1VEKA

Solution structure of rsgi ruh-011, a uba domain from arabidopsis cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
GSSGSSGGEELLPDGVPEEVMESAQPVANEEIVAQLVSMGFSQLHCQKAAINTSNAGVEEAMNWLLSHMDDPDIDAPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of RSGI RUH-011, a UBA Domain from Arabidopsis cDNA
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords ubiquitin-specific protease 14, putative
total genus 13
structure length 84
sequence length 84
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vekA01
1GO5A 4DBGB 2BWEA 1HQYE 1Y8GA 3MMPA 2DAGA 1IM2A 1V92A 1VDLA 1XB2B 2JZ0A 1VG5A 2O25A 1UFZA 2LVOC 1CUKA 1NV8A 2DKLA 3FE3A 4F1IA 1OKSA 1TR8A 2JUJA 2K0BX 1R4GA 1VQ1A 2LTUA 2DAEA 2KNVA 1WR1B 2MROB 2CP8A 3IHPA 2K9DA 2H5XA 1DO2A 2KNZA 2L2DA 1T6OA 1PGYA 4GEWA 3LCUA 2JY5A 3K9OA 3GLHE 2OOAA 1Q02A 2JP7A 1WGLA 2KNAA 1VEJA 1C7YA 1OTRA 1DV0A 1G3IA 2BWBA 2RRUA 1WJ7A 2OO9A 1WHCA 1G41A 2G3QA 4UN2B 1EFUB 1ZV1A 1MN3A 3E21A 3FRIA 5DFLA 3E46A 2L4EA 1XXHE 2CWBA 1ZMVA 4WP2A 2DHYA 2JY8A 2QHOB 2DAIA 3FRHA 2LVQD 2WZJA 1T43A 1HT1E 1HJPA 2DAKA 2L4FA 3H4JA 3GLGE 4HEOA 2HAKA 2DNAA 3GLFE 1KYIA 2DI0A 3LCVB 2EKKA 2EKFA 1P3QQ 1G4AE 1WGNA 2EJSA 1BVSA 2LBCA 1SG9A 4G3OA 1AIPC 1ZMWA 2MGWA 3F92A 2DZLA 2DENA 2OOBA 2LVNC 2ZTDA 5JI2E 1DO0A 2LVAA 1QZEA 2KHHA 2HWJA 1TTEA 3BBZA 1IXSA 3IECA 3T6PA 2JNHA 2MJ5B 2R0IA 2JY7A 2ZTCA 2JY6B 1F4IA 2B3TA 1E94E 2QSFX 4Q7JA 4F2LA 3K9PA 2JZ1A 1ZMUA 4R71A 1VEGA 2LVPC 1HT2E 1VEKA 2QNJA 1NV9A 1JR3E 1OAIA 1WIVA 1YLAA 2MR9A 3B89A 2DAMA 3GLIE 1OQYA 1IFYA 1A5TA
chains in the Genus database with same CATH superfamily
1GO5A 1IQPA 4B3RM 1XHBA 1OFIA 1Y8GA 4B3TM 4GITA 4AKGA 1OJLA 2D7EA 2O25A 2I7PA 5KPTA 3H4MA 5C1BA 3JR5A 1NV8A 3FE3A 3KXEC 4OX9M 3FKEA 2APLA 1OKSA 1R2ZA 4X64M 2JUJA 3HWSA 3UJNA 3GO8A 4JI3M 2DAEA 3HHXA 2KNVA 1WR1B 4KLNA 4AG5A 2CP8A 1Z5BA 3I4VA 3IHPA 4L8RC 1TH4A 2K9DA 2HL7A 3HJSA 1NJGA 2CEAA 2LH0A 3C3EA 2DZOB 3GRVA 4LJAA 3GPXA 3U6EA 2L2DA 1T6OA 3FUVA 3I01M 1ZAEA 3LCUA 2JY5A 1GL7A 3QYEA 1PJSA 2L7HA 2Q2EB 2Z4RA 1Q02A 3KOXE 3MJ5A 2JP7A 5L8RF 2XZFA 1DV0A 5EXXA 3KDSE 1G3IA 4AZFA 1QZMA 2M5ZA 4B3MM 1IN8A 3A45A 4X65M 1QAOA 4DUYM 4M9XA 2G3QA 1GKIA 1N33M 2RGHA 1MN3A 3FRIA 4XGIA 1W5SA 4JXJA 4QHSA 1XXHE 2NQ8C 4HLQA 3L26A 3E9SA 2DHYA 2BNKA 5LMUM 2RKOA 4LFBM 3L25A 2DAIA 3FRHA 2WZJA 1YUBA 1TGUA 2JA2A 1DGFA 1HT1E 2QP9X 4QHTA 1IY1A 4I4LA 2LXEA 1DGHB 2HCBA 3VK7A 1E32A 5IWAM 4I8OA 3SHFA 3M6AA 5IT9S 1XXHA 3T38A 2UXDM 2XSZD 3LCVB 3KVWA 1LTMA 1TDHA 1HNXM 1I4WA 4B7FA 2KEBA 2ZANA 5LMNM 4G3OA 1ZMWA 3MK6A 2KDLA 2P5TA 3VDUA 1NHGC 4LZJA 2XF3A 5F3WA 2WSCF 4LFCM 2DENA 1N78A 3THGA 5EXSA 1JR3D 3U61A 3K8ZA 3D8LA 3SAUA 3FTFA 3AOEA 5FTMA 3GLIA 1L1TA 