3I4VA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
total genus 69
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3i4vA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3i4vA02
2XSUA 3PCIM 3MFLM 3PCDM 3PCNA 3HJSA 1YKOA 1DMHA 3LMXM 2BUTB 2BUUB 1EOBA 2BUZB 5TD3A 3PCCM 3PCKA 3HGIA 4WHPA 1YKOB 2BUMB 4WHPD 3MV4M 1EO2B 3MI5M 3PCHM 4WHQB 2PCDA 2BUXA 3PCMA 2BUVA 1EOAA 2BURA 3HJ8A 3PCBA 3PCAA 3MV6M 1YKLB 2BV0A 2BUQB 3O32A 1EO9B 3O6JA 3PCLA 3PCEA 2BUWB 3LXVM 1DLMA 1YKNA 3MI1M 3T67M 3I51A 1YKKA 1DLTA 3PCIA 2BV0B 3MFLA 3PCDA 3PCGM 2BOYA 1EOBB 3PCFM 3LMXA 4WHOA 4WHPB 4WHOD 4WHSA 3T63M 3PCCA 4WHSD 1TMXA 2BUYA 3N9TA 1YKMA 3LKTM 3MV4A 2XSVA 3PCJM 2BUXB 2BUVB 4ILTA 3TH1A 1EOAB 3O6RA 3PCNM 2BURB 3PCHA 3HHXA 4WHRF 4WHRA 1DLQA 3O5UA 2BUTA 2BUUA 3PCKM 3MV6A 1YKPA 2BUZA 2AZQA 1YKNB 4WHRB 3HJQA 2BUMA 1YKKB 3LXVA 2PCDM 3PCMM 1EO2A 3MI1A 2XSRA 1S9AA 3T67A 1YKPB 4ILVA 4WHQA 4WHOB 3PCBM 3MI5A 3PCAM 3PCGA 1EOCA 3I4YA 3PCFA 4WHSB 3HHYA 3I4VA 2BUYB 1YKLA 3HKPA 1YKMB 3PCLM 3PCEM 3T63A 2BUQA 1EO9A 1EOCB 3LKTA 2BUWA 3PCJA
chains in the Genus database with same CATH superfamily
2R65A 1K3WA 3PCIM 1IXSA 1MU5A 3TE6A 3PCNA 4JXJA 4JI3M 3GP1A 1JB0F 1XMOM 3M6AA 1MX0A 3GLFE 1GKIA 5DFLA 1Z5CA 3PVSA 1PJTA 2JWSA 3KOYE 3RGSA 2K47A 5IWAM 2FE8A 4IIWA 4II7A 3UJNA 4FVMA 4KT0F 1XNRM 2WSFF 1L2CA 4L15A 3FRHA 1YKOB 8CATA 1NY6A 2WSEF 4WHPD 4G4NA 3PXGA 5LMUM 3GPXA 1NJFA 2BJWA 2KHHA 1XXHA 2QNJA 1SXJB 2LNHC 5EP2A 3PCMA 4XK8F 1TDZA 1QANA 3FYCA 1TTEA 4NC6A 5KPRA 1KFVA 1G59A 3KP0E 3C58A 2QBYA 4DV4M 4AKGA 4UN2B 4DR1M 1OIPA 3KS4A 2BWBA 4NL4H 4LJ7A 4LJ6A 1OAOC 3U60B 2BV0A 1DO0A 1I94M 2OQ4A 4IBJA 3T1HM 3FKEA 4F1IA 3CTWB 1VQ1A 4M0DA 1DO2A 2KNZA 3U6PA 4DR6M 1DLMA 5JI3E 2MR9A 3MI1M 4P17A 3W68A 3I01M 2QSFX 1YE9A 1HQCA 4MGKE 5E26A 3K9OA 4YY3M 4DV2M 4JI2M 5IT9S 3PCDA 1OIZA 4LZJA 2O25A 2BOYA 4NXNM 4CJ6A 2F5QA 5IZ7D 3PCFM 3HHZA 1HNZM 1T6OA 4MGZE 4LF4M 4AZFA 3GRYA 4WHPB 4WHOD 2DXIA 3SHGB 2G8LA 1PGYA 2LVOC 3T63M 3PCCA 4WHSD 2QP9X 3FTCA 2YNMD 1SXJC 1X37A 2BNKA 1IXRC 1LV7A 4IBKA 2MGWA 2E5LM 2R6FA 4LF7M 3FUVA 3MV4A 2BUXB 2LBCA 3PCJM 1RU3A 2R45A 1AUAA 1NV9A 2M60A 2DZLA 2FS1A 1N78A 3O6RA 3PCNM 3GLGA 2YQZA 1IBLM 1PJSA 2Y21A 3U5ZA 1NSFA 2D7GA 2K6BA 4ANRA 1W5TA 1K3XA 3WHLA 1L1ZA 4TUWA 4BLCA 4GC9A 2Y0TA 3IECA 1QQWA 2CHQA 3KXEC 1YKPA 2LVQD 2CP8A 3UK6A 5FTNA 3M7GA 1JR3A 2F5OA 2CEAA 2F5PA 2XGNA 3FD9A 3HZJA 4GHAA 1TH3A 1YKKB 2HAKA 2L7IA 4MGYE 3ZQJA 3KDSE 4OW0A 1PRBA 3FUTA 4DV7M 1GO5A 3PCMM 5EXPA 2A5YB 4I8OA 4FWGA 1SXJA 1N34M 3SYLA 4WHOB 2J7OA 2KNVA 2L7HA 1N75A 2QZ4A 3SMSA 4KHPM 4JI4M 1EOCA 4WHSB 2QPAA 4LGMA 3KS8A 1J09A 3B74A 2BUYB 3SAVA 2LWXA 3GQ4A 2JXNA 3HWSA 2HKJA 3CGWA 4KO8A 5FTKA 3GPYA 1NO1A 3U60A 1G3IA 1XC8A 3HY5A 5DYIA 1A5TA 1GLNA 4IBBA 3T38A 2XEPA 4CHTB 2K9DA 2X8AA 4PDIA 3U6QA 3GLFB 3LKTA 2R62A 4IJFA 2XSUA 4L78A 3HX3A 3VKGA 2BJVA 4GKJM 3PCDM 2EA0A 1Z5BA 4AG6A 4DR2M 3FTEA 3TQSA 5EP1A 1L8QA 3RE8A 4JI1M 3E4RA 1T43A 2BUTB 4QHSA 2G5GX 3QAUA 4Y28F 2DWLA 1DGHB 4G4OA 1G71A 1NNUC 2BUZB 3DFZA 3EIHA 2R4JA 1IN8A 2B3TA 2ZBKB 4MH0E 1Z59A 3R9XB 4JI0M 2L09A 3PCCM 4WHPA 1Q39A 3TL4X 3HU2A 4Q7JA 4NRVA 2VQEM 4B7HA 2DHYA 2RGHA 4ZPXA 4D80A 1C7YA 3MV4M 2EKFA 3ZC7B 2XLJA 1PJIA 1IN7A 3J7AS 4FWHA 4BB9A 4LRSA 1I4WA 2ZM6M 2BUXA 1Z6TA 2O01F 2XSZD 1WGLA 1NV8A 1YLAA 2EO2A 4LJAA 3D8LA 3CF2A 1R4GA 4AKHA 2KDLA 1OJLA 1XHBA 2JP7A 4LF5M 4G4QA 3H4MA 2KEBA 1TGUA 4IBIA 2RGOA 2F4VM 3KOXE 2BUQB 2ZTDA 3O32A 2C9OA 4QNMA 2CFOA 3GQ5A 2BUWB 2QQ8A 3H4JA 4XBOA 1VG5A 3FUWA 4DUZM 1NVMA 4DR5M 4NSRA 3FTFA 3I51A 3DA1A 3KP1E 4W5WA 1QUTA 1QAMA 1UM8A 4OVZB 4PCZA 1P3QQ 2R44A 5ITXA 2UUAM 1DLTA 3I04M 2G3QA 3FUXA 2ZAOA 3SMPA 3MFLA 4LZZA 2CHVA 1PM5A 4DUYM 1EOBB 2ZTCA 1NJGA 2MROB 3Q8GA 4L6V6 4LFAM 3VDUA 3J2PB 4G6ZA 4DR4M 4JV5M 4WHOA 3TPZA 4I5SA 1IM2A 1L2DA 4WHSA 2X4AA 4JYAM 2M5ZA 2JA2A 1XB2B 7CATA 4KODA 1ZMWA 2MJ5B 3BOSA 1OTRA 1UFZA 2OPFA 1TMXA 2BUYA 4AQYM 1QZEA 1TDHA 3LKTM 2BUVB 1IY1A 3C3DA 2JY7A 1EOAB 3SATA 3GLIA 4P16A 1QAOA 3K92A 4M9SA 3AV0A 3L29A 3FRIA 3F92A 3GLHE 4S12A 3UGJA 4X66M 2Q2EB 1IBKM 3GQ3A 4WHRF 5EP3A 3TWKA 4WHRA 1IN4A 1L2BA 1QUSA 3JR4A 3V76A 4K0KM 3IG5A 3K8ZA 2BUTA 3OTOM 4DBGB 2YR0A 1PJQA 5BR8M 3MV6A 2UXBM 2ZAMA 2BUZA 1ZMUA 1Y8GA 3PNVA 3VLFB 2QHOB 2BWEA 4D82A 3R8FA 4NRWA 2AZQA 2CV2A 4WP2A 3GPUA 5ITQA 4FD2A 4YHHM 4CIZA 