3I4VA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 69
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3i4vA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3i4vA02
4WHOB 3PCIA 1EO2B 2BV0B 3PCGM 3PCFM 4WHRF 2BUQA 2PCDM 2BUZA 3PCNA 3MV6A 3PCIM 2BV0A 4WHPA 3I4YA 1YKMB 3O32A 2BUXA 3MV6M 2BUTB 3PCFA 3HJ8A 1YKPA 4WHOD 3PCKA 3MV4M 3O5UA 3HHYA 2BUVB 2PCDA 1YKOB 1YKLA 2BUUB 1EOCA 3I51A 3N9TA 2XSVA 3PCKM 3PCMA 1DMHA 2BUMA 3O6JA 2BUYA 1TMXA 3HJQA 4WHRA 4WHOA 3MFLA 3PCHM 1EO2A 3MV4A 1YKNB 4ILTA 3PCMM 3TH1A 3MI1A 3LKTA 3PCLM 1EOBB 1DLMA 3PCCM 3MFLM 2BURB 1EO9B 3HHXA 3MI1M 3LKTM 1YKNA 1YKMA 3PCEA 1EOAB 4WHSD 3PCHA 3T67A 2BUTA 1YKKB 3HGIA 4WHSB 4WHQB 3PCLA 1YKOA 2BUVA 3PCEM 3PCCA 2AZQA 2XSRA 2BUUA 3PCJA 3T67M 1S9AA 3PCAA 2BUQB 3T63M 2BUZB 3PCDA 4WHPD 4ILVA 3PCJM 3LMXA 4WHPB 3PCAM 2BUXB 1DLQA 3MI5M 3PCBA 3HKPA 3O6RA 3PCDM 1EOBA 1YKPB 2BOYA 1DLTA 3LMXM 3T63A 3LXVA 2BURA 2BUWB 1EO9A 3I4VA 1YKLB 1EOCB 3PCBM 3PCNM 1EOAA 2XSUA 3PCGA 3HJSA 5TD3A 3LXVM 2BUMB 1YKKA 3MI5A 2BUYB 4WHSA 4WHQA 4WHRB 2BUWA
chains in the Genus database with same CATH superfamily
1NV9A 2DENA 3GLIB 4WHOB 3GPUA 1QUTA 1WXQA 2QZ4A 2FS1A 4PDGA 1HQCA 1OTRA 1QAMA 4F2LA 1WJ7A 2BUQA 3W0FA 2KA6B 4LZZA 1T3TA 4DR4M 3C3DA 2DAEA 2BUZA 2RKOA 2OOAA 3E9SA 4CIZA 1SG9A 4G4QA 4B3MM 1ZAEA 2KDLA 3MV6A 3SC3A 3GQ3A 1L2BA 1IN4A 1TF0B 2BV0A 3THGA 1R6BX 4JI6M 1ZQ9A 2CV0A 3VKHA 1JQJC 4CJ6A 3L27A 1W5TA 4KLNA 3MV6M 3GPYA 2H5XA 2QNJA 1V34A 1YKPA 1NSFA 4NOOB 5EP1A 8CATA 3PNVA 3O5UA 3BXWA 2QSFX 1TH3A 2HAKA 2D7HA 4LJ5A 1D0MA 3E21A 4M0DA 2BUUB 3U60A 4Z8XA 1I4WA 2K9DA 4X65M 3GLGE 2F5PA 3GO8A 3J81S 1TDHA 1OJLA 3M0EA 4IBFA 2UUCM 4HL4A 3GQ5A 1TMXA 4JI2M 2VQEM 4RKUF 1NJGA 2KZSA 1GJTA 4Z6YA 2C99A 4QHSA 2L6OA 1T43A 1EO2A 3A98B 2R65A 2RRUA 1L2DA 1YKNB 4ILTA 2OO9A 2JY5A 4I4LA 2XLJA 3DFZA 3LVWA 2FFJA 1A5TA 3TH1A 1GVNA 4FVMA 3HX3A 3IG5A 3KOWE 4P17A 1QAOA 2ZTDA 3H4MA 4IBIA 4M9SA 4LJ4A 4AG5A 5KPTA 3GLGA 1L1ZA 2UUBM 3FUVA 2KHHA 2C9OA 3B7ZA 4R3DA 2CE7A 1Y8GA 4QNMA 4DV2M 4GITA 4LFAM 3CTWB 3SHFA 3U6OA 1IBKM 2KRUA 3PCEA 3B7NA 1QZMA 1WHCA 3E46A 3KOXE 3ZQJA 5ITXE 5LMNM 3U6EA 2EJSA 1IXSA 3K1JA 2LBCA 1G3IA 2XEPA 3J7BA 4DUYM 3T67A 4B08A 1HR0M 3VFDA 4LRTA 4WHQB 3GRYA 1R5LA 2CWBA 2CHQA 1X37A 2CP8A 3NBXX 4QNRA 4WW0A 3SATA 3PCCA 3PCEM 2DHRA 4L8RC 2XSRA 1VG5A 3T67M 3B7QA 4B7HA 3PCAA 5FTLA 3U6LA 3VK7A 4LF4M 2ZBKB 2Q2EB 5ITXA 4JN6A 1N32M 4LJ6A 2G5GX 4GIPA 1YSYA 3NBIA 3PCDA 1HNWM 1DGHA 2R4JA 4QOSA 4DV5M 3C9PA 2LVPC 3L28A 5EXSA 1PGYA 4I5SA 2Y0TA 3PCAM 1UM8A 2KNZA 1G8PA 4BLCA 1VDDA 3HHZA 3MI5M 2X4AA 4EIWA 4JYAM 3PCDM 3PNYA 4GMQA 4AKIA 3B9PA 4MH0E 3ZCBB 5JI3E 3SYKA 5ITTA 3PCNA 1DLTA 2I7PA 3SASA 3T63A 3TE6A 1G41A 4MGKE 2BUWB 1SXJB 4L6V6 1J09A 3GLHE 1SXJC 1JB0F 4LJ8A 3E4RA 2V6ZM 5IREB 4S12A 3HZJA 4AKGA 2OQ4A 1PJIA 2F5QA 3HU3A 2Y20A 2Z7JA 3U6QA 3U5ZB 5TD3A 2LTUA 2EKKA 4IBKA 1YKKA 3CF0A 4FCWA 2QCUA 5BR8M 5FTMA 3JR5A 2BUMB 4WHRB 3TWLA 4WHSA 3W68A 4AZFA 3MHVC 1N77A 1P3QQ 3AOEC 2WSEF 4LF5M 4I81A 1OIZA 3GLHA 5EXTA 3PCFM 1G4AE 2BWBA 2P5TA 2V1CA 4JXJA 4GKKM 2DHYA 1NVMA 1QANA 3NWLA 4PDIA 1C7YA 3FUTA 4LF6M 2CV2A 1PJJA 3L2AA 2K6BA 4FWGA 5EXXA 4X62M 3WHKA 1Z5CA 1IN5A 2BNKA 1IFYA 1IXZA 4WHPA 2DNAA 4CHTB 4W5WA 4K0KM 3O32A 2K47A 3CF6E 4L15A 5F3WA 3I04M 2BUXA 2VDBB 2C5RA 4FCVA 4JI4M 2BUTB 3IECA 1XB2B 5KQ8A 4IJEA 1GLNA 2JWSA 3U61B 3T1HM 4JI1M 3MV4M 1OAIA 2C98A 2J7OA 4AG6A 5L8RF 1D2NA 3B89A 5H37D 3MMPA 1GABA 1NO1A 2CUZA 4LGYA 4JI3M 1NHWC 3I51A 3PCKA 1N78A 4JI5M 1J5EM 1I94M 2O25A 2XZFA 2YQZA 3N9TA 3PCKM 2AHMA 3PCMA 1N75A 4LRSA 4B7FA 1Q02A 3V76A 4G4NA 3LMMA 2F5NA 3HJQA 2BUYA 2UXDM 1VEKA 3SYLA 1QAQA 2EUCA 4DR2M 2VF7A 2CHVA 1N36M 1IN6A 1QDRA 4KT0F 3MFLA 3PCHM 4BBAA 2NQ8C 2A5YB 2JNHA 1J7KA 4B3RM 3PCMM 3SBJA 1IBLM 3C58A 2ZAMA 2YR0A 2XFTA 1XXHE 3D8BA 5LMUM 1OQYA 3MK6A 2XH9A 3MFLM 3TPZA 1LTMA 1K3WA 2VQFM 2CEAA 3KSJA 4G4OA 3OTOM 1DO2A 4UN2B 3KVWA 2DZOB 2DAGA 1QUSA 2VF8A 2JY7A 3HHXA 4G4RA 2DWNA 2JP7A 1YKNA 3A42A 1YKMA 1VDLA 3T6PA 3GPXA 2M60A 3FTDA 3K2LA 4DR6M 1CUKA 3W67A 2LXEA 3TWKA 2LVAA 5FTNA 1N33M 1Q39A 1E9SA 1ORYB 1XXHA 1DGBA 2CFOA 1YKOA 5EXPA 2BUVA 4MGZE 2AZQA 1Z6TA 4LZJA 3KP1E 2MH8A 1D0KA 7CATA 3K9PA 4IBBA 3R9XB 2B3TA 3QYEA 2BUQB 4AI6A 1HT2E 2DWZB 2BUZB 1Q3BA 2H1RA 3L29A 3LQQA 1EFUB 2OPFA 2R6FA 4LJ7A 2KW0A 3WHLA 1WR1B 1K82A 2R45A 