1QZEA 3VFDA 1EE8A 1HNWM 2UUCM 3KP0E 3IECA 3ZC7B 3RGPA 4AI6A 4DV3M 4DV2M 3SAWA 1QAMA 5FTJA 2ZTCA 4GHLA 2JY6B 5DNYA 1UM8A 2CUZA 1J7KA 2XGNA 1Z5AA 4MGYE 3HJQA 4PT5A 4YY3M 1LV7A 3B74A 4NXMM 1T3TA 4DR3M 1VEGA 4JI7M 4IJEA 3KOWE 5ITYA 3K1JA 3IG8A 4OW0A 5EQTA 1OAIA 3GQ4A 3KP1E 1H6UA 2MR9A 1IY2A 4QOSA 1KSFX 3GLIE 4AG6A 1K82A 1NNJA 2G5GX 3U6MA 3ZQJA 2CV1A 2UU9M 1OQYA 2X8AA 2QPAA 3LVVA 4R7GA 1IFYA 3HHYA 3VKGA 3A98B 2CHQA 3QAUA 3WHKA 2HHHM 2OQ4A 4MGKE 4DBGB 4AKHA 4G6ZA 3MMPA 1TDZA 4KODA 4DR6M 3B7ZA 1V92A 1VDLA 4ANRA 1UFZA 1QUTA 3R9XB 3L2AA 1OIZA 2I7NA 3Q8GA 1D0MA 4GH9A 2VIIA 3J27B 1WXQA 3U6DA 4G4OA 2F5NA 2MH8A 4LZZA 2LTUA 1R4GA 1VDDA 3PNYA 2ZAOA 7CATA 2MROB 3HU1A 2X49A 3CGWA 3FTCA 1E9RA 3GRYA 4IBGA 3U61B 3HGIA 3B9PA 4DR4M 2L7IA 1PJIA 2D7HA 1TF0B 1IXRC 2FH0A 4IBCA 2ZBKB 3GLHE 2CHVA 1N34M 3U6SA 1C7YA 1VEJA 1N36M 2O01F 3HJ8A 4JI1M 4YHHM 1Z6TA 2BWBA 4RF1A 5EXTA 4MH0E 5EJCA 1WJ7A 4X62M 1YE9A 2ZM6M 1F4IA 4QNRA 1Q3BA 1EFUB 2XZUA 1OIPA 3FUXA 2R44A 3LMMA 5ITRA 1PJTA 2BJVA 3L27A 3J7AS 3KS4A 5BPVA 3SMPA 3T1HM 4XK8F 4B3SM 1IBMM 4WP2A 5ITQA 3TWLA 3HHZA 3EIHA 5KQ8A 3AV0A 4IBDA 1HJPA 3DOAA 2K6BA 3MHVC 3H4JA 2VQEM 5E26A 2CFOA 3GLHA 3GQ3A 2Z4SA 1IBKM 3CF6E 3W68A 4AW4A 3UGJA 2BJWA 2DNAA 1QYRA 2DI0A 2FNAA 3QWLA 3KSJA 3LW5F 3SATA 4FWGA 1P3QQ 1WGNA 2J7OA 2WSEF 3T15A 4G4NA 4LJ6A 5KO3A 2QBYB 4PD2A 2CV0A 4LGYA 1Z59A 4MB7A 2CRUA 2J5YA 4L6V6 4LG2A 2KZUA 1XMQM 4KO8A 3GRRA 5ITTA 2MGWA 1N75A 3GLIB 4HL4A 1IN7A 2DZLA 2XSZA 3FYDA 2UXCM 2LVNC 4IBFA 2ZTDA 4D82A 4NRVA 4DV1M 4B7HA 3J2PB 1DO0A 3U6LA 3VDPA 2O5RA 4Y28F 4ITQA 2HWJA 3BBZA 3M0EA 4G4QA 3GP1A 3PNVA 1XNRM 1TH3A 3T6PA 2UUAM 5IREB 2JNHA 1QAQA 1JR3A 2M60A 1NO1A 3JAMS 3L28A 2C98A 4IIWA 2A5YB 4PDIA 3U60B 2QSFX 4FCWA 4Z8XA 2ERCA 3RE8A 2YR0A 1S3SA 1PJJA 3GQ5A 2V1CA 4P16A 4R71A 3AKZA 3D8BA 3C9PA 2EUCA 4M0WA 1MJGM 4M9SA 2QNJA 1VEKA 2FFJA 3LQQA 5ITXA 1KFVA 1QDRA 3PVSA 4NL4H 2DAMA 4CISA 2XEPA 4DR7M 1SXJE 3RGSA 1L1ZA 2V1UA 4NSOB 5GKNA 2DWZB 1C1KA 1W5TA 4FCVA 4LJ9A 1QUSA 3OTOM 4B7GA 1DGGA 3J81S 2L09A 3AOEC 4FWDA 2C99A 4IBJA 3GPPA 1IN4A 2XLJA 1GLNA 3VK8A 1D0LA 2KW0A 5FLXS 3J7BA 1GL6A 3HU2A 3U5ZB 2F5SA 3AJIB 1NNUC 1IBLM 4M9ZA 4B08A 2QBYA 5ITXE 2K0BX 2Y20A 3TPZA 2R65A 3AFHA 5KQDA 1I94M 4NRWA 1SXJB 2C9OA 4DV6M 4DR2M 2XFSA 3UK6A 3M7GA 2H5XA 3WHLA 1TH2A 1QANA 2KNZA 4OVZB 1PGYA 2YNMD 3VKHA 3K9OA 2DXIA 2F5QA 2OOAA 3FD9A 2R45A 1R6BX 3KOZE 3KS8A 4GKKM 3W0FA 4GMQA 1L8QA 1NSFA 3GLFB 3BXWA 5JI3E 4OVZA 3SMSA 1G41A 1QDTA 2VDBB 4L15A 2R4JA 4I81A 3TL4X 1ZV1A 3GLGA 3U6OA 2F5PA 3E21A 2VF8A 4QNMA 5DFLA 1G8PA 3L29A 4Z6YA 4LF5M 1XC8A 2D7GA 2F5OA 2R46A 3E4RA 4GC5A 4DV4M 3GLFA 2LWXA 2VF7A 3FUUA 1ZMVA 3I04M 4IBKA 2JY8A 5DYIA 2R18A 4LJ7A 3CF2A 4K0KM 