3I4VA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
total genus 69
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3i4vA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3i4vA02
2BUZB 3MV6M 3PCHM 2BUZA 3MV4A 3PCBA 3HHYA 2BV0B 2BUXB 1EO2A 5TD3A 4WHOD 2BUTA 2BUWB 1DMHA 4WHPB 3I51A 3PCDM 3PCKA 1YKPB 3PCCM 4WHSD 1YKPA 3PCBM 1YKKB 1YKLB 4WHPA 3O6RA 3PCAM 3HHXA 2BUMA 3LXVA 4WHPD 3PCDA 2AZQA 3MI5A 4WHOB 2BUXA 1YKOB 2BOYA 3PCCA 1EOBA 1DLMA 3MI1A 2BURA 3PCMM 4WHOA 3PCMA 2PCDA 4WHQB 1YKMA 3PCNM 4WHQA 4WHRB 3MFLM 3O6JA 3PCIM 3HKPA 3T67A 3T63M 2BUQB 3T63A 1TMXA 1YKNA 3PCJM 3HJ8A 3N9TA 2BUVA 3PCNA 3I4YA 4WHRA 1EOAA 4ILTA 1EO9B 3HGIA 3PCFA 1YKNB 1YKKA 2BUYB 4ILVA 3LMXM 3MV6A 3PCHA 3PCJA 2BUQA 3MV4M 2BUTB 3PCEM 1EOAB 2XSVA 3LXVM 1EO9A 1EO2B 2BUUB 3MI5M 3LKTM 2BURB 3LMXA 2BV0A 3PCKM 1DLQA 1YKLA 1S9AA 1EOBB 2BUUA 1EOCA 2PCDM 4WHSB 2BUWA 4WHSA 3LKTA 3PCGM 3O32A 1YKMB 3MFLA 3HJSA 3PCIA 3PCGA 3T67M 3I4VA 3MI1M 3PCAA 3TH1A 1YKOA 2XSRA 3O5UA 3PCLA 1EOCB 2BUMB 2BUVB 3PCFM 3PCLM 2XSUA 2BUYA 3HJQA 1DLTA 3PCEA 4WHRF
chains in the Genus database with same CATH superfamily
3UJNA 4L15A 3B7ZA 2BUZB 2J7OA 3SMPA 2MR9A 3C9PA 2X4AA 1Q3BA 3FTEA 5F3WA 2JY7A 3K1JA 4MGIE 3QYEA 4FVMA 1Q02A 3CGWA 4I5SA 3HHYA 4B7HA 2LBCA 2A5YB 1GL6A 4DV7M 1TGUA 1YE9A 1PJSA 3GRRA 4JI2M 2BUTA 4L4UA 3CF2A 2QBYA 3A42A 1DGGA 3PCDM 3PCKA 2XF3A 3DZDA 3KOWE 4NC6A 3JAMS 4OX9M 1YKKB 2GNOA 5DYGA 3U6PA 1GO5A 3C58A 3PCAM 4WHPA 2ZBKB 1WGLA 3LXVA 2XFTA 4UN2B 4B7GA 4Q7JA 3B74A 1XNRM 4LRSA 3W68A 3GP1A 1P3QQ 1T3TA 3U61B 2FFJA 1N32M 1EOBA 1FNNA 3QWLA 5EP4A 1PRBA 4AQYM 2B3TA 4AG6A 3PXGA 2K47A 5EXXA 3FUTA 3IHPA 3WHLA 5H37D 5FTMA 4LF9M 1R6BX 1QYRA 4IBKA 3SASA 2PCDA 5FLXS 2V1UA 2KRKA 2FS1A 4DR4M 4WHQA 4B3RM 2JZ1A 2UUAM 4G4RA 1J5EM 2JWSA 3GPPA 2BUQB 3EIHA 1R7RA 3NWLA 2CHQA 1G4AE 2C99A 1KFVA 4X66M 5ITXE 4MM3B 4YHHM 2QENA 2X49A 3PCNA 4NRVA 5KPRA 3D8BA 4QNRA 5FSWA 2DAIA 2CHGA 1T43A 1WGNA 2ZM6M 1IBMM 1T6OA 3SBJA 2EO2A 3LMXM 5C1BA 1XNQM 3FTFA 1IFYA 3FYCA 4L8RC 3SFZA 2LWXA 2LVQD 5KO3A 2F5NA 1NY5A 2RKOA 4OVZB 4KODA 3JR4A 2XZUA 2Z4RA 2DNAA 2DHYA 1WIVA 2KHHA 1EO9A 1OJLA 3R8FA 2HL7A 2XSVA 1DGFA 2K6BA 1AIPC 3LKTM 2KEBA 2DAMA 1IXRC 2BV0A 4X65M 3PCKM 4LFAM 3PNVA 3HZJA 1QAQA 1IXSB 2CUZA 3M6AA 1S9AA 4LJ5A 2R18A 3TPZA 2OQ4A 2OO9A 2XFSA 4NOOB 1QDRA 5DFLA 2PCDM 2EKKA 4LGYA 3GLFB 1EIJA 4WHSA 2I7PA 4IJFA 4LF5M 2ERCA 2ZANA 3HJSA 2JZ0A 3PCIA 3AJIB 4IBEA 2KZUA 4NSOB 1DGHA 1TDZA 3FTCA 1NVMA 1VDLA 4BBAA 3BOSA 3M0EA 1L1TA 4IIWA 2J7NA 3Q8XA 4QHTA 4F1IA 4FCVA 1PJJA 1N77A 1KYIA 3LQQA 3UK6A 2DZOB 2XSRA 3TH1A 2L6OA 4GHLA 3W0FA 5FTLA 2YQZA 4DR3M 1EOCB 2QCUA 2D7HA 2BUMB 2XSZA 3AOEA 1YSYA 5IREB 4GEWA 1MJGM 1QUSA 3HY5A 2KZSA 1HQCA 1TR8A 3L28A 3K2LA 3Q8GA 4L6V6 5JI2E 3FD9A 4P17A 5EP2A 4JI6M 1QUTA 2KDLA 2XSUA 1NSFA 4NXMM 5FTNA 5JI3E 1PM5A 3LQRA 1OFIA 2DKLA 1D0LA 3SYKA 2VQEM 1DLTA 3LW5F 3GRUA 3SYLA 5ITYA 1IXZA 4DV5M 4XGIA 1IXSA 3PCHM 1OQYA 2BUVA 2CEAA 3U6SA 3AOEC 3UZUA 2BUZA 3PCBA 3AKZA 3K9PA 4D82A 2VDBB 4FWHA 4LCBA 3GLGB 2LVAA 2BUXB 1Z5CA 3ILKA 1IY2A 2APLA 2C96A 2FNAA 2Z7JA 4S12A 4JI7M 4AI6A 4RF0A 3H4JA 4LJ4A 1SG9A 4IBCA 5KPZA 2F5QA 1E9SA 1QDTA 4LG2A 3L26A 4DR5M 3KFUG 1JR3E 2KNAA 4L16A 1R2YA 1Z5BA 4WURA 3T1HM 3U61A 1GABA 2H1RA 1NNJA 1V33A 3B89A 2R44A 3H4MA 2AZQA 1TH2A 1VQ1A 1GLNA 4WW0A 3VK7A 3GQ4A 3MI5A 3PCCA 1HNZM 4WHOB 2JNHA 3MK6A 1HT2E 2EKFA 4B7FA 4Z6YA 4G4OA 1Z6TA 3IG8A 4GH9A 1C1KA 2K0BX 2CRUA 3LCVB 1XC8A 4XK8F 3KS8A 2HAKA 2CV0A 4JI1M 4WHQB 1YUBA 3AOGA 3HWSA 5L8RF 1E9RA 1YKMA 4AW4A 4GC5A 2LTUA 1XXHA 2BWBA 4FWDA 3RGSA 4F2LA 2AHMA 5ITUA 1ZAEA 1OAIA 2DVWB 2LVPC 2OOAA 5EXTA 3U5ZA 2G3QA 1V92A 3GRYA 4JV5M 3U6DA 4DV0M 2V1CA 2DXIA 1G8PA 1QAMA 3T63A 2WZJA 1G71A 2R46A 3EIEA 1OFHA 1WHCA 2V6ZM 5A2QS 3PCJM 3THGA 1D2NA 3A45A 3J7BA 2FE8A 1TDHA 1DV0A 2QZ4A 1C7YA 2KNVA 4FCWA 4LY6A 1EOAA 4WHRA 2M5ZA 5ITXA 1I94M 1YKNB 1HJPA 2QSFX 5IWAM 2OPFA 4Z8XA 5ITTA 2BUYB 4TUWA 3MV6A 3KOZE 3HU2A 2UXBM 1L2BA 1XXHE 2MROB 2BUTB 1TH3A 1HQYE 2L7IA 2XLJA 1HR0M 1EO2B 1WXQA 3R9XB 3TE6A 4DUZM 3MI5M 3NBIA 3E9SA 3LMXA 3VLFB 1V34A 3GRVA 1JR3D 4KLNA 4JI5M 1N33M 1YKLA 2C5RA 3TL4X 2BNKA 2DWNA 3KSJA 2BUUA 2UXCM 1OTRA 4M0WA 2FOIC 2F5OA 3GLIA 1GL7A 3VFDA 1ORYB 4RKUF 2HKJA 4DR1M 2BUWA 3SAVA 2CE7A 3U60B 3OTOM 3LKTA 1IN8A 1J7KA 3A46A 4LJ8A 3PCGM 2EJSA 1EE8A 