4JI7M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji7M02
1L2BA 3C58A 3TWLA 4LF6M 2ZM6M 2F5SA 4LF8M 3U6PA 4PCZA 3U6OA 3J7AS 1K3WA 4DR7M 2F5PA 4DR1M 5LMUM 1HNWM 4B3RM 2UXBM 4DV0M 4DV7M 2OQ4A 1Z5BA 3SAUA 3GO8A 4G4RA 4NXMM 5ITXE 2F5QA 2UUBM 4PDGA 3J81S 1I94M 4JYAM 4LF9M 5BR8M 1XMQM 3U6LA 3U6SA 2HHHM 1Z59A 1Q3CA 2UU9M 1L1ZA 4LF5M 4NRVA 1HNXM 5A2QS 2OPFA 4JI7M 2EA0A 1Q3BA 1PJIA 1K3XA 1R2ZA 1TDZA 4DV6M 2Q2EB 3JR5A 1L2CA 3U6MA 3SAVA 5ITUA 4DUYM 1IBMM 3GPUA 2F4VM 3SAWA 3VK7A 3T1YM 4CISA 2UUAM 4JI3M 1HNZM 4DR5M 2UUCM 4GKKM 4DR2M 4B3TM 4JI2M 3A45A 2F5OA 2ZBKB 3SBJA 3OTOM 3GPXA 3GPPA 3U6DA 1IBKM 2F5NA 4JI8M 3W0FA 3GQ5A 4JI6M 3SASA 3SARA 4DUZM 3GP1A 3TWMA 4DR6M 1XC8A 3VK8A 4JV5M 4LFBM 1XMOM 2UXDM 3SATA 4B3SM 1XNRM 4GKJM 4DV5M 3JR4A 1MU5A 4X64M 3GQ4A 4ITQA 4DR4M 4NRWA 5ITYA 4OX9M 1N36M 1IBLM 4B3MM 4LF7M 4NXNM 1N33M 1TDHA 2VQFM 1R2YA 1Z5CA 1Z5AA 3TWKA 4JI1M 4YY3M 2HKJA 1L1TA 2E5LM 4PDIA 4JI0M 4X65M 4DV4M 4YHHM 1HR0M 4K0KM 4LFAM 1NNJA 3U6QA 1L2DA 4JI4M 5ITTA 1EE8A 4LFCM 4PD2A 4AQYM 5FLXS 4DV2M 3U6EA 1KFVA 2XZFA 3DOAA 2UXCM 2XZUA 4MB7A 4DV3M 3T1HM 5LMNM 5ITQA 3A42A 3U6CA 1N34M 1J5EM 1Q39A 4LF4M 3A46A 1MX0A 4DV1M 5ITXA 3JAMS 4X62M 5IWAM 2VQEM 1XNQM 4G4QA 5IT9S 4DR3M 1PM5A 3J80S 3GPYA 1N32M 4G4NA 4KHPM 1FJGM 1K82A 4JI5M 4X66M 1PJJA 5ITRA 3GQ3A 4G4OA
chains in the Genus database with same CATH superfamily
3DFZA 4AW4A 3KOWE 4LF6M 2V1CA 1G3IA 1NNUC 2D7EA 3U6PA 2CP8A 2F5SA 4PCZA 1SXJA 3ILKA 4LJ7A 1G41A 2F5PA 4B3RM 2UXBM 2Y0QA 3HHXA 2CHVA 2O25A 1Z5BA 2FH0A 4G3OA 3GO8A 2UUBM 4PDGA 3J81S 1I94M 1W5TA 1IN7A 3M7GA 3U6LA 4M0DA 4LF5M 4NRVA 4GHAA 3KOXE 3U5ZB 3R8FA 4F1IA 2W82A 2NQ8C 1XXHB 1N75A 1W5SA 4X66M 1R2ZA 2FFJA 2CV0A 2LHGA 1QVRA 5ITUA 3GLGE 3B9PA 1NHWC 2F4VM 4MGYE 1IN5A 3FUUA 2M5ZA 4JI3M 1QAOA 1HNZM 4D81A 4GKKM 2CRUA 2F5OA 4FWGA 4UN2B 4CIZA 1NJGA 2OOBA 4AKGA 4M9XA 2BJVA 2XSZD 3SASA 2XFSA 3SFZA 1J09A 1HT1E 3AOEC 1R6BX 4IBJA 1IY0A 4FWDA 3TQSA 1OAIA 2YR0A 2FNAA 2R46A 3U61A 3B7ZA 3MHVC 3GLHB 2C9CA 3FYDA 5IZ7D 2UXDM 4IJFA 3FTEA 4IIWA 3SATA 1VDLA 1TTEA 3PXGA 3JR4A 3U60B 2QBYB 2KRKA 1JR3E 1ZQ9A 2ZAOA 1MN3A 1IXRC 5ITYA 3T6PA 3FUTA 1LV7A 3GRRA 3KDSE 2Y0TA 5FTLA 2VQFM 1R2YA 1J7KA 2KEBA 5EXTA 5EXSA 4R71A 2JXNA 2K6BA 4LG2A 1OIZA 2OO9A 3I04M 2H1RA 1DO0A 4IBIA 4LGMA 1NV8A 4KO8A 2ZTCA 3VFDA 4DV4M 1X37A 3RFWA 1FNNA 4JI4M 5ITTA 4HL4A 4AQYM 5C18A 2MJ5B 3PNYA 4ZPXA 1JQJC 4DV2M 4GH9A 4BLCA 4AZFA 4AI6A 2XGNA 3GLIB 2UXCM 4JXJA 2JNHA 2Y20A 1OJLA 2AHMA 4B7GA 2DAGA 1GJSA 4MGIE 4LY6A 4QHTA 4GC9A 1D0MA 2WSEF 3HJ8A 3UK6A 4LF4M 4EIWA 3GLFB 4IBEA 3JAMS 4DV1M 4X62M 2C98A 4WP2A 3HJSA 5GKNA 3SMSA 2G5GX 2JY7A 3FD9A 3KP0E 5FSWA 4MGHA 3NBXX 4G4NA 3VDUA 1YLAA 4B7HA 1QDTA 2HWJA 4TUWA 4RKUF 4JI6M 3J7BA 3HGIA 3AV0A 4FW9A 3WHKA 1PJQA 2QPAA 3EIHA 1C1KA 2J5YA 2KA6B 3U5ZA 1V33A 2LVNC 2L09A 2ZM6M 4LF8M 3HJQA 3ZC7B 1K3WA 4DR7M 1WJ7A 4LJ6A 1GABA 5E26A 5LMUM 3GLGA 4DV0M 1R7RA 2DAKA 2YFQA 3EIEA 4DV7M 2QQ8A 3B74A 4Y28F 3SAUA 4RNAA 4G4RA 2ZANA 2QNJA 1WGNA 1L8QA 1GLNA 4QNMA 1SXJD 2RRUA 3K9PA 1NO1A 4I4LA 3VLFB 5KPTA 1XB2B 3QYBA 1GL6A 1KYIA 3W0LB 2R62A 1PRBA 2C96A 5F3WA 2DWZB 3I51A 1L1ZA 2M60A 2BWBA 2O5RA 3L29A 1R5LA 3BOSA 5A2QS 2L7IA 2VIIA 3E21A 2VF7A 4NOOB 4IJEA 1PJIA 3T15A 1K3XA 3LW5F 3GLHA 5KPRA 3SAVA 1L2CA 2QENA 1P3QQ 4DUYM 4LGYA 4R3DA 2LHCA 5EP4A 3GPUA 1WIVA 2B3TA 1WHCA 2KZSA 4B7FA 3VK7A 2V1UA 3U60A 2QBYA 1JR3A 1I4WA 7CATA 2KNAA 3PFIA 5EP3A 2R65A 3SBJA 3GPXA 3B7QA 1IBKM 5EP1A 1IN8A 3E46A 4A3VB 1N77A 3HZJA 3GQ5A 4NL4H 2L2DA 5EQTA 3VKHA 1IXSB 2CWBA 1XC8A 1JB0F 3J27B 1A5TA 4L8RC 4MGZE 3FTFA 1AUAA 3IG8A 2R4EA 4LFBM 3GRYA 1VEKA 3E4RA 3HU1A 1XMOM 5FTMA 3CGWA 3R9XB 2CEAA 4GIPA 3LMMA 3GLGB 3GLIA 4B3SM 1XNRM 3V76A 4LRSA 3GQ4A 2L4EA 4ITQA 1IQPA 4NRWA 1Y8GA 3LVWA 4LRTA 1IBLM 1OFIA 4L15A 4LF7M 2WZJA 1OTRA 3L2AA 5KPZA 3CF6E 3K1JA 3GLFA 4PDIA 3F92A 4X65M 4YHHM 1ZMUA 1GVNA 1PJTA 2HL7A 4LFAM 4D82A 4FVMA 3FRHA 2WSFF 