF7A 1TF7A 1KY2A 1CEEA 1H8HD 3CPHA 2WSMA 4AI6A 1XD2B 4KBGA 3IEVA 1XFAA 2ZE5A 1UPTA 3UANA 2F3TA 2OCYC 5IT5A 5L3SA 3P20A 1BYIA 2G1KA 4C0JA 4MGIR 4ZKEA 2XTMA 2QAJA 5EE5B 5EUQB 2HT6A 4OQLA 5FR2A 2HCJB 4M9XA 4Q1DA 1II8B 4BLQA 1E1QD 3H0KA 2P65A 3QKSA 5HZKA 4F7WA 3RLFA 2HT1A 4HAXA 3VKGA 1N2CE 2MSEB 1ZC3A 2IK8A 1E9SA 3B5JA 2Q0HA 3PJRA 4L9SA 4Q4HA 2VA8A 2QQEA 3I61A 3CX8A 1GG2A 3U7EB 2GEUA 4PANA 5F9HA 1CJMA 3FE2A 3BFKA 2BKEA 2WWIA 2XXAA 4ZI3A 4CT5A 3LLUA 1IONA 4CW7A 2UZ3A 3HU1A 1CF4A 4QL3A 3ZYCA 5EE3A 3ZVLA 5E7IA 1KK3A 2N42A 4H9GA 4HLUC 2ZRKA 3LBIA 3K70B 1U0HC 1OXUA 1XEWY 2AWOA 3B1VA 2JLZA 3KQNA 4MRRA 2QMUA 1SXJD 3CW2A 4JN6A 4A2QA 5LB4A 1N3BA 1TU3A 3AF0A 3GLHB 4JYCA 1U8ZA 3KKNA 1XEXB 4UXIA 1SVKA 2JAQA 3C41J 1U0JA 3SFVA 3BBPA 4RFSB 4Q9IA 2CVFA 2B7CA 3IQWA 2W0SA 1VECA 3C14C 4W5JA 1NJGA 1XCMA 1YZUA 4RKEA 5KHOC 1JEDA 2EYQA 3CF6R 4GI7A 2GCPA 4JLBA 3Q7PA 1OIWA 3LWNA 1HE8B 2XX3A 4M9SA 5IK2D 1YR6A 2AWNA 3I5XA 3X1YA 1JR3E 2XOKD 3QXJA 5EXXA 2WSSD 1P62B 2GZDA 5HKKA 4TTRA 4E22A 3CH5A 1R8QA 3O47A 3FVQA 1VG1A 5HCNA 1HH4A 3M1IA 1EFUA 4LGMA 1SGWA 3ADBA 5DI9A 3MUFA 1L8QA 4Q03A 4MYCA 4A9AA 1EFRD 3CBQA 4ZDIA 3A1UA 1QZMA 4YLGA 2OO7A 2NTYC 4M0LA 2VLIA 3WMGA 4AC9A 4AWXA 3IIMA 4DWJA 3MWLA 1U98A 2OV2A 3IPYA 2IC5A 1O3YA 3I3SR 3OFNA 2J1LA 2WKQA 2ZSFA 3QXSA 4RCZA 2GVDC 3T5DA 4IEIA 4TQUS 2BEJA 2IUSA 1BO6A 1R6BX 2W58A 3MLEA 3RANA 3EWSA 5E4FA 2O8CA 1KNXA 3KZ1E 5D3MA 5JJKA 1Q12A 4TLCA 4RFVA 2O0HA 3EZ2A 3QKUA 2IXEA 4YMWA 5HZHA 5E7MA 4WZAE 2ZI4A 5DHAA 4A0FA 5J5CA 1VHLA 5P21A 1QG4A 2IS1A 3X1WA 3I1FA 4PO9A 3U44A 3T1QA 2XJ4A 4BEJA 4OI4A 1SVMA 3IO3A 3VHXA 1DBSA 1E0SA 1DAGA 5KDLA 2ONKA 4U5XA 3A1WA 2Q9CA 3O8DA 4TN1A 4UNNA 2PMDA 3HR7A 2W00A 2XZPA 3BB1A 3ZVMA 3PEWA 1YZLA 4LV8B 1ZNXA 1GAJA 3WHLA 4U7DA 1CR0A 4LHZA 5LD2C 2H8KA 4GOXA 4BZXA 2G77B 2GESA 1XJCA 1Z6AA 3GJ3A 2IYWA 3K9GA 1TEXA 4G0NA 3HR8A 3TR0A 3NH9A 2QTVB 2ZJBA 4ZKDA 3KKPA 1TU4A 1G16A 2EFDB 4PQYA 3NEYA 1M34E 1W47A 1YZQA 3D3QA 2IF0A 3CWQA 3SYNA 1D6JA 4LZZA 1OXTA 1ZM3A 4LCBA 2Q6TA 4PSVA 3Q5EA 4TLEA 5G3ZA 3U7HB 2V3CC 1NKSA 5FL7D 2P5TB 3AM1A 4D4MA 4NYIQ 4QKQA 1R7RA 1E79D 1R2QA 4QJ4A 4BPBA 1MO5A 5C46F 4CVNA 4HSEA 5HR5A 2XNDD 2ZE7A 3LFUA 4EUNA 5CK4A 5BN3A 5DYGA 4BRWA 4D0LB 4GSYA 4XJXA 3HDTA 4GPTA 1KJWA 2R2AA 4HDQB 3VKWA 3PCRB 3RS3A 4R98A 2Z0MA 1COWD 5TDHA 4GRAA 2R6FA 5DLQC 5F98A 4N1AA 1QG2A 1RRFA 5FTJA 1U90A 2AD1A 4ZCIA 4BZPA 2C98A 2BM0A 5EE9A 1LNZA 2QM7A 2AFIE 4Z8XA 3HU2A 2EWWA 1N6PA 3MRSA 3K53A 2C77A 4ESVA 3PFIA 1VDZA 1U99A 1CXZA 2CLSA 4HZUB 4YDHB 3LBHA 2BDTA 3RS2A 4JZKA 2LCFA 1UEJA 3DPUA 1PVOA 4XD7D 2VBCA 2VF8A 1T91A 4XWAA 1E4YA 1CR1A 2DCUA 3CZPA 4NE2A 3TAUA 4EFNA 4JLVA 3PR1A 3WBJA 2FH5B 4QOSA 2JLSA 3IHWA 1DVRA 1U9IA 4URUR 4FI3C 221PA 4JL6A 4YMUA 4HB0A 1YU9A 5KNCA 1ZRHA 2J3EA 5LBIA 2C8VA 4KFUA 2JLYA 3Q9LA 3GLGA 2BM1A 1OB2A 1OIXA 1VHTA 1Q3HA 2JDIA 1IN4A 1YR8A 2VIIA 1LS6A 2YC2C 4XH9B 1OKKD 3Q5DA 4F93B 1KI3A 4RZUA 4W7SA 1KI1A 1MR3F 4O3MA 4ZDJA 4CEJB 4JLAA 3E70C 4LJ7A 1SULA 2J0VA 2CEAA 2J87A 4S35A 4F4JA 1W36B 2VH5R 2C04A 2YVUA 5H8WA 4B3FX 1UF9A 2P6NA 4Z8YA 2GJ8A 1HT1E 3HU3A 1TF2A 2GXQA 4ZIRB 4G01B 1TMKA 1XPRA 1NVUQ 3KKMA 5L3RA 1SVLA 3UWKA 1E9CA 4QJ5A 1FQJA 3RWOA 521PA 2QGZA 3FHCB 1N6IA 2GETA 4NP6A 2FWRA 4LBZA 3ZH9B 4M1YA 1JALA 3KL4A 3RSOA 2OXCA 2WOOA 4PO8A 3U4QB 4LHVA 4JJZA 1P9NA 3NBYC 3TR5A 1Q21A 4TT3D 2DHRA 1GM5A 3ICQB 2OLKA 2OILA 3CB4A 3TSOA 1NN0A 4A0GA 1XZPA 3Q7QA 4LHYA 5BN5A 1OF1A 2OXRA 1E2EA 1KSFX 1C9KA 1F48A 2CCGA 1G5PA 2OFXA 2B7BA 2CCJA 3GJ8A 2O5VA 3NH6A 2H1LA 2YWEA 5JI3E 2FZ4A 5E3HA 3LX8A 2QP4A 2RCNA 4LJYA 1YQTA 2ZI9A 2D62A 3ONWA 3IIJA 4ARZB 3NBZC 3O8RA 1IY1A 4NCKA 5EZ6B 1Z6TA 1II0A 1T0JB 1ZM2A 2FG5A 2NOAA 4HAUA 3SU8A 2WTUA 4M1OA 1G3MA 3SJZA 2F43B 1HV8A 1X8LA 4CEIB 4C4PA 1UBFA 1M1YE 3ADDA 4ZO4A 4A4DA 4R2IA 4GZMA 1FNMA 1J7KA 1ZAKA 3MHVC 4PO1A 1DO2A 1SKQA 1KDRA 4PHTA 3C5HA 4HAZA 5KPDA 1G7TA 1HUQA 3P26A 2IYSA 4HI0E 4PC3A 4MKIA 4OK6A 3L8YA 2ZROA 3BERA 4MKFA 4DT1B 1NIPA 1DEKA 5B2ZA 4BECA 4RD2A 2CL0X 1BIFA 3GJ6A 1QHIA 1UKZA 4FMCB 4IEEA 1HQYE 1UM8A 2GK6A 3UKDA 2ZI3A 2ZVPX 3IPXA 4TL7A 1M7HA 1KKLA 2W2VA 2ZJOA 4ON9A 5CLLA 3VTKA 3LY5A 1XMIA 2K5UA 1AA9A 4Q00A 3PITA 1AZTA 1KO4A 1JQJC 3U6BA 1KI7A 1P75A 1E2FA 1T3HA 4KV9A 5AJXA 4A8JB 4ZV4A 3WMFA 2FOLA 3U3KA 5SZIA 2PJRA 3DZDA 4LHWA 1FOEB 1QRAA 3LH5A 