2HWJA 4A3VB 2F5SA 3MFLA 4AKIA 4I8OA 2KA6B 3KP0E 4HL4A 4G4NA 1QAOA 4B08A 3PCAA 3L29A 4LFCM 3RE8A 2O01F 3E46A 1IM2A 3VKHA 1Z5AA 4AKHA 5EJCA 1SXJE 4OU7A 4GITA 4LGMA 5KPTA 3TWMA 3B7QA 2BUVB 5KQDA 1L8QA 3PCFM 2C98A 2QP9X 4NL4H 2N35A 2I7NA 1SXJC 2P5TA 2LHCA 1VEJA 3U6OA 2KRUA 3PCLM 2H5XA 2JP7A 4DV2M 2UUCM 1ZMUA 3J2PB 3L27A 4IBIA 3VKGA 3K92A 2X8AA 2R4JA 2MGWA 1NY6A 4LZZA 3SAUA 4BLCA 2JY5A 2WSCF 4JN6A 1BVSA 4Y28F 4JI3M 2R0IA 1OIZA 3J81S 1XMOM 4GIPA 2CHVA 3MV4A 3KP1E 3RGPA 1SXJA 4ANRA 2BV0B 2JUJA 2F4VM 5TD3A 3VDPA 1NHWC 4R3DA 3L25A 4LZJA 3FUVA 3PVSA 5E6JA 1DMHA 3F92A 1XWIA 3MMPA 2D7EA 5ITRA 2BUWB 1HT1E 4WHPB 1MN3A 1YKPB 1L2CA 3PCCM 4DV4M 1UM8A 1AUAA 2Z8YM 4RNAA 3U6MA 2Y20A 3PCBM 5ITQA 2DAKA 4ITQA 4WHSD 2XZFA 1YKLB 5DNYA 4M9SA 2K9DA 3HHXA 2XH9A 4XBOA 1WJ7A 4X64M 2ZTDA 4DV1M 3AL0C 1Q39A 2G8LA 1NO1A 1FJGM 3GLIB 2ZAOA 2XGNA 2BUXA 1YKOB 2KNZA 1NHGC 5IZ7D 2BOYA 1R4GA 5EXPA 4WHRF 1K3WA 2Y0QA 3FUUA 4LJ9A 2DAEA 1OAOC 1ZV1A 4IBBA 3TWKA 3MI1A 4GRIA 2BURA 3PCMM 1GKIA 2HCBA 3QAUA 4KT0F 4M9XA 3PCMA 1S3SA 4G4QA 1ZQ9A 2HHHM 5E26A 4IBJA 2E5LM 1MU5A 3SHFA 4P16A 3VK8A 3PCIM 1F4IA 3SAWA 1KSFX 4DUYM 3J27B 3FTDA 1SXJB 2L4FA 4JI4M 5LMNM 1D0MA 1H6UA 5FTJA 1MX0A 2JY8A 3N9TA 3LCUA 4JI8M 2W82A 3U6CA 1XHBA 4YY3M 3VDUA 4GC9A 4PDIA 3U5ZB 2RGHA 1GVNA 1EO9B 2R65A 4LJ7A 1N78A 2JA2A 3HGIA 1GJSA 1IY0A 1YKKA 2DI0A 3WHKA 4ILVA 3NBXX 2EA0A 3FUWA 3FRIA 1W5SA 4B3SM 3PCJA 1NV9A 3I04M 5IT9S 5EP3A 3MV4M 4B3MM 3ZH9B 4GMQA 1N34M 2Z3XA 3PCEM 2O5RA 2L09A 2ZAMA 3K9OA 4PCZA 3LXVM 1QQWA 4NXNM 3U6QA 2QNJA 1NV8A 3FRHA 2LVOC 2DZNB 2BURB 2R4EA 3HX3A 4GKKM 4MGHA 4L78A 1PJQA 3UGJA 4FD2A 2DWZB 1VEGA 3K8ZA 2L4EA 2BJWA 4CHTB 2QQ8A 1XB2B 4IJEA 3C3DA 3GQ3A 4FWGA 4NRWA 4B3TM 1N75A 4JYAM 3SC3A 3O32A 1G3IA 2WSFF 5EXSA 5BR8M 1YKMB 4I4LA 3UMMA 4MB7A 4NSRA 1W5TA 2R6FA 1YKOA 3D8LA 2GQFA 3O5UA 3PCLA 4FW9A 1JR3A 1VEKA 1QVRA 3MFLM 3FUXA 3PFIA 2VIIA 4R71A 1NJFA 4DR2M 1K82A 3HU1A 2G5GX 1QANA 3GLGE 1IN5A 4M9ZA 2OOBA 3I01M 2YR0A 4CGYB 1SXJD 1Y8GA 4CIZA 2R62A 1E94E 2BUYA 2DWLA 2BWEA 1XXHB 4M0DA 4I81A 4QOZC 3AFHA 4LJAA 1TH4A 5GKNA 5LMUM 4QHSA 3BBZA 3B9PA 3KW6A 4DV3M 3GPXA 2WSEF 3DA1A 5KQ8A 5DYIA 2EUCA 1EFUB 2CP8A 4AKGA 1G59A 3MV6M 3C3EA 1N36M 3MJ5A 5EP1A 2VF8A 3RFWA 4IBGA 2L7HA 2UUBM 1Z59A 3KVWA 8CATA 2KXEA 1QZMA 2J5YA 4QNMA 1EO2A 4WHOD 4LJ6A 1NJGA 3SHGB 3T6PA 3ZCBB 1TTEA 4ZPXA 3GLFA 3FYDA 3PNYA 1PJTA 4II7A 4LF7M 3I51A 1PJIA 4K0KM 2MJ5B 4GHAA 4IBFA 1D0KA 1DO2A 1YKPA 2C9CA 3FKEA 3FE3A 3O6RA 4D81A 2CWBA 1VDDA 2KW0A 3GLIE 2BUMA 4WHPD 1JQJC 1E32A 3KS4A 3MHVC 4MGKE 3HU3A 4BB9A 2D7GA 3PCDA 2C9OA 3LVVA 2RRUA 2JXNA 3W0LB 2LH0A 3KOXE 4LF4M 2Y0TA 1DLMA 4CISA 4LFBM 2LVNC 3GQ5A 2XEPA 3A98B 1DGHB 2DAGA 5FTKA 4HLQA 1OKSA 1IBLM 4WHOA 1UFZA 2BJVA 4RF1A 2F5PA 2DZLA 1LTMA 3PCNM 4PT5A 4WHRB 4KO8A 3J80S 4AZFA 3T67A 3KXEC 3HKPA 3T63M 4IBDA 2CV2A 4AG5A 3V76A 3AV0A 3GO8A 1YLAA 3IG5A 5C18A 3GPUA 3TQSA 1R2ZA 1JB0F 4DR7M 1TMXA 4MGYE 1YKNA 3HJ8A 1OIPA 1ZMWA 2LNHC 3DFZA 2ZTCA 2UU9M 4PD2A 4FCTA 4JI0M 4KHPM 2LXEA 3I4YA 1A5TA 3GLHA 3LMMA 3HHZA 3T1YM 4ILTA 4R7GA 1CUKA 2VF7A 7CATA 3PCFA 3CF6E 2LHGA 3U6LA 2XSZD 4G3OA 3PCHA 4MH0E 3PCEA 2NQ8C 1HNXM 4CJ6A 1K3XA 1QZEA 1RU3A 3U6EA 2BUQA 1Q3CA 3J7AS 1WR1B 1GJTA 3L2AA 2DHRA 4OW0A 1NNUC 1R5LA 2RGOA 2YFQA 4X62M 2QBYB 3W67A 4QOSA 4EIWA 1EOAB 3O6JA 3DOAA 2R45A 2M60A 2BUUB 3HHWA 3GLGA 1IN7A 4GKJM 4JXJA 1J09A 2JY6B 2MH8A 1DLQA 3CTWB 1DGBA 1XMQM 4W5WA 4MGZE 1I4WA 2QHOB 5BPVA 1EOBB 1IY1A 4REZA 1EOCA 2DWMA 2CFOA 2L2DA 1ZMVA 2DENA 4WHSB 3QYBA 3E21A 1VG5A 3SMSA 4D80A 3GPYA 3CF0A 4OVZA 4DV6M 3SATA 5EQTA 2Z4SA 3T67M 3T38A 3PCGA 3T15A 3M7GA 3I4VA 3MI1M 2FH0A 1G41A 3TWLA 4G6ZA 3GLFE 3U60A 2UXDM 2YNMD 4WP2A 1X37A 3ZC7B 2VQFM 1L2DA 1DO0A 2Q2EB 3KOYE 4HEOA 3GLHB 1IQPA 1LV7A 3JR5A 1L1ZA 3IECA 2O25A 2Y21A 4LF8M 2QPAA 1PGYA 3KSXA 3KDSE 4LF6M 3LVWA 3SARA 1HNWM 3E4RA 3B7NA 1IN6A 4DBGB 3HJQA 1IBKM 4PDGA 3ZQJA 4DR6M 1IN4A 2CV1A 4LRTA 1TF0B 3BXWA 3GLHE
chains in the Genus database with same CATH topology
