1VEKA

Solution structure of rsgi ruh-011, a uba domain from arabidopsis cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
GSSGSSGGEELLPDGVPEEVMESAQPVANEEIVAQLVSMGFSQLHCQKAAINTSNAGVEEAMNWLLSHMDDPDIDAPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of RSGI RUH-011, a UBA Domain from Arabidopsis cDNA
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords ubiquitin-specific protease 14, putative
total genus 13
structure length 84
sequence length 84
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vekA01
1NV8A 1Q02A 2JY8A 1V92A 1ZMWA 1TTEA 2LVNC 3F92A 1R4GA 1TR8A 2QSFX 2DI0A 1HT2E 2DAGA 2OO9A 2DKLA 2JY5A 1UFZA 3MMPA 1KYIA 1GO5A 1EFUB 2JY7A 2L4FA 2B3TA 2KNVA 3K9OA 3FE3A 1VQ1A 2OOAA 3E46A 2QNJA 2EKKA 1VDLA 1WJ7A 1G3IA 1A5TA 1DO2A 2JUJA 1WHCA 2K9DA 1OQYA 1VEGA 2DZLA 2DENA 1HQYE 2DAMA 2KNZA 2LBCA 1WGNA 1F4IA 4R71A 1WGLA 2BWBA 1OKSA 3E21A 2LTUA 4F2LA 1QZEA 2DHYA 2QHOB 1NV9A 2JY6B 1ZMVA 1SG9A 2LVAA 3T6PA 2WZJA 2G3QA 1ZV1A 1YLAA 2RRUA 2K0BX 1C7YA 1VG5A 2BWEA 1MN3A 1P3QQ 1BVSA 2MR9A 2DAEA 1JR3E 2CP8A 1XXHE 1IXSA 2JP7A 1XB2B 3IHPA 2KNAA 3BBZA 2JNHA 2ZTCA 1HT1E 2KHHA 2HWJA 2MJ5B 1VEKA 1T43A 3B89A 2L4EA 2JZ0A 2O25A 3IECA 1IM2A 5DFLA 3GLHE 1DO0A 3FRHA 2MGWA 3LCVB 3GLFE 3H4JA 3FRIA 2DAIA 1IFYA 3GLIE 1DV0A 2OOBA 4UN2B 1PGYA 1VEJA 4GEWA 1E94E 2LVPC 1WR1B 2CWBA 3GLGE 2DNAA 2MROB 3LCUA 1Y8GA 2JZ1A 4WP2A 2LVOC 4Q7JA 1G4AE 1CUKA 5JI2E 1OAIA 1T6OA 2EJSA 2LVQD 2R0IA 2HAKA 2ZTDA 1HJPA 2DAKA 3K9PA 4G3OA 1G41A 4DBGB 4F1IA 1AIPC 2L2DA 1ZMUA 2EKFA 4HEOA 2H5XA 1WIVA 1OTRA
chains in the Genus database with same CATH superfamily
4DV7M 1IBKM 1NV8A 3FYDA 2Y0TA 1TGUA 2JXNA 2VQEM 1Q02A 1ZMWA 4AKHA 5IWAM 2XZUA 2XEPA 1IQPA 2XSZD 4L4UA 3TWLA 4LF5M 5A2QS 2DI0A 3FTDA 4IIWA 1HT2E 4NSRA 5H37D 4X65M 3KP1E 3GPUA 2JY5A 4LFAM 3D8BA 1I94M 1EFUB 2ZBKB 4Z8XA 3I01M 4LFCM 2Z4RA 4X62M 3U6PA 3L25A 3SAWA 1VQ1A 2OOAA 3E46A 2CV0A 1J5EM 1NSFA 2VF8A 4B3TM 2QBYA 3A98B 3AL0C 1WJ7A 1G3IA 3LVWA 3PNYA 4ZPXA 3M7GA 3M6AA 2LH0A 2MH8A 3DZDA 1E32A 1E9RA 4FCTA 2DVWB 1NO1A 2HCBA 1G71A 3U6MA 3U6OA 4LY6A 2G5GX 4KO8A 2LBCA 4XGIA 4R71A 1OIPA 1WGLA 2BWBA 3GPPA 3VFDA 4F2LA 3MJ5A 1H6UA 4JI3M 1SXJA 4YHHM 4IBGA 1TF0B 4LJ7A 4IBDA 1PJTA 1DGFA 3BXWA 4W5WA 3AFHA 5EP2A 1XC8A 2RGHA 3L26A 1EIJA 2QP9X 1ZMVA 2EO2A 1GKIA 4KHPM 3T6PA 2Z4SA 3FUWA 4QNRA 4LGYA 3RGPA 2N35A 1Z5BA 2RRUA 2ZAOA 4IBIA 4L6V6 3RE8A 5DNYA 1ORYB 3TL4X 4BB9A 3SMPA 2BWEA 1QYRA 1P3QQ 1BVSA 3C3DA 2KRUA 2MR9A 5ITXE 1ZAEA 4MB7A 2ZANA 2EUCA 1KFVA 2QBYB 1GL6A 1GLNA 1JR3E 2CP8A 2Y21A 4FW9A 1IXSA 2HHHM 4QOZC 3GRUA 4REZA 4JI2M 2F4VM 3GPYA 5C1BA 3Q8XA 2ZTCA 2BNKA 3I4VA 4MGZE 3ZH9B 2CEAA 4OW0A 4DR2M 1HT1E 2DHRA 3J7BA 1NHWC 2L7IA 1IY0A 