3I4VA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
total genus 69
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3i4vA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3i4vA02
4WHPB 2BURA 2BUTB 3PCHA 1YKMA 3LKTA 3T63A 3HHXA 3LMXA 3N9TA 3PCMM 1YKMB 3O32A 4ILTA 2BURB 2BUMB 3LXVM 3TH1A 4WHPA 2BUWA 3PCIM 3PCBA 4WHOB 2BUYA 3HKPA 2BUMA 1YKLB 2BUVA 2BV0A 2PCDA 3HGIA 1EOAB 4WHRF 3MV4M 4WHOA 3MI5M 1YKPB 2BUZB 3PCFA 1EOCA 2BUQA 4WHSB 2BOYA 1YKOB 3MI5A 3PCDA 5TD3A 3PCFM 1YKKA 3PCNA 3PCIA 3PCKA 1DLTA 3PCNM 2PCDM 1YKNA 2BUXB 3T67M 3I4YA 1DLMA 3I4VA 2BV0B 2BUUB 3PCJA 1DMHA 2BUYB 3PCEM 3PCCA 3PCGA 3PCAA 3MI1A 3PCLA 2XSVA 3PCJM 3LKTM 4ILVA 3LMXM 1EO2A 3PCDM 2BUVB 4WHSD 2BUTA 3LXVA 1S9AA 3PCBM 4WHRB 3O6JA 2BUUA 1EO9B 1EO2B 3T67A 2BUXA 3O5UA 1YKNB 4WHOD 1TMXA 2XSUA 3MV6M 3PCHM 3PCCM 3T63M 1EOBA 3MV4A 4WHQB 3MV6A 1YKKB 3HHYA 3HJSA 3PCGM 3HJ8A 2XSRA 4WHSA 3PCMA 1EOCB 1DLQA 2BUQB 1YKPA 2BUZA 4WHPD 2AZQA 3HJQA 4WHQA 3PCKM 1EOBB 3O6RA 3MFLM 1EOAA 1YKOA 3I51A 1EO9A 3MFLA 1YKLA 4WHRA 3PCAM 3PCEA 3MI1M 3PCLM 2BUWB
chains in the Genus database with same CATH superfamily
1BVSA 1V33A 4OU7A 3WHKA 2LVAA 1L2CA 4PD2A 1QYRA 4JV5M 1G4AE 3SHGB 2BWEA 4AKGA 5LMUM 4G6ZA 1D2NA 4MB7A 1JR3E 3N9TA 1QUSA 2MROB 1YKMB 4IBCA 3UGJA 2MR9A 4FWHA 3GPXA 5KPRA 3GLGA 2DAEA 2BURB 1Z5CA 4AG5A 2FH0A 4G4RA 4XK8F 5FTNA 3SARA 3RE8A 2BUWA 3PCBA 2QBYB 4II7A 1VDDA 3GQ5A 3KS8A 3GLFA 3HKPA 2XF3A 2HCBA 1D0LA 1FJGM 3WHLA 4AI6A 4F2LA 3U60B 1QDTA 3H4JA 2KXEA 4DV4M 5C18A 3KSJA 2DAKA 2LVOC 4L6V6 3FRHA 4QHSA 4CJ6A 4WHRF 3SYKA 1HT2E 1V34A 2P5TA 1R6BX 5EXTA 4LJ8A 2UUBM 5DNYA 1QVRA 1WR1B 5IZ7D 3U6SA 5H37D 2XSZD 2BOYA 1PGYA 5KQ8A 3K9OA 3LMMA 2D7HA 3AKZA 3PCFM 4LGMA 2KNZA 3PCNA 2CEAA 1ORYB 2FOIC 2WSEF 4LF8M 3FYDA 4G4NA 3PCIA 3E46A 3KOXE 1NNUC 1ZMVA 2X49A 3KSXA 3RGPA 1C7YA 4JI3M 1DLMA 1T6OA 3I4VA 3ZC7B 2BV0B 2JY6B 3ILKA 2BUUB 3PCJA 2F5OA 3A46A 4JYAM 3AOGA 2BUYB 1GLNA 2JZ0A 3FUWA 1IQPA 4FW9A 4LFBM 2KRUA 1DV0A 4NXNM 1K82A 5EXPA 3MI1A 3PCLA 2QPAA 2L4FA 3K2LA 3EIHA 3D8BA 4X65M 4GEWA 3VKHA 3C3EA 1LV7A 4WURA 1D0MA 4MGHA 3LKTM 4LF5M 2QSFX 2DNAA 3U60A 2C9OA 2DWLA 3B89A 1EO2A 4B3RM 1GO5A 4FCWA 4DV7M 1QANA 4WHSD 3C3DA 2OQ4A 5IREB 2W82A 4RKUF 2I7PA 5EXSA 2ZBKB 3ZH9B 3T6PA 4WHRB 2QNJA 2KZSA 3HZJA 4I5SA 2L6OA 2JXNA 5ITQA 1JQJC 3LCVB 1E9SA 1UFZA 4GHLA 4I8OA 3L29A 3SMSA 2BUXA 3B7ZA 3U6LA 1YLAA 3PCHM 4JI2M 5EQTA 2ZM6M 4B3MM 4LCBA 1HQCA 4D81A 1QAMA 4NC6A 3SHFA 1IY1A 4K0KM 2EJSA 4LF9M 3B7NA 2XEPA 3PCGM 2F5QA 4NL4H 5KQDA 2UUAM 4IBEA 1G8PA 4OW0A 3TWMA 2N35A 4JI7M 1QDRA 3MJ5A 2KHHA 4IIWA 4QNMA 3AFHA 3K9PA 3T1YM 1YKPA 2RGOA 1XNQM 4WHQA 5LMNM 1PJJA 4JI8M 5ITUA 3VDPA 2CP8A 4B7HA 2CFOA 3U6PA 1IBLM 4JI6M 2EO2A 1XMQM 3VKGA 3J2PB 1DO2A 4P17A 4DV2M 1TH2A 1VDLA 3KOWE 3I51A 4UN2B 1NV9A 1YKOA 2XH9A 3VFDA 4AQYM 3JAMS 1GABA 2G8LA 3GO8A 1XXHB 4HEOA 1VEKA 2EKFA 3KW6A 3RFWA 4DUZM 3MI1M 3IG8A 5L8RF 2QQ8A 4WHOB 4R3DA 4RNAA 4PDGA 2BUWB 4WHPB 2C98A 1D0KA 2BURA 3PCHA 2KEBA 5EXXA 3B7QA 1R5LA 2LHGA 3KXEC 8CATA 1HNWM 1YKMA 2DZLA 2R6FA 2XSZA 1NV8A 2KRKA 4WP2A 2CV2A 5FLXS 2ZANA 5FSWA 1R2YA 3TL4X 1X37A 2DI0A 3TH1A 4Y28F 1VEGA 1IXSA 1GL6A 3PCIM 7CATA 1ZAEA 1OIPA 1DGHA 3R8FA 4R71A 5EP1A 3HGIA 4MGIE 4M0DA 4CIZA 1NHGC 2R45A 3SMPA 3UMMA 3GQ4A 2C9CA 4PCZA 3GPPA 1MU5A 4KODA 1IN7A 2VQFM 2B3TA 2HAKA 4GMQA 2BNKA 4IBDA 5EP2A 1XXHA 3FUXA 3NWLA 3UJNA 1TGUA 4LJ7A 5FTMA 3J80S 3GRRA 3CTWB 2BUZB 3J27B 4R7GA 4L78A 4M9XA 1YKOB 5GKNA 3MI5A 3L28A 3PCDA 3UZUA 5TD3A 2WZJA 2RGHA 4QOZC 1ZMUA 1IM2A 5E6JA 3GP1A 1L2BA 2E5LM 2JY7A 3K92A 3FRIA 4FD2A 3BBZA 1DLTA 1QAQA 1VEJA 4WW0A 2KNAA 1G41A 2QHOB 2VIIA 2X8AA 1ZMWA 3Q8GA 3PCNM 2NQ8C 3IHPA 4AKHA 2H1RA 2PCDM 1YKNA 2LVQD 3GLFE 3GLIE 1N32M 3T67M 4L4UA 3KP1E 1SXJC 2LHCA 4MH0E 2AHMA 1ZQ9A 3SATA 4B7GA 3L27A 1DGHB 5C1BA 1DMHA 1OIZA 4X64M 1W5SA 4LJAA 3U6QA 3CF6E 4IJEA 2XSVA 2L2DA 1DGBA 3CF2A 3HX3A 2R62A 5FTJA 1L1ZA 1E32A 3VK8A 1IN8A 1TH4A 1XHBA 3KS4A 5DYGA 4ILVA 2JY8A 3D8LA 2XFSA 1L1TA 3DOAA 3LMXM 4DUYM 2R4JA 1NJFA 1Q3BA 4PDIA 1I94M 2BUVB 2BUTA 1QAOA 3M6AA 1IXRC 3GRVA 1S3SA 1IXSB 2QCUA 1NHWC 1S9AA 3HWSA 1QZEA 3PCBM 3TWLA 2KW0A 2YR0A 1PJTA 3A98B 1SG9A 3O6JA 4GKKM 1EO2B 1NVMA 3L26A 2R18A 1AIPC 1L2DA 2LNHC 1YKNB 4A3VB 1TMXA 3MV6M 4GKJM 4FCVA 1WXQA 3SAWA 2WSCF 1XWIA 2BJVA 4OVZA 1XC8A 4WHQB 2KNVA 1G3IA 1WJ7A 