1A7JA 1T9HA 1Z0IA 5FTLA 4PZLA 3AVVA 1XXHA 2RHMA 2ANCA 3QXCA 4PC7A 4MDEA 5EP4A 1G7RA 2CBZA 4M9ZA 3PUZA 3UWOA 1X37A 2IYLD 4EAQA 4F91B 1OPXA 2OE2A 2HJVA 2G0NA 3SDZA 1Z47A 3DM9B 1WF3A 2G9NA 3CRW1 121PA 1F2UB 5AUQA 4LV6A 4LYFA 4URYR 1S3SA 2AL7A 1AS2A 4Z1MD 2O0KA 3QVVA 2IBMA 2PL3A 3UMSA 2WVJA 1KSHA 2ZQ5A 1UBCA 2EFHB 1KAGA 4Q4HB 2PLRA 2Y8EA 1NG1A 2REOA 3U7GA 2A5YB 1Z0JA 4N3NA 4HB2A 2O8EA 1GUAA 3T1VA 1X8JA 4AYTA 4EJSC 1Z0DA 1EWQA 3EIEA 1W0JA 3FOZA 2VO1A 2GJAA 4XVUA 3I72A 3X1XA 2BJVA 3KJHA 1EX7A 1NKTA 2ZIAA 3WYGA 1L4YA 2NPIA 3HWSA 1E2DA 2ZJAA 1G20E 1F60A 3AVXA 4V02A 2CHGA 1MV5A 1HTWA 3U6KA 3BIFA 3K9NA 5BWMA 1M6NA 3SN6A 1ZD9A 1RJ9A 3C5CA 1NVVR 4EPTA 5LPNA 3AUXA 1K5GA 4D4LA 1Z07A 1KK2A 2F1JA 1CULC 1XRJA 2IUTA 3TVTA 4PR0A 1BKDR 3W3AA 1KSJA 2W6JA 4P31A 3OIUA 4ASUA 5FOXA 1E6CA 2EU8A 4C0AC 3TQCA 3GPLA 4R9UC 3CF2A 4CF7A 5BQ5A 1CIPA 3RC8A 1L7VC 3K8YA 3QF4A 4OI1A 3KQKA 1Z6GA 3BH0A 2ZM5A 2CE7A 2REXB 2L0XA 2X77A 5JHHB 1AM4D 1ESNA 2GK7A 3OZXA 5EJEA 2EWVA 1JQLB 1AS0A 1AGRA 2RHDA 1OT3A 4XTCS 1TQ4A 1AQYA 2ERYA 1V5WA 4TMWA 2VP4A 4FINA 4BASA 1G9XA 1ZP6A 1E2GA 2BBTA 5IDVA 2QZ4A 5CIQA 4G5OA 4EFLA 3A4NA 1NL3A 1TNDA 2QRZA 4HAYA 1XEWX 2FU5C 4B33A 2J0UA 2J7PD 5FUXA 3QNUA 3UK6A 1ZVQA 5JSZA 2H92A 1W0JD 1Z0AA 2FZLA 2UKDA 3OESA 2QENA 4S2EA 5H1YA 1JR6A 2IYZA 4RZXA 4NYMQ 4YMVA 5AR1A 4N0EA 3KDSE 3I8SA 4B74A 3IO5A 4OKSA 3U3MA 2JJ1A 2VHUA 5D3QA 2BBWA 1IQPA 3UG7A 2X19A 3ZJYA 3GFOA 1P9WA 1NNEA 2ASEA 2QL6A 4JVSB 2VHJA 1GRRA 4NTZA 4ZDKA 1XEFA 5CJ2A 2J7KA 1U8YA 3VR3A 4DDUA 2XITA 2ZRIA 4Q7LA 3U44B 4BZQA 1VCNA 3FWYA 3RRNA 4HLCA 1Z29A 3AVUA 1F2TA 2ZRPA 4A2PA 2RGDA 5G40A 1VCMA 5FOUA 4ASUD 3IGFA 1CP2A 1JJ7A 3TKLA 3BB3A 4KAXA 3RYTC 1ZIPA 3IIKA 4YMSA 2GHIA 3N5CA 3W34A 5AK0A 4DLZA 4RY2A 3VFDA 4FWHA 5CLQA 4L8GA 2B92A 5JWRA 2YOFA 1Z83A 2NG1A 2IYTA 2FGKA 4JLMA 3CONA 1WBBA 2C99A 2WIAA 1FMLA 4RCYA 1R0WA 2HF9A 2GKSA 2YWHA 1ZD8A 3LW8A 4ZI2A 1YZGA 3OEEA 2IYXA 2BVNA 4PXAA 4TYPA 3AVWA 2GZAA 4L4UA 3BFVA 4LPKA 2CLDX 1DE0A 4BE7B 1M7GA 5A4JA 1II9A 4FXPA 4HATA 2A5JA 5FTMA 1OFIA 2IWRA 1OXVA 2FSHA 1KMHB 3ASZA 1RRCA 1MKYA 3PUVA 1EESA 4JLDA 3LQRA 2WV9A 3MJHA 1U2RA 4ACBA 2Q9AA 4BFZA 1CJVC 1TQ2A 3MG9A 3ZD6A 3BFXA 4DIEA 2OG2A 4FIDA 3UXMA 3VU9B 1U81A 1IN6A 3JZMA 1DAHA 3THYB 4QBGB 1KO5A 1P72A 4Q1FA 3SE0A 2BBSA 3TW8B 3BWDD 1I2DA 3OEHA 3SFZA 1IXZA 2D7DA 4HUQA 2DZNB 4QG7A 1OE0A 2CXXA 5TB5A 4N0DA 1ZUHA 1E9AA 4A15A 3IEUA 2ZANA 2A78A 1G6OA 1MRSA 2E9SA 3U5ZB 1BYUA 4EIWA 4Q1AA 2CLCX 1Z6XA 5JJIA 2F1RA 1N6NA 2ZEJA 3VQTA 1CRQA 1VIAA 3WYAA 3EPJA 1H8HA 1NBMD 4V0OA 5KSPA 2J0QA 2AHOA 2RGNA 1MABA 4IDNA 5CYOA 5JWHA 2V1XA 2KI5A 3QG5A 3GFTA 2ZYUX 1IY0A 2BMEA 3G0HA 3K0FA 1XMJA 1QZXA 3SQWA 1EXMA 4GBMA 1E2IA 1US8A 2VL7A 3TJZA 3GLIA 3T12A 2ORIA 4E07A 1S4QA 2VSXA 4IVPA 1Q0UA 5GJWC 3GLGB 1E1QA 2ZYTX 4TZ6A 1PUIA 2D2EA 3EASA 2FEMA 2VRWA 3MCAA 2YOGA 4GP6A 2CMKA 4XWKA 4O2LA 4G3XA 2DYKA 4MGZR 4PPQA 1P9RA 2IW3A 5L8VA 2I4IA 3KFXA 2DFTA 1H8ED 2FSGA 1IJEA 1GP2A 2C5LA 3K1JA 2IT1A 2ZREA 3KW6A 1BMFD 2FSIA 3FHOA 2QSZA 1RRGA 4TYQA 821PA 2FPLA 2VHCA 2BOVA 3IQXA 2KRKA 4KLNA 1ZU4A 5E7JA 2PMKA 1W2HA 1JBKA 4X8MA 2ZJZA 5JECA 2ZYVX 4DXAA 2J5XA 2ZUBA 3AEZA 3LA6A 4I1SA 1SXJA 4Q5IA 1OYYA 4H1UA 1NLZA 3B9PA 1CR4A 2ORWA 3VHLB 5K8LA 4PHGA 1EFTA 4MDFA 4Q19A 1E2QA 2J41A 1KOFA 2FPKA 4LYAA 3AVYA 1P2UA 2FEOA 1ELOA 3ND8A 3UMRA 2GA8A 1T6NA 2WM9B 3T34A 3CZQA 1FP7A 1LVGA 4Y0AA 1RYHA 4G5GA 4BRUA 1H65A 5IK2A 3VKHA 3QENA 3SYLA 1A2KC 2IEYA 3ZZTA 3VR5A 3BXZA 2XOKA 4M1MA 2OT3B 2MSCB 2F9LA 4KSCA 2WSSA 4DLVA 1UJ2A 2Z4RA 2ODEA 2ZVQX 1EK0A 1Z06A 2ZXUA 1G3QA 2DPXA 1OH7A 2CCKA 1N6HA 2WKRA 1ANKA 2ZYWX 3ZS8A 1E9FA 3S1AA 1EFRA 3WY9A 3SI7A 3L0PA 2AKAB 3CX6A 3AF2A 3AKYA 3GD7A 4Q9KA 3R8FA 4Z51A 4B48A 3K0SA 3M6AA 2Z43A 3KXKA 3PIRA 4KFRA 5KOYA 2QMHA 4OHVA 2QBYB 4IDOA 2FV8A 1XD9A 5DI3A 5ANRB 4D82A 1KI6A 1S0UA 5BXQC 3ZIAD 2IUUA 2V7QD 1CJKC 1GL9B 2IL1A 4LY6A 1X6VA 3ZQJA 4US2R 3CO5A 1IOZA 2PZFA 2R6CA 4BFWA 4EQ6A 1LY1A 4HB4A 4PAMA 2ECKA 4V0MA 1E9DA 3OIWA 1GSIA 3AB3A 2Q9BA 5FTKA 1GVNB 1GIAA 3BAFA 1XMSA 2GCNA 3A4MA 3UATA 4JBYA 4B3XA 1RVDA 3NIBA 2QNRA 5KTYA 2QU8A 4MQBA 2D4HA 4QGAA 4RZ3A 4B6FA 2JLVA 4M1TA 5FPYA 4RD1A 2HLDD 3LXXA 4KXFB 5JMTA 4AY2A 1XXHB 1E98A 4Q4JB 2QMOA 5DN6D 1LS1A 2FMXA 2QA5A 2BJWA 2KB0A 1E2PA 4AYWA 3B6EA 4FMBB 1OXXK 5EE0A 4PAOA 4PHFA 1MO3A 