1VEKA

Solution structure of rsgi ruh-011, a uba domain from arabidopsis cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
GSSGSSGGEELLPDGVPEEVMESAQPVANEEIVAQLVSMGFSQLHCQKAAINTSNAGVEEAMNWLLSHMDDPDIDAPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin-specific protease 14, putative
publication title Solution Structure of RSGI RUH-011, a UBA Domain from Arabidopsis cDNA
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 13
structure length 84
sequence length 84
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vekA01
1ZMUA 1PGYA 2CP8A 1AIPC 2DAMA 2JY6B 1OAIA 2QNJA 1KYIA 2ZTCA 1HJPA 1Y8GA 3GLGE 1G4AE 2MR9A 1IXSA 4HEOA 5DFLA 3BBZA 2MROB 1G3IA 2L2DA 1NV8A 3IHPA 2LVQD 1IFYA 2HWJA 4WP2A 3FRHA 1NV9A 1T43A 1TTEA 1SG9A 2DNAA 2B3TA 4Q7JA 1TR8A 2L4EA 2WZJA 2O25A 2BWEA 2LVPC 2MJ5B 4GEWA 2MGWA 1XXHE 1HQYE 2RRUA 3E46A 3FE3A 1GO5A 1WJ7A 2LBCA 4F2LA 3GLHE 1IM2A 2DENA 1T6OA 1YLAA 3F92A 1C7YA 2JNHA 2EKKA 4F1IA 2DZLA 2HAKA 2JZ0A 2LVOC 3MMPA 3E21A 2EKFA 2EJSA 3B89A 3GLFE 2CWBA 2H5XA 1WGNA 2LTUA 1UFZA 1V92A 5JI2E 1VEGA 3H4JA 2G3QA 2OOAA 1XB2B 1VG5A 2DAIA 3IECA 1VEJA 2DAEA 2OOBA 3FRIA 1ZV1A 2DAGA 1DV0A 2DHYA 1WGLA 1VEKA 2JY7A 1CUKA 2L4FA 1E94E 2LVNC 1HT1E 1VDLA 1OTRA 2ZTDA 3GLIE 1G41A 1Q02A 1QZEA 1EFUB 2JZ1A 2QSFX 2QHOB 2DI0A 1ZMVA 3K9OA 2JP7A 3LCUA 1WHCA 1WR1B 3LCVB 1DO2A 3T6PA 1DO0A 1JR3E 1P3QQ 2LVAA 3K9PA 1VQ1A 2BWBA 2JUJA 1A5TA 1BVSA 2DAKA 2DKLA 4UN2B 2KNZA 4DBGB 2K9DA 1HT2E 1WIVA 1F4IA 2JY8A 1R4GA 2OO9A 1OKSA 1ZMWA 1MN3A 4R71A 2R0IA 2KNAA 4G3OA 2K0BX 2KHHA 2KNVA 2JY5A 1OQYA
chains in the Genus database with same CATH superfamily
1QDTA 1PGYA 3DA1A 2CP8A 1SXJC 1TGUA 2CHQA 2WSFF 3L27A 5ITRA 2BJVA 4AG6A 2KZUA 2QNJA 5BPVA 2CUZA 1KYIA 3JR4A 3RGSA 3CGWA 4FWHA 5FTMA 1HJPA 1Y8GA 4IBCA 3U6PA 1K82A 2Y0TA 3GLGE 1L2CA 4LCBA 1XMQM 3KP0E 4KT0F 4LY6A 2ZM6M 2MROB 1G3IA 4L6V6 3U60B 1EIJA 1MJGM 2JXNA 4OVZA 1NV9A 2CE7A 2FFJA 2LNHC 1TTEA 2DNAA 2B3TA 4Q7JA 4FCVA 5KPZA 4G4OA 2WZJA 2C9OA 1IN6A 1J09A 1PJSA 3QWLA 5EQTA 1QAQA 3WHLA 7CATA 2V1CA 2XF3A 3GLHE 1R2ZA 2M5ZA 3U6DA 3VKHA 4JI3M 3HZJA 2XFSA 3KDSE 1IBLM 1V34A 4JI6M 3ILKA 2EA0A 1C7YA 3AOGA 2EKKA 4IJFA 4F1IA 2KRUA 1NSFA 2HAKA 2UXCM 2LVOC 3KFUG 5DYGA 3AL0C 3B89A 3AOEA 3U6MA 3U5ZB 4DV0M 3J80S 2C9CA 2QZ4A 2D7EA 4GMQA 4IBGA 5KPRA 1HQCA 5BR8M 1N32M 4Z8XA 2R46A 3H4JA 4JXJA 2Z4RA 4LGYA 2R4EA 3L29A 2Q2EB 1IXSB 1XNRM 1PJQA 2F5OA 2DAIA 3GLFA 2DXIA 1KSFX 3GRVA 3J7BA 3AFHA 4BB9A 3R9XB 2G5GX 1ZV1A 3MJ5A 3GLGB 4DR6M 4DV7M 2XGNA 4NXNM 3VFDA 2R18A 3HHXA 1E9SA 1VEKA 1K3WA 3TPZA 3U6SA 1R6BX 2JY7A 1HNZM 1CUKA 4LJ9A 4B7GA 4YHHM 2R45A 2I7PA 1JB0F 1NJFA 3K8ZA 4FCWA 3FYCA 4MGIE 4D82A 3GLIE 4L8RC 1PJJA 4G6ZA 4G4RA 2CEAA 