3FRIA 2VDBB 1QAMA 4PD2A 3BXWA 4M0WA 3FTCA 5FLXS 2JWSA 2ERCA 2JZ1A 2RKOA 4KODA 5DNYA 3A98B 4P16A 1NY6A 4MM3B 2XZFA 2K47A 3ZCBB 1V34A 4PT5A 2XZUA 4GHLA 1QQWA 4DV3M 4KLNA 4CJ6A 4S12A 3C9PA 2YNMD 3A42A 3LVVA 1C7YA 1VDDA 3CF0A 2DWMA 1N34M 3C3DA 1J5EM 3LCUA 2BNKA 4OW0A 2BJWA 2Z8YM 3K8ZA 3VDPA 2L7HA 3KFUG 1BVSA 4DR3M 3J80S 2QSFX 3KS8A 3GRUA 1FJGM 1ZV1A 1NY5A 1IM2A 1QDRA 5E6JA 1OKSA 5BPVA 4GITA 1HT2E 4BB9A 1L2BA 1H6UA 1ZMVA 2LNHC 4I81A 3FYCA 4XBOA 3AOEA 1SXJE 1KSFX 3FUWA 3RGSA 1OAOC 1RU3A 1IY2A 2K9DA 2KXEA 4D80A 4Q7JA 2R45A 4GMQA 2OQ4A 3D8LA 3QWLA 2XSZA 1VQ1A 4XK8F 1N78A 2QCUA 3AL0C 1T43A 1TH3A 3AOGA 5KQDA 4QOZC 2L4FA 4JYAM 1DO2A 1T3TA 1XMQM 3SYKA 3U6SA 2I7PA 2X49A 3HKPA 1NV9A 2K0BX 1Q3CA 3C3EA 2UU9M 4Z6YA 3PVSA 2P5TA 2OPFA 4JI7M 4AG5A 3FE3A 2MROB 3RGPA 1Q3BA 1LTMA 1IXSA 2CE7A 2DNAA 2FS1A 2EA0A 4IBKA 3PNVA 3L25A 2R6FA 3UGJA 3DA1A 3KXEC 5L8RF 2JY8A 1E94E 4B08A 4DV6M 2Q2EB 2MH8A 3Q8XA 3FUVA 3QYEA 3U6MA 1TDZA 2EO2A 1XHBA 3L26A 2V6ZM 3UJNA 3SAWA 2GNOA 4IBGA 3T1YM 2CHGA 2QZ4A 2FE8A 4CISA 2CV2A 3I4VA 3MJ5A 1TR8A 2HCBA 2KNZA 4KT0F 1E9SA 1ORYB 4FCTA 4IBBA 5JI2E 1VEJA 3U6DA 2F5NA 2KNVA 4LZJA 4JI8M 2MR9A 1G59A 1JR3D 1DGHA 3W0FA 3HY5A 3M0EA 4W5WA 8CATA 3W67A 4ANRA 4DUZM 2L6OA 2KZUA 1SXJC 3VKGA 1GJTA 4HEOA 2OOAA 3AJIB 4RF1A 5EXXA 2C5RA 3TE6A 3FTDA 3THGA 3SMPA 4Z8XA 2JZ0A 4FD2A 4L78A 1MU5A 4CHTB 3SHGB 5C1BA 1QAQA 3KSXA 2X8AA 4OX9M 1QUSA 3SHFA 5KO3A 3FUXA 1IN4A 4MGKE 2JUJA 4NXNM 1TDHA 4DBGB 1N33M 1G4AE 2LTUA 3I01M 4GEWA 3TWKA 4JI1M 2QP9X 1WR1B 4YY3M 2HKJA 2J7NA 2R44A 1L1TA 2EUCA 3L28A 3CTWB 4WURA 4QHSA 2KRUA 2X4AA 2RGHA 4LJ4A 3WHLA 1HR0M 3U6QA 1L2DA 1EE8A 2DZNB 4FCVA 4P17A 3HHZA 5DFLA 1NHGC 3U6EA 4FCWA 2JP7A 2LVPC 2LVOC 4CGYB 1YSYA 4MB7A 2DZLA 2XEPA 5LMNM 3M6AA 4GRIA 2XH9A 1Q02A 4IBCA 3LQRA 4RF0A 3TL4X 3NBIA 3U6CA 4LJ8A 3KOZE 4OVZA 4MH0E 3KS4A 1TH4A 2VQEM 2JY5A 2DZOB 1PM5A 1DGHB 5ITRA 3NWLA 3GPYA 1N32M 5FTKA 2Z7JA 4NC6A 3UMMA 4JI5M 3W68A 5EJCA 1MJGM 1PJJA 2KDLA 3GQ3A 4OU7A 3HX3A 4G4OA 3HU3A 3C58A 1VEGA 3TWLA 1XXHE 5DYGA 3GRVA 3LQQA 4FWHA 1QZEA 3U6OA 1D0KA 2G8LA 2XLJA 2Z3XA 3J7AS 1EIJA 2D7GA 2DVWB 1AIPC 2QHOB 4LZZA 4DR1M 1QANA 1HNWM 2R4JA 1WXQA 3Q8GA 4XGIA 2JA2A 4NXMM 2LH0A 3KP1E 1UM8A 1QYRA 2H5XA 1NVMA 2YQZA 3ZQJA 5ITXE 2F5QA 4REZA 4LJ9A 3SC3A 1XWIA 1GO5A 4LF9M 5BR8M 1YUBA 4L6V6 2HHHM 1Z59A 1EFUB 1R4GA 3HWSA 1IY1A 4AKIA 2ZTDA 2FOIC 1HNXM 1TH2A 1VG5A 1NSFA 1OQYA 2MGWA 1OIPA 2HAKA 2KHHA 3GLHE 1Z6TA 4GC5A 1PJSA 5FTJA 3BBZA 1SXJB 2DWNA 2LXEA 4LJAA 2DHRA 1E32A 3JR5A 2RGOA 1GL7A 2DAIA 1DGFA 3K2LA 3H4JA 1IBMM 3D8BA 1IXZA 1ZAEA 3B7NA 4LJ5A 3KSJA 1IFYA 2XF3A 2LBCA 4OVZB 3TPZA 3FKEA 3MK6A 4G6ZA 2UUAM 1D2NA 4HLQA 4II7A 3IHPA 3KVWA 4DR5M 1TF0B 3T38A 5IREB 4DR2M 2UUCM 4B3TM 4WW0A 3A45A 4R7GA 1DGBA 2ZBKB 4JI2M 1GKIA 3OTOM 3GPPA 4I5SA 3UZUA 2D7HA 1YE9A 2JY6B 1G8PA 3SARA 3MMPA 3AFHA 2C9OA 2R18A 1F4IA 1DGGA 3KOYE 3GP1A 3TWMA 4DR6M 2EJSA 3HHWA 2LVAA 2WSCF 5EXPA 3VK8A 2G3QA 2GQFA 1E9RA 4IBFA 3GLIE 4JV5M 2DAEA 2LVQD 1PGYA 3IECA 2O01F 3IG5A 1SG9A 4IBDA 1OFHA 1IN6A 2EKFA 3J2PB 3QAUA 2DI0A 4DV5M 4GKJM 1NJFA 1UFZA 4X64M 4M9SA 1HJPA 2KW0A 3ZH9B 3KW6A 2J7OA 4DR4M 4L4UA 1CUKA 4BBAA 5JI3E 1N36M 3E9SA 3GLFE 4B3MM 3DZDA 2XFTA 1Z5CA 2LWXA 1DV0A 1QUTA 1Z5AA 4NSRA 2CV1A 1D0LA 3LCVB 2E5LM 2C99A 4M9ZA 2R0IA 2CUZA 3CF2A 4JI0M 2Z4SA 4LCBA 4NSOB 4QOSA 3U61B 3HU2A 3K9OA 4I8OA 4K0KM 1NNJA 3AKZA 2N35A 4LFCM 3HHYA 2CHQA 1KFVA 1S3SA 1XXHA 3DOAA 4QNRA 3B89A 4AKHA 1HQCA 2I7NA 5H37D 3I4YA 3SYLA 3T1HM 4L16A 5ITQA 2APLA 1QZMA 1TGUA 2DHYA 4JN6A 5KQ8A 2DENA 2DXIA 1Q39A 3L27A 2CFOA 2EKKA 3A46A 1MX0A 5ITXA 4F2LA 1V92A 2BWEA 5IWAM 2DWLA 1XNQM 2A5YB 4G4QA 1WGLA 2VF8A 5IT9S 2DKLA 3K92A 1T6OA 4AG6A 3H4MA 4KHPM 3RE8A 1K82A 5DYIA 2DAMA 1G71A 2Y21A 2ZAMA 5EP2A 1ZMWA 5FTNA 2Z4RA 1HQYE
chains in the Genus database with same CATH topology