2FOIC 3CF2A 3HKPA 2M5ZA 2JA2A 2FE8A 4IBEA 5C1BA 4OVZA 2JZ1A 3UGJA 4DV3M 1EOBA 1YKPB 1SXJD 5E6JA 1QDTA 2K0BX 1IXRC 3LVVA 3GPPA 1H6UA 1DGGA 2ZM6M 2BURA 1XWIA 1EO9A 1YUBA 2RGHA 3I4VA 3KXEC 4GEWA 2DWMA 1Z5AA 3KS4A 3UZUA 3U60B 2DAIA 1IY2A 3HU1A 1EOAA 2XSUA 3PCGA 5EP2A 2C96A 2MGWA 4NRVA 3VLFB 1MU5A 2QBYA 1AIPC 4FW9A 2D7EA 1R2ZA 3MI5A 4LF8M 1XNQM 2KNAA 3QAUA 2XZUA 2BUWA 4FD2A 4MGYE 2XGNA 3TWMA 3QWLA 4RF0A 3JAMS 3QYBA 4TUWA 2HCBA 2L7IA 1EO2B 2QENA 3FYDA 3VDPA 3PCGM 1GJSA 3U6DA 1IY1A 2L2DA 4GHAA 3GP1A 4DV7M 2PCDM 2GNOA 1G59A 3PFIA 3GLGB 3SAVA 4P16A 3Q8XA 2I7NA 3KFUG 3AOEA 1PJSA 2KZUA 4LFCM 3FTFA 1IQPA 1F4IA 2JY6B 5FSWA 4XBOA 1K3XA 2Z8YM 2Y21A 1GKIA 3IHPA 3RE8A 3I4YA 2UUAM 4GKJM 4IBJA 2YFQA 1DGFA 4D81A 1KFVA 1ZMUA 1IXSB 3HY5A 3GLFE 1R4GA 3I01M 3K9OA 2X8AA 4ITQA 1TR8A 1S3SA 4FWHA 1NHGC 2DZLA 1KYIA 3HJ8A 3PCFA 4WHOD 1YLAA 3GLIE 1C1KA 2J7NA 4JI0M 3W0LB 2F5SA 4AW4A 5IT9S 3KOZE 1KSFX 1IBMM 2J5YA 1YKLA 1ZMWA 3ZH9B 4RF1A 1EOCA 1TTEA 1WGNA 4AQYM 1YE9A 2N35A 2CRUA 3AKZA 3SAUA 2HWJA 3GLFA 5ITYA 1DGHB 2GQFA 2LH0A 1WIVA 1L2CA 4AKHA 1D0LA 1JR3D 1JR3E 3GLIA 4MGHA 4GRIA 4WHOA 2MR9A 2D7GA 3AJIB 3J27B 4JI7M 3MV4A 1R7RA 1MJGM 1MX0A 3BBZA 2XFSA 3FKEA 5FTKA 5KQDA 2UXBM 3MI1A 2LWXA 3PCLM 2EKFA 3RGSA 1DLMA 1R2YA 2FH0A 3BOSA 4DV1M 4DR3M 2DXIA 4XGIA 2V1UA 1IY0A 2F5OA 1HQYE 1L8QA 3U6CA 2JY8A 2LVQD 3L25A 4KHPM 1QQWA 3MI1M 1GL7A 4YY3M 2XSZD 2R62A 1OIPA 3KDSE 4G6ZA 1E9RA 1TGUA 3FD9A 2R18A 3U6PA 3PCHA 2Y0QA 4QHTA 3PXGA 2UXCM 1L1TA 1E94E 1YKKB 2L7HA 3HGIA 1QZEA 4WHSB 4PD2A 3Q8GA 2HL7A 2KXEA 4GH9A 1XNRM 3SAWA 1DV0A 2DVWB 3SMSA 4WP2A 2BUUA 3DOAA 4M9ZA 1HJPA 2YNMD 3GLHB 1S9AA 4CISA 4B7GA 2WSFF 1VEJA 3AFHA 1PJQA 2DAKA 4X64M 3UMMA 4IIWA 4YHHM 3PVSA 4FWDA 1HNXM 1HNZM 3DA1A 1LV7A 3VK8A 4ILVA 1EE8A 3M6AA 3B74A 3A46A 4LF9M 3LMXA 4WHPB 5DYIA 2CV1A 2JZ0A 4KODA 4NSRA 2BJVA 2R0IA 1XMOM 3GRRA 4Y28F 3LQRA 1XMQM 1FJGM 3J7AS 2BUXB 3ILKA 4FCTA 3TL4X 4MB7A 4DR1M 2BOYA 3AOGA 3LMXM 4NSOB 3LXVA 3J80S 1Z5BA 3C3EA 2R44A 2R4EA 2DWLA 3D8LA 2HKJA 4JV5M 4L4UA 4RNAA 2KRKA 4B3SM 1W5SA 3PCNM 3RGPA 4L78A 5IWAM 3T15A 3HJSA 4XK8F 4LF7M 3LXVM 3K92A 3LCVB 2XF3A 2PCDA 4DR7M 2APLA 1WGLA 2BUYB 2ZTCA 4WHQA 5C18A 2QPAA 2ZANA 1VQ1A 1IN7A 4PCZA 1PJTA 4MGIE 3PCIA 2BV0B 1UFZA 3KSXA 3FRHA 4R7GA 3ZC7B 5JI2E 3SHGB 4WHRF 2QP9X 1NJFA 2QHOB 3CGWA 1OKSA 3T38A 3FUUA 4CGYB 5BPVA 5EJCA 1TDZA 1N34M 3FTEA 2BJWA 4LFBM 4B3TM 3FUWA 3PCIM 3SFZA 1SXJE 4OU7A 2WSCF 1E32A 2Z3XA 5GKNA 4JI8M 1RU3A 1QYRA 2X49A 5ITQA 3AV0A 3FYCA 1YKMB 1NNJA 2EA0A 1Q3CA 2DAMA 4R71A 4KO8A 3DZDA 2R46A 2VIIA 1PRBA 1T6OA 4LGMA 2ERCA 1XXHB 4BB9A 4OX9M 2UU9M 2G3QA 4D82A 3HHYA 5KO3A 4HLQA 4LY6A 1YKOB 2BUVB 2MROB 3EIEA 3VKGA 1SXJA 4WURA 5KPRA 3T1YM 3EIHA 1TH2A 2MJ5B 1OFHA 4IBCA 5EP3A 1Z59A 3U6MA 2FNAA 4L16A 2XSVA 4DV6M 3U5ZA 4DV0M 4GC9A 3TQSA 1DMHA 2BUMA 3HWSA 3IG8A 3O6JA 3KS8A 3UK6A 4X66M 4WHRA 3M7GA 3F92A 3KOYE 5EP4A 4ANRA 1NY5A 1G71A 3LCUA 1PM5A 2CHGA 1OFIA 2LNHC 2DI0A 4M9XA 5ITUA 3LKTA 2L4EA 1IM2A 4A3VB 3HHWA 4OVZB 4PT5A 1EOBB 3PCCM 2EO2A 1NV8A 5DYGA 5KPZA 2O5RA 2ZAOA 3SARA 4NRWA 3J2PB 2BURB 1EO9B 2LVOC 4G3OA 2E5LM 5FLXS 2W82A 3LKTM 1V92A 1ZMVA 5FTJA 3FRIA 3UJNA 1AUAA 1OAOC 1EOAB 4WHSD 2L09A 4IBGA 2JXNA 5IZ7D 3GQ4A 4DR5M 2G8LA 2QBYB 4Q7JA 4QOZC 2BUTA 3KW6A 3HU2A 2BWEA 3U61A 2O01F 3PCLA 1NNUC 5A2QS 2KEBA 4NC6A 2RGOA 3FTCA 1QVRA 1ZV1A 3PCJA 2OOBA 5ITRA 2KNVA 3GRVA 3KP0E 3T63M 1TH4A 3FE3A 3R8FA 2HHHM 2DKLA 1GL6A 5EQTA 3RFWA 4WHPD 1BVSA 4LG2A 4D80A 3JR4A 3K8ZA 3U6SA 3MJ5A 3PCJM 5DNYA 1XHBA 2LVNC 3FUXA 5DFLA 1IN8A 1V33A 3A45A 3LW5F 1DLQA 1JR3A 3PCBA 4GC5A 3GRUA 4M0WA 3O6RA 3SMPA 2Z4SA 4HEOA 3VDUA 4II7A 1MN3A 2WZJA 2F4VM 1XC8A 2DZNB 3H4JA 5E26A 3AL0C 1EIJA 1GO5A 3L26A 4REZA 1NY6A 1YKLB 2JUJA 4I8OA 1EOCB 2L4FA 4IBDA 4NXMM 4LJ9A 4ZPXA 1VEGA 3PCBM 2LHGA 4DBGB 2Z4RA 4GHLA 4LCBA 4NL4H 2LHCA 4IJFA 4DV4M 2XSZA 4OW0A 4NXNM 3GLFB 4F1IA 4DUZM 4MM3B 2QQ8A 1HT1E 4LJAA 1DO0A 1FNNA 2C9CA
chains in the Genus database with same CATH topology