3GPXA 3KP1E 3B7QA 3BXWA 3FUWA 2DI0A 2CHGA 2YQZA 3KOYE 1NNJA 4JYAM 3HWSA 1D0LA 2YR0A 3HGIA 3GLHB 3RGPA 2UUBM 3KOZE 2FH0A 3BOSA 4DV3M 5ITUA 2ZAMA 4LF8M 3HU2A 3NWLA 1P3QQ 3TE6A 3SAVA 1L1ZA 1IXRC 1XC8A 3J7AS 4DUZM 2BWBA 4GKJM 2BJWA 4S12A 5FTNA 1BVSA 2M60A 2NQ8C 3SMPA 1YUBA 2VQEM 4EIWA 1PJTA 5FTLA 2KNZA 4OU7A 1JR3A 2V1UA 4DBGB 2K9DA 1IBKM 1JQJC 3MK6A 2OO9A 3W67A 4MGHA 3TL4X 2HCBA 2XLJA 1MN3A 3T1HM 1L1TA 4HLQA 1FNNA 1L2DA 1GJTA 4K0KM 5C1BA 5DNYA 4B3SM 1ZAEA 4G3OA 3SMSA 2K0BX 2OPFA 5FLXS 4ANRA 1IY2A 2KNVA 2LWXA 3K2LA 3LQQA 4L16A 4LF5M 1IFYA 4X65M 4Z6YA 2XEPA 1S3SA 3V76A 4CISA 1OAIA 2N35A 3IG5A 3U5ZA 1GABA 3ZQJA 2F5PA 3KS8A 3PVSA 3W68A 3HKPA 4L4UA 1QDRA 2ZTCA 4KHPM 3I51A 4DR1M 3UGJA 3TWKA 2DWNA 3DFZA 4DV4M 2KZSA 1E9RA 1IXSA 5LMNM 4CJ6A 3SARA 1OIPA 2DHRA 2L09A 1X37A 1EE8A 2CRUA 2L2DA 2LVQD 4IBEA 4LF9M 3GLIB 4FWGA 3FYDA 2J5YA 4IBDA 4WP2A 1ORYB 3KSXA 5E6JA 1G71A 5EXPA 5EXSA 3VDUA 1MU5A 1SG9A 3TWLA 5JI3E 1J7KA 3AV0A 2L4EA 3FTCA 3HJSA 2UXBM 2O25A 1J5EM 4DR4M 5ITQA 2BWEA 2MH8A 4GEWA 5IREB 2QBYB 1XXHE 4G4NA 2X8AA 4X62M 2XSZD 3TWMA 1SXJB 2LBCA 1IN8A 4FCTA 1R5LA 2DENA 1T6OA 4BBAA 3F92A 1GLNA 3U6EA 2JNHA 3GPUA 1NY6A 1Z5CA 1XHBA 3QYBA 4R3DA 4QHSA 5A2QS 4JI7M 4QOZC 2DZNB 4XK8F 2R62A 4KO8A 2LH0A 3GLHA 1OFIA 4I8OA 1MX0A 4GIPA 2A5YB 2Z3XA 3B9PA 2CWBA 2H5XA 4JI5M 3LQRA 1PM5A 2C98A 3NBXX 2Z4SA 2D7GA 3CF2A 5C18A 1N78A 2R65A 3L25A 2OOAA 2VF8A 4Y28F 3GPYA 2WSEF 4M0DA 4QOSA 1VEJA 1GL6A 3U61A 4NC6A 2X49A 4LJ6A 2ZANA 1K3XA 2V6ZM 2QCUA 5ITXE 1IN4A 2DAGA 1N77A 4GKKM 3SBJA 2DHYA 2GNOA 1I94M 2RGOA 3SAWA 1NY5A 2P5TA 1QANA 4LF4M 4M9XA 4LF7M 1QUSA 1HT1E 1VDLA 1XWIA 1DGHB 2Y21A 4JI0M 4FD2A 3RFWA 3KXEC 3WHKA 2LHGA 1C1KA 3W0LB 2AHMA 1OIZA 4DR5M 2E5LM 3K9OA 2JP7A 1XXHB 4IBIA 5FTKA 5EXXA 3SHFA 5H37D 3CF6E 1WHCA 1XNQM 2J7NA 2VIIA 3M0EA 4X64M 1QVRA 2R4JA 3KS4A 3LMMA 3T6PA 3CTWB 4M9SA 1LTMA 2LVAA 4DR3M 1TH4A 1TDHA 2KA6B 3K9PA 1T3TA 1V33A 1QQWA 2O5RA 1KFVA 3VKGA 4D81A 4FWDA 1D0KA 2K47A 1NJGA 2DKLA 4DV1M 4ZPXA 3VLFB 4AG5A 3THGA 4I5SA 2F5NA 3C9PA 1HT2E 1WIVA 4LJAA 4OX9M 2JY8A 3GO8A 2I7NA 1OKSA 2Y0QA 2UUCM 4PCZA 1IY1A 2HKJA 3KOWE 1IBMM 1N33M 2KNAA 3U6LA 4GHAA 2F5SA 2CV2A 3EIEA 3LCVB 1OQYA 1ZMUA 3SAUA 4JI2M 1AIPC 2DAMA 2WSCF 3FUVA 4G4QA 2UUAM 4QNMA 3ZCBB 3U60A 1SXJE 3D8BA 4L78A 4WW0A 2EUCA 4P17A 3VK8A 3UK6A 3T15A 1G4AE 2MR9A 4LGMA 5KO3A 4IBFA 4HEOA 3J81S 2Y20A 3C58A 4IIWA 2YNMD 1SXJD 4ITQA 1NV8A 3IHPA 4MH0E 2HWJA 2ZBKB 5KPTA 4M0WA 2KDLA 3IG8A 5EP1A 3I4VA 1T43A 4IBJA 5EP2A 3KOXE 1TR8A 1WXQA 4RKUF 2MJ5B 3J2PB 4BLCA 1L2BA 3FE3A 4AI6A 1DGFA 1E32A 4LJ4A 1WJ7A 8CATA 4F2LA 4MGYE 4OVZB 3FUTA 4AKIA 2XSZA 1IM2A 2G8LA 3HU3A 1Z5AA 4CGYB 1Z5BA 1YLAA 3M6AA 4CHTB 3JAMS 2L6OA 4NOOB 2GQFA 