4JI7M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji7M02
1N34M 3C58A 1KFVA 1IBLM 4LF7M 1HR0M 4DR7M 4DV5M 1Q3BA 4G4NA 4DR6M 5ITRA 1XNQM 5ITYA 2F5QA 5LMUM 2OPFA 4X62M 4B3RM 2F5PA 4JYAM 3VK8A 4DR3M 1L2BA 3GQ3A 4JI7M 4DR4M 3U6EA 5IWAM 1HNZM 2EA0A 4DV1M 3TWMA 1N32M 1L1TA 1Q3CA 1XC8A 1I94M 2F5NA 2UUBM 3GQ4A 3VK7A 4JI5M 1N33M 4NRWA 4X64M 4DV2M 3J81S 4X66M 4MB7A 3GPUA 3U6SA 2VQEM 2UXDM 4DV0M 1XNRM 3SBJA 4YY3M 5A2QS 3GPPA 3W0FA 4GKKM 2F4VM 1IBMM 4DV6M 1EE8A 1FJGM 2UXCM 4PDGA 4DV7M 3JR4A 4AQYM 4G4QA 3TWKA 3SAWA 4KHPM 1NNJA 4JI6M 3SASA 1Q39A 4NRVA 5FLXS 4LF4M 1MX0A 3OTOM 5ITTA 4DUZM 1R2ZA 1PM5A 3A46A 2UUAM 3T1HM 4DR2M 4LFAM 4NXMM 4CISA 3U6DA 1J5EM 1L2DA 4LF8M 5BR8M 4JI8M 1L2CA 3SARA 4PD2A 1N36M 2UU9M 2UUCM 4OX9M 4LF9M 1Z5BA 4NXNM 3T1YM 1TDHA 3GPXA 3TWLA 4G4OA 3U6PA 2ZM6M 4PDIA 1MU5A 3U6MA 4YHHM 2UXBM 1K3WA 5LMNM 1Z5CA 1XMQM 1PJIA 4DV4M 4B3TM 4JI1M 4LF6M 1Z59A 4DR5M 4LFCM 3A45A 2Q2EB 3SAVA 3A42A 3JR5A 2F5SA 1K82A 1L1ZA 1TDZA 3SATA 3GPYA 4LF5M 5IT9S 3J7AS 5ITXE 4PCZA 3GQ5A 2VQFM 4JV5M 2OQ4A 1K3XA 1PJJA 4DV3M 2HKJA 4JI0M 1HNWM 3U6OA 3U6QA 1Z5AA 5ITQA 2HHHM 3GP1A 3U6CA 3U6LA 1HNXM 2E5LM 2XZFA 4ITQA 3GO8A 4JI2M 5ITXA 4G4RA 2ZBKB 4X65M 3SAUA 3DOAA 2XZUA 3JAMS 4B3SM 4K0KM 4JI4M 5ITUA 4JI3M 1R2YA 4DUYM 4GKJM 1IBKM 4B3MM 4LFBM 4DR1M 2F5OA 3J80S 1XMOM
chains in the Genus database with same CATH superfamily
1IN8A 2JZ1A 2YQZA 4MGYE 2EUCA 2C9CA 3SFZA 3V76A 2CFOA 5JI3E 4B7GA 1HR0M 4AZFA 4G4NA 3EIHA 1VDLA 3KFUG 4DR6M 1I4WA 2Y0QA 1DGFA 5E26A 3MHVC 1QDTA 3KSJA 4B3RM 1GABA 1NVMA 2K0BX 1WR1B 5KPZA 5DYGA 4LJ8A 5C1BA 3U6EA 1N78A 4FD2A 2W82A 4CJ6A 1N32M 1NY5A 1QAQA 2NQ8C 2CUZA 2MR9A 4LZZA 4RNAA 3UJNA 3UK6A 1I94M 1WIVA 2UUBM 4JI5M 4NRWA 5KO3A 4X64M 4DBGB 3J81S 3GPUA 3FUXA 5EXPA 3LCVB 4MGHA 2DXIA 2FOIC 3B9PA 3NBIA 4LJ7A 4YY3M 2C99A 7CATA 4GKKM 3W67A 1IBMM 1R5LA 1EE8A 2KZUA 2Z3XA 4GC9A 3UMMA 2L2DA 1NJGA 1TH3A 3B7ZA 1XWIA 3M0EA 1QUTA 3JR4A 