1VEKA

Solution structure of rsgi ruh-011, a uba domain from arabidopsis cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
GSSGSSGGEELLPDGVPEEVMESAQPVANEEIVAQLVSMGFSQLHCQKAAINTSNAGVEEAMNWLLSHMDDPDIDAPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords ubiquitin-specific protease 14, putative
publication title Solution Structure of RSGI RUH-011, a UBA Domain from Arabidopsis cDNA
rcsb
source organism Arabidopsis thaliana
total genus 13
structure length 84
sequence length 84
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vekA01
2DI0A 2L4FA 2JY5A 1QZEA 2LVAA 1XXHE 1T43A 1VG5A 1AIPC 1HT2E 2KNZA 3LCVB 1NV8A 1SG9A 1HJPA 1VEJA 1F4IA 1UFZA 2JZ0A 3IHPA 1VQ1A 2MR9A 4F1IA 2JY8A 1ZMVA 2JY7A 2L4EA 4HEOA 1HQYE 1WIVA 2LVOC 4F2LA 3GLFE 2EKKA 2ZTDA 3LCUA 5JI2E 3GLIE 2HWJA 2BWBA 4DBGB 1DO2A 1OKSA 2JNHA 2JUJA 4Q7JA 1NV9A 1P3QQ 2LVQD 3MMPA 1OTRA 2BWEA 1ZMWA 4G3OA 1TTEA 3GLGE 1E94E 2HAKA 3F92A 2EJSA 2R0IA 3E21A 1TR8A 1PGYA 2L2DA 3T6PA 1VDLA 1WHCA 2K0BX 2OOAA 2QNJA 1DV0A 1XB2B 3E46A 5DFLA 1WJ7A 2DAMA 1T6OA 2KNVA 3K9PA 2DZLA 2MGWA 2LBCA 1IFYA 3FRIA 1MN3A 2DNAA 2CWBA 2DAEA 3GLHE 2LVPC 2LTUA 2QHOB 1KYIA 2DAGA 2WZJA 3H4JA 1ZV1A 3IECA 2ZTCA 2KNAA 1G41A 1WGLA 1VEGA 2DHYA 2DAIA 1G3IA 2RRUA 1G4AE 2DKLA 4WP2A 2K9DA 1R4GA 2JY6B 1YLAA 1C7YA 1IM2A 1OAIA 2QSFX 1HT1E 1WGNA 2KHHA 2OOBA 3B89A 2G3QA 2DAKA 1IXSA 1Q02A 2LVNC 3FE3A 1DO0A 1A5TA 2O25A 1BVSA 1GO5A 1EFUB 4UN2B 2CP8A 1ZMUA 2JZ1A 1WR1B 2B3TA 2JP7A 1Y8GA 2OO9A 3K9OA 2DENA 1V92A 3FRHA 4GEWA 1JR3E 4R71A 3BBZA 2EKFA 1CUKA 2MJ5B 1OQYA 2MROB 1VEKA 2H5XA
chains in the Genus database with same CATH superfamily
2L4FA 2DWMA 4LG2A 1XC8A 3I4VA 1QZEA 2KZUA 2XLJA 3L29A 3JR4A 2V1CA 2EUCA 3A98B 1DGHB 4JI5M 2R62A 1XMOM 3C58A 2VDBB 3A42A 1HT2E 1IN8A 3U6DA 4ZPXA 3HHXA 3A46A 1F4IA 4CJ6A 3DZDA 4M9XA 3HHZA 1RU3A 1VQ1A 4FD2A 4IIWA 2CE7A 4B3TM 1ZMVA 2JY7A 1R7RA 3SATA 1HQYE 4M0WA 3W68A 2KA6B 4RNAA 4PDIA 3LCUA 4JI3M 3VDPA 1C1KA 3MJ5A 4IBJA 4QNMA 4IJEA 2QBYB 1OIZA 1G71A 2BWBA 2L7HA 4LFAM 1IBMM 1IY2A 2EO2A 1OFHA 3KS8A 3UMMA 3GRRA 3FTCA 4LJ6A 3U5ZB 3B7ZA 1E32A 4P16A 4D80A 1HR0M 4DV4M 2MH8A 3GLGE 2R65A 2YFQA 1PRBA 2AHMA 1E94E 1YE9A 3E21A 4Y28F 3ZH9B 5IZ7D 3M6AA 4LJ5A 3U6EA 3MHVC 3T6PA 4X65M 3GRYA 3FUTA 1J09A 4PT5A 4JI2M 3KXEC 3E46A 5EJCA 1NHWC 4MM3B 2DAMA 3K9PA 4LF4M 4NL4H 3FRIA 1MN3A 4JI0M 3SAUA 2G5GX 2RKOA 4IBGA 3GLHE 3SBJA 4AKGA 4G6ZA 2LVPC 2LTUA 4GIPA 5FTMA 2XSZD 4OX9M 1GVNA 2VQFM 1OJLA 2FE8A 1QUTA 3FUVA 3I51A 1N36M 2WZJA 1QYRA 1ZV1A 2D7EA 5A2QS 1DGFA 2VF8A 1NY5A 2DWZB 4X64M 2QCUA 1TF0B 4B7GA 2DKLA 2CEAA 2R6FA 2ZAOA 1L1TA 4W5WA 3GQ4A 3U60B 2Z4SA 2JY6B 1IQPA 4NXNM 1C7YA 1TH4A 1IXRC 1MX0A 1XXHA 3K2LA 3HU2A 1D0MA 1VDDA 