4JI7M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji7M02
5ITQA 5ITTA 4LFAM 3A45A 1IBLM 4X64M 1HNWM 1PJIA 4MB7A 4DR3M 2F5PA 2UXDM 2E5LM 3U6EA 4NRWA 4PCZA 2UU9M 3GPXA 4DV0M 4DR5M 4B3RM 4K0KM 3J81S 3TWLA 5ITYA 4B3TM 5ITXE 4NRVA 1K3XA 3GQ3A 4DR4M 4LFCM 1Q3BA 4DV1M 5IT9S 1MU5A 1I94M 4X62M 3TWMA 4DV6M 1J5EM 5ITRA 1HNZM 1IBMM 3GQ5A 3GQ4A 1PJJA 4YHHM 4LF9M 1Z59A 2HKJA 4OX9M 4LFBM 2ZBKB 3JR4A 4LF5M 5FLXS 4G4QA 1Z5AA 4YY3M 1N36M 2F5NA 4LF6M 1XMQM 3U6LA 4PDIA 2F5OA 1KFVA 3U6QA 1MX0A 2Q2EB 4JI7M 4DR7M 2UUAM 1XNRM 2UXCM 3W0FA 1Q39A 4DR2M 2F5SA 1L2BA 5IWAM 4PDGA 2OPFA 4DR1M 3SAUA 3U6SA 3SAWA 3VK7A 4JI3M 4DV4M 3J7AS 3DOAA 3U6OA 2XZFA 3U6CA 4B3SM 3GPYA 4JI1M 3SBJA 3GP1A 3GO8A 5ITUA 2ZM6M 3SARA 4JYAM 1XC8A 4JV5M 4ITQA 3T1HM 4X66M 3T1YM 1R2YA 5LMNM 4B3MM 1L2CA 1Z5BA 2VQEM 1IBKM 1PM5A 4JI0M 1N33M 3U6PA 3J80S 1L2DA 2HHHM 4JI8M 1NNJA 1K3WA 4G4OA 3GPUA 2XZUA 3A46A 2F4VM 3SAVA 4GKJM 4DUZM 1L1ZA 4DUYM 2UUCM 4JI2M 3U6DA 4LF7M 4DR6M 1N32M 3JAMS 3SASA 3VK8A 4DV3M 1XMOM 5ITXA 1TDZA 5LMUM 1R2ZA 4KHPM 1Q3CA 4X65M 1L1TA 5A2QS 4NXMM 1TDHA 4NXNM 3U6MA 4G4NA 4DV7M 1K82A 2OQ4A 4PD2A 4CISA 1Z5CA 1FJGM 4LF8M 4AQYM 4DV2M 4JI4M 3GPPA 4LF4M 1XNQM 2UXBM 5BR8M 3JR5A 3C58A 1N34M 2F5QA 3A42A 4JI6M 4GKKM 2EA0A 3SATA 3OTOM 4DV5M 2UUBM 1HNXM 1HR0M 1EE8A 4G4RA 3TWKA 2VQFM 4JI5M
chains in the Genus database with same CATH superfamily
3FUWA 4RNAA 5ITQA 4LJ6A 5EP3A 4LFAM 3AJIB 2WSFF 2KNAA 1GO5A 1VEJA 3SMSA 1QDRA 3KDSE 4G3OA 2R4JA 2QQ8A 4NRWA 1QANA 2UU9M 3M0EA 4DV0M 4DR5M 1TH4A 1VDLA 1WGNA 4QOZC 5ITYA 2GNOA 4AKIA 3L29A 5H37D 3GQ3A 4MGZE 1R6BX 1IN8A 4IJFA 3B9PA 1TGUA 1G8PA 2D7HA 1MU5A 2FFJA 3IG8A 3M6AA 1GKIA 3BBZA 1YE9A 4M0WA 4M0DA 4AG5A 1QZEA 4DV6M 5E26A 3NWLA 5ITRA 4L8RC 1PJJA 4B7HA 3LVWA 3HU2A 3U61B 2ZBKB 2C5RA 2R0IA 3QYEA 1N36M 2QCUA 1GJSA 3U6LA 4MGHA 1IXSB 2F5OA 2LBCA 3U6QA 2H5XA 3FTCA 2ZAOA 3T38A 3GRUA 4JI7M 3CTWB 2UUAM 1XNRM 1TR8A 3W0FA 2CV2A 4FWHA 1IXSA 3HKPA 1IXRC 5IWAM 1D0MA 2ERCA 2JZ1A 4FCTA 4FW9A 2OPFA 4DR1M 1PJTA 3BXWA 3K9OA 3SAUA 2O5RA 2LVQD 1T3TA 4G6ZA 1IXZA 1RU3A 4KLNA 3DOAA 2V1UA 2RGOA 3FUVA 2G3QA 5EXXA 3UJNA 4MH0E 3TQSA 1P3QQ 2L4EA 1KSFX 5DNYA 4JI1M 3I51A 3HJSA 4M9ZA 3HJ8A 4F1IA 4IBEA 2ZM6M 1XC8A 1IN5A 4GRIA 4X66M 2C9OA 1J09A 2MGWA 3FYCA 3LQRA 3QYBA 1R2YA 3T6PA 2JZ0A 1EFUB 1PM5A 2APLA 2C98A 2OO9A 2Y21A 1C7YA 1N33M 3H4MA 4GEWA 3J80S 1L2DA 1ZMWA 3TPZA 2O25A 3U5ZA 4B08A 4G4OA 4P16A 1IM2A 1QDTA 3UZUA 1SXJD 2F4VM 2XSZD 4GKJM 5F3WA 3HWSA 1L1ZA 2UUCM 3U6DA 4DR6M 3JAMS 4DV3M 1R2ZA 2YR0A 4KHPM 1TH3A 1Q3CA 2DENA 3HY5A 4X65M 3D8BA 4KODA 2XLJA 1L1TA 3R8FA 4NXMM 1Q02A 2R4EA 3RFWA 2CHQA 3H4JA 4BB9A 3HHWA 4XGIA 1FJGM 4CISA 1QUSA 1Z5CA 2LVNC 3FUXA 4RF0A 4AQYM 3K9PA 3MMPA 4GMQA 4BBAA 2KRKA 1EIJA 2J7OA 2HCBA 2UXBM 2R44A 3KP0E 2F5QA 4WW0A 1L8QA 4L16A 1NY5A 2VF7A 3B7QA 5EP1A 2EA0A 1OFIA 1DO2A 1VEKA 2DWMA 2Z8YM 1SXJE 4KO8A 2UUBM 1IY2A 4WP2A 3M7GA 1XWIA 3AOEA 3HHXA 3TWKA 1NV8A 4GHAA 3W68A 4OVZA 2FE8A 5EXPA 1E9RA 4IBKA 5EXTA 2XFTA 1GL6A 3C3EA 4MB7A 1QVRA 3U6EA 2JA2A 1HJPA 3B74A 4KT0F 5KPZA 1IY0A 4B3RM 3U60A 1OIZA 1LV7A 1S3SA 3DZDA 4JN6A 3VDUA 4CJ6A 4GH9A 4B3TM 2L4FA 1K3XA 3NBXX 2EUCA 1JB0F 4HL4A 4DBGB 3K2LA 2D7GA 4LRSA 3KS8A 2EKKA 1Q3BA 1V92A 1XXHA 5JI2E 4X62M 3TWMA 2FNAA 5DYIA 1UFZA 5C18A 3U61A 3MHVC 4WURA 3GQ4A 3L2AA 4I4LA 4YHHM 3GLHA 1Z59A 2HKJA 2R18A 1XXHB 4LF9M 5FTMA 2QPAA 1NHGC 2Z7JA 3MK6A 4LZZA 4M9SA 5FSWA 1XMQM 2J5YA 2ZANA 4XBOA 4MGKE 4IJEA 1KFVA 2DAEA 1MX0A 3PNVA 2C9CA 2K9DA 3C3DA 5IZ7D 4NL4H 4TUWA 3CF6E 4D82A 2UXCM 3FYDA 3LCVB 2CRUA 4GITA 1YUBA 1DV0A 3UK6A 5JI3E 4PDGA 3SAWA 4NC6A 3U6SA 2JP7A 1QAMA 4JI3M 2CP8A 2Y0QA 1DGHA 2A5YB 3E21A 1JR3E 2DAGA 4Q7JA 4FWDA 2C96A 4QHSA 3U6OA 3LW5F 4OW0A 2DXIA 2XZFA 2AHMA 2KNZA 3E9SA 4B3SM 2R46A 4QNMA 1MN3A 2G5GX 2J7NA 3LCUA 1D0KA 1AUAA 1SXJC 1QZMA 1R7RA 2CHVA 2LNHC 2BJWA 2OOAA 4GIPA 4LZJA 5EQTA 4ITQA 5LMNM 4B3MM 2QBYA 5FTJA 1UM8A 2JWSA 1IBKM 