4JI7M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji7M02
1XC8A 2F5PA 2EA0A 3U6SA 1XMOM 3J80S 3VK7A 3JAMS 1FJGM 3U6PA 1N34M 3GPYA 4JI3M 1IBKM 5IWAM 3TWMA 2UXDM 3T1YM 4DV2M 3J7AS 4YY3M 5ITUA 1L2CA 4CISA 4JI5M 4K0KM 1L2BA 3GPUA 4LF8M 2XZFA 2OPFA 4NXMM 1PJJA 5ITTA 4G4RA 4NRWA 3JR5A 1Z5BA 4JYAM 4DR3M 1K82A 1KFVA 2UXCM 2UUBM 3T1HM 1Q3CA 1XNRM 4DUYM 4DV3M 4G4OA 1N32M 5ITYA 4DV0M 3A46A 4KHPM 3DOAA 3U6MA 3SASA 4DV5M 2E5LM 1XMQM 4NXNM 3GP1A 5LMNM 5IT9S 3A42A 4DV6M 1J5EM 4PD2A 2UUCM 4B3SM 4LF5M 4DR5M 1MX0A 4OX9M 3JR4A 4JI2M 2UXBM 4GKKM 4LF6M 4PCZA 4JV5M 5FLXS 4X66M 3GPPA 4DR7M 3GQ4A 1N36M 2F5OA 3U6LA 4JI0M 3OTOM 4JI4M 3J81S 3TWKA 1K3XA 2XZUA 1L2DA 5ITQA 5ITRA 1Q3BA 4MB7A 3U6EA 4JI1M 4AQYM 1HNZM 4PDGA 1MU5A 2F5QA 1L1TA 2Q2EB 3U6QA 4DV1M 4ITQA 3GQ3A 3GO8A 3U6CA 3SAUA 4LF4M 1K3WA 1Q39A 1TDZA 2VQEM 4B3TM 1IBMM 4X64M 4DV4M 4JI8M 5BR8M 3GPXA 1Z59A 4B3RM 4YHHM 4LF9M 2UUAM 2ZM6M 1TDHA 2UU9M 3GQ5A 4LFCM 4LFBM 2OQ4A 3SATA 1PM5A 3SAVA 4DR4M 4G4QA 2ZBKB 1HR0M 1PJIA 4DR6M 5ITXA 1R2ZA 1I94M 1L1ZA 4DUZM 4NRVA 1HNXM 4G4NA 1N33M 4DR2M 4X62M 2F5SA 4B3MM 1IBLM 3U6DA 4JI7M 4DV7M 3W0FA 4PDIA 3SAWA 1Z5AA 1XNQM 2VQFM 2F4VM 5A2QS 4LFAM 3A45A 1NNJA 1EE8A 4DR1M 2HHHM 4LF7M 3C58A 1R2YA 3TWLA 3U6OA 5LMUM 1HNWM 2HKJA 3SBJA 3SARA 2F5NA 1Z5CA 3VK8A 4JI6M 5ITXE 4X65M 4GKJM
chains in the Genus database with same CATH superfamily
3QYEA 4GMQA 3U6SA 3J80S 1XMOM 3L26A 1ZV1A 2FOIC 3I4VA 1ZAEA 2FH0A 3T6PA 5ITUA 1GJTA 4CISA 2KDLA 3HJSA 2DI0A 4JI5M 3B89A 3IG8A 4Q7JA 3I04M 3RE8A 1L2BA 1SG9A 2WSFF 4LF8M 1R5LA 2R45A 4R71A 2R44A 2OPFA 2LVAA 1PJJA 2MJ5B 3ZCBB 3J2PB 3Q8XA 2UUBM 1D0KA 2KZSA 3GRVA 5C18A 1XXHA 2ZTDA 4OVZB 5ITYA 1LV7A 2ERCA 2JXNA 4DV0M 2B3TA 3KVWA 5KPZA 4IBGA 1HT1E 2JP7A 1SXJC 2D7EA 2DHRA 2VIIA 3PVSA 1IXSA 1VQ1A 3A42A 4DV6M 4B3SM 3L28A 2CV1A 2W82A 4LJ4A 4OX9M 1VDDA 2HAKA 1CUKA 1NY5A 3BBZA 3LCVB 1IXRC 3KFUG 1IQPA 3H4MA 4OW0A 3SMSA 3E4RA 4DR7M 3HU3A 1R4GA 2JNHA 3U5ZA 3U6LA 1G59A 3E9SA 3QWLA 2ZANA 2JY6B 4D80A 2DZLA 4CHTB 5FTLA 4CIZA 3KOYE 3J81S 5EP2A 3TWKA 4JI4M 2RRUA 2R4JA 5ITRA 3PNYA 2L4FA 2R62A 1HT2E 1GKIA 4PDGA 3HGIA 1XXHB 3HHXA 1QAOA 3MJ5A 4OU7A 5L8RF 2LTUA 1J7KA 4QNMA 3RFWA 2G3QA 1E9RA 2YFQA 2DXIA 1OIZA 2K9DA 3FD9A 1AIPC 2VQEM 1IXSB 2RGHA 2QZ4A 1IN6A 3FUWA 2A5YB 2QHOB 1RU3A 2LVOC 3I4YA 3KP0E 3GPXA 2WZJA 2KZUA 3M6AA 1QZEA 2KNAA 5KQDA 3GLFE 1V33A 2K0BX 2UU9M 4I4LA 3T15A 4LCBA 2FNAA 1YE9A 1GL7A 4FCWA 3UZUA 4G4QA 1R7RA 3U5ZB 2ZBKB 3VDPA 4BLCA 4ZPXA 1OFIA 4HLQA 1IN5A 4M9ZA 4NC6A 5FTMA 3V76A 3B7NA 3CF2A 3KDSE 2QP9X 4DUZM 2MR9A 3RGPA 1IN7A 1PRBA 1HQYE 4DBGB 4LJ9A 1JR3A 4LJ5A 1OTRA 3LQQA 5GKNA 4FWGA 3GLGA 3W0FA 1E94E 4PDIA 3GLIA 1GABA 1Z5AA 2F4VM 3AOEC 4IBCA 5A2QS 2CHVA 3FUVA 1N77A 1HJPA 4L78A 4L4UA 2HHHM 3HHWA 3C58A 1QUSA 4LZJA 1P3QQ 5FSWA 3SARA 4XBOA 2GQFA 1QYRA 2VF8A 1NHGC 2DAGA 4GKJM 2I7NA 2F5PA 2EA0A 1GLNA 2R4EA 3SHGB 2R18A 3KW6A 1FJGM 1N34M 5EXSA 3J27B 4ANRA 1DGFA 2XEPA 4LZZA 4M9XA 2KNZA 2UXDM 3VKHA 4DV2M 3J7AS 1L2CA 4FVMA 1SXJA 1ZMWA 3SHFA 1WIVA 3SYKA 2H5XA 2J7NA 3GLGB 2Y0TA 3LVVA 3HX3A 2D7HA 1TGUA 4GEWA 4LRSA 1XB2B 5DYIA 1E9SA 1QANA 2C5RA 4LJ7A 5C1BA 2JY5A 4B08A 4G4RA 2UXCM 4DR3M 3KOZE 1K82A 5KPTA 2OO9A 3LQRA 4IBJA 2QCUA 3FUXA 1D0LA 2ZAOA 4W5WA 1JQJC 1N32M 1XXHE 3M7GA 2CWBA 3A98B 3B9PA 2Z3XA 4FCTA 4IIWA 1XMQM 2CV0A 3FTDA 1QVRA 3GP1A 2ZAMA 3WHKA 4L8RC 2R65A 1R6BX 4B7GA 1J5EM 4D82A 1NJFA 2LH0A 4KO8A 4MH0E 3WHLA 3LW5F 4LF5M 2DAIA 4Y28F 3I51A 4QOZC 4MM3B 3SC3A 4F2LA 4NSOB 1SXJB 3CF6E 4PCZA 2GNOA 4WP2A 2QNJA 3GPPA 4UN2B 3D8BA 1N36M 3DFZA 3PXGA 1DO2A 1IY1A 1K3XA 2LHGA 2G8LA 3IECA 3ILKA 5ITQA 2EKKA 4MB7A 1IY0A 1QQWA 2BWEA 2C9CA 4RNAA 3VLFB 2BJVA 3U6EA 4GITA 3GQ3A 1D2NA 1F4IA 1YUBA 3SAUA 2DZOB 1DGHA 1VEJA 2XFTA 3AV0A 3ZC7B 1TDZA 1K3WA 3BOSA 3GRRA 2FFJA 4MGYE 1WGLA 2LBCA 3I01M 2KHHA 2JY7A 5BR8M 2XSZA 1Z59A 1D0MA 2XH9A 4FW9A 2J7OA 3UK6A 2R6FA 3ZH9B 4LF9M 3B7ZA 4RF1A 2D7GA 1IN8A 