1QAOA 4B7FA 1FJGM 1XXHA 2C96A 2R6FA 1YE9A 2FE8A 3MMPA 4M9ZA 3E21A 1UM8A 5LMUM 3GQ4A 3HHWA 2XZFA 2DWLA 4JI4M 2ZAOA 3L2AA 5GKNA 1NHGC 2DWZB 1V92A 3K92A 4L15A 2DVWB 3SC3A 4FVMA 5ITTA 2H1RA 3GLGA 2G3QA 1H6UA 2QPAA 3SATA 1XB2B 1VG5A 4LF6M 4LFBM 2YFQA 4NRVA 2CV1A 3SYLA 3MHVC 3AKZA 3OTOM 3IECA 4DUYM 2KEBA 3U6OA 1NO1A 4NL4H 2VF7A 3ZC7B 3FRIA 3QAUA 5F3WA 4GC9A 1HNWM 1AUAA 1WGLA 4DV6M 3FUXA 4KLNA 4YY3M 4B3MM 1NVMA 3I4YA 4D80A 2L4FA 1E94E 2LVNC 3GRRA 1GL7A 4II7A 2J7OA 3K1JA 5ITXA 4QNRA 1Q02A 3B74A 3DOAA 4LRSA 2JZ1A 1NNUC 2QSFX 3E4RA 4LZZA 5ITYA 3W0FA 4A3VB 2UXDM 3A45A 3LCUA 4XGIA 1PJIA 3QYEA 5L8RF 1WR1B 4I81A 1N75A 5IZ7D 1DGGA 3FD9A 3B7ZA 4RF1A 4DV2M 4GHLA 1DGBA 4JI8M 1Q3BA 2QQ8A 3UJNA 1IN7A 3VDPA 2L7IA 3E9SA 2D7HA 1A5TA 2QENA 5IT9S 3FTDA 4PT5A 3U6QA 2DZOB 4UN2B 4MM3B 4IBKA 2VDBB 4RNAA 1IXZA 5EJCA 3JR5A 4MB7A 1ZMWA 1RU3A 4W5WA 3UZUA 3NBIA 3U6CA 2CFOA 3DZDA 3SHGB 3FTFA 4JN6A 2XZUA 2KHHA 4AKGA 2KW0A 2X4AA 2JY5A 1G8PA 4DR7M 4QHTA 4P16A 3EIHA 4GITA 1TDZA 4LJ7A 2HHHM 3HHZA 2JY6B 3SASA 2HL7A 4IJEA 2JA2A 3GLIA 4GRIA 4B08A 4AW4A 3HX3A 5E26A 2VQFM 1QZMA 1Z59A 4GH9A 1OAOC 3LVWA 4MGZE 1QUTA 5DFLA 4LFAM 4AZFA 4PDIA 1PRBA 3BBZA 3RE8A 5KQDA 5KQ8A 2QBYA 2F4VM 3I04M 1IQPA 1Q3CA 4JV5M 1SXJA 3SYKA 1HR0M 3FRHA 3HU1A 3VK7A 4XBOA 3FTEA 4JI1M 3D8LA 2L7HA 4B7HA 2APLA 3GQ5A 1IN5A 2XH9A 2LVPC 1D0MA 2MGWA 1HQYE 2RRUA 3E46A 1GO5A 1OJLA 3T38A 3B7NA 1NHWC 4CIZA 3GP1A 1L8QA 2BNKA 3A98B 3H4MA 4IBBA 2C5RA 2O01F 3L28A 1TH3A 3C3EA 4GC5A 3FKEA 2DZLA 2JZ0A 3I01M 5EP3A 1W5SA 3GRUA 4RF0A 2JWSA 3TQSA 2FS1A 2DWMA 3PNYA 2EKFA 2EJSA 4MGKE 3GRYA 4REZA 3R8FA 3GLFE 5IWAM 4DV5M 1WGNA 2LTUA 3J27B 1W5TA 3ZH9B 1UFZA 3Q8XA 5JI2E 4NSOB 4R7GA 1VEGA 2F5QA 4LG2A 1GKIA 3A42A 3HY5A 2OQ4A 1Z6TA 4LRTA 3GPPA 2RGHA 4LZJA 5DYIA 1GVNA 2W82A 3KVWA 4OW0A 4PD2A 3LW5F 2DAEA 2Z7JA 2OOBA 2CV0A 1DGHA 2C99A 3SFZA 1DV0A 4I4LA 3FUUA 3M7GA 4LJ5A 4DR2M 3LVVA 4TUWA 1YSYA 3U61B 2K6BA 2CHVA 1D2NA 4KODA 2R44A 1Q39A 1GJSA 1R2YA 4B3RM 1OTRA 2ZTDA 3L26A 2FOIC 2KRKA 3C3DA 4HL4A 1N36M 1G41A 4WURA 1QZEA 1EFUB 2XFTA 2QHOB 5FTJA 1ZMVA 1HNXM 1LV7A 2ERCA 2UU9M 1I4WA 4NSRA 3HHYA 4LFCM 1N34M 5EXTA 1DO2A 2FNAA 4AKHA 1DO0A 1JR3E 1VDDA 3KSJA 3HJQA 3T1YM 3A46A 1XMOM 4B3TM 2LXEA 1VQ1A 2JUJA 2Z8YM 2LHCA 1QAMA 4PDGA 4NXMM 4AQYM 1R7RA 2DAKA 1G59A 1TF0B 1JR3D 3Q8GA 3GLFB 3HJ8A 5EP4A 1ZQ9A 3AJIB 2KXEA 3PFIA 2QP9X 1IY0A 3GQ3A 1F4IA 4X66M 4NRWA 1R4GA 3KW6A 1TH2A 3PNVA 5FSWA 3CF0A 4R71A 3UMMA 4LJ8A 2R0IA 1OFHA 2EO2A 1QYRA 2RKOA 3PXGA 4FW9A 3AOEC
chains in the Genus database with same CATH topology