2L4FA 1SG9A 3HU1A 3NWLA 3QYBA 4LFBM 1WIVA 4XGIA 4LF8M 1Q02A 5LMNM 3B7NA 2UU9M 2Z4RA 3GRVA 3GO8A 4CISA 4GHLA 2JZ0A 4AKIA 2XSRA 2OO9A 3T67A 1LTMA 4JN6A 4GRIA 1K82A 1DV0A 3A42A 4DV5M 3PCGA 4DV3M 4R3DA 2V6ZM 4FCVA 1N32M 1MN3A 3FYDA 3J80S 3UMMA 3K2LA 1G4AE 2DAMA 4RF0A 3U6DA 4B7GA 4PT5A 2F5SA 1QYRA 2HWJA 3ZH9B 1YKMB 3GRRA 3L27A 3KVWA 1DGGA 1R5LA 3J7BA 4DV6M 1EIJA 2BUQA 2GNOA 2DWMA 1TH2A 3C9PA 3T15A 1J5EM 1D2NA 1T3TA 2R46A 4B3RM 2BUWA 2HHHM 3MFLM 1BVSA 2LVPC 3HJSA 1L1TA 1YKOA 4LCBA 1PJJA 4OVZA 3QWLA 3LQRA 5C18A 3SC3A 2BUUB 1GVNA 2O5RA 4D81A 2N35A 4L4UA 4OX9M 1EOBA 4AW4A 1IN5A 2JUJA 3IG8A 4REZA 4R7GA 5KPTA 3SAWA 1R2YA 5TD3A 3L26A 3SAUA 2C96A 2LTUA 3HGIA 2WZJA 4R71A 2DNAA 5BPVA 2Z4SA 2Z3XA 1EO2B 2JY6B 3M0EA 2DWNA 2K0BX 3MI5M 1OKSA 3AJIB 2KNAA 1H6UA 4G4RA 1D0LA 1G8PA 3LQQA 4WHQB 2DAEA 1VDDA 2AHMA 4IBCA 3VK7A 2ZANA 3LVVA 2BUVA 3THGA 2PCDA 1EOAA 5F3WA 5DNYA 3HJ8A 1EFUB 2VQFM 5FLXS 2I7PA 5ITYA 3PCBA 2R4EA 1D0KA 4WW0A 3PCAA 4HL4A 3BBZA 1YKLB 3MV6M 4FCTA 2OOAA 3A45A 3A46A 1XNQM 4GIPA 3TWLA 1Z5AA 1HNXM 2JNHA 3GPPA 3B9PA 3O6JA 4QHTA 4NOOB 3PCLA 1IQPA 1D0MA 3EIEA 4IBEA 1DGBA 1E32A 1NHWC 1QAQA 4DR7M 5GKNA 3MHVC 3D8BA 2JY5A 4MM3B 3U6LA 4AG5A 1GABA 3T67M 3KW6A 3MJ5A 1YUBA 3KSXA 2DZNB 3FUUA 2BV0B 1YKKA 1AIPC 4PDGA 3ZCBB 4M9XA 4JI8M 3PCGM 3W67A 5FSWA 2UXCM 3LMXA 3DZDA 3LMMA 2V1CA 3T6PA 4MGIE 2YFQA 3JR5A 2JZ1A 1IN6A 3MK6A 3VK8A 4LF9M 2L2DA 2VF8A 1E94E 1N33M 3WHKA 1OFIA 3DOAA 5EXTA 2CV1A 1HT1E 3AFHA 2OOBA 1YKMA 3MMPA 3GRUA 3GLHB 3UZUA 2MH8A 4LG2A 2XSVA 5ITXE 3TH1A 2DZOB 3KFUG 2BURB 4GMQA 4HLQA 2L6OA 3SBJA 1HR0M 1XXHE 4GEWA 4DR3M 3PCHA 4LJ4A 3T1YM 2WSCF 2FH0A 1HJPA 1DLQA 1QDRA 3J81S 1OFHA 2XFTA 5C1BA 2BUUA 4G3OA 2KA6B 4WURA 1WHCA 3B89A 5KPZA 1HQYE 2DWZB 3LW5F 3U61B 1GL6A 2F5NA 3FTDA 2C99A 3SARA 3SASA 2VF7A 3U6EA 3E9SA 1YKNB 1DGFA 2LVNC 3GLIE 2DHRA 4LRTA 2DAIA 2DKLA 3E21A 1WJ7A 2PCDM 2DENA 4OU7A 2KXEA 1EO2A 3LXVA 2EUCA 1IY0A 1S9AA 1YKPB 4I81A 3W0LB 4B3SM 4WHQA 2RKOA 3PCBM 4DV0M 4JI5M 3MI5A 3PCAM 1E9RA 1JQJC 1Q3CA 3VKHA 2FNAA 2HL7A 5EJCA 5FTLA 3GLFA 1V92A 4NXMM 3B7QA 1W5SA 1G41A 1S3SA 3KSJA 3NBXX 2ERCA 5EP4A 1YKLA 1J7KA 3B7ZA 3HKPA 4X65M 3PCLM 1XMQM 4X64M 1VEKA 3FE3A 1DGHA 1TF0B 3VFDA 1EOCB 1ZMVA 3L2AA 3A98B 3AOEC 3Q8XA 4F2LA 1FJGM 1ZAEA 4B7FA 2UUCM 4Z8XA 4IJEA 2W82A 3AKZA 3GLGE 1DMHA 5EXXA 3LMXM 5ITTA 4IBFA 1VEJA 4GKKM 1OAIA 1QZMA 2P5TA 1NNJA 1CUKA 1ORYB 2QENA 3CF0A 3HU3A 3U6SA 4RNAA 3RFWA 4PD2A 2EJSA 3PCKA 2BUMB 4L8RC 1GL7A 5A2QS 3VDPA 4CGYB 1JR3E 2R0IA 3W0FA 1NHGC 1KSFX 2HCBA 3PCHM 4GC5A 3GLHA 1HT2E 5JI2E 2C5RA 5ITUA 2DAKA 4ITQA 4MGHA 3SYKA 2CE7A 2EKKA 1XWIA 2BURA 1SXJE 1TR8A 1VDLA 2KRKA 3AOEA 3LCUA 1E9SA 4RKUF 2FFJA 1R7RA 4QOZC 2DI0A 3RGPA 3LVWA 1HNWM 3E46A 2C98A 4X62M 2JY8A 4LY6A 1KYIA 1EO9B 3NBIA 3U61A 4A3VB 5IREB 5FTMA 4DV1M 3PCEA 3LXVM 3BXWA 1IXSB 1NY5A 1YKNA 1IBMM 1ZQ9A 4NSOB 2XFSA 1QDTA 4MB7A 2H5XA 1OQYA 3PCIA 3PFIA 4I4LA 4LF6M 1C1KA 3QYEA 3JAMS 4B08A 1F4IA 1MJGM 2CUZA 4LJ5A 5KQDA 1WXQA 4LJ9A 3HHWA 2XSZA 2R18A 2CV0A 3K1JA 4BBAA 1N36M 5FTJA 1IY2A 3U6MA 1R6BX 2KW0A 3K9PA 3J27B 4L16A 2DAGA 3N9TA 2XH9A 2Y0QA 4QNRA 4KLNA 2LH0A 1XXHB 4QOSA 1VEGA 1QVRA 2RRUA 1V34A 4FCWA 4ILTA 2CHGA 2LVAA 3KOWE 2QBYB 2D7EA 2X49A 3SFZA 2J5YA 5H37D 3U6CA 3HHXA 4Z6YA 3ILKA 4M0WA 2GQFA 4IBDA 3L25A 2KZUA 3IHPA 5KQ8A 5KO3A 4JI6M 3O5UA 2UUBM 1Q3BA 3C3EA 4JI7M 4LJ8A 5E6JA 2CRUA 2H1RA 3PCKM 3GLIB 1EE8A 4FW9A 2QCUA 2LXEA 1R2ZA 1YSYA 1GJTA 2UXDM 4EIWA 3TWMA 4GITA 4WHRB 5EQTA 3HJQA 2BUMA 1IFYA 2J7NA 1JR3D 4RF1A 2V1UA 2C9CA 2Z7JA 4FWDA 3MI1A 4LFCM 2VDBB 5EXSA 2LHCA 4AI6A 4LGYA 2L4EA 2LHGA 4B3MM 3PNYA 2XZFA 4ILVA 2FOIC 3U6OA 2Z8YM 4IBGA 2XF3A 1SXJD 2APLA 3CF6E 1GJSA 2DVWB 3I4YA 3PCFA 1V33A 1ZV1A 2I7NA 2CWBA 2D7HA 2KRUA 2Y20A 1FNNA 3HHYA 3AL0C 3AOGA 1N77A 4GH9A 3SHFA 4HEOA 3I4VA 1TH4A 2XZUA 4M9ZA 5L8RF 1IXZA 5DYGA 5ITRA 3LCVB 4B3TM 3KOZE 3PCEM 2NQ8C 3T63A 1WR1B 1WGNA 2VIIA 3L28A 1EO9A 3GLGB 3U5ZB 3PCJA 2KZSA
chains in the Genus database with same CATH topology