4JN6A 3VDUA 3I4YA 4LFBM 2HKJA 1D0KA 1Q02A 4NSOB 5EP2A 3LMMA 2LVNC 2UUCM 3L26A 1PJJA 5IWAM 3J27B 5DNYA 2LNHC 3I04M 1R2ZA 1GO5A 2RGHA 5FTNA 4AW4A 2W82A 1EFUB 4UN2B 2KEBA 3BOSA 4IBBA 4M9SA 2Y20A 5E26A 5ITXA 3GLIA 4TUWA 4G4NA 3JAMS 4B3RM 2DENA 4I8OA 3GPXA 4Z6YA 4GKKM 3FD9A 3RFWA 1NJGA 3GLFB 2DHRA 1SXJB 1JQJC 4JI1M 2BJVA 3DFZA 4G4RA 4AKIA 4EIWA 5KQDA 1L2DA 2MROB 3SMPA 1DGHA 2QZ4A 2Y0TA 4CGYB 2JY5A 1KSFX 3FUWA 2KZSA 1TGUA 3U6CA 2KW0A 3WHLA 4JI6M 3LW5F 2YNMD 1OIPA 2Q2EB 3FTDA 3SYKA 2ERCA 4YHHM 3J81S 3SAVA 2JZ0A 2FOIC 4PCZA 2C5RA 2MR9A 4F1IA 2CV2A 3QYEA 4GH9A 2OPFA 5LMNM 2QBYA 4JV5M 3KOXE 4LJ9A 4FWDA 3U61B 5FTJA 1WIVA 4CHTB 1LTMA 3GP1A 2DZOB 5KPTA 3U5ZA 1QAOA 5ITUA 1NNJA 4GC9A 1QAQA 2JXNA 4RKUF 3HZJA 2JUJA 3RE8A 3NWLA 4GRIA 3R8FA 4IBFA 1PJIA 4ITQA 2HL7A 4FVMA 3ZQJA 4DR6M 2QQ8A 1TDZA 3KP0E 1TTEA 2V6ZM 3FTEA 3GO8A 3U6QA 3SHFA 3A45A 3HU1A 2F5OA 2ZBKB 2EJSA 2YQZA 4M0DA 4NRVA 1TR8A 4BLCA 4LGMA 4BBAA 1PGYA 2L2DA 3KOZE 3TWMA 1NNUC 3QYBA 4KHPM 2CHQA 3UK6A 2WSEF 1XB2B 3FTFA 1EIJA 4LZJA 3Q8XA 5ITQA 3HJ8A 5C18A 4FCWA 2LH0A 3KOYE 3U6LA 4L16A 3KFUG 2V1UA 4L78A 2F5NA 4LJ7A 5H37D 1D0LA 1IFYA 3K8ZA 3SC3A 3KOWE 4DV1M 4IBEA 1FJGM 1NHGC 3H4MA 1OAOC 3FKEA 3HJQA 4RF1A 5E6JA 3CF6E 3QAUA 4AG6A 1GLNA 3TQSA 1KYIA 4GMQA 2DAGA 2DWLA 1T3TA 4L6V6 3IECA 4K0KM 2H1RA 3J80S 1XMQM 1JR3A 3L27A 4AQYM 4X66M 3PNVA 1SXJD 1L8QA 2R18A 3U60A 4DV7M 4DUZM 2DHYA 2WSCF 1GL6A 3KSXA 1GKIA 4WP2A 2K9DA 2LHGA 1NO1A 2N35A 4OVZA 3EIEA 4REZA 2C98A 2Y21A 1YLAA 4B08A 1OAIA 4WURA 1HT1E 2KHHA 3B89A 4R7GA 3AOEC 3KW6A 4MGKE 3UGJA 4OU7A 2DAKA 2C99A 3GRUA 4QHTA 3FE3A 4KODA 3GPYA 1DGBA 3NBXX 4AZFA 1IXSB 1NY6A 2UXDM 1YSYA 4MH0E 2XEPA 3U6OA 3NBIA 3PVSA 1DGGA 3HWSA 2CP8A 5IREB 3V76A 4DR1M 1G8PA 5C1BA 4R3DA 1NJFA 2Y0QA 3C9PA 4RF0A 3GLFA 4LJ8A 1SXJA 3U6SA 2JP7A 1PJSA 4IBKA 2BNKA 2OO9A 3VFDA 1V92A 1QDRA 3M7GA 5ITYA 5DYIA 5GKNA 1XNQM 4IJFA 4M9ZA 3HX3A 1SXJE 4R71A 2F5PA 3LQQA 2QENA 1N34M 3UJNA 3E9SA 3HY5A 2Z8YM 1MJGM 1OQYA 3TWLA 4A3VB 1VEKA 1ORYB 3HU3A 4OVZB 2CRUA 1I4WA 3W67A 2VQEM 2FFJA 3EIHA 4MGHA 2FNAA 4GITA 5IT9S 1TH3A 2WSFF 1NVMA 1XXHE 1N75A 3GLGB 1VG5A 4DUYM 1GJSA 1H6UA 1NV8A 1QVRA 2J7NA 3FUXA 3W0FA 1HJPA 3B9PA 2XZUA 3U61A 4I5SA 3IHPA 2LHCA 1V34A 2F5SA 2JA2A 3HGIA 4II7A 1Z6TA 3HJSA 4HEOA 3HHYA 5KPZA 3VLFB 2FS1A 1ZAEA 5ITXE 5JI2E 3TWKA 3OTOM 3RGPA 3GLIE 4AI6A 2R4EA 2C96A 2CUZA 4LRSA 3SARA 4DR7M 2HWJA 4LF5M 1Z5BA 1OKSA 2O01F 3VKHA 3TPZA 1R5LA 3DOAA 1YUBA 3PFIA 4Q7JA 4QOZC 1NV9A 1P3QQ 1IXZA 2GNOA 1PJTA 4I4LA 2UUAM 3D8BA 2L7IA 5JI3E 4G4OA 4PDGA 1ZMWA 5FTLA 4LF9M 3SHGB 1TH2A 4G4QA 2HAKA 2R46A 2BJWA 7CATA 1Q39A 2HCBA 2R0IA 5LMUM 3T1YM 4BB9A 1SXJC 2DWNA 4L8RC 2Z3XA 2F4VM 5FLXS 4PD2A 4LF7M 4QOSA 1WHCA 