1VEKA

Solution structure of rsgi ruh-011, a uba domain from arabidopsis cdna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
84
Chain Sequence
b'GSSGSSGGEELLPDGVPEEVMESAQPVANEEIVAQLVSMGFSQLHCQKAAINTSNAGVEEAMNWLLSHMDDPDIDAPISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin-specific protease 14, putative
publication title Solution Structure of RSGI RUH-011, a UBA Domain from Arabidopsis cDNA
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 13
structure length 84
sequence length 84
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vekA01
1OTRA 2QNJA 2WZJA 1DO2A 2B3TA 2BWBA 2DAEA 1V92A 4G3OA 1CUKA 1IFYA 4HEOA 1VQ1A 2JUJA 1OQYA 2L4EA 2OOBA 2CWBA 1DO0A 1HT2E 2JZ0A 1VEKA 1WIVA 1AIPC 2HWJA 1KYIA 1C7YA 2MJ5B 2DAMA 2QHOB 2QSFX 3E21A 1ZV1A 2LVOC 1DV0A 1GO5A 4F1IA 1JR3E 3H4JA 5DFLA 2CP8A 5JI2E 3E46A 4DBGB 2HAKA 2DENA 1XXHE 2BWEA 2MROB 1TR8A 2JY6B 2R0IA 1QZEA 1E94E 2OOAA 2L4FA 4Q7JA 1HJPA 1VEGA 1Q02A 2O25A 2ZTCA 2JY8A 3BBZA 2G3QA 3LCVB 1MN3A 2EJSA 1F4IA 2KNVA 1WGNA 3GLFE 1A5TA 1VEJA 2L2DA 1SG9A 1WHCA 2JP7A 1NV9A 1OKSA 1EFUB 2DAGA 1G3IA 2DAIA 1VG5A 1YLAA 1ZMUA 2DHYA 3FE3A 2EKFA 1G4AE 3GLHE 1UFZA 4R71A 4F2LA 2KNZA 1ZMWA 2JY5A 2LVQD 2MGWA 2EKKA 3B89A 3F92A 2DKLA 3T6PA 1NV8A 2DAKA 2DZLA 2JY7A 1T6OA 2LTUA 1T43A 2K0BX 2H5XA 3LCUA 2KNAA 3IHPA 2MR9A 4WP2A 1VDLA 1G41A 2LVPC 3GLGE 1XB2B 3K9OA 3K9PA 1HQYE 1WJ7A 1ZMVA 1PGYA 3MMPA 1WGLA 2LVAA 1HT1E 1P3QQ 3GLIE 1IM2A 3IECA 2OO9A 2JZ1A 2ZTDA 2RRUA 2JNHA 2DI0A 2LBCA 1Y8GA 1BVSA 2DNAA 2LVNC 4UN2B 3FRIA 2K9DA 1WR1B 1OAIA 3FRHA 1IXSA 4GEWA 1R4GA 1TTEA 2KHHA
chains in the Genus database with same CATH superfamily
4LCBA 2QNJA 3KOWE 5DNYA 2FNAA 2I7PA 3LQQA 4A3VB 1GVNA 2J5YA 5F3WA 2BWBA 2XGNA 3TQSA 2DAEA 4FCVA 1W5TA 5EP1A 3GRRA 2XZFA 3GQ5A 4JI1M 4DV5M 3KVWA 4B3RM 1N36M 3VKHA 2BJVA 2CWBA 3KFUG 1DO0A 2JZ0A 4FCWA 3IG8A 3U6OA 5GKNA 1FJGM 1ZAEA 3VFDA 2P5TA 1JR3A 2R4JA 3TL4X 4RNAA 2NQ8C 5EP2A 3KP0E 2QSFX 4R3DA 1XC8A 3HHWA 2OQ4A 4P16A 2J7OA 1ZV1A 3V76A 5FTLA 1L1TA 1DV0A 4OVZA 4X66M 2R4EA 4S12A 3T38A 5JI3E 2KRKA 4L6V6 1GO5A 1IXRC 3J27B 2CHGA 3AOEA 4DBGB 3LMMA 2CUZA 4B3MM 3QYEA 4WURA 4P17A 4GITA 5KPRA 1JR3D 4JYAM 3DA1A 2K47A 1TR8A 4D82A 3SARA 1LTMA 4W5WA 1TH2A 3PFIA 2UXDM 4Q7JA 2O25A 2ZTCA 5EXTA 3GLGA 3U6CA 3J2PB 3SATA 3DFZA 2I7NA 4YHHM 3FUVA 2DVWB 2KNVA 3FTCA 3A45A 4JI7M 3GLFE 1A5TA 2C96A 4AW4A 4X64M 4G6ZA 2JP7A 1EFUB 1J5EM 5L8RF 2Y21A 4B08A 2DHYA 4DR2M 3U6PA 4LFCM 4AG5A 4F2LA 2KNZA 3U6MA 1L2CA 2MGWA 5ITQA 4CIZA 2EKKA 2DHRA 1PJJA 3B89A 3AOGA 3VDPA 5BPVA 2ERCA 3U6EA 5FLXS 4NRVA 4JI2M 1NSFA 2APLA 5EXPA 1PJIA 4HL4A 2KW0A 2QZ4A 2KXEA 3I4YA 4Z6YA 4PDGA 2O01F 3GLIB 3GLHB 1OAOC 2A5YB 4KODA 1T6OA 2FE8A 3K8ZA 