4LFCM 4LFBM 4MGIE 5H37D 3NWLA 3AOEA 1IY2A 4KT0F 3SAVA 3GLHE 3MMPA 4QNRA 3GRUA 1N75A 1I94M 3EIEA 1XHBA 4MGKE 1NHWC 2L2DA 1HNXM 4G4NA 3HJ8A 4QOSA 5E6JA 4DR2M 2EKFA 3IHPA 4HEOA 1JR3E 1ORYB 4LGMA 4XK8F 4REZA 4WURA 4LJ8A 4WW0A 2O25A 5EJCA 3SAWA 2XLJA 1QAMA 1MJGM 2BWBA 1HQCA 2VQFM 2APLA 2HL7A 1T3TA 4LFAM 3W0LB 5KO3A 3A45A 4AG5A 3OTOM 1EE8A 3FYCA 4IBDA 2HWJA 4XGIA 1IFYA 4BB9A 3GRYA 5EQTA 4EIWA 4GHAA 2QENA 3U6OA 5LMUM 1QUTA 1HNWM 3IG5A 1LTMA 1NVMA 2F5NA 2EUCA 3THGA 3SYLA 3R9XB 3VK8A 2M5ZA 5DYGA 5ITXE 1TTEA 1E32A 3FRHA 5IT9S 2KXEA 1XC8A 3T38A 4AKIA 1T43A 2BJWA 3HU2A 1ZQ9A 1IXZA 3HY5A 2FE8A 3JAMS 3D8LA 3GPYA 2X49A 5JI2E 3FUUA 5IWAM 3TWMA 4I8OA 4YY3M 2XF3A 4AKHA 4R3DA 4AW4A 4IBKA 4IBEA 4TUWA 5FTKA 3W67A 2CP8A 2LNHC 2FS1A 4NXMM 2DWZB 2R0IA 1WJ7A 1W5TA 3K2LA 2O5RA 2O01F 3JR5A 1TH2A 4JYAM 1WHCA 2DVWB 2LVPC 4II7A 3T1HM 1Q3CA 2XFSA 4FD2A 2Z8YM 4KLNA 3A46A 4KHPM 2C98A 3DOAA 3U6MA 5FTJA 3SASA 1EFUB 4DV5M 2E5LM 2XGNA 3FTCA 4JXJA 2CRUA 4G3OA 2KA6B 2YNMD 3KS8A 1IN4A 4FWDA 4B7FA 4PD2A 2UUCM 4DR5M 2CHGA 4PT5A 4JI2M 3MHVC 4M9SA 4GKKM 2QQ8A 1NO1A 1AUAA 2L6OA 1V34A 4LF6M 3GLIB 3GLFA 3UMMA 3QAUA 4X66M 3MK6A 3GQ4A 3J7BA 1DGBA 5F3WA 4A3VB 4JI0M 1DV0A 2WSCF 5EXTA 1BVSA 4GRIA 5BPVA 4M0DA 1TH3A 8CATA 2XZUA 1L2DA 1JR3D 1Q3BA 2LHCA 4L16A 3VKGA 2Y21A 1HNZM 4R7GA 1UM8A 2F5QA 2EJSA 2CUZA 5IZ7D 4S12A 1GVNA 3FUTA 3FYDA 3M0EA 3GO8A 1IM2A 3DZDA 3R8FA 1OAOC 5EP1A 1YLAA 1VEGA 3KXEC 1Q39A 1YSYA 3FE3A 1OFHA 3QYBA 3KP1E 4M0WA 3K9PA 4B3TM 4X64M 1X37A 3BXWA 4DV4M 4LG2A 2LXEA 2L7HA 2WSEF 3C3DA 4B3RM 2DZNB 4LJAA 3TQSA 3L27A 4YHHM 3HU1A 4F1IA 2ZM6M 3GLFB 3GQ5A 3SATA 3DA1A 5DFLA 4IBBA 4DR4M 2JUJA 3TPZA 3AJIB 2K47A 1HR0M 4DR6M 3E46A 2V1UA 2YQZA 4NOOB 1OJLA 3U61A 3K1JA 1L1ZA 2QSFX 1SXJD 1V92A 4NRVA 3LMMA 1N33M 2X8AA 3Q8GA 1TR8A 2P5TA 2QPAA 3AFHA 4IBFA 3C3EA 4MGZE 3UGJA 2F5SA 2DAEA 5EP3A 3CGWA 4P17A 4FCVA 3U6DA 5EP4A 4AKGA 1G71A 1OKSA 3HZJA 4NL4H 4HL4A 3U60A 4LRTA 1NY6A 1WGNA 1DO0A 4QHTA 1XNQM 4IJEA 2RGOA 5KQ8A 1Y8GA 1OAIA 2MGWA 2Z4RA 4BBAA 3CF0A 4P16A 3L29A 1I4WA 4DR1M 3FTFA 1PJSA 1S3SA 5FTNA 3TWLA 4I81A 2DWNA 3F92A 1L8QA 2CEAA 1G41A 2KNVA 2HCBA 1QDTA 1OQYA 4JN6A 3U6CA 4Z8XA 1NSFA 1NV9A 1ZMVA 3VFDA 3U61B 1GJSA 3VK7A 2G5GX 1C7YA 3U6PA 2CFOA 3PFIA 4JI3M 1IBKM 1Q02A 3KSXA 3T1YM 4RF0A 1PGYA 3GLGE 3W68A 3KS4A 3GLIE 1H6UA 4GIPA 1DGHB 1OIPA 2MH8A 2OOAA 1VDLA 2KW0A 3U60B 4K0KM 2CE7A 3GPUA 2RKOA 5E26A 2XZFA 4GH9A 3B7QA 5ITTA 4NRWA 1XWIA 3K8ZA 1Z5BA 1KFVA 2DNAA 2C99A 4RKUF 3KOXE 1XNRM 4DUYM 4DV3M 4G4OA 5DNYA 3K92A 1QDRA 4B7HA 3L25A 2XSZD 3NBIA 4NXNM 4CJ6A 1MN3A 5LMNM 4L15A 3E21A 2DAKA 7CATA 1GO5A 2Y0QA 1GL6A 1PJQA 2OOBA 2J5YA 2DAMA 1MX0A 4I5SA 4QHSA 3FRIA 1QZMA 3TL4X 5KPRA 3JR4A 2CV2A 2UXBM 1SXJE 4L6V6 4LJ6A 1N78A 5EXXA 1VG5A 3HHYA 2DKLA 3PNVA 1VEKA 2KEBA 5FLXS 2N35A 4JV5M 3KOWE 1J09A 3AOGA 1QAQA 1TH4A 4AG6A 3B74A 3UJNA 3FKEA 2F5OA 2VF7A 3GLHA 3VDUA 2DHYA 2K6BA 2L09A 2LVQD 4JI1M 4AQYM 3HKPA 1MU5A 2JWSA 1L1TA 2Q2EB 3SFZA 3U6QA 4DV1M 4ITQA 1NJGA 2V1CA 3K9OA 1W5SA 3LVWA 3NBXX 2H1RA 3AKZA 2DENA 2QBYA 1DGGA 2AHMA 2VDBB 2LWXA 3KSJA 5IREB 4LF4M 3TE6A 3FTEA 4GHLA 1IBMM 2L7IA 3HHZA 3ZQJA 4AI6A 4JI8M 2DWMA 2JZ1A 4IJFA 1FNNA 2C96A 2KRUA 2Y20A 1Z6TA 3SMPA 2UUAM 1UFZA 3EIHA 1NV8A 1A5TA 1TDHA 2YR0A 3HWSA 1C1KA 2C9OA 2R46A 5EXPA 2OQ4A 1PM5A 3AL0C 2LVNC 4GC5A 4NSRA 2EO2A 3GLHB 4G6ZA 1PJIA 5ITXA 1R2ZA 2JA2A 1WXQA 4D81A 3CTWB 2M60A 4X62M 1T6OA 1PJTA 4MGHA 4B3MM 3H4JA 1IBLM 2X4AA 2QBYB 4JI7M 4DV7M 2BNKA 1NNUC 2L4EA 1G4AE 1ZMUA 4FWHA 2I7PA 2ZTCA 4AZFA 2CHQA 3L2AA 1EIJA 2Z4SA 1WR1B 1KSFX 2JY8A 2JZ0A 2KRKA 2MROB 4LY6A 5JI3E 2NQ8C 4IBIA 1NNJA 3C9PA 2Z7JA 4LF7M 3LCUA 4Z6YA 1JB0F 1R2YA 4LGYA 4OVZA 4KODA 2HKJA 1G3IA 3RGSA 3SBJA 2V6ZM 3HJQA 4CGYB 4GC9A 2DWLA 1Z5CA 1G8PA 4JI6M 1KYIA 4X65M 1TF0B
chains in the Genus database with same CATH topology