2HWJA 4IBEA 1VEKA 2WSCF 3K8ZA 3L28A 1HNZM 4Z6YA 1SXJB 2JZ0A 2Z7JA 3TQSA 3A46A 1JQJC 3FUTA 3GLHE 1DO0A 4L16A 3LCVB 4OU7A 3GLFE 2J7OA 3KVWA 1G8PA 2DAIA 3GRVA 5FTJA 1Q3BA 3SMSA 5KPZA 4UN2B 1IBMM 3T1YM 2F5PA 4DV2M 1NJFA 3UMMA 1QDRA 1S3SA 3AOEC 1E94E 2CWBA 5EXPA 4LF9M 4DV0M 4DUYM 3PXGA 3HZJA 4LJAA 1Y8GA 2HL7A 4WP2A 3GP1A 2LVOC 2UXDM 1XHBA 4GHAA 1IXRC 4QOSA 3H4MA 1IY2A 1G59A 4IBCA 2WSEF 3ZQJA 1DGBA 2LVQD 2HAKA 1HJPA 3K9PA 5EP3A 4RNAA 1AIPC 1ZMUA 2EKFA 2DZNB 3SYLA 4EIWA 2CHQA 4LCBA 4MGYE 3HJSA 2OOBA 1OTRA 1D2NA 2AHMA 4LFBM 1OAOC 4Y28F 4DR6M 5KPTA 2JY8A 3KOYE 2C5RA 1QVRA 1TTEA 2GNOA 4RF0A 3TWKA 3UJNA 2LVNC 1SXJD 2R44A 2DWLA 4JI4M 2FH0A 1TR8A 1XNQM 3SBJA 2DAGA 4I81A 2OO9A 1QQWA 1NY5A 2YNMD 1NVMA 2DKLA 1JB0F 3HHYA 3T1HM 1LV7A 1UFZA 4JI5M 3MMPA 2M60A 4GIPA 1GO5A 2L4FA 2B3TA 3WHKA 1K82A 2UU9M 3FE3A 3K1JA 1GVNA 1Z5CA 1JR3A 1UM8A 4FWGA 4LF4M 2CRUA 1VDLA 1QAMA 4JYAM 1DO2A 2JUJA 1WHCA 4ITQA 2O5RA 4DR3M 4M9ZA 3B7ZA 1VEGA 4NXNM 2DENA 2VQFM 3AV0A 2JA2A 4PDIA 4DV5M 2R4JA 1L2BA 3W68A 4GKKM 1OKSA 2KRKA 3GLHA 1QZEA 1R7RA 1NNJA 1AUAA 2DHYA 3W0FA 2QHOB 3A45A 4NRWA 2JY6B 3GLIA 4L78A 3HGIA 1YSYA 1WXQA 4LRSA 4QHTA 3KOWE 2G3QA 3GRRA 2XSZA 1LTMA 1TDHA 2D7EA 1VG5A 1N77A 4GKJM 4B3SM 2KZSA 2NQ8C 3C3EA 3M0EA 3GPXA 3ILKA 2R45A 2R6FA 1XB2B 2ERCA 3GRYA 7CATA 2O01F 2FNAA 3IHPA 4MGHA 4MGIE 1OIZA 3BBZA 2H1RA 1DGHB 8CATA 2Y20A 5IREB 2CV1A 4G4NA 2C99A 3W0LB 2KHHA 4CISA 4CGYB 1IN5A 3SHFA 5ITTA 2L4EA 3FUUA 2C9CA 2O25A 4JN6A 5DFLA 3FRHA 1L2CA 4KT0F 1X37A 3FKEA 2ZAMA 3EIEA 2BJWA 4DR5M 3FRIA 1N36M 4IBBA 3SATA 3AOGA 3HJ8A 1IXSB 1IFYA 2UXCM 2K47A 4AW4A 3GLIE 1QUSA 2UUBM 1DV0A 3JR5A 2X49A 1PGYA 1VEJA 2QZ4A 2V6ZM 2LVPC 4I5SA 2CUZA 5EXTA 4CJ6A 4D80A 1IN7A 2DNAA 4LJ4A 2FS1A 3IG5A 4JI1M 3HJQA 4Q7JA 1SXJC 3VLFB 3WHLA 2L7HA 4QNMA 3UK6A 4R3DA 5BPVA 2CV2A 2R4EA 3TE6A 1FJGM 1GJSA 1N78A 3T38A 3CTWB 5FTLA 1PJQA 4DV4M 2R0IA 1L1TA 1OFIA 2ZTDA 4IJFA 4JXJA 4G3OA 2KW0A 3K92A 5FTKA 5GKNA 3HU2A 4X66M 1G41A 4F1IA 3EIHA 1R2YA 1K3WA 2L2DA 1QZMA 2V1UA 2HKJA 4P17A 2D7HA 4HEOA 4ANRA 2H5XA 4G4RA 1IBLM 4NXMM 2DWMA 2RGOA 1GABA 1FNNA 3SYKA 4LG2A 3U6EA 1IN8A 3VKHA 1MX0A 4GITA 1Q3CA 1V92A 2YQZA 4LRTA 4FCWA 1R4GA 4HLQA 1IN4A 3U6SA 2F5OA 4I8OA 5ITRA 5FLXS 1PM5A 2OPFA 3T15A 1XNRM 3KOXE 1NY6A 2R46A 3SASA 2JY7A 2V1CA 2KNVA 4FCVA 3K9OA 4BBAA 1HQCA 1R5LA 1Z59A 4GRIA 4FVMA 3LVVA 4NL4H 3A42A 4LJ8A 1XXHA 5FTNA 4CIZA 2EKKA 2Q2EB 3HU1A 2BJVA 1KSFX 3U6DA 3AJIB 3FTFA 3QYBA 1R2ZA 1V33A 4D82A 2F5NA 2Z3XA 2C96A 4DV1M 1OQYA 2OQ4A 1YUBA 4NSOB 2UUAM 2L09A 2DZLA 2VDBB 2GQFA 2WSFF 4R7GA 3GO8A 1QANA 4HL4A 1HQYE 2DZOB 4DR4M 3TWMA 1F4IA 1XMQM 4K0KM 1OJLA 4L15A 3SAUA 2LXEA 1TH3A 2Y0QA 4NRVA 3FUVA 4WURA 2EA0A 4LF7M 1D0KA 4DR7M 