4WHOB 3GLIB 3GPUA 1WXQA 2QZ4A 4PDGA 1HQCA 1QAMA 2BUQA 3W0FA 2KA6B 4LZZA 1T3TA 4DR4M 2BUZA 3PCNA 2RKOA 3E9SA 4B3MM 4G4QA 3MV6A 1ZAEA 3SC3A 3GQ3A 1L2BA 1IN4A 2BV0A 3THGA 1R6BX 4JI6M 1ZQ9A 2CV0A 3VKHA 1JQJC 3L27A 1W5TA 4KLNA 3MV6M 3GPYA 1YKPA 1NSFA 4NOOB 5EP1A 8CATA 3PNVA 3O5UA 1TH3A 2D7HA 4LJ5A 4M0DA 2BUUB 3U60A 4Z8XA 1I4WA 4X65M 2F5PA 3GO8A 3J81S 1TDHA 1OJLA 3M0EA 4IBFA 2UUCM 4HL4A 3GQ5A 1TMXA 4JI2M 2VQEM 1NJGA 2KZSA 4Z6YA 2C99A 4QHSA 2L6OA 1EO2A 3A98B 2R65A 1L2DA 1YKNB 4ILTA 4I4LA 2XLJA 3TH1A 3DFZA 3LVWA 2FFJA 1GVNA 4FVMA 3IG5A 3KOWE 1QAOA 3H4MA 4IBIA 4M9SA 4AG5A 4LJ4A 5KPTA 3GLGA 1L1ZA 2UUBM 3FUVA 2C9OA 4R3DA 2CE7A 4QNMA 4DV2M 4GITA 4LFAM 3CTWB 3SHFA 3U6OA 1IBKM 2KRUA 3PCEA 1QZMA 3KOXE 5LMNM 3U6EA 5ITXE 3K1JA 1G3IA 2XEPA 3J7BA 4DUYM 3T67A 4B08A 1HR0M 3VFDA 4LRTA 4WHQB 3GRYA 2CHQA 1X37A 4QNRA 4WW0A 3SATA 3PCCA 3PCEM 2DHRA 4L8RC 2XSRA 3T67M 4B7HA 3PCAA 5FTLA 3U6LA 3VK7A 4LF4M 2ZBKB 2Q2EB 5ITXA 4JN6A 1N32M 4LJ6A 2G5GX 4GIPA 1YSYA 3NBIA 3PCDA 1HNWM 1DGHA 2R4JA 4QOSA 4DV5M 3L28A 5EXSA 4I5SA 2Y0TA 3PCAM 1UM8A 1G8PA 4BLCA 1VDDA 3HHZA 3MI5M 2X4AA 4EIWA 4JYAM 3PCDM 3PNYA 4GMQA 4AKIA 3B9PA 4MH0E 3ZCBB 5JI3E 3SYKA 5ITTA 1DLTA 2I7PA 3SASA 3T63A 3TE6A 1G41A 4MGKE 2BUWB 1SXJB 1J09A 1SXJC 4LJ8A 3E4RA 2V6ZM 5IREB 4S12A 4AKGA 2OQ4A 1PJIA 2F5QA 3HU3A 2Y20A 2Z7JA 3U6QA 3U5ZB 5TD3A 4IBKA 1YKKA 3CF0A 4FCWA 2QCUA 5BR8M 5FTMA 3JR5A 2BUMB 4WHRB 3TWLA 4WHSA 4AZFA 3MHVC 1N77A 3AOEC 4LF5M 4I81A 3GLHA 5EXTA 3PCFM 1G4AE 2P5TA 2V1CA 4JXJA 4GKKM 3NWLA 1NVMA 1QANA 4PDIA 3FUTA 4LF6M 2CV2A 1PJJA 3L2AA 4FWGA 5EXXA 4X62M 3WHKA 1Z5CA 1IN5A 2BNKA 1IXZA 4WHPA 4CHTB 4W5WA 4K0KM 3O32A 2K47A 3CF6E 4L15A 5F3WA 2BUXA 2C5RA 4FCVA 4JI4M 2BUTB 5KQ8A 4IJEA 1GLNA 3U61B 4JI1M 3T1HM 3MV4M 3PCKA 2C98A 2J7OA 4AG6A 1D2NA 5H37D 2CUZA 4LGYA 4JI3M 1NHWC 3I51A 1N78A 4JI5M 1J5EM 1I94M 2XZFA 2YQZA 3N9TA 3PCKM 2AHMA 3PCMA 1N75A 4LRSA 4B7FA 4G4NA 2F5NA 3LMMA 2BUYA 3HJQA 2UXDM 3SYLA 1QAQA 2EUCA 4DR2M 2CHVA 1N36M 1IN6A 3MFLA 3PCHM 4BBAA 2NQ8C 2A5YB 1J7KA 4B3RM 3PCMM 3SBJA 1IBLM 3C58A 2ZAMA 2YR0A 2XFTA 3D8BA 5LMUM 3MK6A 2XH9A 3MFLM 3TPZA 1K3WA 2VQFM 2CEAA 3KSJA 4G4OA 3OTOM 1DO2A 3KVWA 2DZOB 3HHXA 2DWNA 4G4RA 1YKNA 3A42A 1YKMA 3GPXA 2M60A 3FTDA 3K2LA 4DR6M 2LXEA 3TWKA 5FTNA 1N33M 1Q39A 1E9SA 1ORYB 1XXHA 1DGBA 2CFOA 1YKOA 5EXPA 2BUVA 4MGZE 2AZQA 1Z6TA 4LZJA 3KP1E 7CATA 4IBBA 3R9XB 2BUQB 4AI6A 1HT2E 2DWZB 2BUZB 1Q3BA 2H1RA 3L29A 3LQQA 2OPFA 4LJ7A 3WHLA 2KW0A 1K82A 2R45A 2FOIC 3CF2A 3HKPA 2M5ZA 2JA2A 2FE8A 4IBEA 5C1BA 4OVZA 3UGJA 4DV3M 1EOBA 1YKPB 1SXJD 5E6JA 1IXRC 3LVVA 3GPPA 1H6UA 1DGGA 2ZM6M 2BURA 1XWIA 1EO9A 1YUBA 2RGHA 3I4VA 3KXEC 2DWMA 1Z5AA 3KS4A 3UZUA 3U60B 1IY2A 3HU1A 1EOAA 2XSUA 3PCGA 5EP2A 2C96A 4NRVA 3VLFB 1MU5A 2QBYA 1R2ZA 4FW9A 2D7EA 3MI5A 4LF8M 1XNQM 3QAUA 2XZUA 2BUWA 4FD2A 4MGYE 2XGNA 3TWMA 3QWLA 4RF0A 3JAMS 4TUWA 2HCBA 2L7IA 1EO2B 2QENA 3FYDA 3VDPA 3PCGM 3U6DA 1IY1A 4GHAA 3GP1A 4DV7M 2PCDM 1G59A 3PFIA 3GLGB 3SAVA 4P16A 3Q8XA 2I7NA 3KFUG 3AOEA 3FTFA 2KZUA 4LFCM 1IQPA 1K3XA 5FSWA 4XBOA 2Y21A 1GKIA 3RE8A 3I4YA 2UUAM 4GKJM 4IBJA 2YFQA 1DGFA 4D81A 1KFVA 1IXSB 2X8AA 4ITQA 1S3SA 4FWHA 1NHGC 3HJ8A 1KYIA 3PCFA 4WHOD 5IT9S 1C1KA 2J7NA 4JI0M 3W0LB 2F5SA 4AW4A 3KOZE 1KSFX 1IBMM 1YKLA 3ZH9B 4RF1A 1EOCA 4AQYM 1YE9A 3AKZA 3SAUA 3GLFA 5ITYA 1DGHB 2LH0A 1L2CA 4AKHA 1JR3D 3GLIA 4WHOA 4MGHA 4GRIA 3AJIB 2D7GA 3J27B 4JI7M 3MV4A 1R7RA 5KQDA 1MX0A 3FKEA 2XFSA 5FTKA 3MI1A 2UXBM 2LWXA 3PCLM 3RGSA 1DLMA 1R2YA 3BOSA 4DV1M 4DR3M 2DXIA 4XGIA 2V1UA 1IY0A 2F5OA 1HQYE 1L8QA 3U6CA 3L25A 4KHPM 1QQWA 3MI1M 1GL7A 4YY3M 2XSZD 2R62A 3KDSE 4G6ZA 1E9RA 1TGUA 3FD9A 2R18A 3U6PA 3PCHA 2Y0QA 4QHTA 3PXGA 2UXCM 1L1TA 1E94E 1YKKB 2L7HA 3HGIA 4WHSB 4PD2A 2HL7A 2KXEA 4GH9A 1XNRM 3SAWA 2DVWB 3SMSA 2BUUA 3DOAA 4M9ZA 3GLHB 2YNMD 1S9AA 4CISA 4B7GA 3AFHA 4X64M 1HNZM 3UMMA 4IIWA 4YHHM 3PVSA 4FWDA 1HNXM 3DA1A 1LV7A 3VK8A 4ILVA 1EE8A 3M6AA 3A46A 4LF9M 3LMXA 4WHPB 5DYIA 2CV1A 4KODA 4NSRA 2BJVA 1FJGM 1XMOM 3GRRA 1XMQM 3LQRA 3J7AS 2BUXB 3ILKA 4FCTA 3TL4X 4MB7A 4DR1M 2BOYA 3AOGA 3LMXM 4NSOB 3LXVA 3J80S 1Z5BA 2R4EA 2DWLA 3D8LA 2HKJA 4JV5M 4L4UA 4RNAA 2KRKA 4B3SM 1W5SA 3PCNM 3RGPA 4L78A 5IWAM 3T15A 3HJSA 4LF7M 3LXVM 3K92A 2XF3A 4DR7M 2BUYB 4WHQA 5C18A 2QPAA 2ZANA 1IN7A 4PCZA 4MGIE 3PCIA 2BV0B 3KSXA 4R7GA 3ZC7B 5JI2E 3SHGB 4WHRF 2QP9X 1NJFA 3T38A 3FUUA 4CGYB 5BPVA 5EJCA 1TDZA 1N34M 3FTEA 2BJWA 4LFBM 4B3TM 3FUWA 3PCIM 3SFZA 1SXJE 4OU7A 1E32A 2Z3XA 5GKNA 4JI8M 2X49A 1QYRA 1YKMB 5ITQA 3AV0A 3FYCA 1NNJA 2EA0A 1Q3CA 4KO8A 3DZDA 2R46A 2VIIA 4LGMA 2ERCA 1XXHB 4BB9A 4OX9M 2UU9M 4D82A 5KO3A 3HHYA 1YKOB 4HLQA 4LY6A 2BUVB 2PCDA 3VKGA 3EIEA 