2LVQD 2UXBM 4FVMA 1R7RA 3B7QA 3SBJA 1T43A 3DZDA 2LHCA 2DHRA 4LRTA 4GRIA 4L4UA 4JI2M 4PDGA 1Z5CA 4MM3B 1PJQA 2ZAMA 4NXNM 3U6CA 3NWLA 4LRSA 5DYGA 3GLFE 5E6JA 1KYIA 3HU3A 4BBAA 4AQYM 4X66M 2EKKA 4D80A 4LJ4A 4IBBA 2EJSA 5IZ7D 4LFAM 1BVSA 2LBCA 1V33A 3GLHB 3SYLA 4EIWA 4FCTA 3U5ZA 2QENA 4PCZA 1SG9A 2DZNB 1ZQ9A 4LY6A 2K47A 3I51A 1G59A 5FTKA 1AIPC 1MU5A 4A3VB 4JV5M 5H37D 3SFZA 2CE7A 3T1YM 1R5LA 4LJ5A 5KPZA 2OOBA 5FTLA 1K3WA 1HNZM 4KHPM 3HX3A 2V6ZM 3QYBA 4II7A 2DWLA 2FOIC 5BR8M 1SXJA 4LJ8A 2KHHA 4CGYB 2Z7JA 1IXSA 3U6QA 4LGMA 3TWMA 4JI6M 3GPYA 4P17A 1GABA 1R2YA 2C96A 2J7NA 1Q39A 4RF0A 1D0KA 4AKIA 2MJ5B 2GQFA 3GLGB 1NY5A 1MX0A 1QVRA 4FWHA 1GVNA 2R62A 1ORYB 4L78A 3UZUA 2B3TA 2JWSA 1IXSB 4Q7JA 5KPRA 4JI4M 4I5SA 4F2LA 3HHWA 4CJ6A 4DV0M 2KZSA 3LQRA 3SASA 2JZ1A 1ZMUA 1GJTA 2VQFM 4G4RA 4LF6M 3TE6A 4NOOB 2LVPC 2FE8A 1HT2E 4RKUF 4JI0M 3PXGA 1WIVA 1JR3E 4KT0F 1DGHA 1SXJC 4REZA 2CV2A 4DUZM 2QCUA 4WW0A 3KOYE 4JN6A 1Q3CA 4ZPXA 1PM5A 5A2QS 4DR1M 3CTWB 2KRKA 4MGIE 2RGOA 3U6PA 1IY0A 1A5TA 3PFIA 4L16A 4RNAA 4JI5M 1N32M 1EIJA 2BWEA 3UMMA 1OAOC 1HQYE 1XXHB 1FNNA 2DAGA 4S12A 1IM2A 2DWNA 3SC3A 1JQJC 1NVMA 1XB2B 2JZ0A 2Y0TA 2Y0QA 3NBXX 1VG5A 3J80S 3SHGB 3Q8XA 2LVOC 1CUKA 2DKLA 4F1IA 2KXEA 4LF7M 1HQCA 4LF9M 5EP1A 1TR8A 2Z8YM 1FJGM 1VQ1A 3SARA 3C58A 3B7NA 4XBOA 3DFZA 1PRBA 1D2NA 3FYCA 2H1RA 2E5LM 2OPFA 2Y21A 1DO2A 3HZJA 3K2LA 4GEWA 1NJFA 1J09A 3TWKA 1X37A 1WGLA 2KNAA 1OTRA 5EP2A 3EIEA 1L2BA 2RRUA 2OO9A 2GNOA 4CHTB 1QQWA 1WHCA 4UN2B 3BOSA 3FTEA 1N77A 2X4AA 4MGHA 3HY5A 3E46A 2L4EA 1GJSA 1XMOM 1IN6A 2WSFF 2KA6B 2CWBA 4LCBA 3VLFB 3ZH9B 1HR0M 2UUBM 3DA1A 3JR4A 3FTDA 2QHOB 2Z3XA 1JB0F 1E9SA 2DAKA 3RFWA 4NSRA 2EO2A 3KW6A 3SYKA 2L4FA 3GLGE 3I4YA 4HEOA 3K92A 5FTNA 3GPUA 4DV5M 4BB9A 4GKJM 1XWIA 2HAKA 3AOGA 3IG5A 3W0LB 3TQSA 3CF0A 5C18A 2L6OA 5EXPA 2C9CA 1NHWC 4DV7M 1K3XA 4LF8M 1L2CA 2EKFA 2XH9A 4TUWA 1G4AE 1J5EM 1OFHA 4GIPA 2N35A 1AUAA 2HKJA 4M0DA 4IJFA 2EA0A 4CIZA 4OU7A 1XNQM 4D81A 3F92A 3W67A 2F4VM 2AHMA 2R6FA 4R3DA 2W82A 4FD2A 5JI2E 3R8FA 2DVWB 2JXNA 4FW9A 2LHGA 3AL0C 4NC6A 1RU3A 4DR5M 4GHAA 2LVAA 3ZCBB 3ILKA 3SAVA 1TTEA 2G8LA 4W5WA 1DGBA 4MGZE 1IXZA 5EP4A 2KRUA 5ITUA 4LF4M 3V76A 2YQZA 2R0IA 2JY7A 3A46A 2DWMA 3LVWA 3FUWA 3A42A 3KFUG 1V34A 5FSWA 3GRUA 2C5RA 4QOZC 1E94E 1SXJD 1L2DA 2FS1A 2XFTA 4IBEA 2QZ4A 3K9PA 2R4EA 2QQ8A 3FUTA 3NBIA 5EP3A 4BLCA 1IN5A 3HKPA 3U60A 4GC9A 1NV9A 1YLAA 3B89A 3C3DA 1NY6A 4WURA 8CATA 3KSXA 4JYAM 1YSYA 4IBIA 1G71A 2LNHC 4JI8M 2CHGA 2YFQA
chains in the Genus database with same CATH topology