4LJ8A 3HHYA 1N34M 1IN6A 2ZAMA 2RKOA 4MB7A 1OJLA 3K1JA 3RGPA 4PCZA 2UUBM 4D81A 1GJSA 3GLGE 3FD9A 4JI5M 3GPPA 1N77A 1XB2B 3K9OA 4OU7A 2RGHA 1ZMVA 3C3DA 5EXXA 2DWZB 3MMPA 2UU9M 4NXMM 1WGLA 2VF7A 1IM2A 3ZQJA 2VQEM 1IN4A 4KLNA 3IECA 1FNNA 4I81A 1TH3A 2MH8A 3JR4A 4ZPXA 3LVWA 4B3SM 1SXJA 3KSXA 3SAUA 3B74A 5FTNA 3U61B 1BVSA 5IREB 3LW5F 1J09A 3FRIA 3K92A 1HNXM 3SAWA 2M5ZA 4FCTA 3U60A 3VDUA 4HLQA 4D80A 4IBEA 3UZUA 3GPXA 3I01M 3FTDA 2RGOA 2WSFF 3GPUA 3T15A 4GEWA 3GQ3A 3NBXX 1K3XA 1OTRA 2ZBKB 4JI4M 3J7BA 1R6BX 1SXJD 4GRIA 3C9PA 1YE9A 4FW9A 1PM5A 3U6LA 2CV2A 2ZAOA 4L8RC 2UUCM 2V1UA 2YR0A 2F5SA 1VQ1A 1GABA 2OOBA 4K0KM 1KFVA 3BOSA 1IN5A 1WIVA 2Z3XA 1IXSB 2JXNA 4GKKM 1C7YA 1E9RA 5E6JA 3CF6E 4JXJA 5DYIA 1QUSA 5EJCA 4IBIA 4DR7M 1SXJE 2F5QA 3SASA 4RKUF 3MK6A 5DFLA 4G4NA 1NY6A 3D8LA 1R7RA 1GL6A 1X37A 2D7EA 3E46A 2HCBA 3A46A 4DUYM 2D7GA 2G5GX 4LZJA 3U6SA 2DENA 3ILKA 5LMNM 4YY3M 1NHWC 2GQFA 3KOZE 3MHVC 4IBFA 1JQJC 3C58A 2JY6B 3UGJA 1J7KA 1QZEA 3GLFA 1NNJA 1L8QA 5BR8M 1HJPA 4CGYB 3BBZA 3EIEA 4OW0A 5DYGA 4IBBA 1R2YA 3HJ8A 2EJSA 4G4RA 2KZSA 1V33A 3SYLA 4IBDA 4OVZB 5KQDA 4II7A 3RE8A 1XXHB 1R2ZA 1QDRA 2QBYB 1XNQM 3SMPA 1NV9A 1AUAA 4LRTA 2DAIA 1VG5A 3FUTA 2UXBM 3T1YM 1H6UA 1ZMUA 2DZOB 1E9SA 4DR1M 3GRUA 2EKFA 1HQCA 3HY5A 2BJWA 4L15A 3UK6A 1C1KA 4DV0M 3JR5A 2JY5A 3GPYA 4RF1A 3WHLA 2CHQA 2JWSA 1Z6TA 2L09A 2C5RA 1GKIA 1PRBA 4IBKA 5E26A 3QAUA 3SAVA 2QPAA 1IXZA 3GLGB 1K3WA 3L27A 4DV3M 3W67A 1R5LA 1TF0B 2XSZA 3W0LB 5IT9S 1Q3CA 2R65A 1QVRA 4I4LA 1TH4A 2LWXA 2R6FA 3I04M 4EIWA 5KPTA 2JY7A 4LF9M 2K0BX 2ZANA 4MGHA 2MR9A 2N35A 4WP2A 2F5OA 4LG2A 2E5LM 4ITQA 1XWIA 3U5ZA 1NNUC 4LRSA 3B9PA 1HQYE 1WJ7A 3K9PA 3HJSA 1S3SA 4QNMA 7CATA 2LHCA 2XSZD 4G4QA 3B7QA 8CATA 4QOZC 1KSFX 1DGBA 4CISA 2W82A 4GHAA 3HGIA 2OO9A 1OFIA 1NHGC 3E9SA 1NO1A 3L28A 1DGFA 4DV2M 3U6QA 1D0MA 4AI6A 1DGGA 2DNAA 2DWLA 4LF8M 3TWKA 2K9DA 2QP9X 2OPFA 2R44A 3ZC7B 3FRHA 5H37D 1QAQA 4RF0A 3SHFA 1OFHA 4L78A 1PJQA 1R4GA 1TTEA 1RU3A 2KHHA 3SYKA 1IBMM 2XFTA 2FFJA 2LNHC 3VKGA 4NC6A 3HKPA 3M7GA 3NWLA 3E4RA 3AKZA 1L1ZA 4G3OA 2XEPA 5LMUM 1IFYA 1IBLM 4HEOA 3HU2A 4Z8XA 3UMMA 4I5SA 2JUJA 1OQYA 1UM8A 4TUWA 1XMOM 1NJFA 2FH0A 3U60B 4AKHA 3FUXA 1DGHA 3IG5A 5IZ7D 4Y28F 1AIPC 1I4WA 1PJTA 1IQPA 1JB0F 2MJ5B 2O5RA 2DWMA 4IBCA 3C3EA 1VDDA 4MGKE 1Z5AA 1Q39A 4JI6M 3GLHA 4R7GA 3FUUA 2CHVA 4LF7M 3CGWA 3I4VA 1Z59A 3AL0C 4F1IA 3H4JA 3LQRA 3WHKA 5FTKA 1HNZM 2CP8A 5EXSA 5JI2E 4AQYM 2HAKA 2Z4RA 2QENA 2R62A 2EO2A 3GRVA 3T1HM 5FTMA 1YSYA 4JN6A 1QAMA 2MROB 3W0FA 4NSRA 4G4OA 1IY1A 2HL7A 4IBGA 4BBAA 1E94E 2OOAA 4GH9A 2L4FA 3KP1E 1VEGA 4OX9M 3LCVB 2F4VM 2JY8A 3SHGB 4NRWA 1HNWM 1MN3A 1K82A 3U61A 4JI3M 3KXEC 1F4IA 3HHZA 2HHHM 2XF3A 3FTEA 4GIPA 