4GMQA 3U6SA 3J80S 1XMOM 3L26A 2FOIC 3I4VA 1ZAEA 5ITUA 4CISA 3HJSA 4JI5M 3IG8A 3RE8A 1L2BA 4LF8M 2R45A 2OPFA 1PJJA 3ZCBB 3J2PB 3Q8XA 2UUBM 2KZSA 3GRVA 5C18A 1XXHA 4OVZB 5ITYA 1LV7A 2ERCA 4DV0M 3KVWA 5KPZA 4IBGA 1HT1E 1SXJC 2D7EA 2DHRA 2VIIA 3PVSA 3A42A 4DV6M 4B3SM 3L28A 2CV1A 2W82A 4LJ4A 4OX9M 1VDDA 1NY5A 1IXRC 3KFUG 1IQPA 3H4MA 4OW0A 3SMSA 3E4RA 4DR7M 3HU3A 1G59A 3U5ZA 3U6LA 3E9SA 3QWLA 2ZANA 4D80A 3OTOM 4CHTB 3J81S 5FTLA 4JI4M 3KOYE 5EP2A 3TWKA 2R4JA 5ITRA 3PNYA 2R62A 1HT2E 1GKIA 4PDGA 3HGIA 1XXHB 3HHXA 1QAOA 3MJ5A 4OU7A 3RFWA 1J7KA 4QNMA 1E9RA 2YFQA 2DXIA 3FD9A 2VQEM 1IXSB 2RGHA 2QZ4A 1IN6A 3FUWA 2A5YB 3I4YA 3KP0E 3GPXA 2KZUA 3M6AA 5KQDA 2UU9M 4I4LA 3T15A 4LCBA 2FNAA 1YE9A 1GL7A 4FCWA 3UZUA 4G4QA 1R7RA 3U5ZB 2ZBKB 3VDPA 4BLCA 4ZPXA 1OFIA 4HLQA 1IN5A 4M9ZA 4DUZM 5FTMA 3CF2A 3KDSE 2QP9X 3RGPA 1IN7A 1HQYE 4LJ9A 1JR3A 4LJ5A 3LQQA 5GKNA 3GLGA 4FWGA 3W0FA 1E94E 4PDIA 3GLIA 1Z5AA 2F4VM 3AOEC 4IBCA 5A2QS 2CHVA 3FUVA 1N77A 4L78A 4L4UA 2HHHM 3HHWA 3C58A 4LZJA 5FSWA 3SARA 4XBOA 1QYRA 1NHGC 4GKJM 2I7NA 2F5PA 2EA0A 1GLNA 2R4EA 3SHGB 2R18A 3KW6A 1FJGM 1N34M 5EXSA 3J27B 1DGFA 2XEPA 4LZZA 4M9XA 2UXDM 3VKHA 4DV2M 3J7AS 1L2CA 4FVMA 1SXJA 3SHFA 3GLGB 3SYKA 2J7NA 2Y0TA 3LVVA 2D7HA 1TGUA 4LRSA 5DYIA 1E9SA 1QANA 2C5RA 4LJ7A 5C1BA 4G4RA 4B08A 2UXCM 4DR3M 3KOZE 1K82A 5KPTA 4IBJA 3LQRA 2QCUA 3FUXA 2ZAOA 4W5WA 1JQJC 1N32M 3M7GA 3A98B 3B9PA 2Z3XA 4FCTA 4IIWA 1XMQM 2CV0A 3FTDA 1QVRA 3GP1A 2ZAMA 3WHKA 4L8RC 2R65A 1R6BX 4B7GA 1J5EM 4D82A 1NJFA 2LH0A 4KO8A 4MH0E 3WHLA 4LF5M 3I51A 4QOZC 4MM3B 3SC3A 4NSOB 1SXJB 3CF6E 4PCZA 3GPPA 1N36M 3D8BA 3DFZA 3PXGA 1DO2A 1IY1A 1K3XA 3ILKA 2G8LA 5ITQA 4MB7A 4RNAA 1IY0A 1QQWA 2C9CA 3VLFB 3U6EA 2BJVA 4GITA 3GQ3A 1D2NA 1YUBA 3SAUA 2DZOB 1DGHA 2XFTA 3AV0A 3ZC7B 1TDZA 1K3WA 3BOSA 3GRRA 2FFJA 4MGYE 5BR8M 2XSZA 1Z59A 2XH9A 4FW9A 2J7OA 3UK6A 4LF9M 3ZH9B 4RF1A 2D7GA 1IN8A 4LFCM 4LFBM 4MGIE 5H37D 3NWLA 3AOEA 1IY2A 3SAVA 4QNRA 3GRUA 1N75A 1I94M 3EIEA 1XHBA 4MGKE 1NHWC 1HNXM 4G4NA 3HJ8A 4QOSA 5E6JA 4DR2M 1ORYB 4LGMA 4REZA 4WURA 4LJ8A 4WW0A 5EJCA 3SAWA 2XLJA 1QAMA 2VQFM 1HQCA 2HL7A 1T3TA 4LFAM 3W0LB 5KO3A 3A45A 4AG5A 1EE8A 3FYCA 4IBDA 4XGIA 4BB9A 3GRYA 5EQTA 4EIWA 4GHAA 2QENA 3U6OA 5LMUM 1HNWM 3IG5A 1NVMA 2F5NA 3R9XB 2EUCA 3THGA 3SYLA 3VK8A 2M5ZA 5DYGA 5ITXE 1E32A 5IT9S 2KXEA 1XC8A 3T38A 4AKIA 2BJWA 3HU2A 1ZQ9A 1IXZA 2FE8A 3JAMS 3D8LA 3GPYA 2X49A 5JI2E 3FUUA 5IWAM 3TWMA 4I8OA 4YY3M 2XF3A 4AKHA 4R3DA 4AW4A 4IBKA 4IBEA 4TUWA 5FTKA 2LNHC 4NXMM 2DWZB 1W5TA 3K2LA 2O5RA 3JR5A 4JYAM 1TH2A 2DVWB 4II7A 3T1HM 1Q3CA 2XFSA 4FD2A 4KLNA 3A46A 4KHPM 2C98A 3DOAA 3U6MA 5FTJA 3SASA 4DV5M 2E5LM 2XGNA 3FTCA 4JXJA 2KA6B 2YNMD 3KS8A 1IN4A 4FWDA 4B7FA 4PD2A 2UUCM 4DR5M 2CHGA 4PT5A 4JI2M 3MHVC 4M9SA 4GKKM 2L6OA 4LF6M 3GLIB 3GLFA 3UMMA 3QAUA 4X66M 3MK6A 3GQ4A 3J7BA 1DGBA 5F3WA 4A3VB 4JI0M 5EXTA 5BPVA 8CATA 4GRIA 4M0DA 1TH3A 2XZUA 1L2DA 1JR3D 1Q3BA 4L16A 3VKGA 2Y21A 1HNZM 4R7GA 1UM8A 2F5QA 5IZ7D 2CUZA 4S12A 1GVNA 3FUTA 3FYDA 3M0EA 3GO8A 1IM2A 3DZDA 3R8FA 5EP1A 3KXEC 1Q39A 1YSYA 4M0WA 1OFHA 4B3TM 3KP1E 4X64M 1X37A 4LG2A 4DV4M 2LXEA 2L7HA 4B3RM 2DZNB 4LJAA 3TQSA 3L27A 4YHHM 3HU1A 2ZM6M 3GLFB 3GQ5A 3SATA 3DA1A 4IBBA 4DR4M 3TPZA 3AJIB 2K47A 1HR0M 4DR6M 2V1UA 2YQZA 4NOOB 1OJLA 3U61A 3K1JA 1L1ZA 1SXJD 4NRVA 3LMMA 1N33M 2X8AA 2QPAA 2P5TA 3AFHA 4IBFA 2F5SA 4MGZE 3UGJA 5EP3A 3U6DA 4AKGA 4FCVA 5EP4A 4NL4H 4HL4A 3U60A 4LRTA 1NY6A 1DO0A 4QHTA 1XNQM 4IJEA 2RGOA 5KQ8A 2Z4RA 4BBAA 3CF0A 4P16A 3L29A 1I4WA 4DR1M 3FTFA 1S3SA 5FTNA 3TWLA 4I81A 2DWNA 1L8QA 2CEAA 1G41A 2HCBA 4JN6A 3U6CA 4Z8XA 1NSFA 3VFDA 3U61B 3VK7A 2G5GX 3U6PA 2CFOA 3PFIA 4JI3M 1IBKM 3KSXA 3T1YM 4RF0A 3KS4A 1H6UA 4GIPA 1DGHB 2KW0A 3U60B 4K0KM 2CE7A 3GPUA 2RKOA 5E26A 2XZFA 4GH9A 5ITTA 4NRWA 1XWIA 3K8ZA 1Z5BA 1KFVA 2C99A 3KOXE 1XNRM 4DUYM 4DV3M 4G4OA 5DNYA 3K92A 4B7HA 3L25A 2XSZD 3NBIA 4NXNM 5LMNM 4L15A 7CATA 2Y0QA 1GL6A 4I5SA 1MX0A 4QHSA 3TL4X 5KPRA 1QZMA 3JR4A 2UXBM 2CV2A 1SXJE 4LJ6A 1N78A 