1AUAA 1Z6TA 4NSRA 4B7FA 5KO3A 1SXJD 4LGYA 3FTFA 3LVVA 3TQSA 4KLNA 4LF7M 4GH9A 1IN4A 3FYCA 2XSRA 1MJGM 2LVPC 3B9PA 4MM3B 1EOCB 2BUQB 2DAMA 4HLQA 3TPZA 1T3TA 2AZQA 5KPZA 4OX9M 4EIWA 4AZFA 1NSFA 2JWSA 5BR8M 4FCTA 1EOBB 3PCKM 1NO1A 1WGLA 3ZCBB 1G71A 4JN6A 3MK6A 4NSOB 4ANRA 3AL0C 3M7GA 3SC3A 3VLFB 1L8QA 5FTLA 3FTDA 3T38A 4GC5A 1EOAA 2CHQA 1SXJB 1WIVA 3LQRA 2MGWA 4W5WA 2DWZB 3U61B 3FTEA 4KHPM 3MFLA 1E9RA 1TR8A 1OJLA 2DKLA 4BBAA 3PCAM 3NBIA 2JUJA 1PJSA 2JZ1A 3E4RA 1WHCA 3H4MA 1PJQA 1YUBA 2UUCM 1J5EM 3A45A 4M9ZA 1Q39A 4LZZA 4Z8XA 3HHXA 2OOBA 3PVSA 5ITTA 1JR3D 1XNRM 2HL7A 3LMXA 4G3OA 2RKOA 1SXJE 1NJGA 4ILTA 1LTMA 3R9XB 2UXCM 3AJIB 2VF7A 2L7IA 2BUMB 1JR3A 3U5ZA 2LBCA 2QBYA 4WHPA 3SAUA 2ERCA 5ITXA 1P3QQ 1GL7A 2BUYA 2C5RA 3PNYA 4JI4M 2BUMA 3HU3A 4IBGA 2BV0A 2PCDA 3KVWA 1PJIA 3EIEA 1XB2B 1J7KA 3KFUG 2DXIA 4YY3M 4KO8A 2KA6B 1JB0F 1Z5AA 4DR2M 1V92A 2O01F 5IWAM 3LQQA 3MV4M 1DGFA 3AOEA 3I01M 2CUZA 1R7RA 1N77A 1OKSA 3MI5M 1YKPB 2DVWB 1TF0B 4DV0M 4GIPA 2EA0A 2UXBM 4JI5M 3PCCA 1I4WA 4WHSB 2XFTA 1EFUB 2XGNA 3VDUA 2Z8YM 2DWNA 4LRTA 4L15A 3W0LB 4LG2A 2VDBB 5ITRA 3J7AS 1YKKA 1Z59A 2ZTDA 2DZOB 5FTKA 1TTEA 3TWKA 3QWLA 2K0BX 3PCKA 4YHHM 5BPVA 3GLGE 3LCUA 1N36M 4D82A 2H5XA 2JY5A 4MGZE 2DHRA 2DENA 1R4GA 3LVWA 4DV3M 2BUXB 3FUVA 1IY0A 2CRUA 4X66M 1IBMM 3JR5A 3E21A 2CV0A 3BOSA 2Y0QA 2HWJA 2J7NA 3GLFB 4DR3M 2KDLA 4MGKE 3FD9A 3K1JA 3PCGA 3CF0A 2VQEM 2UU9M 2XZFA 4DR4M 4LZJA 4IBKA 4LRSA 3F92A 3U5ZB 1DGGA 1HQYE 3GLGB 4BB9A 3KP0E 1PM5A 3CGWA 2EUCA 4LJ5A 1EIJA 2EKKA 3VK7A 5DFLA 1PRBA 3PCDM 4CGYB 2Y20A 3MMPA 4DV6M 1Q3CA 3U6OA 2DWMA 1F4IA 2Y21A 3T1HM 1A5TA 2D7EA 2R44A 2YFQA 3HY5A 1HR0M 3IECA 3W68A 3LXVA 4G4OA 4AG6A 3U6EA 3GPUA 4NRVA 1G59A 4GC9A 1MX0A 4IJFA 1IFYA 3KOYE 2BUUA 2CHGA 2O5RA 3GLHA 1GJSA 4G4QA 3T67A 3O5UA 1K3XA 4WHOD 4B3SM 5A2QS 4NXMM 2K6BA 3T63M 1EOBA 2G3QA 2LVNC 1N33M 3GRYA 1N78A 3MV6A 1YKKB 3C58A 3U61A 2X4AA 3HHYA 3HJSA 5EJCA 4RF0A 1YSYA 3HJ8A 3HU2A 1NY5A 1SXJA 4DBGB 4WHSA 1DLQA 2R46A 3QYEA 1RU3A 4LJ4A 4WHPD 1NY6A 3HJQA 2L09A 5ITXE 4TUWA 4OVZB 3I04M 2JNHA 3MFLM 5F3WA 4FWGA 4PT5A 2V1UA 1E94E 4LY6A 3C9PA 1EO9A 1IN6A 2CHVA 2QP9X 3AOEC 3KOZE 3PNVA 1H6UA 3W67A 2WSFF 1WGNA 3PFIA 3U6DA 3L25A 2JP7A 3U6CA 4M0WA 3K8ZA 3PCEA 3PCLM 4S12A 4LFAM 2GNOA 2BUTB 3QYBA 1W5TA 3J7BA 3THGA 2YQZA 3TE6A 3LKTA 2MJ5B 3T63A 1OAOC 4GRIA 4DV5M 4DR5M 4F1IA 3PCMM 1OAIA 2DAGA 2OPFA 1XMOM 2OOAA 1GKIA 2J7OA 4L16A 1KYIA 3O32A 2BWBA 3GLIB 3LXVM 1ZV1A 2L4EA 4AW4A 4L8RC 5EP4A 4M9SA 3GLIA 1YKLB 2BUVA 3GRUA 1IXZA 2QZ4A 1OFIA 2RRUA 1OTRA 3GPYA 3UK6A 2FE8A 4CISA 1EOAB 1J09A 3DFZA 4JI0M 2MH8A 4B3TM 2A5YB 3BXWA 4WHOA 3OTOM 3SASA 1HNXM 4JI1M 3PCFA 2Z3XA 3FUTA 1EOCA 2BUQA 4HL4A 2LTUA 2UXDM 1XXHE 1YE9A 4XBOA 4REZA 1IBKM 2FNAA 3HHZA 4Q7JA 4GITA 1VQ1A 4ITQA 4LF6M 2Q2EB 4DR6M 1GVNA 2I7NA 2XZUA 2F5PA 2QENA 2ZAOA 2K9DA 2G5GX 5KPTA 3DZDA 2F5SA 1EE8A 2C99A 4NOOB 2KZUA 3GLHE 3LW5F 5JI2E 2XLJA 3U6MA 1KSFX 2F4VM 2DZNB 2C96A 3I4YA 3IG5A 3JR4A 1OFHA 2Z4RA 4X62M 1N75A 2M60A 3Q8XA 3PCEM 4B08A 1Y8GA 3W0FA 2L7HA 4LJ9A 3PCAA 3DA1A 1Z5BA 1QZMA 3FUUA 4KT0F 1IN5A 2FFJA 2R0IA 4QNRA 3GQ3A 3PCJM 3A42A 3HHWA 4GHAA 3L2AA 1UM8A 1Q02A 2BJWA 2APLA 2J5YA 3GLHB 2HKJA 1TDHA 4I81A 3SFZA 5EP3A 1T43A 3MHVC 3FE3A 2ZAMA 3T15A 1NNJA 2V6ZM 3FKEA 3QAUA 2LH0A 1HT1E 4IBIA 1GJTA 3M0EA 1HNZM 2V1CA 2R4EA 1EO9B 2VF8A 4LJ6A 4I4LA 1MN3A 1IY2A 2Z4SA 2ZTCA 2XSUA 4QOSA 4XGIA 4DV1M 3PXGA 1C1KA 3V76A 3J81S 2D7GA 1K3WA 3PCCM 2Z7JA 2M5ZA 2R65A 5ITYA 3MV4A 3ZQJA 4DR7M 2CWBA 2LWXA 2JA2A 4D80A 2DHYA 3E9SA 2Y0TA 1R2ZA 1KFVA 1OQYA 4IBBA 4ZPXA 5DYIA 2K47A 1QUTA 2YNMD 4AKIA 2F5NA 3PCMA 4Z6YA 1TH3A 1HJPA 3KDSE 5E26A 3B74A 2CE7A 2GQFA 2FS1A 4CHTB 5JI3E 1N34M 2BUZA 4LFCM 4IBJA 3NBXX 2OO9A 4FWDA 4BLCA 2DAIA 4LF4M 4QHTA 1CUKA 1DO0A 4IBFA 4DR1M 4NRWA 5IT9S 3O6RA 3RGSA 2HHHM 4FVMA 3SAVA 3AV0A 2LXEA 4RF1A 1VG5A 3SYLA 1TDZA 1FNNA 3HU1A 2O25A 3SBJA 1QQWA 4MGYE 4P16A 1YKLA 2CV1A 4WHRA 4JXJA 3FTCA
chains in the Genus database with same CATH topology