2KEBA 3AV0A 4B7FA 2L2DA 2LXEA 3L2AA 4LF6M 1WHCA 3J81S 2WSCF 3GRYA 4IJFA 3CF0A 4LZZA 1Z5CA 1L2BA 2HKJA 1YLAA 2YNMD 4DV6M 3FE3A 3TE6A 1G4AE 5ITRA 3M0EA 4FWHA 2F5NA 3GLHE 1UFZA 4R71A 4NOOB 3KOXE 4FD2A 1T3TA 4LJ6A 2LVQD 2KDLA 1IN7A 1N32M 3GLFB 3A98B 3M6AA 3KOYE 4DUZM 1L2DA 2WSEF 2DKLA 4GMQA 4MH0E 4QHTA 4LGYA 4LFAM 2X4AA 3JAMS 5IWAM 1NV8A 2C9OA 3H4MA 2DAKA 2DZLA 5EP3A 4JI8M 1T43A 3I51A 4PT5A 3LCUA 4LF4M 1GL7A 4LY6A 1ZQ9A 1V34A 2VDBB 3IHPA 4M9SA 2AHMA 2CE7A 4FVMA 1G71A 1VDLA 3L29A 3GP1A 1TGUA 2CRUA 2LVPC 4FWGA 5C18A 4M9XA 4MGYE 1MU5A 4KO8A 1QYRA 2M60A 2XZUA 4DR4M 3KW6A 3FTFA 1PGYA 2LVAA 1HT1E 2V1CA 3PNVA 2JA2A 3AFHA 1XHBA 2LH0A 4IJEA 2JZ1A 5ITXA 3HZJA 3Q8GA 4KT0F 2RRUA 1TDZA 2JNHA 2DI0A 2LBCA 3VK8A 1Y8GA 2D7HA 3HU3A 4REZA 2LVNC 1QUTA 2KZUA 2FS1A 4IIWA 4UN2B 2V6ZM 1WR1B 4AG6A 2C98A 3SC3A 2R18A 3U5ZB 4LGMA 4BB9A 1OIPA 3PNYA 4LJ9A 3D8BA 1XXHA 4DR5M 1HR0M 2QBYA 2Q2EB 2X49A 1TDHA 2C99A 2WZJA 2YFQA 1DO2A 4PDIA 2DXIA 1NVMA 2B3TA 2Y20A 4NSOB 3TPZA 4QHSA 4M9ZA 4LJ5A 1V92A 1CUKA 4B3TM 1GLNA 1Z5BA 3NBIA 2GNOA 2LHGA 3UJNA 3W68A 5C1BA 2L4EA 2VIIA 3SBJA 1D0KA 2CFOA 3FYDA 3HX3A 4IBJA 4JI0M 1HT2E 2UXCM 1VEKA 4BLCA 2HWJA 3BXWA 1KYIA 3ZCBB 2Z8YM 3TWMA 2XFSA 3U6DA 2DAMA 2QHOB 1I94M 4GC5A 5ITXE 4AZFA 1IBKM 4LF5M 3E21A 3KS4A 3B7ZA 5FTJA 2R45A 1G59A 4CJ6A 4XBOA 2LVOC 4WW0A 3TWLA 3DZDA 3A42A 1JR3E 5EQTA 3PVSA 4DV4M 4AKIA 2C9CA 2Z7JA 4B7HA 4CHTB 3AOEC 2G8LA 1G8PA 3GO8A 1EIJA 1XXHE 1MJGM 2BWEA 3EIHA 1NY5A 1SXJB 4GHLA 1DGHB 3OTOM 2R0IA 4DR6M 1QANA 4DV7M 4DR3M 3SMSA 2UUAM 1IY0A 1YUBA 3DOAA 4M0DA 3R8FA 3KSJA 2L6OA 1Q02A 2G3QA 1WXQA 5ITTA 3GQ4A 2L7HA 3HU1A 4LJ7A 4X65M 2CV0A 5FSWA 1WGNA 3ZH9B 3CTWB 5EP4A 1VEJA 3GLIA 1SG9A 4KHPM 3HWSA 1OKSA 2QQ8A 4PD2A 3Q8XA 1G3IA 2DAGA 4ANRA 2DWNA 2J7NA 1XMQM 2FOIC 2DZNB 3MJ5A 4LFBM 5ITUA 3KS8A 3B7NA 4MGZE 2H1RA 1ZMWA 3KDSE 4L4UA 4QOSA 1D0LA 2Y0QA 3R9XB 1GJTA 2KA6B 4NL4H 4XK8F 5A2QS 2XLJA 3QYBA 3RFWA 3F92A 3FYCA 5ITYA 3J80S 2CEAA 3AJIB 4M0WA 3T6PA 1IY2A 3HJQA 1ORYB 1W5SA 3FUWA 4LJAA 3QWLA 1NJGA 2EA0A 1PJSA 1E32A 2LTUA 2H5XA 2VF8A 2KNAA 3VK7A 4B7GA 1QQWA 3VLFB 4L16A 3LVVA 4NXNM 1OIZA 4GKJM 3CF2A 1G41A 2BNKA 2K6BA 1N75A 3FKEA 1LV7A 4I8OA 4LJ4A 2VQFM 1QDTA 1Q3BA 5KPZA 4MM3B 1EE8A 3RGSA 4XGIA 1XNRM 3THGA 3L26A 1P3QQ 2R46A 1QAOA 3GLIE 4AKGA 3HHXA 3K2LA 2CV1A 3PXGA 2EUCA 1N78A 1MX0A 2ZTDA 2Y0TA 4DV1M 1IN8A 3L25A 1SXJC 3SFZA 2XH9A 1QZMA 2Z4SA 2F5PA 4FWDA 4GC9A 1N33M 3J7AS 1OAIA 4MGIE 5KO3A 1IXSA 2L7IA 2KRUA 2ZM6M 5KQ8A 4QNRA 2X8AA 2YQZA 1D2NA 2QCUA 4X62M 4JV5M
chains in the Genus database with same CATH topology