5EXXA 3HHYA 3PNVA 2KEBA 4JV5M 5FLXS 3KOWE 1J09A 3AOGA 1QAQA 1TH4A 4AG6A 2F5OA 3UJNA 3FKEA 3GLHA 3VDUA 2L09A 4JI1M 4AQYM 3HKPA 1MU5A 1L1TA 2Q2EB 3SFZA 3U6QA 4DV1M 4ITQA 1NJGA 2V1CA 3LVWA 1W5SA 3AKZA 2H1RA 2QBYA 1DGGA 2AHMA 3KSJA 2LWXA 4LF4M 5IREB 3TE6A 3FTEA 4GHLA 1IBMM 2L7IA 3HHZA 4AI6A 4JI8M 2DWMA 4IJFA 1FNNA 2C96A 2KRUA 2Y20A 1Z6TA 3SMPA 2UUAM 3EIHA 1TDHA 3HWSA 2YR0A 1C1KA 2C9OA 2R46A 5EXPA 2OQ4A 1PM5A 3AL0C 4GC5A 4NSRA 2EO2A 3GLHB 4G6ZA 1PJIA 5ITXA 1R2ZA 2JA2A 1WXQA 4D81A 3CTWB 2M60A 4X62M 4B3MM 4MGHA 1IBLM 2X4AA 2QBYB 4JI7M 4DV7M 2BNKA 1NNUC 4AZFA 1G4AE 4FWHA 2I7PA 2CHQA 3L2AA 2Z4SA 2KRKA 1KSFX 4LY6A 5JI3E 2NQ8C 4IBIA 1NNJA 2Z7JA 4LF7M 4Z6YA 1R2YA 4LGYA 4OVZA 4KODA 2HKJA 1G3IA 3RGSA 3SBJA 2V6ZM 3HJQA 4CGYB 4GC9A 2DWLA 1Z5CA 1G8PA 4JI6M 1KYIA 4X65M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XC8 A;  2F5P A;  2EA0 A;  3U6S A;  1XMO M;  3J80 S;  3VK7 A;  3JAM S;  1FJG M;  3U6P A;  1N34 M;  3GPY A;  4JI3 M;  1IBK M;  5IWA M;  3TWM A;  2UXD M;  3T1Y M;  4DV2 M;  3J7A S;  4YY3 M;  5ITU A;  1L2C A;  4CIS A;  4JI5 M;  4K0K M;  1L2B A;  3GPU A;  4LF8 M;  2XZF A;  2OPF A;  4NXM M;  1PJJ A;  5ITT A;  4G4R A;  4NRW A;  3JR5 A;  1Z5B A;  4JYA M;  4DR3 M;  1K82 A;  1KFV A;  2UXC M;  2UUB M;  3T1H M;  1Q3C A;  1XNR M;  4DUY M;  4DV3 M;  4G4O A;  1N32 M;  5ITY A;  4DV0 M;  3A46 A;  4KHP M;  3DOA A;  3U6M A;  3SAS A;  4DV5 M;  2E5L M;  1XMQ M;  4NXN M;  3GP1 A;  5LMN M;  5IT9 S;  3A42 A;  4DV6 M;  1J5E M;  4PD2 A;  2UUC M;  4B3S M;  4LF5 M;  4DR5 M;  1MX0 A;  4OX9 M;  3JR4 A;  4JI2 M;  2UXB M;  4GKK M;  4LF6 M;  4PCZ A;  4JV5 M;  5FLX S;  4X66 M;  3GPP A;  4DR7 M;  3GQ4 A;  1N36 M;  2F5O A;  3U6L A;  4JI0 M;  3OTO M;  4JI4 M;  3J81 S;  3TWK A;  1K3X A;  2XZU A;  1L2D A;  5ITQ A;  5ITR A;  1Q3B A;  4MB7 A;  3U6E A;  4JI1 M;  4AQY M;  1HNZ M;  4PDG A;  1MU5 A;  2F5Q A;  1L1T A;  2Q2E B;  3U6Q A;  4DV1 M;  4ITQ A;  3GQ3 A;  3GO8 A;  3U6C A;  3SAU A;  4LF4 M;  1K3W A;  1Q39 A;  1TDZ A;  2VQE M;  4B3T M;  1IBM M;  4X64 M;  4DV4 M;  4JI8 M;  5BR8 M;  3GPX A;  1Z59 A;  4B3R M;  4YHH M;  4LF9 M;  2UUA M;  2ZM6 M;  1TDH A;  2UU9 M;  3GQ5 A;  4LFC M;  4LFB M;  2OQ4 A;  3SAT A;  1PM5 A;  3SAV A;  4DR4 M;  4G4Q A;  2ZBK B;  1HR0 M;  1PJI A;  4DR6 M;  5ITX A;  1R2Z A;  1I94 M;  1L1Z A;  4DUZ M;  4NRV A;  1HNX M;  4G4N A;  1N33 M;  4DR2 M;  4X62 M;  2F5S A;  4B3M M;  1IBL M;  3U6D A;  4JI7 M;  4DV7 M;  3W0F A;  4PDI A;  3SAW A;  1Z5A A;  1XNQ M;  2VQF M;  2F4V M;  5A2Q S;  4LFA M;  3A45 A;  1NNJ A;  1EE8 A;  4DR1 M;  2HHH M;  4LF7 M;  3C58 A;  1R2Y A;  3TWL A;  3U6O A;  5LMU M;  1HNW M;  2HKJ A;  3SBJ A;  3SAR A;  2F5N A;  1Z5C A;  3VK8 A;  4JI6 M;  5ITX E;  4X65 M;  4GKJ M; 
#chains in the Genus database with same CATH topology
 3QYE A;  4GMQ A;  3U6S A;  3J80 S;  1XMO M;  3L26 A;  1ZV1 A;  2FOI C;  3I4V A;  1ZAE A;  2FH0 A;  3T6P A;  5ITU A;  1GJT A;  4CIS A;  2KDL A;  3HJS A;  2DI0 A;  4JI5 M;  3B89 A;  3IG8 A;  4Q7J A;  3I04 M;  3RE8 A;  1L2B A;  1SG9 A;  2WSF F;  4LF8 M;  1R5L A;  2R45 A;  4R71 A;  2R44 A;  2OPF A;  2LVA A;  1PJJ A;  2MJ5 B;  3ZCB B;  3J2P B;  3Q8X A;  2UUB M;  1D0K A;  2KZS A;  3GRV A;  5C18 A;  1XXH A;  2ZTD A;  4OVZ B;  5ITY A;  1LV7 A;  2ERC A;  2JXN A;  4DV0 M;  2B3T A;  3KVW A;  5KPZ A;  4IBG A;  1HT1 E;  2JP7 A;  1SXJ C;  2D7E A;  2DHR A;  2VII A;  3PVS A;  1IXS A;  1VQ1 A;  3A42 A;  4DV6 M;  4B3S M;  3L28 A;  2CV1 A;  2W82 A;  4LJ4 A;  4OX9 M;  1VDD A;  2HAK A;  1CUK A;  1NY5 A;  3BBZ A;  3LCV B;  1IXR C;  3KFU G;  1IQP A;  3H4M A;  4OW0 A;  3SMS A;  3E4R A;  4DR7 M;  3HU3 A;  1R4G A;  2JNH A;  3U5Z A;  3U6L A;  1G59 A;  3E9S A;  3QWL A;  2ZAN A;  2JY6 B;  4D80 A;  2DZL A;  4CHT B;  5FTL A;  4CIZ A;  3KOY E;  3J81 S;  5EP2 A;  3TWK A;  4JI4 M;  2RRU A;  2R4J A;  5ITR A;  3PNY A;  2L4F A;  2R62 A;  1HT2 E;  1GKI A;  4PDG A;  