2OOAA 1DV0A 1XWIA 2UXBM 4LY6A 1GABA 5DFLA 4MGYE 4X62M 5DYGA 1GL7A 2UXCM 1WJ7A 1G59A 1PJQA 1T6OA 2KNVA 3JR5A 4S12A 3SASA 2DZLA 2X4AA 2MGWA 3AJIB 1X37A 2LBCA 1IY1A 3M0EA 3TL4X 2ZM6M 2F5QA 2I7NA 1LV7A 4HLQA 5EP1A 2CWBA 3LVVA 4FCTA 2QHOB 3K92A 3ZCBB 3J7AS 2A5YB 3LVWA 4LGYA 1QZMA 2R44A 5FTKA 3AL0C 5EQTA 1IN6A 3AFHA 2CHGA 1R6BX 2KNAA 1JR3D 2VF7A 2XFSA 3KVWA 1WGLA 3VK7A 1NSFA 1Z59A 2DAIA 4GC5A 2RRUA 2KXEA 4LJAA 3W0LB 3GQ5A 2LXEA 1N33M 1FNNA 1R4GA 4JI7M 4OW0A 3FYDA 4QNRA 5F3WA 1IM2A 3FYCA 1GJTA 3K1JA 3CGWA 5EXXA 1D2NA 2K6BA 2KRKA 2OOBA 2G3QA 4CISA 3SAWA 4L4UA 4LF6M 1OFIA 1IXSA 1QAMA 4NSRA 4FWGA 2UUBM 3IG5A 1V33A 5FSWA 1BVSA 2FH0A 1WXQA 1E9RA 1JB0F 3UZUA 2YR0A 1ZMUA 2JZ1A 2XH9A 4B3MM 4B7FA 3L25A 3HKPA 3K9OA 4I81A 2E5LM 2CV0A 1K3XA 2LWXA 2ZANA 2X49A 4GEWA 1JR3E 4IBDA 5ITRA 3VKGA 4JYAM 2EKFA 3SMSA 1CUKA 3Q8GA 4P17A 2OQ4A 2I7PA 1ZQ9A 4JI4M 2K47A 2KDLA 3CF0A 1Q3CA 3GLGA 1J7KA 1S3SA 2DI0A 4FWHA 2ZAMA 1QQWA 2LVAA 3QWLA 3AKZA 2M5ZA 2APLA 4NXMM 1E9SA 2C9OA 3B7NA 3FUUA 1T43A 3T15A 4LFCM 3GRVA 2QP9X 1AIPC 2KNZA 2P5TA 3LCVB 1SG9A 4B3SM 1VEJA 1UFZA 2J5YA 4QHSA 5EXTA 2CV1A 1HQCA 5KPRA 1EE8A 4ANRA 2NQ8C 3C3DA 4LRTA 3BXWA 3T1HM 2JY8A 2L4EA 3GLHA 2XFTA 3AV0A 2LVOC 4XK8F 2Z4RA 4F2LA 3C3EA 2EKKA 2ZTDA 3B74A 3GLFE 1N77A 1QANA 1W5SA 3RGSA 4NC6A 2Z7JA 4LZZA 2XZFA 1HNZM 4DBGB 1DO2A 2JNHA 1IY0A 3ZC7B 3J7BA 5EP3A 1L1ZA 3WHKA 4MB7A 5KO3A 2LVQD 1K82A 3MMPA 4DV5M 1IN5A 1OTRA 2BWEA 4G3OA 1IBLM 3KDSE 3GPUA 2DZNB 4KLNA 5EP4A 4JI8M 4LF8M 2O5RA 1Z5CA 1IN7A 3F92A 4NRWA 3I01M 2J7OA 2G8LA 1VDLA 2K0BX 2L6OA 4MGIE 2QNJA 4DR2M 3R9XB 3MK6A 4L15A 4FCVA 2CFOA 3SFZA 2L09A 2QPAA 1IN4A 4DR4M 5L8RF 2VIIA 1KFVA 3U6PA 2RGOA 3HHWA 3GLHB 2DNAA 2DAEA 1N32M 2EA0A 4IBIA 4DV0M 4XGIA 2D7GA 4FW9A 1QDTA 2XSZA 3T38A 4DR5M 5BPVA 1J5EM 3DA1A 1TDHA 4WW0A 3H4JA 3U6MA 2ZTCA 4LCBA 3PNYA 1L2CA 4KT0F 4D82A 1G41A 2CHVA 3CF2A 3CTWB 2XF3A 3D8LA 1VEGA 3L2AA 3THGA 5BR8M 1K3WA 3VK8A 1G3IA 3KS4A 1G4AE 2HHHM 1N78A 4DV2M 1HNXM 2XGNA 3B7QA 1Z5AA 1R2YA 2UU9M 3AOGA 2GQFA 3GQ3A 4DV6M 2QSFX 1HNWM 2R4JA 4MGZE 1WGNA 5EXSA 3GPPA 1XHBA 4GHLA 4GKJM 1I94M 4NOOB 4B7HA 4DR3M 1L2BA 1XXHB 1DO0A 1A5TA 5EXPA 3SYLA 2O25A 4JXJA 4DV3M 5KQ8A 4AKHA 2C9CA 1MU5A 2JWSA 2KRUA 3ILKA 4CIZA 4GHAA 4IBCA 1UM8A 3PXGA 3KSJA 4AG5A 3E4RA 1WR1B 3J2PB 2DXIA 2B3TA 5ITTA 4YY3M 4XBOA 1Y8GA 3LQRA 2M60A 3L28A 4D81A 1PM5A 4Z8XA 2R45A 4HL4A 3FRHA 1Q3BA 2D7HA 2DVWB 3GLIB 3BBZA 4LJ4A 1W5TA 8CATA 2MJ5B 4KO8A 3KP1E 1AUAA 2X8AA 3AOEA 3IG8A 3TE6A 1XNRM 1QUSA 2H5XA 1IBKM
chains in the Genus database with same CATH topology