2R65A 3PCIM 1MU5A 3TE6A 3PCNA 4JXJA 4JI3M 3GP1A 1XMOM 3M6AA 1MX0A 1GKIA 1Z5CA 3PVSA 3KOYE 3RGSA 2K47A 5IWAM 2FE8A 4IIWA 4II7A 3UJNA 4FVMA 1XNRM 1L2CA 4L15A 1YKOB 8CATA 1NY6A 4WHPD 4G4NA 3PXGA 5LMUM 3GPXA 1NJFA 2BJWA 1XXHA 1SXJB 2LNHC 5EP2A 3PCMA 1TDZA 1QANA 3FYCA 1G59A 2QBYA 5KPRA 1KFVA 3KP0E 3C58A 4DV4M 4AKGA 4DR1M 3KS4A 4NL4H 4LJ7A 4LJ6A 3U60B 2BV0A 1DO0A 1I94M 2OQ4A 4IBJA 3T1HM 3FKEA 3CTWB 4M0DA 1DO2A 3U6PA 4DR6M 1DLMA 5JI3E 3MI1M 1YE9A 1HQCA 4MGKE 5E26A 4YY3M 5IT9S 4JI2M 3PCDA 4LZJA 2BOYA 4NXNM 2F5QA 5IZ7D 3PCFM 3HHZA 1HNZM 4MGZE 4LF4M 4AZFA 3GRYA 4WHPB 4WHOD 2DXIA 3SHGB 2G8LA 3T63M 3PCCA 4WHSD 2QP9X 3FTCA 2YNMD 1SXJC 1X37A 2BNKA 1IXRC 1LV7A 4IBKA 2E5LM 4LF7M 3MV4A 3FUVA 3PCJM 2BUXB 2R45A 1N78A 2M60A 3O6RA 3PCNM 3GLGA 2YQZA 1IBLM 3U5ZA 2Y21A 1NSFA 2D7GA 1W5TA 1K3XA 3WHLA 1L1ZA 4TUWA 4BLCA 4GC9A 2Y0TA 1QQWA 2CHQA 3KXEC 1YKPA 3UK6A 5FTNA 3M7GA 1JR3A 2F5OA 2CEAA 2F5PA 2XGNA 3FD9A 4GHAA 1TH3A 1YKKB 2L7IA 4MGYE 3KDSE 4OW0A 3PCMM 3FUTA 4DV7M 5EXPA 2A5YB 4I8OA 4FWGA 1SXJA 1N34M 3SYLA 4WHOB 2J7OA 2L7HA 1EOCA 1N75A 2QZ4A 3SMSA 4KHPM 4JI4M 4WHSB 2QPAA 4LGMA 3KS8A 1J09A 2BUYB 3SAVA 2LWXA 3GQ4A 3HWSA 4KO8A 2HKJA 3GPYA 1XC8A 5FTKA 3U60A 1G3IA 5DYIA 1GLNA 4IBBA 3T38A 4PDIA 2XEPA 4CHTB 3U6QA 2X8AA 1K3WA 3GLFB 3LKTA 2R62A 4IJFA 2XSUA 4L78A 3VKGA 2BJVA 4GKJM 3PCDM 2EA0A 1Z5BA 4AG6A 4DR2M 3FTEA 3TQSA 5EP1A 1L8QA 3RE8A 4JI1M 3E4RA 2BUTB 4QHSA 2G5GX 3QAUA 2DWLA 1DGHB 4G4OA 1NNUC 2BUZB 3DFZA 3EIHA 2R4JA 1IN8A 2ZBKB 4MH0E 3R9XB 1Z59A 3PCCM 4JI0M 2L09A 4WHPA 1Q39A 3TL4X 3HU2A 4NRVA 2VQEM 4B7HA 2RGHA 4ZPXA 4D80A 3MV4M 3ZC7B 2XLJA 1PJIA 1IN7A 3J7AS 4FWHA 4BB9A 4LRSA 1I4WA 2ZM6M 2BUXA 1Z6TA 2XSZD 2EO2A 4LJAA 3D8LA 3CF2A 4AKHA 1OJLA 1XHBA 4LF5M 4G4QA 3H4MA 2KEBA 1TGUA 4IBIA 2RGOA 2F4VM 3KOXE 2BUQB 3O32A 2C9OA 4QNMA 2CFOA 3GQ5A 2BUWB 4XBOA 3FUWA 4DUZM 1NVMA 4DR5M 4NSRA 3FTFA 3I51A 3DA1A 3KP1E 4W5WA 4OVZB 1QAMA 1UM8A 4PCZA 4DV2M 2UUAM 1DLTA 5ITXA 3SMPA 3FUXA 2ZAOA 3MFLA 4LZZA 2CHVA 1PM5A 4DUYM 1EOBB 1NJGA 4JV5M 4LFAM 3VDUA 4DR4M 3J2PB 4G6ZA 4WHOA 3TPZA 4I5SA 1IM2A 1L2DA 4WHSA 2X4AA 4JYAM 2JA2A 2M5ZA 7CATA 4KODA 3BOSA 2OPFA 1TMXA 2BUYA 4AQYM 1TDHA 3LKTM 2BUVB 1IY1A 1EOAB 3SATA 3GLIA 4P16A 1QAOA 3K92A 4M9SA 3AV0A 3L29A 4S12A 3UGJA 4WHRF 4X66M 2Q2EB 1IBKM 3GQ3A 5EP3A 3TWKA 4WHRA 1IN4A 1L2BA 3JR4A 4K0KM 3IG5A 3K8ZA 2BUTA 3OTOM 2YR0A 5BR8M 3MV6A 2UXBM 2ZAMA 2BUZA 3R8FA 3VLFB 3PNVA 4NRWA 4D82A 2AZQA 2CV2A 3GPUA 5ITQA 4FD2A 4YHHM 3HU1A 3NWLA 4LFBM 4XGIA 4LF8M 5LMNM 2UU9M 2Z4RA 3GRVA 3GO8A 4CISA 4GHLA 4AKIA 2XSRA 3T67A 4JN6A 4GRIA 1K82A 3A42A 4DV5M 3PCGA 4DV3M 4R3DA 2V6ZM 4FCVA 1N32M 3FYDA 3J80S 3UMMA 3K2LA 1G4AE 4RF0A 3U6DA 4B7GA 4PT5A 2F5SA 1QYRA 3ZH9B 1YKMB 3GRRA 3L27A 3KVWA 1DGGA 3J7BA 4DV6M 2BUQA 2DWMA 1TH2A 3T15A 1J5EM 1D2NA 1T3TA 2R46A 4B3RM 2BUWA 2HHHM 3MFLM 3HJSA 1YKOA 1L1TA 4LCBA 1PJJA 4OVZA 3QWLA 3LQRA 5C18A 3SC3A 2BUUB 1GVNA 2O5RA 4D81A 4L4UA 4OX9M 1EOBA 4AW4A 1IN5A 3IG8A 4REZA 4R7GA 5KPTA 3SAWA 1R2YA 5TD3A 3L26A 3SAUA 2C96A 3HGIA 5BPVA 2Z4SA 2Z3XA 1EO2B 3M0EA 2DWNA 3MI5M 3AJIB 1H6UA 4G4RA 1G8PA 3LQQA 4WHQB 2PCDA 1VDDA 2AHMA 4IBCA 3VK7A 2ZANA 3LVVA 2BUVA 3THGA 1EOAA 5F3WA 5DNYA 3HJ8A 2VQFM 5FLXS 2I7PA 5ITYA 3PCBA 2R4EA 4WW0A 3PCAA 4HL4A 3MV6M 1YKLB 4FCTA 3A45A 3A46A 1XNQM 4GIPA 3TWLA 1Z5AA 1HNXM 3GPPA 3B9PA 3O6JA 4QHTA 4NOOB 3PCLA 1IQPA 3EIEA 4IBEA 1DGBA 1E32A 1NHWC 1QAQA 4DR7M 5GKNA 3MHVC 3D8BA 4MM3B 3U6LA 4AG5A 3T67M 3KW6A 3MJ5A 1YUBA 3KSXA 2DZNB 3FUUA 2BV0B 1YKKA 4PDGA 3ZCBB 4M9XA 4JI8M 3PCGM 5FSWA 2UXCM 3LMXA 3DZDA 3LMMA 2V1CA 4MGIE 2YFQA 3JR5A 1IN6A 3MK6A 3VK8A 4LF9M 1N33M 1E94E 3WHKA 1OFIA 3DOAA 5EXTA 2CV1A 1HT1E 3AFHA 1YKMA 3GRUA 3GLHB 3UZUA 4LG2A 2XSVA 5ITXE 3TH1A 2DZOB 3KFUG 2BURB 4GMQA 4HLQA 2L6OA 3SBJA 1HR0M 3PCHA 4DR3M 4LJ4A 3T1YM 1DLQA 3J81S 1OFHA 2XFTA 5C1BA 2BUUA 2KA6B 4WURA 5KPZA 1HQYE 2DWZB 3U61B 1GL6A 2F5NA 3FTDA 2C99A 3SARA 3SASA 3U6EA 1YKNB 3E9SA 1DGFA 2DHRA 4LRTA 3LXVA 2PCDM 4OU7A 2KXEA 1EO2A 2EUCA 1IY0A 1S9AA 1YKPB 4I81A 3W0LB 4B3SM 4WHQA 2RKOA 3PCBM 4DV0M 4JI5M 3MI5A 3PCAM 1E9RA 1JQJC 1Q3CA 3VKHA 2FNAA 2HL7A 5EJCA 5FTLA 3GLFA 4NXMM 1W5SA 1G41A 1S3SA 3KSJA 2ERCA 5EP4A 1YKLA 1J7KA 3HKPA 4X65M 3PCLM 1XMQM 4X64M 1DGHA 3VFDA 1EOCB 3L2AA 3AOEC 3A98B 3Q8XA 1FJGM 1ZAEA 4B7FA 2UUCM 4Z8XA 4IJEA 2W82A 3AKZA 1DMHA 5EXXA 3LMXM 5ITTA 4IBFA 4GKKM 2P5TA 1QZMA 1NNJA 1ORYB 2QENA 3HU3A 3CF0A 3U6SA 4RNAA 3RFWA 4PD2A 3PCKA 2BUMB 4L8RC 1GL7A 5A2QS 3VDPA 4CGYB 3W0FA 1NHGC 1KSFX 2HCBA 3PCHM 4GC5A 3GLHA 1HT2E 5JI2E 2C5RA 5ITUA 4ITQA 4MGHA 3SYKA 2CE7A 2BURA 1XWIA 1SXJE 2KRKA 3AOEA 1E9SA 2FFJA 1R7RA 4QOZC 3RGPA 3LVWA 1HNWM 2C98A 4X62M 