4OU7A 3WHKA 1L2CA 4PD2A 1QYRA 4JV5M 1G4AE 3SHGB 4AKGA 5LMUM 4G6ZA 1D2NA 4MB7A 3N9TA 1YKMB 4IBCA 3UGJA 4FWHA 3GPXA 5KPRA 3GLGA 2BURB 1Z5CA 4AG5A 4G4RA 2BUWA 5FTNA 3SARA 3RE8A 3PCBA 2QBYB 4II7A 1VDDA 3GQ5A 3KS8A 3GLFA 3HKPA 2XF3A 2HCBA 1FJGM 3WHLA 4AI6A 3U60B 2KXEA 4DV4M 5C18A 3KSJA 4QHSA 4WHRF 3SYKA 1HT2E 2P5TA 1R6BX 5EXTA 4LJ8A 2UUBM 5DNYA 1QVRA 5IZ7D 3U6SA 5H37D 2XSZD 2BOYA 5KQ8A 3LMMA 2D7HA 3AKZA 3PCFM 4LGMA 3PCNA 2CEAA 1ORYB 2FOIC 4LF8M 3FYDA 4G4NA 3PCIA 3KOXE 1NNUC 2X49A 3KSXA 3RGPA 4JI3M 1DLMA 3I4VA 3ZC7B 2BV0B 3ILKA 2BUUB 3PCJA 2F5OA 3A46A 4JYAM 3AOGA 2BUYB 1GLNA 3FUWA 3PCCA 4FW9A 1IQPA 4LFBM 2KRUA 4NXNM 1K82A 5EXPA 3MI1A 3PCLA 2QPAA 3K2LA 3EIHA 3D8BA 4X65M 3VKHA 1LV7A 4WURA 4MGHA 3LKTM 4LF5M 3U60A 2C9OA 2DWLA 1EO2A 4B3RM 4FCWA 4DV7M 1QANA 4WHSD 2OQ4A 5IREB 2W82A 2I7PA 5EXSA 2ZBKB 3ZH9B 4WHRB 2KZSA 4I5SA 2L6OA 5ITQA 4GHLA 1JQJC 1E9SA 4I8OA 3L29A 3SMSA 2BUXA 3U6LA 3PCHM 4JI2M 5EQTA 2ZM6M 4B3MM 4LCBA 1HQCA 4D81A 1QAMA 3SHFA 1IY1A 4K0KM 4LF9M 2XEPA 3PCGM 2F5QA 4NL4H 5KQDA 2UUAM 4IBEA 1G8PA 4OW0A 3TWMA 4JI7M 3MJ5A 4QNMA 4IIWA 3T1YM 3AFHA 1YKPA 2RGOA 1XNQM 4WHQA 5LMNM 1PJJA 4JI8M 5ITUA 3VDPA 3U6PA 4B7HA 2CFOA 1IBLM 4JI6M 2EO2A 1XMQM 3VKGA 3J2PB 1DO2A 4DV2M 1TH2A 3KOWE 1YKOA 3I51A 2XH9A 3VFDA 4AQYM 3JAMS 2G8LA 3GO8A 1XXHB 3KW6A 4DUZM 3RFWA 3MI1M 3IG8A 4WHOB 4R3DA 4RNAA 4PDGA 2BUWB 4WHPB 2C98A 2BURA 3PCHA 2KEBA 5EXXA 3KXEC 1HNWM 8CATA 1YKMA 2CV2A 2XSZA 2KRKA 5FLXS 2ZANA 5FSWA 1R2YA 3TL4X 1X37A 3TH1A 1GL6A 3PCIM 7CATA 1ZAEA 1DGHA 3R8FA 5EP1A 3HGIA 4MGIE 4M0DA 1NHGC 2R45A 3SMPA 3UMMA 3GQ4A 2C9CA 4PCZA 3GPPA 1MU5A 4KODA 1IN7A 2VQFM 4GMQA 2BNKA 4IBDA 5EP2A 1XXHA 3FUXA 3NWLA 3UJNA 1TGUA 4LJ7A 5FTMA 3J80S 3GRRA 3CTWB 2BUZB 3J27B 4R7GA 4L78A 4M9XA 1YKOB 5GKNA 3MI5A 3L28A 3PCDA 3UZUA 5TD3A 2RGHA 4QOZC 1IM2A 5E6JA 3GP1A 1L2BA 2E5LM 3K92A 4FD2A 1DLTA 1QAQA 4WW0A 1G41A 2VIIA 2X8AA 3PCNM 2NQ8C 4AKHA 2H1RA 2PCDM 1YKNA 1N32M 3T67M 4L4UA 3KP1E 1SXJC 4MH0E 3SATA 2AHMA 1ZQ9A 4B7GA 3L27A 1DGHB 5C1BA 1DMHA 4X64M 1W5SA 4LJAA 3U6QA 3CF6E 4IJEA 2XSVA 1DGBA 3CF2A 2R62A 5FTJA 1L1ZA 1E32A 3VK8A 1IN8A 1TH4A 1XHBA 3KS4A 5DYGA 4ILVA 3D8LA 2XFSA 1L1TA 3DOAA 3LMXM 4DUYM 2R4JA 1NJFA 1Q3BA 4PDIA 1I94M 2BUVB 2BUTA 1QAOA 3M6AA 1IXRC 3GRVA 1S3SA 1IXSB 2QCUA 1NHWC 1S9AA 3HWSA 3PCBM 3TWLA 2KW0A 2YR0A 3A98B 3O6JA 4GKKM 1EO2B 1NVMA 3L26A 2R18A 1L2DA 1YKNB 2LNHC 4A3VB 1TMXA 3MV6M 4GKJM 4FCVA 1WXQA 3SAWA 4OVZA 1XWIA 2BJVA 1XC8A 4WHQB 4NSRA 1G3IA 1Z6TA 3FTFA 4B7FA 5KO3A 1SXJD 4LGYA 3LVVA 3TQSA 4KLNA 4LF7M 4GH9A 1IN4A 3FYCA 2XSRA 3B9PA 4MM3B 1EOCB 2BUQB 4HLQA 3TPZA 1T3TA 2AZQA 5KPZA 4OX9M 4EIWA 4AZFA 1NSFA 5BR8M 3PCKM 4FCTA 3AL0C 3ZCBB 4JN6A 3MK6A 4NSOB 3M7GA 3SC3A 3VLFB 1L8QA 5FTLA 3FTDA 3T38A 4GC5A 1EOAA 2CHQA 1SXJB 3LQRA 4W5WA 2DWZB 3U61B 3FTEA 4KHPM 3MFLA 1E9RA 1OJLA 4BBAA 3PCAM 3NBIA 3E4RA 3H4MA 1YUBA 2UUCM 1J5EM 3A45A 4M9ZA 1Q39A 4LZZA 4Z8XA 3HHXA 3PVSA 3LMXA 5ITTA 1JR3D 1XNRM 2HL7A 2RKOA 1SXJE 1NJGA 4ILTA 2UXCM 3R9XB 3AJIB 2BUMB 2L7IA 1JR3A 3U5ZA 2QBYA 4WHPA 3SAUA 2ERCA 5ITXA 1GL7A 2BUYA 2C5RA 3PNYA 4JI4M 2BUMA 3HU3A 4IBGA 2BV0A 2PCDA 3KVWA 1PJIA 3EIEA 1J7KA 3KFUG 2DXIA 4YY3M 4KO8A 2KA6B 1Z5AA 4DR2M 5IWAM 3LQQA 3MV4M 1DGFA 3AOEA 2CUZA 1R7RA 1N77A 3MI5M 1YKPB 2DVWB 4DV0M 4GIPA 2EA0A 2UXBM 4JI5M 4WHSB 1I4WA 2XFTA 2XGNA 3VDUA 2DWNA 4LRTA 4L15A 3W0LB 4LG2A 3J7AS 5ITRA 1YKKA 1Z59A 3TWKA 2DZOB 5FTKA 3QWLA 3PCKA 4YHHM 5BPVA 1N36M 4D82A 4MGZE 2DHRA 4DV3M 3LVWA 2BUXB 3FUVA 1IY0A 4X66M 1IBMM 3JR5A 2CV0A 3BOSA 2Y0QA 4DR3M 2J7NA 3GLFB 4MGKE 3FD9A 3K1JA 3PCGA 3CF0A 2VQEM 2UU9M 2XZFA 4DR4M 4LZJA 4IBKA 4LRSA 3U5ZB 1PM5A 1DGGA 1HQYE 3GLGB 4BB9A 3KP0E 2EUCA 4LJ5A 3VK7A 3PCDM 4CGYB 2Y20A 4DV6M 2DWMA 1Q3CA 3U6OA 2Y21A 3T1HM 2D7EA 2YFQA 1HR0M 3LXVA 4G4OA 4AG6A 3U6EA 3GPUA 4NRVA 1G59A 4GC9A 1MX0A 4IJFA 3KOYE 2BUUA 2CHGA 2O5RA 3GLHA 3T67A 4G4QA 3O5UA 1K3XA 4WHOD 4B3SM 5A2QS 4NXMM 3T63M 1EOBA 1N33M 3GRYA 1N78A 3MV6A 1YKKB 3C58A 3U61A 2X4AA 3HHYA 3HJSA 5EJCA 4RF0A 1YSYA 3HJ8A 3HU2A 1NY5A 1SXJA 4WHSA 1DLQA 2R46A 4LJ4A 4WHPD 1NY6A 3HJQA 2L09A 5ITXE 4TUWA 4OVZB 3MFLM 5F3WA 4FWGA 4PT5A 2V1UA 1E94E 4LY6A 1EO9A 1IN6A 2CHVA 2QP9X 3AOEC 3KOZE 3PNVA 1H6UA 3L25A 3PFIA 3U6DA 3U6CA 4M0WA 3K8ZA 3PCEA 3PCLM 4S12A 4LFAM 2BUTB 3THGA 1W5TA 3J7BA 2YQZA 3TE6A 3LKTA 3T63A 4GRIA 4DV5M 4DR5M 3PCMM 2OPFA 1XMOM 4L16A 1GKIA 2J7OA 3O32A 1KYIA 3GLIB 3LXVM 4L8RC 4AW4A 5EP4A 4M9SA 3GLIA 1YKLB 2BUVA 3GRUA 1IXZA 2QZ4A 1OFIA 3GPYA 3UK6A 2FE8A 4CISA 1EOAB 1J09A 3DFZA 4JI0M 4B3TM 2A5YB 4WHOA 3OTOM 3SASA 1HNXM 4JI1M 3PCFA 2Z3XA 3FUTA 1EOCA 2BUQA 4HL4A 2UXDM 1YE9A 4XBOA 4REZA 1IBKM 2FNAA 3HHZA 4ITQA 4GITA 