1GO5A 4DBGB 2BWEA 1HQYE 1Y8GA 3MMPA 2DAGA 1IM2A 1V92A 1VDLA 1XB2B 2JZ0A 1VG5A 2O25A 1UFZA 2LVOC 1CUKA 1NV8A 2DKLA 3FE3A 4F1IA 1OKSA 1TR8A 2JUJA 2K0BX 1R4GA 1VQ1A 2LTUA 2DAEA 2KNVA 1WR1B 2MROB 2CP8A 3IHPA 2K9DA 2H5XA 1DO2A 2KNZA 2L2DA 1T6OA 1PGYA 4GEWA 3LCUA 2JY5A 3K9OA 3GLHE 2OOAA 1Q02A 2JP7A 1WGLA 2KNAA 1VEJA 1C7YA 1OTRA 1DV0A 1G3IA 2BWBA 2RRUA 1WJ7A 2OO9A 1WHCA 1G41A 2G3QA 4UN2B 1EFUB 1ZV1A 1MN3A 3E21A 3FRIA 5DFLA 3E46A 2L4EA 1XXHE 2CWBA 1ZMVA 4WP2A 2DHYA 2JY8A 2QHOB 2DAIA 3FRHA 2LVQD 2WZJA 1T43A 1HT1E 1HJPA 2DAKA 2L4FA 3H4JA 3GLGE 4HEOA 2HAKA 2DNAA 3GLFE 1KYIA 2DI0A 3LCVB 2EKKA 2EKFA 1P3QQ 1G4AE 1WGNA 2EJSA 1BVSA 2LBCA 1SG9A 4G3OA 1AIPC 1ZMWA 2MGWA 3F92A 2DZLA 2DENA 2OOBA 2LVNC 2ZTDA 5JI2E 1DO0A 2LVAA 1QZEA 2KHHA 2HWJA 1TTEA 3BBZA 1IXSA 3IECA 3T6PA 2JNHA 2MJ5B 2R0IA 2JY7A 2ZTCA 2JY6B 1F4IA 2B3TA 1E94E 2QSFX 4Q7JA 4F2LA 3K9PA 2JZ1A 1ZMUA 4R71A 1VEGA 2LVPC 1HT2E 1VEKA 2QNJA 1NV9A 1JR3E 1OAIA 1WIVA 1YLAA 2MR9A 3B89A 2DAMA 3GLIE 1OQYA 1IFYA 1A5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO5 A;  4DBG B;  2BWE A;  1HQY E;  1Y8G A;  3MMP A;  2DAG A;  1IM2 A;  1V92 A;  1VDL A;  1XB2 B;  2JZ0 A;  1VG5 A;  2O25 A;  1UFZ A;  2LVO C;  1CUK A;  1NV8 A;  2DKL A;  3FE3 A;  4F1I A;  1OKS A;  1TR8 A;  2JUJ A;  2K0B X;  1R4G A;  1VQ1 A;  2LTU A;  2DAE A;  2KNV A;  1WR1 B;  2MRO B;  2CP8 A;  3IHP A;  2K9D A;  2H5X A;  1DO2 A;  2KNZ A;  2L2D A;  1T6O A;  1PGY A;  4GEW A;  3LCU A;  2JY5 A;  3K9O A;  3GLH E;  2OOA A;  1Q02 A;  2JP7 A;  1WGL A;  2KNA A;  1VEJ A;  1C7Y A;  1OTR A;  1DV0 A;  1G3I A;  2BWB A;  2RRU A;  1WJ7 A;  2OO9 A;  1WHC A;  1G41 A;  2G3Q A;  4UN2 B;  1EFU B;  1ZV1 A;  1MN3 A;  3E21 A;  3FRI A;  5DFL A;  3E46 A;  2L4E A;  1XXH E;  2CWB A;  1ZMV A;  4WP2 A;  2DHY A;  2JY8 A;  2QHO B;  2DAI A;  3FRH A;  2LVQ D;  2WZJ A;  1T43 A;  1HT1 E;  1HJP A;  2DAK A;  2L4F A;  3H4J A;  3GLG E;  4HEO A;  2HAK A;  2DNA A;  3GLF E;  1KYI A;  2DI0 A;  3LCV B;  2EKK A;  2EKF A;  1P3Q Q;  1G4A E;  1WGN A;  2EJS A;  1BVS A;  2LBC A;  1SG9 A;  4G3O A;  1AIP C;  1ZMW A;  2MGW A;  3F92 A;  2DZL A;  2DEN A;  2OOB A;  2LVN C;  2ZTD A;  5JI2 E;  1DO0 A;  2LVA A;  1QZE A;  2KHH A;  2HWJ A;  1TTE A;  3BBZ A;  1IXS A;  3IEC A;  3T6P A;  2JNH A;  2MJ5 B;  2R0I A;  2JY7 A;  2ZTC A;  2JY6 B;  1F4I A;  2B3T A;  1E94 E;  2QSF X;  4Q7J A;  4F2L A;  3K9P A;  2JZ1 A;  1ZMU A;  4R71 A;  1VEG A;  2LVP C;  1HT2 E;  1VEK A;  2QNJ A;  1NV9 A;  1JR3 E;  1OAI A;  1WIV A;  1YLA A;  2MR9 A;  3B89 A;  2DAM A;  3GLI E;  1OQY A;  1IFY A;  1A5T A; 
#chains in the Genus database with same CATH topology