1GJTA 1NNUC 4JI0M 3SMPA 3U6PA 3U5ZB 2LHGA 1G4AE 2L7IA 1AIPC 2K0BX 1VDDA 1WR1B 1NO1A 1K82A 2Z4SA 4LJ7A 1ORYB 4IBCA 5KO3A 3A98B 3ZCBB 2QP9X 3GLFA 3W67A 4JI2M 4M9XA 2DZLA 2RKOA 1E9SA 1FNNA 4Y28F 1OKSA 1XMOM 3QWLA 3PVSA 1V33A 3KOYE 2K6BA 2W82A 2XSZA 5A2QS 4OU7A 2Y0TA 4AI6A 4HEOA 3L26A 3EIHA 1H6UA 1W5SA 4LJAA 1E32A 2DHYA 1X37A 3FUUA 1W5TA 1YSYA 2M60A 2MH8A 2WZJA 1ZQ9A 2MJ5B 3GPPA 1ZV1A 1PJSA 3D8LA 3GRYA 4AKHA 5BR8M 3JR5A 1N34M 4JI6M 2LTUA 4JXJA 4L6V6 5E6JA 2CE7A 3KSJA 2KXEA 1XXHE 3OTOM 2L7HA 4OVZB 3TL4X 2VQFM 4G4RA 4JI5M 3FE3A 3SC3A 3A45A 1DGFA 2BWEA 2CV1A 3LVVA 2CFOA 4LJ5A 2JUJA 1PJIA 3LQQA 4DR3M 4IBGA 2F5PA 4R71A 1VEGA 3AKZA 4REZA 3SHGB 3GPXA 2Z3XA 1C1KA 1NSFA 1ZMVA 3RE8A 3J81S 5ITXE 2MROB 2DNAA 4B7GA 2YNMD 2L6OA 1SXJB 1JR3A 2KZSA 4I81A 3SYLA 3GLFE 1PRBA 4LJ8A 4LFCM 4GC9A 3J2PB 4DV1M 5IT9S 4I5SA 1NHWC 3UMMA 3J27B 3K1JA 7CATA 2LWXA 1I94M 3KOWE 4MM3B 2GQFA 3B89A 1IN7A 3FTDA 4D80A 3KXEC 2O01F 1QYRA 2R62A 3GQ5A 2LVPC 1HNZM 4LFBM 4OX9M 2KZUA 2QNJA 2R6FA 3PFIA 5DFLA 4AZFA 4LF5M 1GABA 4YY3M 2F5NA 2I7PA 1QQWA 4I8OA 2C99A 4L15A 4PT5A 1PJQA 1OQYA 4PDIA 5EP2A 3TE6A 2DAIA 2ZAMA 4GHLA 4LJ9A 2XEPA 2LH0A 5L8RF 3AFHA 3LMMA 3V76A 2RGHA 4ANRA 2DWNA 3GLHE 2F5SA 4LGYA 2VDBB 1T6OA 1TH2A 1ZMUA 3VK7A 1IY1A 4CGYB 4B7FA 1DO0A 5KQ8A 4DV4M 2XFSA 1A5TA 3B7NA 3DFZA 1LTMA 2P5TA 1QAOA 3MJ5A 2QENA 1IQPA 2KW0A 3GPYA 4LCBA 3SBJA 3GP1A 2I7NA 3KW6A 1IFYA 5ITUA 4RF1A 3SARA 4JYAM 2QHOB 3AOGA 3THGA 2QBYB 5FTNA 3T15A 3HZJA 1L2CA 2CUZA 2DZOB 2JY7A 1Z5BA 3HGIA 5EJCA 4LJ4A 3VFDA 4EIWA 2ZTDA 4L78A 3SFZA 3VKGA 1CUKA 2FH0A 2MR9A 2HHHM 1T43A 1NNJA 2WSEF 3Q8GA 4IBFA 1KYIA 1Z6TA 4IBIA 3GPUA 1SXJA 1N75A 4R7GA 8CATA 2X49A 3SHFA 1GVNA 4DUZM 2BWBA 1N32M 3PXGA 2K47A 2EKFA 5EP4A 3SASA 2ZTCA 4F2LA 3KSXA 1TDZA 1WJ7A 2XGNA 5LMUM 1NY6A 1WGLA 3RGSA 1IN4A 1G3IA 4QNRA 3GRVA 4FD2A 1XHBA 2HWJA 2M5ZA 1G59A 3FD9A 3FTEA 4G4NA 1GL7A 1OJLA 2CHGA 2OQ4A 4PD2A 1HT2E 2XH9A 1G41A 3F92A 5EXSA 4DV2M 1NJGA 2Y20A 4W5WA 1XNQM 3GLIA 4FWGA 1IBMM 2N35A 2QSFX 4RKUF 1DGHB 1N78A 1QAQA 4XK8F 2X8AA 3VLFB 4DV5M 2QZ4A 1NJFA 1EE8A 2DKLA 4NSRA 1HR0M 4IIWA 1OIPA 4GKKM 5ITTA 1WXQA 3AV0A 2DHRA 3ILKA 3K8ZA 2LXEA 2EJSA 5FTLA 1IBLM 1J7KA 4X64M 1HNWM 1DGGA 2Z4RA 4FCVA 2R65A 2X4AA 2UXDM 3L28A 2E5LM 1OTRA 4PCZA 3CF0A 1E94E 1QUTA 3CF2A 2B3TA 2CWBA 3KOZE 4R3DA 4K0KM 1NVMA 4IBJA 3TWLA 3QAUA 3FRIA 4NRVA 3FTFA 1BVSA 1JQJC 3KS4A 4DR4M 3IG5A 1R4GA 2DI0A 2KHHA 2JY8A 1Y8GA 1HQCA 2CEAA 2EO2A 2H1RA 3K92A 4GC5A 2RRUA 3IECA 4QOSA 5C1BA 5IREB 2L09A 2LVAA 2D7EA 1WHCA 3VDPA 3E46A 4CIZA 3HHZA 5KPRA 4UN2B 1J5EM 3EIEA 3I04M 3J7BA 3W0LB 2JNHA 4Z6YA 1VG5A 5KQDA 4ZPXA 3JR4A 3I4VA 3E4RA 2XF3A 5FLXS 2JXNA 1Z5AA 4II7A 4G4QA 4LF6M 3VKHA 4IBDA 4IBBA 3HU1A 1HT1E 2VF8A 2DVWB 3FRHA 3HU3A 3AL0C 2Q2EB 1OAOC 3IHPA 1D2NA 1DGBA 4DR7M 4NOOB 3GLGB 1Q39A 2BJVA 2BNKA 4DR2M 2JY5A 3I4YA 3KVWA 1L2BA 2DWZB 4L4UA 3ZQJA 2KA6B 3CGWA 3KP1E 4LY6A 4CHTB 3KOXE 3C9PA 1NV9A 3J7AS 2HAKA 3HHYA 3I01M 2L2DA 1V34A 3ZC7B 1I4WA 1VQ1A 3SYKA 3U6CA 4LG2A 5GKNA 4AKGA 3UGJA 2KDLA 2NQ8C 3AOEC 4A3VB 3GO8A 3KFUG 2JY6B 2V1CA 3NBIA 2DWLA 1TTEA 4JV5M 3BOSA 3T1HM 3R9XB 3T1YM 1GLNA 3HJQA 2FOIC 3WHLA 1TF0B 4LRTA 4AW4A 2VQEM 1D0LA 4AG6A 4D81A 2LVOC 3GLFB 1JR3D 2G8LA 1N77A 1R5LA 2KRUA 1HQYE 2OOBA 3GRRA 1K3WA 5KPTA 3U60B 4JI8M 1F4IA 1ZAEA 4MGYE 4Z8XA 2XZUA 3PNYA 5DYGA 3A46A 3FKEA 3SAVA 3GLIE 1WIVA 4DUYM 4LF7M 4S12A 3L27A 3GLGE 2KEBA 3FUTA 1YLAA 2FS1A 3VK8A 2CV0A 4FVMA 2YFQA 3RGPA 2V6ZM 3DA1A 4LGMA 4QHTA 1PGYA 5ITXA 3L25A 2DZNB 2YQZA 3Q8XA 1OFHA 1G71A 1OAIA 3WHKA 1IN6A 4HLQA 1TDHA 4NXNM 5FTKA 2WSCF 3GLHB 2DAKA 3U6MA 4DV7M 4BLCA 3ZH9B 5BPVA 4LF8M 3GLIB 2VIIA 4JI4M 2R45A 4LF4M 2HL7A 4P17A 3GLGA 2KNVA 3C58A 1XB2B 3HX3A 3A42A 2DAMA 2LHCA 4NSOB 4MGIE 3SATA 3B7ZA 1HNXM 1SG9A 4FCWA 1MJGM
chains in the Genus database with same CATH topology