3DFZA 4AW4A 3KOWE 4LF6M 2V1CA 1G3IA 1NNUC 2D7EA 3U6PA 2F5SA 4PCZA 1SXJA 3ILKA 4LJ7A 1G41A 2F5PA 4B3RM 2UXBM 2Y0QA 3HHXA 2CHVA 1Z5BA 3GO8A 2UUBM 4PDGA 3J81S 1I94M 1W5TA 1IN7A 3M7GA 3U6LA 4M0DA 4LF5M 4NRVA 4GHAA 3KOXE 3U5ZB 3R8FA 2W82A 2NQ8C 1XXHB 1N75A 1W5SA 1R2ZA 2FFJA 2CV0A 1QVRA 5ITUA 3B9PA 1NHWC 2F4VM 4MGYE 1IN5A 3FUUA 2M5ZA 4JI3M 1QAOA 1HNZM 4D81A 4GKKM 2F5OA 4FWGA 1NJGA 4AKGA 4M9XA 2BJVA 2XSZD 3SASA 2XFSA 3SFZA 1J09A 1HT1E 3AOEC 1R6BX 4IBJA 1IY0A 4FWDA 3TQSA 3U61A 2YR0A 2FNAA 2R46A 3MHVC 3GLHB 2C9CA 3FYDA 5IZ7D 2UXDM 4IJFA 3FTEA 4IIWA 3SATA 3PXGA 3JR4A 3U60B 2QBYB 2KRKA 1ZQ9A 2ZAOA 1IXRC 5ITYA 3FUTA 1LV7A 3GRRA 3KDSE 2Y0TA 5FTLA 2VQFM 1R2YA 1J7KA 2KEBA 5EXTA 5EXSA 4LG2A 2H1RA 1DO0A 4IBIA 4LGMA 4KO8A 3VFDA 4DV4M 1X37A 3RFWA 1FNNA 4JI4M 5ITTA 4HL4A 4AQYM 5C18A 3PNYA 4ZPXA 1JQJC 4DV2M 4GH9A 4BLCA 4AZFA 4AI6A 2XGNA 3GLIB 2UXCM 4JXJA 2Y20A 1OJLA 2AHMA 4B7GA 4MGIE 4LY6A 4QHTA 4GC9A 3HJ8A 3UK6A 4LF4M 4EIWA 3GLFB 4IBEA 3JAMS 4DV1M 4X62M 2C98A 3HJSA 5GKNA 3SMSA 2G5GX 3FD9A 3KP0E 4G4NA 5FSWA 4MGHA 3VDUA 4B7HA 4TUWA 4JI6M 3J7BA 3HGIA 3AV0A 4FW9A 3WHKA 2QPAA 3EIHA 1C1KA 3U5ZA 2KA6B 2L09A 2ZM6M 4LF8M 3HJQA 3ZC7B 1K3WA 4DR7M 4LJ6A 5E26A 5LMUM 3GLGA 4DV0M 1R7RA 2YFQA 3EIEA 4DV7M 3SAUA 4RNAA 4G4RA 2ZANA 4QNMA 1L8QA 1GLNA 1SXJD 4I4LA 3VLFB 5KPTA 1GL6A 1KYIA 3W0LB 2R62A 2C96A 5F3WA 2DWZB 3I51A 1L1ZA 2M60A 2O5RA 3L29A 3BOSA 5A2QS 2L7IA 2VIIA 4NOOB 4IJEA 1PJIA 3T15A 1K3XA 3GLHA 5KPRA 3SAVA 1L2CA 2QENA 4DUYM 4LGYA 4R3DA 5EP4A 3GPUA 2KZSA 4B7FA 3VK7A 2V1UA 3U60A 2QBYA 1JR3A 1I4WA 7CATA 3PFIA 5EP3A 2R65A 3SBJA 3GPXA 1IBKM 5EP1A 1IN8A 4A3VB 1N77A 3GQ5A 4NL4H 5EQTA 3VKHA 1IXSB 3J27B 4L8RC 4MGZE 3FTFA 3IG8A 2R4EA 4LFBM 3GRYA 3E4RA 3HU1A 1XMOM 5FTMA 3R9XB 2CEAA 4GIPA 3LMMA 3GLGB 3GLIA 4B3SM 1XNRM 4LRSA 3GQ4A 4ITQA 1IQPA 4NRWA 3LVWA 4LRTA 1IBLM 1OFIA 4L15A 4LF7M 3L2AA 5KPZA 3CF6E 3K1JA 3GLFA 4PDIA 4X65M 4YHHM 1GVNA 2HL7A 4LFAM 4D82A 4FVMA 1QAMA 4PD2A 4M0WA 3FTCA 5FLXS 2ERCA 2RKOA 4KODA 5DNYA 2XZFA 3A98B 4P16A 1NY6A 4MM3B 2K47A 3ZCBB 4PT5A 2XZUA 4GHLA 1QQWA 4DV3M 4KLNA 4S12A 2YNMD 3A42A 3LVVA 1VDDA 3CF0A 2DWMA 1N34M 1J5EM 2BNKA 4OW0A 2BJWA 3K8ZA 3VDPA 2L7HA 3KFUG 4DR3M 3J80S 3KS8A 3GRUA 1FJGM 1NY5A 1IM2A 5E6JA 5BPVA 4GITA 1HT2E 4BB9A 1L2BA 1H6UA 2LNHC 4I81A 3FYCA 4XBOA 3AOEA 1SXJE 1KSFX 3FUWA 3RGSA 1IY2A 2KXEA 4D80A 2R45A 4GMQA 2OQ4A 3D8LA 3QWLA 2XSZA 1N78A 2QCUA 3AL0C 1TH3A 3AOGA 4QOZC 5KQDA 4JYAM 1DO2A 1T3TA 1XMQM 3SYKA 3U6SA 2I7PA 2X49A 3HKPA 1Q3CA 2UU9M 4Z6YA 3PVSA 2P5TA 2OPFA 4JI7M 4AG5A 2EA0A 3RGPA 1Q3BA 2CE7A 3L25A 4IBKA 3PNVA 3UGJA 3DA1A 3KXEC 1E94E 4B08A 4DV6M 2Q2EB 1TDZA 3Q8XA 3FUVA 3U6MA 2EO2A 1XHBA 3L26A 2V6ZM 3UJNA 3SAWA 4IBGA 3T1YM 2CHGA 2QZ4A 2FE8A 4CISA 2CV2A 3I4VA 3MJ5A 2HCBA 1E9SA 1ORYB 4FCTA 4IBBA 5JI2E 3U6DA 2F5NA 4JI8M 4LZJA 1G59A 1JR3D 1DGHA 3W0FA 3M0EA 4W5WA 8CATA 4DUZM 2L6OA 2KZUA 1SXJC 3VKGA 3AJIB 4RF1A 5EXXA 2C5RA 3TE6A 3FTDA 3THGA 3SMPA 4Z8XA 4FD2A 4L78A 1MU5A 4CHTB 3SHGB 5C1BA 1QAQA 3KSXA 2X8AA 4OX9M 3SHFA 5KO3A 3FUXA 1IN4A 4MGKE 4NXNM 1N33M 1TDHA 1G4AE 3TWKA 4JI1M 2QP9X 4YY3M 2HKJA 2J7NA 1L1TA 2EUCA 3L28A 3CTWB 4WURA 4QHSA 2KRUA 2X4AA 2RGHA 4LJ4A 3WHLA 1HR0M 3U6QA 1L2DA 1EE8A 2DZNB 4FCVA 3HHZA 1NHGC 3U6EA 4FCWA 4CGYB 1YSYA 4MB7A 2XEPA 5LMNM 3M6AA 4GRIA 2XH9A 3U6CA 4IBCA 3LQRA 4RF0A 3TL4X 3NBIA 4LJ8A 3KOZE 4OVZA 4MH0E 3KS4A 1TH4A 2VQEM 2DZOB 1PM5A 1DGHB 5ITRA 3NWLA 3GPYA 1N32M 5FTKA 2Z7JA 3UMMA 4JI5M 5EJCA 1PJJA 3GQ3A 4OU7A 4G4OA 3HU3A 3C58A 3TWLA 5DYGA 3GRVA 3LQQA 4FWHA 3U6OA 2G8LA 2XLJA 3J7AS 2Z3XA 2D7GA 2DVWB 4LZZA 4DR1M 1QANA 1HNWM 2R4JA 1WXQA 4XGIA 2JA2A 4NXMM 2LH0A 3KP1E 1UM8A 1QYRA 1NVMA 2YQZA 5ITXE 2F5QA 4REZA 4LJ9A 3SC3A 1XWIA 4LF9M 5BR8M 1YUBA 2HHHM 1Z59A 3HWSA 1IY1A 4AKIA 2FOIC 1HNXM 1TH2A 1NSFA 1Z6TA 4GC5A 5FTJA 1SXJB 2DWNA 2LXEA 4LJAA 2DHRA 1E32A 3JR5A 2RGOA 1GL7A 1DGFA 3K2LA 1IBMM 3D8BA 1IXZA 1ZAEA 4LJ5A 3KSJA 2XF3A 4OVZB 3TPZA 3FKEA 3MK6A 4G6ZA 2UUAM 1D2NA 4HLQA 4II7A 3KVWA 4DR5M 2UUCM 