 1GO5 A;  1IQP A;  4B3R M;  1XHB A;  1OFI A;  1Y8G A;  4B3T M;  4GIT A;  4AKG A;  1OJL A;  2D7E A;  2O25 A;  2I7P A;  5KPT A;  3H4M A;  5C1B A;  3JR5 A;  1NV8 A;  3FE3 A;  3KXE C;  4OX9 M;  3FKE A;  2APL A;  1OKS A;  1R2Z A;  4X64 M;  2JUJ A;  3HWS A;  3UJN A;  3GO8 A;  4JI3 M;  2DAE A;  3HHX A;  2KNV A;  1WR1 B;  4KLN A;  4AG5 A;  2CP8 A;  1Z5B A;  3I4V A;  3IHP A;  4L8R C;  1TH4 A;  2K9D A;  2HL7 A;  3HJS A;  1NJG A;  2CEA A;  2LH0 A;  3C3E A;  2DZO B;  3GRV A;  4LJA A;  3GPX A;  3U6E A;  2L2D A;  1T6O A;  3FUV A;  3I01 M;  1ZAE A;  3LCU A;  2JY5 A;  1GL7 A;  3QYE A;  1PJS A;  2L7H A;  2Q2E B;  2Z4R A;  1Q02 A;  3KOX E;  3MJ5 A;  2JP7 A;  5L8R F;  2XZF A;  1DV0 A;  5EXX A;  3KDS E;  1G3I A;  4AZF A;  1QZM A;  2M5Z A;  4B3M M;  1IN8 A;  3A45 A;  4X65 M;  1QAO A;  4DUY M;  4M9X A;  2G3Q A;  1GKI A;  1N33 M;  2RGH A;  1MN3 A;  3FRI A;  4XGI A;  1W5S A;  4JXJ A;  4QHS A;  1XXH E;  2NQ8 C;  4HLQ A;  3L26 A;  3E9S A;  2DHY A;  2BNK A;  5LMU M;  2RKO A;  4LFB M;  3L25 A;  2DAI A;  3FRH A;  2WZJ A;  1YUB A;  1TGU A;  2JA2 A;  1DGF A;  1HT1 E;  2QP9 X;  4QHT A;  1IY1 A;  4I4L A;  2LXE A;  1DGH B;  2HCB A;  3VK7 A;  1E32 A;  5IWA M;  4I8O A;  3SHF A;  3M6A A;  5IT9 S;  1XXH A;  3T38 A;  2UXD M;  2XSZ D;  3LCV B;  3KVW A;  1LTM A;  1TDH A;  1HNX M;  1I4W A;  4B7F A;  2KEB A;  2ZAN A;  5LMN M;  4G3O A;  1ZMW A;  3MK6 A;  2KDL A;  2P5T A;  3VDU A;  1NHG C;  4LZJ A;  2XF3 A;  5F3W A;  2WSC F;  4LFC M;  2DEN A;  1N78 A;  3THG A;  5EXS A;  1JR3 D;  3U61 A;  3K8Z A;  3D8L A;  3SAU A;  3FTF A;  3AOE A;  5FTM A;  3GLI A;  1L1T A;  1QZE A;  3VFD A;  1EE8 A;  1HNW M;  2UUC M;  3KP0 E;  3IEC A;  3ZC7 B;  3RGP A;  4AI6 A;  4DV3 M;  4DV2 M;  3SAW A;  1QAM A;  5FTJ A;  2ZTC A;  4GHL A;  2JY6 B;  5DNY A;  1UM8 A;  2CUZ A;  1J7K A;  2XGN A;  1Z5A A;  4MGY E;  3HJQ A;  4PT5 A;  4YY3 M;  1LV7 A;  3B74 A;  4NXM M;  1T3T A;  4DR3 M;  1VEG A;  4JI7 M;  4IJE A;  3KOW E;  5ITY A;  3K1J A;  3IG8 A;  4OW0 A;  5EQT A;  1OAI A;  3GQ4 A;  3KP1 E;  1H6U A;  2MR9 A;  1IY2 A;  4QOS A;  1KSF X;  3GLI E;  4AG6 A;  1K82 A;  1NNJ A;  2G5G X;  3U6M A;  3ZQJ A;  2CV1 A;  2UU9 M;  1OQY A;  2X8A A;  2QPA A;  3LVV A;  4R7G A;  1IFY A;  3HHY A;  3VKG A;  3A98 B;  2CHQ A;  3QAU A;  3WHK A;  2HHH M;  2OQ4 A;  4MGK E;  4DBG B;  4AKH A;  4G6Z A;  3MMP A;  1TDZ A;  4KOD A;  4DR6 M;  3B7Z A;  1V92 A;  1VDL A;  4ANR A;  1UFZ A;  1QUT A;  3R9X B;  3L2A A;  1OIZ A;  2I7N A;  3Q8G A;  1D0M A;  4GH9 A;  2VII A;  3J27 B;  1WXQ A;  3U6D A;  4G4O A;  2F5N A;  2MH8 A;  4LZZ A;  2LTU A;  1R4G A;  1VDD A;  3PNY A;  2ZAO A;  7CAT A;  2MRO B;  3HU1 A;  2X49 A;  3CGW A;  3FTC A;  1E9R A;  3GRY A;  4IBG A;  3U61 B;  3HGI A;  3B9P A;  4DR4 M;  2L7I A;  1PJI A;  2D7H A;  1TF0 B;  1IXR C;  2FH0 A;  4IBC A;  2ZBK B;  3GLH E;  2CHV A;  1N34 M;  3U6S A;  1C7Y A;  1VEJ A;  1N36 M;  2O01 F;  3HJ8 A;  4JI1 M;  