4LF6M 4DR6M 2Q2EB 1GVNA 2I7NA 2XZUA 2F5PA 2QENA 2ZAOA 2G5GX 5KPTA 3DZDA 2F5SA 1EE8A 2C99A 4NOOB 2KZUA 5JI2E 2F4VM 2XLJA 3U6MA 1KSFX 2DZNB 2C96A 3I4YA 3IG5A 3JR4A 1OFHA 2Z4RA 4X62M 1N75A 2M60A 3Q8XA 3PCEM 4B08A 3W0FA 2L7HA 4LJ9A 3PCAA 3DA1A 1Z5BA 1QZMA 3FUUA 1IN5A 2FFJA 4QNRA 3GQ3A 3PCJM 3HHWA 3A42A 4GHAA 3L2AA 1UM8A 2BJWA 3GLHB 3SFZA 2HKJA 1TDHA 4I81A 5EP3A 3MHVC 2ZAMA 3T15A 1NNJA 2V6ZM 3QAUA 3FKEA 2LH0A 1HT1E 4IBIA 3M0EA 1HNZM 2V1CA 2R4EA 1EO9B 4LJ6A 4I4LA 2Z4SA 1IY2A 2XSUA 4QOSA 4XGIA 4DV1M 3PXGA 1C1KA 3J81S 1K3WA 2D7GA 3PCCM 2Z7JA 2M5ZA 2R65A 5ITYA 3MV4A 4DR7M 2LWXA 2JA2A 4D80A 3E9SA 2Y0TA 1R2ZA 1KFVA 4ZPXA 4IBBA 4AKIA 5DYIA 2K47A 2YNMD 2F5NA 3PCMA 4Z6YA 1TH3A 3KDSE 5E26A 4CHTB 2CE7A 5JI3E 1N34M 2BUZA 4LFCM 4IBJA 4FWDA 4BLCA 4LF4M 1EOBB 4QHTA 1DO0A 5IT9S 4IBFA 4DR1M 4NRWA 3O6RA 3RGSA 2HHHM 4FVMA 3SAVA 3AV0A 2LXEA 4RF1A 3SYLA 1TDZA 1FNNA 3HU1A 3SBJA 1QQWA 4MGYE 4P16A 1YKLA 2CV1A 4WHRA 4JXJA 3FTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WHP B;  2BUR A;  2BUT B;  3PCH A;  1YKM A;  3LKT A;  3T63 A;  3HHX A;  3LMX A;  3N9T A;  3PCM M;  1YKM B;  3O32 A;  4ILT A;  2BUR B;  2BUM B;  3LXV M;  3TH1 A;  4WHP A;  2BUW A;  3PCI M;  3PCB A;  4WHO B;  2BUY A;  3HKP A;  2BUM A;  1YKL B;  2BUV A;  2BV0 A;  2PCD A;  3HGI A;  1EOA B;  4WHR F;  3MV4 M;  4WHO A;  3MI5 M;  1YKP B;  2BUZ B;  3PCF A;  1EOC A;  2BUQ A;  4WHS B;  2BOY A;  1YKO B;  3MI5 A;  3PCD A;  5TD3 A;  3PCF M;  1YKK A;  3PCN A;  3PCI A;  3PCK A;  1DLT A;  3PCN M;  2PCD M;  1YKN A;  2BUX B;  3T67 M;  3I4Y A;  1DLM A;  3I4V A;  2BV0 B;  2BUU B;  3PCJ A;  1DMH A;  2BUY B;  3PCE M;  3PCC A;  3PCG A;  3PCA A;  3MI1 A;  3PCL A;  2XSV A;  3PCJ M;  3LKT M;  4ILV A;  3LMX M;  1EO2 A;  3PCD M;  2BUV B;  4WHS D;  2BUT A;  3LXV A;  1S9A A;  3PCB M;  4WHR B;  3O6J A;  2BUU A;  1EO9 B;  1EO2 B;  3T67 A;  2BUX A;  3O5U A;  1YKN B;  4WHO D;  1TMX A;  2XSU A;  3MV6 M;  3PCH M;  3PCC M;  3T63 M;  1EOB A;  3MV4 A;  4WHQ B;  3MV6 A;  1YKK B;  3HHY A;  3HJS A;  3PCG M;  3HJ8 A;  2XSR A;  4WHS A;  3PCM A;  1EOC B;  1DLQ A;  2BUQ B;  1YKP A;  2BUZ A;  4WHP D;  2AZQ A;  3HJQ A;  4WHQ A;  3PCK M;  1EOB B;  3O6R A;  3MFL M;  1EOA A;  1YKO A;  3I51 A;  1EO9 A;  3MFL A;  1YKL A;  4WHR A;  3PCA M;  3PCE A;  3MI1 M;  3PCL M;  2BUW B; 
#chains in the Genus database with same CATH topology
 1BVS A;  1V33 A;  4OU7 A;  3WHK A;  2LVA A;  1L2C A;  4PD2 A;  1QYR A;  4JV5 M;  1G4A E;  3SHG B;  2BWE A;  4AKG A;  5LMU M;  4G6Z A;  1D2N A;  4MB7 A;  1JR3 E;  3N9T A;  1QUS A;  2MRO B;  1YKM B;  4IBC A;  3UGJ A;  2MR9 A;  4FWH A;  3GPX A;  5KPR A;  3GLG A;  2DAE A;  2BUR B;  1Z5C A;  4AG5 A;  2FH0 A;  4G4R A;  4XK8 F;  5FTN A;  3SAR A;  3RE8 A;  2BUW A;  3PCB A;  2QBY B;  4II7 A;  1VDD A;  3GQ5 A;  3KS8 A;  3GLF A;  3HKP A;  2XF3 A;  2HCB A;  1D0L A;  1FJG M;  3WHL A;  4AI6 A;  4F2L A;  3U60 B;  1QDT A;  3H4J A;  2KXE A;  4DV4 M;  5C18 A;  3KSJ A;  2DAK A;  2LVO C;  4L6V 6;  3FRH A;  4QHS A;  4CJ6 A;  4WHR F;  3SYK A;  1HT2 E;  1V34 A;  2P5T A;  1R6B X;  5EXT A;  4LJ8 A;  2UUB M;  5DNY A;  1QVR A;  1WR1 B;  5IZ7 D;  3U6S A;  5H37 D;  2XSZ D;  2BOY A;  1PGY A;  5KQ8 A;  3K9O A;  3LMM A;  2D7H A;  3AKZ A;  3PCF M;  4LGM A;  2KNZ A;  3PCN A;  2CEA A;  1ORY B;  2FOI C;  2WSE F;  4LF8 M;  3FYD A;  4G4N A;  3PCI A;  3E46 A;  3KOX E;  1NNU C;  1ZMV A;  2X49 A;  3KSX A;  3RGP A;  1C7Y A;  4JI3 M;  1DLM A;  1T6O A;  3I4V A;  3ZC7 B;  2BV0 B;  2JY6 B;  3ILK A;  2BUU B;  3PCJ A;  2F5O A;  3A46 A;  4JYA M;  3AOG A;  2BUY B;  1GLN A;  2JZ0 A;  3FUW A;  1IQP A;  4FW9 A;  4LFB M;  2KRU A;  1DV0 A;  4NXN M;  1K82 A;  5EXP A;  3MI1 A;  3PCL A;  2QPA A;  2L4F A;  3K2L A;  3EIH A;  3D8B A;  4X65 M;  4GEW A;  3VKH A;  3C3E A;  1LV7 A;  4WUR A;  1D0M A;  4MGH A;  3LKT M;  4LF5 M;  2QSF X;  2DNA A;  3U60 A;  2C9O A;  2DWL A;  3B89 A;  1EO2 A;  4B3R M;  1GO5 A;  4FCW A;  4DV7 M;  1QAN A;  4WHS D;  3C3D A;  2OQ4 A;  5IRE B;  2W82 A;  4RKU F;  2I7P A;  5EXS A;  2ZBK B;  3ZH9 B;  3T6P A;  4WHR B;  2QNJ A;  2KZS A;  3HZJ A;  4I5S A;  2L6O A;  2JXN A;  5ITQ A;  1JQJ C;  3LCV B;  1E9S A;  1UFZ A;  4GHL A;  4I8O A;  3L29 A;  3SMS A;  2BUX A;  3B7Z A;  3U6L A;  1YLA A;  3PCH M;  4JI2 M;  5EQT A;  2ZM6 M;  4B3M M;  4LCB