2DI0A 2L4FA 2JY5A 1QZEA 2LVAA 1XXHE 1T43A 1VG5A 1AIPC 1HT2E 2KNZA 3LCVB 1NV8A 1SG9A 1HJPA 1VEJA 1F4IA 1UFZA 2JZ0A 3IHPA 1VQ1A 2MR9A 4F1IA 2JY8A 1ZMVA 2JY7A 2L4EA 4HEOA 1HQYE 1WIVA 2LVOC 4F2LA 3GLFE 2EKKA 2ZTDA 3LCUA 5JI2E 3GLIE 2HWJA 2BWBA 4DBGB 1DO2A 1OKSA 2JNHA 2JUJA 4Q7JA 1NV9A 1P3QQ 2LVQD 3MMPA 1OTRA 2BWEA 1ZMWA 4G3OA 1TTEA 3GLGE 1E94E 2HAKA 3F92A 2EJSA 2R0IA 3E21A 1TR8A 1PGYA 2L2DA 3T6PA 1VDLA 1WHCA 2K0BX 2OOAA 2QNJA 1DV0A 1XB2B 3E46A 5DFLA 1WJ7A 2DAMA 1T6OA 2KNVA 3K9PA 2DZLA 2MGWA 2LBCA 1IFYA 3FRIA 1MN3A 2DNAA 2CWBA 2DAEA 3GLHE 2LVPC 2LTUA 2QHOB 1KYIA 2DAGA 2WZJA 3H4JA 1ZV1A 3IECA 2ZTCA 2KNAA 1G41A 1WGLA 1VEGA 2DHYA 2DAIA 1G3IA 2RRUA 1G4AE 2DKLA 4WP2A 2K9DA 1R4GA 2JY6B 1YLAA 1C7YA 1IM2A 1OAIA 2QSFX 1HT1E 1WGNA 2KHHA 2OOBA 3B89A 2G3QA 2DAKA 1IXSA 1Q02A 2LVNC 3FE3A 1DO0A 1A5TA 2O25A 1BVSA 1GO5A 1EFUB 4UN2B 2CP8A 1ZMUA 2JZ1A 1WR1B 2B3TA 2JP7A 1Y8GA 2OO9A 3K9OA 2DENA 1V92A 3FRHA 4GEWA 1JR3E 4R71A 3BBZA 2EKFA 1CUKA 2MJ5B 1OQYA 2MROB 1VEKA 2H5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DI0 A;  2L4F A;  2JY5 A;  1QZE A;  2LVA A;  1XXH E;  1T43 A;  1VG5 A;  1AIP C;  1HT2 E;  2KNZ A;  3LCV B;  1NV8 A;  1SG9 A;  1HJP A;  1VEJ A;  1F4I A;  1UFZ A;  2JZ0 A;  3IHP A;  1VQ1 A;  2MR9 A;  4F1I A;  2JY8 A;  1ZMV A;  2JY7 A;  2L4E A;  4HEO A;  1HQY E;  1WIV A;  2LVO C;  4F2L A;  3GLF E;  2EKK A;  2ZTD A;  3LCU A;  5JI2 E;  3GLI E;  2HWJ A;  2BWB A;  4DBG B;  1DO2 A;  1OKS A;  2JNH A;  2JUJ A;  4Q7J A;  1NV9 A;  1P3Q Q;  2LVQ D;  3MMP A;  1OTR A;  2BWE A;  1ZMW A;  4G3O A;  1TTE A;  3GLG E;  1E94 E;  2HAK A;  3F92 A;  2EJS A;  2R0I A;  3E21 A;  1TR8 A;  1PGY A;  2L2D A;  3T6P A;  1VDL A;  1WHC A;  2K0B X;  2OOA A;  2QNJ A;  1DV0 A;  1XB2 B;  3E46 A;  5DFL A;  1WJ7 A;  2DAM A;  1T6O A;  2KNV A;  3K9P A;  2DZL A;  2MGW A;  2LBC A;  1IFY A;  3FRI A;  1MN3 A;  2DNA A;  2CWB A;  2DAE A;  3GLH E;  2LVP C;  2LTU A;  2QHO B;  1KYI A;  2DAG A;  2WZJ A;  3H4J A;  1ZV1 A;  3IEC A;  2ZTC A;  2KNA A;  1G41 A;  1WGL A;  1VEG A;  2DHY A;  2DAI A;  1G3I A;  2RRU A;  1G4A E;  2DKL A;  4WP2 A;  2K9D A;  1R4G A;  2JY6 B;  1YLA A;  1C7Y A;  1IM2 A;  1OAI A;  2QSF X;  1HT1 E;  1WGN A;  2KHH A;  2OOB A;  3B89 A;  2G3Q A;  2DAK A;  1IXS A;  1Q02 A;  2LVN C;  3FE3 A;  1DO0 A;  1A5T A;  2O25 A;  1BVS A;  1GO5 A;  1EFU B;  4UN2 B;  2CP8 A;  1ZMU A;  2JZ1 A;  1WR1 B;  2B3T A;  2JP7 A;  1Y8G A;  2OO9 A;  3K9O A;  2DEN A;  1V92 A;  3FRH A;  4GEW A;  1JR3 E;  4R71 A;  3BBZ A;  2EKF A;  1CUK A;  2MJ5 B;  1OQY A;  2MRO B;  1VEK A;  2H5X A; 
#chains in the Genus database with same CATH topology