3UJNA 4L15A 2BUZB 2J7OA 3SMPA 2X4AA 1Q3BA 3FTEA 5F3WA 3K1JA 4MGIE 4FVMA 4I5SA 3HHYA 4B7HA 2A5YB 1GL6A 4DV7M 1TGUA 1YE9A 3GRRA 4JI2M 2BUTA 4L4UA 3CF2A 2QBYA 3A42A 1DGGA 3PCDM 3PCKA 2XF3A 3DZDA 3KOWE 3JAMS 4OX9M 1YKKB 5DYGA 3U6PA 4WHPA 3C58A 3PCAM 2ZBKB 3LXVA 2XFTA 4B7GA 1XNRM 4LRSA 3GP1A 3U61B 1T3TA 2FFJA 1EOBA 1FNNA 3QWLA 5EP4A 4AQYM 4AG6A 3PXGA 2K47A 5EXXA 3FUTA 3WHLA 5H37D 5FTMA 4LF9M 1R6BX 1QYRA 4IBKA 3SASA 2PCDA 5FLXS 2V1UA 2KRKA 4DR4M 4WHQA 4B3RM 2UUAM 4G4RA 1J5EM 2BUQB 3GPPA 3EIHA 1R7RA 3NWLA 2CHQA 1G4AE 2C99A 1KFVA 4X66M 5ITXE 4MM3B 4YHHM 2QENA 2X49A 3PCNA 4NRVA 5KPRA 3D8BA 4QNRA 5FSWA 2CHGA 2ZM6M 1IBMM 3SBJA 2EO2A 3LMXM 5C1BA 1XNQM 3FTFA 3FYCA 4L8RC 3SFZA 2LWXA 5KO3A 2F5NA 1NY5A 2RKOA 4OVZB 4KODA 3JR4A 2XZUA 2Z4RA 2XSVA 1EO9A 1OJLA 3R8FA 2HL7A 1DGFA 3LKTM 2KEBA 1IXRC 2BV0A 4X65M 3PCKM 4LFAM 3PNVA 1QAQA 1IXSB 2CUZA 3M6AA 1S9AA 4LJ5A 2R18A 3TPZA 2OQ4A 2XFSA 4NOOB 2PCDM 3GLFB 4LGYA 4WHSA 2I7PA 4IJFA 4LF5M 2ERCA 2ZANA 3HJSA 3PCIA 3AJIB 4IBEA 2KZUA 4NSOB 1DGHA 1TDZA 3FTCA 1NVMA 4BBAA 1L1TA 3BOSA 3M0EA 1N32M 4IIWA 2J7NA 3Q8XA 4QHTA 1PJJA 4FCVA 1N77A 3TH1A 1KYIA 3LQQA 3UK6A 2DZOB 2XSRA 2L6OA 4GHLA 3W0FA 5FTLA 2YQZA 4DR3M 1EOCB 2QCUA 2D7HA 2BUMB 2XSZA 3AOEA 1YSYA 5IREB 2KZSA 1HQCA 3L28A 5JI2E 3K2LA 3FD9A 4JI6M 5EP2A 2XSUA 1NSFA 4NXMM 5FTNA 5JI3E 1PM5A 3LQRA 1OFIA 3SYKA 1DLTA 2VQEM 3GRUA 3SYLA 5ITYA 1IXZA 4DV5M 4XGIA 3PCHM 2BUVA 2CEAA 3U6SA 3AOEC 3UZUA 2BUZA 3PCBA 3AKZA 4D82A 3GLGB 4FWHA 4LCBA 2BUXB 1Z5CA 3ILKA 1IY2A 2C96A 2FNAA 2Z7JA 4S12A 4JI7M 4AI6A 4RF0A 4LJ4A 4IBCA 5KPZA 2F5QA 1E9SA 4LG2A 3L26A 4DR5M 3KFUG 4L16A 1R2YA 1Z5BA 4WURA 3T1HM 3U61A 2H1RA 1NNJA 3H4MA 2AZQA 1TH2A 3MI5A 1GLNA 4WW0A 3VK7A 3GQ4A 3PCCA 4WHOB 1HNZM 3MK6A 1HT2E 4Z6YA 4B7FA 4G4OA 1Z6TA 3IG8A 4GH9A 1C1KA 1XC8A 2CV0A 4JI1M 4WHQB 1YUBA 3AOGA 3HWSA 1YKMA 1E9RA 4AW4A 4GC5A 1XXHA 4FWDA 3RGSA 2AHMA 5ITUA 1ZAEA 3KS8A 2DVWB 5EXTA 3MFLM 3O6JA 4JV5M 3GRYA 3U6DA 4DV0M 2V1CA 2DXIA 1G8PA 1QAMA 3T63A 2R46A 3EIEA 1OFHA 2V6ZM 5A2QS 3PCJM 3THGA 1D2NA 3A45A 3J7BA 2FE8A 1TDHA 2QZ4A 4FCWA 4LY6A 1EOAA 4WHRA 2M5ZA 5ITXA 1I94M 1YKNB 5IWAM 2OPFA 4Z8XA 5ITTA 2BUYB 4TUWA 3MV6A 3KOZE 3HU2A 2UXBM 1L2BA 2BUTB 1TH3A 1HQYE 2L7IA 2XLJA 1HR0M 1EO2B 1WXQA 3R9XB 3TE6A 4DUZM 3MI5M 3NBIA 3E9SA 3LMXA 3VLFB 3GRVA 1JR3D 4KLNA 4JI5M 1N33M 1YKLA 2C5RA 3TL4X 2BNKA 2DWNA 3KSJA 2BUUA 2UXCM 4M0WA 2FOIC 2F5OA 3GLIA 1GL7A 3VFDA 1ORYB 2HKJA 4DR1M 2BUWA 3SAVA 2CE7A 3U60B 3OTOM 3LKTA 1IN8A 1J7KA 3A46A 4LJ8A 3PCGM 4A3VB 1EE8A 2F5SA 3MFLA 4AKIA 4I8OA 2KA6B 3KP0E 4HL4A 4G4NA 1QAOA 4B08A 3PCAA 3L29A 4LFCM 3RE8A 1IM2A 3VKHA 1Z5AA 4AKHA 5EJCA 1SXJE 4OU7A 4GITA 4LGMA 5KPTA 3TWMA 2BUVB 5KQDA 1L8QA 3PCFM 2C98A 2QP9X 4NL4H 2I7NA 1SXJC 2P5TA 3U6OA 2KRUA 3PCLM 4DV2M 2UUCM 3J2PB 3L27A 4IBIA 3VKGA 3K92A 2X8AA 2R4JA 4LZZA 1NY6A 3SAUA 4BLCA 4JN6A 4JI3M 4JI4M 1XMOM 3J81S 4GIPA 2CHVA 3MV4A 3KP1E 3RGPA 1SXJA 2BV0B 2F4VM 5TD3A 3VDPA 1NHWC 4R3DA 3L25A 4LZJA 3FUVA 3PVSA 5E6JA 1DMHA 2BUWB 1XWIA 4WHPB 2D7EA 5ITRA 1HT1E 1YKPB 1L2CA 3PCCM 4DV4M 1UM8A 4RNAA 3U6MA 2Y20A 3PCBM 5ITQA 4ITQA 4WHSD 2XZFA 1YKLB 5DNYA 4M9SA 3HHXA 2XH9A 4XBOA 4X64M 4DV1M 3AL0C 1Q39A 2G8LA 1FJGM 3GLIB 2ZAOA 2XGNA 2BUXA 1YKOB 2BOYA 1NHGC 5IZ7D 5EXPA 1K3WA 2Y0QA 3FUUA 4LJ9A 4IBBA 3TWKA 3MI1A 4GRIA 2BURA 3PCMM 1GKIA 2HCBA 3QAUA 4M9XA 3PCMA 1S3SA 4G4QA 1ZQ9A 2HHHM 5E26A 4IBJA 2E5LM 1MU5A 3SHFA 4P16A 3VK8A 3PCIM 3SAWA 1KSFX 4DUYM 3J27B 3FTDA 1SXJB 5LMNM 1H6UA 5FTJA 1MX0A 3N9TA 4JI8M 2W82A 3U6CA 1XHBA 4YY3M 3VDUA 4GC9A 4PDIA 3U5ZB 2RGHA 1GVNA 1EO9B 2R65A 4LJ7A 1N78A 2JA2A 3HGIA 1YKKA 1IY0A 3WHKA 4ILVA 2EA0A 3FUWA 4B3SM 1W5SA 3PCJA 5IT9S 5EP3A 3MV4M 4B3MM 3ZH9B 4GMQA 1N34M 2Z3XA 3PCEM 2O5RA 2L09A 2ZAMA 4PCZA 3LXVM 1QQWA 4NXNM 3U6QA 2DZNB 2BURB 2R4EA 4GKKM 4MGHA 4L78A 3UGJA 4FD2A 2DWZB 3K8ZA 2BJWA 4CHTB 4IJEA 3GQ3A 4FWGA 4NRWA 4B3TM 1N75A 4JYAM 3SC3A 3O32A 1G3IA 5EXSA 1YKMB 5BR8M 4I4LA 3UMMA 4MB7A 4NSRA 1W5TA 1YKOA 3D8LA 3O5UA 3PCLA 4FW9A 1JR3A 1QVRA 3FUXA 3PFIA 2VIIA 4DR2M 1NJFA 1K82A 3HU1A 2G5GX 1QANA 1IN5A 4M9ZA 2YR0A 4CGYB 1SXJD 2R62A 1E94E 2BUYA 2DWLA 1XXHB 4M0DA 4I81A 4QOZC 3AFHA 4LJAA 1TH4A 5GKNA 5LMUM 4QHSA 3KW6A 3B9PA 4DV3M 3U5ZA 3GPXA 3DA1A 4WHRF 5KQ8A 5DYIA 2EUCA 4AKGA 1G59A 3MV6M 1N36M 3MJ5A 5EP1A 3RFWA 4IBGA 2L7HA 2UUBM 1Z59A 3KVWA 8CATA 2KXEA 1QZMA 4QNMA 1EO2A 4WHOD 4LJ6A 1NJGA 3SHGB 3ZCBB 4ZPXA 3GLFA 3FYDA 3PNYA 4II7A 4LF7M 3I51A 1PJIA 4K0KM 4GHAA 4IBFA 1DO2A 1YKPA 2C9CA 3FKEA 3O6RA 4D81A 2KW0A 1VDDA 2BUMA 4WHPD 1JQJC 1E32A 3KS4A 3MHVC 4MGKE 3HU3A 4BB9A 2D7GA 3PCDA 2C9OA 3LVVA 3W0LB 2LH0A 3KOXE 4LF4M 2Y0TA 1DLMA 4CISA 4LFBM 3GQ5A 2XEPA 