1ZMUA 1PGYA 2CP8A 1AIPC 2DAMA 2JY6B 1OAIA 2QNJA 1KYIA 2ZTCA 1HJPA 1Y8GA 3GLGE 1G4AE 2MR9A 1IXSA 4HEOA 5DFLA 3BBZA 2MROB 1G3IA 2L2DA 1NV8A 3IHPA 2LVQD 1IFYA 2HWJA 4WP2A 3FRHA 1NV9A 1T43A 1TTEA 1SG9A 2DNAA 2B3TA 4Q7JA 1TR8A 2L4EA 2WZJA 2O25A 2BWEA 2LVPC 2MJ5B 4GEWA 2MGWA 1XXHE 1HQYE 2RRUA 3E46A 3FE3A 1GO5A 1WJ7A 2LBCA 4F2LA 3GLHE 1IM2A 2DENA 1T6OA 1YLAA 3F92A 1C7YA 2JNHA 2EKKA 4F1IA 2DZLA 2HAKA 2JZ0A 2LVOC 3MMPA 3E21A 2EKFA 2EJSA 3B89A 3GLFE 2CWBA 2H5XA 1WGNA 2LTUA 1UFZA 1V92A 5JI2E 1VEGA 3H4JA 2G3QA 2OOAA 1XB2B 1VG5A 2DAIA 3IECA 1VEJA 2DAEA 2OOBA 3FRIA 1ZV1A 2DAGA 1DV0A 2DHYA 1WGLA 1VEKA 2JY7A 1CUKA 2L4FA 1E94E 2LVNC 1HT1E 1VDLA 1OTRA 2ZTDA 3GLIE 1G41A 1Q02A 1QZEA 1EFUB 2JZ1A 2QSFX 2QHOB 2DI0A 1ZMVA 3K9OA 2JP7A 3LCUA 1WHCA 1WR1B 3LCVB 1DO2A 3T6PA 1DO0A 1JR3E 1P3QQ 2LVAA 3K9PA 1VQ1A 2BWBA 2JUJA 1A5TA 1BVSA 2DAKA 2DKLA 4UN2B 2KNZA 4DBGB 2K9DA 1HT2E 1WIVA 1F4IA 2JY8A 1R4GA 2OO9A 1OKSA 1ZMWA 1MN3A 4R71A 2R0IA 2KNAA 4G3OA 2K0BX 2KHHA 2KNVA 2JY5A 1OQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZMU A;  1PGY A;  2CP8 A;  1AIP C;  2DAM A;  2JY6 B;  1OAI A;  2QNJ A;  1KYI A;  2ZTC A;  1HJP A;  1Y8G A;  3GLG E;  1G4A E;  2MR9 A;  1IXS A;  4HEO A;  5DFL A;  3BBZ A;  2MRO B;  1G3I A;  2L2D A;  1NV8 A;  3IHP A;  2LVQ D;  1IFY A;  2HWJ A;  4WP2 A;  3FRH A;  1NV9 A;  1T43 A;  1TTE A;  1SG9 A;  2DNA A;  2B3T A;  4Q7J A;  1TR8 A;  2L4E A;  2WZJ A;  2O25 A;  2BWE A;  2LVP C;  2MJ5 B;  4GEW A;  2MGW A;  1XXH E;  1HQY E;  2RRU A;  3E46 A;  3FE3 A;  1GO5 A;  1WJ7 A;  2LBC A;  4F2L A;  3GLH E;  1IM2 A;  2DEN A;  1T6O A;  1YLA A;  3F92 A;  1C7Y A;  2JNH A;  2EKK A;  4F1I A;  2DZL A;  2HAK A;  2JZ0 A;  2LVO C;  3MMP A;  3E21 A;  2EKF A;  2EJS A;  3B89 A;  3GLF E;  2CWB A;  2H5X A;  1WGN A;  2LTU A;  1UFZ A;  1V92 A;  5JI2 E;  1VEG A;  3H4J A;  2G3Q A;  2OOA A;  1XB2 B;  1VG5 A;  2DAI A;  3IEC A;  1VEJ A;  2DAE A;  2OOB A;  3FRI A;  1ZV1 A;  2DAG A;  1DV0 A;  2DHY A;  1WGL A;  1VEK A;  2JY7 A;  1CUK A;  2L4F A;  1E94 E;  2LVN C;  1HT1 E;  1VDL A;  1OTR A;  2ZTD A;  3GLI E;  1G41 A;  1Q02 A;  1QZE A;  1EFU B;  2JZ1 A;  2QSF X;  2QHO B;  2DI0 A;  1ZMV A;  3K9O A;  2JP7 A;  3LCU A;  1WHC A;  1WR1 B;  3LCV B;  1DO2 A;  3T6P A;  1DO0 A;  1JR3 E;  1P3Q Q;  2LVA A;  3K9P A;  1VQ1 A;  2BWB A;  2JUJ A;  1A5T A;  1BVS A;  2DAK A;  2DKL A;  4UN2 B;  2KNZ A;  4DBG B;  2K9D A;  1HT2 E;  1WIV A;  1F4I A;  2JY8 A;  1R4G A;  2OO9 A;  1OKS A;  1ZMW A;  1MN3 A;  4R71 A;  2R0I A;  2KNA A;  4G3O A;  2K0B X;  2KHH A;  2KNV A;  2JY5 A;  1OQY A; 
#chains in the Genus database with same CATH topology