2NZ8A 3W8RA 1R0XA 2WMOB 3PEUA 2ZSEA 3R20A 5DSZA 1AN0A 3HYRA 3IBYA 1ZW6A 3VLFB 4B3GA 3PEYA 2WJIA 3SNHA 3U3RA 3D31A 1W0KD 4BFXA 2UZIR 5JEEA 1NI3A 1P61B 1Z0KA 3PQCA 3TH5A 4Q4AA 4BFUA 2R62A 3D6TB 3OIVA 4M9QA 5FL7A 4URZR 5ELXA 2C9YA 2NZJA 1E2MA 1I4LD 1E79A 3BORA 3FFAA 621PA 3TE6A 4L9WA 2P5SA 4A3VB 4A6PA 2V4ZA 5FOTA 1T3LA 1OV4A 1Q3TA 1J2JA 1JPJA 2XNDA 2CJWB 3LVQE 2HXSA 4MYTA 2CNWA 4B2PA 2QPAA 5HE9A 2EFGA 1DARA 1TF5A 2QN6A 3H4MA 3EA0A 1OHHD 3QF7A 1EFCA 2LWIA 2RGNC 5FOVA 2QAGB 2VP6A 1TADA 2O8FA 1COWA 2A3RA 3W3ZB 2O8BB 2JJ8A 1QF9A 3QEJA 4MRSA 3GLGE 1FTSA 5CM9C 2V55B 2ZRFA 1RJ9B 4OJKA 5JBQA 2IHYA 1ODFA 4JLNA 1G8PA 4JLPA 4PPGA 1WCV1 2ZRHA 1E99A 1VYUA 2OAP1 1FPMA 1N6LA 3EZ9A 1XP8A 2QY9A 4B35A 2QTHA 1RZ3A 1YVDA 2I1VB 2NO9A 3Q85A 3QXHA 4OK3A 1P6XA 4LYJA 4XD7A 4DCTA 3CLVA 4NONA 4Q7MB 5FUYA 3WNBA 4FWTA 1ZYUA 4TTQA 1Q1EA 3QF4B 2Q3FA 2X1VA 2GEDA 2VPPA 3A37A 2RAPA 3VR4A 3QKRB 1D8TA 2HUPA 1LFDB 2R44A 3NHAA 1UKEA 2AKYA 2B8WA 4GDFA 3LVRE 5JLJA 4Q66C 1IXRC 3CRVA 2D2FA 5G41A 1OKKA 3SC3A 1SVSA 4B2IA 4DKXA 3QG1A 3RHFA 4KFSA 3ZQ6A 4B3BA 1ETUA 1MO4A 4FMDF 1D9ZA 2D3WA 4I81A 2ZU0C 1SXJC 1GL7A 3RSLA 3KQUA 1W49A 2CNWD 4JT4A 5F2EA 3VMFA 1XF9A 1M7BA 3REGA 4URXR 3SQXA 3SZRA 5EP1A 2XB4A 3W9YA 3VNVA 2V6JA 2I1QA 3TIFA 4AKIA 3RRZA 3T61A 4R2HA 4EJSA 3B13B 4DSOA 4AG6A 1L2TA 2BWJA 1KI9A 2JATA 2WJVA 3ND9A 4GMDA 2FGJA 4IVQA 4JVNA 4TT3A 5BYKA 2ZS8A 1QHHB 3QBTA 3KQLA 4GL2A 4UNRA 2A7QA 4DCNA 4IKEA 4ZCMA 3C15C 2ODNA 3T06B 1VYTA 4LPSA 4II7A 4M53A 3TLXA 3WRXC 4B43A 2JJ2D 4PAQA 3TUZC 2IS6A 4DRZA 3SS8A 3RS5A 1TQDA 3QPVA 1G8GA 2D06A 3R7WA 4CYMA 2H18A 2WHXA 4QC2A 2ZI5A 1J90A 3B7GA 3L0SA 5L3QA 4DSUA 3SHFA 1BH2A 5CB6A 2I3BA 3THWA 1GNPA 2ZRMA 3I5YA 3THXB 1NF3A 3C7KA 2P0EA 4NL4H 1ZINA 1FX0A 4US0R 1E2LA 2QPOA 1GKIA 4W5WA 5L3VA 2VP5A 1J70A 1TAGA 1SHKA 1D9XA 3KTAA 4PFSA 5JEDA 1S3GA 4KSBA 1N5KA 4YONB 1NMZA 2P6RA 3EAQA 4JLKA 4D2IA 1ZD1A 4C7OA 3L0IB 1NMYA 4LV5B 4YDSA 4Q1BA 2ZRDA 2W2TA 1JB1A 1JR3D 1OYWA 1Z63A 1XXHE 4NZYA 3W6NA 1ZMXA 2PCLA 2QE7A 4JVLA 2PZGA 5FPSA 1T8UA 5SZJA 3K9LA 1UBEA 1IN5A 4AG5A 2OAQ1 4XSGA 2DB3A 5KPJA 4QGHA 2GXAA 1KGDA 3CNOA 3PUWA 1PV4A 3NC0C 2H16A 2IYRA 1OIVA 4XWOA 1E0AA 2ERXA 4DUGD 3AF1A 3QPWA 2YJTD 2E87A 3ETLA 4CEHB 3I73A 4BUJA 2ZRGA 3EPLA 1WP9A 1E32A 3M4YA 4IDQA 4TQAA 1XWIA 1EWRA 2ATXA 3N2EA 1IN7A 1E69A 1NY5A 2HDNB 3T1TA 3OE7D 2C2HA 3RS4A 5TMPA 4V0KA 2GCOB 4IDHA 1XD2A 3EXAA 4Q9LA 3KKQA 5TVKA 1N5JA 1X1RA 4MRVA 1BS1A 1P60A 4TQ9A 1UEIA 3J81k 5EQTA 1DADA 1OH5A 4Z1MA 2J46A 2YYZA 4GT1A 5FFMA 4IFEA 4MRPA 5LD2B 3QPUA 3G5UA 2ZR0A 4NHOA 4D4KA 2O52A 1NVXQ 1YHNA 1GL6A 2A5DA 3DO6A 4QHYA 3FTQA 4DLXA 1XCGB 2D7CA 3GMTA 2O8DB 5JCPA 2XTZA 5C4GB 5B64A 4RD6A 2PH1A 3GQBA 1W7AA 5KSYA 4MKHA 4PSAA 4LJ6A 2LKDA 2QE7D 2IS4A 4PQFA 2FFHA 3HPRA 4JBWA 4BFSA 1FP6A 2H57A 2ZU6A 1VCOA 4HEJA 5JRJA 5LDDC 3EG5A 1U8AA 1N6OA 2GDJA 4RSGA 1QHYA 4RJLA 5CK5A 4PHHA 3GFPA 2BMJA 2R65A 5HCIA 1G8HA 2IXGA 1HQCA 2Z83A 3FKQA 3JVVA 2QM8A 1SXJB 1N0VC 2ZUCA 3GLFA 4URVR 5FOSA 4DJTA 4EPXA 2VTKA 4Q02A 5JI2E 2DWQA 2FFBA 1GILA 4M22A 2AK3A 2WPDD 2RKOA 3IDQA 2VSOA 1DAMA 3GLHA 5EXSA 4DEYA 4G1UC 5L3SB 3EWAA 4TYYA 1XEXA 4W9MC 1AS3A 3QXXA 2WBLC 2PBRA 1U94A 1DAEA 1KZGB 4HB3A 4TMZA 2GRJA 1MOZA 3TBKA 2ZAOA 2NO0A 1IBRA 1HT2E 1KJZA 2H17A 2DWZB 3ZDQA 2ZR9A 3QKSB 1E1RD 1JEEA 1IAQA 1PUJA 1Z8FA 4B6EA 1DAIA 1P73A 3DKPA 3S1AB 2JCSA 4IJMA 1A2BA 1T0HB 4I99A 5EP2A 4OBEA 3H1TA 4CT4B 2XXAB 3OAAD 1Q22A 2J7PA 5KDOA 1ZIOA 2CE2X 3PVSA 1N5IA 1W5SA 2GBLA 3D7MA 3FKSD 3GEHA 4PQRA 5FBQB 5SZKB 3EZ7A 3I4LA 4FCWA 2XEXA 4QJ3A 721PA 2PCJA 1G7CA 5DI3B 2WWYA 5J40A 1X8KA 4I1VA 3BH7A 1NLYA 1FW6A 1VG0B 2FN4A 1YRAA 3NHBA 1E2NA 1TQ6A 4AK9A 3K70D 4EFMA 1OXSC 3EX7C 3QOFA 4WIAA 3A6PC 4LJ9A 3QSYA 4CGZA 2QQ0A 4Q47A 1ZM9A 4EQ6B 2ZRBA 1QHXA 3CNNA 2HF8A 1EG7A 4AKEA 2WAXA 3QEOA 3NWJA 1G3IA 1VPLA 4UNSA 1DPFA 4XTRA 4WZ6A 4OQXA 1G21E 4KJZA 3A1TA 3RRYA 2IXFA 3LNCA 1IHUA 3BJIC 1MT0A 3CR7A 5CB8A 3QBVA 2AR7A 2PEYA 3X1ZA 2WOJA 3W90A 3BK7A 1ZM4A 1S1CA 1NVWQ 3LO5A 3KXLA 4TMKA 4TMXA 5GJCA 3X2SA 2N1BA 3BS4A 3EW9A 4PTLA 2BBOA 2A30A 4Q4LA 3KB2A 3RVBA 2YOHA 2G0TA 4PZZA 4RZ2A 1JJVA 1YZTA 4WXPA 4MRNA 3B1XA 1AKEA 2Z5FA 1W4AA 2GWHA 1G8FA 3W6OA 1AQUA 3DEFA 3MJRA 4Q4AB 2XB2A 4LJAA 1GWNA 3VX3A 1XU4A 2G1JA 2YHSA 3KJEA 4NYJR 3LQQA 1J8MF 2R9VA 1P2VA 2VQSA 2O8CB 4GNKA 