4YHH M;  1Z6T A;  2BWB A;  4RF1 A;  5EXT A;  4MH0 E;  5EJC A;  1WJ7 A;  4X62 M;  1YE9 A;  2ZM6 M;  1F4I A;  4QNR A;  1Q3B A;  1EFU B;  2XZU A;  1OIP A;  3FUX A;  2R44 A;  3LMM A;  5ITR A;  1PJT A;  2BJV A;  3L27 A;  3J7A S;  3KS4 A;  5BPV A;  3SMP A;  3T1H M;  4XK8 F;  4B3S M;  1IBM M;  4WP2 A;  5ITQ A;  3TWL A;  3HHZ A;  3EIH A;  5KQ8 A;  3AV0 A;  4IBD A;  1HJP A;  3DOA A;  2K6B A;  3MHV C;  3H4J A;  2VQE M;  5E26 A;  2CFO A;  3GLH A;  3GQ3 A;  2Z4S A;  1IBK M;  3CF6 E;  3W68 A;  4AW4 A;  3UGJ A;  2BJW A;  2DNA A;  1QYR A;  2DI0 A;  2FNA A;  3QWL A;  3KSJ A;  3LW5 F;  3SAT A;  4FWG A;  1P3Q Q;  1WGN A;  2J7O A;  2WSE F;  3T15 A;  4G4N A;  4LJ6 A;  5KO3 A;  2QBY B;  4PD2 A;  2CV0 A;  4LGY A;  1Z59 A;  4MB7 A;  2CRU A;  2J5Y A;  4L6V 6;  4LG2 A;  2KZU A;  1XMQ M;  4KO8 A;  3GRR A;  5ITT A;  2MGW A;  1N75 A;  3GLI B;  4HL4 A;  1IN7 A;  2DZL A;  2XSZ A;  3FYD A;  2UXC M;  2LVN C;  4IBF A;  2ZTD A;  4D82 A;  4NRV A;  4DV1 M;  4B7H A;  3J2P B;  1DO0 A;  3U6L A;  3VDP A;  2O5R A;  4Y28 F;  4ITQ A;  2HWJ A;  3BBZ A;  3M0E A;  4G4Q A;  3GP1 A;  3PNV A;  1XNR M;  1TH3 A;  3T6P A;  2UUA M;  5IRE B;  2JNH A;  1QAQ A;  1JR3 A;  2M60 A;  1NO1 A;  3JAM S;  3L28 A;  2C98 A;  4IIW A;  2A5Y B;  4PDI A;  3U60 B;  2QSF X;  4FCW A;  4Z8X A;  2ERC A;  3RE8 A;  2YR0 A;  1S3S A;  1PJJ A;  3GQ5 A;  2V1C A;  4P16 A;  4R71 A;  3AKZ A;  3D8B A;  3C9P A;  2EUC A;  4M0W A;  1MJG M;  4M9S A;  2QNJ A;  1VEK A;  2FFJ A;  3LQQ A;  5ITX A;  1KFV A;  1QDR A;  3PVS A;  4NL4 H;  2DAM A;  4CIS A;  2XEP A;  4DR7 M;  1SXJ E;  3RGS A;  1L1Z A;  2V1U A;  4NSO B;  5GKN A;  2DWZ B;  1C1K A;  1W5T A;  4FCV A;  4LJ9 A;  1QUS A;  3OTO M;  4B7G A;  1DGG A;  3J81 S;  2L09 A;  3AOE C;  4FWD A;  2C99 A;  4IBJ A;  3GPP A;  1IN4 A;  2XLJ A;  1GLN A;  3VK8 A;  1D0L A;  2KW0 A;  5FLX S;  3J7B A;  1GL6 A;  3HU2 A;  3U5Z B;  2F5S A;  3AJI B;  1NNU C;  1IBL M;  4M9Z A;  4B08 A;  2QBY A;  5ITX E;  2K0B X;  2Y20 A;  3TPZ A;  2R65 A;  3AFH A;  5KQD A;  1I94 M;  4NRW A;  1SXJ B;  2C9O A;  4DV6 M;  4DR2 M;  2XFS A;  3UK6 A;  3M7G A;  2H5X A;  3WHL A;  1TH2 A;  1QAN A;  2KNZ A;  4OVZ B;  1PGY A;  2YNM D;  3VKH A;  3K9O A;  2DXI A;  2F5Q A;  2OOA A;  3FD9 A;  2R45 A;  1R6B X;  3KOZ E;  3KS8 A;  4GKK M;  3W0F A;  4GMQ A;  1L8Q A;  1NSF A;  3GLF B;  3BXW A;  5JI3 E;  4OVZ A;  3SMS A;  1G41 A;  1QDT A;  2VDB B;  4L15 A;  2R4J A;  4I81 A;  3TL4 X;  1ZV1 A;  3GLG A;  3U6O A;  2F5P A;  3E21 A;  2VF8 A;  4QNM A;  5DFL A;  1G8P A;  3L29 A;  4Z6Y A;  4LF5 M;  1XC8 A;  2D7G A;  2F5O A;  2R46 A;  3E4R A;  4GC5 A;  4DV4 M;  3GLF A;  2LWX A;  2VF7 A;  3FUU A;  1ZMV A;  3I04 M;  4IBK A;  2JY8 A;  