 1QDT A;  1PGY A;  3DA1 A;  2CP8 A;  1SXJ C;  1TGU A;  2CHQ A;  2WSF F;  3L27 A;  5ITR A;  2BJV A;  4AG6 A;  2KZU A;  2QNJ A;  5BPV A;  2CUZ A;  1KYI A;  3JR4 A;  3RGS A;  3CGW A;  4FWH A;  5FTM A;  1HJP A;  1Y8G A;  4IBC A;  3U6P A;  1K82 A;  2Y0T A;  3GLG E;  1L2C A;  4LCB A;  1XMQ M;  3KP0 E;  4KT0 F;  4LY6 A;  2ZM6 M;  2MRO B;  1G3I A;  4L6V 6;  3U60 B;  1EIJ A;  1MJG M;  2JXN A;  4OVZ A;  1NV9 A;  2CE7 A;  2FFJ A;  2LNH C;  1TTE A;  2DNA A;  2B3T A;  4Q7J A;  4FCV A;  5KPZ A;  4G4O A;  2WZJ A;  2C9O A;  1IN6 A;  1J09 A;  1PJS A;  3QWL A;  5EQT A;  1QAQ A;  3WHL A;  7CAT A;  2V1C A;  2XF3 A;  3GLH E;  1R2Z A;  2M5Z A;  3U6D A;  3VKH A;  4JI3 M;  3HZJ A;  2XFS A;  3KDS E;  1IBL M;  1V34 A;  4JI6 M;  3ILK A;  2EA0 A;  1C7Y A;  3AOG A;  2EKK A;  4IJF A;  4F1I A;  2KRU A;  1NSF A;  2HAK A;  2UXC M;  2LVO C;  3KFU G;  5DYG A;  3AL0 C;  3B89 A;  3AOE A;  3U6M A;  3U5Z B;  4DV0 M;  3J80 S;  2C9C A;  2QZ4 A;  2D7E A;  4GMQ A;  4IBG A;  5KPR A;  1HQC A;  5BR8 M;  1N32 M;  4Z8X A;  2R46 A;  3H4J A;  4JXJ A;  2Z4R A;  4LGY A;  2R4E A;  3L29 A;  2Q2E B;  1IXS B;  1XNR M;  1PJQ A;  2F5O A;  2DAI A;  3GLF A;  2DXI A;  1KSF X;  3GRV A;  3J7B A;  3AFH A;  4BB9 A;  3R9X B;  2G5G X;  1ZV1 A;  3MJ5 A;  3GLG B;  4DR6 M;  4DV7 M;  2XGN A;  4NXN M;  3VFD A;  2R18 A;  3HHX A;  1E9S A;  1VEK A;  1K3W A;  3TPZ A;  3U6S A;  1R6B X;  2JY7 A;  1HNZ M;  1CUK A;  4LJ9 A;  4B7G A;  4YHH M;  2R45 A;  2I7P A;  1JB0 F;  1NJF A;  3K8Z A;  4FCW A;  3FYC A;  4MGI E;  4D82 A;  3GLI E;  4L8R C;  1PJJ A;  4G6Z A;  4G4R A;  2CEA A;  3GPX A;  3KP1 E;  3B7Q A;  3BXW A;  3FUW A;  2DI0 A;  2CHG A;  2YQZ A;  3KOY E;  1NNJ A;  4JYA M;  3HWS A;  1D0L A;  2YR0 A;  3HGI A;  3GLH B;  3RGP A;  2UUB M;  3KOZ E;  2FH0 A;  3BOS A;  4DV3 M;  5ITU A;  2ZAM A;  4LF8 M;  3HU2 A;  3NWL A;  1P3Q Q;  3TE6 A;  3SAV A;  1L1Z A;  1IXR C;  1XC8 A;  3J7A S;  4DUZ M;  2BWB A;  4GKJ M;  2BJW A;  4S12 A;  5FTN A;  1BVS A;  2M60 A;  2NQ8 C;  3SMP A;  1YUB A;  2VQE M;  4EIW A;  1PJT A;  5FTL A;  2KNZ A;  4OU7 A;  1JR3 A;  2V1U A;  4DBG B;  2K9D A;  1IBK M;  1JQJ C;  3MK6 A;  2OO9 A;  3W67 A;  4MGH A;  3TL4 X;  2HCB A;  2XLJ A;  1MN3 A;  3T1H M;  1L1T A;  4HLQ A;  1FNN A;  1L2D A;  1GJT A;  4K0K M;  5C1B A;  5DNY A;  4B3S M;  1ZAE A;  4G3O A;  3SMS A;  2K0B X;  2OPF A;  5FLX S;  4ANR A;  1IY2 A;  2KNV A;  2LWX A;  3K2L A;  3LQQ A;  4L16 A;  4LF5 M;  1IFY A;  4X65 M;  4Z6Y A;  2XEP A;  1S3S A;  3V76 A;  4CIS A;  1OAI A;  2N35 A;  3IG5 A;  3U5Z A;  1GAB A;  3ZQJ A;  2F5P A;  3KS8 A;  3PVS A;  3W68 A;  3HKP A;  4L4U A;  1QDR A;  2ZTC A;  4KHP M;  3I51 A;  4DR1 M;  3UGJ A;  3TWK A;  2DWN A;  3DFZ A;  4DV4 M;  2KZS A;  1E9R A;  1IXS A;  5LMN M;  4CJ6 A;  3SAR A;  1OIP A;  2DHR A;  2L09 A;  1X37 A;  1EE8 A;  2CRU A;  2L2D A;  2LVQ D;  4IBE A;  4LF9 M;  3GLI B;  4FWG A;  3FYD A;  2J5Y A;  4IBD A;  4WP2 