3T38A 5IREB 4DR2M 4B3TM 4WW0A 3A45A 4R7GA 1DGBA 2ZBKB 4JI2M 1GKIA 3OTOM 3GPPA 4I5SA 3UZUA 2D7HA 1YE9A 1G8PA 3SARA 3AFHA 2C9OA 2R18A 1DGGA 3KOYE 3GP1A 3TWMA 4DR6M 3HHWA 5EXPA 3VK8A 1XC8A 4JV5M 4IBFA 1E9RA 3IG5A 4IBDA 1OFHA 1IN6A 3J2PB 3QAUA 4DV5M 4GKJM 1NJFA 4X64M 4M9SA 2KW0A 3ZH9B 3KW6A 2J7OA 4DR4M 4L4UA 4BBAA 5JI3E 1N36M 4B3MM 3E9SA 3DZDA 2XFTA 1Z5CA 2LWXA 1Z5AA 4NSRA 2CV1A 2E5LM 2C99A 4M9ZA 2CUZA 3CF2A 4JI0M 2Z4SA 4LCBA 4NSOB 4QOSA 3U61B 3HU2A 4I8OA 4K0KM 1NNJA 3AKZA 4LFCM 3HHYA 2CHQA 1KFVA 1S3SA 1XXHA 3DOAA 4QNRA 4AKHA 1HQCA 2I7NA 5H37D 3I4YA 3SYLA 3T1HM 4L16A 5ITQA 1QZMA 1TGUA 5KQ8A 4JN6A 2DXIA 1Q39A 3L27A 2CFOA 3A46A 1MX0A 5ITXA 5IWAM 2DWLA 1XNQM 2A5YB 4G4QA 5IT9S 3K92A 4AG6A 3H4MA 4KHPM 3RE8A 1K82A 5DYIA 2Y21A 2ZAMA 5FTNA 5EP2A 4X66M 2Z4RA 1HQYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2B A;  3C58 A;  3TWL A;  4LF6 M;  2ZM6 M;  2F5S A;  4LF8 M;  3U6P A;  4PCZ A;  3U6O A;  3J7A S;  1K3W A;  4DR7 M;  2F5P A;  4DR1 M;  5LMU M;  1HNW M;  4B3R M;  2UXB M;  4DV0 M;  4DV7 M;  2OQ4 A;  1Z5B A;  3SAU A;  3GO8 A;  4G4R A;  4NXM M;  5ITX E;  2F5Q A;  2UUB M;  4PDG A;  3J81 S;  1I94 M;  4JYA M;  4LF9 M;  5BR8 M;  1XMQ M;  3U6L A;  3U6S A;  2HHH M;  1Z59 A;  1Q3C A;  2UU9 M;  1L1Z A;  4LF5 M;  4NRV A;  1HNX M;  5A2Q S;  2OPF A;  4JI7 M;  2EA0 A;  1Q3B A;  1PJI A;  1K3X A;  1R2Z A;  1TDZ A;  4DV6 M;  2Q2E B;  3JR5 A;  1L2C A;  3U6M A;  3SAV A;  5ITU A;  4DUY M;  1IBM M;  3GPU A;  2F4V M;  3SAW A;  3VK7 A;  3T1Y M;  4CIS A;  2UUA M;  4JI3 M;  1HNZ M;  4DR5 M;  2UUC M;  4GKK M;  4DR2 M;  4B3T M;  4JI2 M;  3A45 A;  2F5O A;  2ZBK B;  3SBJ A;  3OTO M;  3GPX A;  3GPP A;  3U6D A;  1IBK M;  2F5N A;  4JI8 M;  3W0F A;  3GQ5 A;  4JI6 M;  3SAS A;  3SAR A;  4DUZ M;  3GP1 A;  3TWM A;  4DR6 M;  1XC8 A;  3VK8 A;  4JV5 M;  4LFB M;  1XMO M;  2UXD M;  3SAT A;  4B3S M;  1XNR M;  4GKJ M;  4DV5 M;  3JR4 A;  1MU5 A;  4X64 M;  3GQ4 A;  4ITQ A;  4DR4 M;  4NRW A;  5ITY A;  4OX9 M;  1N36 M;  1IBL M;  4B3M M;  4LF7 M;  4NXN M;  1N33 M;  1TDH A;  2VQF M;  1R2Y A;  1Z5C A;  1Z5A A;  3TWK A;  4JI1 M;  4YY3 M;  2HKJ A;  1L1T A;  2E5L M;  4PDI A;  4JI0 M;  4X65 M;  4DV4 M;  4YHH M;  1HR0 M;  4K0K M;  4LFA M;  1NNJ A;  3U6Q A;  1L2D A;  4JI4 M;  5ITT A;  1EE8 A;  4LFC M;  4PD2 A;  4AQY M;  5FLX S;  4DV2 M;  3U6E A;  1KFV A;  2XZF A;  3DOA A;  2UXC M;  2XZU A;  4MB7 A;  4DV3 M;  3T1H M;  5LMN M;  5ITQ A;  3A42 A;  3U6C A;  1N34 M;  1J5E M;  1Q39 A;  4LF4 M;  3A46 A;  1MX0 A;  4DV1 M;  5ITX A;  3JAM S;  4X62 M;  5IWA M;  2VQE M;  1XNQ M;  4G4Q A;  5IT9 S;  4DR3 M;  1PM5 A;  3J80 S;  3GPY A;  1N32 M;  4G4N A;  4KHP M;  1FJG M;  1K82 A;  4JI5 M;  4X66 M;  1PJJ A;  5ITR A;  3GQ3 A;  4G4O A; 
#chains in the Genus database with same CATH topology
 3DFZ A;  4AW4 A;  3KOW E;  4LF6 M;  2V1C A;  1G3I A;  1NNU C;  2D7E A;  3U6P A;  2CP8 A;  2F5S A;  4PCZ A;  1SXJ A;  3ILK A;  4LJ7 A;  1G41 A;  2F5P A;  4B3R M;  2UXB M;  2Y0Q A;  3HHX A;  2CHV A;  2O25 A;  1Z5B A;  2FH0 A;  4G3O A;  3GO8 A;  2UUB M;  4PDG A;  3J81 S;  1I94 M;  1W5T A;  1IN7 A;  3M7G A;  3U6L A;  4M0D A;  4LF5 M;  4NRV A;  4GHA A;  3KOX E;  3U5Z B;  3R8F A;  4F1I A;  2W82 A;  2NQ8 C;  1XXH B;  1N75 A;  1W5S A;  4X66 M;  1R2Z A;  2FFJ A;  2CV0 A;  2LHG A;  1QVR A;  5ITU A;  3GLG E;  3B9P A;  1NHW C;  2F4V M;  4MGY E;  1IN5 A;  3FUU A;  2M5Z A;  4JI3 M;  1QAO A;  1HNZ M;  4D81 A;  4GKK M;  2CRU A;  2F5O A;  4FWG A;  4UN2 B;  4CIZ A;  1NJG A;  2OOB A;  4AKG A;  4M9X A;  2BJV A;  2XSZ D;  3SAS A;  2XFS A;  3SFZ A;  1J09 A;  1HT1 E;  3AOE C;  1R6B X;  4IBJ A;  1IY0 A;  4FWD A;  3TQS A;  1OAI A;  2YR0 A;  2FNA A;  2R46 A;  3U61 A;  3B7Z A;  3MHV C;  3GLH B;  2C9C A;  3FYD A;  5IZ7 D;  2UXD M;  4IJF A;  3FTE A;  4IIW A;  3SAT A;  1VDL A;  1TTE A;  3PXG A;  3JR4 A;  3U60 B;  2QBY B;  2KRK A;  1JR3 E;  1ZQ9 A;  2ZAO A;  