 2L4F A;  2DWM A;  4LG2 A;  1XC8 A;  3I4V A;  1QZE A;  2KZU A;  2XLJ A;  3L29 A;  3JR4 A;  2V1C A;  2EUC A;  3A98 B;  1DGH B;  4JI5 M;  2R62 A;  1XMO M;  3C58 A;  2VDB B;  3A42 A;  1HT2 E;  1IN8 A;  3U6D A;  4ZPX A;  3HHX A;  3A46 A;  1F4I A;  4CJ6 A;  3DZD A;  4M9X A;  3HHZ A;  1RU3 A;  1VQ1 A;  4FD2 A;  4IIW A;  2CE7 A;  4B3T M;  1ZMV A;  2JY7 A;  1R7R A;  3SAT A;  1HQY E;  4M0W A;  3W68 A;  2KA6 B;  4RNA A;  4PDI A;  3LCU A;  4JI3 M;  3VDP A;  1C1K A;  3MJ5 A;  4IBJ A;  4QNM A;  4IJE A;  2QBY B;  1OIZ A;  1G71 A;  2BWB A;  2L7H A;  4LFA M;  1IBM M;  1IY2 A;  2EO2 A;  1OFH A;  3KS8 A;  3UMM A;  3GRR A;  3FTC A;  4LJ6 A;  3U5Z B;  3B7Z A;  1E32 A;  4P16 A;  4D80 A;  1HR0 M;  4DV4 M;  2MH8 A;  3GLG E;  2R65 A;  2YFQ A;  1PRB A;  2AHM A;  1E94 E;  1YE9 A;  3E21 A;  4Y28 F;  3ZH9 B;  5IZ7 D;  3M6A A;  4LJ5 A;  3U6E A;  3MHV C;  3T6P A;  4X65 M;  3GRY A;  3FUT A;  1J09 A;  4PT5 A;  4JI2 M;  3KXE C;  3E46 A;  5EJC A;  1NHW C;  4MM3 B;  2DAM A;  3K9P A;  4LF4 M;  4NL4 H;  3FRI A;  1MN3 A;  4JI0 M;  3SAU A;  2G5G X;  2RKO A;  4IBG A;  3GLH E;  3SBJ A;  4AKG A;  4G6Z A;  2LVP C;  2LTU A;  4GIP A;  5FTM A;  2XSZ D;  4OX9 M;  1GVN A;  2VQF M;  1OJL A;  2FE8 A;  1QUT A;  3FUV A;  3I51 A;  1N36 M;  2WZJ A;  1QYR A;  1ZV1 A;  2D7E A;  5A2Q S;  1DGF A;  2VF8 A;  1NY5 A;  2DWZ B;  4X64 M;  2QCU A;  1TF0 B;  4B7G A;  2DKL A;  2CEA A;  2R6F A;  2ZAO A;  1L1T A;  4W5W A;  3GQ4 A;  3U60 B;  2Z4S A;  2JY6 B;  1IQP A;  4NXN M;  1C7Y A;  1TH4 A;  1IXR C;  1MX0 A;  1XXH A;  3K2L A;  3HU2 A;  1D0M A;  1VDD A;  4JN6 A;  3VDU A;  3I4Y A;  4LFB M;  2HKJ A;  1D0K A;  1Q02 A;  4NSO B;  5EP2 A;  3LMM A;  2LVN C;  2UUC M;  3L26 A;  1PJJ A;  5IWA M;  3J27 B;  5DNY A;  2LNH C;  3I04 M;  1R2Z A;  1GO5 A;  2RGH A;  5FTN A;  4AW4 A;  2W82 A;  1EFU B;  4UN2 B;  2KEB A;  3BOS A;  4IBB A;  4M9S A;  2Y20 A;  5E26 A;  5ITX A;  3GLI A;  4TUW A;  4G4N A;  3JAM S;  4B3R M;  2DEN A;  4I8O A;  3GPX A;  4Z6Y A;  4GKK M;  3FD9 A;  3RFW A;  1NJG A;  3GLF B;  2DHR A;  1SXJ B;  1JQJ C;  4JI1 M;  2BJV A;  3DFZ A;  4G4R A;  4AKI A;  4EIW A;  5KQD A;  1L2D A;  2MRO B;  3SMP A;  1DGH A;  2QZ4 A;  2Y0T A;  4CGY B;  2JY5 A;  1KSF X;  3FUW A;  2KZS A;  1TGU A;  3U6C A;  2KW0 A;  3WHL A;  4JI6 M;  3LW5 F;  2YNM D;  1OIP A;  2Q2E B;  3FTD A;  3SYK A;  2ERC A;  4YHH M;  3J81 S;  3SAV A;  2JZ0 A;  2FOI C;  4PCZ A;  2C5R A;  2MR9 A;  4F1I A;  2CV2 A;  3QYE A;  4GH9 A;  2OPF A;  5LMN M;  2QBY A;  4JV5 M;  3KOX E;  4LJ9 A;  4FWD A;  3U61 B;  5FTJ A;  1WIV A;  4CHT B;  1LTM A;  3GP1 A;  2DZO B;  5KPT A;  3U5Z A;  1QAO A;  5ITU A;  1NNJ A;  4GC9 A;  1QAQ A;  2JXN A;  4RKU F;  3HZJ A;  2JUJ A;  3RE8 A;  3NWL A;  4GRI A;  3R8F A;  4IBF A;  1PJI A;  4ITQ A;  2HL7 A;  4FVM A;  3ZQJ A;  4DR6 M;  2QQ8 A;  1TDZ A;  3KP0 E;  1TTE A;  2V6Z M;  3FTE A;  3GO8 A;  3U6Q A;  3SHF A;  3A45 A;  3HU1 A;  