4AQYM 3LVWA 4G4QA 3AOEC 3FTDA 2J7OA 3TWKA 3AJIB 3KDSE 3HJ8A 3SASA 3C9PA 2OOAA 2VDBB 4NRVA 1T3TA 1WJ7A 1SXJA 2XFTA 1PRBA 2ZANA 1E94E 4OVZA 2KEBA 3C3EA 1IXSB 3GRRA 2QBYA 1BVSA 2DZOB 3FUTA 4LG2A 1L8QA 3GRVA 4FW9A 1WGNA 2KA6B 3A98B 3E9SA 1N75A 5L8RF 3A46A 2G3QA 2BNKA 5F3WA 2Y20A 4LFAM 3FUVA 2DWLA 2WSEF 1C1KA 2BJWA 3GRUA 3B74A 2APLA 1IM2A 4MGIE 4G3OA 2CHVA 3SMPA 3SHGB 4LF8M 4R3DA 2V6ZM 4IBGA 1WGLA 4I5SA 2X4AA 2KXEA 1D0KA 2XLJA 1IN5A 1TF0B 2UUCM 1TH2A 1UFZA 1G8PA 4NXNM 4LF9M 3GPXA 2MJ5B 4A3VB 3THGA 2DENA 5FTKA 1DO2A 2KRUA 3NWLA 2HWJA 3CF2A 1E32A 3HY5A 4FWHA 3KXEC 1LTMA 3IHPA 2RKOA 2V1CA 4DR5M 2JY5A 2L7IA 2Q2EB 2Z4RA 1GKIA 3CF6E 4Q7JA 4XGIA 5EP3A 3VKHA 3K92A 4LZJA 1L1ZA 3GPYA 3J7AS 4IIWA 3SYLA 3WHLA 4WURA 3CGWA 4PCZA 1G71A 4IBDA 1H6UA 2CP8A 3W68A 3ZC7B 1PGYA 1K3XA 2Z4SA 2JZ0A 2K47A 3AFHA 4IBIA 2JUJA 3L27A 4BB9A 3PVSA 2FFJA 2Y0TA 4JI0M 2FNAA 1Z5AA 1G41A 1SXJB 3K2LA 4OVZB 5FTJA 1XB2B 3GP1A 1NY6A 3U6LA 3U6CA 2XZFA 2QBYB 4G4RA 1EIJA 2ZBKB 3DOAA 2BJVA 2BWBA 4I81A 1GLNA 2QCUA 2L6OA 1VDDA 5H37D 1VEGA 3HJSA 3SYKA 4P17A 4M9XA 3KOWE 4GHLA 1J09A 4MGKE 3SATA 2LVOC 2DZNB 3H4MA 1MJGM 3L26A 2R44A 2P5TA 1KFVA 1G59A 1PJTA 2CV1A 2LHGA 2I7NA 2M5ZA 2R4JA 4DR7M 3K9PA 2CHQA 4LGYA 1Q3BA 1NNUC 3J2PB 1QYRA 1RU3A 3KSXA 2D7EA 4L16A 3DA1A 3TL4X 5ITRA 4G6ZA 2LVQD 2FH0A 1MN3A 1SXJD 4JYAM 1GJTA 1ZAEA 3MJ5A 4DR3M 4B7FA 3FTEA 1GL7A 4DR4M 4MGZE 2EA0A 4DV1M 4GEWA 1TGUA 3J27B 1YUBA 3I51A 2DNAA 3TPZA 2JP7A 4DV2M 3VDUA 2KNVA 4KT0F 2DAKA 3HKPA 3E4RA 4X66M 4W5WA 2VQEM 2JWSA 2CV0A 5EP1A 4DV0M 1XNRM 3SBJA 3K8ZA 1NHGC 3GPPA 3W0FA 4FCVA 5IREB 3KOZE 3TE6A 4GC5A 4IBFA 2H1RA 2JY7A 4GITA 4BLCA 4KHPM 3I04M 4BBAA 1Q39A 1P3QQ 2ZAMA 3L28A 1ZMWA 2DWZB 3LVVA 1OIPA 4HLQA 1GO5A 3IG5A 3U61A 4DUZM 2LTUA 2DHYA 2J5YA 1PM5A 2LBCA 5EQTA 3GRYA 4L8RC 1QZMA 2KRKA 3B7QA 3KW6A 3GLHE 4DR2M 2KNAA 4P16A 2LVPC 2Z7JA 2EKFA 2L7HA 2DAGA 4M9SA 3GLFE 1N77A 4M9ZA 4NXMM 4CISA 4AKHA 3QAUA 4QNRA 1AIPC 