3NXSA 5D3MB 1CS4C 4MUAA 4OHZA 3B60A 3K9HA 5HPYB 4UQOA 2ZRCA 1Q1BA 4UXHA 2JASA 4Q18A 2Z4SA 5C1BA 3RC3A 4M1WA 1VCIA 1Y63A 2Q3MA 2PT7A 3B1YA 5BYJA 4JT2A 1LF5A 1WQ1R 3NEJA 3WBKA 4IHQA 4QXAA 1CBUA 5FR1A 2BCGY 4TZ0A 2KSQA 1I2MA 3ADKA 4LDJA 4F92B 5AJWA 1AJEA 4C2TA 4C9BA 2B6HA 4LBVA 2V1UA 1OB5A 5J4VA 1ZNYA 4B2LA 4QM7A 4HDCA 4DLSA 3RDPA 1NJFA 2FJUA 5J4KA 1E2HA 3QKTA 2XSZD 1YE8A 4DIDA 2J45A 2MSDB 4OYHA 3OIYA 4QNRA 2IHBA 1Z08A 3FB4A 1GNRA 1NBMA 5EZ5A 1N5LA 4IXMA 3LBNA 1Z28A 4K8OA 1LB1B 4C0QC 4A2WA 4CRWB 2P3SA 3MWYW 3IBGA 4K81B 4LRSA 2GAAA 3C8UA 2ZS9A 3W5IA 4DLUA 1K6MA 2FF7A 4NDZA 2KBEA 4HZUA 2DFKB 3VAAA 1CRPA 2N46A 3KJGA 4D4JA 4QFMA 1E0KA 5TY0A 3NKVA 2QSYA 1FUKA 2G88A 2RB4A 1FNNA 3FPAA 1SVOA 2XAUA 2NPFA 4IOKA 4B32A 2V6IA 1SXJE 4B76A 4C0SA 2W6IA 1OW3B 2OFOA 4Q21A 1D2EA 1B0UA 4LRTA 1KTVA 4XVQA 4CZ2A 4JIMA 3H84A 5EXTA 2AN9A 1NSFA 2ZRNA 3ECCA 3EIQA 5CJPA 1F3OA 1H8EA 4G5QA 4JBXA 2QT1A 5H68A 4M21A 4DBLC 2ZRJA 4CIDA 4CEJA 2P2LA 1ZU5A 4YXWA 2O0JA 5KDDA 1P5ZB 1BMFA 3L8ZA 3B78A 2YINC 4ITRC 1WXQA 5TARA 5EE1A 1NG9A 2ZJ5A 1G17A 4IRUB 3U3OA 3RS0A 5CM8B 4OHWA 4ZIRA 4C2UA 4C0HA 4BLRA 1ZCBA 2OFWA 4NH0A 4P32A 1S1MA 3KB1A 4DCVA 2YWGA 1T4GA 1NVVQ 4EJSB 1RRPA 4B3CA 1G291 1T8TA 1O87A 1UDWA 3AKEA 4P4SA 1RC8A 2GF9A 3TQFA 4C0BA 2OZEA 4JS0A 4DLYA 3K09A 3A36A 2TMKA 3A4LA 3U4QA 4L15A 1W1WA 3KXIA 5KU1A 1W2GA 4OK5A 3ZZ0A 3B2EA 4OHXA 2ZE6A 4GITA 2ODBA 3PV0A 2ONJA 2C95A 4A1FA 2WJGA 1D2MA 4FMDB 1C4OA 3AUYA 3CRMA 5K8UA 4C0KA 1G41A 4L5BA 3BGWA 1KNQA 3R7WB 2RMKA 4FCTA 2C9OA 2R6DA 1V43A 1G4AE 1R5OA 4MGYR 2IA5A 4TYNA 4RVCA 2FDCA 4ABYA 2GBLC 4TMTA 2W6ID 2PX3A 3VX4A 3L2OB 3CRQA 4ERNA 1Z2AA 1FX0B 2XZLA 3JZAA 1NSTA 3R9WA 1KI2A 2F1IA 2FFQA 4V0ME 2QP3A 3RABA 1N0WA 1KMQA 4C0LA 4FWDA 1NN3A 2F43A 1G4UR 4YXWD 1G8YA 4NYJQ 4CEIA 4C7OB 1MRNA 3MFYA 1GFIA 1KSGA 1W36D 4Q1CA 3I8XA 1AGPA 3QIAA 3BRWD 4HUTA 2WZQA 4C30A 1NIJA 1G1MA 2V8OA 2GNOA 3WP1B 3QY0A 2CHVA 3FHTA 3W5JA 2HYIC 2IEZA 2QT0A 3PEVA 2C96A 3V9PA 2G83A 3VR2A 2H7VA 2HEIA 4URWR 3ZIAA 1BOFA 2W2XA 3BOSA 2D74A 3UG6A 2V7QA 2BIFA 4KCGA 4DT1A 3CPEA 1WBDA 1OFTA 2BEKA 2UVQA 5JJLA 3K0CA 3CF0A 2KE5A 4F4CA 4NCJA 4TSFD 2DVWB 2PX0A 5KSZA 2NO7A 4IOMA 5FBWB 1X1SA 3FYHA 1A5TA 4IVRA 1SHZA 1E96A 1QVAA 2OM2A 1E9RA 2HLDA 2RGXA 4W5HA 4A8JA 1JAHA 1DG1G 2ZI6A 1N0UA 4KU4A 2EYUA 1DG3A 3TNFA 4F4IA 5DN6A 1PLJA 1NVMA 2VHQA 3QQ5A 5CYPA 3CR8A 2GJKA 1GITA 2CL7X 2HCBA 5HE8A 1ONBA 5DHFA 4U00A 4LJ5A 2OEPA 3LV8A 3B1ZA 3RRMA 1G3RA 5J4YA 2EQBA 4KYIB 1DOAA 1S96A 1NRJB 2ATVA 3DVLA 5K8TA 2OBMA 1KK1A 1I4DD 2RGEA 3A58B 1W0KA 2ZPTX 4HDOB 2JLRA 3B9QA 4LBYA 3EPKA 1F2UA 4DVGA 4ZCLA 4EDHA 4QHTA 5IRCD 4K46A 3KQHA 4IOLA 2EFEB 4Q9HA 1C1KA 4DCSA 4UJ5A 3CIOA 2G6BA 4PC2A 4G5RA 4D0NA 4ESHA 4BFVA 5AUNB 4BLSA 3AVTA 1S8FA 2YZ2A 4WVFA 1SKYE 3MWJA 3KFVA 3FMOB 4V03A 2KBFA 3KJIA 3ZGXA 1G18A 4GFDA 4NYIR 4DHEA 1OHHA 1RKBA 1J8YF 3N2IA 4V0NA 5KO2A 2GEVA 1TUIA 3AP1A 3H2YA 3SJCA 1KIMA 2BV3A 2ZE8A 2RGAA 4JKIA 2IYQA 1WMSA 5J4HA 3TSWA 2GTPA 2HXYA 1WB9A 4QNMA 4OL0A 4KI0A 5FUWA 3GLFB 1T5IA 2SHKA 3CH4B 1UBGA 1XTQA 3DHWC 4JSTA 4M1KA 2F7SA 3TRFA 1KJYA 1FTNA 4BGDA 1XPUA 1UAAA 4UKDA 2XNSA 2ZUDA 3A1VA 3KUCA 3QVUA 1OSNA 2GJSA 4LJ4A 3SEAA 1GDDA 2AFHE 2WKPA 2JLWA 3TGPA 3UMFA 1P4SA 1CTQA 1FUUA 5E95A 3R9IA 5LB2A 4DLWA 4DB2A 1XJQA 4JVMA 3R8CA 1CKEA 4EKDA 5CDFA 2WMNB 3MD0A 4RD3A 1PJRA 4PPNA 5FPHA 3BC1A 1OLOA 3VR1A 3T15A 3UPUA 5JHGB 3RNLA 4B44A 1W36C 4GZLA 4KODA 4LX0A 2IF2A 1JNYA 3C4JA 4FWGA 3AVOA 3BD9A 4BLTA 1I4TD 4UJ3A 4FN5A 3OHMA 4Q1EA 2O8EB 4H1VA 2XTNA 3TK1A 4AKHA 5GVRA 4WA7A 2V54A 2BCJQ 3SHWA 1GKUB 2PT5A 3K09C 1AK2A 2YWFA 4BFYA 3T1OA 5FBLB 3THOA 4HYYA 2IYVA 2PLFA 3BB4A 3E1SA 2RGCA 4I1UA 1DAFA 4MYUA 1KI4A 4RD4A 4LUCA 2F3RA 2WWHA 2ZRLA 2ODWA
chains in the Genus database with same CATH superfamily