A;  1HQC A;  4D81 A;  1QAM A;  4NC6 A;  3SHF A;  1IY1 A;  4K0K M;  2EJS A;  4LF9 M;  3B7N A;  2XEP A;  3PCG M;  2F5Q A;  4NL4 H;  5KQD A;  2UUA M;  4IBE A;  1G8P A;  4OW0 A;  3TWM A;  2N35 A;  4JI7 M;  1QDR A;  3MJ5 A;  2KHH A;  4IIW A;  4QNM A;  3AFH A;  3K9P A;  3T1Y M;  1YKP A;  2RGO A;  1XNQ M;  4WHQ A;  5LMN M;  1PJJ A;  4JI8 M;  5ITU A;  3VDP A;  2CP8 A;  4B7H A;  2CFO A;  3U6P A;  1IBL M;  4JI6 M;  2EO2 A;  1XMQ M;  3VKG A;  3J2P B;  1DO2 A;  4P17 A;  4DV2 M;  1TH2 A;  1VDL A;  3KOW E;  3I51 A;  4UN2 B;  1NV9 A;  1YKO A;  2XH9 A;  3VFD A;  4AQY M;  3JAM S;  1GAB A;  2G8L A;  3GO8 A;  1XXH B;  4HEO A;  1VEK A;  2EKF A;  3KW6 A;  3RFW A;  4DUZ M;  3MI1 M;  3IG8 A;  5L8R F;  2QQ8 A;  4WHO B;  4R3D A;  4RNA A;  4PDG A;  2BUW B;  4WHP B;  2C98 A;  1D0K A;  2BUR A;  3PCH A;  2KEB A;  5EXX A;  3B7Q A;  1R5L A;  2LHG A;  3KXE C;  8CAT A;  1HNW M;  1YKM A;  2DZL A;  2R6F A;  2XSZ A;  1NV8 A;  2KRK A;  4WP2 A;  2CV2 A;  5FLX S;  2ZAN A;  5FSW A;  1R2Y A;  3TL4 X;  1X37 A;  2DI0 A;  3TH1 A;  4Y28 F;  1VEG A;  1IXS A;  1GL6 A;  3PCI M;  7CAT A;  1ZAE A;  1OIP A;  1DGH A;  3R8F A;  4R71 A;  5EP1 A;  3HGI A;  4MGI E;  4M0D A;  4CIZ A;  1NHG C;  2R45 A;  3SMP A;  3UMM A;  3GQ4 A;  2C9C A;  4PCZ A;  3GPP A;  1MU5 A;  4KOD A;  1IN7 A;  2VQF M;  2B3T A;  2HAK A;  4GMQ A;  2BNK A;  4IBD A;  5EP2 A;  1XXH A;  3FUX A;  3NWL A;  3UJN A;  1TGU A;  4LJ7 A;  5FTM A;  3J80 S;  3GRR A;  3CTW B;  2BUZ B;  3J27 B;  4R7G A;  4L78 A;  4M9X A;  1YKO B;  5GKN A;  3MI5 A;  3L28 A;  3PCD A;  3UZU A;  5TD3 A;  2WZJ A;  2RGH A;  4QOZ C;  1ZMU A;  1IM2 A;  5E6J A;  3GP1 A;  1L2B A;  2E5L M;  2JY7 A;  3K92 A;  3FRI A;  4FD2 A;  3BBZ A;  1DLT A;  1QAQ A;  1VEJ A;  4WW0 A;  2KNA A;  1G41 A;  2QHO B;  2VII A;  2X8A A;  1ZMW A;  3Q8G A;  3PCN M;  2NQ8 C;  3IHP A;  4AKH A;  2H1R A;  2PCD M;  1YKN A;  2LVQ D;  3GLF E;  3GLI E;  1N32 M;  3T67 M;  4L4U A;  3KP1 E;  1SXJ C;  2LHC A;  4MH0 E;  2AHM A;  1ZQ9 A;  3SAT A;  4B7G A;  3L27 A;  1DGH B;  5C1B A;  1DMH A;  1OIZ A;  4X64 M;  1W5S A;  4LJA A;  3U6Q A;  3CF6 E;  4IJE A;  2XSV A;  2L2D A;  1DGB A;  3CF2 A;  3HX3 A;  2R62 A;  5FTJ A;  1L1Z A;  1E32 A;  3VK8 A;  1IN8 A;  1TH4 A;  1XHB A;  3KS4 A;  5DYG A;  4ILV A;  2JY8 A;  3D8L A;  2XFS A;  1L1T A;  3DOA A;  3LMX M;  4DUY M;  2R4J A;  1NJF A;  1Q3B A;  4PDI A;  1I94 M;  2BUV B;  2BUT A;  1QAO A;  3M6A A;  1IXR C;  3GRV A;  1S3S A;  1IXS B;  2QCU A;  1NHW C;  1S9A A;  3HWS A;  1QZE A;  3PCB M;  3TWL A;  2KW0 A;  2YR0 A;  1PJT A;  3A98 B;  1SG9 A;  3O6J A;  4GKK M;  1EO2 B;  1NVM A;  3L26 A;  2R18 A;  1AIP C;  1L2D A;  2LNH C;  1YKN B;  4A3V B;  1TMX A;  3MV6 M;  4GKJ M;  4FCV A;  1WXQ A;  3SAW A;  2WSC F;  1XWI A;  2BJV A;  4OVZ A;  1XC8 A;  4WHQ B;  2KNV A;  1G3I A;  1WJ7 A;  1AUA A;  1Z6T A;  4NSR A;  4B7F A;  5KO3 A;  1SXJ D;  4LGY A;  3FTF A;  3LVV A;  3TQS A;  4KLN A;  4LF7 M;  4GH9 A;  1IN4 A;  3FYC A;  2XSR A;  1MJG M;  2LVP C;  3B9P A;  4MM3 B;  1EOC B;  2BUQ B;  2DAM A;  4HLQ A;  3TPZ A;  1T3T A;  2AZQ A;  5KPZ A;  4OX9 M;  4EIW A;  4AZF A;  1NSF A;  2JWS A;  5BR8 M;  4FCT A;  1EOB B;  3PCK M;  1NO1 A;  1WGL A;  3ZCB B;  1G71 A;  4JN6 A;  3MK6 A;  4NSO B;  4ANR A;  3AL0 C;  3M7G A;  3SC3 A;  3VLF B;  1L8Q A;  5FTL A;  3FTD A;  3T38 A;  4GC5 A;  1EOA A;  2CHQ A;  1SXJ B;  1WIV A;  3LQR A;  2MGW A;  4W5W A;  2DWZ B;  3U61 B;  3FTE A;  4KHP M;  3MFL A;  1E9R A;  1TR8 A;  1OJL A;  2DKL A;  4BBA A;  3PCA M;  3NBI A;  2JUJ A;  1PJS A;  2JZ1 A;  3E4R A;  1WHC A;  3H4M A;  1PJQ A;  1YUB A;  2UUC M;  1J5E M;  3A45 A;  4M9Z A;  1Q39 A;  4LZZ A;  4Z8X A;  3HHX A;  2OOB A;  3PVS A;  5ITT A;  1JR3 D;  1XNR M;  2HL7 A;  3LMX A;  4G3O A;  2RKO A;  1SXJ E;  1NJG A;  4ILT A;  1LTM A;  3R9X B;  2UXC M;  3AJI B;  2VF7 A;  2L7I A;  2BUM B;  1JR3 A;  3U5Z A;  2LBC A;  2QBY A;  4WHP A;  3SAU A;  2ERC A;  5ITX A;  1P3Q Q;  1GL7 A;  2BUY A;  2C5R A;  3PNY A;  4JI4 M;  2BUM A;  3HU3 A;  4IBG A;  2BV0 A;  2PCD A;  3KVW A;  1PJI A;  3EIE A;  1XB2 B;  1J7K A;  3KFU G;  2DXI A;  4YY3 M;  4KO8 A;  2KA6 B;  1JB0 F;  1Z5A A;  4DR2 M;  1V92 A;  2O01 F;  5IWA M;  3LQQ A;  3MV4 M;  1DGF A;  3AOE A;  3I01 M;  2CUZ A;  1R7R A;  1N77 A;  1OKS A;  3MI5 M;  1YKP B;  2DVW B;  