3A98B 1DGHB 5FTKA 4HLQA 1IBLM 4WHOA 2BJVA 4RF1A 2F5PA 3PCNM 4PT5A 4WHRB 4KO8A 3J80S 4AZFA 3T67A 3KXEC 3HKPA 3T63M 4IBDA 2CV2A 4AG5A 3AV0A 3GO8A 3IG5A 5C18A 3GPUA 3TQSA 1R2ZA 4DR7M 1TMXA 4MGYE 1YKNA 3HJ8A 2LNHC 3DFZA 2UU9M 4PD2A 4FCTA 4JI0M 4KHPM 2LXEA 3I4YA 3HHZA 3GLHA 3LMMA 3T1YM 4ILTA 4R7GA 7CATA 3PCFA 3CF6E 3U6LA 2XSZD 3PCHA 4MH0E 3PCEA 2NQ8C 1HNXM 1K3XA 2BUQA 3U6EA 1Q3CA 3J7AS 3L2AA 2DHRA 4OW0A 1NNUC 2RGOA 2YFQA 4X62M 2QBYB 1EOAB 4QOSA 4EIWA 3DOAA 2R45A 2M60A 2BUUB 3HHWA 3GLGA 1IN7A 4GKJM 4JXJA 1J09A 1DLQA 3CTWB 1DGBA 1XMQM 4W5WA 4MGZE 1I4WA 5BPVA 1EOBB 1IY1A 4REZA 1EOCA 2DWMA 2CFOA 4WHSB 3SMSA 4D80A 3GPYA 3CF0A 4OVZA 4DV6M 3SATA 5EQTA 2Z4SA 3T67M 3T38A 3PCGA 3T15A 3M7GA 3I4VA 3MI1M 1G41A 3TWLA 4G6ZA 3U60A 2UXDM 2YNMD 1X37A 3ZC7B 2VQFM 1L2DA 1DO0A 2Q2EB 3KOYE 3GLHB 1IQPA 1LV7A 3JR5A 1L1ZA 2Y21A 4LF8M 2QPAA 3KSXA 3KDSE 4LF6M 3LVWA 3SARA 1HNWM 3E4RA 1IN6A 3HJQA 1IBKM 4PDGA 4DR6M 1IN4A 2CV1A 4LRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUZ B;  3MV6 M;  3PCH M;  2BUZ A;  3MV4 A;  3PCB A;  3HHY A;  2BV0 B;  2BUX B;  1EO2 A;  5TD3 A;  4WHO D;  2BUT A;  2BUW B;  1DMH A;  4WHP B;  3I51 A;  3PCD M;  3PCK A;  1YKP B;  3PCC M;  4WHS D;  1YKP A;  3PCB M;  1YKK B;  1YKL B;  4WHP A;  3O6R A;  3PCA M;  3HHX A;  2BUM A;  3LXV A;  4WHP D;  3PCD A;  2AZQ A;  3MI5 A;  4WHO B;  2BUX A;  1YKO B;  2BOY A;  3PCC A;  1EOB A;  1DLM A;  3MI1 A;  2BUR A;  3PCM M;  4WHO A;  3PCM A;  2PCD A;  4WHQ B;  1YKM A;  3PCN M;  4WHQ A;  4WHR B;  3MFL M;  3O6J A;  3PCI M;  3HKP A;  3T67 A;  3T63 M;  2BUQ B;  3T63 A;  1TMX A;  1YKN A;  3PCJ M;  3HJ8 A;  3N9T A;  2BUV A;  3PCN A;  3I4Y A;  4WHR A;  1EOA A;  4ILT A;  1EO9 B;  3HGI A;  3PCF A;  1YKN B;  1YKK A;  2BUY B;  4ILV A;  3LMX M;  3MV6 A;  3PCH A;  3PCJ A;  2BUQ A;  3MV4 M;  2BUT B;  3PCE M;  1EOA B;  2XSV A;  3LXV M;  1EO9 A;  1EO2 B;  2BUU B;  3MI5 M;  3LKT M;  2BUR B;  3LMX A;  2BV0 A;  3PCK M;  1DLQ A;  1YKL A;  1S9A A;  1EOB B;  2BUU A;  1EOC A;  2PCD M;  4WHS B;  2BUW A;  4WHS A;  3LKT A;  3PCG M;  3O32 A;  1YKM B;  3MFL A;  3HJS A;  3PCI A;  3PCG A;  3T67 M;  3I4V A;  3MI1 M;  3PCA A;  3TH1 A;  1YKO A;  2XSR A;  3O5U A;  3PCL A;  1EOC B;  2BUM B;  2BUV B;  3PCF M;  3PCL M;  2XSU A;  2BUY A;  3HJQ A;  1DLT A;  3PCE A;  4WHR F; 
#chains in the Genus database with same CATH topology
 3UJN A;  4L15 A;  3B7Z A;  2BUZ B;  2J7O A;  3SMP A;  2MR9 A;  3C9P A;  2X4A A;  1Q3B A;  3FTE A;  5F3W A;  2JY7 A;  3K1J A;  4MGI E;  3QYE A;  4FVM A;  1Q02 A;  3CGW A;  4I5S A;  3HHY A;  4B7H A;  2LBC A;  2A5Y B;  1GL6 A;  4DV7 M;  1TGU A;  1YE9 A;  1PJS A;  3GRR A;  4JI2 M;  2BUT A;  4L4U A;  3CF2 A;  2QBY A;  3A42 A;  1DGG A;  3PCD M;  3PCK A;  2XF3 A;  3DZD A;  3KOW E;  4NC6 A;  3JAM S;  4OX9 M;  1YKK B;  2GNO A;  5DYG A;  3U6P A;  1GO5 A;  3C58 A;  3PCA M;  4WHP A;  2ZBK B;  1WGL A;  3LXV A;  2XFT A;  4UN2 B;  4B7G A;  4Q7J A;  3B74 A;  1XNR M;  4LRS A;  3W68 A;  3GP1 A;  1P3Q Q;  1T3T A;  3U61 B;  2FFJ A;  1N32 M;  1EOB A;  1FNN A;  3QWL A;  5EP4 A;  1PRB A;  4AQY M;  2B3T A;  4AG6 A;  3PXG A;  2K47 A;  5EXX A;  3FUT A;  3IHP A;  3WHL A;  5H37 D;  5FTM A;  4LF9 M;  1R6B X;  1QYR A;  4IBK A;  3SAS A;  2PCD A;  5FLX S;  2V1U A;  2KRK A;  2FS1 A;  4DR4 M;  4WHQ A;  4B3R M;  2JZ1 A;  2UUA M;  4G4R A;  1J5E M;  2JWS A;  3GPP A;  2BUQ B;  3EIH A;  1R7R A;  3NWL A;  2CHQ A;  1G4A E;  2C99 A;  1KFV A;  4X66 M;  5ITX E;  4MM3 B;  4YHH M;  2QEN A;  2X49 A;  3PCN A;  4NRV A;  5KPR A;  3D8B A;  4QNR A;  5FSW A;  2DAI A;  2CHG A;  1T43 A;  1WGN A;  2ZM6 M;  1IBM M;  1T6O A;  3SBJ A;  2EO2 A;  3LMX M;  5C1B A;  1XNQ M;  3FTF A;  1IFY A;  3FYC A;  4L8R C;  3SFZ A;  2LWX A;  2LVQ D;  5KO3 A;  2F5N A;  1NY5 A;  2RKO A;  4OVZ B;  4KOD A;  3JR4 A;  2XZU A;  2Z4R A;  2DNA A;  2DHY A;  1WIV A;  2KHH A;  1EO9 A;  1OJL A;  3R8F A;  2HL7 A;  2XSV A;  1DGF A;  2K6B A;  1AIP C;  3LKT M;  2KEB A;  2DAM A;  1IXR C;  2BV0 A;  4X65 M;  3PCK M;  4LFA M;  3PNV A;  3HZJ A;  1QAQ A;  1IXS B;  2CUZ A;  3M6A A;  1S9A A;  4LJ5 A;  2R18 A;  3TPZ A;  2OQ4 A;  2OO9 A;  2XFS A;  4NOO B;  1QDR A;  5DFL A;  2PCD M;  2EKK A;  4LGY A;  3GLF B;  1EIJ A;  4WHS A;  2I7P A;  4IJF A;  4LF5 M;  2ERC A;  2ZAN A;  3HJS A;  2JZ0 A;  3PCI