1SXJA 4WURA 5KPRA 3T1YM 3EIHA 1TH2A 1OFHA 4IBCA 5EP3A 1Z59A 3U6MA 2FNAA 4L16A 2XSVA 4DV6M 3U5ZA 4DV0M 4GC9A 3TQSA 1DMHA 2BUMA 3HWSA 3IG8A 3O6JA 3KS8A 3UK6A 4X66M 4WHRA 3M7GA 3KOYE 5EP4A 1NY5A 1PM5A 2CHGA 1OFIA 2LNHC 5ITUA 4M9XA 3LKTA 4A3VB 1IM2A 3HHWA 4OVZB 4PT5A 1EOBB 3PCCM 2EO2A 5DYGA 5KPZA 2O5RA 2ZAOA 3SARA 4NRWA 3J2PB 2BURB 1EO9B 3LKTM 2E5LM 5FLXS 2W82A 5FTJA 3UJNA 1EOAB 4WHSD 2L09A 4IBGA 5IZ7D 3GQ4A 4DR5M 2G8LA 2QBYB 4QOZC 2BUTA 3KW6A 3HU2A 3U61A 3PCLA 1NNUC 5A2QS 2KEBA 2RGOA 3FTCA 1QVRA 3PCJA 5ITRA 3GRVA 3KP0E 3T63M 1TH4A 3R8FA 2HHHM 1GL6A 5EQTA 3RFWA 4WHPD 4LG2A 4D80A 3JR4A 3K8ZA 3U6SA 3MJ5A 3PCJM 5DNYA 1XHBA 3FUXA 1IN8A 3A45A 1DLQA 1JR3A 3PCBA 4GC5A 3GRUA 4M0WA 3O6RA 3SMPA 2Z4SA 3VDUA 2F4VM 4II7A 1XC8A 2DZNB 5E26A 3AL0C 3L26A 4REZA 1NY6A 1YKLB 4I8OA 1EOCB 3PCBM 4IBDA 4NXMM 4LJ9A 4ZPXA 2Z4RA 4GHLA 4LCBA 4NL4H 4IJFA 4DV4M 2XSZA 4OW0A 4NXNM 3GLFB 4DUZM 4MM3B 4LJAA 1HT1E 1DO0A 1FNNA 2C9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WHO B;  3PCI A;  1EO2 B;  2BV0 B;  3PCG M;  3PCF M;  4WHR F;  2BUQ A;  2PCD M;  2BUZ A;  3PCN A;  3MV6 A;  3PCI M;  2BV0 A;  4WHP A;  3I4Y A;  1YKM B;  3O32 A;  2BUX A;  3MV6 M;  2BUT B;  3PCF A;  3HJ8 A;  1YKP A;  4WHO D;  3PCK A;  3MV4 M;  3O5U A;  3HHY A;  2BUV B;  2PCD A;  1YKO B;  1YKL A;  2BUU B;  1EOC A;  3I51 A;  3N9T A;  2XSV A;  3PCK M;  3PCM A;  1DMH A;  2BUM A;  3O6J A;  2BUY A;  1TMX A;  3HJQ A;  4WHR A;  4WHO A;  3MFL A;  3PCH M;  1EO2 A;  3MV4 A;  1YKN B;  4ILT A;  3PCM M;  3TH1 A;  3MI1 A;  3LKT A;  3PCL M;  1EOB B;  1DLM A;  3PCC M;  3MFL M;  2BUR B;  1EO9 B;  3HHX A;  3MI1 M;  3LKT M;  1YKN A;  1YKM A;  3PCE A;  1EOA B;  4WHS D;  3PCH A;  3T67 A;  2BUT A;  1YKK B;  3HGI A;  4WHS B;  4WHQ B;  3PCL A;  1YKO A;  2BUV A;  3PCE M;  3PCC A;  2AZQ A;  2XSR A;  2BUU A;  3PCJ A;  3T67 M;  1S9A A;  3PCA A;  2BUQ B;  3T63 M;  2BUZ B;  3PCD A;  4WHP D;  4ILV A;  3PCJ M;  3LMX A;  4WHP B;  3PCA M;  2BUX B;  1DLQ A;  3MI5 M;  3PCB A;  3HKP A;  3O6R A;  3PCD M;  1EOB A;  1YKP B;  2BOY A;  1DLT A;  3LMX M;  3T63 A;  3LXV A;  2BUR A;  2BUW B;  1EO9 A;  3I4V A;  1YKL B;  1EOC B;  3PCB M;  3PCN M;  1EOA A;  2XSU A;  3PCG A;  3HJS A;  5TD3 A;  3LXV M;  2BUM B;  1YKK A;  3MI5 A;  2BUY B;  4WHS A;  4WHQ A;  4WHR B;  2BUW A; 
#chains in the Genus database with same CATH topology
 1NV9 A;  2DEN A;  3GLI B;  4WHO B;  3GPU A;  1QUT A;  1WXQ A;  2QZ4 A;  2FS1 A;  4PDG A;  1HQC A;  1OTR A;  1QAM A;  4F2L A;  1WJ7 A;  2BUQ A;  3W0F A;  2KA6 B;  4LZZ A;  1T3T A;  4DR4 M;  3C3D A;  2DAE A;  2BUZ A;  2RKO A;  2OOA A;  3E9S A;  4CIZ A;  1SG9 A;  4G4Q A;  4B3M M;  1ZAE A;  2KDL A;  3MV6 A;  3SC3 A;  3GQ3 A;  1L2B A;  1IN4 A;  1TF0 B;  2BV0 A;  3THG A;  1R6B X;  4JI6 M;  1ZQ9 A;  2CV0 A;  3VKH A;  1JQJ C;  4CJ6 A;  3L27 A;  1W5T A;  4KLN A;  3MV6 M;  3GPY A;  2H5X A;  2QNJ A;  1V34 A;  1YKP A;  1NSF A;  4NOO B;  5EP1 A;  8CAT A;  3PNV A;  3O5U A;  3BXW A;  2QSF X;  1TH3 A;  2HAK A;  2D7H A;  4LJ5 A;  1D0M A;  3E21 A;  4M0D A;  2BUU B;  3U60 A;  4Z8X A;  1I4W A;  2K9D A;  4X65 M;  3GLG E;  2F5P A;  3GO8 A;  3J81 S;  1TDH A;  1OJL A;  3M0E A;  4IBF A;  2UUC M;  4HL4 A;  3GQ5 A;  1TMX A;  4JI2 M;  2VQE M;  4RKU F;  1NJG A;  2KZS A;  1GJT A;  4Z6Y A;  2C99 A;  4QHS A;  2L6O A;  1T43 A;  1EO2 A;  3A98 B;  2R65 A;  2RRU A;  1L2D A;  1YKN B;  4ILT A;  2OO9 A;  2JY5 A;  4I4L A;  2XLJ A;  3DFZ A;  3LVW A;  2FFJ A;  1A5T A;  3TH1 A;  1GVN A;  4FVM A;  3HX3 A;  3IG5 A;  3KOW E;  4P17 A;  1QAO A;  2ZTD A;  3H4M A;  4IBI A;  4M9S A;  4LJ4 A;  4AG5 A;  5KPT A;  3GLG A;  1L1Z A;  2UUB M;  3FUV A;  2KHH A;  2C9O A;  3B7Z A;  4R3D A;  2CE7 A;  1Y8G A;  4QNM A;  4DV2 M;  4GIT A;  4LFA M;  3CTW B;  3SHF A;  3U6O A;  1IBK M;  2KRU A;  3PCE A;  3B7N A;  1QZM A;  1WHC A;  3E46 A;  3KOX E;  3ZQJ A;  5ITX E;  5LMN M;  3U6E A;  2EJS A;  1IXS A;  3K1J A;  2LBC A;  1G3I A;  2XEP A;  3J7B A;  4DUY M;  3T67 A;  4B08 A;  1HR0 M;  3VFD A;  4LRT A;  4WHQ B;  3GRY A;  1R5L A;  2CWB A;  2CHQ A;  1X37 A;  2CP8 A;  3NBX X;  4QNR A;  4WW0 A;  3SAT A;  3PCC A;  3PCE M;  2DHR A;  4L8R C;  2XSR A;  1VG5 A;  3T67 M;  3B7Q A;  4B7H A;  3PCA A;  5FTL A;  3U6L A;  3VK7 A;  4LF4 M;  2ZBK B;  2Q2E B;  5ITX A;  4JN6 A;  1N32 M;  