3FUWA 4RNAA 5ITQA 4LJ6A 5EP3A 4LFAM 3AJIB 3SMSA 3KDSE 2R4JA 4NRWA 1QANA 2UU9M 3M0EA 4DV0M 4DR5M 1TH4A 4QOZC 5ITYA 4AKIA 3L29A 5H37D 3GQ3A 4MGZE 1R6BX 1IN8A 4IJFA 3B9PA 1TGUA 1G8PA 2D7HA 1MU5A 2FFJA 3IG8A 3M6AA 1GKIA 4M0WA 1YE9A 4M0DA 4AG5A 4DV6M 5E26A 3NWLA 5ITRA 4L8RC 1PJJA 4B7HA 3LVWA 3HU2A 3U61B 2ZBKB 2C5RA 1N36M 2QCUA 3U6LA 4MGHA 1IXSB 2F5OA 3U6QA 3FTCA 2ZAOA 3T38A 3GRUA 4JI7M 3CTWB 2UUAM 1XNRM 3W0FA 2CV2A 4FWHA 3HKPA 1IXRC 5IWAM 2ERCA 2OPFA 4DR1M 4FCTA 4FW9A 3SAUA 2O5RA 1T3TA 4G6ZA 1IXZA 4KLNA 3DOAA 2V1UA 2RGOA 3FUVA 5EXXA 3UJNA 4MH0E 3TQSA 1KSFX 5DNYA 4JI1M 3I51A 3HJSA 4M9ZA 3HJ8A 4IBEA 2ZM6M 1XC8A 1IN5A 4GRIA 4X66M 2C9OA 1J09A 3FYCA 3LQRA 1R2YA 1PM5A 2C98A 2Y21A 1N33M 3H4MA 3J80S 1L2DA 3TPZA 3U5ZA 4B08A 4G4OA 4P16A 1IM2A 3UZUA 1SXJD 2F4VM 2XSZD 4GKJM 5F3WA 3HWSA 1L1ZA 2UUCM 3U6DA 4DR6M 3JAMS 4DV3M 1R2ZA 2YR0A 4KHPM 1TH3A 1Q3CA 4X65M 3D8BA 4KODA 2XLJA 1L1TA 3R8FA 4NXMM 2R4EA 3RFWA 2CHQA 4BB9A 3HHWA 4XGIA 1FJGM 4CISA 1Z5CA 3FUXA 4RF0A 4AQYM 4BBAA 4GMQA 2KRKA 2J7OA 2HCBA 2UXBM 3KP0E 2F5QA 4WW0A 1L8QA 4L16A 1NY5A 5EP1A 2EA0A 2DWMA 1OFIA 1DO2A 4KO8A 1SXJE 2UUBM 1IY2A 3M7GA 3AOEA 1XWIA 3HHXA 3TWKA 4GHAA 4OVZA 2FE8A 5EXPA 1E9RA 4IBKA 5EXTA 2XFTA 1GL6A 4MB7A 1QVRA 3U6EA 2JA2A 5KPZA 1IY0A 4B3RM 3U60A 3DZDA 1LV7A 1S3SA 4JN6A 3VDUA 4GH9A 4B3TM 1K3XA 2EUCA 4HL4A 3K2LA 2D7GA 4LRSA 3KS8A 1Q3BA 1XXHA 5JI2E 4X62M 3TWMA 2FNAA 5DYIA 5C18A 3U61A 3MHVC 4WURA 3GQ4A 3L2AA 4I4LA 4YHHM 3GLHA 1Z59A 2HKJA 2R18A 1XXHB 4LF9M 5FTMA 2QPAA 1NHGC 2Z7JA 3MK6A 4LZZA 5FSWA 1XMQM 2ZANA 4XBOA 4MGKE 4IJEA 1KFVA 1MX0A 3PNVA 2C9CA 5IZ7D 4NL4H 3CF6E 4D82A 2UXCM 3FYDA 4GITA 1YUBA 3UK6A 5JI3E 4PDGA 3SAWA 3U6SA 1QAMA 4JI3M 2Y0QA 1DGHA 2A5YB 4FWDA 2C96A 4QHSA 3U6OA 4OW0A 2DXIA 2XZFA 2AHMA 3E9SA 4B3SM 2R46A 4QNMA 2G5GX 2J7NA 1SXJC 1QZMA 1R7RA 2CHVA 2LNHC 2BJWA 4GIPA 4LZJA 5EQTA 4ITQA 4TUWA 5LMNM 4B3MM 2QBYA 5FTJA 1UM8A 1IBKM 1NNUC 4JI0M 3SMPA 3U6PA 3U5ZB 1G4AE 2L7IA 1VDDA 2Z4SA 4LJ7A 1ORYB 4IBCA 5KO3A 3A98B 3ZCBB 2QP9X 3GLFA 4JI2M 4M9XA 2RKOA 1E9SA 1FNNA 1XMOM 3QWLA 3PVSA 3KOYE 2W82A 2XSZA 5A2QS 4OU7A 2Y0TA 4AI6A 3L26A 3EIHA 1H6UA 1W5SA 4LJAA 1E32A 1K82A 3FUUA 1X37A 1W5TA 1YSYA 2M60A 1ZQ9A 3GPPA 3GRYA 3D8LA 4AKHA 5BR8M 3JR5A 1N34M 4JI6M 4JXJA 5E6JA 2CE7A 3KSJA 2KXEA 3OTOM 2L7HA 4OVZB 3TL4X 2VQFM 4G4RA 4JI5M 3SC3A 3A45A 1DGFA 2CV1A 3LVVA 2CFOA 4LJ5A 1PJIA 3LQQA 4DR3M 4IBGA 2F5PA 3AKZA 4REZA 3SHGB 3GPXA 2Z3XA 1C1KA 1NSFA 3RE8A 3J81S 5ITXE 4B7GA 2YNMD 2L6OA 1SXJB 1JR3A 2KZSA 4I81A 3SYLA 4LJ8A 4LFCM 4GC9A 3J2PB 4DV1M 5IT9S 4I5SA 1NHWC 3J27B 3K1JA 7CATA 2LWXA 1I94M 3KOWE 4MM3B 1IN7A 3FTDA 4D80A 3KXEC 1HNZM 1QYRA 2R62A 3GQ5A 4LFBM 4OX9M 2KZUA 3PFIA 4AZFA 4LF5M 4YY3M 2F5NA 2I7PA 1QQWA 4I8OA 2C99A 4L15A 4PT5A 4PDIA 5EP2A 3TE6A 2ZAMA 4GHLA 4LJ9A 2XEPA 2LH0A 3AFHA 3LMMA 2RGHA 2DWNA 2F5SA 4LGYA 1TH2A 3VK7A 1IY1A 4CGYB 4B7FA 1DO0A 5KQ8A 4DV4M 2XFSA 3DFZA 2P5TA 1QAOA 3MJ5A 2QENA 1IQPA 2KW0A 3GPYA 4LCBA 3SBJA 3GP1A 2I7NA 3KW6A 5ITUA 4RF1A 3SARA 4JYAM 3AOGA 3THGA 2QBYB 5FTNA 3T15A 1L2CA 2CUZA 2DZOB 3HGIA 1Z5BA 5EJCA 3VFDA 4LJ4A 4EIWA 4L78A 3SFZA 3VKGA 2HHHM 1NNJA 4IBFA 1KYIA 1Z6TA 4IBIA 3GPUA 1SXJA 1N75A 4R7GA 8CATA 2X49A 3SHFA 1GVNA 4DUZM 1N32M 3PXGA 2K47A 5EP4A 3SASA 3KSXA 1TDZA 5LMUM 2XGNA 1NY6A 3RGSA 1IN4A 1G3IA 4QNRA 3GRVA 4FD2A 1XHBA 2M5ZA 1G59A 3FD9A 3FTEA 4G4NA 1GL7A 1OJLA 2CHGA 2OQ4A 4PD2A 1HT2E 2XH9A 1G41A 5EXSA 4DV2M 1NJGA 2Y20A 4W5WA 1XNQM 3GLIA 4FWGA 1IBMM 1DGHB 1N78A 1QAQA 2X8AA 3VLFB 4DV5M 2QZ4A 1NJFA 1EE8A 4NSRA 1HR0M 4IIWA 4GKKM 5ITTA 1WXQA 3AV0A 2DHRA 3ILKA 3K8ZA 2LXEA 5FTLA 1IBLM 1J7KA 4X64M 1HNWM 1DGGA 2Z4RA 4FCVA 2R65A 2X4AA 2UXDM 3L28A 2E5LM 4PCZA 3CF0A 1E94E 4R3DA 3CF2A 3KOZE 4K0KM 1NVMA 4IBJA 3TWLA 3QAUA 4NRVA 3FTFA 1JQJC 3KS4A 4DR4M 3IG5A 4M9SA 2CEAA 1HQCA 3K92A 2EO2A 2H1RA 4GC5A 4QOSA 3UMMA 5C1BA 5IREB 2L09A 2D7EA 3VDPA 3HHZA 5KPRA 1J5EM 3EIEA 3J7BA 3W0LB 4Z6YA 5KQDA 4ZPXA 3JR4A 3I4VA 3E4RA 2XF3A 5FLXS 4G4QA 1Z5AA 4II7A 4LF6M 3VKHA 