3HGI A;  1XXH B;  3HHX A;  1QAO A;  3MJ5 A;  4OU7 A;  5L8R F;  2LTU A;  1J7K A;  4QNM A;  3RFW A;  2G3Q A;  1E9R A;  2YFQ A;  2DXI A;  1OIZ A;  2K9D A;  3FD9 A;  1AIP C;  2VQE M;  1IXS B;  2RGH A;  2QZ4 A;  1IN6 A;  3FUW A;  2A5Y B;  2QHO B;  1RU3 A;  2LVO C;  3I4Y A;  3KP0 E;  3GPX A;  2WZJ A;  2KZU A;  3M6A A;  1QZE A;  2KNA A;  5KQD A;  3GLF E;  1V33 A;  2K0B X;  2UU9 M;  4I4L A;  3T15 A;  4LCB A;  2FNA A;  1YE9 A;  1GL7 A;  4FCW A;  3UZU A;  4G4Q A;  1R7R A;  3U5Z B;  2ZBK B;  3VDP A;  4BLC A;  4ZPX A;  1OFI A;  4HLQ A;  1IN5 A;  4M9Z A;  4NC6 A;  5FTM A;  3V76 A;  3B7N A;  3CF2 A;  3KDS E;  2QP9 X;  4DUZ M;  2MR9 A;  3RGP A;  1IN7 A;  1PRB A;  1HQY E;  4DBG B;  4LJ9 A;  1JR3 A;  4LJ5 A;  1OTR A;  3LQQ A;  5GKN A;  4FWG A;  3GLG A;  3W0F A;  1E94 E;  4PDI A;  3GLI A;  1GAB A;  1Z5A A;  2F4V M;  3AOE C;  4IBC A;  5A2Q S;  2CHV A;  3FUV A;  1N77 A;  1HJP A;  4L78 A;  4L4U A;  2HHH M;  3HHW A;  3C58 A;  1QUS A;  4LZJ A;  1P3Q Q;  5FSW A;  3SAR A;  4XBO A;  2GQF A;  1QYR A;  2VF8 A;  1NHG C;  2DAG A;  4GKJ M;  2I7N A;  2F5P A;  2EA0 A;  1GLN A;  2R4E A;  3SHG B;  2R18 A;  3KW6 A;  1FJG M;  1N34 M;  5EXS A;  3J27 B;  4ANR A;  1DGF A;  2XEP A;  4LZZ A;  4M9X A;  2KNZ A;  2UXD M;  3VKH A;  4DV2 M;  3J7A S;  1L2C A;  4FVM A;  1SXJ A;  1ZMW A;  3SHF A;  1WIV A;  3SYK A;  2H5X A;  2J7N A;  3GLG B;  2Y0T A;  3LVV A;  3HX3 A;  2D7H A;  1TGU A;  4GEW A;  4LRS A;  1XB2 B;  5DYI A;  1E9S A;  1QAN A;  2C5R A;  4LJ7 A;  5C1B A;  2JY5 A;  4B08 A;  4G4R A;  2UXC M;  4DR3 M;  3KOZ E;  1K82 A;  5KPT A;  2OO9 A;  3LQR A;  4IBJ A;  2QCU A;  3FUX A;  1D0L A;  2ZAO A;  4W5W A;  1JQJ C;  1N32 M;  1XXH E;  3M7G A;  2CWB A;  3A98 B;  3B9P A;  2Z3X A;  4FCT A;  4IIW A;  1XMQ M;  2CV0 A;  3FTD A;  1QVR A;  3GP1 A;  2ZAM A;  3WHK A;  4L8R C;  2R65 A;  1R6B X;  4B7G A;  1J5E M;  4D82 A;  1NJF A;  2LH0 A;  4KO8 A;  4MH0 E;  3WHL A;  3LW5 F;  4LF5 M;  2DAI A;  4Y28 F;  3I51 A;  4QOZ C;  4MM3 B;  3SC3 A;  4F2L A;  4NSO B;  1SXJ B;  3CF6 E;  4PCZ A;  2GNO A;  4WP2 A;  2QNJ A;  3GPP A;  4UN2 B;  3D8B A;  1N36 M;  3DFZ A;  3PXG A;  1DO2 A;  1IY1 A;  1K3X A;  2LHG A;  2G8L A;  3IEC A;  3ILK A;  5ITQ A;  2EKK A;  4MB7 A;  1IY0 A;  1QQW A;  2BWE A;  2C9C A;  4RNA A;  3VLF B;  2BJV A;  3U6E A;  4GIT A;  3GQ3 A;  1D2N A;  1F4I A;  1YUB A;  3SAU A;  2DZO B;  1DGH A;  1VEJ A;  2XFT A;  3AV0 A;  3ZC7 B;  1TDZ A;  1K3W A;  3BOS A;  3GRR A;  2FFJ A;  4MGY E;  1WGL A;  2LBC A;  3I01 M;  2KHH A;  2JY7 A;  5BR8 M;  2XSZ A;  1Z59 A;  1D0M A;  2XH9 A;  4FW9 A;  2J7O A;  3UK6 A;  2R6F A;  3ZH9 B;  4LF9 M;  3B7Z A;  4RF1 A;  2D7G A;  1IN8 A;  4LFC M;  4LFB M;  4MGI E;  5H37 D;  3NWL A;  3AOE A;  1IY2 A;  4KT0 F;  3SAV A;  3GLH E;  3MMP A;  4QNR A;  3GRU A;  1N75 A;  1I94 M;  3EIE A;  1XHB A;  4MGK E;  1NHW C;  2L2D A;  1HNX M;  4G4N A;  3HJ8 A;  4QOS A;  5E6J A;  4DR2 M;  2EKF A;  3IHP A;  4HEO A;  1JR3 E;  1ORY B;  4LGM A;  4XK8 F;  4REZ A;  4WUR A;  4LJ8 A;  4WW0 A;  2O25 A;  5EJC A;  3SAW A;  2XLJ A;  1QAM A;  1MJG M;  2BWB A;  1HQC A;  2VQF M;  2APL A;  2HL7 A;  1T3T A;  4LFA M;  3W0L B;  5KO3 A;  3A45 A;  4AG5 A;  3OTO M;  1EE8 A;  3FYC A;  4IBD A;  2HWJ A;  4XGI A;  1IFY A;  4BB9 A;  3GRY A;  5EQT A;  4EIW A;  4GHA A;  2QEN A;  3U6O A;  5LMU M;  1QUT A;  1HNW M;  3IG5 A;  1LTM A;  1NVM A;  2F5N A;  2EUC A;  3THG A;  3SYL A;  3R9X B;  3VK8 A;  2M5Z A;  5DYG A;  5ITX E;  1TTE A;  1E32 A;  3FRH A;  5IT9 S;  2KXE A;  1XC8 A;  3T38 A;  4AKI A;  1T43 A;  2BJW A;  3HU2 A;  1ZQ9 A;  1IXZ A;  3HY5 A;  2FE8 A;  3JAM S;  3D8L A;  3GPY A;  2X49 A;  5JI2 E;  3FUU A;  5IWA M;  3TWM A;  4I8O A;  4YY3 M;  2XF3 A;  4AKH A;  4R3D A;  4AW4 A;  4IBK A;  4IBE A;  4TUW A;  5FTK A;  3W67 A;  2CP8 A;  2LNH C;  2FS1 A;  4NXM M;  2DWZ B;  2R0I A;  1WJ7 A;  1W5T A;  3K2L A;  2O5R A;  2O01 F;  3JR5 A;  