4LJ6 A;  2G5G X;  4GIP A;  1YSY A;  3NBI A;  3PCD A;  1HNW M;  1DGH A;  2R4J A;  4QOS A;  4DV5 M;  3C9P A;  2LVP C;  3L28 A;  5EXS A;  1PGY A;  4I5S A;  2Y0T A;  3PCA M;  1UM8 A;  2KNZ A;  1G8P A;  4BLC A;  1VDD A;  3HHZ A;  3MI5 M;  2X4A A;  4EIW A;  4JYA M;  3PCD M;  3PNY A;  4GMQ A;  4AKI A;  3B9P A;  4MH0 E;  3ZCB B;  5JI3 E;  3SYK A;  5ITT A;  3PCN A;  1DLT A;  2I7P A;  3SAS A;  3T63 A;  3TE6 A;  1G41 A;  4MGK E;  2BUW B;  1SXJ B;  4L6V 6;  1J09 A;  3GLH E;  1SXJ C;  1JB0 F;  4LJ8 A;  3E4R A;  2V6Z M;  5IRE B;  4S12 A;  3HZJ A;  4AKG A;  2OQ4 A;  1PJI A;  2F5Q A;  3HU3 A;  2Y20 A;  2Z7J A;  3U6Q A;  3U5Z B;  5TD3 A;  2LTU A;  2EKK A;  4IBK A;  1YKK A;  3CF0 A;  4FCW A;  2QCU A;  5BR8 M;  5FTM A;  3JR5 A;  2BUM B;  4WHR B;  3TWL A;  4WHS A;  3W68 A;  4AZF A;  3MHV C;  1N77 A;  1P3Q Q;  3AOE C;  2WSE F;  4LF5 M;  4I81 A;  1OIZ A;  3GLH A;  5EXT A;  3PCF M;  1G4A E;  2BWB A;  2P5T A;  2V1C A;  4JXJ A;  4GKK M;  2DHY A;  1NVM A;  1QAN A;  3NWL A;  4PDI A;  1C7Y A;  3FUT A;  4LF6 M;  2CV2 A;  1PJJ A;  3L2A A;  2K6B A;  4FWG A;  5EXX A;  4X62 M;  3WHK A;  1Z5C A;  1IN5 A;  2BNK A;  1IFY A;  1IXZ A;  4WHP A;  2DNA A;  4CHT B;  4W5W A;  4K0K M;  3O32 A;  2K47 A;  3CF6 E;  4L15 A;  5F3W A;  3I04 M;  2BUX A;  2VDB B;  2C5R A;  4FCV A;  4JI4 M;  2BUT B;  3IEC A;  1XB2 B;  5KQ8 A;  4IJE A;  1GLN A;  2JWS A;  3U61 B;  3T1H M;  4JI1 M;  3MV4 M;  1OAI A;  2C98 A;  2J7O A;  4AG6 A;  5L8R F;  1D2N A;  3B89 A;  5H37 D;  3MMP A;  1GAB A;  1NO1 A;  2CUZ A;  4LGY A;  4JI3 M;  1NHW C;  3I51 A;  3PCK A;  1N78 A;  4JI5 M;  1J5E M;  1I94 M;  2O25 A;  2XZF A;  2YQZ A;  3N9T A;  3PCK M;  2AHM A;  3PCM A;  1N75 A;  4LRS A;  4B7F A;  1Q02 A;  3V76 A;  4G4N A;  3LMM A;  2F5N A;  3HJQ A;  2BUY A;  2UXD M;  1VEK A;  3SYL A;  1QAQ A;  2EUC A;  4DR2 M;  2VF7 A;  2CHV A;  1N36 M;  1IN6 A;  1QDR A;  4KT0 F;  3MFL A;  3PCH M;  4BBA A;  2NQ8 C;  2A5Y B;  2JNH A;  1J7K A;  4B3R M;  3PCM M;  3SBJ A;  1IBL M;  3C58 A;  2ZAM A;  2YR0 A;  2XFT A;  1XXH E;  3D8B A;  5LMU M;  1OQY A;  3MK6 A;  2XH9 A;  3MFL M;  3TPZ A;  1LTM A;  1K3W A;  2VQF M;  2CEA A;  3KSJ A;  4G4O A;  3OTO M;  1DO2 A;  4UN2 B;  3KVW A;  2DZO B;  2DAG A;  1QUS A;  2VF8 A;  2JY7 A;  3HHX A;  4G4R A;  2DWN A;  2JP7 A;  1YKN A;  3A42 A;  1YKM A;  1VDL A;  3T6P A;  3GPX A;  2M60 A;  3FTD A;  3K2L A;  4DR6 M;  1CUK A;  3W67 A;  2LXE A;  3TWK A;  2LVA A;  5FTN A;  1N33 M;  1Q39 A;  1E9S A;  1ORY B;  1XXH A;  1DGB A;  2CFO A;  1YKO A;  5EXP A;  2BUV A;  4MGZ E;  2AZQ A;  1Z6T A;  4LZJ A;  3KP1 E;  2MH8 A;  1D0K A;  7CAT A;  3K9P A;  4IBB A;  3R9X B;  2B3T A;  3QYE A;  2BUQ B;  4AI6 A;  1HT2 E;  2DWZ B;  2BUZ B;  1Q3B A;  2H1R A;  3L29 A;  3LQQ A;  1EFU B;  2OPF A;  2R6F A;  4LJ7 A;  2KW0 A;  3WHL A;  1WR1 B;  1K82 A;  2R45 A;  2FOI C;  3CF2 A;  3HKP A;  2M5Z A;  2JA2 A;  2FE8 A;  4IBE A;  5C1B A;  4OVZ A;  2JZ1 A;  3UGJ A;  4DV3 M;  1EOB A;  1YKP B;  1SXJ D;  5E6J A;  1QDT A;  2K0B X;  1IXR C;  3LVV A;  3GPP A;  1H6U A;  1DGG A;  2ZM6 M;  2BUR A;  1XWI A;  1EO9 A;  1YUB A;  2RGH A;  3I4V A;  3KXE C;  4GEW A;  2DWM A;  1Z5A A;  3KS4 A;  3UZU A;  3U60 B;  2DAI A;  1IY2 A;  3HU1 A;  1EOA A;  2XSU A;  3PCG A;  5EP2 A;  2C96 A;  2MGW A;  4NRV A;  3VLF B;  1MU5 A;  2QBY A;  1AIP C;  4FW9 A;  2D7E A;  1R2Z A;  3MI5 A;  4LF8 M;  1XNQ M;  2KNA A;  3QAU A;  2XZU A;  2BUW A;  4FD2 A;  4MGY E;  2XGN A;  3TWM A;  3QWL A;  4RF0 A;  3JAM S;  3QYB A;  4TUW A;  2HCB A;  2L7I A;  1EO2 B;  2QEN A;  3FYD A;  3VDP A;  3PCG M;  1GJS A;  3U6D A;  1IY1 A;  2L2D A;  4GHA A;  3GP1 A;  4DV7 M;  2PCD M;  2GNO A;  1G59 A;  3PFI A;  3GLG B;  3SAV A;  4P16 A;  3Q8X A;  2I7N A;  3KFU G;  3AOE A;  1PJS A;  2KZU A;  4LFC M;  3FTF A;  1IQP A;  1F4I A;  2JY6 B;  5FSW A;  4XBO A;  1K3X A;  2Z8Y M;  2Y21 A;  1GKI A;  3IHP A;  3RE8 A;  3I4Y A;  2UUA M;  4GKJ M;  4IBJ A;  2YFQ A;  1DGF A;  4D81 A;  1KFV A;  1ZMU A;  1IXS B;  3HY5 A;  3GLF E;  1R4G A;  3I01 M;  3K9O A;  2X8A A;  4ITQ A;  1TR8 A;  1S3S A;  4FWH A;  1NHG C;  2DZL A;  1KYI A;  3HJ8 A;  3PCF A;  4WHO D;  1YLA A;  3GLI E;  1C1K A;  2J7N A;  4JI0 M;  3W0L B;  2F5S A;  4AW4 A;  5IT9 S;  3KOZ E;  1KSF X;  1IBM M;  2J5Y A;  1YKL A;  1ZMW A;  3ZH9 B;  4RF1 A;  1EOC