1OTRA 2QNJA 2WZJA 1DO2A 2B3TA 2BWBA 2DAEA 1V92A 4G3OA 1CUKA 1IFYA 4HEOA 1VQ1A 2JUJA 1OQYA 2L4EA 2OOBA 2CWBA 1DO0A 1HT2E 2JZ0A 1VEKA 1WIVA 1AIPC 2HWJA 1KYIA 1C7YA 2MJ5B 2DAMA 2QHOB 2QSFX 3E21A 1ZV1A 2LVOC 1DV0A 1GO5A 4F1IA 1JR3E 3H4JA 5DFLA 2CP8A 5JI2E 3E46A 4DBGB 2HAKA 2DENA 1XXHE 2BWEA 2MROB 1TR8A 2JY6B 2R0IA 1QZEA 1E94E 2OOAA 2L4FA 4Q7JA 1HJPA 1VEGA 1Q02A 2O25A 2ZTCA 2JY8A 3BBZA 2G3QA 3LCVB 1MN3A 2EJSA 1F4IA 2KNVA 1WGNA 3GLFE 1A5TA 1VEJA 2L2DA 1SG9A 1WHCA 2JP7A 1NV9A 1OKSA 1EFUB 2DAGA 1G3IA 2DAIA 1VG5A 1YLAA 1ZMUA 2DHYA 3FE3A 2EKFA 1G4AE 3GLHE 1UFZA 4R71A 4F2LA 2KNZA 1ZMWA 2JY5A 2LVQD 2MGWA 2EKKA 3B89A 3F92A 2DKLA 3T6PA 1NV8A 2DAKA 2DZLA 2JY7A 1T6OA 2LTUA 1T43A 2K0BX 2H5XA 3LCUA 2KNAA 3IHPA 2MR9A 4WP2A 1VDLA 1G41A 2LVPC 3GLGE 1XB2B 3K9OA 3K9PA 1HQYE 1WJ7A 1ZMVA 1PGYA 3MMPA 1WGLA 2LVAA 1HT1E 1P3QQ 3GLIE 1IM2A 3IECA 2OO9A 2JZ1A 2ZTDA 2RRUA 2JNHA 2DI0A 2LBCA 1Y8GA 1BVSA 2DNAA 2LVNC 4UN2B 3FRIA 2K9DA 1WR1B 1OAIA 3FRHA 1IXSA 4GEWA 1R4GA 1TTEA 2KHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTR A;  2QNJ A;  2WZJ A;  1DO2 A;  2B3T A;  2BWB A;  2DAE A;  1V92 A;  4G3O A;  1CUK A;  1IFY A;  4HEO A;  1VQ1 A;  2JUJ A;  1OQY A;  2L4E A;  2OOB A;  2CWB A;  1DO0 A;  1HT2 E;  2JZ0 A;  1VEK A;  1WIV A;  1AIP C;  2HWJ A;  1KYI A;  1C7Y A;  2MJ5 B;  2DAM A;  2QHO B;  2QSF X;  3E21 A;  1ZV1 A;  2LVO C;  1DV0 A;  1GO5 A;  4F1I A;  1JR3 E;  3H4J A;  5DFL A;  2CP8 A;  5JI2 E;  3E46 A;  4DBG B;  2HAK A;  2DEN A;  1XXH E;  2BWE A;  2MRO B;  1TR8 A;  2JY6 B;  2R0I A;  1QZE A;  1E94 E;  2OOA A;  2L4F A;  4Q7J A;  1HJP A;  1VEG A;  1Q02 A;  2O25 A;  2ZTC A;  2JY8 A;  3BBZ A;  2G3Q A;  3LCV B;  1MN3 A;  2EJS A;  1F4I A;  2KNV A;  1WGN A;  3GLF E;  1A5T A;  1VEJ A;  2L2D A;  1SG9 A;  1WHC A;  2JP7 A;  1NV9 A;  1OKS A;  1EFU B;  2DAG A;  1G3I A;  2DAI A;  1VG5 A;  1YLA A;  1ZMU A;  2DHY A;  3FE3 A;  2EKF A;  1G4A E;  3GLH E;  1UFZ A;  4R71 A;  4F2L A;  2KNZ A;  1ZMW A;  2JY5 A;  2LVQ D;  2MGW A;  2EKK A;  3B89 A;  3F92 A;  2DKL A;  3T6P A;  1NV8 A;  2DAK A;  2DZL A;  2JY7 A;  1T6O A;  2LTU A;  1T43 A;  2K0B X;  2H5X A;  3LCU A;  2KNA A;  3IHP A;  2MR9 A;  4WP2 A;  1VDL A;  1G41 A;  2LVP C;  3GLG E;  1XB2 B;  3K9O A;  3K9P A;  1HQY E;  1WJ7 A;  1ZMV A;  1PGY A;  3MMP A;  1WGL A;  2LVA A;  1HT1 E;  1P3Q Q;  3GLI E;  1IM2 A;  3IEC A;  2OO9 A;  2JZ1 A;  2ZTD A;  2RRU A;  2JNH A;  2DI0 A;  2LBC A;  1Y8G A;  1BVS A;  2DNA A;  2LVN C;  4UN2 B;  3FRI A;  2K9D A;  1WR1 B;  1OAI A;  3FRH A;  1IXS A;  4GEW A;  1R4G A;  1TTE A;  2KHH A; 
#chains in the Genus database with same CATH topology