1TH2 A;  4JYA M;  1WHC A;  2DVW B;  2LVP C;  4II7 A;  3T1H M;  1Q3C A;  2XFS A;  4FD2 A;  2Z8Y M;  4KLN A;  3A46 A;  4KHP M;  2C98 A;  3DOA A;  3U6M A;  5FTJ A;  3SAS A;  1EFU B;  4DV5 M;  2E5L M;  2XGN A;  3FTC A;  4JXJ A;  2CRU A;  4G3O A;  2KA6 B;  2YNM D;  3KS8 A;  1IN4 A;  4FWD A;  4B7F A;  4PD2 A;  2UUC M;  4DR5 M;  2CHG A;  4PT5 A;  4JI2 M;  3MHV C;  4M9S A;  4GKK M;  2QQ8 A;  1NO1 A;  1AUA A;  2L6O A;  1V34 A;  4LF6 M;  3GLI B;  3GLF A;  3UMM A;  3QAU A;  4X66 M;  3MK6 A;  3GQ4 A;  3J7B A;  1DGB A;  5F3W A;  4A3V B;  4JI0 M;  1DV0 A;  2WSC F;  5EXT A;  1BVS A;  4GRI A;  5BPV A;  4M0D A;  1TH3 A;  8CAT A;  2XZU A;  1L2D A;  1JR3 D;  1Q3B A;  2LHC A;  4L16 A;  3VKG A;  2Y21 A;  1HNZ M;  4R7G A;  1UM8 A;  2F5Q A;  2EJS A;  2CUZ A;  5IZ7 D;  4S12 A;  1GVN A;  3FUT A;  3FYD A;  3M0E A;  3GO8 A;  1IM2 A;  3DZD A;  3R8F A;  1OAO C;  5EP1 A;  1YLA A;  1VEG A;  3KXE C;  1Q39 A;  1YSY A;  3FE3 A;  1OFH A;  3QYB A;  3KP1 E;  4M0W A;  3K9P A;  4B3T M;  4X64 M;  1X37 A;  3BXW A;  4DV4 M;  4LG2 A;  2LXE A;  2L7H A;  2WSE F;  3C3D A;  4B3R M;  2DZN B;  4LJA A;  3TQS A;  3L27 A;  4YHH M;  3HU1 A;  4F1I A;  2ZM6 M;  3GLF B;  3GQ5 A;  3SAT A;  3DA1 A;  5DFL A;  4IBB A;  4DR4 M;  2JUJ A;  3TPZ A;  3AJI B;  2K47 A;  1HR0 M;  4DR6 M;  3E46 A;  2V1U A;  2YQZ A;  4NOO B;  1OJL A;  3U61 A;  3K1J A;  1L1Z A;  2QSF X;  1SXJ D;  1V92 A;  4NRV A;  3LMM A;  1N33 M;  2X8A A;  3Q8G A;  1TR8 A;  2P5T A;  2QPA A;  3AFH A;  4IBF A;  3C3E A;  4MGZ E;  3UGJ A;  2F5S A;  2DAE A;  5EP3 A;  3CGW A;  4P17 A;  4FCV A;  3U6D A;  5EP4 A;  4AKG A;  1G71 A;  1OKS A;  3HZJ A;  4NL4 H;  4HL4 A;  3U60 A;  4LRT A;  1NY6 A;  1WGN A;  1DO0 A;  4QHT A;  1XNQ M;  4IJE A;  2RGO A;  5KQ8 A;  1Y8G A;  1OAI A;  2MGW A;  2Z4R A;  4BBA A;  3CF0 A;  4P16 A;  3L29 A;  1I4W A;  4DR1 M;  3FTF A;  1PJS A;  1S3S A;  5FTN A;  3TWL A;  4I81 A;  2DWN A;  3F92 A;  1L8Q A;  2CEA A;  1G41 A;  2KNV A;  2HCB A;  1QDT A;  1OQY A;  4JN6 A;  3U6C A;  4Z8X A;  1NSF A;  1NV9 A;  1ZMV A;  3VFD A;  3U61 B;  1GJS A;  3VK7 A;  2G5G X;  1C7Y A;  3U6P A;  2CFO A;  3PFI A;  4JI3 M;  1IBK M;  1Q02 A;  3KSX A;  3T1Y M;  4RF0 A;  1PGY A;  3GLG E;  3W68 A;  3KS4 A;  3GLI E;  1H6U A;  4GIP A;  1DGH B;  1OIP A;  2MH8 A;  2OOA A;  1VDL A;  2KW0 A;  3U60 B;  4K0K M;  2CE7 A;  3GPU A;  2RKO A;  5E26 A;  2XZF A;  4GH9 A;  3B7Q A;  5ITT A;  4NRW A;  1XWI A;  3K8Z A;  1Z5B A;  1KFV A;  2DNA A;  2C99 A;  4RKU F;  3KOX E;  1XNR M;  4DUY M;  4DV3 M;  4G4O A;  5DNY A;  3K92 A;  1QDR A;  4B7H A;  3L25 A;  2XSZ D;  3NBI A;  4NXN M;  4CJ6 A;  1MN3 A;  5LMN M;  4L15 A;  3E21 A;  2DAK A;  7CAT A;  1GO5 A;  2Y0Q A;  1GL6 A;  1PJQ A;  2OOB A;  2J5Y A;  2DAM A;  1MX0 A;  4I5S A;  4QHS A;  3FRI A;  1QZM A;  3TL4 X;  5KPR A;  3JR4 A;  2CV2 A;  2UXB M;  1SXJ E;  4L6V 6;  4LJ6 A;  1N78 A;  5EXX A;  1VG5 A;  3HHY A;  2DKL A;  3PNV A;  1VEK A;  2KEB A;  5FLX S;  2N35 A;  4JV5 M;  3KOW E;  1J09 A;  3AOG A;  1QAQ A;  1TH4 A;  4AG6 A;  3B74 A;  3UJN A;  3FKE A;  2F5O A;  2VF7 A;  3GLH A;  3VDU A;  2DHY A;  2K6B A;  2L09 A;  2LVQ D;  4JI1 M;  4AQY M;  3HKP A;  1MU5 A;  2JWS A;  1L1T A;  2Q2E B;  3SFZ A;  3U6Q A;  4DV1 M;  4ITQ A;  1NJG A;  2V1C A;  3K9O A;  1W5S A;  3LVW A;  3NBX X;  2H1R A;  3AKZ A;  2DEN A;  2QBY A;  1DGG A;  2AHM A;  2VDB B;  2LWX A;  3KSJ A;  5IRE B;  4LF4 M;  3TE6 A;  3FTE A;  4GHL A;  1IBM M;  2L7I A;  3HHZ A;  3ZQJ A;  4AI6 A;  4JI8 M;  2DWM A;  2JZ1 A;  4IJF A;  1FNN A;  2C96 A;  2KRU A;  2Y20 A;  1Z6T A;  3SMP A;  2UUA M;  1UFZ A;  3EIH A;  1NV8 A;  1A5T A;  1TDH A;  2YR0 A;  3HWS A;  1C1K A;  2C9O A;  2R46 A;  5EXP A;  2OQ4 A;  1PM5 A;  3AL0 C;  2LVN C;  4GC5 A;  4NSR A;  2EO2 A;  3GLH B;  4G6Z A;  1PJI A;  5ITX A;  1R2Z A;  2JA2 A;  1WXQ A;  4D81 A;  3CTW B;  2M60 A;  4X62 M;  1T6O A;  1PJT A;  4MGH A;  4B3M M;  3H4J A;  1IBL M;  2X4A A;  2QBY B;  4JI7 M;  4DV7 M;  2BNK A;  1NNU C;  2L4E A;  1G4A E;  1ZMU A;  4FWH A;  2I7P A;  2ZTC A;  4AZF A;  2CHQ A;  3L2A A;  1EIJ A;  2Z4S A;  1WR1 B;  1KSF X;  2JY8 A;  2JZ0 A;  2KRK A;  2MRO B;  4LY6 A;  5JI3 E;  2NQ8 C;  4IBI A;  1NNJ A;  3C9P A;  2Z7J A;  4LF7 M;  3LCU A;  4Z6Y A;  1JB0 F;  1R2Y A;  4LGY A;  4OVZ A;  4KOD A;  2HKJ A;  1G3I A;  3RGS A;  3SBJ A;  2V6Z M;  3HJQ A;  4CGY B;  4GC9 A;  2DWL A;  1Z5C A;  1G8P A;  4JI6 M;  1KYI A;  4X65 M;  1TF0 B; 