4IBDA 4IBBA 3HU1A 1HT1E 2DVWB 3HU3A 3AL0C 2Q2EB 1D2NA 1DGBA 4DR7M 4NOOB 3GLGB 1Q39A 2BJVA 2BNKA 4DR2M 1L2BA 3I4YA 3KVWA 2DWZB 4L4UA 2KA6B 3KP1E 4LY6A 4CHTB 3KOXE 3J7AS 3HHYA 3ZC7B 4LG2A 1I4WA 3SYKA 4AKGA 3U6CA 5GKNA 3UGJA 3KFUG 2NQ8C 3AOEC 4A3VB 3GO8A 2V1CA 3NBIA 2DWLA 4JV5M 3BOSA 3T1HM 3R9XB 3T1YM 1GLNA 3HJQA 2FOIC 3WHLA 4LRTA 4AW4A 2VQEM 4AG6A 4D81A 3GLFB 1JR3D 2G8LA 1N77A 2KRUA 1HQYE 3GRRA 1K3WA 4JI8M 5KPTA 3U60B 1ZAEA 4MGYE 4Z8XA 2XZUA 3PNYA 5DYGA 3A46A 3FKEA 3SAVA 4DUYM 4LF7M 4S12A 3L27A 2KEBA 3FUTA 3VK8A 2CV0A 4FVMA 2YFQA 3RGPA 2V6ZM 3DA1A 4LGMA 4QHTA 5ITXA 3L25A 2DZNB 2YQZA 3Q8XA 1OFHA 3WHKA 1IN6A 4HLQA 1TDHA 4NXNM 5FTKA 3GLHB 3U6MA 4DV7M 4BLCA 3ZH9B 5BPVA 4LF8M 3GLIB 2VIIA 4JI4M 2R45A 4LF4M 2HL7A 3GLGA 3C58A 3A42A 4NSOB 4MGIE 3SATA 1HNXM 4FCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITQ A;  5ITT A;  4LFA M;  3A45 A;  1IBL M;  4X64 M;  1HNW M;  1PJI A;  4MB7 A;  4DR3 M;  2F5P A;  2UXD M;  2E5L M;  3U6E A;  4NRW A;  4PCZ A;  2UU9 M;  3GPX A;  4DV0 M;  4DR5 M;  4B3R M;  4K0K M;  3J81 S;  3TWL A;  5ITY A;  4B3T M;  5ITX E;  4NRV A;  1K3X A;  3GQ3 A;  4DR4 M;  4LFC M;  1Q3B A;  4DV1 M;  5IT9 S;  1MU5 A;  1I94 M;  4X62 M;  3TWM A;  4DV6 M;  1J5E M;  5ITR A;  1HNZ M;  1IBM M;  3GQ5 A;  3GQ4 A;  1PJJ A;  4YHH M;  4LF9 M;  1Z59 A;  2HKJ A;  4OX9 M;  4LFB M;  2ZBK B;  3JR4 A;  4LF5 M;  5FLX S;  4G4Q A;  1Z5A A;  4YY3 M;  1N36 M;  2F5N A;  4LF6 M;  1XMQ M;  3U6L A;  4PDI A;  2F5O A;  1KFV A;  3U6Q A;  1MX0 A;  2Q2E B;  4JI7 M;  4DR7 M;  2UUA M;  1XNR M;  2UXC M;  3W0F A;  1Q39 A;  4DR2 M;  2F5S A;  1L2B A;  5IWA M;  4PDG A;  2OPF A;  4DR1 M;  3SAU A;  3U6S A;  3SAW A;  3VK7 A;  4JI3 M;  4DV4 M;  3J7A S;  3DOA A;  3U6O A;  2XZF A;  3U6C A;  4B3S M;  3GPY A;  4JI1 M;  3SBJ A;  3GP1 A;  3GO8 A;  5ITU A;  2ZM6 M;  3SAR A;  4JYA M;  1XC8 A;  4JV5 M;  4ITQ A;  3T1H M;  4X66 M;  3T1Y M;  1R2Y A;  5LMN M;  4B3M M;  1L2C A;  1Z5B A;  2VQE M;  1IBK M;  1PM5 A;  4JI0 M;  1N33 M;  3U6P A;  3J80 S;  1L2D A;  2HHH M;  4JI8 M;  1NNJ A;  1K3W A;  4G4O A;  3GPU A;  2XZU A;  3A46 A;  2F4V M;  3SAV A;  4GKJ M;  4DUZ M;  1L1Z A;  4DUY M;  2UUC M;  4JI2 M;  3U6D A;  4LF7 M;  4DR6 M;  1N32 M;  3JAM S;  3SAS A;  3VK8 A;  4DV3 M;  1XMO M;  5ITX A;  1TDZ A;  5LMU M;  1R2Z A;  4KHP M;  1Q3C A;  4X65 M;  1L1T A;  5A2Q S;  4NXM M;  1TDH A;  4NXN M;  3U6M A;  4G4N A;  4DV7 M;  1K82 A;  2OQ4 A;  4PD2 A;  4CIS A;  1Z5C A;  1FJG M;  4LF8 M;  4AQY M;  4DV2 M;  4JI4 M;  3GPP A;  4LF4 M;  1XNQ M;  2UXB M;  5BR8 M;  3JR5 A;  3C58 A;  1N34 M;  2F5Q A;  3A42 A;  4JI6 M;  4GKK M;  2EA0 A;  3SAT A;  3OTO M;  4DV5 M;  2UUB M;  1HNX M;  1HR0 M;  1EE8 A;  4G4R A;  3TWK A;  2VQF M;  4JI5 M; 
#chains in the Genus database with same CATH topology
 3FUW A;  4RNA A;  5ITQ A;  4LJ6 A;  5EP3 A;  4LFA M;  3AJI B;  2WSF F;  2KNA A;  1GO5 A;  1VEJ A;  3SMS A;  1QDR A;  3KDS E;  4G3O A;  2R4J A;  2QQ8 A;  4NRW A;  1QAN A;  2UU9 M;  3M0E A;  4DV0 M;  4DR5 M;  1TH4 A;  1VDL A;  1WGN A;  4QOZ C;  5ITY A;  2GNO A;  4AKI A;  3L29 A;  5H37 D;  3GQ3 A;  4MGZ E;  1R6B X;  1IN8 A;  4IJF A;  3B9P A;  1TGU A;  1G8P A;  2D7H A;  1MU5 A;  2FFJ A;  3IG8 A;  3M6A A;  1GKI A;  3BBZ A;  1YE9 A;  4M0W A;  4M0D A;  4AG5 A;  1QZE A;  4DV6 M;  5E26 A;  3NWL A;  5ITR A;  4L8R C;  1PJJ A;  4B7H A;  3LVW A;  3HU2 A;  3U61 B;  2ZBK B;  2C5R A;  2R0I A;  3QYE A;  1N36 M;  2QCU A;  1GJS A;  3U6L A;  4MGH A;  1IXS B;  2F5O A;  2LBC A;  3U6Q A;  2H5X A;  3FTC A;  2ZAO A;  3T38 A;  3GRU A;  4JI7 M;  3CTW B;  2UUA M;  1XNR M;  1TR8 A;  3W0F A;  2CV2 A;  4FWH A;  1IXS A;  3HKP A;  1IXR C;  5IWA M;  1D0M A;  2ERC A;  2JZ1 A;  4FCT A;  4FW9 A;  2OPF A;  4DR1 M;  1PJT A;  3BXW A;  3K9O A;  3SAU A;  2O5R A;  2LVQ D;  1T3T A;  4G6Z A;  1IXZ A;  1RU3 A;  4KLN A;  3DOA A;  2V1U A;  2RGO A;  3FUV A;  2G3Q A;  5EXX A;  