 4LCB A;  2QNJ A;  3KOW E;  5DNY A;  2FNA A;  2I7P A;  3LQQ A;  4A3V B;  1GVN A;  2J5Y A;  5F3W A;  2BWB A;  2XGN A;  3TQS A;  2DAE A;  4FCV A;  1W5T A;  5EP1 A;  3GRR A;  2XZF A;  3GQ5 A;  4JI1 M;  4DV5 M;  3KVW A;  4B3R M;  1N36 M;  3VKH A;  2BJV A;  2CWB A;  3KFU G;  1DO0 A;  2JZ0 A;  4FCW A;  3IG8 A;  3U6O A;  5GKN A;  1FJG M;  1ZAE A;  3VFD A;  2P5T A;  1JR3 A;  2R4J A;  3TL4 X;  4RNA A;  2NQ8 C;  5EP2 A;  3KP0 E;  2QSF X;  4R3D A;  1XC8 A;  3HHW A;  2OQ4 A;  4P16 A;  2J7O A;  1ZV1 A;  3V76 A;  5FTL A;  1L1T A;  1DV0 A;  4OVZ A;  4X66 M;  2R4E A;  4S12 A;  3T38 A;  5JI3 E;  2KRK A;  4L6V 6;  1GO5 A;  1IXR C;  3J27 B;  2CHG A;  3AOE A;  4DBG B;  3LMM A;  2CUZ A;  4B3M M;  3QYE A;  4WUR A;  4P17 A;  4GIT A;  5KPR A;  1JR3 D;  4JYA M;  3DA1 A;  2K47 A;  1TR8 A;  4D82 A;  3SAR A;  1LTM A;  4W5W A;  1TH2 A;  3PFI A;  2UXD M;  4Q7J A;  2O25 A;  2ZTC A;  5EXT A;  3GLG A;  3U6C A;  3J2P B;  3SAT A;  3DFZ A;  2I7N A;  4YHH M;  3FUV A;  2DVW B;  2KNV A;  3FTC A;  3A45 A;  4JI7 M;  3GLF E;  1A5T A;  2C96 A;  4AW4 A;  4X64 M;  4G6Z A;  2JP7 A;  1EFU B;  1J5E M;  5L8R F;  2Y21 A;  4B08 A;  2DHY A;  4DR2 M;  3U6P A;  4LFC M;  4AG5 A;  4F2L A;  2KNZ A;  3U6M A;  1L2C A;  2MGW A;  5ITQ A;  4CIZ A;  2EKK A;  2DHR A;  1PJJ A;  3B89 A;  3AOG A;  3VDP A;  5BPV A;  2ERC A;  3U6E A;  5FLX S;  4NRV A;  4JI2 M;  1NSF A;  2APL A;  5EXP A;  1PJI A;  4HL4 A;  2KW0 A;  2QZ4 A;  2KXE A;  3I4Y A;  4Z6Y A;  4PDG A;  2O01 F;  3GLI B;  3GLH B;  1OAO C;  2A5Y B;  4KOD A;  1T6O A;  2FE8 A;  3K8Z A;  4LJ8 A;  3HHY A;  1N34 M;  1IN6 A;  2ZAM A;  2RKO A;  4MB7 A;  1OJL A;  3K1J A;  3RGP A;  4PCZ A;  2UUB M;  4D81 A;  1GJS A;  3GLG E;  3FD9 A;  4JI5 M;  3GPP A;  1N77 A;  1XB2 B;  3K9O A;  4OU7 A;  2RGH A;  1ZMV A;  3C3D A;  5EXX A;  2DWZ B;  3MMP A;  2UU9 M;  4NXM M;  1WGL A;  2VF7 A;  1IM2 A;  3ZQJ A;  2VQE M;  1IN4 A;  4KLN A;  3IEC A;  1FNN A;  4I81 A;  1TH3 A;  2MH8 A;  3JR4 A;  4ZPX A;  3LVW A;  4B3S M;  1SXJ A;  3KSX A;  3SAU A;  3B74 A;  5FTN A;  3U61 B;  1BVS A;  5IRE B;  3LW5 F;  1J09 A;  3FRI A;  3K92 A;  1HNX M;  3SAW A;  2M5Z A;  4FCT A;  3U60 A;  3VDU A;  4HLQ A;  4D80 A;  4IBE A;  3UZU A;  3GPX A;  3I01 M;  3FTD A;  2RGO A;  2WSF F;  3GPU A;  3T15 A;  4GEW A;  3GQ3 A;  3NBX X;  1K3X A;  1OTR A;  2ZBK B;  4JI4 M;  3J7B A;  1R6B X;  1SXJ D;  4GRI A;  3C9P A;  1YE9 A;  4FW9 A;  1PM5 A;  3U6L A;  2CV2 A;  2ZAO A;  4L8R C;  2UUC M;  2V1U A;  2YR0 A;  2F5S A;  1VQ1 A;  1GAB A;  2OOB A;  4K0K M;  1KFV A;  3BOS A;  1IN5 A;  1WIV A;  2Z3X A;  1IXS B;  2JXN A;  4GKK M;  1C7Y A;  1E9R A;  5E6J A;  3CF6 E;  4JXJ A;  5DYI A;  1QUS A;  5EJC A;  4IBI A;  4DR7 M;  1SXJ E;  2F5Q A;  3SAS A;  4RKU F;  3MK6 A;  5DFL A;  4G4N A;  1NY6 A;  3D8L A;  1R7R A;  1GL6 A;  1X37 A;  2D7E A;  3E46 A;  2HCB A;  3A46 A;  4DUY M;  2D7G A;  2G5G X;  4LZJ A;  3U6S A;  2DEN