4LY6A 1KYIA 1EO9B 3NBIA 3U61A 4A3VB 5IREB 5FTMA 4DV1M 3PCEA 3LXVM 1IXSB 1NY5A 1YKNA 1IBMM 1ZQ9A 4NSOB 2XFSA 4MB7A 3PCIA 3PFIA 4I4LA 4LF6M 1C1KA 3JAMS 4B08A 4LJ5A 2CUZA 5KQDA 1WXQA 4LJ9A 3HHWA 2XSZA 2R18A 2CV0A 3K1JA 4BBAA 1N36M 5FTJA 1IY2A 3U6MA 1R6BX 2KW0A 4L16A 3J27B 3N9TA 2XH9A 2Y0QA 4QNRA 4KLNA 2LH0A 1XXHB 4QOSA 1QVRA 4FCWA 4ILTA 2CHGA 3KOWE 2QBYB 2D7EA 2X49A 3SFZA 5H37D 3U6CA 3HHXA 4Z6YA 3ILKA 4M0WA 4IBDA 3L25A 2KZUA 5KQ8A 4JI6M 5KO3A 3O5UA 2UUBM 1Q3BA 4JI7M 4LJ8A 5E6JA 2H1RA 3PCKM 3GLIB 1EE8A 4FW9A 2QCUA 2LXEA 1R2ZA 1YSYA 2UXDM 4EIWA 3TWMA 4GITA 4WHRB 5EQTA 3HJQA 2BUMA 2J7NA 1JR3D 4RF1A 2V1UA 2C9CA 2Z7JA 4FWDA 3MI1A 4LFCM 5EXSA 4AI6A 4LGYA 4B3MM 3PNYA 2XZFA 4ILVA 2FOIC 3U6OA 4IBGA 2XF3A 1SXJD 3CF6E 2DVWB 3I4YA 3PCFA 2I7NA 2D7HA 2KRUA 2Y20A 1FNNA 3HHYA 3AL0C 3AOGA 1N77A 4GH9A 3SHFA 3I4VA 1TH4A 2XZUA 4M9ZA 1IXZA 5DYGA 5ITRA 3PCEM 4B3TM 3KOZE 3T63A 2NQ8C 2VIIA 3L28A 1EO9A 3GLGB 3U5ZB 3PCJA 2KZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSU A;  3PCI M;  3MFL M;  3PCD M;  3PCN A;  3HJS A;  1YKO A;  1DMH A;  3LMX M;  2BUT B;  2BUU B;  1EOB A;  2BUZ B;  5TD3 A;  3PCC M;  3PCK A;  3HGI A;  4WHP A;  1YKO B;  2BUM B;  4WHP D;  3MV4 M;  1EO2 B;  3MI5 M;  3PCH M;  4WHQ B;  2PCD A;  2BUX A;  3PCM A;  2BUV A;  1EOA A;  2BUR A;  3HJ8 A;  3PCB A;  3PCA A;  3MV6 M;  1YKL B;  2BV0 A;  2BUQ B;  3O32 A;  1EO9 B;  3O6J A;  3PCL A;  3PCE A;  2BUW B;  3LXV M;  1DLM A;  1YKN A;  3MI1 M;  3T67 M;  3I51 A;  1YKK A;  1DLT A;  3PCI A;  2BV0 B;  3MFL A;  3PCD A;  3PCG M;  2BOY A;  1EOB B;  3PCF M;  3LMX A;  4WHO A;  4WHP B;  4WHO D;  4WHS A;  3T63 M;  3PCC A;  4WHS D;  1TMX A;  2BUY A;  3N9T A;  1YKM A;  3LKT M;  3MV4 A;  2XSV A;  3PCJ M;  2BUX B;  2BUV B;  4ILT A;  3TH1 A;  1EOA B;  3O6R A;  3PCN M;  2BUR B;  3PCH A;  3HHX A;  4WHR F;  4WHR A;  1DLQ A;  3O5U A;  2BUT A;  2BUU A;  3PCK M;  3MV6 A;  1YKP A;  2BUZ A;  2AZQ A;  1YKN B;  4WHR B;  3HJQ A;  2BUM A;  1YKK B;  3LXV A;  2PCD M;  3PCM M;  1EO2 A;  3MI1 A;  2XSR A;  1S9A A;  3T67 A;  1YKP B;  4ILV A;  4WHQ A;  4WHO B;  3PCB M;  3MI5 A;  3PCA M;  3PCG A;  1EOC A;  3I4Y A;  3PCF A;  4WHS B;  3HHY A;  3I4V A;  2BUY B;  1YKL A;  3HKP A;  1YKM B;  3PCL M;  3PCE M;  3T63 A;  2BUQ A;  1EO9 A;  1EOC B;  3LKT A;  2BUW A;  3PCJ A; 
#chains in the Genus database with same CATH topology
 2R65 A;  1K3W A;  3PCI M;  1IXS A;  1MU5 A;  3TE6 A;  3PCN A;  4JXJ A;  4JI3 M;  3GP1 A;  1JB0 F;  1XMO M;  3M6A A;  1MX0 A;  3GLF E;  1GKI A;  5DFL A;  1Z5C A;  3PVS A;  1PJT A;  2JWS A;  3KOY E;  3RGS A;  2K47 A;  5IWA M;  2FE8 A;  4IIW A;  4II7 A;  3UJN A;  4FVM A;  4KT0 F;  1XNR M;  2WSF F;  1L2C A;  4L15 A;  3FRH A;  1YKO B;  8CAT A;  1NY6 A;  2WSE F;  4WHP D;  4G4N A;  3PXG A;  5LMU M;  3GPX A;  1NJF A;  2BJW A;  2KHH A;  1XXH A;  2QNJ A;  1SXJ B;  2LNH C;  5EP2 A;  3PCM A;  4XK8 F;  1TDZ A;  1QAN A;  3FYC A;  1TTE A;  4NC6 A;  5KPR A;  1KFV A;  1G59 A;  3KP0 E;  3C58 A;  2QBY A;  4DV4 M;  4AKG A;  4UN2 B;  4DR1 M;  1OIP A;  3KS4 A;  2BWB A;  4NL4 H;  4LJ7 A;  4LJ6 A;  1OAO C;  3U60 B;  2BV0 A;  1DO0 A;  1I94 M;  2OQ4 A;  4IBJ A;  3T1H M;  3FKE A;  4F1I A;  3CTW B;  1VQ1 A;  4M0D A;  1DO2 A;  2KNZ A;  3U6P A;  4DR6 M;  1DLM A;  5JI3 E;  2MR9 A;  3MI1 M;  4P17 A;  3W68 A;  3I01 M;  2QSF X;  1YE9 A;  1HQC A;  4MGK E;  5E26 A;  3K9O A;  4YY3 M;  4DV2 M;  4JI2 M;  5IT9 S;  3PCD A;  1OIZ A;  4LZJ A;  2O25 A;  2BOY A;  4NXN M;  4CJ6 A;  2F5Q A;  5IZ7 D;  3PCF M;  3HHZ A;  1HNZ M;  1T6O A;  4MGZ E;  4LF4 M;  4AZF A;  3GRY A;  4WHP B;  4WHO D;  2DXI A;  3SHG B;  2G8L A;  1PGY A;  2LVO C;  3T63 M;  3PCC A;  4WHS D;  2QP9 X;  3FTC A;  2YNM D;  1SXJ C;  1X37 A;  2BNK A;  1IXR C;  1LV7 A;  4IBK A;  2MGW A;  2E5L M;  2R6F A;  4LF7 M;  3FUV A;  3MV4 A;  2BUX B;  2LBC A;  3PCJ M;  1RU3 A;  2R45 A;  1AUA A;  1NV9 A;  2M60 A;  2DZL A;  2FS1 A;  1N78 A;  3O6R A;  3PCN M;  3GLG A;  2YQZ A;  1IBL M;  1PJS A;  2Y21 A;  3U5Z A;  1NSF A;  2D7G A;  2K6B A;  4ANR A;  1W5T A;  1K3X A;  3WHL A;  1L1Z A;  4TUW A;  4BLC A;  4GC9 A;  2Y0T A;  3IEC A;  1QQW A;  2CHQ A;  3KXE C;  1YKP A;  2LVQ D;  2CP8 A;  3UK6 A;  5FTN A;  3M7G A;  1JR3 A;  2F5O A;  2CEA A;  2F5P A;  2XGN A;  3FD9 A;  3HZJ A;  4GHA A;  1TH3 A;  1YKK