2FE8A 1QAOA 1SG9A 2LVAA 2W82A 4AKIA 1D0MA 4LF6M 1R6BX 3DOAA 3L29A 2K0BX 2Z8YM 5EP4A 3FTCA 4YY3M 1C7YA 3TPZA 4MM3B 1MN3A 4M0WA 2DAEA 1GL7A 3DA1A 3MK6A 5EJCA 3GLFB 1XXHE 2XH9A 1HR0M 1W5TA 3GLHB 3GLGB 1N33M 2R65A 1IXZA 4G6ZA 2XLJA 2CHVA 2C9OA 3Q8GA 4RF1A 4LZZA 3VK7A 2KNAA 3J2PB 3HHZA 4TUWA 2JNHA 2QCUA 2F5QA 4MH0E 1J09A 3GQ4A 1GJTA 5ITXA 3OTOM 1N32M 5FTMA 4FD2A 1DGGA 2MJ5B 5L8RF 3PVSA 4M0DA 3U6LA 1T43A 3J81S 1PRBA 5LMUM 3IECA 1QDTA 3NBIA 1N75A 2MGWA 1PJSA 4AG5A 3H4JA 3W67A 2ZM6M 3VDPA 3NBXX 3MHVC 5KO3A 4PDGA 3CF0A 1OFHA 2I7PA 3KXEC 1NJGA 2X4AA 1I4WA 2QENA 3L27A 4GEWA 4B08A 3U5ZA 1WR1B 3PNVA 3I51A 2QQ8A 1MJGM 3VDUA 3QWLA 3ZC7B 1TDZA 5LMNM 2MROB 2X8AA 1XXHB 2VIIA 4X64M 2KZUA 4GC5A 1CUKA 4G4QA 5JI2E 3HY5A 2C98A 1T6OA 3IG8A 4NC6A 3HX3A 4IBFA 4DUZM 5DYIA 5IZ7D 2LNHC 2KXEA 3GLGA 2FFJA 5E6JA 4DBGB 5BR8M 5ITQA 3I04M 2FOIC 5EP1A 1Z5AA 3U61B 4AI6A 1YE9A 4JI0M 1WIVA 3CGWA 4M9SA 3SARA 3E4RA 3B7QA 2CHGA 3KOZE 5KPRA 3R8FA 3F92A 3GQ3A 4LF8M 2A5YB 3KS8A 1XWIA 2QPAA 3B7NA 5ITYA 3D8LA 4NOOB 3CF2A 4GC9A 4AG6A 2QSFX 4S12A 1JR3D 1N34M 4LZJA 1D0LA 4M9XA 1XMOM 5IT9S 1KYIA 1QUTA 3CF6E 4LJ6A 2E5LM 2VF7A 3C9PA 1MU5A 4OVZA 2UXBM 4JI7M 3J27B 2RKOA 4FWDA 1J7KA 2J5YA 2QNJA 4II7A 3KS4A 3SC3A 3KW6A 4PCZA 3HU3A 1A5TA 2UUCM 3KSJA 3B9PA 1K3XA 2K9DA 2XFSA 4FWHA 4AZFA 5JI3E 4KODA 3AOEA 2DXIA 3JR4A 3C58A 4PD2A 2DAMA 2KNZA 1WGNA 3AKZA 3FYCA 2XGNA 3BOSA 3E21A 1QAQA 2LTUA 4JI8M 1W5SA 1ZQ9A 1VDDA 3FD9A 4GHLA 1EE8A 3E9SA 3HKPA 4A3VB 1NV9A 4P16A 3RGSA 3VK8A 3L2AA 1DGHA 3QYEA 2KDLA 5KQDA 3J7AS 4LJ9A 2WZJA 2J7NA 3VKGA 2R62A 2DWNA 1ZV1A 4MGKE 3U6QA 3R9XB 4LGMA 1YLAA 4KLNA 4PT5A 4RKUF 2F5SA 4CHTB 5KQ8A 3U5ZB 3HWSA 3NWLA 3UGJA 3THGA 3ZCBB 3SHGB 5FSWA 3U60A 3U60B 1L1ZA 1TH4A 2JWSA 2JP7A 3GQ5A 4OVZB 3HHWA 4G4OA 1IN6A 5DYGA 5EXXA 4AKGA 3LQRA 2XFTA 2KA6B 2CFOA 1Z6TA 3LQQA 1L8QA 3SAVA 2D7GA 3GLIB 3DFZA 3QAUA 1C1KA 3KSXA 2XZFA 3J80S 2LWXA 4WW0A 1V34A 2DWZB 1E9SA 3K2LA 3B89A 5C18A 2YFQA 4DR1M 3U61A 3RFWA 1PJIA 1IM2A 4B7FA 1SXJE 2P5TA 3B74A 3PFIA 2LHCA 4OX9M 3FTEA 3JAMS 4B7GA 4IBJA 1PJJA 4JV5M 1NHGC 3KP0E 5E26A 4B3MM 2APLA 1T3TA 4IJEA 2M5ZA 4DV6M 4GH9A 4XBOA 3V76A 4I4LA 1HNWM 4QHSA 4LJ5A 4L8RC 3GLGE 3GLFA 3LCUA 1TH2A 4B7HA 4XK8F 1L2DA 2JZ1A 2G8LA 3HHXA 3LW5F 1HNXM 2I7NA 1RU3A 1G4AE 2L6OA 2YR0A 1IY1A 4GMQA 2XF3A 3SFZA 5EXSA 2K6BA 3UZUA 5ITUA 1OAIA 3U6CA 3FUXA 2EJSA 1NNUC 2KEBA 4BLCA 4JI6M 4B3RM 5F3WA 2R18A 5EQTA 4DV3M 2DAKA 3I4YA 4AQYM 4IBKA 1Q39A 4D81A 2CE7A 2LHGA 3KFUG 3KDSE 3LMMA
chains in the Genus database with same CATH topology