#chains in the Genus database with same CATH homology
 4GMQ A;  3U6S A;  3J80 S;  1XMO M;  3L26 A;  2FOI C;  3I4V A;  1ZAE A;  5ITU A;  4CIS A;  3HJS A;  4JI5 M;  3IG8 A;  3RE8 A;  1L2B A;  4LF8 M;  2R45 A;  2OPF A;  1PJJ A;  3ZCB B;  3J2P B;  3Q8X A;  2UUB M;  2KZS A;  3GRV A;  5C18 A;  1XXH A;  4OVZ B;  5ITY A;  1LV7 A;  2ERC A;  4DV0 M;  3KVW A;  5KPZ A;  4IBG A;  1HT1 E;  1SXJ C;  2D7E A;  2DHR A;  2VII A;  3PVS A;  3A42 A;  4DV6 M;  4B3S M;  3L28 A;  2CV1 A;  2W82 A;  4LJ4 A;  4OX9 M;  1VDD A;  1NY5 A;  1IXR C;  3KFU G;  1IQP A;  3H4M A;  4OW0 A;  3SMS A;  3E4R A;  4DR7 M;  3HU3 A;  1G59 A;  3U5Z A;  3U6L A;  3E9S A;  3QWL A;  2ZAN A;  4D80 A;  3OTO M;  4CHT B;  3J81 S;  5FTL A;  4JI4 M;  3KOY E;  5EP2 A;  3TWK A;  2R4J A;  5ITR A;  3PNY A;  2R62 A;  1HT2 E;  1GKI A;  4PDG A;  3HGI A;  1XXH B;  3HHX A;  1QAO A;  3MJ5 A;  4OU7 A;  3RFW A;  1J7K A;  4QNM A;  1E9R A;  2YFQ A;  2DXI A;  3FD9 A;  2VQE M;  1IXS B;  2RGH A;  2QZ4 A;  1IN6 A;  3FUW A;  2A5Y B;  3I4Y A;  3KP0 E;  3GPX A;  2KZU A;  3M6A A;  5KQD A;  2UU9 M;  4I4L A;  3T15 A;  4LCB A;  2FNA A;  1YE9 A;  1GL7 A;  4FCW A;  3UZU A;  4G4Q A;  1R7R A;  3U5Z B;  2ZBK B;  3VDP A;  4BLC A;  4ZPX A;  1OFI A;  4HLQ A;  1IN5 A;  4M9Z A;  4DUZ M;  5FTM A;  3CF2 A;  3KDS E;  2QP9 X;  3RGP A;  1IN7 A;  1HQY E;  4LJ9 A;  1JR3 A;  4LJ5 A;  3LQQ A;  5GKN A;  3GLG A;  4FWG A;  3W0F A;  1E94 E;  4PDI A;  3GLI A;  1Z5A A;  2F4V M;  3AOE C;  4IBC A;  5A2Q S;  2CHV A;  3FUV A;  1N77 A;  4L78 A;  4L4U A;  2HHH M;  3HHW A;  3C58 A;  4LZJ A;  5FSW A;  3SAR A;  4XBO A;  1QYR A;  1NHG C;  4GKJ M;  2I7N A;  2F5P A;  2EA0 A;  1GLN A;  2R4E A;  3SHG B;  2R18 A;  3KW6 A;  1FJG M;  1N34 M;  5EXS A;  3J27 B;  1DGF A;  2XEP A;  4LZZ A;  4M9X A;  2UXD M;  3VKH A;  4DV2 M;  3J7A S;  1L2C A;  4FVM A;  1SXJ A;  3SHF A;  3GLG B;  3SYK A;  2J7N A;  2Y0T A;  3LVV A;  2D7H A;  1TGU A;  4LRS A;  5DYI A;  1E9S A;  1QAN A;  2C5R A;  4LJ7 A;  5C1B A;  4G4R A;  4B08 A;  2UXC M;  4DR3 M;  3KOZ E;  1K82 A;  5KPT A;  4IBJ A;  3LQR A;  2QCU A;  3FUX A;  2ZAO A;  4W5W A;  1JQJ C;  1N32 M;  3M7G A;  3A98 B;  3B9P A;  2Z3X A;  4FCT A;  4IIW A;  1XMQ M;  2CV0 A;  3FTD A;  1QVR A;  3GP1 A;  2ZAM A;  3WHK A;  4L8R C;  2R65 A;  1R6B X;  4B7G A;  1J5E M;  4D82 A;  1NJF A;  2LH0 A;  4KO8 A;  4MH0 E;  3WHL A;  4LF5 M;  3I51 A;  4QOZ C;  4MM3 B;  3SC3 A;  4NSO B;  1SXJ B;  3CF6 E;  4PCZ A;  3GPP A;  1N36 M;  3D8B A;  3DFZ A;  3PXG A;  1DO2 A;  1IY1 A;  1K3X A;  3ILK A;  2G8L A;  5ITQ A;  4MB7 A;  4RNA A;  1IY0 A;  1QQW A;  2C9C A;  3VLF B;  3U6E A;  2BJV A;  4GIT A;  3GQ3 A;  1D2N A;  1YUB A;  3SAU A;  2DZO B;  1DGH A;  2XFT A;  3AV0 A;  3ZC7 B;  1TDZ A;  1K3W A;  3BOS A;  3GRR A;  2FFJ A;  4MGY E;  5BR8 M;  2XSZ A;  1Z59 A;  2XH9 A;  4FW9 A;  2J7O A;  3UK6 A;  4LF9 M;  3ZH9 B;  4RF1 A;  2D7G A;  1IN8 A;  4LFC M;  4LFB M;  4MGI E;  5H37 D;  3NWL A;  3AOE A;  1IY2 A;  3SAV A;  4QNR A;  3GRU A;  1N75 A;  1I94 M;  3EIE A;  1XHB A;  4MGK E;  1NHW C;  1HNX M;  4G4N A;  3HJ8 A;  4QOS A;  5E6J A;  4DR2 M;  1ORY B;  4LGM A;  4REZ A;  4WUR A;  4LJ8 A;  4WW0 A;  5EJC A;  3SAW A;  2XLJ A;  1QAM A;  2VQF M;  1HQC A;  2HL7 A;  1T3T A;  4LFA M;  3W0L B;  5KO3 A;  3A45 A;  4AG5 A;  1EE8 A;  3FYC A;  4IBD A;  4XGI A;  4BB9 A;  3GRY A;  5EQT A;  4EIW A;  4GHA A;  2QEN