5DYI A;  2R18 A;  4LJ7 A;  3CF2 A;  4K0K M;  2LVQ D;  2UXB M;  4FVM A;  1R7R A;  3B7Q A;  3SBJ A;  1T43 A;  3DZD A;  2LHC A;  2DHR A;  4LRT A;  4GRI A;  4L4U A;  4JI2 M;  4PDG A;  1Z5C A;  4MM3 B;  1PJQ A;  2ZAM A;  4NXN M;  3U6C A;  3NWL A;  4LRS A;  5DYG A;  3GLF E;  5E6J A;  1KYI A;  3HU3 A;  4BBA A;  4AQY M;  4X66 M;  2EKK A;  4D80 A;  4LJ4 A;  4IBB A;  2EJS A;  5IZ7 D;  4LFA M;  1BVS A;  2LBC A;  1V33 A;  3GLH B;  3SYL A;  4EIW A;  4FCT A;  3U5Z A;  2QEN A;  4PCZ A;  1SG9 A;  2DZN B;  1ZQ9 A;  4LY6 A;  2K47 A;  3I51 A;  1G59 A;  5FTK A;  1AIP C;  1MU5 A;  4A3V B;  4JV5 M;  5H37 D;  3SFZ A;  2CE7 A;  3T1Y M;  1R5L A;  4LJ5 A;  5KPZ A;  2OOB A;  5FTL A;  1K3W A;  1HNZ M;  4KHP M;  3HX3 A;  2V6Z M;  3QYB A;  4II7 A;  2DWL A;  2FOI C;  5BR8 M;  1SXJ A;  4LJ8 A;  2KHH A;  4CGY B;  2Z7J A;  1IXS A;  3U6Q A;  4LGM A;  3TWM A;  4JI6 M;  3GPY A;  4P17 A;  1GAB A;  1R2Y A;  2C96 A;  2J7N A;  1Q39 A;  4RF0 A;  1D0K A;  4AKI A;  2MJ5 B;  2GQF A;  3GLG B;  1NY5 A;  1MX0 A;  1QVR A;  4FWH A;  1GVN A;  2R62 A;  1ORY B;  4L78 A;  3UZU A;  2B3T A;  2JWS A;  1IXS B;  4Q7J A;  5KPR A;  4JI4 M;  4I5S A;  4F2L A;  3HHW A;  4CJ6 A;  4DV0 M;  2KZS A;  3LQR A;  3SAS A;  2JZ1 A;  1ZMU A;  1GJT A;  2VQF M;  4G4R A;  4LF6 M;  3TE6 A;  4NOO B;  2LVP C;  2FE8 A;  1HT2 E;  4RKU F;  4JI0 M;  3PXG A;  1WIV A;  1JR3 E;  4KT0 F;  1DGH A;  1SXJ C;  4REZ A;  2CV2 A;  4DUZ M;  2QCU A;  4WW0 A;  3KOY E;  4JN6 A;  1Q3C A;  4ZPX A;  1PM5 A;  5A2Q S;  4DR1 M;  3CTW B;  2KRK A;  4MGI E;  2RGO A;  3U6P A;  1IY0 A;  1A5T A;  3PFI A;  4L16 A;  4RNA A;  4JI5 M;  1N32 M;  1EIJ A;  2BWE A;  3UMM A;  1OAO C;  1HQY E;  1XXH B;  1FNN A;  2DAG A;  4S12 A;  1IM2 A;  2DWN A;  3SC3 A;  1JQJ C;  1NVM A;  1XB2 B;  2JZ0 A;  2Y0T A;  2Y0Q A;  3NBX X;  1VG5 A;  3J80 S;  3SHG B;  3Q8X A;  2LVO C;  1CUK A;  2DKL A;  4F1I A;  2KXE A;  4LF7 M;  1HQC A;  4LF9 M;  5EP1 A;  1TR8 A;  2Z8Y M;  1FJG M;  1VQ1 A;  3SAR A;  3C58 A;  3B7N A;  4XBO A;  3DFZ A;  1PRB A;  1D2N A;  3FYC A;  2H1R A;  2E5L M;  2OPF A;  2Y21 A;  1DO2 A;  3HZJ A;  3K2L A;  4GEW A;  1NJF A;  1J09 A;  3TWK A;  1X37 A;  1WGL A;  2KNA A;  1OTR A;  5EP2 A;  3EIE A;  1L2B A;  2RRU A;  2OO9 A;  2GNO A;  4CHT B;  1QQW A;  1WHC A;  4UN2 B;  3BOS A;  3FTE A;  1N77 A;  2X4A A;  4MGH A;  3HY5 A;  3E46 A;  2L4E A;  1GJS A;  1XMO M;  1IN6 A;  2WSF F;  2KA6 B;  2CWB A;  4LCB A;  3VLF B;  3ZH9 B;  1HR0 M;  2UUB M;  3DA1 A;  3JR4 A;  3FTD A;  2QHO B;  2Z3X A;  1JB0 F;  1E9S A;  2DAK A;  3RFW A;  4NSR A;  2EO2 A;  3KW6 A;  3SYK A;  2L4F A;  3GLG E;  3I4Y A;  4HEO A;  3K92 A;  5FTN A;  3GPU A;  4DV5 M;  4BB9 A;  4GKJ M;  1XWI A;  2HAK