A;  3ILK A;  5LMN M;  4YY3 M;  1NHW C;  2GQF A;  3KOZ E;  3MHV C;  4IBF A;  1JQJ C;  3C58 A;  2JY6 B;  3UGJ A;  1J7K A;  1QZE A;  3GLF A;  1NNJ A;  1L8Q A;  5BR8 M;  1HJP A;  4CGY B;  3BBZ A;  3EIE A;  4OW0 A;  5DYG A;  4IBB A;  1R2Y A;  3HJ8 A;  2EJS A;  4G4R A;  2KZS A;  1V33 A;  3SYL A;  4IBD A;  4OVZ B;  5KQD A;  4II7 A;  3RE8 A;  1XXH B;  1R2Z A;  1QDR A;  2QBY B;  1XNQ M;  3SMP A;  1NV9 A;  1AUA A;  4LRT A;  2DAI A;  1VG5 A;  3FUT A;  2UXB M;  3T1Y M;  1H6U A;  1ZMU A;  2DZO B;  1E9S A;  4DR1 M;  3GRU A;  2EKF A;  1HQC A;  3HY5 A;  2BJW A;  4L15 A;  3UK6 A;  1C1K A;  4DV0 M;  3JR5 A;  2JY5 A;  3GPY A;  4RF1 A;  3WHL A;  2CHQ A;  2JWS A;  1Z6T A;  2L09 A;  2C5R A;  1GKI A;  1PRB A;  4IBK A;  5E26 A;  3QAU A;  3SAV A;  2QPA A;  1IXZ A;  3GLG B;  1K3W A;  3L27 A;  4DV3 M;  3W67 A;  1R5L A;  1TF0 B;  2XSZ A;  3W0L B;  5IT9 S;  1Q3C A;  2R65 A;  1QVR A;  4I4L A;  1TH4 A;  2LWX A;  2R6F A;  3I04 M;  4EIW A;  5KPT A;  2JY7 A;  4LF9 M;  2K0B X;  2ZAN A;  4MGH A;  2MR9 A;  2N35 A;  4WP2 A;  2F5O A;  4LG2 A;  2E5L M;  4ITQ A;  1XWI A;  3U5Z A;  1NNU C;  4LRS A;  3B9P A;  1HQY E;  1WJ7 A;  3K9P A;  3HJS A;  1S3S A;  4QNM A;  7CAT A;  2LHC A;  2XSZ D;  4G4Q A;  3B7Q A;  8CAT A;  4QOZ C;  1KSF X;  1DGB A;  4CIS A;  2W82 A;  4GHA A;  3HGI A;  2OO9 A;  1OFI A;  1NHG C;  3E9S A;  1NO1 A;  3L28 A;  1DGF A;  4DV2 M;  3U6Q A;  1D0M A;  4AI6 A;  1DGG A;  2DNA A;  2DWL A;  4LF8 M;  3TWK A;  2K9D A;  2QP9 X;  2OPF A;  2R44 A;  3ZC7 B;  3FRH A;  5H37 D;  1QAQ A;  4RF0 A;  3SHF A;  1OFH A;  4L78 A;  1PJQ A;  1R4G A;  1TTE A;  1RU3 A;  2KHH A;  3SYK A;  1IBM M;  2XFT A;  2FFJ A;  2LNH C;  3VKG A;  4NC6 A;  3HKP A;  3M7G A;  3NWL A;  3E4R A;  3AKZ A;  1L1Z A;  4G3O A;  2XEP A;  5LMU M;  1IFY A;  1IBL M;  4HEO A;  3HU2 A;  4Z8X A;  3UMM A;  4I5S A;  2JUJ A;  1OQY A;  1UM8 A;  4TUW A;  1XMO M;  1NJF A;  2FH0 A;  3U60 B;  4AKH A;  3FUX A;  1DGH A;  3IG5 A;  5IZ7 D;  4Y28 F;  1AIP C;  1I4W A;  1PJT A;  1IQP A;  1JB0 F;  2MJ5 B;  2O5R A;  2DWM A;  4IBC A;  3C3E A;  1VDD A;  4MGK E;  1Z5A A;  1Q39 A;  4JI6 M;  3GLH A;  4R7G A;  3FUU A;  2CHV A;  4LF7 M;  3CGW A;  3I4V A;  1Z59 A;  3AL0 C;  4F1I A;  3H4J A;  3LQR A;  3WHK A;  5FTK A;  1HNZ M;  2CP8 A;  5EXS A;  5JI2 E;  4AQY M;  2HAK A;  2Z4R A;  2QEN A;  2R62 A;  2EO2 A;  3GRV A;  3T1H M;  5FTM A;  1YSY A;  4JN6 A;  1QAM A;  2MRO B;  3W0F A;  4NSR A;  4G4O A;  1IY1 A;  2HL7 A;  4IBG A;  4BBA A;  1E94 E;  2OOA A;  4GH9 A;  2L4F A;  3KP1 E;  1VEG A;  4OX9 M;  3LCV B;  2F4V M;  2JY8 A;  3SHG B;  4NRW A;  1HNW M;  1MN3 A;  1K82 A;  3U61 A;  4JI3 M;  3KXE C;  1F4I A;  3HHZ A;  2HHH M;  2XF3 A;  3FTE A;  