B;  2HAK A;  2L7I A;  4MGY E;  3ZQJ A;  3KDS E;  4OW0 A;  1PRB A;  3FUT A;  4DV7 M;  1GO5 A;  3PCM M;  5EXP A;  2A5Y B;  4I8O A;  4FWG A;  1SXJ A;  1N34 M;  3SYL A;  4WHO B;  2J7O A;  2KNV A;  2L7H A;  1N75 A;  2QZ4 A;  3SMS A;  4KHP M;  4JI4 M;  1EOC A;  4WHS B;  2QPA A;  4LGM A;  3KS8 A;  1J09 A;  3B74 A;  2BUY B;  3SAV A;  2LWX A;  3GQ4 A;  2JXN A;  3HWS A;  2HKJ A;  3CGW A;  4KO8 A;  5FTK A;  3GPY A;  1NO1 A;  3U60 A;  1G3I A;  1XC8 A;  3HY5 A;  5DYI A;  1A5T A;  1GLN A;  4IBB A;  3T38 A;  2XEP A;  4CHT B;  2K9D A;  2X8A A;  4PDI A;  3U6Q A;  3GLF B;  3LKT A;  2R62 A;  4IJF A;  2XSU A;  4L78 A;  3HX3 A;  3VKG A;  2BJV A;  4GKJ M;  3PCD M;  2EA0 A;  1Z5B A;  4AG6 A;  4DR2 M;  3FTE A;  3TQS A;  5EP1 A;  1L8Q A;  3RE8 A;  4JI1 M;  3E4R A;  1T43 A;  2BUT B;  4QHS A;  2G5G X;  3QAU A;  4Y28 F;  2DWL A;  1DGH B;  4G4O A;  1G71 A;  1NNU C;  2BUZ B;  3DFZ A;  3EIH A;  2R4J A;  1IN8 A;  2B3T A;  2ZBK B;  4MH0 E;  1Z59 A;  3R9X B;  4JI0 M;  2L09 A;  3PCC M;  4WHP A;  1Q39 A;  3TL4 X;  3HU2 A;  4Q7J A;  4NRV A;  2VQE M;  4B7H A;  2DHY A;  2RGH A;  4ZPX A;  4D80 A;  1C7Y A;  3MV4 M;  2EKF A;  3ZC7 B;  2XLJ A;  1PJI A;  1IN7 A;  3J7A S;  4FWH A;  4BB9 A;  4LRS A;  1I4W A;  2ZM6 M;  2BUX A;  1Z6T A;  2O01 F;  2XSZ D;  1WGL A;  1NV8 A;  1YLA A;  2EO2 A;  4LJA A;  3D8L A;  3CF2 A;  1R4G A;  4AKH A;  2KDL A;  1OJL A;  1XHB A;  2JP7 A;  4LF5 M;  4G4Q A;  3H4M A;  2KEB A;  1TGU A;  4IBI A;  2RGO A;  2F4V M;  3KOX E;  2BUQ B;  2ZTD A;  3O32 A;  2C9O A;  4QNM A;  2CFO A;  3GQ5 A;  2BUW B;  2QQ8 A;  3H4J A;  4XBO A;  1VG5 A;  3FUW A;  4DUZ M;  1NVM A;  4DR5 M;  4NSR A;  3FTF A;  3I51 A;  3DA1 A;  3KP1 E;  4W5W A;  1QUT A;  1QAM A;  1UM8 A;  4OVZ B;  4PCZ A;  1P3Q Q;  2R44 A;  5ITX A;  2UUA M;  1DLT A;  3I04 M;  2G3Q A;  3FUX A;  2ZAO A;  3SMP A;  3MFL A;  4LZZ A;  2CHV A;  1PM5 A;  4DUY M;  1EOB B;  2ZTC A;  1NJG A;  2MRO B;  3Q8G A;  4L6V 6;  4LFA M;  3VDU A;  3J2P B;  4G6Z A;  4DR4 M;  4JV5 M;  4WHO A;  3TPZ A;  4I5S A;  1IM2 A;  1L2D A;  4WHS A;  2X4A A;  4JYA M;  2M5Z A;  2JA2 A;  1XB2 B;  7CAT A;  4KOD A;  1ZMW A;  2MJ5 B;  3BOS A;  1OTR A;  1UFZ A;  2OPF A;  1TMX A;  2BUY A;  4AQY M;  1QZE A;  1TDH A;  3LKT M;  2BUV B;  1IY1 A;  3C3D A;  2JY7 A;  1EOA B;  3SAT A;  3GLI A;  4P16 A;  1QAO A;  3K92 A;  4M9S A;  3AV0 A;  3L29 A;  3FRI A;  3F92 A;  3GLH E;  4S12 A;  3UGJ A;  4X66 M;  2Q2E B;  1IBK M;  3GQ3 A;  4WHR F;  5EP3 A;  3TWK A;  4WHR A;  1IN4 A;  1L2B A;  1QUS A;  3JR4 A;  3V76 A;  4K0K M;  3IG5 A;  3K8Z A;  2BUT A;  3OTO M;  4DBG B;  2YR0 A;  1PJQ A;  5BR8 M;  3MV6 A;  2UXB M;  2ZAM A;  2BUZ A;  1ZMU A;  1Y8G A;  3PNV A;  3VLF B;  2QHO B;  2BWE A;  4D82 A;  3R8F A;  4NRW A;  2AZQ A;  2CV2 A;  4WP2 A;  3GPU A;  5ITQ A;  4FD2 A;  4YHH M;  4CIZ A;  2L4F A;  1SG9 A;  3HU1 A;  3NWL A;  3QYB A;  4LFB M;  1WIV A;  4XGI A;  4LF8 M;  1Q02 A;  5LMN M;  3B7N A;  2UU9 M;  2Z4R A;  3GRV A;  3GO8 A;  4CIS A;  4GHL A;  2JZ0 A;  4AKI A;  2XSR A;  2OO9 A;  3T67 A;  1LTM A;  4JN6 A;  4GRI A;  1K82 A;  1DV0 A;  3A42 A;  4DV5 M;  3PCG A;  4DV3 M;  4R3D A;  2V6Z M;  4FCV A;  1N32 M;  1MN3 A;  3FYD A;  3J80 S;  3UMM A;  3K2L A;  1G4A E;  2DAM A;  4RF0 A;  3U6D A;  4B7G A;  4PT5 A;  2F5S A;  1QYR A;  2HWJ A;  3ZH9 B;  1YKM B;  3GRR A;  3L27 A;  3KVW A;  1DGG A;  1R5L A;  3J7B A;  4DV6 M;  1EIJ A;  2BUQ A;  2GNO A;  2DWM A;  1TH2 A;  3C9P A;  3T15 A;  1J5E M;  1D2N A;  1T3T A;  2R46 A;  4B3R M;  2BUW A;  2HHH M;  3MFL M;  1BVS A;  2LVP C;  3HJS A;  1L1T A;  1YKO A;  4LCB A;  1PJJ A;  4OVZ A;  3QWL A;  3LQR A;  5C18 A;  3SC3 A;  2BUU B;  1GVN A;  2O5R A;  4D81 A;  2N35 A;  4L4U A;  4OX9 M;  1EOB A;  4AW4 A;  1IN5 A;  2JUJ A;  3IG8 A;  4REZ A;  4R7G A;  5KPT A;  3SAW A;  1R2Y A;  5TD3 A;  3L26 A;  3SAU A;  2C96 A;  2LTU A;  3HGI A;  2WZJ A;  4R71 A;  2DNA A;  5BPV A;  2Z4S A;  2Z3X A;  1EO2 B;  2JY6 B;  3M0E A;  2DWN A;  2K0B X;  3MI5 M;  1OKS A;  3AJI B;  2KNA A;  1H6U A;  4G4R A;  1D0L A;  1G8P A;  3LQQ A;  4WHQ B;  2DAE A;  1VDD A;  2AHM A;  4IBC A;  3VK7 A;  2ZAN A;  3LVV A;  2BUV A;  3THG A;  2PCD A;  1EOA A;  5F3W A;  5DNY A;  3HJ8 A;  1EFU B;  2VQF M;  5FLX S;  2I7P A;  5ITY A;  3PCB A;  2R4E A;  1D0K A;  4WW0 A;  3PCA A;  4HL4 A;  