1NV8A 1Q02A 2JY8A 1V92A 1ZMWA 1TTEA 2LVNC 3F92A 1R4GA 1TR8A 2QSFX 2DI0A 1HT2E 2DAGA 2OO9A 2DKLA 2JY5A 1UFZA 3MMPA 1KYIA 1GO5A 1EFUB 2JY7A 2L4FA 2B3TA 2KNVA 3K9OA 3FE3A 1VQ1A 2OOAA 3E46A 2QNJA 2EKKA 1VDLA 1WJ7A 1G3IA 1A5TA 1DO2A 2JUJA 1WHCA 2K9DA 1OQYA 1VEGA 2DZLA 2DENA 1HQYE 2DAMA 2KNZA 2LBCA 1WGNA 1F4IA 4R71A 1WGLA 2BWBA 1OKSA 3E21A 2LTUA 4F2LA 1QZEA 2DHYA 2QHOB 1NV9A 2JY6B 1ZMVA 1SG9A 2LVAA 3T6PA 2WZJA 2G3QA 1ZV1A 1YLAA 2RRUA 2K0BX 1C7YA 1VG5A 2BWEA 1MN3A 1P3QQ 1BVSA 2MR9A 2DAEA 1JR3E 2CP8A 1XXHE 1IXSA 2JP7A 1XB2B 3IHPA 2KNAA 3BBZA 2JNHA 2ZTCA 1HT1E 2KHHA 2HWJA 2MJ5B 1VEKA 1T43A 3B89A 2L4EA 2JZ0A 2O25A 3IECA 1IM2A 5DFLA 3GLHE 1DO0A 3FRHA 2MGWA 3LCVB 3GLFE 3H4JA 3FRIA 2DAIA 1IFYA 3GLIE 1DV0A 2OOBA 4UN2B 1PGYA 1VEJA 4GEWA 1E94E 2LVPC 1WR1B 2CWBA 3GLGE 2DNAA 2MROB 3LCUA 1Y8GA 2JZ1A 4WP2A 2LVOC 4Q7JA 1G4AE 1CUKA 5JI2E 1OAIA 1T6OA 2EJSA 2LVQD 2R0IA 2HAKA 2ZTDA 1HJPA 2DAKA 3K9PA 4G3OA 1G41A 4DBGB 4F1IA 1AIPC 2L2DA 1ZMUA 2EKFA 4HEOA 2H5XA 1WIVA 1OTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV8 A;  1Q02 A;  2JY8 A;  1V92 A;  1ZMW A;  1TTE A;  2LVN C;  3F92 A;  1R4G A;  1TR8 A;  2QSF X;  2DI0 A;  1HT2 E;  2DAG A;  2OO9 A;  2DKL A;  2JY5 A;  1UFZ A;  3MMP A;  1KYI A;  1GO5 A;  1EFU B;  2JY7 A;  2L4F A;  2B3T A;  2KNV A;  3K9O A;  3FE3 A;  1VQ1 A;  2OOA A;  3E46 A;  2QNJ A;  2EKK A;  1VDL A;  1WJ7 A;  1G3I A;  1A5T A;  1DO2 A;  2JUJ A;  1WHC A;  2K9D A;  1OQY A;  1VEG A;  2DZL A;  2DEN A;  1HQY E;  2DAM A;  2KNZ A;  2LBC A;  1WGN A;  1F4I A;  4R71 A;  1WGL A;  2BWB A;  1OKS A;  3E21 A;  2LTU A;  4F2L A;  1QZE A;  2DHY A;  2QHO B;  1NV9 A;  2JY6 B;  1ZMV A;  1SG9 A;  2LVA A;  3T6P A;  2WZJ A;  2G3Q A;  1ZV1 A;  1YLA A;  2RRU A;  2K0B X;  1C7Y A;  1VG5 A;  2BWE A;  1MN3 A;  1P3Q Q;  1BVS A;  2MR9 A;  2DAE A;  1JR3 E;  2CP8 A;  1XXH E;  1IXS A;  2JP7 A;  1XB2 B;  3IHP A;  2KNA A;  3BBZ A;  2JNH A;  2ZTC A;  1HT1 E;  2KHH A;  2HWJ A;  2MJ5 B;  1VEK A;  1T43 A;  3B89 A;  2L4E A;  2JZ0 A;  2O25 A;  3IEC A;  1IM2 A;  5DFL A;  3GLH E;  1DO0 A;  3FRH A;  2MGW A;  3LCV B;  3GLF E;  3H4J A;  3FRI A;  2DAI A;  1IFY A;  3GLI E;  1DV0 A;  2OOB A;  4UN2 B;  1PGY A;  1VEJ A;  4GEW A;  1E94 E;  2LVP C;  1WR1 B;  2CWB A;  3GLG E;  2DNA A;  2MRO B;  3LCU A;  1Y8G A;  2JZ1 A;  4WP2 A;  2LVO C;  4Q7J A;  1G4A E;  1CUK A;  5JI2 E;  1OAI A;  1T6O A;  2EJS A;  2LVQ D;  2R0I A;  2HAK A;  2ZTD A;  1HJP A;  2DAK A;  3K9P A;  4G3O A;  1G41 A;  4DBG B;  4F1I A;  1AIP C;  2L2D A;  1ZMU A;  2EKF A;  4HEO A;  2H5X A;  1WIV A;  1OTR A; 
#chains in the Genus database with same CATH topology