A;  1TTE A;  1WGN A;  4AQY M;  1YE9 A;  2N35 A;  2CRU A;  3AKZ A;  3SAU A;  2HWJ A;  3GLF A;  5ITY A;  1DGH B;  2GQF A;  2LH0 A;  1WIV A;  1L2C A;  4AKH A;  1D0L A;  1JR3 D;  1JR3 E;  3GLI A;  4MGH A;  4GRI A;  4WHO A;  2MR9 A;  2D7G A;  3AJI B;  3J27 B;  4JI7 M;  3MV4 A;  1R7R A;  1MJG M;  1MX0 A;  3BBZ A;  2XFS A;  3FKE A;  5FTK A;  5KQD A;  2UXB M;  3MI1 A;  2LWX A;  3PCL M;  2EKF A;  3RGS A;  1DLM A;  1R2Y A;  2FH0 A;  3BOS A;  4DV1 M;  4DR3 M;  2DXI A;  4XGI A;  2V1U A;  1IY0 A;  2F5O A;  1HQY E;  1L8Q A;  3U6C A;  2JY8 A;  2LVQ D;  3L25 A;  4KHP M;  1QQW A;  3MI1 M;  1GL7 A;  4YY3 M;  2XSZ D;  2R62 A;  1OIP A;  3KDS E;  4G6Z A;  1E9R A;  1TGU A;  3FD9 A;  2R18 A;  3U6P A;  3PCH A;  2Y0Q A;  4QHT A;  3PXG A;  2UXC M;  1L1T A;  1E94 E;  1YKK B;  2L7H A;  3HGI A;  1QZE A;  4WHS B;  4PD2 A;  3Q8G A;  2HL7 A;  2KXE A;  4GH9 A;  1XNR M;  3SAW A;  1DV0 A;  2DVW B;  3SMS A;  4WP2 A;  2BUU A;  3DOA A;  4M9Z A;  1HJP A;  2YNM D;  3GLH B;  1S9A A;  4CIS A;  4B7G A;  2WSF F;  1VEJ A;  3AFH A;  1PJQ A;  2DAK A;  4X64 M;  3UMM A;  4IIW A;  4YHH M;  3PVS A;  4FWD A;  1HNX M;  1HNZ M;  3DA1 A;  1LV7 A;  3VK8 A;  4ILV A;  1EE8 A;  3M6A A;  3B74 A;  3A46 A;  4LF9 M;  3LMX A;  4WHP B;  5DYI A;  2CV1 A;  2JZ0 A;  4KOD A;  4NSR A;  2BJV A;  2R0I A;  1XMO M;  3GRR A;  4Y28 F;  3LQR A;  1XMQ M;  1FJG M;  3J7A S;  2BUX B;  3ILK A;  4FCT A;  3TL4 X;  4MB7 A;  4DR1 M;  2BOY A;  3AOG A;  3LMX M;  4NSO B;  3LXV A;  3J80 S;  1Z5B A;  3C3E A;  2R44 A;  2R4E A;  2DWL A;  3D8L A;  2HKJ A;  4JV5 M;  4L4U A;  4RNA A;  2KRK A;  4B3S M;  1W5S A;  3PCN M;  3RGP A;  4L78 A;  5IWA M;  3T15 A;  3HJS A;  4XK8 F;  4LF7 M;  3LXV M;  3K92 A;  3LCV B;  2XF3 A;  2PCD A;  4DR7 M;  2APL A;  1WGL A;  2BUY B;  2ZTC A;  4WHQ A;  5C18 A;  2QPA A;  2ZAN A;  1VQ1 A;  1IN7 A;  4PCZ A;  1PJT A;  4MGI E;  3PCI A;  2BV0 B;  1UFZ A;  3KSX A;  3FRH A;  4R7G A;  3ZC7 B;  5JI2 E;  3SHG B;  4WHR F;  2QP9 X;  1NJF A;  2QHO B;  3CGW A;  1OKS A;  3T38 A;  3FUU A;  4CGY B;  5BPV A;  5EJC A;  1TDZ A;  1N34 M;  3FTE A;  2BJW A;  4LFB M;  4B3T M;  3FUW A;  3PCI M;  3SFZ A;  1SXJ E;  4OU7 A;  2WSC F;  1E32 A;  2Z3X A;  5GKN A;  4JI8 M;  1RU3 A;  1QYR A;  2X49 A;  5ITQ A;  3AV0 A;  3FYC A;  1YKM B;  1NNJ A;  2EA0 A;  1Q3C A;  2DAM A;  4R71 A;  4KO8 A;  3DZD A;  2R46 A;  2VII A;  1PRB A;  1T6O A;  4LGM A;  2ERC A;  1XXH B;  4BB9 A;  4OX9 M;  2UU9 M;  2G3Q A;  4D82 A;  3HHY A;  5KO3 A;  4HLQ A;  4LY6 A;  1YKO B;  2BUV B;  2MRO B;  3EIE A;  3VKG A;  1SXJ A;  4WUR A;  5KPR A;  3T1Y M;  3EIH A;  1TH2 A;  2MJ5 B;  1OFH A;  4IBC A;  5EP3 A;  1Z59 A;  3U6M A;  2FNA A;  4L16 A;  2XSV A;  4DV6 M;  3U5Z A;  4DV0 M;  4GC9 A;  3TQS A;  1DMH A;  2BUM A;  3HWS A;  3IG8 A;  3O6J A;  3KS8 A;  3UK6 A;  4X66 M;  4WHR A;  3M7G A;  3F92 A;  3KOY E;  5EP4 A;  4ANR A;  1NY5 A;  1G71 A;  3LCU A;  1PM5 A;  2CHG A;  1OFI A;  2LNH C;  2DI0 A;  4M9X A;  5ITU A;  3LKT A;  2L4E A;  1IM2 A;  4A3V B;  3HHW A;  4OVZ B;  4PT5 A;  1EOB B;  3PCC M;  2EO2 A;  1NV8 A;  5DYG A;  5KPZ A;  2O5R A;  2ZAO A;  3SAR A;  4NRW A;  3J2P B;  2BUR B;  1EO9 B;  2LVO C;  4G3O A;  2E5L M;  5FLX S;  2W82 A;  3LKT M;  1V92 A;  1ZMV A;  5FTJ A;  3FRI A;  3UJN A;  1AUA A;  1OAO C;  1EOA B;  4WHS D;  2L09 A;  4IBG A;  2JXN A;  5IZ7 D;  3GQ4 A;  4DR5 M;  2G8L A;  2QBY B;  4Q7J A;  4QOZ C;  2BUT A;  3KW6 A;  3HU2 A;  2BWE A;  3U61 A;  2O01 F;  3PCL A;  1NNU C;  5A2Q S;  2KEB A;  4NC6 A;  2RGO A;  3FTC A;  1QVR A;  1ZV1 A;  3PCJ A;  2OOB A;  5ITR A;  2KNV A;  3GRV A;  3KP0 E;  3T63 M;  1TH4 A;  3FE3 A;  3R8F A;  2HHH M;  2DKL A;  1GL6 A;  5EQT A;  3RFW A;  4WHP D;  1BVS A;  4LG2 A;  4D80 A;  3JR4 A;  3K8Z A;  3U6S A;  3MJ5 A;  3PCJ M;  5DNY A;  1XHB A;  2LVN C;  3FUX A;  5DFL A;  1IN8 A;  1V33 A;  3A45 A;  3LW5 F;  1DLQ A;  1JR3 A;  3PCB A;  4GC5 A;  3GRU A;  4M0W A;  3O6R A;  3SMP A;  2Z4S A;  4HEO A;  3VDU A;  4II7 A;  1MN3 A;  2WZJ A;  2F4V M;  1XC8 A;  2DZN B;  3H4J A;  5E26 A;  3AL0 C;  1EIJ A;  1GO5 A;  3L26 A;  4REZ A;  1NY6 A;  1YKL B;  2JUJ A;  4I8O A;  1EOC B;  2L4F A;  4IBD A;  4NXM M;  4LJ9 A;  4ZPX A;  1VEG A;  3PCB M;  2LHG A;  4DBG B;  2Z4R A;  4GHL A;  4LCB A;  4NL4 H;  2LHC A;  4IJF A;  4DV4 M;  2XSZ A;  4OW0 A;  4NXN M;  3GLF B;  4F1I A;  4DUZ M;  4MM3 B;  2QQ8 A;  1HT1 E;  4LJA A;  1DO0 A;  1FNN A;  2C9C A; 