A;  3AJI B;  4IBE A;  2KZU A;  4NSO B;  1DGH A;  1TDZ A;  3FTC A;  1NVM A;  1VDL A;  4BBA A;  3BOS A;  3M0E A;  1L1T A;  4IIW A;  2J7N A;  3Q8X A;  4QHT A;  4F1I A;  4FCV A;  1PJJ A;  1N77 A;  1KYI A;  3LQQ A;  3UK6 A;  2DZO B;  2XSR A;  3TH1 A;  2L6O A;  4GHL A;  3W0F A;  5FTL A;  2YQZ A;  4DR3 M;  1EOC B;  2QCU A;  2D7H A;  2BUM B;  2XSZ A;  3AOE A;  1YSY A;  5IRE B;  4GEW A;  1MJG M;  1QUS A;  3HY5 A;  2KZS A;  1HQC A;  1TR8 A;  3L28 A;  3K2L A;  3Q8G A;  4L6V 6;  5JI2 E;  3FD9 A;  4P17 A;  5EP2 A;  4JI6 M;  1QUT A;  2KDL A;  2XSU A;  1NSF A;  4NXM M;  5FTN A;  5JI3 E;  1PM5 A;  3LQR A;  1OFI A;  2DKL A;  1D0L A;  3SYK A;  2VQE M;  1DLT A;  3LW5 F;  3GRU A;  3SYL A;  5ITY A;  1IXZ A;  4DV5 M;  4XGI A;  1IXS A;  3PCH M;  1OQY A;  2BUV A;  2CEA A;  3U6S A;  3AOE C;  3UZU A;  2BUZ A;  3PCB A;  3AKZ A;  3K9P A;  4D82 A;  2VDB B;  4FWH A;  4LCB A;  3GLG B;  2LVA A;  2BUX B;  1Z5C A;  3ILK A;  1IY2 A;  2APL A;  2C96 A;  2FNA A;  2Z7J A;  4S12 A;  4JI7 M;  4AI6 A;  4RF0 A;  3H4J A;  4LJ4 A;  1SG9 A;  4IBC A;  5KPZ A;  2F5Q A;  1E9S A;  1QDT A;  4LG2 A;  3L26 A;  4DR5 M;  3KFU G;  1JR3 E;  2KNA A;  4L16 A;  1R2Y A;  1Z5B A;  4WUR A;  3T1H M;  3U61 A;  1GAB A;  2H1R A;  1NNJ A;  1V33 A;  3B89 A;  2R44 A;  3H4M A;  2AZQ A;  1TH2 A;  1VQ1 A;  1GLN A;  4WW0 A;  3VK7 A;  3GQ4 A;  3MI5 A;  3PCC A;  1HNZ M;  4WHO B;  2JNH A;  3MK6 A;  1HT2 E;  2EKF A;  4B7F A;  4Z6Y A;  4G4O A;  1Z6T A;  3IG8 A;  4GH9 A;  1C1K A;  2K0B X;  2CRU A;  3LCV B;  1XC8 A;  4XK8 F;  3KS8 A;  2HAK A;  2CV0 A;  4JI1 M;  4WHQ B;  1YUB A;  3AOG A;  3HWS A;  5L8R F;  1E9R A;  1YKM A;  4AW4 A;  4GC5 A;  2LTU A;  1XXH A;  2BWB A;  4FWD A;  3RGS A;  4F2L A;  2AHM A;  5ITU A;  1ZAE A;  1OAI A;  2DVW B;  2LVP C;  2OOA A;  5EXT A;  3U5Z A;  2G3Q A;  1V92 A;  3GRY A;  4JV5 M;  3U6D A;  4DV0 M;  2V1C A;  2DXI A;  1G8P A;  1QAM A;  3T63 A;  2WZJ A;  1G71 A;  2R46 A;  3EIE A;  1OFH A;  1WHC A;  2V6Z M;  5A2Q S;  3PCJ M;  3THG A;  1D2N A;  3A45 A;  3J7B A;  2FE8 A;  1TDH A;  1DV0 A;  2QZ4 A;  1C7Y A;  2KNV A;  4FCW A;  4LY6 A;  1EOA A;  4WHR A;  2M5Z A;  5ITX A;  1I94 M;  1YKN B;  1HJP A;  2QSF X;  5IWA M;  2OPF A;  4Z8X A;  5ITT A;  2BUY B;  4TUW A;  3MV6 A;  3KOZ E;  3HU2 A;  2UXB M;  1L2B A;  1XXH E;  2MRO B;  2BUT B;  1TH3 A;  1HQY E;  2L7I A;  2XLJ A;  1HR0 M;  1EO2 B;  1WXQ A;  3R9X B;  3TE6 A;  4DUZ M;  3MI5 M;  3NBI A;  3E9S A;  3LMX A;  3VLF B;  1V34 A;  3GRV A;  1JR3 D;  4KLN A;  4JI5 M;  1N33 M;  1YKL A;  2C5R A;  3TL4 X;  2BNK A;  2DWN A;  3KSJ A;  2BUU A;  2UXC M;  1OTR A;  4M0W A;  2FOI C;  2F5O A;  3GLI A;  1GL7 A;  3VFD A;  1ORY B;  4RKU F;  2HKJ A;  4DR1 M;  2BUW A;  3SAV A;  2CE7 A;  3U60 B;  3OTO M;  3LKT A;  1IN8 A;  1J7K A;  3A46 A;  4LJ8 A;  3PCG M;  2EJS A;  1EE8 A;  2HWJ A;  4A3V B;  2F5S A;  3MFL A;  4AKI A;  4I8O A;  2KA6 B;  3KP0 E;  4HL4 A;  4G4N A;  1QAO A;  4B08 A;  3PCA A;  3L29 A;  4LFC M;  3RE8 A;  2O01 F;  3E46 A;  1IM2 A;  3VKH A;  1Z5A A;  4AKH A;  5EJC A;  1SXJ E;  4OU7 A;  4GIT A;  4LGM A;  5KPT A;  3TWM A;  3B7Q A;  2BUV B;  5KQD A;  1L8Q A;  3PCF M;  2C98 A;  2QP9 X;  4NL4 H;  2N35 A;  2I7N A;  1SXJ C;  2P5T A;  2LHC A;  1VEJ A;  3U6O A;  2KRU A;  3PCL M;  2H5X A;  2JP7 A;  4DV2 M;  2UUC M;  1ZMU A;  3J2P B;  3L27 A;  4IBI A;  3VKG A;  3K92 A;  2X8A A;  2R4J A;  2MGW A;  1NY6 A;  4LZZ A;  3SAU A;  4BLC A;  2JY5 A;  2WSC F;  4JN6 A;  1BVS A;  4Y28 F;  4JI3 M;  2R0I A;  1OIZ A;  3J81 S;  1XMO M;  4GIP A;  2CHV A;  3MV4 A;  3KP1 E;  3RGP A;  1SXJ A;  4ANR A;  2BV0 B;  2JUJ A;  2F4V M;  5TD3 A;  3VDP A;  1NHW C;  4R3D A;  3L25 A;  4LZJ A;  3FUV A;  3PVS A;  5E6J A;  1DMH A;  3F92 A;  1XWI A;  3MMP A;  2D7E A;  5ITR A;  2BUW B;  1HT1 E;  4WHP B;  1MN3 A;  1YKP B;  1L2C A;  3PCC M;  4DV4 M;  1UM8 A;  1AUA A;  2Z8Y M;  4RNA A;  3U6M A;  2Y20 A;  3PCB M;  5ITQ A;  2DAK A;  4ITQ A;  4WHS D;  2XZF A;  1YKL B;  5DNY A;  4M9S A;  2K9D A;  3HHX A;  2XH9 A;  4XBO A;  1WJ7 A;  4X64 M;  2ZTD A;  4DV1 M;  3AL0 C;  1Q39 A;  2G8L A;  1NO1 A;  1FJG M;  3GLI B;  2ZAO A;  2XGN A;  2BUX A;  1YKO B;  2KNZ A;  1NHG C;  5IZ7 D;  2BOY A;  1R4G A;  5EXP A;  4WHR F;  1K3W A;  2Y0Q A;  3FUU A;  4LJ9 A;  2DAE A;  1OAO C;  1ZV1 A;  4IBB A;  3TWK A;  