1TF0 B;  4DV0 M;  4GIP A;  2EA0 A;  2UXB M;  4JI5 M;  3PCC A;  1I4W A;  4WHS B;  2XFT A;  1EFU B;  2XGN A;  3VDU A;  2Z8Y M;  2DWN A;  4LRT A;  4L15 A;  3W0L B;  4LG2 A;  2VDB B;  5ITR A;  3J7A S;  1YKK A;  1Z59 A;  2ZTD A;  2DZO B;  5FTK A;  1TTE A;  3TWK A;  3QWL A;  2K0B X;  3PCK A;  4YHH M;  5BPV A;  3GLG E;  3LCU A;  1N36 M;  4D82 A;  2H5X A;  2JY5 A;  4MGZ E;  2DHR A;  2DEN A;  1R4G A;  3LVW A;  4DV3 M;  2BUX B;  3FUV A;  1IY0 A;  2CRU A;  4X66 M;  1IBM M;  3JR5 A;  3E21 A;  2CV0 A;  3BOS A;  2Y0Q A;  2HWJ A;  2J7N A;  3GLF B;  4DR3 M;  2KDL A;  4MGK E;  3FD9 A;  3K1J A;  3PCG A;  3CF0 A;  2VQE M;  2UU9 M;  2XZF A;  4DR4 M;  4LZJ A;  4IBK A;  4LRS A;  3F92 A;  3U5Z B;  1DGG A;  1HQY E;  3GLG B;  4BB9 A;  3KP0 E;  1PM5 A;  3CGW A;  2EUC A;  4LJ5 A;  1EIJ A;  2EKK A;  3VK7 A;  5DFL A;  1PRB A;  3PCD M;  4CGY B;  2Y20 A;  3MMP A;  4DV6 M;  1Q3C A;  3U6O A;  2DWM A;  1F4I A;  2Y21 A;  3T1H M;  1A5T A;  2D7E A;  2R44 A;  2YFQ A;  3HY5 A;  1HR0 M;  3IEC A;  3W68 A;  3LXV A;  4G4O A;  4AG6 A;  3U6E A;  3GPU A;  4NRV A;  1G59 A;  4GC9 A;  1MX0 A;  4IJF A;  1IFY A;  3KOY E;  2BUU A;  2CHG A;  2O5R A;  3GLH A;  1GJS A;  4G4Q A;  3T67 A;  3O5U A;  1K3X A;  4WHO D;  4B3S M;  5A2Q S;  4NXM M;  2K6B A;  3T63 M;  1EOB A;  2G3Q A;  2LVN C;  1N33 M;  3GRY A;  1N78 A;  3MV6 A;  1YKK B;  3C58 A;  3U61 A;  2X4A A;  3HHY A;  3HJS A;  5EJC A;  4RF0 A;  1YSY A;  3HJ8 A;  3HU2 A;  1NY5 A;  1SXJ A;  4DBG B;  4WHS A;  1DLQ A;  2R46 A;  3QYE A;  1RU3 A;  4LJ4 A;  4WHP D;  1NY6 A;  3HJQ A;  2L09 A;  5ITX E;  4TUW A;  4OVZ B;  3I04 M;  2JNH A;  3MFL M;  5F3W A;  4FWG A;  4PT5 A;  2V1U A;  1E94 E;  4LY6 A;  3C9P A;  1EO9 A;  1IN6 A;  2CHV A;  2QP9 X;  3AOE C;  3KOZ E;  3PNV A;  1H6U A;  3W67 A;  2WSF F;  1WGN A;  3PFI A;  3U6D A;  3L25 A;  2JP7 A;  3U6C A;  4M0W A;  3K8Z A;  3PCE A;  3PCL M;  4S12 A;  4LFA M;  2GNO A;  2BUT B;  3QYB A;  1W5T A;  3J7B A;  3THG A;  2YQZ A;  3TE6 A;  3LKT A;  2MJ5 B;  3T63 A;  1OAO C;  4GRI A;  4DV5 M;  4DR5 M;  4F1I A;  3PCM M;  1OAI A;  2DAG A;  2OPF A;  1XMO M;  2OOA A;  1GKI A;  2J7O A;  4L16 A;  1KYI A;  3O32 A;  2BWB A;  3GLI B;  3LXV M;  1ZV1 A;  2L4E A;  4AW4 A;  4L8R C;  5EP4 A;  4M9S A;  3GLI A;  1YKL B;  2BUV A;  3GRU A;  1IXZ A;  2QZ4 A;  1OFI A;  2RRU A;  1OTR A;  3GPY A;  3UK6 A;  2FE8 A;  4CIS A;  1EOA B;  1J09 A;  3DFZ A;  4JI0 M;  2MH8 A;  4B3T M;  2A5Y B;  3BXW A;  4WHO A;  3OTO M;  3SAS A;  1HNX M;  4JI1 M;  3PCF A;  2Z3X A;  3FUT A;  1EOC A;  2BUQ A;  4HL4 A;  2LTU A;  2UXD M;  1XXH E;  1YE9 A;  4XBO A;  4REZ A;  1IBK M;  2FNA A;  3HHZ A;  4Q7J A;  4GIT A;  1VQ1 A;  4ITQ A;  4LF6 M;  2Q2E B;  4DR6 M;  1GVN A;  2I7N A;  2XZU A;  2F5P A;  2QEN A;  2ZAO A;  2K9D A;  2G5G X;  5KPT A;  3DZD A;  2F5S A;  1EE8 A;  2C99 A;  4NOO B;  2KZU A;  3GLH E;  3LW5 F;  5JI2 E;  2XLJ A;  3U6M A;  1KSF X;  2F4V M;  2DZN B;  2C96 A;  3I4Y A;  3IG5 A;  3JR4 A;  1OFH A;  2Z4R A;  4X62 M;  1N75 A;  2M60 A;  3Q8X A;  3PCE M;  4B08 A;  1Y8G A;  3W0F A;  2L7H A;  4LJ9 A;  3PCA A;  3DA1 A;  1Z5B A;  1QZM A;  3FUU A;  4KT0 F;  1IN5 A;  2FFJ A;  2R0I A;  4QNR A;  3GQ3 A;  3PCJ M;  3A42 A;  3HHW A;  4GHA A;  3L2A A;  1UM8 A;  1Q02 A;  2BJW A;  2APL A;  2J5Y A;  3GLH B;  2HKJ A;  1TDH A;  4I81 A;  3SFZ A;  5EP3 A;  1T43 A;  3MHV C;  3FE3 A;  2ZAM A;  3T15 A;  1NNJ A;  2V6Z M;  3FKE A;  3QAU A;  2LH0 A;  1HT1 E;  4IBI A;  1GJT A;  3M0E A;  1HNZ M;  2V1C A;  2R4E A;  1EO9 B;  2VF8 A;  4LJ6 A;  4I4L A;  1MN3 A;  1IY2 A;  2Z4S A;  2ZTC A;  2XSU A;  4QOS A;  4XGI A;  4DV1 M;  3PXG A;  1C1K A;  3V76 A;  3J81 S;  2D7G A;  1K3W A;  3PCC M;  2Z7J A;  2M5Z A;  2R65 A;  5ITY A;  3MV4 A;  3ZQJ A;  4DR7 M;  2CWB A;  2LWX A;  2JA2 A;  4D80 A;  2DHY A;  3E9S A;  2Y0T A;  1R2Z A;  1KFV A;  1OQY A;  4IBB A;  4ZPX A;  5DYI A;  2K47 A;  1QUT A;  2YNM D;  4AKI A;  2F5N A;  3PCM A;  4Z6Y A;  1TH3 A;  1HJP A;  3KDS E;  5E26 A;  3B74 A;  2CE7 A;  2GQF A;  2FS1 A;  4CHT B;  5JI3 E;  1N34 M;  2BUZ A;  4LFC M;  4IBJ A;  3NBX X;  2OO9 A;  4FWD A;  4BLC A;  2DAI A;  4LF4 M;  4QHT A;  1CUK A;  1DO0 A;  4IBF A;  4DR1 M;  4NRW A;  5IT9 S;  3O6R A;  3RGS A;  2HHH M;  4FVM A;  3SAV A;  3AV0 A;  2LXE A;  4RF1 A;  1VG5 A;  3SYL A;  1TDZ A;  1FNN A;  3HU1 A;  2O25 A;  3SBJ A;  1QQW A;  4MGY E;  4P16 A;  1YKL A;  2CV1 A;  4WHR A;  4JXJ A;  3FTC A; 