3BBZ A;  1YKL B;  3MV6 M;  4FCT A;  2OOA A;  3A45 A;  3A46 A;  1XNQ M;  4GIP A;  3TWL A;  1Z5A A;  1HNX M;  2JNH A;  3GPP A;  3B9P A;  3O6J A;  4QHT A;  4NOO B;  3PCL A;  1IQP A;  1D0M A;  3EIE A;  4IBE A;  1DGB A;  1E32 A;  1NHW C;  1QAQ A;  4DR7 M;  5GKN A;  3MHV C;  3D8B A;  2JY5 A;  4MM3 B;  3U6L A;  4AG5 A;  1GAB A;  3T67 M;  3KW6 A;  3MJ5 A;  1YUB A;  3KSX A;  2DZN B;  3FUU A;  2BV0 B;  1YKK A;  1AIP C;  4PDG A;  3ZCB B;  4M9X A;  4JI8 M;  3PCG M;  3W67 A;  5FSW A;  2UXC M;  3LMX A;  3DZD A;  3LMM A;  2V1C A;  3T6P A;  4MGI E;  2YFQ A;  3JR5 A;  2JZ1 A;  1IN6 A;  3MK6 A;  3VK8 A;  4LF9 M;  2L2D A;  2VF8 A;  1E94 E;  1N33 M;  3WHK A;  1OFI A;  3DOA A;  5EXT A;  2CV1 A;  1HT1 E;  3AFH A;  2OOB A;  1YKM A;  3MMP A;  3GRU A;  3GLH B;  3UZU A;  2MH8 A;  4LG2 A;  2XSV A;  5ITX E;  3TH1 A;  2DZO B;  3KFU G;  2BUR B;  4GMQ A;  4HLQ A;  2L6O A;  3SBJ A;  1HR0 M;  1XXH E;  4GEW A;  4DR3 M;  3PCH A;  4LJ4 A;  3T1Y M;  2WSC F;  2FH0 A;  1HJP A;  1DLQ A;  1QDR A;  3J81 S;  1OFH A;  2XFT A;  5C1B A;  2BUU A;  4G3O A;  2KA6 B;  4WUR A;  1WHC A;  3B89 A;  5KPZ A;  1HQY E;  2DWZ B;  3LW5 F;  3U61 B;  1GL6 A;  2F5N A;  3FTD A;  2C99 A;  3SAR A;  3SAS A;  2VF7 A;  3U6E A;  3E9S A;  1YKN B;  1DGF A;  2LVN C;  3GLI E;  2DHR A;  4LRT A;  2DAI A;  2DKL A;  3E21 A;  1WJ7 A;  2PCD M;  2DEN A;  4OU7 A;  2KXE A;  1EO2 A;  3LXV A;  2EUC A;  1IY0 A;  1S9A A;  1YKP B;  4I81 A;  3W0L B;  4B3S M;  4WHQ A;  2RKO A;  3PCB M;  4DV0 M;  4JI5 M;  3MI5 A;  3PCA M;  1E9R A;  1JQJ C;  1Q3C A;  3VKH A;  2FNA A;  2HL7 A;  5EJC A;  5FTL A;  3GLF A;  1V92 A;  4NXM M;  3B7Q A;  1W5S A;  1G41 A;  1S3S A;  3KSJ A;  3NBX X;  2ERC A;  5EP4 A;  1YKL A;  1J7K A;  3B7Z A;  3HKP A;  4X65 M;  3PCL M;  1XMQ M;  4X64 M;  1VEK A;  3FE3 A;  1DGH A;  1TF0 B;  3VFD A;  1EOC B;  1ZMV A;  3L2A A;  3A98 B;  3AOE C;  3Q8X A;  4F2L A;  1FJG M;  1ZAE A;  4B7F A;  2UUC M;  4Z8X A;  4IJE A;  2W82 A;  3AKZ A;  3GLG E;  1DMH A;  5EXX A;  3LMX M;  5ITT A;  4IBF A;  1VEJ A;  4GKK M;  1OAI A;  1QZM A;  2P5T A;  1NNJ A;  1CUK A;  1ORY B;  2QEN A;  3CF0 A;  3HU3 A;  3U6S A;  4RNA A;  3RFW A;  4PD2 A;  2EJS A;  3PCK A;  2BUM B;  4L8R C;  1GL7 A;  5A2Q S;  3VDP A;  4CGY B;  1JR3 E;  2R0I A;  3W0F A;  1NHG C;  1KSF X;  2HCB A;  3PCH M;  4GC5 A;  3GLH A;  1HT2 E;  5JI2 E;  2C5R A;  5ITU A;  2DAK A;  4ITQ A;  4MGH A;  3SYK A;  2CE7 A;  2EKK A;  1XWI A;  2BUR A;  1SXJ E;  1TR8 A;  1VDL A;  2KRK A;  3AOE A;  3LCU A;  1E9S A;  4RKU F;  2FFJ A;  1R7R A;  4QOZ C;  2DI0 A;  3RGP A;  3LVW A;  1HNW M;  3E46 A;  2C98 A;  4X62 M;  2JY8 A;  4LY6 A;  1KYI A;  1EO9 B;  3NBI A;  3U61 A;  4A3V B;  5IRE B;  5FTM A;  4DV1 M;  3PCE A;  3LXV M;  3BXW A;  1IXS B;  1NY5 A;  1YKN A;  1IBM M;  1ZQ9 A;  4NSO B;  2XFS A;  1QDT A;  4MB7 A;  2H5X A;  1OQY A;  3PCI A;  3PFI A;  4I4L A;  4LF6 M;  1C1K A;  3QYE A;  3JAM S;  4B08 A;  1F4I A;  1MJG M;  2CUZ A;  4LJ5 A;  5KQD A;  1WXQ A;  4LJ9 A;  3HHW A;  2XSZ A;  2R18 A;  2CV0 A;  3K1J A;  4BBA A;  1N36 M;  5FTJ A;  1IY2 A;  3U6M A;  1R6B X;  2KW0 A;  3K9P A;  3J27 B;  4L16 A;  2DAG A;  3N9T A;  2XH9 A;  2Y0Q A;  4QNR A;  4KLN A;  2LH0 A;  1XXH B;  4QOS A;  1VEG A;  1QVR A;  2RRU A;  1V34 A;  4FCW A;  4ILT A;  2CHG A;  2LVA A;  3KOW E;  2QBY B;  2D7E A;  2X49 A;  3SFZ A;  2J5Y A;  5H37 D;  3U6C A;  3HHX A;  4Z6Y A;  3ILK A;  4M0W A;  2GQF A;  4IBD A;  3L25 A;  2KZU A;  3IHP A;  5KQ8 A;  5KO3 A;  4JI6 M;  3O5U A;  2UUB M;  1Q3B A;  3C3E A;  4JI7 M;  4LJ8 A;  5E6J A;  2CRU A;  2H1R A;  3PCK M;  3GLI B;  1EE8 A;  4FW9 A;  2QCU A;  2LXE A;  1R2Z A;  1YSY A;  1GJT A;  2UXD M;  4EIW A;  3TWM A;  4GIT A;  4WHR B;  5EQT A;  3HJQ A;  2BUM A;  1IFY A;  2J7N A;  1JR3 D;  4RF1 A;  2V1U A;  2C9C A;  2Z7J A;  4FWD A;  3MI1 A;  4LFC M;  2VDB B;  5EXS A;  2LHC A;  4AI6 A;  4LGY A;  2L4E A;  2LHG A;  4B3M M;  3PNY A;  2XZF A;  4ILV A;  2FOI C;  3U6O A;  2Z8Y M;  4IBG A;  2XF3 A;  1SXJ D;  2APL A;  3CF6 E;  1GJS A;  2DVW B;  3I4Y A;  3PCF A;  1V33 A;  1ZV1 A;  2I7N A;  2CWB A;  2D7H A;  2KRU A;  2Y20 A;  1FNN A;  3HHY A;  3AL0 C;  3AOG A;  1N77 A;  4GH9 A;  3SHF A;  4HEO A;  3I4V A;  1TH4 A;  2XZU A;  4M9Z A;  5L8R F;  1IXZ A;  5DYG A;  5ITR A;  3LCV B;  4B3T M;  3KOZ E;  3PCE M;  2NQ8 C;  3T63 A;  1WR1 B;  1WGN A;  2VII A;  3L28 A;  1EO9 A;  3GLG B;  3U5Z B;  3PCJ A;  2KZS A; 