A;  1ORY B;  3KSX A;  5E6J A;  1G71 A;  5EXP A;  5EXS A;  3VDU A;  1MU5 A;  1SG9 A;  3TWL A;  5JI3 E;  1J7K A;  3AV0 A;  2L4E A;  3FTC A;  3HJS A;  2UXB M;  2O25 A;  1J5E M;  4DR4 M;  5ITQ A;  2BWE A;  2MH8 A;  4GEW A;  5IRE B;  2QBY B;  1XXH E;  4G4N A;  2X8A A;  4X62 M;  2XSZ D;  3TWM A;  1SXJ B;  2LBC A;  1IN8 A;  4FCT A;  1R5L A;  2DEN A;  1T6O A;  4BBA A;  3F92 A;  1GLN A;  3U6E A;  2JNH A;  3GPU A;  1NY6 A;  1Z5C A;  1XHB A;  3QYB A;  4R3D A;  4QHS A;  5A2Q S;  4JI7 M;  4QOZ C;  2DZN B;  4XK8 F;  2R62 A;  4KO8 A;  2LH0 A;  3GLH A;  1OFI A;  4I8O A;  1MX0 A;  4GIP A;  2A5Y B;  2Z3X A;  3B9P A;  2CWB A;  2H5X A;  4JI5 M;  3LQR A;  1PM5 A;  2C98 A;  3NBX X;  2Z4S A;  2D7G A;  3CF2 A;  5C18 A;  1N78 A;  2R65 A;  3L25 A;  2OOA A;  2VF8 A;  4Y28 F;  3GPY A;  2WSE F;  4M0D A;  4QOS A;  1VEJ A;  1GL6 A;  3U61 A;  4NC6 A;  2X49 A;  4LJ6 A;  2ZAN A;  1K3X A;  2V6Z M;  2QCU A;  5ITX E;  1IN4 A;  2DAG A;  1N77 A;  4GKK M;  3SBJ A;  2DHY A;  2GNO A;  1I94 M;  2RGO A;  3SAW A;  1NY5 A;  2P5T A;  1QAN A;  4LF4 M;  4M9X A;  4LF7 M;  1QUS A;  1HT1 E;  1VDL A;  1XWI A;  1DGH B;  2Y21 A;  4JI0 M;  4FD2 A;  3RFW A;  3KXE C;  3WHK A;  2LHG A;  1C1K A;  3W0L B;  2AHM A;  1OIZ A;  4DR5 M;  2E5L M;  3K9O A;  2JP7 A;  1XXH B;  4IBI A;  5FTK A;  5EXX A;  3SHF A;  5H37 D;  3CF6 E;  1WHC A;  1XNQ M;  2J7N A;  2VII A;  3M0E A;  4X64 M;  1QVR A;  2R4J A;  3KS4 A;  3LMM A;  3T6P A;  3CTW B;  4M9S A;  1LTM A;  2LVA A;  4DR3 M;  1TH4 A;  1TDH A;  2KA6 B;  3K9P A;  1T3T A;  1V33 A;  1QQW A;  2O5R A;  1KFV A;  3VKG A;  4D81 A;  4FWD A;  1D0K A;  2K47 A;  1NJG A;  2DKL A;  4DV1 M;  4ZPX A;  3VLF B;  4AG5 A;  3THG A;  4I5S A;  2F5N A;  3C9P A;  1HT2 E;  1WIV A;  4LJA A;  4OX9 M;  2JY8 A;  3GO8 A;  2I7N A;  1OKS A;  2Y0Q A;  2UUC M;  4PCZ A;  1IY1 A;  2HKJ A;  3KOW E;  1IBM M;  1N33 M;  2KNA A;  3U6L A;  4GHA A;  2F5S A;  2CV2 A;  3EIE A;  3LCV B;  1OQY A;  1ZMU A;  3SAU A;  4JI2 M;  1AIP C;  2DAM A;  2WSC F;  3FUV A;  4G4Q A;  2UUA M;  4QNM A;  3ZCB B;  3U60 A;  1SXJ E;  3D8B A;  4L78 A;  4WW0 A;  2EUC A;  4P17 A;  3VK8 A;  3UK6 A;  3T15 A;  1G4A E;  2MR9 A;  4LGM A;  5KO3 A;  4IBF A;  4HEO A;  3J81 S;  2Y20 A;  3C58 A;  4IIW A;  2YNM D;  1SXJ D;  4ITQ A;  1NV8 A;  3IHP A;  4MH0 E;  2HWJ A;  2ZBK B;  5KPT A;  4M0W A;  2KDL A;  3IG8 A;  5EP1 A;  3I4V A;  1T43 A;  4IBJ A;  5EP2 A;  3KOX E;  1TR8 A;  1WXQ A;  4RKU F;  2MJ5 B;  3J2P B;  4BLC A;  1L2B A;  3FE3 A;  4AI6 A;  1DGF A;  1E32 A;  4LJ4 A;  1WJ7 A;  8CAT A;  4F2L A;  4MGY E;  4OVZ B;  3FUT A;  4AKI A;  2XSZ A;  1IM2 A;  2G8L A;  3HU3 A;  1Z5A A;  4CGY B;  1Z5B A;  1YLA A;  3M6A A;  4CHT B;  3JAM S;  