#chains in the Genus database with same CATH homology
 4OU7 A;  3WHK A;  1L2C A;  4PD2 A;  1QYR A;  4JV5 M;  1G4A E;  3SHG B;  4AKG A;  5LMU M;  4G6Z A;  1D2N A;  4MB7 A;  3N9T A;  1YKM B;  4IBC A;  3UGJ A;  4FWH A;  3GPX A;  5KPR A;  3GLG A;  2BUR B;  1Z5C A;  4AG5 A;  4G4R A;  2BUW A;  5FTN A;  3SAR A;  3RE8 A;  3PCB A;  2QBY B;  4II7 A;  1VDD A;  3GQ5 A;  3KS8 A;  3GLF A;  3HKP A;  2XF3 A;  2HCB A;  1FJG M;  3WHL A;  4AI6 A;  3U60 B;  2KXE A;  4DV4 M;  5C18 A;  3KSJ A;  4QHS A;  4WHR F;  3SYK A;  1HT2 E;  2P5T A;  1R6B X;  5EXT A;  4LJ8 A;  2UUB M;  5DNY A;  1QVR A;  5IZ7 D;  3U6S A;  5H37 D;  2XSZ D;  2BOY A;  5KQ8 A;  3LMM A;  2D7H A;  3AKZ A;  3PCF M;  4LGM A;  3PCN A;  2CEA A;  1ORY B;  2FOI C;  4LF8 M;  3FYD A;  4G4N A;  3PCI A;  3KOX E;  1NNU C;  2X49 A;  3KSX A;  3RGP A;  4JI3 M;  1DLM A;  3I4V A;  3ZC7 B;  2BV0 B;  3ILK A;  2BUU B;  3PCJ A;  2F5O A;  3A46 A;  4JYA M;  3AOG A;  2BUY B;  1GLN A;  3FUW A;  3PCC A;  4FW9 A;  1IQP A;  4LFB M;  2KRU A;  4NXN M;  1K82 A;  5EXP A;  3MI1 A;  3PCL A;  2QPA A;  3K2L A;  3EIH A;  3D8B A;  4X65 M;  3VKH A;  1LV7 A;  4WUR A;  4MGH A;  3LKT M;  4LF5 M;  3U60 A;  2C9O A;  2DWL A;  1EO2 A;  4B3R M;  4FCW A;  4DV7 M;  1QAN A;  4WHS D;  2OQ4 A;  5IRE B;  2W82 A;  2I7P A;  5EXS A;  2ZBK B;  3ZH9 B;  4WHR B;  2KZS A;  4I5S A;  2L6O A;  5ITQ A;  4GHL A;  1JQJ C;  1E9S A;  4I8O A;  3L29 A;  3SMS A;  2BUX A;  3U6L A;  3PCH M;  4JI2 M;  5EQT A;  2ZM6 M;  4B3M M;  4LCB A;  1HQC A;  4D81 A;  1QAM A;  3SHF A;  1IY1 A;  4K0K M;  4LF9 M;  2XEP A;  3PCG M;  2F5Q A;  4NL4 H;  5KQD A;  2UUA M;  4IBE A;  1G8P A;  4OW0 A;  3TWM A;  4JI7 M;  3MJ5 A;  4QNM A;  4IIW A;  3T1Y M;  3AFH A;  1YKP A;  2RGO A;  1XNQ M;  4WHQ A;  5LMN M;  1PJJ A;  4JI8 M;  5ITU A;  3VDP A;  3U6P A;  4B7H A;  2CFO A;  1IBL M;  4JI6 M;  2EO2 A;  1XMQ M;  3VKG A;  3J2P B;  1DO2 A;  4DV2 M;  1TH2 A;  3KOW E;  1YKO A;  3I51 A;  2XH9 A;  3VFD A;  4AQY M;  3JAM S;  2G8L A;  3GO8 A;  1XXH B;  3KW6 A;  4DUZ M;  3RFW A;  3MI1 M;  3IG8 A;  4WHO B;  4R3D A;  4RNA A;  4PDG A;  2BUW B;  4WHP B;  2C98 A;  2BUR A;  3PCH A;  2KEB A;  5EXX A;  3KXE C;  1HNW M;  8CAT A;  1YKM A;  2CV2 A;  2XSZ A;  2KRK A;  5FLX S;  2ZAN A;  5FSW A;  1R2Y A;  3TL4 X;  1X37 A;  3TH1 A;  1GL6 A;  3PCI M;  7CAT A;  1ZAE A;  1DGH A;  3R8F A;  5EP1 A;  3HGI A;  4MGI E;  4M0D A;  1NHG C;  2R45 A;  3SMP A;  3UMM A;  3GQ4 A;  2C9C A;  4PCZ A;  3GPP A;  1MU5 A;  4KOD A;  1IN7 A;  2VQF M;  4GMQ A;  2BNK A;  4IBD A;  5EP2 A;  1XXH A;  3FUX A;  3NWL A;  3UJN A;  1TGU A;  4LJ7 A;  5FTM A;  3J80 S;  3GRR A;  3CTW B;  2BUZ B;  3J27 B;  4R7G A;  4L78 A;  4M9X A;  1YKO B;  5GKN A;  3MI5 A;  3L28 A;  3PCD A;  3UZU A;  5TD3 A;  2RGH A;  4QOZ C;  1IM2 A;  5E6J A;  3GP1 A;  1L2B A;  2E5L M;  3K92 A;  4FD2 A;  1DLT A;  1QAQ A;  4WW0 A;  1G41 A;  2VII A;  2X8A A;  3PCN M;  2NQ8 C;  4AKH A;  2H1R A;  2PCD M;  1YKN A;  1N32 M;  3T67 M;  4L4U A;  3KP1 E;  1SXJ C;  4MH0 E;  3SAT A;  2AHM A;  1ZQ9 A;  4B7G A;  3L27 A;  1DGH B;  5C1B A;  1DMH A;  4X64 M;  1W5S A;  4LJA A;  3U6Q A;  3CF6 E;  4IJE A;  2XSV A;  1DGB A;  3CF2 A;  2R62 A;  5FTJ A;  1L1Z A;  1E32 A;  3VK8 A;  1IN8 A;  1TH4 A;  1XHB A;  3KS4 A;  5DYG A;  4ILV A;  3D8L A;  2XFS A;  1L1T A;  3DOA A;  3LMX M;  4DUY M;  2R4J A;  1NJF A;  1Q3B A;  4PDI A;  1I94 M;  2BUV B;  2BUT A;  1QAO A;  3M6A A;  1IXR C;  3GRV A;  1S3S A;  1IXS B;  2QCU A;  1NHW C;  1S9A A;  3HWS A;  3PCB M;  3TWL A;  2KW0 A;  2YR0 A;  3A98 B;  3O6J A;  4GKK M;  1EO2 B;  1NVM A;  3L26 A;  2R18 A;  1L2D A;  1YKN B;  2LNH C;  4A3V B;  1TMX A;  3MV6 M;  4GKJ M;  4FCV A;  1WXQ A;  3SAW A;  4OVZ A;  1XWI A;  2BJV A;  1XC8 A;  4WHQ B;  4NSR A;  1G3I A;  1Z6T A;  3FTF A;  4B7F A;  5KO3 A;  1SXJ D;  4LGY A;  3LVV A;  3TQS A;  4KLN A;  4LF7 M;  4GH9 A;  1IN4 A;  3FYC A;  2XSR A;  3B9P A;  4MM3 B;  1EOC B;  2BUQ B;  4HLQ A;  3TPZ A;  1T3T A;  2AZQ A;  5KPZ A;  4OX9 M;  4EIW A;  4AZF A;  1NSF A;  5BR8 M;  3PCK M;  4FCT A;  3AL0 C;  3ZCB B;  4JN6 A;  3MK6 A;  4NSO B;  3M7G A;  3SC3 A;  3VLF B;  1L8Q A;  5FTL A;  3FTD A;  3T38 A;  4GC5 A;  1EOA A;  2CHQ A;  