 4DV7 M;  1IBK M;  1NV8 A;  3FYD A;  2Y0T A;  1TGU A;  2JXN A;  2VQE M;  1Q02 A;  1ZMW A;  4AKH A;  5IWA M;  2XZU A;  2XEP A;  1IQP A;  2XSZ D;  4L4U A;  3TWL A;  4LF5 M;  5A2Q S;  2DI0 A;  3FTD A;  4IIW A;  1HT2 E;  4NSR A;  5H37 D;  4X65 M;  3KP1 E;  3GPU A;  2JY5 A;  4LFA M;  3D8B A;  1I94 M;  1EFU B;  2ZBK B;  4Z8X A;  3I01 M;  4LFC M;  2Z4R A;  4X62 M;  3U6P A;  3L25 A;  3SAW A;  1VQ1 A;  2OOA A;  3E46 A;  2CV0 A;  1J5E M;  1NSF A;  2VF8 A;  4B3T M;  2QBY A;  3A98 B;  3AL0 C;  1WJ7 A;  1G3I A;  3LVW A;  3PNY A;  4ZPX A;  3M7G A;  3M6A A;  2LH0 A;  2MH8 A;  3DZD A;  1E32 A;  1E9R A;  4FCT A;  2DVW B;  1NO1 A;  2HCB A;  1G71 A;  3U6M A;  3U6O A;  4LY6 A;  2G5G X;  4KO8 A;  2LBC A;  4XGI A;  4R71 A;  1OIP A;  1WGL A;  2BWB A;  3GPP A;  3VFD A;  4F2L A;  3MJ5 A;  1H6U A;  4JI3 M;  1SXJ A;  4YHH M;  4IBG A;  1TF0 B;  4LJ7 A;  4IBD A;  1PJT A;  1DGF A;  3BXW A;  4W5W A;  3AFH A;  5EP2 A;  1XC8 A;  2RGH A;  3L26 A;  1EIJ A;  2QP9 X;  1ZMV A;  2EO2 A;  1GKI A;  4KHP M;  3T6P A;  2Z4S A;  3FUW A;  4QNR A;  4LGY A;  3RGP A;  2N35 A;  1Z5B A;  2RRU A;  2ZAO A;  4IBI A;  4L6V 6;  3RE8 A;  5DNY A;  1ORY B;  3TL4 X;  4BB9 A;  3SMP A;  2BWE A;  1QYR A;  1P3Q Q;  1BVS A;  3C3D A;  2KRU A;  2MR9 A;  5ITX E;  1ZAE A;  4MB7 A;  2ZAN A;  2EUC A;  1KFV A;  2QBY B;  1GL6 A;  1GLN A;  1JR3 E;  2CP8 A;  2Y21 A;  4FW9 A;  1IXS A;  2HHH M;  4QOZ C;  3GRU A;  4REZ A;  4JI2 M;  2F4V M;  3GPY A;  5C1B A;  3Q8X A;  2ZTC A;  2BNK A;  3I4V A;  4MGZ E;  3ZH9 B;  2CEA A;  4OW0 A;  4DR2 M;  1HT1 E;  2DHR A;  3J7B A;  1NHW C;  2L7I A;  1IY0 A;  2HWJ A;  4IBE A;  1VEK A;  2WSC F;  3K8Z A;  3L28 A;  1HNZ M;  4Z6Y A;  1SXJ B;  2JZ0 A;  2Z7J A;  3TQS A;  3A46 A;  1JQJ C;  3FUT A;  3GLH E;  1DO0 A;  4L16 A;  3LCV B;  4OU7 A;  3GLF E;  2J7O A;  3KVW A;  1G8P A;  2DAI A;  3GRV A;  5FTJ A;  1Q3B A;  3SMS A;  5KPZ A;  4UN2 B;  1IBM M;  3T1Y M;  2F5P A;  4DV2 M;  1NJF A;  3UMM A;  1QDR A;  1S3S A;  3AOE C;  1E94 E;  2CWB A;  5EXP A;  4LF9 M;  4DV0 M;  4DUY M;  3PXG A;  3HZJ A;  4LJA A;  1Y8G A;  2HL7 A;  4WP2 A;  3GP1 A;  2LVO C;  2UXD M;  1XHB A;  4GHA A;  1IXR C;  4QOS A;  3H4M A;  1IY2 A;  1G59 A;  4IBC A;  2WSE F;  3ZQJ A;  1DGB A;  2LVQ D;  2HAK A;  1HJP A;  3K9P A;  5EP3 A;  4RNA A;  1AIP C;  1ZMU A;  2EKF A;  2DZN B;  3SYL A;  4EIW A;  2CHQ A;  4LCB A;  4MGY E;  3HJS A;  2OOB A;  1OTR A;  1D2N A;  2AHM A;  4LFB M;  1OAO C;  4Y28 F;  4DR6 M;  5KPT A;  2JY8 A;  3KOY E;  2C5R A;  1QVR A;  1TTE A;  2GNO A;  4RF0 A;  3TWK A;  3UJN A;  2LVN C;  1SXJ D;  2R44 A;  2DWL A;  4JI4 M;  2FH0 A;  1TR8 A;  1XNQ M;  3SBJ A;  2DAG A;  4I81 A;  2OO9 A;  1QQW A;  1NY5 A;  2YNM D;  1NVM A;  2DKL A;  1JB0 F;  3HHY A;  3T1H M;  1LV7 A;  1UFZ A;  4JI5 M;  3MMP A;  2M60 A;  4GIP A;  1GO5 A;  2L4F A;  2B3T A;  3WHK A;  1K82 A;  2UU9 M;  3FE3 A;  3K1J A;  1GVN A;  1Z5C A;  1JR3 A;  1UM8 A;  