2KJQA 1R4NA 4RZHA 4U02A 1GKYA 5J43A 3DYIA 5I4CA 3TZ6A 1E2KA 6Q21A 2HU8A 4MXDA 3ZHCA 3DTTA 1WVGA 4BLPA 5L4LA 3KWLA 1I30A 5KYNA 2YFQA 5IXJA 4A7PA 5JNWA 4ZP1A 5DNYB 1X86B 4CQMD 3HDJA 4BQFA 4Q3DA 2KWIA 2ZITA 2BYTA 2NO1A 1ORWA 3RTCA 5KB3A 3THYA 3BE5A 1GZDA 4MS4B 2IP2A 1PZXA 2ZJ7A 4J0QA 5F9FA 1BXZA 1R8SA 2FVYA 4QPDA 3C3YA 3OE7A 1WW2A 2IYUA 4LRSB 4A6DA 2JFVA 4RWEA 3MMNA 5AJVB 2EW1A 4US1R 3O9ZA 1T35A 2P9CA 4YI5A 4QM6A 1AIPA 5HIKA 1PE0A 2IZ6A 3EEOA 5DIFA 1F6BA 4YIHA 3S7TA 1XZIA 4FCCA 1PEYA 4DQKA 1YR9A 2VP0A 1M72A 1ZHHA 4BPRA 1WM1A 4LSGA 1QDLB 4OJQA 4NESA 3FMFA 1TZCA 2NTEA 3E7DA 2CB9A 3Q8XB 1A3CA 2GXUA 2PO7A 1RWKA 4JC8A 1FRQA 4YP6A 1I2AA 1RLJA 5IWAM 1XTJA 4LVUA 1NY6A 2ISSD 3TSZA 3UAYA 5CA1A 1DJPA 1PGJA 4O2AB 5ENZA 3O8NA 4DMLA 4D6PA 2ZDGA 3ZX5A 3ZWBA 5LDHA 3L84A 1LTQA 3ICEA 2I62A 1QOQB 3OD1A 3OZTA 3B36A 3HVUA 1Q1AA 2F67A 3G9UA 4QLBA 2OBNA 2P3LA 2W37A 4R1TA 2FPMA 1D03A 4MW4A 4RADA 3MBOA 3TI9A 3WZ2A 3SYKA 3EARA 4GKKM 2YZNA 2BFCA 2GZRA 1S2MA 3C45A 4AURA 4HPJB 1XB2A 3IE2A 4LRWA 4B2YA 1KO7A 2QSUA 1ODLA 3I39X 2QMZA 4YWJA 2ECOA 4DC9A 4ZCQA 1NXVA 5KNDA 1E6UA 1EVZA 2XF3A 3J80A 3ROFA 2YZKA 1XMQM 4XCQA 3HYTA 3ZNNA 5ENVA 1VBMA 5E9QA 3O03A 1G2IA 2CLKB 2OZLB 2YYYA 2HA3A 1WMAA 3IKJA 3UAXA 4G4NA 5HRUA 4DV5M 5G0UA 4CM5A 4YCNA 1AIPC 2CDNA 3KCNA 2NU9B 4DIFA 4X93A 2NW6A 2W9XA 1DTEA 3GA7A 4GLJA 4CKXA 1CFJA 3THGA 5HIMA 4QPZA 1ZEJA 4WESA 3UPDA 4OL9A 4TVBA 4NPHA 4IXTA 1LPBB 2HC9A 3F67A 1EDOA 2JI7A 4OREX 3TDMA 2CP8A 1QHGA 3ENKA 5C4MA 2FQQA 1R4MB 1Y3AA 3TW0A 3S2IA 4QXOA 3DGEC 3EZFA 3I9OA 4DR6B 5FWYB 3RWMB 3A1DA 4GLBA 4WK2B 5EESA 3TTSA 3B82A 1B1CA 4JENA 1QHHA 2DFLA 1J39A 5A5GA 4AQYB 2QGNA 4IDPA 1T6ZA 3DZGA 3V1MA 5E9WA 6GPBA 2FHSA 4YREA 4N18A 4DM3A 3OJCA 2VQEB 3PCTA 2E5FA 4ZICA 3U6CA 4BMDA 4HAWA 4NU8X 4F3CA 2PD6A 4G1EB 3R7BA 4O1HA 3FG9A 1U8XX 3O92A 3AIKA 1USUA 3RUEA 3SLGA 1NQVA 3OU2A 4TWAA 1LK5A 3RV3A 3E5RA 1U8TA 4TL9A 3CYFA 2IZ0A 4D9KA 2JLQA 1KE2A 1O1YA 2M5ZA 4WZAB 2FG7C 2L19A 1NOJA 5FPQA 2O7NA 2Q21A 2OG1A 3OEED 2IKSA 4RIGA 5JS7A 4B84A 4BNLA 4X1OA 3HDYA 3PE3A 1MHTA 2L69A 3P2OA 1TJNA 1NUQA 4YCBA 1DS6A 3MMPA 1C1YA 1ST2A 3R0ZA 3ADPA 5CT6A 3P96A 4V0LA 1FSGA 1DO0A 2WTNA 3MWGA 3NDPA 3QKWA 5D5PA 2HJRA 3RPEA 1IMOA 2ZE5A 4RZIA 3T8YA 2X1MA 4C0JA 5CXQA 5JAPA 2HT6A 4QOFA 4OQLA 2HCJB 4UDXX 4AZ0A 4B1FA 3AV3A 4O29A 1B7GO 3RQIA 4ED9A 2MSEB 2G76A 3B5JA 2NTJA 3KKLA 4PANA 3EPRA 2NNWB 4K6FA 3QVLA 4QL3A 3JD3A 4ZEOA 2YVQA 4GC9A 3E9SA 2XLBA 3NP9A 2JVJA 2HU2A 3GP1A 4ATNA 3Q7TA 1XCMA 2M9MA 1W76A 4M0DA 4DQVA 3W77A 2AWNA 4Z0NA 5EXXA 1SVNA 4H3KB 3TL6A 4NEQA 5DYYA 3ABSB 1O95D 3VGPA 2VLIA 4ZHQF 4BO2A 1O3YA 4O2BB 2O54A 4CKWB 5K1ZA 5H02A 2HJSA 3NTRA 4M55A 4GGOA 2DHYA 2ZI4A 4A0FA 5J5VA 1M1YB 4D3XA 1KFJB 4NVRA 2GCEA 1CUGA 3BHIA 3T1QA 2B1QA 1DAGA 2W4MA 3OI7A 2PS1A 3RUHA 1OWPA 2PMDA 3HR7A 3V6LA 4CKYA 5TQ0B 2IH2A 3O21A 4LHZA 3C8MA 3GJ3A 2IYWA 3K9GA 2IH4A 2FPIA 1BD3A 5CLFA 4C6TB 3VOAA 4FFNA 4WQMA 2NVWA 4G9EA 5G3ZA 3U7HB 3K1AB 4GM1A 4YASA 1N7JA 3GZNB 3SHOA 1DKQA 3K9WA 1JT9A 4D0LB 2HA2A 3CEPB 1SEVA 3H1FA 2H1IA 3EBOA 4FYMA 2PL1A 1MQSA 4Y2UA 3AL0C 1JJIA 2QM7A 2PWZA 1J42A 1G9TA 4FC6A 4MP3A 3IP9A 2VF8A 2VBCA 1OLSA 1LKZA 1N32M 1O95C 3TAUA 1UIRA 3HC7A 4JR0A 5JD4A 1U3UA 3MB8A 3Q6IA 4UAJA 2CXOA 1OB2A 1N5MA 4RZUA 2XYVA 1P3QQ 3VXKA 5EMHA 5EIAA 2JJYA 1E5DA 1TRKA 1WSDA 4O4IB 4MGEA 1XTPA 4KIJA 3JXEA 2FWRA 2VR1A 4CI0B 4ZALA 1IG0A 1J8FA 1Q21A 4P1ZA 3N0XA 3QH4A 3CB4A 2D7EA 2XVXA 4HKTA 2F8MA 1E2EA 1KSFX 1C9KA 1N33M 1QRSA 3RKSA 4LC9A 3B9RA 2RCNA 1YQTA 1BCSB 3L9WA 2P9BA 3L1IA 3CE9A 5EZ6B 5A7FA 3A3KA 3N6XA 3SU8A 1X8LA 4Z49A 4AT1A 1XNRB 4M38A 2P6OA 3B7WA 2VVTA 3ON5A 3NWBA 1KDRA 3IP7A 2DBRA 1GCUA 5IARA 4MS3B 1E18A 5BN4B 3KEQA 3KPYA 4AZFA 4EBBA 1G1AA 5I9TA 1REQA 3D8TA 2YUTA 3UJAA 1U5CA 4A8JB 1FXUA 2X9VA 3NBQA 1NVMB 3W1VA 2BAGA 5SZIA 3L0CA 1M6EX 1PRYA 2I03A 8MHTA 3PUZA 5TEWA 4EAQA 5ICGA 1UFRA 4GMKA 1DGBA 2F1OA 2PH7A 1VPWA 1BMQA 4X7PA 3KE8A 3QVVA 2PL3A 3LNTA 4KREA 2WVJA 1UBCA 3STVA 2YMLA 4CHTB 1EEXB 4YJ3F 2GKGA 3C3MA 4HB2A 4ZFNA 2CZCA 1X8JA 4AYTA 1NV8A 3JQEA 1X1EA 1W0JA 2GJAA 1JZTA 3I72A 2AOUB 1NKTA 3GUYA 3N2ZB 3Q7IA 1LSJA 4J6FA 4E5YA 2F64A 1K6JA 4NY1A 2LTUA 1NYQA 2JFYA 3PDJA 5C5EA 1KSJA 1GUFA 1I01A 4C0AC 2OB2A 3H8VA 5JTTA 5A5FA 5DHSA 2RHDA 4DR7M 3ZCPA 1OI2A 2J0UA 3RUAA 4LYDA 1W0JD 2FZLA 5DCUA 2C7PA 3NHLA 5CT8A 4R7GA 3UG7A 1Z2PX 1JFSA 5DB4A 1EJ6A 5H4GA 4YRQA 4CMIA 5AW1A 1LSUA 3AI2A 4PLCA 3QYPA 1SUWA 1BDJA 1ZSVA 3A06A 3VFDA 3AONB 1RQNA 4JLMA 2VCHA 4RCYA 4IIHA 2YWHA 2CMGA 1ZCZA 3MBKA 1SB8A 4K9NA 2I22A 2GK4A 1TJPB 1OXVA 4PIMA 2Y0BA 4ACBA 2X8JA 1DU4A 2PUWA 3UXMA 1ISGA 1Q39A 3W5HA 1GQQA 2BBSA 2MYNA 4UMDA 1AB5A 1RHRA 1VOTA 4B7AA 1SKMA 1KDYA 2X3FA 3DMHA 1LJLA 2H1RA 4PF1A 3K0HA 1HYBA 1E1CA 5JWHA 3QG5A 3GFTA 3K0FA 3ELDA 1PQYA 1US8A 2VJCA 1KVUA 1BJTA 2EA0A 1M3SA 4CTNA 4GNRA 1Y1QA 1K3FA 