1IN6A 2KZSA 2CEAA 4LJ4A 4RF0A 3UZUA 1KSFX 3GLHA 4IBKA 3KOXE 5EXTA 2DWNA 3LQRA 5BR8M 1OFHA 1SXJE 3GLFA 3FUUA 2C9OA 4JI8M 2KNZA 2VF8A 3HHWA 3K9OA 1L2CA 3KS8A 1Z5BA 3T1YM 2L09A 3Q8GA 4G4OA 4L4UA 4F2LA 1OQYA 1W5TA 2FS1A 2ZTCA 1MU5A 1YE9A 3FKEA 2DKLA 3HWSA 3U6MA 2QPAA 1HT2E 1TR8A 1VEKA 4Y28F 4YHHM 1K3WA 2K9DA 3HHXA 2C5RA 3HHZA 4DV4M 4B3TM 3UGJA 2LH0A 4NSRA 2QHOB 3SHFA 2AHMA 2YNMD 3AL0C 4AG5A 3SAVA 3FRHA 2XFSA 3A42A 1PJSA 3JR5A 2LNHC 4MM3B 1TDZA 4NC6A 1K82A 4LF5M 5IT9S 1DGHA 1DGGA 3D8BA 3KOYE 3L29A 3GQ5A 1C7YA 4WP2A 1JB0F 2N35A 5KQ8A 1OTRA 2YR0A 4R7GA 2CHGA 2HKJA 4IJEA 3U61B 3T15A 3RGSA 4JI2M 1HNXM 4II7A 4GH9A 3IG8A 3B7NA 3CF0A 1ZQ9A 4FVMA 1T6OA 2KDLA 2OOBA 3I4VA 3D8LA 4OW0A 4D82A 1OFIA 3SAUA 2XZUA 2R65A 3AV0A 3JAMS 4B3SM 4IBCA 4K0KM 2O25A 1R2YA 5E6JA 4DUYM 2I7PA 1DGBA 2V1UA 4MH0E 4GKJM 4IBEA 2RGOA 3BBZA 3VKGA 2QENA 3GLHB 3J80S 1JQJC 1HQYE 4XK8F 1NV8A 3RFWA 1QAMA 2XSZA 3GLFB 2FE8A 1V33A 3HZJA 3ZH9B 4R71A 3VLFB 4DV5M 1G3IA 1OAOC 4LJAA 4AI6A 2R6FA 4NL4H 4ANRA 2F5QA 1DV0A 1LV7A 1QQWA 2OPFA 3MMPA 4X62M 1QVRA 2BWEA 2F5PA 1Z6TA 3E21A 2WSCF 4D80A 3BOSA 1QUSA 5JI2E 2LWXA 1HNZM 5EP2A 1J7KA 1XHBA 2CE7A 5EXXA 1L1TA 1XC8A 5GKNA 4LRSA 2R62A 1DGHB 3DFZA 3DZDA 3GQ4A 3VK7A 1N33M 2CWBA 2UXDM 1PJQA 4IBJA 4GRIA 2CRUA 1XXHE 2ERCA 4ZPXA 1W5SA 1NJFA 5A2QS 2Y21A 3I4YA 4QHTA 5FSWA 1TTEA 4GMQA 1NSFA 2OO9A 4QNMA 4PDGA 1CUKA 1VG5A 3FUWA 2G8LA 3ILKA 2XEPA 3HHYA 3SAWA 1XXHA 4LY6A 4QOSA 2R0IA 5FLXS 4LF4M 3HU2A 4QOZC 2R18A 1MX0A 8CATA 3FTFA 2JY6B 3OTOM 3W0LB 3KP1E 1SG9A 3U5ZA 2ZAOA 1R4GA 1EFUB 4F1IA 3HGIA 4FWGA 3GLIE 4I8OA 1Y8GA 2KHHA 4IJFA 5KPTA 2EO2A 3AOEA 1IFYA 2XH9A 1J5EM 2D7GA 2M60A 1G4AE 3GLIA 2R45A 4AW4A 4GIPA 2JNHA 2QQ8A 4WW0A 3SARA 2LVAA 5C18A 2F4VM 4OX9M 1TDHA 3F92A 1VQ1A 4M0WA 2MROB 3T38A 1WHCA 2QZ4A 2J7NA 5KQDA 3VDPA 1PJIA 4JN6A 4NOOB 2RRUA 2HAKA 2KW0A 3ZCBB 4LF6M 4Z6YA 1R6BX 1Z59A 3GLGE 4LFCM 2A5YB 2JY8A 2XSZD 4AKIA 1E9RA 2C96A 2F5SA 