4FWG A;  4LF4 M;  2CRU A;  1VDL A;  1QAM A;  4JYA M;  1DO2 A;  2JUJ A;  1WHC A;  4ITQ A;  2O5R A;  4DR3 M;  4M9Z A;  3B7Z A;  1VEG A;  4NXN M;  2DEN A;  2VQF M;  3AV0 A;  2JA2 A;  4PDI A;  4DV5 M;  2R4J A;  1L2B A;  3W68 A;  4GKK M;  1OKS A;  2KRK A;  3GLH A;  1QZE A;  1R7R A;  1NNJ A;  1AUA A;  2DHY A;  3W0F A;  2QHO B;  3A45 A;  4NRW A;  2JY6 B;  3GLI A;  4L78 A;  3HGI A;  1YSY A;  1WXQ A;  4LRS A;  4QHT A;  3KOW E;  2G3Q A;  3GRR A;  2XSZ A;  1LTM A;  1TDH A;  2D7E A;  1VG5 A;  1N77 A;  4GKJ M;  4B3S M;  2KZS A;  2NQ8 C;  3C3E A;  3M0E A;  3GPX A;  3ILK A;  2R45 A;  2R6F A;  1XB2 B;  2ERC A;  3GRY A;  7CAT A;  2O01 F;  2FNA A;  3IHP A;  4MGH A;  4MGI E;  1OIZ A;  3BBZ A;  2H1R A;  1DGH B;  8CAT A;  2Y20 A;  5IRE B;  2CV1 A;  4G4N A;  2C99 A;  3W0L B;  2KHH A;  4CIS A;  4CGY B;  1IN5 A;  3SHF A;  5ITT A;  2L4E A;  3FUU A;  2C9C A;  2O25 A;  4JN6 A;  5DFL A;  3FRH A;  1L2C A;  4KT0 F;  1X37 A;  3FKE A;  2ZAM A;  3EIE A;  2BJW A;  4DR5 M;  3FRI A;  1N36 M;  4IBB A;  3SAT A;  3AOG A;  3HJ8 A;  1IXS B;  1IFY A;  2UXC M;  2K47 A;  4AW4 A;  3GLI E;  1QUS A;  2UUB M;  1DV0 A;  3JR5 A;  2X49 A;  1PGY A;  1VEJ A;  2QZ4 A;  2V6Z M;  2LVP C;  4I5S A;  2CUZ A;  5EXT A;  4CJ6 A;  4D80 A;  1IN7 A;  2DNA A;  4LJ4 A;  2FS1 A;  3IG5 A;  4JI1 M;  3HJQ A;  4Q7J A;  1SXJ C;  3VLF B;  3WHL A;  2L7H A;  4QNM A;  3UK6 A;  4R3D A;  5BPV A;  2CV2 A;  2R4E A;  3TE6 A;  1FJG M;  1GJS A;  1N78 A;  3T38 A;  3CTW B;  5FTL A;  1PJQ A;  4DV4 M;  2R0I A;  1L1T A;  1OFI A;  2ZTD A;  4IJF A;  4JXJ A;  4G3O A;  2KW0 A;  3K92 A;  5FTK A;  5GKN A;  3HU2 A;  4X66 M;  1G41 A;  4F1I A;  3EIH A;  1R2Y A;  1K3W A;  2L2D A;  1QZM A;  2V1U A;  2HKJ A;  4P17 A;  2D7H A;  4HEO A;  4ANR A;  2H5X A;  4G4R A;  1IBL M;  4NXM M;  2DWM A;  2RGO A;  1GAB A;  1FNN A;  3SYK A;  4LG2 A;  3U6E A;  1IN8 A;  3VKH A;  1MX0 A;  4GIT A;  1Q3C A;  1V92 A;  2YQZ A;  4LRT A;  4FCW A;  1R4G A;  4HLQ A;  1IN4 A;  3U6S A;  2F5O A;  4I8O A;  5ITR A;  5FLX S;  1PM5 A;  2OPF A;  3T15 A;  1XNR M;  3KOX E;  1NY6 A;  2R46 A;  3SAS A;  2JY7 A;  2V1C A;  2KNV A;  4FCV A;  3K9O A;  4BBA A;  1HQC A;  1R5L A;  1Z59 A;  4GRI A;  4FVM A;  3LVV A;  4NL4 H;  3A42 A;  4LJ8 A;  1XXH A;  5FTN A;  4CIZ A;  2EKK A;  2Q2E B;  3HU1 A;  2BJV A;  1KSF X;  3U6D A;  3AJI B;  3FTF A;  3QYB A;  1R2Z A;  1V33 A;  4D82 A;  2F5N A;  2Z3X A;  2C96 A;  4DV1 M;  1OQY A;  2OQ4 A;  1YUB A;  4NSO B;  2UUA M;  2L09 A;  2DZL A;  2VDB B;  2GQF A;  2WSF F;  4R7G A;  3GO8 A;  1QAN A;  4HL4 A;  1HQY E;  2DZO B;  4DR4 M;  3TWM A;  1F4I A;  1XMQ M;  4K0K M;  1OJL A;  4L15 A;  3SAU A;  2LXE A;  1TH3 A;  2Y0Q A;  4NRV A;  3FUV A;  