3UJN A;  4MH0 E;  3TQS A;  1P3Q Q;  2L4E A;  1KSF X;  5DNY A;  4JI1 M;  3I51 A;  3HJS A;  4M9Z A;  3HJ8 A;  4F1I A;  4IBE A;  2ZM6 M;  1XC8 A;  1IN5 A;  4GRI A;  4X66 M;  2C9O A;  1J09 A;  2MGW A;  3FYC A;  3LQR A;  3QYB A;  1R2Y A;  3T6P A;  2JZ0 A;  1EFU B;  1PM5 A;  2APL A;  2C98 A;  2OO9 A;  2Y21 A;  1C7Y A;  1N33 M;  3H4M A;  4GEW A;  3J80 S;  1L2D A;  1ZMW A;  3TPZ A;  2O25 A;  3U5Z A;  4B08 A;  4G4O A;  4P16 A;  1IM2 A;  1QDT A;  3UZU A;  1SXJ D;  2F4V M;  2XSZ D;  4GKJ M;  5F3W A;  3HWS A;  1L1Z A;  2UUC M;  3U6D A;  4DR6 M;  3JAM S;  4DV3 M;  1R2Z A;  2YR0 A;  4KHP M;  1TH3 A;  1Q3C A;  2DEN A;  3HY5 A;  4X65 M;  3D8B A;  4KOD A;  2XLJ A;  1L1T A;  3R8F A;  4NXM M;  1Q02 A;  2R4E A;  3RFW A;  2CHQ A;  3H4J A;  4BB9 A;  3HHW A;  4XGI A;  1FJG M;  4CIS A;  1QUS A;  1Z5C A;  2LVN C;  3FUX A;  4RF0 A;  4AQY M;  3K9P A;  3MMP A;  4GMQ A;  4BBA A;  2KRK A;  1EIJ A;  2J7O A;  2HCB A;  2UXB M;  2R44 A;  3KP0 E;  2F5Q A;  4WW0 A;  1L8Q A;  4L16 A;  1NY5 A;  2VF7 A;  3B7Q A;  5EP1 A;  2EA0 A;  1OFI A;  1DO2 A;  1VEK A;  2DWM A;  2Z8Y M;  1SXJ E;  4KO8 A;  2UUB M;  1IY2 A;  4WP2 A;  3M7G A;  1XWI A;  3AOE A;  3HHX A;  3TWK A;  1NV8 A;  4GHA A;  3W68 A;  4OVZ A;  2FE8 A;  5EXP A;  1E9R A;  4IBK A;  5EXT A;  2XFT A;  1GL6 A;  3C3E A;  4MB7 A;  1QVR A;  3U6E A;  2JA2 A;  1HJP A;  3B74 A;  4KT0 F;  5KPZ A;  1IY0 A;  4B3R M;  3U60 A;  1OIZ A;  1LV7 A;  1S3S A;  3DZD A;  4JN6 A;  3VDU A;  4CJ6 A;  4GH9 A;  4B3T M;  2L4F A;  1K3X A;  3NBX X;  2EUC A;  1JB0 F;  4HL4 A;  4DBG B;  3K2L A;  2D7G A;  4LRS A;  3KS8 A;  2EKK A;  1Q3B A;  1V92 A;  1XXH A;  5JI2 E;  4X62 M;  3TWM A;  2FNA A;  5DYI A;  1UFZ A;  5C18 A;  3U61 A;  3MHV C;  4WUR A;  3GQ4 A;  3L2A A;  4I4L A;  4YHH M;  3GLH A;  1Z59 A;  2HKJ A;  2R18 A;  1XXH B;  4LF9 M;  5FTM A;  2QPA A;  1NHG C;  2Z7J A;  3MK6 A;  4LZZ A;  4M9S A;  5FSW A;  1XMQ M;  2J5Y A;  2ZAN A;  4XBO A;  4MGK E;  4IJE A;  1KFV A;  2DAE A;  1MX0 A;  3PNV A;  2C9C A;  2K9D A;  3C3D A;  5IZ7 D;  4NL4 H;  4TUW A;  3CF6 E;  4D82 A;  2UXC M;  3FYD A;  3LCV B;  2CRU A;  4GIT A;  1YUB A;  1DV0 A;  3UK6 A;  5JI3 E;  4PDG A;  3SAW A;  4NC6 A;  3U6S A;  2JP7 A;  1QAM A;  4JI3 M;  2CP8 A;  2Y0Q A;  1DGH A;  2A5Y B;  3E21 A;  1JR3 E;  2DAG A;  4Q7J A;  4FWD A;  2C96 A;  4QHS A;  3U6O A;  3LW5 F;  4OW0 A;  2DXI A;  2XZF A;  2AHM A;  2KNZ A;  3E9S A;  4B3S M;  2R46 A;  4QNM A;  1MN3 A;  2G5G X;  2J7N A;  3LCU A;  1D0K A;  1AUA A;  1SXJ C;  1QZM A;  1R7R A;  2CHV A;  2LNH C;  2BJW A;  2OOA A;  4GIP A;  4LZJ A;  5EQT A;  4ITQ A;  5LMN M;  4B3M M;  2QBY A;  5FTJ A;  1UM8 A;  2JWS A;  1IBK M;  1GJT A;  1NNU C;  4JI0 M;  3SMP A;  3U6P A;  3U5Z B;  2LHG A;  1G4A E;  2L7I A;  1AIP C;  2K0B X;  1VDD A;  1WR1 B;  1NO1 A;  1K82 A;  2Z4S A;  4LJ7 A;  1ORY B;  4IBC A;  5KO3 A;  3A98 B;  3ZCB B;  2QP9 X;  3GLF A;  3W67 A;  4JI2 M;  4M9X A;  2DZL A;  2RKO A;  1E9S A;  1FNN A;  4Y28 F;  1OKS A;  1XMO M;  3QWL A;  3PVS A;  1V33 A;  3KOY E;  2K6B A;  2W82 A;  2XSZ A;  5A2Q S;  4OU7 A;  2Y0T A;  4AI6 A;  4HEO A;  3L26 A;  3EIH A;  1H6U A;  1W5S A;  4LJA A;  1E32 A;  2DHY A;  1X37 A;  3FUU A;  1W5T A;  1YSY A;  2M60 A;  2MH8 A;  2WZJ A;  1ZQ9 A;  2MJ5 B;  3GPP A;  1ZV1 A;  1PJS A;  3D8L A;  3GRY A;  4AKH A;  5BR8 M;  3JR5 A;  1N34 M;  4JI6 M;  2LTU A;  4JXJ A;  4L6V 6;  5E6J A;  2CE7 A;  3KSJ A;  2KXE A;  1XXH E;  3OTO M;  2L7H A;  4OVZ B;  3TL4 X;  2VQF M;  4G4R A;  4JI5 M;  3FE3 A;  3SC3 A;  3A45 A;  1DGF A;  2BWE A;  2CV1 A;  3LVV A;  2CFO A;  4LJ5 A;  2JUJ A;  1PJI A;  3LQQ A;  4DR3 M;  4IBG A;  2F5P A;  4R71 A;  1VEG A;  3AKZ A;  4REZ A;  3SHG B;  3GPX A;  2Z3X A;  1C1K A;  1NSF A;  1ZMV A;  3RE8 A;  3J81 S;  5ITX E;  2MRO B;  2DNA A;  4B7G A;  2YNM D;  2L6O A;  1SXJ B;  1JR3 A;  2KZS A;  4I81 A;  3SYL A;  3GLF E;  1PRB A;  4LJ8 A;  4LFC M;  