2F5O A;  2ZBK B;  2EJS A;  2YQZ A;  4M0D A;  4NRV A;  1TR8 A;  4BLC A;  4LGM A;  4BBA A;  1PGY A;  2L2D A;  3KOZ E;  3TWM A;  1NNU C;  3QYB A;  4KHP M;  2CHQ A;  3UK6 A;  2WSE F;  1XB2 B;  3FTF A;  1EIJ A;  4LZJ A;  3Q8X A;  5ITQ A;  3HJ8 A;  5C18 A;  4FCW A;  2LH0 A;  3KOY E;  3U6L A;  4L16 A;  3KFU G;  2V1U A;  4L78 A;  2F5N A;  4LJ7 A;  5H37 D;  1D0L A;  1IFY A;  3K8Z A;  3SC3 A;  3KOW E;  4DV1 M;  4IBE A;  1FJG M;  1NHG C;  3H4M A;  1OAO C;  3FKE A;  3HJQ A;  4RF1 A;  5E6J A;  3CF6 E;  3QAU A;  4AG6 A;  1GLN A;  3TQS A;  1KYI A;  4GMQ A;  2DAG A;  2DWL A;  1T3T A;  4L6V 6;  3IEC A;  4K0K M;  2H1R A;  3J80 S;  1XMQ M;  1JR3 A;  3L27 A;  4AQY M;  4X66 M;  3PNV A;  1SXJ D;  1L8Q A;  2R18 A;  3U60 A;  4DV7 M;  4DUZ M;  2DHY A;  2WSC F;  1GL6 A;  3KSX A;  1GKI A;  4WP2 A;  2K9D A;  2LHG A;  1NO1 A;  2N35 A;  4OVZ A;  3EIE A;  4REZ A;  2C98 A;  2Y21 A;  1YLA A;  4B08 A;  1OAI A;  4WUR A;  1HT1 E;  2KHH A;  3B89 A;  4R7G A;  3AOE C;  3KW6 A;  4MGK E;  3UGJ A;  4OU7 A;  2DAK A;  2C99 A;  3GRU A;  4QHT A;  3FE3 A;  4KOD A;  3GPY A;  1DGB A;  3NBX X;  4AZF A;  1IXS B;  1NY6 A;  2UXD M;  1YSY A;  4MH0 E;  2XEP A;  3U6O A;  3NBI A;  3PVS A;  1DGG A;  3HWS A;  2CP8 A;  5IRE B;  3V76 A;  4DR1 M;  1G8P A;  5C1B A;  4R3D A;  1NJF A;  2Y0Q A;  3C9P A;  4RF0 A;  3GLF A;  4LJ8 A;  1SXJ A;  3U6S A;  2JP7 A;  1PJS A;  4IBK A;  2BNK A;  2OO9 A;  3VFD A;  1V92 A;  1QDR A;  3M7G A;  5ITY A;  5DYI A;  5GKN A;  1XNQ M;  4IJF A;  4M9Z A;  3HX3 A;  1SXJ E;  4R71 A;  2F5P A;  3LQQ A;  2QEN A;  1N34 M;  3UJN A;  3E9S A;  3HY5 A;  2Z8Y M;  1MJG M;  1OQY A;  3TWL A;  4A3V B;  1VEK A;  1ORY B;  3HU3 A;  4OVZ B;  2CRU A;  1I4W A;  3W67 A;  2VQE M;  2FFJ A;  3EIH A;  4MGH A;  2FNA A;  4GIT A;  5IT9 S;  1TH3 A;  2WSF F;  1NVM A;  1XXH E;  1N75 A;  3GLG B;  1VG5 A;  4DUY M;  1GJS A;  1H6U A;  1NV8 A;  1QVR A;  2J7N A;  3FUX A;  3W0F A;  1HJP A;  3B9P A;  2XZU A;  3U61 A;  4I5S A;  3IHP A;  2LHC A;  1V34 A;  2F5S A;  2JA2 A;  3HGI A;  4II7 A;  1Z6T A;  3HJS A;  4HEO A;  3HHY A;  5KPZ A;  3VLF B;  2FS1 A;  1ZAE A;  5ITX E;  5JI2 E;  3TWK A;  3OTO M;  3RGP A;  3GLI E;  4AI6 A;  2R4E A;  2C96 A;  2CUZ A;  4LRS A;  3SAR A;  4DR7 M;  2HWJ A;  4LF5 M;  1Z5B A;  1OKS A;  2O01 F;  3VKH A;  3TPZ A;  1R5L A;  3DOA A;  1YUB A;  3PFI A;  4Q7J A;  4QOZ C;  1NV9 A;  1P3Q Q;  1IXZ A;  2GNO A;  1PJT A;  4I4L A;  2UUA M;  3D8B A;  2L7I A;  5JI3 E;  4G4O A;  4PDG A;  1ZMW A;  5FTL A;  4LF9 M;  3SHG B;  1TH2 A;  4G4Q A;  2HAK A;  2R46 A;  2BJW A;  7CAT A;  1Q39 A;  2HCB A;  2R0I A;  5LMU M;  3T1Y M;  4BB9 A;  1SXJ C;  2DWN A;  4L8R C;  2Z3X A;  2F4V M;  5FLX S;  4PD2 A;  4LF7 