1XOIA 2DFTA 1KYVA 2OC9A 3WGQA 2ZREA 4G84A 2BOVA 1ZU4A 4L4SA 1O94A 3LUBA 1S8AA 3DP7A 3B6KA 5EPOA 2GA8A 1ABBA 1QO9A 4XX0B 1W0CA 3KSRA 3Q8WA 5BSEA 1JQ5A 2QR3A 4YCCA 3HZRA 1S3FA 2GLUA 1Z06A 2DG2A 1VMEA 1QIKA 4PZ0A 2FMUA 3CX6A 5EFZA 1U1GA 3ER6A 3UXHA 1C0LA 1RI4A 3CKKA 3RU7A 4I1IA 1Y6JA 4JI4M 3NTXA 4BDTA 2NM0A 5JYBA 4XQ9A 4CLHA 2DBVO 2PZFA 1MC4A 4PAMA 4HDSB 4YRKA 4B7XA 4Q7JA 3A4MA 4J0HA 1K66A 1JMKC 3UGJA 4MUXA 5FPYA 4RD1A 4J75A 3HWWA 1T5BA 3G1WA 5EE0A 1WZUA 4MP8A 2DPGA 1V16B 3F2VA 3LQ1A 3HP4A 1JLLA 1ZI6A 3PQCA 4EF5A 2IH5A 3KVYA 3LUFA 1E2MA 2BISA 1I8TA 2P5SA 2J6BA 2B8JA 3AL3A 1PYOA 3ANMA 4FOTA 2P69A 3IX7A 2A3RA 2JJ8A 1JTEA 4M1EA 4OFXA 5I48A 3QX9A 2PMWB 1M2NA 1T3ZA 2ZWOA 4R3NA 5HIAA 1ZAYA 3F9CA 3DBIA 1MG5A 2B1IA 3OKFA 5NLLA 3GD5A 1SUDA 3VR4A 1P2BA 4I5IA 3RHFA 5B37A 1O94C 4I81A 1EJ0A 3H2GA 1WJ7A 4JT4A 4YALA 4YAUA 2FPXA 4DILA 2DERA 1ACJA 3RRZA 3GRVA 1WCIB 3JYNA 2RHHA 4MEBA 4KAAA 3AHCA 2D2XA 2WJVA 3PC8A 3OJ0A 3GUCA 3WKBA 7ABPA 1VIVA 5ICFA 4OY3A 1UXOA 1V37A 2I76A 3RAEC 3KO8A 4BX0A 4F21A 2IS6A 2TMDA 4EG7A 4A27A 3L6EA 3OQBA 2ZI5A 1NWHA 2PS0A 1JWLA 1B8OA 4XGNA 3H1BA 3R77A 1E2LA 1M2JA 4W5WA 1MRZA 4KSBA 2ZW9A 3LTNC 4X7BA 4WKNA 1NMYA 3INRA 4ME6A 1TGYA 4L8RC 1J8DA 2W2TA 4PNPA 4RPIA 3K9LA 1BFUA 1IN5A 1VL2A 5BOSB 1EIJA 1K75A 1YI8A 3AUFA 1NVBA 3AEUB 4PVDA 3HA7A 1L5LA 1CQIA 5T41A 3BMQB 1OC2A 3VNBA 5TMEA 3ZD9A 4F3YA 3DCIA 4Z1MA 3M6FA 3G5UA 3G2JA 4QFBA 3AJRA 4QEDA 2IZ7A 3GEPA 2AJLI 2Q2VA 3E9RA 1CE8B 1CUWA 5C4GB 2IEBA 3HPRA 4MVWA 5DM0A 1N6OA 1X1CA 1OIPA 5IDWA 4AMYA 4MI1A 1KERA 2XAAA 4Y2GA 3DXYA 3U9SA 3SZOA 4IF6A 1LTHR 1SXJB 3TDNA 3CC8A 1HNWB 1CZHA 2JFHA 4EFKA 4W9MC 1AS3A 1SD2A 2BWEA 4G1BA 2VK1A 5ED4A 1JEEA 4EVRA 2M6LA 5A06A 4CM8B 1Q0RA 3ONFA 4B08A 4YJFA 4Z4HA 2CE2X 2MYUA 4Q6WA 3IHTA 1XROA 2JIDA 3I6IA 3F7NA 5FUMA 4P7BA 5DI3B 4FDTA 1R27A 3DB1A 2EX1A 4CIZA 3RE8A 3X0DA 3KYCB 1YBAA 3FYTA 4IZOA 2JIMA 2PEYA 3DXZA 3ZGLA 2WOJA 1NVWQ 2Y92A 2E21A 4Q4LA 2GWHA 1G8FA 3U3DA 2VAMA 3UWPA 5EZQA 3KJEA 3FKEA 3LQQA 3C4QA 5KWJA 3PNYA 5LN1A 1X80A 2WJ6A 3RC3A 2Z4SA 1T8PA 3V76A 4MGYE 1R8XA 3CZ5A 4F45A 2GAFA 3TRHA 3H5OA 3H9EO 3LLSA 4DM7A 4DLSA 4W5QA 4C0XA 5E1MA 5JISA 1GNRA 4GHAA 2HPHA 3E05A 4C0QC 1V35A 1JIIA 1NVGA 4NDZA 3OX2A 5C8XA 2PNJA 5CDGA 2N46A 4PCUA 1NW5A 2G88A 1ZIYA 5BV8A 1S4MA 1MAAA 5KYYB 1MG0A 1OW3B 1KHHA 4DMGA 4UCFA 4ND2A 1F3OA 4RXUA 1GO5A 3OTIA 4YXWA 1Z68A 1NI5A 3PT9A 3IKVA 3ZBQA 4IJQA 3HY6A 2YWGA 1TVCA 2QRMA 1XJWA 4B3CA 1H2WA 4O2AF 1LRLA 4JS0A 4BP3A 1YQQA 2R1TB 4EGQA 3F73A 4KPFC 4KQJA 1EXDA 3HZZA 1QAMA 2ODBA 3PV0A 4FMDB 3AUYA 2AUMA 1XSEA 2C9OA 1LU9A 4TYNA 3IAM1 4ABYA 2OO3A 2PZJA 1SIBE 2V1CA 1T1RA 2BCEA 3DZFA 4GKBA 4ERNA 3PHIA 4EP1A 4X92A 1ZK1A 5A4DA 4YXWD 4CEIA 4C7OB 2SECE 1MU5A 1RQRA 5K0TA 2OHXA 2VHYA 3EXEB 2DAMA 1U3WA 5JJLA 2F2TA 3D0KA 4F9FA 2HAEA 2L2QA 1DMSA 1RAFA 1SHZA 1OFVA 5D85A 5DBGA 1L4FA 2HCBA 5DHFA 3AR6A 4UD6A 4K9KA 4NAVA 1C50A 1TMGE 1I0ZA 3WYEA 5K8TA 4LEIA 4B6SA 4OXRA 1QIFA 3ZE0B 4OG2A 1K5HA 5IRCD 4K46A 2BGRA 4H7DA 1SUPA 3ESBA 2FSVA 2OCXA 4EKGA 3AQIA 2GHRA 1J8YF 2WUEA 1KRWA 2J3KA 4JKIA 2HK8A 1C9MA 3ASVA 3ESZA 3T9AA 1LNQA 3BZWA 2UYHA 4RA9A 1CF2O 1XTUA 3KLOA 3SEAA 2VDPB 2X8WA 2C4NA 2DECA 4KQWA 2NXNA 3ZY3A 4CKBA 2I7NA 2Z8YA 3IDFA 1P5RA 1KC3A 4BWGA 4Q1EA 1Z59A 4KXVA 3EF3A 1R1DA 3DE6X 1YE5A 2FMTA 1C41A 1Y7IA 1J0CA 4OXXA 1QS0B 2ZR8A 2GZSA 4OOEA 1D8AA 3RSCA 1FS4A 2XUKA 4HH1A 1V4BA 1D2AA 4BOYA 4DG9A 4HNUA 3L7KA 3T9FA 1H0KA 1DUSA 2DJIA 4XB6B 3A4VA 3KQYA 4CF3A 4FYYA 4MVJE 4WLEA 1SQ5A 1JR4A 4JLSA 2GEKA 3KOXE 2X22A 2HNKA 3CS3A 4YT4A 5DOZA 1SD5A 3A1NA 1YVPA 3D8BA 2A58A 2MR6A 5ADUS 4D4HA 1XNHA 2UU9B 4C3VA 2G9RA 2IIPA 1RW4A 4AM8A 2RKWA 4DMCA 1GT6A 5I7OA 4M6WB 4NCAA 4IRXA 2Z98A 6PFKA 3QJYA 2FWAA 3QNWA 4N49A 4AZ3B 5KAMA 1QTRA 2FSVC 2ZI7A 4OQNA 3PPWA 2VP2A 4FUQA 4XSHA 4P92A 4POAA 4W6ZA 1WPRA 3PKJA 5IVPA 5B3LA 1GPJA 1NQXA 3K6RA 5ELMA 3E2IA 1R16A 3N05A 4Q9AA 1BH6A 4RCVA 2VPQA 4D43A 4E3ZA 3AHJA 2EGHA 1YF3A 3R4CA 1DWOA 5LIPA 1PFYA 1MNQA 5DLYA 5ESRA 3GA0A 1DTSA 5EJ8A 4ZD6A 5DPMA 4HDAA 3BL6A 1HL7A 1II8A 3IRVA 3ENWA 2J59A 1KDTA 3AOEA 4O2RA 4LZLA 4JI5M 3HLKA 4ND1A 3HABA 1GPNA 4EPVA 3OAAA 1DIHA 5HHTA 5CVJA 1QIHA 4WWHA 5KJFA 1YS6A 3HUDA 3FDIA 4DXDA 4EUHA 2PEZA 4CDRA 2VT3A 1VHJA 1HE2A 3OUUA 1CVIA 5IX8A 1JG2A 4O2BF 2JEOA 4P4UA 3T35A 1T2NA 2WJZB 4EA7A 