#chains in the Genus database with same CATH homology
 2R65 A;  3PCI M;  1MU5 A;  3TE6 A;  3PCN A;  4JXJ A;  4JI3 M;  3GP1 A;  1XMO M;  3M6A A;  1MX0 A;  1GKI A;  1Z5C A;  3PVS A;  3KOY E;  3RGS A;  2K47 A;  5IWA M;  2FE8 A;  4IIW A;  4II7 A;  3UJN A;  4FVM A;  1XNR M;  1L2C A;  4L15 A;  1YKO B;  8CAT A;  1NY6 A;  4WHP D;  4G4N A;  3PXG A;  5LMU M;  3GPX A;  1NJF A;  2BJW A;  1XXH A;  1SXJ B;  2LNH C;  5EP2 A;  3PCM A;  1TDZ A;  1QAN A;  3FYC A;  1G59 A;  2QBY A;  5KPR A;  1KFV A;  3KP0 E;  3C58 A;  4DV4 M;  4AKG A;  4DR1 M;  3KS4 A;  4NL4 H;  4LJ7 A;  4LJ6 A;  3U60 B;  2BV0 A;  1DO0 A;  1I94 M;  2OQ4 A;  4IBJ A;  3T1H M;  3FKE A;  3CTW B;  4M0D A;  1DO2 A;  3U6P A;  4DR6 M;  1DLM A;  5JI3 E;  3MI1 M;  1YE9 A;  1HQC A;  4MGK E;  5E26 A;  4YY3 M;  5IT9 S;  4JI2 M;  3PCD A;  4LZJ A;  2BOY A;  4NXN M;  2F5Q A;  5IZ7 D;  3PCF M;  3HHZ A;  1HNZ M;  4MGZ E;  4LF4 M;  4AZF A;  3GRY A;  4WHP B;  4WHO D;  2DXI A;  3SHG B;  2G8L A;  3T63 M;  3PCC A;  4WHS D;  2QP9 X;  3FTC A;  2YNM D;  1SXJ C;  1X37 A;  2BNK A;  1IXR C;  1LV7 A;  4IBK A;  2E5L M;  4LF7 M;  3MV4 A;  3FUV A;  3PCJ M;  2BUX B;  2R45 A;  1N78 A;  2M60 A;  3O6R A;  3PCN M;  3GLG A;  2YQZ A;  1IBL M;  3U5Z A;  2Y21 A;  1NSF A;  2D7G A;  1W5T A;  1K3X A;  3WHL A;  1L1Z A;  4TUW A;  4BLC A;  4GC9 A;  2Y0T A;  1QQW A;  2CHQ A;  3KXE C;  1YKP A;  3UK6 A;  5FTN A;  3M7G A;  1JR3 A;  2F5O A;  2CEA A;  2F5P A;  2XGN A;  3FD9 A;  4GHA A;  1TH3 A;  1YKK B;  2L7I A;  4MGY E;  3KDS E;  4OW0 A;  3PCM M;  3FUT A;  4DV7 M;  5EXP A;  2A5Y B;  4I8O A;  4FWG A;  1SXJ A;  1N34 M;  3SYL A;  4WHO B;  2J7O A;  2L7H A;  1EOC A;  1N75 A;  2QZ4 A;  3SMS A;  4KHP M;  4JI4 M;  4WHS B;  2QPA A;  4LGM A;  3KS8 A;  1J09 A;  2BUY B;  3SAV A;  2LWX A;  3GQ4 A;  3HWS A;  4KO8 A;  2HKJ A;  3GPY A;  1XC8 A;  5FTK A;  3U60 A;  1G3I A;  5DYI A;  1GLN A;  4IBB A;  3T38 A;  4PDI A;  2XEP A;  4CHT B;  3U6Q A;  2X8A A;  1K3W A;  3GLF B;  3LKT A;  2R62 A;  4IJF A;  2XSU A;  4L78 A;  3VKG A;  2BJV A;  4GKJ M;  3PCD M;  2EA0 A;  1Z5B A;  4AG6 A;  4DR2 M;  3FTE A;  3TQS A;  5EP1 A;  1L8Q A;  3RE8 A;  4JI1 M;  3E4R A;  2BUT B;  4QHS A;  2G5G X;  3QAU A;  2DWL A;  1DGH B;  4G4O A;  1NNU C;  2BUZ B;  3DFZ A;  3EIH A;  2R4J A;  1IN8 A;  2ZBK B;  4MH0 E;  3R9X B;  1Z59 A;  3PCC M;  4JI0 M;  2L09 A;  4WHP A;  1Q39 A;  3TL4 X;  3HU2 A;  4NRV A;  2VQE M;  4B7H A;  2RGH A;  4ZPX A;  4D80 A;  3MV4 M;  3ZC7 B;  2XLJ A;  1PJI A;  1IN7 A;  3J7A S;  4FWH A;  4BB9 A;  4LRS A;  1I4W A;  2ZM6 M;  2BUX A;  1Z6T A;  2XSZ D;  2EO2 A;  4LJA A;  3D8L A;  3CF2 A;  4AKH A;  1OJL A;  1XHB A;  4LF5 M;  4G4Q A;  3H4M A;  2KEB A;  1TGU A;  4IBI A;  2RGO A;  2F4V M;  3KOX E;  2BUQ B;  3O32 A;  2C9O A;  4QNM A;  2CFO A;  3GQ5 A;  2BUW B;  4XBO A;  3FUW A;  4DUZ M;  1NVM A;  4DR5 M;  4NSR A;  3FTF A;  3I51 A;  3DA1 A;  3KP1 E;  4W5W A;  4OVZ B;  1QAM A;  1UM8 A;  4PCZ A;  4DV2 M;  2UUA M;  1DLT A;  5ITX A;  3SMP A;  3FUX A;  2ZAO A;  3MFL A;  4LZZ A;  2CHV A;  1PM5 A;  4DUY M;  1EOB B;  1NJG A;  4JV5 M;  4LFA M;  3VDU A;  4DR4 M;  3J2P B;  4G6Z A;  4WHO A;  3TPZ A;  4I5S A;  1IM2 A;  1L2D A;  4WHS A;  2X4A A;  4JYA M;  2JA2 A;  2M5Z A;  7CAT A;  4KOD A;  3BOS A;  2OPF A;  1TMX A;  2BUY A;  4AQY M;  1TDH A;  3LKT M;  2BUV B;  1IY1 A;  1EOA B;  3SAT A;  3GLI A;  4P16 A;  1QAO A;  3K92 A;  4M9S A;  3AV0 A;  3L29 A;  4S12 A;  3UGJ A;  4WHR F;  4X66 M;  2Q2E B;  1IBK M;  3GQ3 A;  5EP3 A;  3TWK A;  4WHR A;  1IN4 A;  1L2B A;  3JR4 A;  4K0K M;  3IG5 A;  3K8Z A;  2BUT A;  3OTO M;  2YR0 A;  5BR8 M;  3MV6 A;  2UXB M;  2ZAM A;  2BUZ A;  3R8F A;  3VLF B;  3PNV A;  4NRW A;  4D82 A;  2AZQ A;  2CV2 A;  3GPU A;  5ITQ A;  4FD2 A;  4YHH M;  3HU1 A;  3NWL A;  4LFB M;  4XGI A;  4LF8 M;  5LMN M;  2UU9 M;  2Z4R A;  3GRV A;  3GO8 A;  4CIS A;  4GHL A;  4AKI A;  2XSR A;  3T67 A;  4JN6 A;  4GRI A;  1K82 A;  3A42 A;  4DV5 M;  3PCG A;  4DV3 M;  4R3D A;  2V6Z M;  4FCV A;  1N32 M;  3FYD A;  3J80 S;  3UMM A;  3K2L A;  1G4A E;  4RF0 A;  3U6D A;  4B7G A;  4PT5 A;  2F5S A;  1QYR A;  3ZH9 B;  1YKM B;  3GRR A;  3L27 A;  3KVW A;  1DGG A;  3J7B A;  4DV6 M;  2BUQ A;  