M;  4QOS A;  1WHC A;  2OOA A;  1DV0 A;  1XWI A;  2UXB M;  4LY6 A;  1GAB A;  5DFL A;  4MGY E;  4X62 M;  5DYG A;  1GL7 A;  2UXC M;  1WJ7 A;  1G59 A;  1PJQ A;  1T6O A;  2KNV A;  3JR5 A;  4S12 A;  3SAS A;  2DZL A;  2X4A A;  2MGW A;  3AJI B;  1X37 A;  2LBC A;  1IY1 A;  3M0E A;  3TL4 X;  2ZM6 M;  2F5Q A;  2I7N A;  1LV7 A;  4HLQ A;  5EP1 A;  2CWB A;  3LVV A;  4FCT A;  2QHO B;  3K92 A;  3ZCB B;  3J7A S;  2A5Y B;  3LVW A;  4LGY A;  1QZM A;  2R44 A;  5FTK A;  3AL0 C;  5EQT A;  1IN6 A;  3AFH A;  2CHG A;  1R6B X;  2KNA A;  1JR3 D;  2VF7 A;  2XFS A;  3KVW A;  1WGL A;  3VK7 A;  1NSF A;  1Z59 A;  2DAI A;  4GC5 A;  2RRU A;  2KXE A;  4LJA A;  3W0L B;  3GQ5 A;  2LXE A;  1N33 M;  1FNN A;  1R4G A;  4JI7 M;  4OW0 A;  3FYD A;  4QNR A;  5F3W A;  1IM2 A;  3FYC A;  1GJT A;  3K1J A;  3CGW A;  5EXX A;  1D2N A;  2K6B A;  2KRK A;  2OOB A;  2G3Q A;  4CIS A;  3SAW A;  4L4U A;  4LF6 M;  1OFI A;  1IXS A;  1QAM A;  4NSR A;  4FWG A;  2UUB M;  3IG5 A;  1V33 A;  5FSW A;  1BVS A;  2FH0 A;  1WXQ A;  1E9R A;  1JB0 F;  3UZU A;  2YR0 A;  1ZMU A;  2JZ1 A;  2XH9 A;  4B3M M;  4B7F A;  3L25 A;  3HKP A;  3K9O A;  4I81 A;  2E5L M;  2CV0 A;  1K3X A;  2LWX A;  2ZAN A;  2X49 A;  4GEW A;  1JR3 E;  4IBD A;  5ITR A;  3VKG A;  4JYA M;  2EKF A;  3SMS A;  1CUK A;  3Q8G A;  4P17 A;  2OQ4 A;  2I7P A;  1ZQ9 A;  4JI4 M;  2K47 A;  2KDL A;  3CF0 A;  1Q3C A;  3GLG A;  1J7K A;  1S3S A;  2DI0 A;  4FWH A;  2ZAM A;  1QQW A;  2LVA A;  3QWL A;  3AKZ A;  2M5Z A;  2APL A;  4NXM M;  1E9S A;  2C9O A;  3B7N A;  3FUU A;  1T43 A;  3T15 A;  4LFC M;  3GRV A;  2QP9 X;  1AIP C;  2KNZ A;  2P5T A;  3LCV B;  1SG9 A;  4B3S M;  1VEJ A;  1UFZ A;  2J5Y A;  4QHS A;  5EXT A;  2CV1 A;  1HQC A;  5KPR A;  1EE8 A;  4ANR A;  2NQ8 C;  3C3D A;  4LRT A;  3BXW A;  3T1H M;  2JY8 A;  2L4E A;  3GLH A;  2XFT A;  3AV0 A;  2LVO C;  4XK8 F;  2Z4R A;  4F2L A;  3C3E A;  2EKK A;  2ZTD A;  3B74 A;  3GLF E;  1N77 A;  1QAN A;  1W5S A;  3RGS A;  4NC6 A;  2Z7J A;  4LZZ A;  2XZF A;  1HNZ M;  4DBG B;  1DO2 A;  2JNH A;  1IY0 A;  3ZC7 B;  3J7B A;  5EP3 A;  1L1Z A;  3WHK A;  4MB7 A;  5KO3 A;  2LVQ D;  1K82 A;  3MMP A;  4DV5 M;  1IN5 A;  1OTR A;  2BWE A;  4G3O A;  1IBL M;  3KDS E;  3GPU A;  2DZN B;  4KLN A;  5EP4 A;  4JI8 M;  4LF8 M;  2O5R A;  1Z5C A;  1IN7 A;  3F92 A;  4NRW A;  3I01 M;  2J7O A;  2G8L A;  1VDL A;  2K0B X;  2L6O A;  4MGI E;  2QNJ A;  4DR2 M;  3R9X B;  3MK6 A;  4L15 A;  4FCV A;  2CFO A;  3SFZ A;  2L09 A;  2QPA A;  1IN4 A;  4DR4 M;  5L8R F;  2VII A;  1KFV A;  3U6P A;  2RGO A;  3HHW A;  3GLH B;  2DNA A;  2DAE A;  1N32 M;  2EA0 A;  4IBI A;  4DV0 M;  4XGI A;  2D7G A;  4FW9 A;  1QDT A;  2XSZ A;  3T38 A;  4DR5 M;  5BPV A;  1J5E M;  