1MN3 A;  1IXR C;  5ITY A;  3T6P A;  3FUT A;  1LV7 A;  3GRR A;  3KDS E;  2Y0T A;  5FTL A;  2VQF M;  1R2Y A;  1J7K A;  2KEB A;  5EXT A;  5EXS A;  4R71 A;  2JXN A;  2K6B A;  4LG2 A;  1OIZ A;  2OO9 A;  3I04 M;  2H1R A;  1DO0 A;  4IBI A;  4LGM A;  1NV8 A;  4KO8 A;  2ZTC A;  3VFD A;  4DV4 M;  1X37 A;  3RFW A;  1FNN A;  4JI4 M;  5ITT A;  4HL4 A;  4AQY M;  5C18 A;  2MJ5 B;  3PNY A;  4ZPX A;  1JQJ C;  4DV2 M;  4GH9 A;  4BLC A;  4AZF A;  4AI6 A;  2XGN A;  3GLI B;  2UXC M;  4JXJ A;  2JNH A;  2Y20 A;  1OJL A;  2AHM A;  4B7G A;  2DAG A;  1GJS A;  4MGI E;  4LY6 A;  4QHT A;  4GC9 A;  1D0M A;  2WSE F;  3HJ8 A;  3UK6 A;  4LF4 M;  4EIW A;  3GLF B;  4IBE A;  3JAM S;  4DV1 M;  4X62 M;  2C98 A;  4WP2 A;  3HJS A;  5GKN A;  3SMS A;  2G5G X;  2JY7 A;  3FD9 A;  3KP0 E;  5FSW A;  4MGH A;  3NBX X;  4G4N A;  3VDU A;  1YLA A;  4B7H A;  1QDT A;  2HWJ A;  4TUW A;  4RKU F;  4JI6 M;  3J7B A;  3HGI A;  3AV0 A;  4FW9 A;  3WHK A;  1PJQ A;  2QPA A;  3EIH A;  1C1K A;  2J5Y A;  2KA6 B;  3U5Z A;  1V33 A;  2LVN C;  2L09 A;  2ZM6 M;  4LF8 M;  3HJQ A;  3ZC7 B;  1K3W A;  4DR7 M;  1WJ7 A;  4LJ6 A;  1GAB A;  5E26 A;  5LMU M;  3GLG A;  4DV0 M;  1R7R A;  2DAK A;  2YFQ A;  3EIE A;  4DV7 M;  2QQ8 A;  3B74 A;  4Y28 F;  3SAU A;  4RNA A;  4G4R A;  2ZAN A;  2QNJ A;  1WGN A;  1L8Q A;  1GLN A;  4QNM A;  1SXJ D;  2RRU A;  3K9P A;  1NO1 A;  4I4L A;  3VLF B;  5KPT A;  1XB2 B;  3QYB A;  1GL6 A;  1KYI A;  3W0L B;  2R62 A;  1PRB A;  2C96 A;  5F3W A;  2DWZ B;  3I51 A;  1L1Z A;  2M60 A;  2BWB A;  2O5R A;  3L29 A;  1R5L A;  3BOS A;  5A2Q S;  2L7I A;  2VII A;  3E21 A;  2VF7 A;  4NOO B;  4IJE A;  1PJI A;  3T15 A;  1K3X A;  3LW5 F;  3GLH A;  5KPR A;  3SAV A;  1L2C A;  2QEN A;  1P3Q Q;  4DUY M;  4LGY A;  4R3D A;  2LHC A;  5EP4 A;  3GPU A;  1WIV A;  2B3T A;  1WHC A;  2KZS A;  4B7F A;  3VK7 A;  2V1U A;  3U60 A;  2QBY A;  1JR3 A;  1I4W A;  7CAT A;  2KNA A;  3PFI A;  5EP3 A;  2R65 A;  3SBJ A;  3GPX A;  3B7Q A;  1IBK M;  5EP1 A;  1IN8 A;  3E46 A;  4A3V B;  1N77 A;  3HZJ A;  3GQ5 A;  4NL4 H;  2L2D A;  5EQT A;  3VKH A;  1IXS B;  2CWB A;  1XC8 A;  1JB0 F;  3J27 B;  1A5T A;  4L8R C;  4MGZ E;  3FTF A;  1AUA A;  3IG8 A;  2R4E A;  4LFB M;  3GRY A;  1VEK A;  3E4R A;  3HU1 A;  1XMO M;  5FTM A;  3CGW A;  3R9X B;  2CEA A;  4GIP A;  3LMM A;  3GLG B;  3GLI A;  4B3S M;  1XNR M;  3V76 A;  4LRS A;  3GQ4 A;  2L4E A;  4ITQ A;  1IQP A;  4NRW A;  1Y8G A;  3LVW A;  4LRT A;  1IBL M;  1OFI A;  4L15 A;  4LF7 M;  2WZJ A;  1OTR A;  3L2A A;  5KPZ A;  3CF6 E;  3K1J A;  3GLF A;  4PDI A;  3F92 A;  4X65 M;  4YHH M;  1ZMU A;  1GVN A;  1PJT A;  2HL7 A;  4LFA M;  4D82 A;  4FVM A;  3FRH A;  2WSF F;  3FRI A;  2VDB B;  1QAM A;  4PD2 A;  3BXW A;  4M0W A;  3FTC A;  5FLX S;  2JWS A;  2ERC A;  2JZ1 A;  2RKO A;  4KOD A;  5DNY A;  3A98 B;  4P16 A;  1NY6 A;  4MM3 B;  2XZF A;  2K47 A;  3ZCB B;  1V34 A;  4PT5 A;  2XZU A;  4GHL A;  1QQW A;  4DV3 M;  4KLN A;  4CJ6 A;  4S12 A;  3C9P A;  2YNM D;  3A42 A;  3LVV A;  1C7Y A;  1VDD A;  3CF0 A;  2DWM A;  1N34 M;  3C3D A;  1J5E M;  3LCU A;  2BNK A;  4OW0 A;  2BJW A;  2Z8Y M;  3K8Z A;  3VDP A;  2L7H A;  3KFU G;  1BVS A;  4DR3 M;  3J80 S;  2QSF X;  3KS8 A;  3GRU A;  1FJG M;  1ZV1 A;  1NY5 A;  1IM2 A;  1QDR A;  5E6J A;  1OKS A;  5BPV A;  4GIT A;  1HT2 E;  4BB9 A;  1L2B A;  1H6U A;  1ZMV A;  2LNH C;  4I81 A;  3FYC A;  4XBO A;  3AOE A;  1SXJ E;  1KSF X;  3FUW A;  3RGS A;  1OAO C;  1RU3 A;  1IY2 A;  2K9D A;  2KXE A;  4D80 A;  4Q7J A;  2R45 A;  4GMQ A;  2OQ4 A;  3D8L A;  3QWL A;  2XSZ A;  1VQ1 A;  4XK8 F;  1N78 A;  2QCU A;  3AL0 C;  1T43 A;  1TH3 A;  3AOG A;  5KQD A;  4QOZ C;  2L4F A;  4JYA M;  1DO2 A;  1T3T A;  1XMQ M;  3SYK A;  3U6S A;  2I7P A;  2X49 A;  3HKP A;  1NV9 A;  2K0B X;  1Q3C A;  3C3E A;  2UU9 M;  4Z6Y A;  3PVS A;  2P5T A;  2OPF A;  4JI7 M;  4AG5 A;  3FE3 A;  2MRO B;  3RGP A;  1Q3B A;  1LTM A;  1IXS A;  