4GC9 A;  3J2P B;  4DV1 M;  5IT9 S;  4I5S A;  1NHW C;  3UMM A;  3J27 B;  3K1J A;  7CAT A;  2LWX A;  1I94 M;  3KOW E;  4MM3 B;  2GQF A;  3B89 A;  1IN7 A;  3FTD A;  4D80 A;  3KXE C;  2O01 F;  1QYR A;  2R62 A;  3GQ5 A;  2LVP C;  1HNZ M;  4LFB M;  4OX9 M;  2KZU A;  2QNJ A;  2R6F A;  3PFI A;  5DFL A;  4AZF A;  4LF5 M;  1GAB A;  4YY3 M;  2F5N A;  2I7P A;  1QQW A;  4I8O A;  2C99 A;  4L15 A;  4PT5 A;  1PJQ A;  1OQY A;  4PDI A;  5EP2 A;  3TE6 A;  2DAI A;  2ZAM A;  4GHL A;  4LJ9 A;  2XEP A;  2LH0 A;  5L8R F;  3AFH A;  3LMM A;  3V76 A;  2RGH A;  4ANR A;  2DWN A;  3GLH E;  2F5S A;  4LGY A;  2VDB B;  1T6O A;  1TH2 A;  1ZMU A;  3VK7 A;  1IY1 A;  4CGY B;  4B7F A;  1DO0 A;  5KQ8 A;  4DV4 M;  2XFS A;  1A5T A;  3B7N A;  3DFZ A;  1LTM A;  2P5T A;  1QAO A;  3MJ5 A;  2QEN A;  1IQP A;  2KW0 A;  3GPY A;  4LCB A;  3SBJ A;  3GP1 A;  2I7N A;  3KW6 A;  1IFY A;  5ITU A;  4RF1 A;  3SAR A;  4JYA M;  2QHO B;  3AOG A;  3THG A;  2QBY B;  5FTN A;  3T15 A;  3HZJ A;  1L2C A;  2CUZ A;  2DZO B;  2JY7 A;  1Z5B A;  3HGI A;  5EJC A;  4LJ4 A;  3VFD A;  4EIW A;  2ZTD A;  4L78 A;  3SFZ A;  3VKG A;  1CUK A;  2FH0 A;  2MR9 A;  2HHH M;  1T43 A;  1NNJ A;  2WSE F;  3Q8G A;  4IBF A;  1KYI A;  1Z6T A;  4IBI A;  3GPU A;  1SXJ A;  1N75 A;  4R7G A;  8CAT A;  2X49 A;  3SHF A;  1GVN A;  4DUZ M;  2BWB A;  1N32 M;  3PXG A;  2K47 A;  2EKF A;  5EP4 A;  3SAS A;  2ZTC A;  4F2L A;  3KSX A;  1TDZ A;  1WJ7 A;  2XGN A;  5LMU M;  1NY6 A;  1WGL A;  3RGS A;  1IN4 A;  1G3I A;  4QNR A;  3GRV A;  4FD2 A;  1XHB A;  2HWJ A;  2M5Z A;  1G59 A;  3FD9 A;  3FTE A;  4G4N A;  1GL7 A;  1OJL A;  2CHG A;  2OQ4 A;  4PD2 A;  1HT2 E;  2XH9 A;  1G41 A;  3F92 A;  5EXS A;  4DV2 M;  1NJG A;  2Y20 A;  4W5W A;  1XNQ M;  3GLI A;  4FWG A;  1IBM M;  2N35 A;  2QSF X;  4RKU F;  1DGH B;  1N78 A;  1QAQ A;  4XK8 F;  2X8A A;  3VLF B;  4DV5 M;  2QZ4 A;  1NJF A;  1EE8 A;  2DKL A;  4NSR A;  1HR0 M;  4IIW A;  1OIP A;  4GKK M;  5ITT A;  1WXQ A;  3AV0 A;  2DHR A;  3ILK A;  3K8Z A;  2LXE A;  2EJS A;  5FTL A;  1IBL M;  1J7K A;  4X64 M;  1HNW M;  1DGG A;  2Z4R A;  4FCV A;  2R65 A;  2X4A A;  2UXD M;  3L28 A;  2E5L M;  1OTR A;  4PCZ A;  3CF0 A;  1E94 E;  1QUT A;  3CF2 A;  2B3T A;  2CWB A;  3KOZ E;  4R3D A;  4K0K M;  1NVM A;  4IBJ A;  3TWL A;  3QAU A;  3FRI A;  4NRV A;  3FTF A;  1BVS A;  1JQJ C;  3KS4 A;  4DR4 M;  3IG5 A;  1R4G A;  2DI0 A;  2KHH A;  2JY8 A;  1Y8G A;  1HQC A;  2CEA A;  2EO2 A;  2H1R A;  3K92 A;  4GC5 A;  2RRU A;  3IEC A;  4QOS A;  5C1B A;  5IRE B;  2L09 A;  2LVA A;  2D7E A;  1WHC A;  3VDP A;  3E46 A;  4CIZ A;  3HHZ A;  5KPR A;  4UN2 B;  1J5E M;  3EIE A;  3I04 M;  3J7B A;  3W0L B;  2JNH A;  4Z6Y A;  1VG5 A;  5KQD A;  4ZPX A;  3JR4 A;  3I4V A;  3E4R A;  2XF3 A;  5FLX S;  2JXN A;  1Z5A A;  4II7 A;  4G4Q A;  4LF6 M;  3VKH A;  4IBD A;  4IBB A;  3HU1 A;  1HT1 E;  2VF8 A;  2DVW B;  3FRH A;  3HU3 A;  3AL0 C;  2Q2E B;  1OAO C;  3IHP A;  1D2N A;  1DGB A;  4DR7 M;  4NOO B;  3GLG B;  1Q39 A;  2BJV A;  2BNK A;  4DR2 M;  2JY5 A;  3I4Y A;  3KVW A;  1L2B A;  2DWZ B;  4L4U A;  3ZQJ A;  2KA6 B;  3CGW A;  3KP1 E;  4LY6 A;  4CHT B;  3KOX E;  3C9P A;  1NV9 A;  3J7A S;  2HAK A;  3HHY A;  3I01 M;  2L2D A;  1V34 A;  3ZC7 B;  1I4W A;  1VQ1 A;  3SYK A;  3U6C A;  4LG2 A;  5GKN A;  4AKG A;  3UGJ A;  2KDL A;  2NQ8 C;  3AOE C;  4A3V B;  3GO8 A;  3KFU G;  2JY6 B;  2V1C A;  3NBI A;  2DWL A;  1TTE A;  4JV5 M;  3BOS A;  3T1H M;  3R9X B;  3T1Y M;  1GLN A;  3HJQ A;  2FOI C;  3WHL A;  1TF0 B;  4LRT A;  4AW4 A;  2VQE M;  1D0L A;  4AG6 A;  4D81 A;  2LVO C;  3GLF B;  1JR3 D;  2G8L A;  1N77 A;  1R5L A;  2KRU A;  1HQY E;  2OOB A;  3GRR A;  1K3W A;  5KPT A;  3U60 B;  4JI8 M;  1F4I A;  1ZAE A;  4MGY E;  4Z8X A;  2XZU A;  3PNY A;  5DYG A;  3A46 A;  3FKE A;  3SAV A;  3GLI E;  1WIV A;  4DUY M;  4LF7 M;  4S12 A;  3L27 A;  3GLG E;  2KEB A;  3FUT A;  1YLA A;  2FS1 A;  3VK8 A;  2CV0 A;  4FVM A;  2YFQ A;  3RGP A;  2V6Z M;  3DA1 A;  4LGM A;  4QHT A;  1PGY A;  5ITX A;  3L25 A;  2DZN B;  2YQZ A;  3Q8X A;  1OFH A;  1G71 A;  1OAI A;  3WHK A;  1IN6 A;  4HLQ A;  1TDH A;  4NXN M;  5FTK A;  2WSC F;  3GLH B;  2DAK A;  3U6M A;  4DV7 M;  4BLC A;  3ZH9 B;  5BPV A;  4LF8 M;  3GLI B;  2VII A;  4JI4 M;  2R45 A;  4LF4 M;  2HL7 A;  4P17 A;  3GLG A;  2KNV A;  3C58 A;  1XB2 B;  3HX3 A;  3A42 A;  2DAM A;  2LHC A;  4NSO B;  4MGI E;  3SAT A;  3B7Z A;  1HNX M;  1SG9 A;  4FCW A;  1MJG M; 