2L6O A;  4NOO B;  2GQF A;  1QAO A;  4B7F A;  1FJG M;  1XXH A;  2C96 A;  2R6F A;  1YE9 A;  2FE8 A;  3MMP A;  4M9Z A;  3E21 A;  1UM8 A;  5LMU M;  3GQ4 A;  3HHW A;  2XZF A;  2DWL A;  4JI4 M;  2ZAO A;  3L2A A;  5GKN A;  1NHG C;  2DWZ B;  1V92 A;  3K92 A;  4L15 A;  2DVW B;  3SC3 A;  4FVM A;  5ITT A;  2H1R A;  3GLG A;  2G3Q A;  1H6U A;  2QPA A;  3SAT A;  1XB2 B;  1VG5 A;  4LF6 M;  4LFB M;  2YFQ A;  4NRV A;  2CV1 A;  3SYL A;  3MHV C;  3AKZ A;  3OTO M;  3IEC A;  4DUY M;  2KEB A;  3U6O A;  1NO1 A;  4NL4 H;  2VF7 A;  3ZC7 B;  3FRI A;  3QAU A;  5F3W A;  4GC9 A;  1HNW M;  1AUA A;  1WGL A;  4DV6 M;  3FUX A;  4KLN A;  4YY3 M;  4B3M M;  1NVM A;  3I4Y A;  4D80 A;  2L4F A;  1E94 E;  2LVN C;  3GRR A;  1GL7 A;  4II7 A;  2J7O A;  3K1J A;  5ITX A;  4QNR A;  1Q02 A;  3B74 A;  3DOA A;  4LRS A;  2JZ1 A;  1NNU C;  2QSF X;  3E4R A;  4LZZ A;  5ITY A;  3W0F A;  4A3V B;  2UXD M;  3A45 A;  3LCU A;  4XGI A;  1PJI A;  3QYE A;  5L8R F;  1WR1 B;  4I81 A;  1N75 A;  5IZ7 D;  1DGG A;  3FD9 A;  3B7Z A;  4RF1 A;  4DV2 M;  4GHL A;  1DGB A;  4JI8 M;  1Q3B A;  2QQ8 A;  3UJN A;  1IN7 A;  3VDP A;  2L7I A;  3E9S A;  2D7H A;  1A5T A;  2QEN A;  5IT9 S;  3FTD A;  4PT5 A;  3U6Q A;  2DZO B;  4UN2 B;  4MM3 B;  4IBK A;  2VDB B;  4RNA A;  1IXZ A;  5EJC A;  3JR5 A;  4MB7 A;  1ZMW A;  1RU3 A;  4W5W A;  3UZU A;  3NBI A;  3U6C A;  2CFO A;  3DZD A;  3SHG B;  3FTF A;  4JN6 A;  2XZU A;  2KHH A;  4AKG A;  2KW0 A;  2X4A A;  2JY5 A;  1G8P A;  4DR7 M;  4QHT A;  4P16 A;  3EIH A;  4GIT A;  1TDZ A;  4LJ7 A;  2HHH M;  3HHZ A;  2JY6 B;  3SAS A;  2HL7 A;  4IJE A;  2JA2 A;  3GLI A;  4GRI A;  4B08 A;  4AW4 A;  3HX3 A;  5E26 A;  2VQF M;  1QZM A;  1Z59 A;  4GH9 A;  1OAO C;  3LVW A;  4MGZ E;  1QUT A;  5DFL A;  4LFA M;  4AZF A;  4PDI A;  1PRB A;  3BBZ A;  3RE8 A;  5KQD A;  5KQ8 A;  2QBY A;  2F4V M;  3I04 M;  1IQP A;  1Q3C A;  4JV5 M;  1SXJ A;  3SYK A;  1HR0 M;  3FRH A;  3HU1 A;  3VK7 A;  4XBO A;  3FTE A;  4JI1 M;  3D8L A;  2L7H A;  4B7H A;  2APL A;  3GQ5 A;  1IN5 A;  2XH9 A;  2LVP C;  1D0M A;  2MGW A;  1HQY E;  2RRU A;  3E46 A;  1GO5 A;  1OJL A;  3T38 A;  3B7N A;  1NHW C;  4CIZ A;  3GP1 A;  1L8Q A;  2BNK A;  3A98 B;  3H4M A;  4IBB A;  2C5R A;  2O01 F;  3L28 A;  1TH3 A;  3C3E A;  4GC5 A;  3FKE A;  2DZL A;  2JZ0 A;  3I01 M;  5EP3 A;  1W5S A;  3GRU A;  4RF0 A;  2JWS A;  3TQS A;  2FS1 A;  2DWM A;  3PNY A;  2EKF A;  2EJS A;  4MGK E;  3GRY A;  4REZ A;  3R8F A;  3GLF E;  5IWA M;  4DV5 M;  1WGN A;  2LTU A;  3J27 B;  1W5T A;  3ZH9 B;  1UFZ A;  3Q8X A;  5JI2 E;  4NSO B;  4R7G A;  1VEG A;  2F5Q A;  4LG2 A;  1GKI A;  3A42 A;  3HY5 A;  2OQ4 A;  1Z6T A;  4LRT A;  3GPP A;  2RGH A;  4LZJ A;  5DYI A;  1GVN A;  