2CE7 A;  2DNA A;  2FS1 A;  2EA0 A;  4IBK A;  3PNV A;  3L25 A;  2R6F A;  3UGJ A;  3DA1 A;  3KXE C;  5L8R F;  2JY8 A;  1E94 E;  4B08 A;  4DV6 M;  2Q2E B;  2MH8 A;  3Q8X A;  3FUV A;  3QYE A;  3U6M A;  1TDZ A;  2EO2 A;  1XHB A;  3L26 A;  2V6Z M;  3UJN A;  3SAW A;  2GNO A;  4IBG A;  3T1Y M;  2CHG A;  2QZ4 A;  2FE8 A;  4CIS A;  2CV2 A;  3I4V A;  3MJ5 A;  1TR8 A;  2HCB A;  2KNZ A;  4KT0 F;  1E9S A;  1ORY B;  4FCT A;  4IBB A;  5JI2 E;  1VEJ A;  3U6D A;  2F5N A;  2KNV A;  4LZJ A;  4JI8 M;  2MR9 A;  1G59 A;  1JR3 D;  1DGH A;  3W0F A;  3HY5 A;  3M0E A;  4W5W A;  8CAT A;  3W67 A;  4ANR A;  4DUZ M;  2L6O A;  2KZU A;  1SXJ C;  3VKG A;  1GJT A;  4HEO A;  2OOA A;  3AJI B;  4RF1 A;  5EXX A;  2C5R A;  3TE6 A;  3FTD A;  3THG A;  3SMP A;  4Z8X A;  2JZ0 A;  4FD2 A;  4L78 A;  1MU5 A;  4CHT B;  3SHG B;  5C1B A;  1QAQ A;  3KSX A;  2X8A A;  4OX9 M;  1QUS A;  3SHF A;  5KO3 A;  3FUX A;  1IN4 A;  4MGK E;  2JUJ A;  4NXN M;  1TDH A;  4DBG B;  1N33 M;  1G4A E;  2LTU A;  3I01 M;  4GEW A;  3TWK A;  4JI1 M;  2QP9 X;  1WR1 B;  4YY3 M;  2HKJ A;  2J7N A;  2R44 A;  1L1T A;  2EUC A;  3L28 A;  3CTW B;  4WUR A;  4QHS A;  2KRU A;  2X4A A;  2RGH A;  4LJ4 A;  3WHL A;  1HR0 M;  3U6Q A;  1L2D A;  1EE8 A;  2DZN B;  4FCV A;  4P17 A;  3HHZ A;  5DFL A;  1NHG C;  3U6E A;  4FCW A;  2JP7 A;  2LVP C;  2LVO C;  4CGY B;  1YSY A;  4MB7 A;  2DZL A;  2XEP A;  5LMN M;  3M6A A;  4GRI A;  2XH9 A;  1Q02 A;  4IBC A;  3LQR A;  4RF0 A;  3TL4 X;  3NBI A;  3U6C A;  4LJ8 A;  3KOZ E;  4OVZ A;  4MH0 E;  3KS4 A;  1TH4 A;  2VQE M;  2JY5 A;  2DZO B;  1PM5 A;  1DGH B;  5ITR A;  3NWL A;  3GPY A;  1N32 M;  5FTK A;  2Z7J A;  4NC6 A;  3UMM A;  4JI5 M;  3W68 A;  5EJC A;  1MJG M;  1PJJ A;  2KDL A;  3GQ3 A;  4OU7 A;  3HX3 A;  4G4O A;  3HU3 A;  3C58 A;  1VEG A;  3TWL A;  1XXH E;  5DYG A;  3GRV A;  3LQQ A;  4FWH A;  1QZE A;  3U6O A;  1D0K A;  2G8L A;  2XLJ A;  2Z3X A;  3J7A S;  1EIJ A;  2D7G A;  2DVW B;  1AIP C;  2QHO B;  4LZZ A;  4DR1 M;  1QAN A;  1HNW M;  2R4J A;  1WXQ A;  3Q8G A;  4XGI A;  2JA2 A;  4NXM M;  2LH0 A;  3KP1 E;  1UM8 A;  1QYR A;  2H5X A;  1NVM A;  2YQZ A;  3ZQJ A;  5ITX E;  2F5Q A;  4REZ A;  4LJ9 A;  3SC3 A;  1XWI A;  1GO5 A;  4LF9 M;  5BR8 M;  1YUB A;  4L6V 6;  2HHH M;  1Z59 A;  1EFU B;  1R4G A;  3HWS A;  1IY1 A;  4AKI A;  2ZTD A;  2FOI C;  1HNX M;  1TH2 A;  1VG5 A;  1NSF A;  1OQY A;  2MGW A;  1OIP A;  2HAK A;  2KHH A;  3GLH E;  1Z6T A;  4GC5 A;  1PJS A;  5FTJ A;  3BBZ A;  1SXJ B;  2DWN A;  2LXE A;  4LJA A;  2DHR A;  1E32 A;  3JR5 A;  2RGO A;  1GL7 A;  2DAI A;  1DGF A;  3K2L A;  3H4J A;  1IBM M;  3D8B A;  1IXZ A;  1ZAE A;  3B7N A;  4LJ5 A;  3KSJ A;  1IFY A;  2XF3 A;  2LBC A;  4OVZ B;  3TPZ A;  3FKE A;  3MK6 A;  4G6Z A;  2UUA M;  1D2N A;  4HLQ A;  4II7 A;  3IHP A;  3KVW A;  4DR5 M;  1TF0 B;  3T38 A;  5IRE B;  4DR2 M;  2UUC M;  4B3T M;  4WW0 A;  3A45 A;  4R7G A;  1DGB A;  2ZBK B;  4JI2 M;  1GKI A;  3OTO M;  3GPP A;  4I5S A;  3UZU A;  2D7H A;  1YE9 A;  2JY6 B;  1G8P A;  3SAR A;  3MMP A;  3AFH A;  2C9O A;  2R18 A;  1F4I A;  1DGG A;  3KOY E;  3GP1 A;  3TWM A;  4DR6 M;  2EJS A;  3HHW A;  2LVA A;  2WSC F;  5EXP A;  3VK8 A;  2G3Q A;  2GQF A;  1E9R A;  4IBF A;  3GLI E;  4JV5 M;  2DAE A;  2LVQ D;  1PGY A;  3IEC A;  2O01 F;  3IG5 A;  1SG9 A;  4IBD A;  1OFH A;  1IN6 A;  2EKF A;  3J2P B;  3QAU A;  2DI0 A;  4DV5 M;  4GKJ M;  1NJF A;  1UFZ A;  4X64 M;  4M9S A;  1HJP A;  2KW0 A;  3ZH9 B;  3KW6 A;  2J7O A;  4DR4 M;  4L4U A;  1CUK A;  4BBA A;  5JI3 E;  1N36 M;  3E9S A;  3GLF E;  4B3M M;  3DZD A;  2XFT A;  1Z5C A;  2LWX A;  1DV0 A;  1QUT A;  1Z5A A;  4NSR A;  2CV1 A;  1D0L A;  3LCV B;  2E5L M;  2C99 A;  4M9Z A;  2R0I A;  2CUZ A;  3CF2 A;  4JI0 M;  2Z4S A;  4LCB A;  4NSO B;  4QOS A;  3U61 B;  3HU2 A;  3K9O A;  4I8O A;  4K0K M;  1NNJ A;  3AKZ A;  2N35 A;  4LFC M;  3HHY A;  2CHQ A;  1KFV A;  1S3S A;  1XXH A;  3DOA A;  4QNR A;  3B89 A;  4AKH A;  1HQC A;  2I7N A;  5H37 D;  3I4Y A;  3SYL A;  3T1H M;  4L16 A;  5ITQ A;  2APL A;  1QZM A;  1TGU A;  2DHY A;  4JN6 A;  5KQ8 A;  2DEN A;  2DXI A;  1Q39 A;  3L27 A;  2CFO A;  2EKK A;  3A46 A;  1MX0 A;  5ITX A;  4F2L A;  1V92 A;  2BWE A;  5IWA M;  2DWL A;  1XNQ M;  2A5Y B;  4G4Q A;  1WGL A;  2VF8 A;  5IT9 S;  2DKL A;  3K92 A;  1T6O A;  4AG6 A;  3H4M A;  4KHP M;  3RE8 A;  1K82 A;  5DYI A;  2DAM A;  1G71 A;  2Y21 A;  2ZAM A;  5EP2 A;  1ZMW A;  5FTN A;  2Z4R A;  1HQY E; 