A;  3U6O A;  5LMU M;  1HNW M;  3IG5 A;  1NVM A;  2F5N A;  3R9X B;  2EUC A;  3THG A;  3SYL A;  3VK8 A;  2M5Z A;  5DYG A;  5ITX E;  1E32 A;  5IT9 S;  2KXE A;  1XC8 A;  3T38 A;  4AKI A;  2BJW A;  3HU2 A;  1ZQ9 A;  1IXZ A;  2FE8 A;  3JAM S;  3D8L A;  3GPY A;  2X49 A;  5JI2 E;  3FUU A;  5IWA M;  3TWM A;  4I8O A;  4YY3 M;  2XF3 A;  4AKH A;  4R3D A;  4AW4 A;  4IBK A;  4IBE A;  4TUW A;  5FTK A;  2LNH C;  4NXM M;  2DWZ B;  1W5T A;  3K2L A;  2O5R A;  3JR5 A;  4JYA M;  1TH2 A;  2DVW B;  4II7 A;  3T1H M;  1Q3C A;  2XFS A;  4FD2 A;  4KLN A;  3A46 A;  4KHP M;  2C98 A;  3DOA A;  3U6M A;  5FTJ A;  3SAS A;  4DV5 M;  2E5L M;  2XGN A;  3FTC A;  4JXJ A;  2KA6 B;  2YNM D;  3KS8 A;  1IN4 A;  4FWD A;  4B7F A;  4PD2 A;  2UUC M;  4DR5 M;  2CHG A;  4PT5 A;  4JI2 M;  3MHV C;  4M9S A;  4GKK M;  2L6O A;  4LF6 M;  3GLI B;  3GLF A;  3UMM A;  3QAU A;  4X66 M;  3MK6 A;  3GQ4 A;  3J7B A;  1DGB A;  5F3W A;  4A3V B;  4JI0 M;  5EXT A;  5BPV A;  8CAT A;  4GRI A;  4M0D A;  1TH3 A;  2XZU A;  1L2D A;  1JR3 D;  1Q3B A;  4L16 A;  3VKG A;  2Y21 A;  1HNZ M;  4R7G A;  1UM8 A;  2F5Q A;  5IZ7 D;  2CUZ A;  4S12 A;  1GVN A;  3FUT A;  3FYD A;  3M0E A;  3GO8 A;  1IM2 A;  3DZD A;  3R8F A;  5EP1 A;  3KXE C;  1Q39 A;  1YSY A;  4M0W A;  1OFH A;  4B3T M;  3KP1 E;  4X64 M;  1X37 A;  4LG2 A;  4DV4 M;  2LXE A;  2L7H A;  4B3R M;  2DZN B;  4LJA A;  3TQS A;  3L27 A;  4YHH M;  3HU1 A;  2ZM6 M;  3GLF B;  3GQ5 A;  3SAT A;  3DA1 A;  4IBB A;  4DR4 M;  3TPZ A;  3AJI B;  2K47 A;  1HR0 M;  4DR6 M;  2V1U A;  2YQZ A;  4NOO B;  1OJL A;  3U61 A;  3K1J A;  1L1Z A;  1SXJ D;  4NRV A;  3LMM A;  1N33 M;  2X8A A;  2QPA A;  2P5T A;  3AFH A;  4IBF A;  2F5S A;  4MGZ E;  3UGJ A;  5EP3 A;  3U6D A;  4AKG A;  4FCV A;  5EP4 A;  4NL4 H;  4HL4 A;  3U60 A;  4LRT A;  1NY6 A;  1DO0 A;  4QHT A;  1XNQ M;  4IJE A;  2RGO A;  5KQ8 A;  2Z4R A;  4BBA A;  3CF0 A;  4P16 A;  3L29 A;  1I4W A;  4DR1 M;  3FTF A;  1S3S A;  5FTN A;  3TWL A;  4I81 A;  2DWN A;  1L8Q A;  2CEA A;  1G41 A;  2HCB A;  4JN6 A;  3U6C A;  4Z8X A;  1NSF A;  3VFD A;  3U61 B;  3VK7 A;  2G5G X;  3U6P A;  2CFO A;  3PFI A;  4JI3 M;  1IBK M;  3KSX A;  3T1Y M;  4RF0 A;  3KS4 A;  1H6U A;  4GIP A;  1DGH B;  2KW0 A;  3U60 B;  4K0K M;  2CE7 A;  3GPU A;  2RKO A;  5E26 A;  2XZF A;  4GH9 A;  5ITT A;  4NRW A;  1XWI A;  3K8Z A;  1Z5B A;  1KFV A;  2C99 A;  3KOX E;  1XNR M;  4DUY M;  4DV3 M;  4G4O A;  5DNY A;  3K92 A;  4B7H A;  3L25 A;  2XSZ D;  3NBI A;  4NXN M;  5LMN M;  4L15 A;  7CAT A;  2Y0Q A;  1GL6 A;  4I5S A;  1MX0 A;  4QHS A;  3TL4 X;  5KPR A;  1QZM A;  3JR4 A;  2UXB M;  2CV2 A;  1SXJ E;  4LJ6 A;  1N78 A;  5EXX A;  3HHY A;  3PNV A;  2KEB A;  4JV5 M;  5FLX S;  3KOW E;  1J09 A;  3AOG A;  1QAQ A;  1TH4 A;  4AG6 A;  2F5O A;  3UJN A;  3FKE A;  3GLH A;  3VDU A;  2L09 A;  4JI1 M;  4AQY M;  3HKP A;  1MU5 A;  1L1T A;  2Q2E B;  3SFZ A;  3U6Q A;  4DV1 M;  4ITQ A;  1NJG A;  2V1C A;  3LVW A;  1W5S A;  3AKZ A;  2H1R A;  2QBY A;  1DGG A;  2AHM A;  3KSJ A;  2LWX A;  4LF4 M;  5IRE B;  3TE6 A;  3FTE A;  4GHL A;  1IBM M;  2L7I A;  3HHZ A;  4AI6 A;  4JI8 M;  2DWM A;  4IJF A;  1FNN A;  2C96 A;  2KRU A;  2Y20 A;  1Z6T A;  3SMP A;  2UUA M;  3EIH A;  1TDH A;  3HWS A;  2YR0 A;  1C1K A;  2C9O A;  2R46 A;  5EXP A;  2OQ4 A;  1PM5 A;  3AL0 C;  4GC5 A;  4NSR A;  2EO2 A;  3GLH B;  4G6Z A;  1PJI A;  5ITX A;  1R2Z A;  2JA2 A;  1WXQ A;  4D81 A;  3CTW B;  2M60 A;  4X62 M;  4B3M M;  4MGH A;  1IBL M;  2X4A A;  2QBY B;  4JI7 M;  4DV7 M;  2BNK A;  1NNU C;  4AZF A;  1G4A E;  4FWH A;  2I7P A;  2CHQ A;  3L2A A;  2Z4S A;  2KRK A;  1KSF X;  4LY6 A;  5JI3 E;  2NQ8 C;  4IBI A;  1NNJ A;  2Z7J A;  4LF7 M;  4Z6Y A;  1R2Y A;  4LGY A;  4OVZ A;  4KOD A;  2HKJ A;  1G3I A;  3RGS A;  3SBJ A;  2V6Z M;  3HJQ A;  4CGY B;  4GC9 A;  2DWL A;  1Z5C A;  1G8P A;  4JI6 M;  1KYI A;  4X65 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...