3MI1 A;  4GRI A;  2BUR A;  3PCM M;  1GKI A;  2HCB A;  3QAU A;  4KT0 F;  4M9X A;  3PCM A;  1S3S A;  4G4Q A;  1ZQ9 A;  2HHH M;  5E26 A;  4IBJ A;  2E5L M;  1MU5 A;  3SHF A;  4P16 A;  3VK8 A;  3PCI M;  1F4I A;  3SAW A;  1KSF X;  4DUY M;  3J27 B;  3FTD A;  1SXJ B;  2L4F A;  4JI4 M;  5LMN M;  1D0M A;  1H6U A;  5FTJ A;  1MX0 A;  2JY8 A;  3N9T A;  3LCU A;  4JI8 M;  2W82 A;  3U6C A;  1XHB A;  4YY3 M;  3VDU A;  4GC9 A;  4PDI A;  3U5Z B;  2RGH A;  1GVN A;  1EO9 B;  2R65 A;  4LJ7 A;  1N78 A;  2JA2 A;  3HGI A;  1GJS A;  1IY0 A;  1YKK A;  2DI0 A;  3WHK A;  4ILV A;  3NBX X;  2EA0 A;  3FUW A;  3FRI A;  1W5S A;  4B3S M;  3PCJ A;  1NV9 A;  3I04 M;  5IT9 S;  5EP3 A;  3MV4 M;  4B3M M;  3ZH9 B;  4GMQ A;  1N34 M;  2Z3X A;  3PCE M;  2O5R A;  2L09 A;  2ZAM A;  3K9O A;  4PCZ A;  3LXV M;  1QQW A;  4NXN M;  3U6Q A;  2QNJ A;  1NV8 A;  3FRH A;  2LVO C;  2DZN B;  2BUR B;  2R4E A;  3HX3 A;  4GKK M;  4MGH A;  4L78 A;  1PJQ A;  3UGJ A;  4FD2 A;  2DWZ B;  1VEG A;  3K8Z A;  2L4E A;  2BJW A;  4CHT B;  2QQ8 A;  1XB2 B;  4IJE A;  3C3D A;  3GQ3 A;  4FWG A;  4NRW A;  4B3T M;  1N75 A;  4JYA M;  3SC3 A;  3O32 A;  1G3I A;  2WSF F;  5EXS A;  5BR8 M;  1YKM B;  4I4L A;  3UMM A;  4MB7 A;  4NSR A;  1W5T A;  2R6F A;  1YKO A;  3D8L A;  2GQF A;  3O5U A;  3PCL A;  4FW9 A;  1JR3 A;  1VEK A;  1QVR A;  3MFL M;  3FUX A;  3PFI A;  2VII A;  4R71 A;  1NJF A;  4DR2 M;  1K82 A;  3HU1 A;  2G5G X;  1QAN A;  3GLG E;  1IN5 A;  4M9Z A;  2OOB A;  3I01 M;  2YR0 A;  4CGY B;  1SXJ D;  1Y8G A;  4CIZ A;  2R62 A;  1E94 E;  2BUY A;  2DWL A;  2BWE A;  1XXH B;  4M0D A;  4I81 A;  4QOZ C;  3AFH A;  4LJA A;  1TH4 A;  5GKN A;  5LMU M;  4QHS A;  3BBZ A;  3B9P A;  3KW6 A;  4DV3 M;  3GPX A;  2WSE F;  3DA1 A;  5KQ8 A;  5DYI A;  2EUC A;  1EFU B;  2CP8 A;  4AKG A;  1G59 A;  3MV6 M;  3C3E A;  1N36 M;  3MJ5 A;  5EP1 A;  2VF8 A;  3RFW A;  4IBG A;  2L7H A;  2UUB M;  1Z59 A;  3KVW A;  8CAT A;  2KXE A;  1QZM A;  2J5Y A;  4QNM A;  1EO2 A;  4WHO D;  4LJ6 A;  1NJG A;  3SHG B;  3T6P A;  3ZCB B;  1TTE A;  4ZPX A;  3GLF A;  3FYD A;  3PNY A;  1PJT A;  4II7 A;  4LF7 M;  3I51 A;  1PJI A;  4K0K M;  2MJ5 B;  4GHA A;  4IBF A;  1D0K A;  1DO2 A;  1YKP A;  2C9C A;  3FKE A;  3FE3 A;  3O6R A;  4D81 A;  2CWB A;  1VDD A;  2KW0 A;  3GLI E;  2BUM A;  4WHP D;  1JQJ C;  1E32 A;  3KS4 A;  3MHV C;  4MGK E;  3HU3 A;  4BB9 A;  2D7G A;  3PCD A;  2C9O A;  3LVV A;  2RRU A;  2JXN A;  3W0L B;  2LH0 A;  3KOX E;  4LF4 M;  2Y0T A;  1DLM A;  4CIS A;  4LFB M;  2LVN C;  3GQ5 A;  2XEP A;  3A98 B;  1DGH B;  2DAG A;  5FTK A;  4HLQ A;  1OKS A;  1IBL M;  4WHO A;  1UFZ A;  2BJV A;  4RF1 A;  2F5P A;  2DZL A;  1LTM A;  3PCN M;  4PT5 A;  4WHR B;  4KO8 A;  3J80 S;  4AZF A;  3T67 A;  3KXE C;  3HKP A;  3T63 M;  4IBD A;  2CV2 A;  4AG5 A;  3V76 A;  3AV0 A;  3GO8 A;  1YLA A;  3IG5 A;  5C18 A;  3GPU A;  3TQS A;  1R2Z A;  1JB0 F;  4DR7 M;  1TMX A;  4MGY E;  1YKN A;  3HJ8 A;  1OIP A;  1ZMW A;  2LNH C;  3DFZ A;  2ZTC A;  2UU9 M;  4PD2 A;  4FCT A;  4JI0 M;  4KHP M;  2LXE A;  3I4Y A;  1A5T A;  3GLH A;  3LMM A;  3HHZ A;  3T1Y M;  4ILT A;  4R7G A;  1CUK A;  2VF7 A;  7CAT A;  3PCF A;  3CF6 E;  2LHG A;  3U6L A;  2XSZ D;  4G3O A;  3PCH A;  4MH0 E;  3PCE A;  2NQ8 C;  1HNX M;  4CJ6 A;  1K3X A;  1QZE A;  1RU3 A;  3U6E A;  2BUQ A;  1Q3C A;  3J7A S;  1WR1 B;  1GJT A;  3L2A A;  2DHR A;  4OW0 A;  1NNU C;  1R5L A;  2RGO A;  2YFQ A;  4X62 M;  2QBY B;  3W67 A;  4QOS A;  4EIW A;  1EOA B;  3O6J A;  3DOA A;  2R45 A;  2M60 A;  2BUU B;  3HHW A;  3GLG A;  1IN7 A;  4GKJ M;  4JXJ A;  1J09 A;  2JY6 B;  2MH8 A;  1DLQ A;  3CTW B;  1DGB A;  1XMQ M;  4W5W A;  4MGZ E;  1I4W A;  2QHO B;  5BPV A;  1EOB B;  1IY1 A;  4REZ A;  1EOC A;  2DWM A;  2CFO A;  2L2D A;  1ZMV A;  2DEN A;  4WHS B;  3QYB A;  3E21 A;  1VG5 A;  3SMS A;  4D80 A;  3GPY A;  3CF0 A;  4OVZ A;  4DV6 M;  3SAT A;  5EQT A;  2Z4S A;  3T67 M;  3T38 A;  3PCG A;  3T15 A;  3M7G A;  3I4V A;  3MI1 M;  2FH0 A;  1G41 A;  3TWL A;  4G6Z A;  3GLF E;  3U60 A;  2UXD M;  2YNM D;  4WP2 A;  1X37 A;  3ZC7 B;  2VQF M;  1L2D A;  1DO0 A;  2Q2E B;  3KOY E;  4HEO A;  3GLH B;  1IQP A;  1LV7 A;  3JR5 A;  1L1Z A;  3IEC A;  2O25 A;  2Y21 A;  4LF8 M;  2QPA A;  1PGY A;  3KSX A;  3KDS E;  4LF6 M;  3LVW A;  3SAR A;  1HNW M;  3E4R A;  3B7N A;  1IN6 A;  4DBG B;  3HJQ A;  1IBK M;  4PDG A;  3ZQJ A;  4DR6 M;  1IN4 A;  2CV1 A;  4LRT A;  1TF0 B;  3BXW A;  3GLH E; 