A;  3AOG A;  3IG5 A;  3W0L B;  3TQS A;  3CF0 A;  5C18 A;  2L6O A;  5EXP A;  2C9C A;  1NHW C;  4DV7 M;  1K3X A;  4LF8 M;  1L2C A;  2EKF A;  2XH9 A;  4TUW A;  1G4A E;  1J5E M;  1OFH A;  4GIP A;  2N35 A;  1AUA A;  2HKJ A;  4M0D A;  4IJF A;  2EA0 A;  4CIZ A;  4OU7 A;  1XNQ M;  4D81 A;  3F92 A;  3W67 A;  2F4V M;  2AHM A;  2R6F A;  4R3D A;  2W82 A;  4FD2 A;  5JI2 E;  3R8F A;  2DVW B;  2JXN A;  4FW9 A;  2LHG A;  3AL0 C;  4NC6 A;  1RU3 A;  4DR5 M;  4GHA A;  2LVA A;  3ZCB B;  3ILK A;  3SAV A;  1TTE A;  2G8L A;  4W5W A;  1DGB A;  4MGZ E;  1IXZ A;  5EP4 A;  2KRU A;  5ITU A;  4LF4 M;  3V76 A;  2YQZ A;  2R0I A;  2JY7 A;  3A46 A;  2DWM A;  3LVW A;  3FUW A;  3A42 A;  3KFU G;  1V34 A;  5FSW A;  3GRU A;  2C5R A;  4QOZ C;  1E94 E;  1SXJ D;  1L2D A;  2FS1 A;  2XFT A;  4IBE A;  2QZ4 A;  3K9P A;  2R4E A;  2QQ8 A;  3FUT A;  3NBI A;  5EP3 A;  4BLC A;  1IN5 A;  3HKP A;  3U60 A;  4GC9 A;  1NV9 A;  1YLA A;  3B89 A;  3C3D A;  1NY6 A;  4WUR A;  8CAT A;  3KSX A;  4JYA M;  1YSY A;  4IBI A;  1G71 A;  2LNH C;  4JI8 M;  2CHG A;  2YFQ A; 
#chains in the Genus database with same CATH homology
 1GO5 A;  4DBG B;  2BWE A;  1HQY E;  1Y8G A;  3MMP A;  2DAG A;  1IM2 A;  1V92 A;  1VDL A;  1XB2 B;  2JZ0 A;  1VG5 A;  2O25 A;  1UFZ A;  2LVO C;  1CUK A;  1NV8 A;  2DKL A;  3FE3 A;  4F1I A;  1OKS A;  1TR8 A;  2JUJ A;  2K0B X;  1R4G A;  1VQ1 A;  2LTU A;  2DAE A;  2KNV A;  1WR1 B;  2MRO B;  2CP8 A;  3IHP A;  2K9D A;  2H5X A;  1DO2 A;  2KNZ A;  2L2D A;  1T6O A;  1PGY A;  4GEW A;  3LCU A;  2JY5 A;  3K9O A;  3GLH E;  2OOA A;  1Q02 A;  2JP7 A;  1WGL A;  2KNA A;  1VEJ A;  1C7Y A;  1OTR A;  1DV0 A;  1G3I A;  2BWB A;  2RRU A;  1WJ7 A;  2OO9 A;  1WHC A;  1G41 A;  2G3Q A;  4UN2 B;  1EFU B;  1ZV1 A;  1MN3 A;  3E21 A;  3FRI A;  5DFL A;  3E46 A;  2L4E A;  1XXH E;  2CWB A;  1ZMV A;  4WP2 A;  2DHY A;  2JY8 A;  2QHO B;  2DAI A;  3FRH A;  2LVQ D;  2WZJ A;  1T43 A;  1HT1 E;  1HJP A;  2DAK A;  2L4F A;  3H4J A;  3GLG E;  4HEO A;  2HAK A;  2DNA A;  3GLF E;  1KYI A;  2DI0 A;  3LCV B;  2EKK A;  2EKF A;  1P3Q Q;  1G4A E;  1WGN A;  2EJS A;  1BVS A;  2LBC A;  1SG9 A;  4G3O A;  1AIP C;  1ZMW A;  2MGW A;  3F92 A;  2DZL A;  2DEN A;  2OOB A;  2LVN C;  2ZTD A;  5JI2 E;  1DO0 A;  2LVA A;  1QZE A;  2KHH A;  2HWJ A;  1TTE A;  3BBZ A;  1IXS A;  3IEC A;  3T6P A;  2JNH A;  2MJ5 B;  2R0I A;  2JY7 A;  2ZTC A;  2JY6 B;  1F4I A;  2B3T A;  1E94 E;  2QSF X;  4Q7J A;  4F2L A;  3K9P A;  2JZ1 A;  1ZMU A;  4R71 A;  1VEG A;  2LVP C;  1HT2 E;  1VEK A;  2QNJ A;  1NV9 A;  1JR3 E;  1OAI A;  1WIV A;  1YLA A;  2MR9 A;  3B89 A;  2DAM A;  3GLI E;  1OQY A;  1IFY A;  1A5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...