2E1RA 3HGMA 4YV7A 5K03A 1TK2A 3IVMA 4JJEA 5FAXA 1EDDA 1E8MA 1P5FA 1MB9A 1VBKA 3U3JA 4DZZA 1JHAA 1EB9A 5HVNA 5J4LA 3QWLA 2WFAA 4W9RA 3STTA 1X87A 1O9BA 4F2DA 2R87A 5LXTA 3PHCA 2VUIB 1BQEA 3MTIA 3VDMA 3RM3A 3ZGYA 2OM6A 2YIVX 3CSUA 3HVKA 1XVLA 1TTTA 1QH8A 2O8BA 3NVAA 3K94A 1TUGA 3QU4A 5EGSA 4MITA 5JBNA 4P4TA 5A6VA 3DLBA 1CLUA 4RK0A 1H5QA 3VOSA 3DXFA 3GC6A 3PUYA 5AVTA 1E77A 3QKRA 4MAMA 1KWKA 2Z8ZA 3IKTA 1VIYA 1AUQA 3BRSA 1GU1A 3OZRA 3HKCB 1EGAA 4WOPA 3ZVRA 3FSGA 2WYVA 3MPOA 2AMVA 1E0DA 4KKVA 5IKEA 2J6HA 3WLIA 4AJOA 4IWYA 4PC1A 4A0RA 4O4IF 1XZHA 3T3IA 1UKBA 3AOEC 1NF8A 3TRDA 1PN3A 2EXXA 4ZOLB 1C30B 1R9JA 1OROA 2E18A 2ICAA 3SNKA 3H11B 3M6IA 1Q44A 5DJ5A 3DF9A 1NJ8A 1Y1KE 4PAGA 2Q6IA 5H81A 3M0EA 1V71A 3KNZA 1DP4A 1EKXA 4BNKA 4ZOQI 4RPJA 3LVFO 1V7CA 1PR9A 1RMYA 5BW8A 5DZSA 5FV7A 4Z2YA 3RIEA 2IP4A 2QGFA 3QBEA 1YR7A 4P6VF 1A9XA 2F55A 1C0IA 5KQPA 2HHAA 4NDNE 3SSAA 4CV1A 1LI7A 2UXDM 3BWEA 3F8SA 5FQOA 1E63A 1DAPA 1ZUD1 3KUXA 1SQ6A 3NOVA 5LC1A 4FEYA 1ZLXA 3QLVA 1UXKA 2DZOB 1SHJA 1U4OA 1BFKA 1QORA 2OO9A 4PONA 5JJ5A 3BDAA 1M2WA 3KAQA 1D09A 4OEHA 5FXMA 3PKIA 4EH1A 1Y8CA 4YAOA 2LXNA 1KY2A 3IEVA 3UANA 2XE8A 4MS1A 5IDYA 3FBGA 3FE3A 1ZZEA 5ARBA 3BMCB 2ZQYA 2X23A 5F9HA 1TTHA 3LLUA 2PSHA 1L3BA 5EJMA 1T13A 1P77A 1QZZA 2XHEA 5E7IA 1U7HA 3MUNA 2ZRKA 5DBEX 1OXUA 1SA0A 3KQNA 4I9GA 4WZZA 5LB4A 2FR8A 4UXIA 1QVWA 2FEXA 1VL0A 2XTAA 1NJ1A 1J00A 1RS0A 2G67A 2PU7A 5BT8A 5JRDS 1CQPA 2XX3A 2XA9A 1YR6A 3I5XA 4MI3A 3T3DA 1L5HA 3LPAA 1AKTA 1VG1A 5HCNA 5JS6A 4HVAA 1EFUA 4RC9A 3MUFA 2CNBA 3R2JA 2H52A 4NFSA 4RABA 5ARCA 1OI4A 5JQGA 1XEAA 3BK1A 3K4PA 1R6BX 1KNXA 4LE0A 4FZRA 4TS9A 3QM1A 3JQGA 4XBOA 5DTJA 1QG4A 3C3EA 4M9CA 2RJNA 3EZGA 5JAQA 2PTHA 2M6KA 1KJNA 2L7HA 2XLCA 2W00A 1GNTA 5F7JA 3QLVC 4ZKDA 4JITA 1KMNA 4PD2A 3N2GB 1NX6A 2V3CC 3WLEA 1NMSA 1E79D 1T4MA 2A9OA 3JW8A 4GX1A 4GSYA 1M2GA 2E7ZA 3WKEA 1X39A 1GR0A 4EF4A 5TDHA 3GJZA 2R6FA 1K4MA 2PGDA 2O25A 2R5FA 5T6MA 4B4WA 4K0KB 3E7FA 1Z35A 1LGYA 5E3IA 4YDHB 3ZGZA 3HB1A 3LBHA 4E15A 2YR0A 4XD7D 1T91A 4CM3A 3KTOA 1U7OA 2ETVA 2WU0A 1DVRA 4CQLA 221PA 1UBTS 4FK8A 4KFUA 1FTYA 4LRTB 3CLTD 2D00A 2VIIA 5BVGA 2ZTVA 5CFRA 4AWAA 2J87A 2KNAA 1KEEB 2C04A 1PU2A 2XMZA 2A35A 3ROGA 3HU3A 2XQIA 1XPRA 2FTKE 4FM9A 5T5QA 1MFZA 2OHOA 2G0AA 2Z3VA 2GETA 4QLAA 1OQYA 2WWRA 1FSZA 1KXJA 1Y6RA 3TR5A 2OLKA 3W8FA 2ZCUA 2G7ZA 2VHXA 1DQZA 4XEUA 4GYWA 1RNLA 2BEWB 4CPDA 2NU7A 3J7AC 3FOCA 4CV0A 5ITZB 3LSTA 4MWGA 3LDGA 2WYHA 1KS9A 2P3OA 4QYXA 3AEXA 1H22A 4R54A 1ECLA 2ZUWA 4MKIA 3EXFB 4JR2A 3CB2A 1RWWA 4FJ0A 4NXMM 3LY5A 5EJIA 2R48A 1TGVA 1T3HA 3HCWA 4F6RA 1GV1A 2PJRA 2X9GA 2V7UA 1M6HA 5M7EA 1UMCA 2ANCA 1T6OA 4G41A 4KO1S 1PJQA 3ZDFA 4FOSA 5CT4A 3ORRA 1QQTA 1PGOA 3C7CB 1JHVA 4D3DA 4ONEA 4RWZA 2HPZA 1T36B 3T1VA 3DVAA 3AZPA 4I9FA 3FLAA 2CLMB 4DR3M 2H0AA 3TNJA 3TNLA 3C0KA 3SZUA 2RG7A 1Q6ZA 2O3JA 1L4YA 3L0YA 3U6KA 1YNOA 2ZT6A 3FTEA 3M6UA 4J2TA 4LFBB 1BFDA 3T4XA 3L46A 5K3CA 1BKDR 1TB4A 4DREA 5FOXA 2YASA 5BQ5A 1CK4A 3K8YA 4HYEA 5JHHB 2B7LA 3PQ8A 1QE3A 4ZK6A 4D4IA 1G9XA 5IDVA 1XRMA 2R0IA 1TNDA 3VO1A 2JRCA 3JTMA 4TUYA 3U4MA 1VPTA 1YS1X 3M9XA 2DWUA 2C5FA 3KWMA 2VHUA 5JH7B 3ZJYA 4C03A 2VHJA 1Z75A 4JK3A 3P8ZA 4M36A 3I9NA 4KQGA 3Q2KA 4UBIA 2CT8A 2QDXA 4AY5A 3L1UA 2HF9A 1YZGA 2CLDX 1DE0A 1UBUS 3ASZA 3C6KA 2RI1A 1C3XA 3ZD6A 4GR4A 1SBYA 4BGVA 4Q1FA 4YB8A 1I2DA 2H4WA 1DKMA 1V8BA 1TDJA 4R1QA 2BH2A 3EPJA 1H8HA 3SLKA 2J0QA 3S0JA 2R7LA 4TRMA 3SQWA 3FCYA 2HIHA 2JGLA 3JQAD 3GLGB 1PR5A 3SC4A 1W4ZA 1OXMA 4CXMA 3IOEA 3L93A 5DF1A 1TF0B 2CDCA 2KA6B 2ZSHA 4XB1A 3U09A 5PNTA 5KWIA 2QZPA 3OPYI 4BKRA 3PKZA 4JYPA 1L7DA 3AOGA 2KRKA 3VSEA 2ZJZA 1NUPA 4BHTA 1HNWM 1B3RA 4F5ZA 2P68A 3TL4X 5MFPA 1D0MA 1RZVA 3VNAA 1KOFA 5H80A 1P2UA 2AT1A 2D3TA 1XRQA 1ZMOA 2Q8QA 1F3LA 3UT5B 4AN4A 4ZT4A 5A3VA 4C4TA 4I8OA 3T3OA 1EIWA 3LLVA 2IOHA 2FZKA 1OH7A 1WV1A 3JVIA 3PUJA 4AMGA 3NFYA 4FSHA 4P7FA 1JDVA 3HXPA 4DKJA 1KI6A 4AX8A 1S0UA 4PPYA 3AW8A 5IM4A 1V25A 5T3UA 1NPDA 2LDBA 4NV1A 4L74A 4PG7A 2XNJA 2YXEA 4RZ3A 1RP7A 4AY2A 4PZ9A 2H63A 4TVSA 4ZYUA 5IAGA 4UCQA 4B3GA 2WJIA 1MZVA 4BFXA 3DJFA 3RVNA 3V1KA 4IQ0A 2LUOA 4K9MA 3QEBZ 3LZDA 3GFFA 5ELXA 4B9EA 3ORHA 1T3LA 3WIBA 5BY2A 1J2JA 4WBXC 1WS6A 2Y1GA 1WXXA 5LYJA 1DDIA 3FW1A 3K5WA 3LQ2A 1G8PA 1P39A 3N76A 4OAPA 3I0ZA 2I6FA 2AX3A 1KEUA 1EG2A 2VDJA 3LCCA 