#chains in the Genus database with same CATH homology
 3DFZ A;  4AW4 A;  3KOW E;  4LF6 M;  2V1C A;  1G3I A;  1NNU C;  2D7E A;  3U6P A;  2F5S A;  4PCZ A;  1SXJ A;  3ILK A;  4LJ7 A;  1G41 A;  2F5P A;  4B3R M;  2UXB M;  2Y0Q A;  3HHX A;  2CHV A;  1Z5B A;  3GO8 A;  2UUB M;  4PDG A;  3J81 S;  1I94 M;  1W5T A;  1IN7 A;  3M7G A;  3U6L A;  4M0D A;  4LF5 M;  4NRV A;  4GHA A;  3KOX E;  3U5Z B;  3R8F A;  2W82 A;  2NQ8 C;  1XXH B;  1N75 A;  1W5S A;  1R2Z A;  2FFJ A;  2CV0 A;  1QVR A;  5ITU A;  3B9P A;  1NHW C;  2F4V M;  4MGY E;  1IN5 A;  3FUU A;  2M5Z A;  4JI3 M;  1QAO A;  1HNZ M;  4D81 A;  4GKK M;  2F5O A;  4FWG A;  1NJG A;  4AKG A;  4M9X A;  2BJV A;  2XSZ D;  3SAS A;  2XFS A;  3SFZ A;  1J09 A;  1HT1 E;  3AOE C;  1R6B X;  4IBJ A;  1IY0 A;  4FWD A;  3TQS A;  3U61 A;  2YR0 A;  2FNA A;  2R46 A;  3MHV C;  3GLH B;  2C9C A;  3FYD A;  5IZ7 D;  2UXD M;  4IJF A;  3FTE A;  4IIW A;  3SAT A;  3PXG A;  3JR4 A;  3U60 B;  2QBY B;  2KRK A;  1ZQ9 A;  2ZAO A;  1IXR C;  5ITY A;  3FUT A;  1LV7 A;  3GRR A;  3KDS E;  2Y0T A;  5FTL A;  2VQF M;  1R2Y A;  1J7K A;  2KEB A;  5EXT A;  5EXS A;  4LG2 A;  2H1R A;  1DO0 A;  4IBI A;  4LGM A;  4KO8 A;  3VFD A;  4DV4 M;  1X37 A;  3RFW A;  1FNN A;  4JI4 M;  5ITT A;  4HL4 A;  4AQY M;  5C18 A;  3PNY A;  4ZPX A;  1JQJ C;  4DV2 M;  4GH9 A;  4BLC A;  4AZF A;  4AI6 A;  2XGN A;  3GLI B;  2UXC M;  4JXJ A;  2Y20 A;  1OJL A;  2AHM A;  4B7G A;  4MGI E;  4LY6 A;  4QHT A;  4GC9 A;  3HJ8 A;  3UK6 A;  4LF4 M;  4EIW A;  3GLF B;  4IBE A;  3JAM S;  4DV1 M;  4X62 M;  2C98 A;  3HJS A;  5GKN A;  3SMS A;  2G5G X;  3FD9 A;  3KP0 E;  4G4N A;  5FSW A;  4MGH A;  3VDU A;  4B7H A;  4TUW A;  4JI6 M;  3J7B A;  3HGI A;  3AV0 A;  4FW9 A;  3WHK A;  2QPA A;  3EIH A;  1C1K A;  3U5Z A;  2KA6 B;  2L09 A;  2ZM6 M;  4LF8 M;  3HJQ A;  3ZC7 B;  1K3W A;  4DR7 M;  4LJ6 A;  5E26 A;  5LMU M;  3GLG A;  4DV0 M;  1R7R A;  2YFQ A;  3EIE A;  4DV7 M;  3SAU A;  4RNA A;  4G4R A;  2ZAN A;  4QNM A;  1L8Q A;  1GLN A;  1SXJ D;  4I4L A;  3VLF B;  5KPT A;  1GL6 A;  1KYI A;  3W0L B;  2R62 A;  2C96 A;  5F3W A;  2DWZ B;  3I51 A;  1L1Z A;  2M60 A;  2O5R A;  3L29 A;  3BOS A;  5A2Q S;  2L7I A;  2VII A;  4NOO B;  4IJE A;  1PJI A;  3T15 A;  1K3X A;  3GLH A;  5KPR A;  3SAV A;  1L2C A;  2QEN A;  4DUY M;  4LGY A;  4R3D A;  5EP4 A;  3GPU A;  2KZS A;  4B7F A;  3VK7 A;  2V1U A;  3U60 A;  2QBY A;  1JR3 A;  1I4W A;  7CAT A;  3PFI A;  5EP3 A;  2R65 A;  3SBJ A;  3GPX A;  1IBK M;  5EP1 A;  1IN8 A;  4A3V B;  1N77 A;  3GQ5 A;  4NL4 H;  5EQT A;  3VKH A;  1IXS B;  3J27 B;  4L8R C;  4MGZ E;  3FTF A;  3IG8 A;  2R4E A;  4LFB M;  3GRY A;  3E4R A;  3HU1 A;  1XMO M;  5FTM A;  3R9X B;  2CEA A;  4GIP A;  3LMM A;  3GLG B;  3GLI A;  4B3S M;  1XNR M;  4LRS A;  3GQ4 A;  4ITQ A;  1IQP A;  4NRW A;  3LVW A;  4LRT A;  1IBL M;  1OFI A;  4L15 A;  4LF7 M;  3L2A A;  5KPZ A;  3CF6 E;  3K1J A;  3GLF A;  4PDI A;  4X65 M;  4YHH M;  1GVN A;  2HL7 A;  4LFA M;  4D82 A;  4FVM A;  1QAM A;  4PD2 A;  4M0W A;  3FTC A;  5FLX S;  2ERC A;  2RKO A;  4KOD A;  5DNY A;  2XZF A;  3A98 B;  4P16 A;  1NY6 A;  4MM3 B;  2K47 A;  3ZCB B;  4PT5 A;  2XZU A;  4GHL A;  1QQW A;  4DV3 M;  4KLN A;  4S12 A;  2YNM D;  3A42 A;  3LVV A;  1VDD A;  3CF0 A;  2DWM A;  1N34 M;  1J5E M;  2BNK A;  4OW0 A;  2BJW A;  3K8Z A;  3VDP A;  2L7H A;  3KFU G;  4DR3 M;  3J80 S;  3KS8 A;  3GRU A;  1FJG