#chains in the Genus database with same CATH homology
 3FUW A;  4RNA A;  5ITQ A;  4LJ6 A;  5EP3 A;  4LFA M;  3AJI B;  3SMS A;  3KDS E;  2R4J A;  4NRW A;  1QAN A;  2UU9 M;  3M0E A;  4DV0 M;  4DR5 M;  1TH4 A;  4QOZ C;  5ITY A;  4AKI A;  3L29 A;  5H37 D;  3GQ3 A;  4MGZ E;  1R6B X;  1IN8 A;  4IJF A;  3B9P A;  1TGU A;  1G8P A;  2D7H A;  1MU5 A;  2FFJ A;  3IG8 A;  3M6A A;  1GKI A;  4M0W A;  1YE9 A;  4M0D A;  4AG5 A;  4DV6 M;  5E26 A;  3NWL A;  5ITR A;  4L8R C;  1PJJ A;  4B7H A;  3LVW A;  3HU2 A;  3U61 B;  2ZBK B;  2C5R A;  1N36 M;  2QCU A;  3U6L A;  4MGH A;  1IXS B;  2F5O A;  3U6Q A;  3FTC A;  2ZAO A;  3T38 A;  3GRU A;  4JI7 M;  3CTW B;  2UUA M;  1XNR M;  3W0F A;  2CV2 A;  4FWH A;  3HKP A;  1IXR C;  5IWA M;  2ERC A;  2OPF A;  4DR1 M;  4FCT A;  4FW9 A;  3SAU A;  2O5R A;  1T3T A;  4G6Z A;  1IXZ A;  4KLN A;  3DOA A;  2V1U A;  2RGO A;  3FUV A;  5EXX A;  3UJN A;  4MH0 E;  3TQS A;  1KSF X;  5DNY A;  4JI1 M;  3I51 A;  3HJS A;  4M9Z A;  3HJ8 A;  4IBE A;  2ZM6 M;  1XC8 A;  1IN5 A;  4GRI A;  4X66 M;  2C9O A;  1J09 A;  3FYC A;  3LQR A;  1R2Y A;  1PM5 A;  2C98 A;  2Y21 A;  1N33 M;  3H4M A;  3J80 S;  1L2D A;  3TPZ A;  3U5Z A;  4B08 A;  4G4O A;  4P16 A;  1IM2 A;  3UZU A;  1SXJ D;  2F4V M;  2XSZ D;  4GKJ M;  5F3W A;  3HWS A;  1L1Z A;  2UUC M;  3U6D A;  4DR6 M;  3JAM S;  4DV3 M;  1R2Z A;  2YR0 A;  4KHP M;  1TH3 A;  1Q3C A;  4X65 M;  3D8B A;  4KOD A;  2XLJ A;  1L1T A;  3R8F A;  4NXM M;  2R4E A;  3RFW A;  2CHQ A;  4BB9 A;  3HHW A;  4XGI A;  1FJG M;  4CIS A;  1Z5C A;  3FUX A;  4RF0 A;  4AQY M;  4BBA A;  4GMQ A;  2KRK A;  2J7O A;  2HCB A;  2UXB M;  3KP0 E;  2F5Q A;  4WW0 A;  1L8Q A;  4L16 A;  1NY5 A;  5EP1 A;  2EA0 A;  2DWM A;  1OFI A;  1DO2 A;  4KO8 A;  1SXJ E;  2UUB M;  1IY2 A;  3M7G A;  3AOE A;  1XWI A;  3HHX A;  3TWK A;  4GHA A;  4OVZ A;  2FE8 A;  5EXP A;  1E9R A;  4IBK A;  5EXT A;  2XFT A;  1GL6 A;  4MB7 A;  1QVR A;  3U6E A;  2JA2 A;  5KPZ A;  1IY0 A;  4B3R M;  3U60 A;  3DZD A;  1LV7 A;  1S3S A;  4JN6 A;  3VDU A;  4GH9 A;  4B3T M;  1K3X A;  2EUC A;  4HL4 A;  3K2L A;  2D7G A;  4LRS A;  3KS8 A;  1Q3B A;  1XXH A;  5JI2 E;  4X62 M;  3TWM A;  2FNA A;  5DYI A;  5C18 A;  3U61 A;  3MHV C;  4WUR A;  3GQ4 A;  3L2A A;  4I4L A;  4YHH M;  3GLH A;  1Z59 A;  2HKJ A;  2R18 A;  1XXH B;  4LF9 M;  5FTM A;  2QPA A;  1NHG C;  2Z7J A;  3MK6 A;  4LZZ A;  5FSW A;  1XMQ M;  2ZAN A;  4XBO A;  4MGK E;  4IJE A;  1KFV A;  1MX0 A;  3PNV A;  2C9C A;  5IZ7 D;  4NL4 H;  3CF6 E;  4D82 A;  2UXC M;  3FYD A;  4GIT A;  1YUB A;  3UK6 A;  5JI3 E;  4PDG A;  3SAW A;  3U6S A;  1QAM A;  4JI3 M;  2Y0Q A;  1DGH A;  2A5Y B;  4FWD A;  2C96 A;  4QHS A;  3U6O A;  4OW0 A;  2DXI A;  2XZF A;  2AHM A;  3E9S A;  4B3S M;  2R46 A;  4QNM A;  2G5G X;  2J7N A;  1SXJ C;  1QZM A;  1R7R A;  2CHV A;  2LNH C;  2BJW A;  4GIP A;  4LZJ A;  5EQT A;  4ITQ A;  4TUW A;  5LMN M;  4B3M M;  2QBY A;  5FTJ A;  1UM8 A;  1IBK M;  1NNU C;  4JI0 M;  3SMP A;  3U6P A;  3U5Z B;  1G4A E;  2L7I A;  1VDD A;  2Z4S A;  4LJ7 A;  1ORY B;  4IBC A;  5KO3 A;  3A98 B;  3ZCB B;  2QP9 X;  3GLF A;  4JI2 M;  4M9X A;  2RKO A;  1E9S A;  1FNN A;  1XMO M;  3QWL A;  3PVS A;  3KOY E;  2W82 A;  2XSZ A;  5A2Q S;  4OU7 A;  2Y0T A;  4AI6 A;  3L26 A;  3EIH A;  1H6U A;  1W5S A;  4LJA A;  1E32 A;  1K82 A;  3FUU A;  1X37 A;  1W5T A;  1YSY A;  2M60 A;  1ZQ9 A;  3GPP A;  3GRY A;  3D8L