#chains in the Genus database with same CATH homology
 3UJN A;  4L15 A;  2BUZ B;  2J7O A;  3SMP A;  2X4A A;  1Q3B A;  3FTE A;  5F3W A;  3K1J A;  4MGI E;  4FVM A;  4I5S A;  3HHY A;  4B7H A;  2A5Y B;  1GL6 A;  4DV7 M;  1TGU A;  1YE9 A;  3GRR A;  4JI2 M;  2BUT A;  4L4U A;  3CF2 A;  2QBY A;  3A42 A;  1DGG A;  3PCD M;  3PCK A;  2XF3 A;  3DZD A;  3KOW E;  3JAM S;  4OX9 M;  1YKK B;  5DYG A;  3U6P A;  4WHP A;  3C58 A;  3PCA M;  2ZBK B;  3LXV A;  2XFT A;  4B7G A;  1XNR M;  4LRS A;  3GP1 A;  3U61 B;  1T3T A;  2FFJ A;  1EOB A;  1FNN A;  3QWL A;  5EP4 A;  4AQY M;  4AG6 A;  3PXG A;  2K47 A;  5EXX A;  3FUT A;  3WHL A;  5H37 D;  5FTM A;  4LF9 M;  1R6B X;  1QYR A;  4IBK A;  3SAS A;  2PCD A;  5FLX S;  2V1U A;  2KRK A;  4DR4 M;  4WHQ A;  4B3R M;  2UUA M;  4G4R A;  1J5E M;  2BUQ B;  3GPP A;  3EIH A;  1R7R A;  3NWL A;  2CHQ A;  1G4A E;  2C99 A;  1KFV A;  4X66 M;  5ITX E;  4MM3 B;  4YHH M;  2QEN A;  2X49 A;  3PCN A;  4NRV A;  5KPR A;  3D8B A;  4QNR A;  5FSW A;  2CHG A;  2ZM6 M;  1IBM M;  3SBJ A;  2EO2 A;  3LMX M;  5C1B A;  1XNQ M;  3FTF A;  3FYC A;  4L8R C;  3SFZ A;  2LWX A;  5KO3 A;  2F5N A;  1NY5 A;  2RKO A;  4OVZ B;  4KOD A;  3JR4 A;  2XZU A;  2Z4R A;  2XSV A;  1EO9 A;  1OJL A;  3R8F A;  2HL7 A;  1DGF A;  3LKT M;  2KEB A;  1IXR C;  2BV0 A;  4X65 M;  3PCK M;  4LFA M;  3PNV A;  1QAQ A;  1IXS B;  2CUZ A;  3M6A A;  1S9A A;  4LJ5 A;  2R18 A;  3TPZ A;  2OQ4 A;  2XFS A;  4NOO B;  2PCD M;  3GLF B;  4LGY A;  4WHS A;  2I7P A;  4IJF A;  4LF5 M;  2ERC A;  2ZAN A;  3HJS A;  3PCI A;  3AJI B;  4IBE A;  2KZU A;  4NSO B;  1DGH A;  1TDZ A;  3FTC A;  1NVM A;  4BBA A;  1L1T A;  3BOS A;  3M0E A;  1N32 M;  4IIW A;  2J7N A;  3Q8X A;  4QHT A;  1PJJ A;  4FCV A;  1N77 A;  3TH1 A;  1KYI A;  3LQQ A;  3UK6 A;  2DZO B;  2XSR A;  2L6O A;  4GHL A;  3W0F A;  5FTL A;  2YQZ A;  4DR3 M;  1EOC B;  2QCU A;  2D7H A;  2BUM B;  2XSZ A;  3AOE A;  1YSY A;  5IRE B;  2KZS A;  1HQC A;  3L28 A;  5JI2 E;  3K2L A;  3FD9 A;  4JI6 M;  5EP2 A;  2XSU A;  1NSF A;  4NXM M;  5FTN A;  5JI3 E;  1PM5 A;  3LQR A;  1OFI A;  3SYK A;  1DLT A;  2VQE M;  3GRU A;  3SYL A;  5ITY A;  1IXZ A;  4DV5 M;  4XGI A;  3PCH M;  2BUV A;  2CEA A;  3U6S A;  3AOE C;  3UZU A;  2BUZ A;  3PCB A;  3AKZ A;  4D82 A;  3GLG B;  4FWH A;  4LCB A;  2BUX B;  1Z5C A;  3ILK A;  1IY2 A;  2C96 A;  2FNA A;  2Z7J A;  4S12 A;  4JI7 M;  4AI6 A;  4RF0 A;  4LJ4 A;  4IBC A;  5KPZ A;  2F5Q A;  1E9S A;  4LG2 A;  3L26 A;  4DR5 M;  3KFU G;  4L16 A;  1R2Y A;  1Z5B A;  4WUR A;  3T1H M;  3U61 A;  2H1R A;  1NNJ A;  3H4M A;  2AZQ A;  1TH2 A;  3MI5 A;  1GLN A;  4WW0 A;  3VK7 A;  3GQ4 A;  3PCC A;  4WHO B;  1HNZ M;  3MK6 A;  1HT2 E;  4Z6Y A;  4B7F A;  4G4O A;  1Z6T A;  3IG8 A;  4GH9 A;  1C1K A;  1XC8 A;  2CV0 A;  4JI1 M;  4WHQ B;  1YUB A;  3AOG A;  3HWS A;  1YKM A;  1E9R A;  4AW4 A;  4GC5 A;  1XXH A;  4FWD A;  3RGS A;  2AHM A;  5ITU A;  1ZAE A;  3KS8 A;  2DVW B;  5EXT A;  3MFL M;  3O6J A;  4JV5 M;  3GRY A;  3U6D A;  4DV0 M;  2V1C A;  2DXI A;  1G8P A;  1QAM A;  3T63 A;  2R46 A;  3EIE A;  1OFH A;  2V6Z M;  5A2Q S;  3PCJ M;  3THG A;  1D2N A;  3A45 A;  3J7B A;  2FE8 A;  1TDH A;  2QZ4 A;  4FCW A;  4LY6 A;  1EOA A;  4WHR A;  2M5Z A;  5ITX A;  1I94 M;  1YKN B;  5IWA M;  2OPF A;  4Z8X A;  5ITT A;  2BUY B;  4TUW A;  3MV6 A;  3KOZ E;  3HU2 A;  2UXB M;  1L2B A;  2BUT B;  1TH3 A;  1HQY E;  2L7I A;  2XLJ A;  1HR0 M;  1EO2 B;  1WXQ A;  3R9X B;  3TE6 A;  4DUZ M;  3MI5 M;  3NBI A;  3E9S A;  3LMX A;  3VLF B;  3GRV A;  1JR3 D;  4KLN A;  4JI5 M;  1N33 M;  1YKL A;  2C5R A;  3TL4 X;  2BNK A;  2DWN A;  3KSJ A;  2BUU A;  2UXC M;  4M0W A;  2FOI C;  2F5O A;  3GLI A;  1GL7 A;  3VFD A;  1ORY B;  2HKJ A;  4DR1 M;  2BUW A;  3SAV A;  2CE7 A;  3U60 B;  3OTO M;  3LKT A;  1IN8 A;  1J7K A;  3A46 A;  4LJ8 A;  3PCG M;  4A3V B;  1EE8 A;  2F5S A;  3MFL A;  4AKI A;  4I8O A;  2KA6 B;  3KP0 E;  4HL4 A;  4G4N A;  1QAO A;  4B08 A;  3PCA A;  3L29 A;  4LFC M;  3RE8 A;  1IM2 A;  3VKH A;  1Z5A A;  4AKH A;  5EJC A;  1SXJ E;  4OU7 A;  4GIT A;  4LGM A;  5KPT A;  3TWM A;  2BUV B;  5KQD A;  1L8Q A;  3PCF M;  2C98 A;  2QP9 X;  4NL4 H;  2I7N A;  1SXJ C;  2P5T A;  3U6O A;  2KRU A;  3PCL M;  