M;  1NY5 A;  1IM2 A;  5E6J A;  5BPV A;  4GIT A;  1HT2 E;  4BB9 A;  1L2B A;  1H6U A;  2LNH C;  4I81 A;  3FYC A;  4XBO A;  3AOE A;  1SXJ E;  1KSF X;  3FUW A;  3RGS A;  1IY2 A;  2KXE A;  4D80 A;  2R45 A;  4GMQ A;  2OQ4 A;  3D8L A;  3QWL A;  2XSZ A;  1N78 A;  2QCU A;  3AL0 C;  1TH3 A;  3AOG A;  4QOZ C;  5KQD A;  4JYA M;  1DO2 A;  1T3T A;  1XMQ M;  3SYK A;  3U6S A;  2I7P A;  2X49 A;  3HKP A;  1Q3C A;  2UU9 M;  4Z6Y A;  3PVS A;  2P5T A;  2OPF A;  4JI7 M;  4AG5 A;  2EA0 A;  3RGP A;  1Q3B A;  2CE7 A;  3L25 A;  4IBK A;  3PNV A;  3UGJ A;  3DA1 A;  3KXE C;  1E94 E;  4B08 A;  4DV6 M;  2Q2E B;  1TDZ A;  3Q8X A;  3FUV A;  3U6M A;  2EO2 A;  1XHB A;  3L26 A;  2V6Z M;  3UJN A;  3SAW A;  4IBG A;  3T1Y M;  2CHG A;  2QZ4 A;  2FE8 A;  4CIS A;  2CV2 A;  3I4V A;  3MJ5 A;  2HCB A;  1E9S A;  1ORY B;  4FCT A;  4IBB A;  5JI2 E;  3U6D A;  2F5N A;  4JI8 M;  4LZJ A;  1G59 A;  1JR3 D;  1DGH A;  3W0F A;  3M0E A;  4W5W A;  8CAT A;  4DUZ M;  2L6O A;  2KZU A;  1SXJ C;  3VKG A;  3AJI B;  4RF1 A;  5EXX A;  2C5R A;  3TE6 A;  3FTD A;  3THG A;  3SMP A;  4Z8X A;  4FD2 A;  4L78 A;  1MU5 A;  4CHT B;  3SHG B;  5C1B A;  1QAQ A;  3KSX A;  2X8A A;  4OX9 M;  3SHF A;  5KO3 A;  3FUX A;  1IN4 A;  4MGK E;  4NXN M;  1N33 M;  1TDH A;  1G4A E;  3TWK A;  4JI1 M;  2QP9 X;  4YY3 M;  2HKJ A;  2J7N A;  1L1T A;  2EUC A;  3L28 A;  3CTW B;  4WUR A;  4QHS A;  2KRU A;  2X4A A;  2RGH A;  4LJ4 A;  3WHL A;  1HR0 M;  3U6Q A;  1L2D A;  1EE8 A;  2DZN B;  4FCV A;  3HHZ A;  1NHG C;  3U6E A;  4FCW A;  4CGY B;  1YSY A;  4MB7 A;  2XEP A;  5LMN M;  3M6A A;  4GRI A;  2XH9 A;  3U6C A;  4IBC A;  3LQR A;  4RF0 A;  3TL4 X;  3NBI A;  4LJ8 A;  3KOZ E;  4OVZ A;  4MH0 E;  3KS4 A;  1TH4 A;  2VQE M;  2DZO B;  1PM5 A;  1DGH B;  5ITR A;  3NWL A;  3GPY A;  1N32 M;  5FTK A;  2Z7J A;  3UMM A;  4JI5 M;  5EJC A;  1PJJ A;  3GQ3 A;  4OU7 A;  4G4O A;  3HU3 A;  3C58 A;  3TWL A;  5DYG A;  3GRV A;  3LQQ A;  4FWH A;  3U6O A;  2G8L A;  2XLJ A;  3J7A S;  2Z3X A;  2D7G A;  2DVW B;  4LZZ A;  4DR1 M;  1QAN A;  1HNW M;  2R4J A;  1WXQ A;  4XGI A;  2JA2 A;  4NXM M;  2LH0 A;  3KP1 E;  1UM8 A;  1QYR A;  1NVM A;  2YQZ A;  5ITX E;  2F5Q A;  4REZ A;  4LJ9 A;  3SC3 A;  1XWI A;  4LF9 M;  5BR8 M;  1YUB A;  2HHH M;  1Z59 A;  3HWS A;  1IY1 A;  4AKI A;  2FOI C;  1HNX M;  1TH2 A;  1NSF A;  1Z6T A;  4GC5 A;  5FTJ A;  1SXJ B;  2DWN A;  2LXE A;  4LJA A;  2DHR A;  1E32 A;  3JR5 A;  2RGO A;  1GL7 A;  1DGF A;  3K2L A;  1IBM M;  3D8B A;  1IXZ A;  1ZAE A;  4LJ5 A;  3KSJ A;  2XF3 A;  4OVZ B;  3TPZ A;  3FKE A;  3MK6 A;  4G6Z A;  2UUA M;  1D2N A;  4HLQ A;  4II7 A;  3KVW A;  4DR5 M;  2UUC M;  3T38 A;  5IRE B;  4DR2 M;  4B3T M;  4WW0 A;  3A45 A;  4R7G A;  1DGB A;  2ZBK B;  4JI2 M;  1GKI A;  3OTO M;  3GPP A;  4I5S A;  3UZU A;  2D7H A;  1YE9 A;  1G8P A;  3SAR A;  3AFH A;  2C9O A;  2R18 A;  1DGG A;  3KOY E;  3GP1 A;  3TWM A;  4DR6 M;  3HHW A;  5EXP A;  3VK8 A;  1XC8 A;  4JV5 M;  4IBF A;  1E9R A;  3IG5 A;  4IBD A;  1OFH A;  1IN6 A;  3J2P B;  3QAU A;  4DV5 M;  4GKJ M;  1NJF A;  4X64 M;  4M9S A;  2KW0 A;  3ZH9 B;  3KW6 A;  2J7O A;  4DR4 M;  4L4U A;  4BBA A;  5JI3 E;  1N36 M;  4B3M M;  3E9S A;  3DZD A;  2XFT A;  1Z5C A;  2LWX A;  1Z5A A;  4NSR A;  2CV1 A;  2E5L M;  2C99 A;  4M9Z A;  2CUZ A;  3CF2 A;  4JI0 M;  2Z4S A;  4LCB A;  4NSO B;  4QOS A;  3U61 B;  3HU2 A;  4I8O A;  4K0K M;  1NNJ A;  3AKZ A;  4LFC M;  3HHY A;  2CHQ A;  1KFV A;  1S3S A;  1XXH A;  3DOA A;  4QNR A;  4AKH A;  1HQC A;  2I7N A;  5H37 D;  3I4Y A;  3SYL A;  3T1H M;  4L16 A;  5ITQ A;  1QZM A;  1TGU A;  5KQ8 A;  4JN6 A;  2DXI A;  1Q39 A;  3L27 A;  2CFO A;  3A46 A;  1MX0 A;  5ITX A;  5IWA M;  2DWL A;  1XNQ M;  2A5Y B;  4G4Q A;  5IT9 S;  3K92 A;  4AG6 A;  3H4M A;  4KHP M;  3RE8 A;  1K82 A;  5DYI A;  2Y21 A;  2ZAM A;  5FTN A;  5EP2 A;  4X66 M;  2Z4R A;  1HQY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...