#chains in the Genus database with same CATH homology
 4WHO B;  3GLI B;  3GPU A;  1WXQ A;  2QZ4 A;  4PDG A;  1HQC A;  1QAM A;  2BUQ A;  3W0F A;  2KA6 B;  4LZZ A;  1T3T A;  4DR4 M;  2BUZ A;  3PCN A;  2RKO A;  3E9S A;  4B3M M;  4G4Q A;  3MV6 A;  1ZAE A;  3SC3 A;  3GQ3 A;  1L2B A;  1IN4 A;  2BV0 A;  3THG A;  1R6B X;  4JI6 M;  1ZQ9 A;  2CV0 A;  3VKH A;  1JQJ C;  3L27 A;  1W5T A;  4KLN A;  3MV6 M;  3GPY A;  1YKP A;  1NSF A;  4NOO B;  5EP1 A;  8CAT A;  3PNV A;  3O5U A;  1TH3 A;  2D7H A;  4LJ5 A;  4M0D A;  2BUU B;  3U60 A;  4Z8X A;  1I4W A;  4X65 M;  2F5P A;  3GO8 A;  3J81 S;  1TDH A;  1OJL A;  3M0E A;  4IBF A;  2UUC M;  4HL4 A;  3GQ5 A;  1TMX A;  4JI2 M;  2VQE M;  1NJG A;  2KZS A;  4Z6Y A;  2C99 A;  4QHS A;  2L6O A;  1EO2 A;  3A98 B;  2R65 A;  1L2D A;  1YKN B;  4ILT A;  4I4L A;  2XLJ A;  3TH1 A;  3DFZ A;  3LVW A;  2FFJ A;  1GVN A;  4FVM A;  3IG5 A;  3KOW E;  1QAO A;  3H4M A;  4IBI A;  4M9S A;  4AG5 A;  4LJ4 A;  5KPT A;  3GLG A;  1L1Z A;  2UUB M;  3FUV A;  2C9O A;  4R3D A;  2CE7 A;  4QNM A;  4DV2 M;  4GIT A;  4LFA M;  3CTW B;  3SHF A;  3U6O A;  1IBK M;  2KRU A;  3PCE A;  1QZM A;  3KOX E;  5LMN M;  3U6E A;  5ITX E;  3K1J A;  1G3I A;  2XEP A;  3J7B A;  4DUY M;  3T67 A;  4B08 A;  1HR0 M;  3VFD A;  4LRT A;  4WHQ B;  3GRY A;  2CHQ A;  1X37 A;  4QNR A;  4WW0 A;  3SAT A;  3PCC A;  3PCE M;  2DHR A;  4L8R C;  2XSR A;  3T67 M;  4B7H A;  3PCA A;  5FTL A;  3U6L A;  3VK7 A;  4LF4 M;  2ZBK B;  2Q2E B;  5ITX A;  4JN6 A;  1N32 M;  4LJ6 A;  2G5G X;  4GIP A;  1YSY A;  3NBI A;  3PCD A;  1HNW M;  1DGH A;  2R4J A;  4QOS A;  4DV5 M;  3L28 A;  5EXS A;  4I5S A;  2Y0T A;  3PCA M;  1UM8 A;  1G8P A;  4BLC A;  1VDD A;  3HHZ A;  3MI5 M;  2X4A A;  4EIW A;  4JYA M;  3PCD M;  3PNY A;  4GMQ A;  4AKI A;  3B9P A;  4MH0 E;  3ZCB B;  5JI3 E;  3SYK A;  5ITT A;  1DLT A;  2I7P A;  3SAS A;  3T63 A;  3TE6 A;  1G41 A;  4MGK E;  2BUW B;  1SXJ B;  1J09 A;  1SXJ C;  4LJ8 A;  3E4R A;  2V6Z M;  5IRE B;  4S12 A;  4AKG A;  2OQ4 A;  1PJI A;  2F5Q A;  3HU3 A;  2Y20 A;  2Z7J A;  3U6Q A;  3U5Z B;  5TD3 A;  4IBK A;  1YKK A;  3CF0 A;  4FCW A;  2QCU A;  5BR8 M;  5FTM A;  3JR5 A;  2BUM B;  4WHR B;  3TWL A;  4WHS A;  4AZF A;  3MHV C;  1N77 A;  3AOE C;  4LF5 M;  4I81 A;  3GLH A;  5EXT A;  3PCF M;  1G4A E;  2P5T A;  2V1C A;  4JXJ A;  4GKK M;  3NWL A;  1NVM A;  1QAN A;  4PDI A;  3FUT A;  4LF6 M;  2CV2 A;  1PJJ A;  3L2A A;  4FWG A;  5EXX A;  4X62 M;  3WHK A;  1Z5C A;  1IN5 A;  2BNK A;  1IXZ A;  4WHP A;  4CHT B;  4W5W A;  4K0K M;  3O32 A;  2K47 A;  3CF6 E;  4L15 A;  5F3W A;  2BUX A;  2C5R A;  4FCV A;  4JI4 M;  2BUT B;  5KQ8 A;  4IJE A;  1GLN A;  3U61 B;  4JI1 M;  3T1H M;  3MV4 M;  3PCK A;  2C98 A;  2J7O A;  4AG6 A;  1D2N A;  5H37 D;  2CUZ A;  4LGY A;  4JI3 M;  1NHW C;  3I51 A;  1N78 A;  4JI5 M;  1J5E M;  1I94 M;  2XZF A;  2YQZ A;  3N9T A;  3PCK M;  2AHM A;  3PCM A;  1N75 A;  4LRS A;  4B7F A;  4G4N A;  2F5N A;  3LMM A;  2BUY A;  3HJQ A;  2UXD M;  3SYL A;  1QAQ A;  2EUC A;  4DR2 M;  2CHV A;  1N36 M;  1IN6 A;  3MFL A;  3PCH M;  4BBA A;  2NQ8 C;  2A5Y B;  1J7K A;  4B3R M;  3PCM M;  3SBJ A;  1IBL M;  3C58 A;  2ZAM A;  2YR0 A;  2XFT A;  3D8B A;  5LMU M;  3MK6 A;  2XH9 A;  3MFL M;  3TPZ A;  1K3W A;  2VQF M;  2CEA A;  3KSJ A;  4G4O A;  3OTO M;  1DO2 A;  3KVW A;  2DZO B;  3HHX A;  2DWN A;  4G4R A;  1YKN A;  3A42 A;  1YKM A;  3GPX A;  2M60 A;  3FTD A;  3K2L A;  4DR6 M;  2LXE A;  3TWK A;  5FTN A;  1N33 M;  1Q39 A;  1E9S A;  1ORY B;  1XXH A;  1DGB A;  2CFO A;  1YKO A;  5EXP A;  2BUV A;  4MGZ E;  2AZQ A;  1Z6T A;  4LZJ A;  3KP1 E;  7CAT A;  4IBB A;  3R9X B;  2BUQ B;  4AI6 A;  1HT2 E;  2DWZ B;  2BUZ B;  1Q3B A;  2H1R A;  3L29 A;  3LQQ A;  2OPF A;  4LJ7 A;  3WHL A;  2KW0 A;  1K82 A;  2R45 A;  2FOI C;  3CF2 A;  3HKP A;  2M5Z A;  2JA2 A;  2FE8 A;  4IBE A;  5C1B A;  4OVZ A;  3UGJ A;  4DV3 M;  1EOB A;  1YKP B;  1SXJ D;  5E6J A;  1IXR C;  3LVV A;  3GPP A;  1H6U A;  1DGG A;  2ZM6 M;  2BUR A;  1XWI A;  1EO9 A;  1YUB A;  2RGH A;  3I4V A;  3KXE C;  2DWM A;  1Z5A A;  3KS4 A;  3UZU A;  3U60 B;  1IY2 A;  3HU1 A;  1EOA A;  2XSU A;  3PCG A;  5EP2 A;  2C96 A;  4NRV A;  3VLF B;  1MU5 A;  2QBY A;  1R2Z A;  