2W82 A;  3KVW A;  4OW0 A;  4PD2 A;  3LW5 F;  2DAE A;  2Z7J A;  2OOB A;  2CV0 A;  1DGH A;  2C99 A;  3SFZ A;  1DV0 A;  4I4L A;  3FUU A;  3M7G A;  4LJ5 A;  4DR2 M;  3LVV A;  4TUW A;  1YSY A;  3U61 B;  2K6B A;  2CHV A;  1D2N A;  4KOD A;  2R44 A;  1Q39 A;  1GJS A;  1R2Y A;  4B3R M;  1OTR A;  2ZTD A;  3L26 A;  2FOI C;  2KRK A;  3C3D A;  4HL4 A;  1N36 M;  1G41 A;  4WUR A;  1QZE A;  1EFU B;  2XFT A;  2QHO B;  5FTJ A;  1ZMV A;  1HNX M;  1LV7 A;  2ERC A;  2UU9 M;  1I4W A;  4NSR A;  3HHY A;  4LFC M;  1N34 M;  5EXT A;  1DO2 A;  2FNA A;  4AKH A;  1DO0 A;  1JR3 E;  1VDD A;  3KSJ A;  3HJQ A;  3T1Y M;  3A46 A;  1XMO M;  4B3T M;  2LXE A;  1VQ1 A;  2JUJ A;  2Z8Y M;  2LHC A;  1QAM A;  4PDG A;  4NXM M;  4AQY M;  1R7R A;  2DAK A;  1G59 A;  1TF0 B;  1JR3 D;  3Q8G A;  3GLF B;  3HJ8 A;  5EP4 A;  1ZQ9 A;  3AJI B;  2KXE A;  3PFI A;  2QP9 X;  1IY0 A;  3GQ3 A;  1F4I A;  4X66 M;  4NRW A;  1R4G A;  3KW6 A;  1TH2 A;  3PNV A;  5FSW A;  3CF0 A;  4R71 A;  3UMM A;  4LJ8 A;  2R0I A;  1OFH A;  2EO2 A;  1QYR A;  2RKO A;  3PXG A;  4FW9 A;  3AOE C; 
#chains in the Genus database with same CATH homology
 1ZMU A;  1PGY A;  2CP8 A;  1AIP C;  2DAM A;  2JY6 B;  1OAI A;  2QNJ A;  1KYI A;  2ZTC A;  1HJP A;  1Y8G A;  3GLG E;  1G4A E;  2MR9 A;  1IXS A;  4HEO A;  5DFL A;  3BBZ A;  2MRO B;  1G3I A;  2L2D A;  1NV8 A;  3IHP A;  2LVQ D;  1IFY A;  2HWJ A;  4WP2 A;  3FRH A;  1NV9 A;  1T43 A;  1TTE A;  1SG9 A;  2DNA A;  2B3T A;  4Q7J A;  1TR8 A;  2L4E A;  2WZJ A;  2O25 A;  2BWE A;  2LVP C;  2MJ5 B;  4GEW A;  2MGW A;  1XXH E;  1HQY E;  2RRU A;  3E46 A;  3FE3 A;  1GO5 A;  1WJ7 A;  2LBC A;  4F2L A;  3GLH E;  1IM2 A;  2DEN A;  1T6O A;  1YLA A;  3F92 A;  1C7Y A;  2JNH A;  2EKK A;  4F1I A;  2DZL A;  2HAK A;  2JZ0 A;  2LVO C;  3MMP A;  3E21 A;  2EKF A;  2EJS A;  3B89 A;  3GLF E;  2CWB A;  2H5X A;  1WGN A;  2LTU A;  1UFZ A;  1V92 A;  5JI2 E;  1VEG A;  3H4J A;  2G3Q A;  2OOA A;  1XB2 B;  1VG5 A;  2DAI A;  3IEC A;  1VEJ A;  2DAE A;  2OOB A;  3FRI A;  1ZV1 A;  2DAG A;  1DV0 A;  2DHY A;  1WGL A;  1VEK A;  2JY7 A;  1CUK A;  2L4F A;  1E94 E;  2LVN C;  1HT1 E;  1VDL A;  1OTR A;  2ZTD A;  3GLI E;  1G41 A;  1Q02 A;  1QZE A;  1EFU B;  2JZ1 A;  2QSF X;  2QHO B;  2DI0 A;  1ZMV A;  3K9O A;  2JP7 A;  3LCU A;  1WHC A;  1WR1 B;  3LCV B;  1DO2 A;  3T6P A;  1DO0 A;  1JR3 E;  1P3Q Q;  2LVA A;  3K9P A;  1VQ1 A;  2BWB A;  2JUJ A;  1A5T A;  1BVS A;  2DAK A;  2DKL A;  4UN2 B;  2KNZ A;  4DBG B;  2K9D A;  1HT2 E;  1WIV A;  1F4I A;  2JY8 A;  1R4G A;  2OO9 A;  1OKS A;  1ZMW A;  1MN3 A;  4R71 A;  2R0I A;  2KNA A;  4G3O A;  2K0B X;  2KHH A;  2KNV A;  2JY5 A;  1OQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...