4GIP A;  2KEB A;  3AV0 A;  4B7F A;  2L2D A;  2LXE A;  3L2A A;  4LF6 M;  1WHC A;  3J81 S;  2WSC F;  3GRY A;  4IJF A;  3CF0 A;  4LZZ A;  1Z5C A;  1L2B A;  2HKJ A;  1YLA A;  2YNM D;  4DV6 M;  3FE3 A;  3TE6 A;  1G4A E;  5ITR A;  3M0E A;  4FWH A;  2F5N A;  3GLH E;  1UFZ A;  4R71 A;  4NOO B;  3KOX E;  4FD2 A;  1T3T A;  4LJ6 A;  2LVQ D;  2KDL A;  1IN7 A;  1N32 M;  3GLF B;  3A98 B;  3M6A A;  3KOY E;  4DUZ M;  1L2D A;  2WSE F;  2DKL A;  4GMQ A;  4MH0 E;  4QHT A;  4LGY A;  4LFA M;  2X4A A;  3JAM S;  5IWA M;  1NV8 A;  2C9O A;  3H4M A;  2DAK A;  2DZL A;  5EP3 A;  4JI8 M;  1T43 A;  3I51 A;  4PT5 A;  3LCU A;  4LF4 M;  1GL7 A;  4LY6 A;  1ZQ9 A;  1V34 A;  2VDB B;  3IHP A;  4M9S A;  2AHM A;  2CE7 A;  4FVM A;  1G71 A;  1VDL A;  3L29 A;  3GP1 A;  1TGU A;  2CRU A;  2LVP C;  4FWG A;  5C18 A;  4M9X A;  4MGY E;  1MU5 A;  4KO8 A;  1QYR A;  2M60 A;  2XZU A;  4DR4 M;  3KW6 A;  3FTF A;  1PGY A;  2LVA A;  1HT1 E;  2V1C A;  3PNV A;  2JA2 A;  3AFH A;  1XHB A;  2LH0 A;  4IJE A;  2JZ1 A;  5ITX A;  3HZJ A;  3Q8G A;  4KT0 F;  2RRU A;  1TDZ A;  2JNH A;  2DI0 A;  2LBC A;  3VK8 A;  1Y8G A;  2D7H A;  3HU3 A;  4REZ A;  2LVN C;  1QUT A;  2KZU A;  2FS1 A;  4IIW A;  4UN2 B;  2V6Z M;  1WR1 B;  4AG6 A;  2C98 A;  3SC3 A;  2R18 A;  3U5Z B;  4LGM A;  4BB9 A;  1OIP A;  3PNY A;  4LJ9 A;  3D8B A;  1XXH A;  4DR5 M;  1HR0 M;  2QBY A;  2Q2E B;  2X49 A;  1TDH A;  2C99 A;  2WZJ A;  2YFQ A;  1DO2 A;  4PDI A;  2DXI A;  1NVM A;  2B3T A;  2Y20 A;  4NSO B;  3TPZ A;  4QHS A;  4M9Z A;  4LJ5 A;  1V92 A;  1CUK A;  4B3T M;  1GLN A;  1Z5B A;  3NBI A;  2GNO A;  2LHG A;  3UJN A;  3W68 A;  5C1B A;  2L4E A;  2VII A;  3SBJ A;  1D0K A;  2CFO A;  3FYD A;  3HX3 A;  4IBJ A;  4JI0 M;  1HT2 E;  2UXC M;  1VEK A;  4BLC A;  2HWJ A;  3BXW A;  1KYI A;  3ZCB B;  2Z8Y M;  3TWM A;  2XFS A;  3U6D A;  2DAM A;  2QHO B;  1I94 M;  4GC5 A;  5ITX E;  4AZF A;  1IBK M;  4LF5 M;  3E21 A;  3KS4 A;  3B7Z A;  5FTJ A;  2R45 A;  1G59 A;  4CJ6 A;  4XBO A;  2LVO C;  4WW0 A;  3TWL A;  3DZD A;  3A42 A;  1JR3 E;  5EQT A;  3PVS A;  4DV4 M;  4AKI A;  2C9C A;  2Z7J A;  4B7H A;  4CHT B;  3AOE C;  2G8L A;  1G8P A;  3GO8 A;  1EIJ A;  1XXH E;  1MJG M;  2BWE A;  3EIH A;  1NY5 A;  1SXJ B;  4GHL A;  1DGH B;  3OTO M;  2R0I A;  4DR6 M;  1QAN A;  4DV7 M;  4DR3 M;  3SMS A;  2UUA M;  1IY0 A;  1YUB A;  3DOA A;  4M0D A;  3R8F A;  3KSJ A;  2L6O A;  1Q02 A;  2G3Q A;  1WXQ A;  5ITT A;  3GQ4 A;  2L7H A;  3HU1 A;  4LJ7 A;  4X65 M;  2CV0 A;  5FSW A;  1WGN A;  3ZH9 B;  3CTW B;  5EP4 A;  1VEJ A;  3GLI A;  1SG9 A;  4KHP M;  3HWS A;  1OKS A;  2QQ8 A;  4PD2 A;  3Q8X A;  1G3I A;  2DAG A;  4ANR A;  2DWN A;  2J7N A;  1XMQ M;  2FOI C;  2DZN B;  3MJ5 A;  4LFB M;  