4WUR A;  2EA0 A;  4LF7 M;  1D0K A;  4DR7 M;  2FE8 A;  1QAO A;  1SG9 A;  2LVA A;  2W82 A;  4AKI A;  1D0M A;  4LF6 M;  1R6B X;  3DOA A;  3L29 A;  2K0B X;  2Z8Y M;  5EP4 A;  3FTC A;  4YY3 M;  1C7Y A;  3TPZ A;  4MM3 B;  1MN3 A;  4M0W A;  2DAE A;  1GL7 A;  3DA1 A;  3MK6 A;  5EJC A;  3GLF B;  1XXH E;  2XH9 A;  1HR0 M;  1W5T A;  3GLH B;  3GLG B;  1N33 M;  2R65 A;  1IXZ A;  4G6Z A;  2XLJ A;  2CHV A;  2C9O A;  3Q8G A;  4RF1 A;  4LZZ A;  3VK7 A;  2KNA A;  3J2P B;  3HHZ A;  4TUW A;  2JNH A;  2QCU A;  2F5Q A;  4MH0 E;  1J09 A;  3GQ4 A;  1GJT A;  5ITX A;  3OTO M;  1N32 M;  5FTM A;  4FD2 A;  1DGG A;  2MJ5 B;  5L8R F;  3PVS A;  4M0D A;  3U6L A;  1T43 A;  3J81 S;  1PRB A;  5LMU M;  3IEC A;  1QDT A;  3NBI A;  1N75 A;  2MGW A;  1PJS A;  4AG5 A;  3H4J A;  3W67 A;  2ZM6 M;  3VDP A;  3NBX X;  3MHV C;  5KO3 A;  4PDG A;  3CF0 A;  1OFH A;  2I7P A;  3KXE C;  1NJG A;  2X4A A;  1I4W A;  2QEN A;  3L27 A;  4GEW A;  4B08 A;  3U5Z A;  1WR1 B;  3PNV A;  3I51 A;  2QQ8 A;  1MJG M;  3VDU A;  3QWL A;  3ZC7 B;  1TDZ A;  5LMN M;  2MRO B;  2X8A A;  1XXH B;  2VII A;  4X64 M;  2KZU A;  4GC5 A;  1CUK A;  4G4Q A;  5JI2 E;  3HY5 A;  2C98 A;  1T6O A;  3IG8 A;  4NC6 A;  3HX3 A;  4IBF A;  4DUZ M;  5DYI A;  5IZ7 D;  2LNH C;  2KXE A;  3GLG A;  2FFJ A;  5E6J A;  4DBG B;  5BR8 M;  5ITQ A;  3I04 M;  2FOI C;  5EP1 A;  1Z5A A;  3U61 B;  4AI6 A;  1YE9 A;  4JI0 M;  1WIV A;  3CGW A;  4M9S A;  3SAR A;  3E4R A;  3B7Q A;  2CHG A;  3KOZ E;  5KPR A;  3R8F A;  3F92 A;  3GQ3 A;  4LF8 M;  2A5Y B;  3KS8 A;  1XWI A;  2QPA A;  3B7N A;  5ITY A;  3D8L A;  4NOO B;  3CF2 A;  4GC9 A;  4AG6 A;  2QSF X;  4S12 A;  1JR3 D;  1N34 M;  4LZJ A;  1D0L A;  4M9X A;  1XMO M;  5IT9 S;  1KYI A;  1QUT A;  3CF6 E;  4LJ6 A;  2E5L M;  2VF7 A;  3C9P A;  1MU5 A;  4OVZ A;  2UXB M;  4JI7 M;  3J27 B;  2RKO A;  4FWD A;  1J7K A;  2J5Y A;  2QNJ A;  4II7 A;  3KS4 A;  3SC3 A;  3KW6 A;  4PCZ A;  3HU3 A;  1A5T A;  2UUC M;  3KSJ A;  3B9P A;  1K3X A;  2K9D A;  2XFS A;  4FWH A;  4AZF A;  5JI3 E;  4KOD A;  3AOE A;  2DXI A;  3JR4 A;  3C58 A;  4PD2 A;  2DAM A;  2KNZ A;  1WGN A;  3AKZ A;  3FYC A;  2XGN A;  3BOS A;  3E21 A;  1QAQ A;  2LTU A;  4JI8 M;  1W5S A;  1ZQ9 A;  1VDD A;  3FD9 A;  4GHL A;  1EE8 A;  3E9S A;  3HKP A;  4A3V B;  1NV9 A;  4P16 A;  3RGS A;  3VK8 A;  3L2A A;  1DGH A;  3QYE A;  2KDL A;  5KQD A;  3J7A S;  4LJ9 A;  2WZJ A;  2J7N A;  3VKG A;  2R62 A;  2DWN A;  1ZV1 A;  4MGK E;  3U6Q A;  3R9X B;  4LGM A;  1YLA A;  4KLN A;  4PT5 A;  4RKU F;  2F5S A;  4CHT B;  5KQ8 A;  3U5Z B;  3HWS A;  3NWL A;  3UGJ A;  3THG A;  3ZCB B;  3SHG B;  5FSW A;  3U60 A;  3U60 B;  1L1Z A;  1TH4 A;  2JWS A;  2JP7 A;  3GQ5 A;  4OVZ B;  3HHW A;  4G4O