1SXJ B;  3LQR A;  4W5W A;  2DWZ B;  3U61 B;  3FTE A;  4KHP M;  3MFL A;  1E9R A;  1OJL A;  4BBA A;  3PCA M;  3NBI A;  3E4R A;  3H4M A;  1YUB A;  2UUC M;  1J5E M;  3A45 A;  4M9Z A;  1Q39 A;  4LZZ A;  4Z8X A;  3HHX A;  3PVS A;  3LMX A;  5ITT A;  1JR3 D;  1XNR M;  2HL7 A;  2RKO A;  1SXJ E;  1NJG A;  4ILT A;  2UXC M;  3R9X B;  3AJI B;  2BUM B;  2L7I A;  1JR3 A;  3U5Z A;  2QBY A;  4WHP A;  3SAU A;  2ERC A;  5ITX A;  1GL7 A;  2BUY A;  2C5R A;  3PNY A;  4JI4 M;  2BUM A;  3HU3 A;  4IBG A;  2BV0 A;  2PCD A;  3KVW A;  1PJI A;  3EIE A;  1J7K A;  3KFU G;  2DXI A;  4YY3 M;  4KO8 A;  2KA6 B;  1Z5A A;  4DR2 M;  5IWA M;  3LQQ A;  3MV4 M;  1DGF A;  3AOE A;  2CUZ A;  1R7R A;  1N77 A;  3MI5 M;  1YKP B;  2DVW B;  4DV0 M;  4GIP A;  2EA0 A;  2UXB M;  4JI5 M;  4WHS B;  1I4W A;  2XFT A;  2XGN A;  3VDU A;  2DWN A;  4LRT A;  4L15 A;  3W0L B;  4LG2 A;  3J7A S;  5ITR A;  1YKK A;  1Z59 A;  3TWK A;  2DZO B;  5FTK A;  3QWL A;  3PCK A;  4YHH M;  5BPV A;  1N36 M;  4D82 A;  4MGZ E;  2DHR A;  4DV3 M;  3LVW A;  2BUX B;  3FUV A;  1IY0 A;  4X66 M;  1IBM M;  3JR5 A;  2CV0 A;  3BOS A;  2Y0Q A;  4DR3 M;  2J7N A;  3GLF B;  4MGK E;  3FD9 A;  3K1J A;  3PCG A;  3CF0 A;  2VQE M;  2UU9 M;  2XZF A;  4DR4 M;  4LZJ A;  4IBK A;  4LRS A;  3U5Z B;  1PM5 A;  1DGG A;  1HQY E;  3GLG B;  4BB9 A;  3KP0 E;  2EUC A;  4LJ5 A;  3VK7 A;  3PCD M;  4CGY B;  2Y20 A;  4DV6 M;  2DWM A;  1Q3C A;  3U6O A;  2Y21 A;  3T1H M;  2D7E A;  2YFQ A;  1HR0 M;  3LXV A;  4G4O A;  4AG6 A;  3U6E A;  3GPU A;  4NRV A;  1G59 A;  4GC9 A;  1MX0 A;  4IJF A;  3KOY E;  2BUU A;  2CHG A;  2O5R A;  3GLH A;  3T67 A;  4G4Q A;  3O5U A;  1K3X A;  4WHO D;  4B3S M;  5A2Q S;  4NXM M;  3T63 M;  1EOB A;  1N33 M;  3GRY A;  1N78 A;  3MV6 A;  1YKK B;  3C58 A;  3U61 A;  2X4A A;  3HHY A;  3HJS A;  5EJC A;  4RF0 A;  1YSY A;  3HJ8 A;  3HU2 A;  1NY5 A;  1SXJ A;  4WHS A;  1DLQ A;  2R46 A;  4LJ4 A;  4WHP D;  1NY6 A;  3HJQ A;  2L09 A;  5ITX E;  4TUW A;  4OVZ B;  3MFL M;  5F3W A;  4FWG A;  4PT5 A;  2V1U A;  1E94 E;  4LY6 A;  1EO9 A;  1IN6 A;  2CHV A;  2QP9 X;  3AOE C;  3KOZ E;  3PNV A;  1H6U A;  3L25 A;  3PFI A;  3U6D A;  3U6C A;  4M0W A;  3K8Z A;  3PCE A;  3PCL M;  4S12 A;  4LFA M;  2BUT B;  3THG A;  1W5T A;  3J7B A;  2YQZ A;  3TE6 A;  3LKT A;  3T63 A;  4GRI A;  4DV5 M;  4DR5 M;  3PCM M;  2OPF A;  1XMO M;  4L16 A;  1GKI A;  2J7O A;  3O32 A;  1KYI A;  3GLI B;  3LXV M;  4L8R C;  4AW4 A;  5EP4 A;  4M9S A;  3GLI A;  1YKL B;  2BUV A;  3GRU A;  1IXZ A;  2QZ4 A;  1OFI A;  3GPY A;  3UK6 A;  2FE8 A;  4CIS A;  1EOA B;  1J09 A;  3DFZ A;  4JI0 M;  4B3T M;  2A5Y B;  4WHO A;  3OTO M;  3SAS A;  1HNX M;  4JI1 M;  3PCF A;  2Z3X A;  3FUT A;  1EOC A;  2BUQ A;  4HL4 A;  2UXD M;  1YE9 A;  4XBO A;  4REZ A;  1IBK M;  2FNA A;  3HHZ A;  4ITQ A;  4GIT A;  4LF6 M;  4DR6 M;  2Q2E B;  1GVN A;  2I7N A;  2XZU A;  2F5P A;  2QEN A;  2ZAO A;  2G5G X;  5KPT A;  3DZD A;  2F5S A;  1EE8 A;  2C99 A;  4NOO B;  2KZU A;  5JI2 E;  2F4V M;  2XLJ A;  3U6M A;  1KSF X;  2DZN B;  2C96 A;  3I4Y A;  3IG5 A;  3JR4 A;  1OFH A;  2Z4R A;  4X62 M;  1N75 A;  2M60 A;  3Q8X A;  3PCE M;  4B08 A;  3W0F A;  2L7H A;  4LJ9 A;  3PCA A;  3DA1 A;  1Z5B A;  1QZM A;  3FUU A;  1IN5 A;  2FFJ A;  4QNR A;  3GQ3 A;  3PCJ M;  3HHW A;  3A42 A;  4GHA A;  3L2A A;  1UM8 A;  2BJW A;  3GLH B;  3SFZ A;  2HKJ A;  1TDH A;  4I81 A;  5EP3 A;  3MHV C;  2ZAM A;  3T15 A;  1NNJ A;  2V6Z M;  3QAU A;  3FKE A;  2LH0 A;  1HT1 E;  4IBI A;  3M0E A;  1HNZ M;  2V1C A;  2R4E A;  1EO9 B;  4LJ6 A;  4I4L A;  2Z4S A;  1IY2 A;  2XSU A;  4QOS A;  4XGI A;  4DV1 M;  3PXG A;  1C1K A;  3J81 S;  1K3W A;  2D7G A;  3PCC M;  2Z7J A;  2M5Z A;  2R65 A;  5ITY A;  3MV4 A;  4DR7 M;  2LWX A;  2JA2 A;  4D80 A;  3E9S A;  2Y0T A;  1R2Z A;  1KFV A;  4ZPX A;  4IBB A;  4AKI A;  5DYI A;  2K47 A;  2YNM D;  2F5N A;  3PCM A;  4Z6Y A;  1TH3 A;  3KDS E;  5E26 A;  4CHT B;  2CE7 A;  5JI3 E;  1N34 M;  2BUZ A;  4LFC M;  4IBJ A;  4FWD A;  4BLC A;  4LF4 M;  1EOB B;  4QHT A;  1DO0 A;  5IT9 S;  4IBF A;  4DR1 M;  4NRW A;  3O6R A;  3RGS A;  2HHH M;  4FVM A;  3SAV A;  3AV0 A;  2LXE A;  4RF1 A;  3SYL A;  1TDZ A;  1FNN A;  3HU1 A;  3SBJ A;  1QQW A;  4MGY E;  4P16 A;  1YKL A;  2CV1 A;  4WHR A;  4JXJ A;  3FTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...