3DA1 A;  1TDH A;  4WW0 A;  3H4J A;  3U6M A;  2ZTC A;  4LCB A;  3PNY A;  1L2C A;  4KT0 F;  4D82 A;  1G41 A;  2CHV A;  3CF2 A;  3CTW B;  2XF3 A;  3D8L A;  1VEG A;  3L2A A;  3THG A;  5BR8 M;  1K3W A;  3VK8 A;  1G3I A;  3KS4 A;  1G4A E;  2HHH M;  1N78 A;  4DV2 M;  1HNX M;  2XGN A;  3B7Q A;  1Z5A A;  1R2Y A;  2UU9 M;  3AOG A;  2GQF A;  3GQ3 A;  4DV6 M;  2QSF X;  1HNW M;  2R4J A;  4MGZ E;  1WGN A;  5EXS A;  3GPP A;  1XHB A;  4GHL A;  4GKJ M;  1I94 M;  4NOO B;  4B7H A;  4DR3 M;  1L2B A;  1XXH B;  1DO0 A;  1A5T A;  5EXP A;  3SYL A;  2O25 A;  4JXJ A;  4DV3 M;  5KQ8 A;  4AKH A;  2C9C A;  1MU5 A;  2JWS A;  2KRU A;  3ILK A;  4CIZ A;  4GHA A;  4IBC A;  1UM8 A;  3PXG A;  3KSJ A;  4AG5 A;  3E4R A;  1WR1 B;  3J2P B;  2DXI A;  2B3T A;  5ITT A;  4YY3 M;  4XBO A;  1Y8G A;  3LQR A;  2M60 A;  3L28 A;  4D81 A;  1PM5 A;  4Z8X A;  2R45 A;  4HL4 A;  3FRH A;  1Q3B A;  2D7H A;  2DVW B;  3GLI B;  3BBZ A;  4LJ4 A;  1W5T A;  8CAT A;  2MJ5 B;  4KO8 A;  3KP1 E;  1AUA A;  2X8A A;  3AOE A;  3IG8 A;  3TE6 A;  1XNR M;  1QUS A;  2H5X A;  1IBK M; 
#chains in the Genus database with same CATH homology
 2DI0 A;  2L4F A;  2JY5 A;  1QZE A;  2LVA A;  1XXH E;  1T43 A;  1VG5 A;  1AIP C;  1HT2 E;  2KNZ A;  3LCV B;  1NV8 A;  1SG9 A;  1HJP A;  1VEJ A;  1F4I A;  1UFZ A;  2JZ0 A;  3IHP A;  1VQ1 A;  2MR9 A;  4F1I A;  2JY8 A;  1ZMV A;  2JY7 A;  2L4E A;  4HEO A;  1HQY E;  1WIV A;  2LVO C;  4F2L A;  3GLF E;  2EKK A;  2ZTD A;  3LCU A;  5JI2 E;  3GLI E;  2HWJ A;  2BWB A;  4DBG B;  1DO2 A;  1OKS A;  2JNH A;  2JUJ A;  4Q7J A;  1NV9 A;  1P3Q Q;  2LVQ D;  3MMP A;  1OTR A;  2BWE A;  1ZMW A;  4G3O A;  1TTE A;  3GLG E;  1E94 E;  2HAK A;  3F92 A;  2EJS A;  2R0I A;  3E21 A;  1TR8 A;  1PGY A;  2L2D A;  3T6P A;  1VDL A;  1WHC A;  2K0B X;  2OOA A;  2QNJ A;  1DV0 A;  1XB2 B;  3E46 A;  5DFL A;  1WJ7 A;  2DAM A;  1T6O A;  2KNV A;  3K9P A;  2DZL A;  2MGW A;  2LBC A;  1IFY A;  3FRI A;  1MN3 A;  2DNA A;  2CWB A;  2DAE A;  3GLH E;  2LVP C;  2LTU A;  2QHO B;  1KYI A;  2DAG A;  2WZJ A;  3H4J A;  1ZV1 A;  3IEC A;  2ZTC A;  2KNA A;  1G41 A;  1WGL A;  1VEG A;  2DHY A;  2DAI A;  1G3I A;  2RRU A;  1G4A E;  2DKL A;  4WP2 A;  2K9D A;  1R4G A;  2JY6 B;  1YLA A;  1C7Y A;  1IM2 A;  1OAI A;  2QSF X;  1HT1 E;  1WGN A;  2KHH A;  2OOB A;  3B89 A;  2G3Q A;  2DAK A;  1IXS A;  1Q02 A;  2LVN C;  3FE3 A;  1DO0 A;  1A5T A;  2O25 A;  1BVS A;  1GO5 A;  1EFU B;  4UN2 B;  2CP8 A;  1ZMU A;  2JZ1 A;  1WR1 B;  2B3T A;  2JP7 A;  1Y8G A;  2OO9 A;  3K9O A;  2DEN A;  1V92 A;  3FRH A;  4GEW A;  1JR3 E;  4R71 A;  3BBZ A;  2EKF A;  1CUK A;  2MJ5 B;  1OQY A;  2MRO B;  1VEK A;  2H5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...