4Z7QB 3PJGA 1V3QE 2VPPA 1JFTA 3TE7A 4GDFA 2FR1A 2ZSJA 3A3PA 5FD8A 3QG1A 1TVEA 3U7QA 1X7WB 4FMDF 3IIEA 4DW8A 1GL7A 2CFTA 3RSLA 1M2OA 3UV3A 4X9XA 2I1QA 5EVCA 2BFBB 1PUXA 3T61A 4K8RB 3QE2A 2VEOA 4G4JA 2YWBA 4FGWA 1H4SA 4QBKA 1XN1A 5B4TA 1PO7A 2I6TA 3QLUA 3RVQA 4LPSA 3R3YA 4IFTA 3NAZA 2JY5A 3QPVA 4BLUA 4QVKA 2OR3A 3MTJA 4W4TA 1WB4A 3ZG6A 2WMYA 1ZH4A 1ZX1A 3S2EA 2A9QA 3ESRA 3BZBA 1H6UA 4KAJA 4CJXA 1N8SA 2EDCA 4DV1B 4MVJA 3V4ZA 1Y6ZA 4UQLA 2XA1A 1E7RA 5SY9A 1XC7A 2W71A 3GRRA 3ONEA 3KOXA 5HP4A 2E87A 3EIXA 3EPLA 1ULAA 1JQAA 2Q9UA 3OE7D 3A9SA 2GCOB 1Z39A 3DF7A 3LY9A 1DDOA 2UZ1B 4F4HA 5GM2A 4P5DA 4CU5A 4MKHA 3ME5A 1PCXA 2IVZA 1EE1A 1ZCJA 4HEJA 4JQOA 3WOHA 1ARZA 1XQVA 3N75A 3CG0A 4QYSA 3D5EA 4KK3A 5JI2E 2HPAA 2FFBA 4M22A 2E82A 1LBIA 2RCYA 5L3SB 2PBRA 1NQUA 1IXYA 2NSHA 2H17A 3CXUA 4YJDA 5LVAA 4BO9A 4AP6A 4XGIA 3I4CA 3O4JA 1TLFA 3P9KA 1O89A 4UZSA 2J7OA 1HKHA 3D2BA 3GEHA 2YBEA 1V0JA 5CDTA 4QJ3A 2WLTA 3G2PA 1NLYA 3QLUC 1E2NA 5C5CA 1ZOLA 1R8JA 2ZSIA 5DFLA 1HSOA 4JDPA 3JYQA 2IXFA 3BJIC 1QTIA 4N5DA 4KZKA 1MTOA 4CUZA 1JVNA 3BK7A 3ET5A 2GN4A 3R3VA 3EAFA 2PUAA 4G0XA 1FUYB 1E2BA 3HFGA 1SCNE 2Q5EA 3WB0A 1AQUA 4IHAA 1U6JA 1AH2A 3GPIA 1UPCA 2G1JA 4X3CA 1J8MF 4NQZA 4RY8A 1L1ZA 5KNDD 2JIQA 3U17A 2HZBA 4JT2A 1BX0A 3ZX4A 3ADKA 5B55A 4LDJA 1WUKS 5AJWA 1XZLA 4R8RA 3CCBA 4HDCA 2B30A 1ACMA 1YKFA 4EF6A 1O5IA 5J4KA 1E2HA 4UTNA 2MSDB 4XYBA 3PD1A 4HWGA 4QNRA 3OTHA 1K88A 3GO4A 4UOEA 1Z28A 3NBIA 1WV0A 1CZRA 2HQBA 1QYIA 3HY4A 2KBEA 1CRPA 3J80S 3TWKA 2OZPA 1C0EA 3TSAA 3WFJA 1JG3A 3L7IA 2YQ5A 1AQIA 1B0PA 2OZVA 1T6XA 4CZ2A 1SBNE 4HNAB 4DANA 3H84A 3QK7A 4G5QA 2HWJA 3BG5A 4RFLA 4EK9A 2K6GA 1ZU5A 2Z2IA 1BMFA 4PG4A 2XWBF 2YINC 2ZJ5A 1L1FA 5CM8B 2VS1A 1ZCBA 4EJSB 1Z5PA 3JQ8B 1P7YA 3W67A 3RFWA 5JTUA 5B7QA 3KXIA 1RM3A 5EI5A 1EDEA 1SCAA 1H3EA 3FRJA 5K4GA 1KNQA 5HQ3A 4D3FA 4FCTA 3C8HA 4MGYR 4ZU3A 1H9BA 1Z13A 4DUYB 1HORA 2F1IA 4GX5A 3OE4A 2IZ5A 2BGMA 1NXPA 4RELA 3L49A 3TJRA 3FHTA 3W5JA 2HEIA 4FN4A 4CIAA 1PT8A 5AW8A 4HJRA 2G17A 2AQIA 3ICVA 1XT6A 2JKVA 3H4IA 3R9XA 4OFZA 2VHQA 2GJKA 4BJ3A 5HE8A 1DRUA 3B1ZA 4U9HS 4CFYA 4YP1A 1H2HA 4P17A 2RGEA 1SHTX 4E2YA 4DVGA 5DHUA 3KQHA 2Z57A 4F5DA 1MF7A 4UJ5A 3S1SA 3H2JA 3HMQA 3SFTA 3SJCA 3TSWA 2WP8J 5C80A 4M1KA 2XNSA 3ZHXA 3QVUA 3IMCA 3QX3A 1RWVA 4DB2A 1IHYA 5IXYA 5BSVA 3CN9A 2Z2XA 4CUJA 5AI4A 5JSUA 2CL5A 2CWWA 1N78A 1UZAA 3TRIA 3BD6A 3G0BA 4IG4A 4ZOLF 3SP1A 4JJIA 2XUFA 4X1YB 3PZBA 3KG2A 1AMOA 1UWKA 3HO1A 3LBAA 5ISMA 4FNGA 2F3RA 2ZKIA 2JAPA 4O1IA 3BMOB 1KF0A 2V6ZM 3L6DA 4H7EA 3PSHA 2LCQA 1R10A 1AMUA 3KZMA 1B1AA 2XVZA 1HDZA 5I4KA 1ZM7A 3JX9A 1CS0B 4XLZA 3P2MA 2JFZA 3JAWA 1OX6A 3E3NA 1MAVA 1TKCA 4YQYA 5ALHA 4BQSA 2RE8A 4M0WA 1JH8A 4XB2A 5IJZA 1A4RA 2CLLB 2WVGA 4Q3KA 2LDXA 1OVMA 3V2GA 5KTKA 4N40A 2NXCA 4RY0A 3IHLA 5C53B 2QG9A 4MWDA 5KYVA 3WP0A 2GJ9A 3RSHA 3ESQA 4DCUA 3BTOA 3I6QA 4U4AA 2D7JA 4ESOA 4HNGA 2WU3A 3P71T 4KGXA 1F7VA 4HUQB 1NLUA 3W06A 3FZGA 2PH3A 2BFPA 1XD8A 3AI3A 2LBPA 3PQ4A 4TL7A 5FKJA 4MR8A 4QGFA 3GEIA 3NBKA 4XUGB 4MPTA 4UC0A 1K8RA 3OQJA 3UV6A 4E32A 2Z04A 3L28A 1R64A 1WE2A 1G5RA 5EUMA 1TAHA 1SK9A 3JYPA 1E1RA 3WB9A 4R16A 5EJGA 1XRRA 5JSHA 4CG3A 3RASA 3RYCA 4BLCA 4Q24A 1CC1S 4GEGA 3SS7X 1SCIA 4MDHA 3IXMA 3WGUA 1JDBB 1C5KA 5IVIA 1VYVA 2DT8A 1OJLA 5JZ9A 2WICA 2XVYA 1MFPA 1FS5A 5I4BA 3GCWA 5JAOA 1JKIA 4Q9JA 4XJTA 3RREA 3UC5A 5KTTA 1DKLA 3ZCVA 1ZVKA 1TM1E 1G2QA 2DQZA 1Z62A 3L6BA 5UKDA 2MSNA 2PZLA 1L4NA 1SN7A 2DR0A 3DE1X 3NONA 1A7KA 1A27A 4LWZA 2H1WA 1F14A 5I8WA 5IT4A 1E9BA 5L6MB 2FPWA 3QFHA 2QL9A 1B8NA 1X7YB 1EDZA 2QZSA 5DE3A 5TSDA 4KKXB 2A33A 2JGDA 4JXJA 2ZBEA 2YXDA 4X8LA 2EL7A 4CMHA 5HDQA 1Z37A 3OZFA 1JB0F 3JQCA 3AFIA 1PI3A 1ZVJA 1E1YA 1QWOA 3KYDB 3HGQA 2WEKA 4KLRA 2FRDA 3EHEA 3ILYA 4X00A 1ZUIA 1D1TA 3DUFA 2V59A 1Y3CE 1FJHA 1SC3A 2PJZA 1CU1A 3WYFA 4OTZA 3MT8A 2OO5A 5FUVA 4KVZA 2C2BA 1XA4A 2FMFA 3NUQA 2JIPA 1RIFA 3EMVA 5HS4A 1XNQB 3S2SA 4K0KM 4P53A 3ROMA 4PGGA 1C9EA 4ZGWA 1KRXA 5F78A 3B85A 2QMYA 4BO5A 4O33A 4KHPB 2CZGA 2XEDA 1VC2A 3L8EA 2PN1A 4RGYA 4GIBA 1W4RA 2BGNA 4Q7KA 4R7ZA 2FZGA 2I66A 3LAWA 3BIXA 3K2BA 2XT9A 4WXRA 8ATCA 3H1PA 2C0CA 3QFCA 6YASA 3UPTA 2XE6A 2VATA 4YUAA 3BMNB 5BORA 4XFJA 3P4YA 4A0HA 2P78A 3F6YA 2BEUA 4BNWA 3CLHA 5ITXE 5EMJA 4CIVA 1JDUA 1CYEA 1E4EA 4P3YA 1M0TA 2JXNA 3T9DA 4ZAWA 1SUBA 5FBVB