A;  4AKH A;  5BR8 M;  3JR5 A;  1N34 M;  4JI6 M;  4JXJ A;  5E6J A;  2CE7 A;  3KSJ A;  2KXE A;  3OTO M;  2L7H A;  4OVZ B;  3TL4 X;  2VQF M;  4G4R A;  4JI5 M;  3SC3 A;  3A45 A;  1DGF A;  2CV1 A;  3LVV A;  2CFO A;  4LJ5 A;  1PJI A;  3LQQ A;  4DR3 M;  4IBG A;  2F5P A;  3AKZ A;  4REZ A;  3SHG B;  3GPX A;  2Z3X A;  1C1K A;  1NSF A;  3RE8 A;  3J81 S;  5ITX E;  4B7G A;  2YNM D;  2L6O A;  1SXJ B;  1JR3 A;  2KZS A;  4I81 A;  3SYL A;  4LJ8 A;  4LFC M;  4GC9 A;  3J2P B;  4DV1 M;  5IT9 S;  4I5S A;  1NHW C;  3J27 B;  3K1J A;  7CAT A;  2LWX A;  1I94 M;  3KOW E;  4MM3 B;  1IN7 A;  3FTD A;  4D80 A;  3KXE C;  1HNZ M;  1QYR A;  2R62 A;  3GQ5 A;  4LFB M;  4OX9 M;  2KZU A;  3PFI A;  4AZF A;  4LF5 M;  4YY3 M;  2F5N A;  2I7P A;  1QQW A;  4I8O A;  2C99 A;  4L15 A;  4PT5 A;  4PDI A;  5EP2 A;  3TE6 A;  2ZAM A;  4GHL A;  4LJ9 A;  2XEP A;  2LH0 A;  3AFH A;  3LMM A;  2RGH A;  2DWN A;  2F5S A;  4LGY A;  1TH2 A;  3VK7 A;  1IY1 A;  4CGY B;  4B7F A;  1DO0 A;  5KQ8 A;  4DV4 M;  2XFS A;  3DFZ A;  2P5T A;  1QAO A;  3MJ5 A;  2QEN A;  1IQP A;  2KW0 A;  3GPY A;  4LCB A;  3SBJ A;  3GP1 A;  2I7N A;  3KW6 A;  5ITU A;  4RF1 A;  3SAR A;  4JYA M;  3AOG A;  3THG A;  2QBY B;  5FTN A;  3T15 A;  1L2C A;  2CUZ A;  2DZO B;  3HGI A;  1Z5B A;  5EJC A;  3VFD A;  4LJ4 A;  4EIW A;  4L78 A;  3SFZ A;  3VKG A;  2HHH M;  1NNJ A;  4IBF A;  1KYI A;  1Z6T A;  4IBI A;  3GPU A;  1SXJ A;  1N75 A;  4R7G A;  8CAT A;  2X49 A;  3SHF A;  1GVN A;  4DUZ M;  1N32 M;  3PXG A;  2K47 A;  5EP4 A;  3SAS A;  3KSX A;  1TDZ A;  5LMU M;  2XGN A;  1NY6 A;  3RGS A;  1IN4 A;  1G3I A;  4QNR A;  3GRV A;  4FD2 A;  1XHB A;  2M5Z A;  1G59 A;  3FD9 A;  3FTE A;  4G4N A;  1GL7 A;  1OJL A;  2CHG A;  2OQ4 A;  4PD2 A;  1HT2 E;  2XH9 A;  1G41 A;  5EXS A;  4DV2 M;  1NJG A;  2Y20 A;  4W5W A;  1XNQ M;  3GLI A;  4FWG A;  1IBM M;  1DGH B;  1N78 A;  1QAQ A;  2X8A A;  3VLF B;  4DV5 M;  2QZ4 A;  1NJF A;  1EE8 A;  4NSR A;  1HR0 M;  4IIW A;  4GKK M;  5ITT A;  1WXQ A;  3AV0 A;  2DHR A;  3ILK A;  3K8Z A;  2LXE A;  5FTL A;  1IBL M;  1J7K A;  4X64 M;  1HNW M;  1DGG A;  2Z4R A;  4FCV A;  2R65 A;  2X4A A;  2UXD M;  3L28 A;  2E5L M;  4PCZ A;  3CF0 A;  1E94 E;  4R3D A;  3CF2 A;  3KOZ E;  4K0K M;  1NVM A;  4IBJ A;  3TWL A;  3QAU A;  4NRV A;  3FTF A;  1JQJ C;  3KS4 A;  4DR4 M;  3IG5 A;  4M9S A;  2CEA A;  1HQC A;  3K92 A;  2EO2 A;  2H1R A;  4GC5 A;  4QOS A;  3UMM A;  5C1B A;  5IRE B;  2L09 A;  2D7E A;  3VDP A;  3HHZ A;  5KPR A;  1J5E M;  3EIE A;  3J7B A;  3W0L B;  4Z6Y A;  5KQD A;  4ZPX A;  3JR4 A;  3I4V A;  3E4R A;  2XF3 A;  5FLX S;  4G4Q A;  1Z5A A;  4II7 A;  4LF6 M;  3VKH A;  4IBD A;  4IBB A;  3HU1 A;  1HT1 E;  2DVW B;  3HU3 A;  3AL0 C;  2Q2E B;  1D2N A;  1DGB A;  4DR7 M;  4NOO B;  3GLG B;  1Q39 A;  2BJV A;  2BNK A;  4DR2 M;  1L2B A;  3I4Y A;  3KVW A;  2DWZ B;  4L4U A;  2KA6 B;  3KP1 E;  4LY6 A;  4CHT B;  3KOX E;  3J7A S;  3HHY A;  3ZC7 B;  4LG2 A;  1I4W A;  3SYK A;  4AKG A;  3U6C A;  5GKN A;  3UGJ A;  3KFU G;  2NQ8 C;  3AOE C;  4A3V B;  3GO8 A;  2V1C A;  3NBI A;  2DWL A;  4JV5 M;  3BOS A;  3T1H M;  3R9X B;  3T1Y M;  1GLN A;  3HJQ A;  2FOI C;  3WHL A;  4LRT A;  4AW4 A;  2VQE M;  4AG6 A;  4D81 A;  3GLF B;  1JR3 D;  2G8L A;  1N77 A;  2KRU A;  1HQY E;  3GRR A;  1K3W A;  4JI8 M;  5KPT A;  3U60 B;  1ZAE A;  4MGY E;  4Z8X A;  2XZU A;  3PNY A;  5DYG A;  3A46 A;  3FKE A;  3SAV A;  4DUY M;  4LF7 M;  4S12 A;  3L27 A;  2KEB A;  3FUT A;  3VK8 A;  2CV0 A;  4FVM A;  2YFQ A;  3RGP A;  2V6Z M;  3DA1 A;  4LGM A;  4QHT A;  5ITX A;  3L25 A;  2DZN B;  2YQZ A;  3Q8X A;  1OFH A;  3WHK A;  1IN6 A;  4HLQ A;  1TDH A;  4NXN M;  5FTK A;  3GLH B;  3U6M A;  4DV7 M;  4BLC A;  3ZH9 B;  5BPV A;  4LF8 M;  3GLI B;  2VII A;  4JI4 M;  2R45 A;  4LF4 M;  2HL7 A;  3GLG A;  3C58 A;  3A42 A;  4NSO B;  4MGI E;  3SAT A;  1HNX M;  4FCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...