4DV2 M;  2UUC M;  3J2P B;  3L27 A;  4IBI A;  3VKG A;  3K92 A;  2X8A A;  2R4J A;  4LZZ A;  1NY6 A;  3SAU A;  4BLC A;  4JN6 A;  4JI3 M;  4JI4 M;  1XMO M;  3J81 S;  4GIP A;  2CHV A;  3MV4 A;  3KP1 E;  3RGP A;  1SXJ A;  2BV0 B;  2F4V M;  5TD3 A;  3VDP A;  1NHW C;  4R3D A;  3L25 A;  4LZJ A;  3FUV A;  3PVS A;  5E6J A;  1DMH A;  2BUW B;  1XWI A;  4WHP B;  2D7E A;  5ITR A;  1HT1 E;  1YKP B;  1L2C A;  3PCC M;  4DV4 M;  1UM8 A;  4RNA A;  3U6M A;  2Y20 A;  3PCB M;  5ITQ A;  4ITQ A;  4WHS D;  2XZF A;  1YKL B;  5DNY A;  4M9S A;  3HHX A;  2XH9 A;  4XBO A;  4X64 M;  4DV1 M;  3AL0 C;  1Q39 A;  2G8L A;  1FJG M;  3GLI B;  2ZAO A;  2XGN A;  2BUX A;  1YKO B;  2BOY A;  1NHG C;  5IZ7 D;  5EXP A;  1K3W A;  2Y0Q A;  3FUU A;  4LJ9 A;  4IBB A;  3TWK A;  3MI1 A;  4GRI A;  2BUR A;  3PCM M;  1GKI A;  2HCB A;  3QAU A;  4M9X A;  3PCM A;  1S3S A;  4G4Q A;  1ZQ9 A;  2HHH M;  5E26 A;  4IBJ A;  2E5L M;  1MU5 A;  3SHF A;  4P16 A;  3VK8 A;  3PCI M;  3SAW A;  1KSF X;  4DUY M;  3J27 B;  3FTD A;  1SXJ B;  5LMN M;  1H6U A;  5FTJ A;  1MX0 A;  3N9T A;  4JI8 M;  2W82 A;  3U6C A;  1XHB A;  4YY3 M;  3VDU A;  4GC9 A;  4PDI A;  3U5Z B;  2RGH A;  1GVN A;  1EO9 B;  2R65 A;  4LJ7 A;  1N78 A;  2JA2 A;  3HGI A;  1YKK A;  1IY0 A;  3WHK A;  4ILV A;  2EA0 A;  3FUW A;  4B3S M;  1W5S A;  3PCJ A;  5IT9 S;  5EP3 A;  3MV4 M;  4B3M M;  3ZH9 B;  4GMQ A;  1N34 M;  2Z3X A;  3PCE M;  2O5R A;  2L09 A;  2ZAM A;  4PCZ A;  3LXV M;  1QQW A;  4NXN M;  3U6Q A;  2DZN B;  2BUR B;  2R4E A;  4GKK M;  4MGH A;  4L78 A;  3UGJ A;  4FD2 A;  2DWZ B;  3K8Z A;  2BJW A;  4CHT B;  4IJE A;  3GQ3 A;  4FWG A;  4NRW A;  4B3T M;  1N75 A;  4JYA M;  3SC3 A;  3O32 A;  1G3I A;  5EXS A;  1YKM B;  5BR8 M;  4I4L A;  3UMM A;  4MB7 A;  4NSR A;  1W5T A;  1YKO A;  3D8L A;  3O5U A;  3PCL A;  4FW9 A;  1JR3 A;  1QVR A;  3FUX A;  3PFI A;  2VII A;  4DR2 M;  1NJF A;  1K82 A;  3HU1 A;  2G5G X;  1QAN A;  1IN5 A;  4M9Z A;  2YR0 A;  4CGY B;  1SXJ D;  2R62 A;  1E94 E;  2BUY A;  2DWL A;  1XXH B;  4M0D A;  4I81 A;  4QOZ C;  3AFH A;  4LJA A;  1TH4 A;  5GKN A;  5LMU M;  4QHS A;  3KW6 A;  3B9P A;  4DV3 M;  3U5Z A;  3GPX A;  3DA1 A;  4WHR F;  5KQ8 A;  5DYI A;  2EUC A;  4AKG A;  1G59 A;  3MV6 M;  1N36 M;  3MJ5 A;  5EP1 A;  3RFW A;  4IBG A;  2L7H A;  2UUB M;  1Z59 A;  3KVW A;  8CAT A;  2KXE A;  1QZM A;  4QNM A;  1EO2 A;  4WHO D;  4LJ6 A;  1NJG A;  3SHG B;  3ZCB B;  4ZPX A;  3GLF A;  3FYD A;  3PNY A;  4II7 A;  4LF7 M;  3I51 A;  1PJI A;  4K0K M;  4GHA A;  4IBF A;  1DO2 A;  1YKP A;  2C9C A;  3FKE A;  3O6R A;  4D81 A;  2KW0 A;  1VDD A;  2BUM A;  4WHP D;  1JQJ C;  1E32 A;  3KS4 A;  3MHV C;  4MGK E;  3HU3 A;  4BB9 A;  2D7G A;  3PCD A;  2C9O A;  3LVV A;  3W0L B;  2LH0 A;  3KOX E;  4LF4 M;  2Y0T A;  1DLM A;  4CIS A;  4LFB M;  3GQ5 A;  2XEP A;  3A98 B;  1DGH B;  5FTK A;  4HLQ A;  1IBL M;  4WHO A;  2BJV A;  4RF1 A;  2F5P A;  3PCN M;  4PT5 A;  4WHR B;  4KO8 A;  3J80 S;  4AZF A;  3T67 A;  3KXE C;  3HKP A;  3T63 M;  4IBD A;  2CV2 A;  4AG5 A;  3AV0 A;  3GO8 A;  3IG5 A;  5C18 A;  3GPU A;  3TQS A;  1R2Z A;  4DR7 M;  1TMX A;  4MGY E;  1YKN A;  3HJ8 A;  2LNH C;  3DFZ A;  2UU9 M;  4PD2 A;  4FCT A;  4JI0 M;  4KHP M;  2LXE A;  3I4Y A;  3HHZ A;  3GLH A;  3LMM A;  3T1Y M;  4ILT A;  4R7G A;  7CAT A;  3PCF A;  3CF6 E;  3U6L A;  2XSZ D;  3PCH A;  4MH0 E;  3PCE A;  2NQ8 C;  1HNX M;  1K3X A;  2BUQ A;  3U6E A;  1Q3C A;  3J7A S;  3L2A A;  2DHR A;  4OW0 A;  1NNU C;  2RGO A;  2YFQ A;  4X62 M;  2QBY B;  1EOA B;  4QOS A;  4EIW A;  3DOA A;  2R45 A;  2M60 A;  2BUU B;  3HHW A;  3GLG A;  1IN7 A;  4GKJ M;  4JXJ A;  1J09 A;  1DLQ A;  3CTW B;  1DGB A;  1XMQ M;  4W5W A;  4MGZ E;  1I4W A;  5BPV A;  1EOB B;  1IY1 A;  4REZ A;  1EOC A;  2DWM A;  2CFO A;  4WHS B;  3SMS A;  4D80 A;  3GPY A;  3CF0 A;  4OVZ A;  4DV6 M;  3SAT A;  5EQT A;  2Z4S A;  3T67 M;  3T38 A;  3PCG A;  3T15 A;  3M7G A;  3I4V A;  3MI1 M;  1G41 A;  3TWL A;  4G6Z A;  3U60 A;  2UXD M;  2YNM D;  1X37 A;  3ZC7 B;  2VQF M;  1L2D A;  1DO0 A;  2Q2E B;  3KOY E;  3GLH B;  1IQP A;  1LV7 A;  3JR5 A;  1L1Z A;  2Y21 A;  4LF8 M;  2QPA A;  3KSX A;  3KDS E;  4LF6 M;  3LVW A;  3SAR A;  1HNW M;  3E4R A;  1IN6 A;  3HJQ A;  1IBK M;  4PDG A;  4DR6 M;  1IN4 A;  2CV1 A;  4LRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...