2DWM A;  1TH2 A;  3T15 A;  1J5E M;  1D2N A;  1T3T A;  2R46 A;  4B3R M;  2BUW A;  2HHH M;  3MFL M;  3HJS A;  1YKO A;  1L1T A;  4LCB A;  1PJJ A;  4OVZ A;  3QWL A;  3LQR A;  5C18 A;  3SC3 A;  2BUU B;  1GVN A;  2O5R A;  4D81 A;  4L4U A;  4OX9 M;  1EOB A;  4AW4 A;  1IN5 A;  3IG8 A;  4REZ A;  4R7G A;  5KPT A;  3SAW A;  1R2Y A;  5TD3 A;  3L26 A;  3SAU A;  2C96 A;  3HGI A;  5BPV A;  2Z4S A;  2Z3X A;  1EO2 B;  3M0E A;  2DWN A;  3MI5 M;  3AJI B;  1H6U A;  4G4R A;  1G8P A;  3LQQ A;  4WHQ B;  2PCD A;  1VDD A;  2AHM A;  4IBC A;  3VK7 A;  2ZAN A;  3LVV A;  2BUV A;  3THG A;  1EOA A;  5F3W A;  5DNY A;  3HJ8 A;  2VQF M;  5FLX S;  2I7P A;  5ITY A;  3PCB A;  2R4E A;  4WW0 A;  3PCA A;  4HL4 A;  3MV6 M;  1YKL B;  4FCT A;  3A45 A;  3A46 A;  1XNQ M;  4GIP A;  3TWL A;  1Z5A A;  1HNX M;  3GPP A;  3B9P A;  3O6J A;  4QHT A;  4NOO B;  3PCL A;  1IQP A;  3EIE A;  4IBE A;  1DGB A;  1E32 A;  1NHW C;  1QAQ A;  4DR7 M;  5GKN A;  3MHV C;  3D8B A;  4MM3 B;  3U6L A;  4AG5 A;  3T67 M;  3KW6 A;  3MJ5 A;  1YUB A;  3KSX A;  2DZN B;  3FUU A;  2BV0 B;  1YKK A;  4PDG A;  3ZCB B;  4M9X A;  4JI8 M;  3PCG M;  5FSW A;  2UXC M;  3LMX A;  3DZD A;  3LMM A;  2V1C A;  4MGI E;  2YFQ A;  3JR5 A;  1IN6 A;  3MK6 A;  3VK8 A;  4LF9 M;  1N33 M;  1E94 E;  3WHK A;  1OFI A;  3DOA A;  5EXT A;  2CV1 A;  1HT1 E;  3AFH A;  1YKM A;  3GRU A;  3GLH B;  3UZU A;  4LG2 A;  2XSV A;  5ITX E;  3TH1 A;  2DZO B;  3KFU G;  2BUR B;  4GMQ A;  4HLQ A;  2L6O A;  3SBJ A;  1HR0 M;  3PCH A;  4DR3 M;  4LJ4 A;  3T1Y M;  1DLQ A;  3J81 S;  1OFH A;  2XFT A;  5C1B A;  2BUU A;  2KA6 B;  4WUR A;  5KPZ A;  1HQY E;  2DWZ B;  3U61 B;  1GL6 A;  2F5N A;  3FTD A;  2C99 A;  3SAR A;  3SAS A;  3U6E A;  1YKN B;  3E9S A;  1DGF A;  2DHR A;  4LRT A;  3LXV A;  2PCD M;  4OU7 A;  2KXE A;  1EO2 A;  2EUC A;  1IY0 A;  1S9A A;  1YKP B;  4I81 A;  3W0L B;  4B3S M;  4WHQ A;  2RKO A;  3PCB M;  4DV0 M;  4JI5 M;  3MI5 A;  3PCA M;  1E9R A;  1JQJ C;  1Q3C A;  3VKH A;  2FNA A;  2HL7 A;  5EJC A;  5FTL A;  3GLF A;  4NXM M;  1W5S A;  1G41 A;  1S3S A;  3KSJ A;  2ERC A;  5EP4 A;  1YKL A;  1J7K A;  3HKP A;  4X65 M;  3PCL M;  1XMQ M;  4X64 M;  1DGH A;  3VFD A;  1EOC B;  3L2A A;  3AOE C;  3A98 B;  3Q8X A;  1FJG M;  1ZAE A;  4B7F A;  2UUC M;  4Z8X A;  4IJE A;  2W82 A;  3AKZ A;  1DMH A;  5EXX A;  3LMX M;  5ITT A;  4IBF A;  4GKK M;  2P5T A;  1QZM A;  1NNJ A;  1ORY B;  2QEN A;  3HU3 A;  3CF0 A;  3U6S A;  4RNA A;  3RFW A;  4PD2 A;  3PCK A;  2BUM B;  4L8R C;  1GL7 A;  5A2Q S;  3VDP A;  4CGY B;  3W0F A;  1NHG C;  1KSF X;  2HCB A;  3PCH M;  4GC5 A;  3GLH A;  1HT2 E;  5JI2 E;  2C5R A;  5ITU A;  4ITQ A;  4MGH A;  3SYK A;  2CE7 A;  2BUR A;  1XWI A;  1SXJ E;  2KRK A;  3AOE A;  1E9S A;  2FFJ A;  1R7R A;  4QOZ C;  3RGP A;  3LVW A;  1HNW M;  2C98 A;  4X62 M;  4LY6 A;  1KYI A;  1EO9 B;  3NBI A;  3U61 A;  4A3V B;  5IRE B;  5FTM A;  4DV1 M;  3PCE A;  3LXV M;  1IXS B;  1NY5 A;  1YKN A;  1IBM M;  1ZQ9 A;  4NSO B;  2XFS A;  4MB7 A;  3PCI A;  3PFI A;  4I4L A;  4LF6 M;  1C1K A;  3JAM S;  4B08 A;  4LJ5 A;  2CUZ A;  5KQD A;  1WXQ A;  4LJ9 A;  3HHW A;  2XSZ A;  2R18 A;  2CV0 A;  3K1J A;  4BBA A;  1N36 M;  5FTJ A;  1IY2 A;  3U6M A;  1R6B X;  2KW0 A;  4L16 A;  3J27 B;  3N9T A;  2XH9 A;  2Y0Q A;  4QNR A;  4KLN A;  2LH0 A;  1XXH B;  4QOS A;  1QVR A;  4FCW A;  4ILT A;  2CHG A;  3KOW E;  2QBY B;  2D7E A;  2X49 A;  3SFZ A;  5H37 D;  3U6C A;  3HHX A;  4Z6Y A;  3ILK A;  4M0W A;  4IBD A;  3L25 A;  2KZU A;  5KQ8 A;  4JI6 M;  5KO3 A;  3O5U A;  2UUB M;  1Q3B A;  4JI7 M;  4LJ8 A;  5E6J A;  2H1R A;  3PCK M;  3GLI B;  1EE8 A;  4FW9 A;  2QCU A;  2LXE A;  1R2Z A;  1YSY A;  2UXD M;  4EIW A;  3TWM A;  4GIT A;  4WHR B;  5EQT A;  3HJQ A;  2BUM A;  2J7N A;  1JR3 D;  4RF1 A;  2V1U A;  2C9C A;  2Z7J A;  4FWD A;  3MI1 A;  4LFC M;  5EXS A;  4AI6 A;  4LGY A;  4B3M M;  3PNY A;  2XZF A;  4ILV A;  2FOI C;  3U6O A;  4IBG A;  2XF3 A;  1SXJ D;  3CF6 E;  2DVW B;  3I4Y A;  3PCF A;  2I7N A;  2D7H A;  2KRU A;  2Y20 A;  1FNN A;  3HHY A;  3AL0 C;  3AOG A;  1N77 A;  4GH9 A;  3SHF A;  3I4V A;  1TH4 A;  2XZU A;  4M9Z A;  1IXZ A;  5DYG A;  5ITR A;  3PCE M;  4B3T M;  3KOZ E;  3T63 A;  2NQ8 C;  2VII A;  3L28 A;  1EO9 A;  3GLG B;  3U5Z B;  3PCJ A;  2KZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...