5ITU A;  3KS8 A;  3B7N A;  4MGZ E;  2H1R A;  1ZMW A;  3KDS E;  4L4U A;  4QOS A;  1D0L A;  2Y0Q A;  3R9X B;  1GJT A;  2KA6 B;  4NL4 H;  4XK8 F;  5A2Q S;  2XLJ A;  3QYB A;  3RFW A;  3F92 A;  3FYC A;  5ITY A;  3J80 S;  2CEA A;  3AJI B;  4M0W A;  3T6P A;  1IY2 A;  3HJQ A;  1ORY B;  1W5S A;  3FUW A;  4LJA A;  3QWL A;  1NJG A;  2EA0 A;  1PJS A;  1E32 A;  2LTU A;  2H5X A;  2VF8 A;  2KNA A;  3VK7 A;  4B7G A;  1QQW A;  3VLF B;  4L16 A;  3LVV A;  4NXN M;  1OIZ A;  4GKJ M;  3CF2 A;  1G41 A;  2BNK A;  2K6B A;  1N75 A;  3FKE A;  1LV7 A;  4I8O A;  4LJ4 A;  2VQF M;  1QDT A;  1Q3B A;  5KPZ A;  4MM3 B;  1EE8 A;  3RGS A;  4XGI A;  1XNR M;  3THG A;  3L26 A;  1P3Q Q;  2R46 A;  1QAO A;  3GLI E;  4AKG A;  3HHX A;  3K2L A;  2CV1 A;  3PXG A;  2EUC A;  1N78 A;  1MX0 A;  2ZTD A;  2Y0T A;  4DV1 M;  1IN8 A;  3L25 A;  1SXJ C;  3SFZ A;  2XH9 A;  1QZM A;  2Z4S A;  2F5P A;  4FWD A;  4GC9 A;  1N33 M;  3J7A S;  1OAI A;  4MGI E;  5KO3 A;  1IXS A;  2L7I A;  2KRU A;  2ZM6 M;  5KQ8 A;  4QNR A;  2X8A A;  2YQZ A;  1D2N A;  2QCU A;  4X62 M;  4JV5 M; 
#chains in the Genus database with same CATH homology
 1OTR A;  2QNJ A;  2WZJ A;  1DO2 A;  2B3T A;  2BWB A;  2DAE A;  1V92 A;  4G3O A;  1CUK A;  1IFY A;  4HEO A;  1VQ1 A;  2JUJ A;  1OQY A;  2L4E A;  2OOB A;  2CWB A;  1DO0 A;  1HT2 E;  2JZ0 A;  1VEK A;  1WIV A;  1AIP C;  2HWJ A;  1KYI A;  1C7Y A;  2MJ5 B;  2DAM A;  2QHO B;  2QSF X;  3E21 A;  1ZV1 A;  2LVO C;  1DV0 A;  1GO5 A;  4F1I A;  1JR3 E;  3H4J A;  5DFL A;  2CP8 A;  5JI2 E;  3E46 A;  4DBG B;  2HAK A;  2DEN A;  1XXH E;  2BWE A;  2MRO B;  1TR8 A;  2JY6 B;  2R0I A;  1QZE A;  1E94 E;  2OOA A;  2L4F A;  4Q7J A;  1HJP A;  1VEG A;  1Q02 A;  2O25 A;  2ZTC A;  2JY8 A;  3BBZ A;  2G3Q A;  3LCV B;  1MN3 A;  2EJS A;  1F4I A;  2KNV A;  1WGN A;  3GLF E;  1A5T A;  1VEJ A;  2L2D A;  1SG9 A;  1WHC A;  2JP7 A;  1NV9 A;  1OKS A;  1EFU B;  2DAG A;  1G3I A;  2DAI A;  1VG5 A;  1YLA A;  1ZMU A;  2DHY A;  3FE3 A;  2EKF A;  1G4A E;  3GLH E;  1UFZ A;  4R71 A;  4F2L A;  2KNZ A;  1ZMW A;  2JY5 A;  2LVQ D;  2MGW A;  2EKK A;  3B89 A;  3F92 A;  2DKL A;  3T6P A;  1NV8 A;  2DAK A;  2DZL A;  2JY7 A;  1T6O A;  2LTU A;  1T43 A;  2K0B X;  2H5X A;  3LCU A;  2KNA A;  3IHP A;  2MR9 A;  4WP2 A;  1VDL A;  1G41 A;  2LVP C;  3GLG E;  1XB2 B;  3K9O A;  3K9P A;  1HQY E;  1WJ7 A;  1ZMV A;  1PGY A;  3MMP A;  1WGL A;  2LVA A;  1HT1 E;  1P3Q Q;  3GLI E;  1IM2 A;  3IEC A;  2OO9 A;  2JZ1 A;  2ZTD A;  2RRU A;  2JNH A;  2DI0 A;  2LBC A;  1Y8G A;  1BVS A;  2DNA A;  2LVN C;  4UN2 B;  3FRI A;  2K9D A;  1WR1 B;  1OAI A;  3FRH A;  1IXS A;  4GEW A;  1R4G A;  1TTE A;  2KHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...