4FW9 A;  2D7E A;  3MI5 A;  4LF8 M;  1XNQ M;  3QAU A;  2XZU A;  2BUW A;  4FD2 A;  4MGY E;  2XGN A;  3TWM A;  3QWL A;  4RF0 A;  3JAM S;  4TUW A;  2HCB A;  2L7I A;  1EO2 B;  2QEN A;  3FYD A;  3VDP A;  3PCG M;  3U6D A;  1IY1 A;  4GHA A;  3GP1 A;  4DV7 M;  2PCD M;  1G59 A;  3PFI A;  3GLG B;  3SAV A;  4P16 A;  3Q8X A;  2I7N A;  3KFU G;  3AOE A;  3FTF A;  2KZU A;  4LFC M;  1IQP A;  1K3X A;  5FSW A;  4XBO A;  2Y21 A;  1GKI A;  3RE8 A;  3I4Y A;  2UUA M;  4GKJ M;  4IBJ A;  2YFQ A;  1DGF A;  4D81 A;  1KFV A;  1IXS B;  2X8A A;  4ITQ A;  1S3S A;  4FWH A;  1NHG C;  3HJ8 A;  1KYI A;  3PCF A;  4WHO D;  5IT9 S;  1C1K A;  2J7N A;  4JI0 M;  3W0L B;  2F5S A;  4AW4 A;  3KOZ E;  1KSF X;  1IBM M;  1YKL A;  3ZH9 B;  4RF1 A;  1EOC A;  4AQY M;  1YE9 A;  3AKZ A;  3SAU A;  3GLF A;  5ITY A;  1DGH B;  2LH0 A;  1L2C A;  4AKH A;  1JR3 D;  3GLI A;  4WHO A;  4MGH A;  4GRI A;  3AJI B;  2D7G A;  3J27 B;  4JI7 M;  3MV4 A;  1R7R A;  5KQD A;  1MX0 A;  3FKE A;  2XFS A;  5FTK A;  3MI1 A;  2UXB M;  2LWX A;  3PCL M;  3RGS A;  1DLM A;  1R2Y A;  3BOS A;  4DV1 M;  4DR3 M;  2DXI A;  4XGI A;  2V1U A;  1IY0 A;  2F5O A;  1HQY E;  1L8Q A;  3U6C A;  3L25 A;  4KHP M;  1QQW A;  3MI1 M;  1GL7 A;  4YY3 M;  2XSZ D;  2R62 A;  3KDS E;  4G6Z A;  1E9R A;  1TGU A;  3FD9 A;  2R18 A;  3U6P A;  3PCH A;  2Y0Q A;  4QHT A;  3PXG A;  2UXC M;  1L1T A;  1E94 E;  1YKK B;  2L7H A;  3HGI A;  4WHS B;  4PD2 A;  2HL7 A;  2KXE A;  4GH9 A;  1XNR M;  3SAW A;  2DVW B;  3SMS A;  2BUU A;  3DOA A;  4M9Z A;  3GLH B;  2YNM D;  1S9A A;  4CIS A;  4B7G A;  3AFH A;  4X64 M;  1HNZ M;  3UMM A;  4IIW A;  4YHH M;  3PVS A;  4FWD A;  1HNX M;  3DA1 A;  1LV7 A;  3VK8 A;  4ILV A;  1EE8 A;  3M6A A;  3A46 A;  4LF9 M;  3LMX A;  4WHP B;  5DYI A;  2CV1 A;  4KOD A;  4NSR A;  2BJV A;  1FJG M;  1XMO M;  3GRR A;  1XMQ M;  3LQR A;  3J7A S;  2BUX B;  3ILK A;  4FCT A;  3TL4 X;  4MB7 A;  4DR1 M;  2BOY A;  3AOG A;  3LMX M;  4NSO B;  3LXV A;  3J80 S;  1Z5B A;  2R4E A;  2DWL A;  3D8L A;  2HKJ A;  4JV5 M;  4L4U A;  4RNA A;  2KRK A;  4B3S M;  1W5S A;  3PCN M;  3RGP A;  4L78 A;  5IWA M;  3T15 A;  3HJS A;  4LF7 M;  3LXV M;  3K92 A;  2XF3 A;  4DR7 M;  2BUY B;  4WHQ A;  5C18 A;  2QPA A;  2ZAN A;  1IN7 A;  4PCZ A;  4MGI E;  3PCI A;  2BV0 B;  3KSX A;  4R7G A;  3ZC7 B;  5JI2 E;  3SHG B;  4WHR F;  2QP9 X;  1NJF A;  3T38 A;  3FUU A;  4CGY B;  5BPV A;  5EJC A;  1TDZ A;  1N34 M;  3FTE A;  2BJW A;  4LFB M;  4B3T M;  3FUW A;  3PCI M;  3SFZ A;  1SXJ E;  4OU7 A;  1E32 A;  2Z3X A;  5GKN A;  4JI8 M;  2X49 A;  1QYR A;  1YKM B;  5ITQ A;  3AV0 A;  3FYC A;  1NNJ A;  2EA0 A;  1Q3C A;  4KO8 A;  3DZD A;  2R46 A;  2VII A;  4LGM A;  2ERC A;  1XXH B;  4BB9 A;  4OX9 M;  2UU9 M;  4D82 A;  5KO3 A;  3HHY A;  1YKO B;  4HLQ A;  4LY6 A;  2BUV B;  2PCD A;  3VKG A;  3EIE A;  1SXJ A;  4WUR A;  5KPR A;  3T1Y M;  3EIH A;  1TH2 A;  1OFH A;  4IBC A;  5EP3 A;  1Z59 A;  3U6M A;  2FNA A;  4L16 A;  2XSV A;  4DV6 M;  3U5Z A;  4DV0 M;  4GC9 A;  3TQS A;  1DMH A;  2BUM A;  3HWS A;  3IG8 A;  3O6J A;  3KS8 A;  3UK6 A;  4X66 M;  4WHR A;  3M7G A;  3KOY E;  5EP4 A;  1NY5 A;  1PM5 A;  2CHG A;  1OFI A;  2LNH C;  5ITU A;  4M9X A;  3LKT A;  4A3V B;  1IM2 A;  3HHW A;  4OVZ B;  4PT5 A;  1EOB B;  3PCC M;  2EO2 A;  5DYG A;  5KPZ A;  2O5R A;  2ZAO A;  3SAR A;  4NRW A;  3J2P B;  2BUR B;  1EO9 B;  3LKT M;  2E5L M;  5FLX S;  2W82 A;  5FTJ A;  3UJN A;  1EOA B;  4WHS D;  2L09 A;  4IBG A;  5IZ7 D;  3GQ4 A;  4DR5 M;  2G8L A;  2QBY B;  4QOZ C;  2BUT A;  3KW6 A;  3HU2 A;  3U61 A;  3PCL A;  1NNU C;  5A2Q S;  2KEB A;  2RGO A;  3FTC A;  1QVR A;  3PCJ A;  5ITR A;  3GRV A;  3KP0 E;  3T63 M;  1TH4 A;  3R8F A;  2HHH M;  1GL6 A;  5EQT A;  3RFW A;  4WHP D;  4LG2 A;  4D80 A;  3JR4 A;  3K8Z A;  3U6S A;  3MJ5 A;  3PCJ M;  5DNY A;  1XHB A;  3FUX A;  1IN8 A;  3A45 A;  1DLQ A;  1JR3 A;  3PCB A;  4GC5 A;  3GRU A;  4M0W A;  3O6R A;  3SMP A;  2Z4S A;  3VDU A;  2F4V M;  4II7 A;  1XC8 A;  2DZN B;  5E26 A;  3AL0 C;  3L26 A;  4REZ A;  1NY6 A;  1YKL B;  4I8O A;  1EOC B;  3PCB M;  4IBD A;  4NXM M;  4LJ9 A;  4ZPX A;  2Z4R A;  4GHL A;  4LCB A;  4NL4 H;  4IJF A;  4DV4 M;  2XSZ A;  4OW0 A;  4NXN M;  3GLF B;  4DUZ M;  4MM3 B;  4LJA A;  1HT1 E;  1DO0 A;  1FNN A;  2C9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...