A;  1IN6 A;  5DYG A;  5EXX A;  4AKG A;  3LQR A;  2XFT A;  2KA6 B;  2CFO A;  1Z6T A;  3LQQ A;  1L8Q A;  3SAV A;  2D7G A;  3GLI B;  3DFZ A;  3QAU A;  1C1K A;  3KSX A;  2XZF A;  3J80 S;  2LWX A;  4WW0 A;  1V34 A;  2DWZ B;  1E9S A;  3K2L A;  3B89 A;  5C18 A;  2YFQ A;  4DR1 M;  3U61 A;  3RFW A;  1PJI A;  1IM2 A;  4B7F A;  1SXJ E;  2P5T A;  3B74 A;  3PFI A;  2LHC A;  4OX9 M;  3FTE A;  3JAM S;  4B7G A;  4IBJ A;  1PJJ A;  4JV5 M;  1NHG C;  3KP0 E;  5E26 A;  4B3M M;  2APL A;  1T3T A;  4IJE A;  2M5Z A;  4DV6 M;  4GH9 A;  4XBO A;  3V76 A;  4I4L A;  1HNW M;  4QHS A;  4LJ5 A;  4L8R C;  3GLG E;  3GLF A;  3LCU A;  1TH2 A;  4B7H A;  4XK8 F;  1L2D A;  2JZ1 A;  2G8L A;  3HHX A;  3LW5 F;  1HNX M;  2I7N A;  1RU3 A;  1G4A E;  2L6O A;  2YR0 A;  1IY1 A;  4GMQ A;  2XF3 A;  3SFZ A;  5EXS A;  2K6B A;  3UZU A;  5ITU A;  1OAI A;  3U6C A;  3FUX A;  2EJS A;  1NNU C;  2KEB A;  4BLC A;  4JI6 M;  4B3R M;  5F3W A;  2R18 A;  5EQT A;  4DV3 M;  2DAK A;  3I4Y A;  4AQY M;  4IBK A;  1Q39 A;  4D81 A;  2CE7 A;  2LHG A;  3KFU G;  3KDS E;  3LMM A; 
#chains in the Genus database with same CATH homology
 1NV8 A;  1Q02 A;  2JY8 A;  1V92 A;  1ZMW A;  1TTE A;  2LVN C;  3F92 A;  1R4G A;  1TR8 A;  2QSF X;  2DI0 A;  1HT2 E;  2DAG A;  2OO9 A;  2DKL A;  2JY5 A;  1UFZ A;  3MMP A;  1KYI A;  1GO5 A;  1EFU B;  2JY7 A;  2L4F A;  2B3T A;  2KNV A;  3K9O A;  3FE3 A;  1VQ1 A;  2OOA A;  3E46 A;  2QNJ A;  2EKK A;  1VDL A;  1WJ7 A;  1G3I A;  1A5T A;  1DO2 A;  2JUJ A;  1WHC A;  2K9D A;  1OQY A;  1VEG A;  2DZL A;  2DEN A;  1HQY E;  2DAM A;  2KNZ A;  2LBC A;  1WGN A;  1F4I A;  4R71 A;  1WGL A;  2BWB A;  1OKS A;  3E21 A;  2LTU A;  4F2L A;  1QZE A;  2DHY A;  2QHO B;  1NV9 A;  2JY6 B;  1ZMV A;  1SG9 A;  2LVA A;  3T6P A;  2WZJ A;  2G3Q A;  1ZV1 A;  1YLA A;  2RRU A;  2K0B X;  1C7Y A;  1VG5 A;  2BWE A;  1MN3 A;  1P3Q Q;  1BVS A;  2MR9 A;  2DAE A;  1JR3 E;  2CP8 A;  1XXH E;  1IXS A;  2JP7 A;  1XB2 B;  3IHP A;  2KNA A;  3BBZ A;  2JNH A;  2ZTC A;  1HT1 E;  2KHH A;  2HWJ A;  2MJ5 B;  1VEK A;  1T43 A;  3B89 A;  2L4E A;  2JZ0 A;  2O25 A;  3IEC A;  1IM2 A;  5DFL A;  3GLH E;  1DO0 A;  3FRH A;  2MGW A;  3LCV B;  3GLF E;  3H4J A;  3FRI A;  2DAI A;  1IFY A;  3GLI E;  1DV0 A;  2OOB A;  4UN2 B;  1PGY A;  1VEJ A;  4GEW A;  1E94 E;  2LVP C;  1WR1 B;  2CWB A;  3GLG E;  2DNA A;  2MRO B;  3LCU A;  1Y8G A;  2JZ1 A;  4WP2 A;  2LVO C;  4Q7J A;  1G4A E;  1CUK A;  5JI2 E;  1OAI A;  1T6O A;  2EJS A;  2LVQ D;  2R0I A;  2HAK A;  2ZTD A;  1HJP A;  2DAK A;  3K9P A;  4G3O A;  1G41 A;  4DBG B;  4F1I A;  1AIP C;  2L2D A;  1ZMU A;  2EKF A;  4HEO A;  2H5X A;  1WIV A;  1OTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...