2Z8YM 2R46A 2JXNA 2X8AA 1IY2A 2XGNA 4B7HA 4CIZA 1IXRC 1KYIA 2VF7A 1ZMVA 4NSOB 1XXHB 2OQ4A 4JV5M 4I4LA 1NV9A 3GLGA 1HT1E 1GVNA 4DV3M 2MGWA 3FD9A 1ZV1A 3VFDA 1OJLA 2DVWB 3U6OA 3J7BA 5ITQA 3FRIA 3U6QA 1FJGM 3U5ZB 1GL6A 2L4EA 2QSFX 3B89A 3HU1A 3IECA 3GO8A 3PNVA 3HU3A 1HQCA 5FTMA 3AOGA 1IQPA 2DAIA 5ITUA 4JI3M 2EKKA 4D81A 2LVNC 2QP9X 2WSFF 1IBKM 4B3MM 1QZEA 1D0MA 3ZQJA 2D7HA 4DR1M 4LJ5A 3GLIB 4KODA 4FWDA 1XMOM 2YFQA 4CHTB 1N34M 2R4EA 3C58A 3PNYA 3Q8XA 4HEOA 5EP4A 1IBLM 3QYBA 4LF7M 5FTNA 3PXGA 1NO1A 3M7GA 5DNYA 1XNQM 1D0LA 2HCBA 4UN2B 5ITYA 3SC3A 4LJ9A 3T6PA 5LMUM 5EXSA 3HJQA 2L4FA 4M0DA 3PFIA 3VK8A 3KVWA 1L2BA 4LRTA 3GQ3A 4JI7M 1GJSA 2DWMA 5IWAM 3TWMA 4REZA 1IXZA 1Q3CA 2F5NA 1Q02A 4IBBA 1YLAA 4RKUF 2B3TA 1R7RA 3E46A 1F4IA 3CTWB 3HX3A 3U6SA 4MB7A 3GLGB 1IN4A 4FCWA 4CGYB 4TUWA 2EJSA 3K1JA 3NBXX 3WHKA 1E9SA 2ZTDA 1A5TA 4DV6M 4L15A 2UXCM 3MK6A 2C98A 2LXEA 4DV7M 3R8FA 3LCUA 3FTCA 4L78A 2DAMA 3FYCA 4AG6A 1NNJA 4JI6M 1VEJA 1JR3D 2K6BA 1X37A 3LW5F 2LHCA 4LJ6A 3U60A 1QAOA 2DZLA 5ITTA 1D2NA 1R2ZA 3LMMA 2XF3A 2H5XA 1AUAA 2O01F 3L2AA 3T1HM 3U6PA 2UUAM 1S3SA 1SXJC 3RGPA 4RF1A 1V34A 3U6DA 1OIZA 4KLNA 1QDRA 4KO8A 4L6V6 5IZ7D 1L2DA 5EJCA 1ZMUA 1FNNA 3H4JA 1HJPA 2GNOA 4LCBA 2QNJA 1NHWC 3BXWA 3I01M 4B08A 1OAIA 4HL4A 4PD2A 1N36M 2UU9M 1QANA 1WXQA 4JXJA 4OU7A 2WZJA 1OKSA 3TWLA 3SMSA 2ZM6M 3LQQA 4PDIA 3R9XB 5KPRA 2UXBM 5LMNM 1Z5CA 2RGHA 1XMQM 4JI1M 3FYDA 2DAEA 4GHAA 2MH8A 4EIWA 1IN7A 1T43A 3A45A 1YSYA 3AKZA 1IY1A 4AKGA 1DO0A 3L25A 2G5GX 2VIIA 5ITXE 5DFLA 2VQFM 4XBOA 2DHRA 3QYEA 5BPVA 1PJJA 1TH4A 3TQSA 3C3DA 3KP0E 3KS4A 3M6AA 2JA2A 3QWLA 3U60B 1HNWM 2HHHM 1JR3E 2E5LM 4PT5A 4ITQA 5FTLA 4Z8XA 5ITXA 2O5RA 2HL7A 4X65M 1ORYB 3FE3A 2DI0A 3RE8A 4QHSA 2CV2A 4JI4M 5DYIA 4FCTA 1IY0A 1UM8A 1JR3A 4LGMA 4LFBM 2GQFA 3EIEA 4S12A 2F5OA 2X49A 1IXSA 1V92A
chains in the Genus database with same CATH topology
1IN8A 2YQZA 4MGYE 2EUCA 2C9CA 3SFZA 2CFOA 5JI3E 4B7GA 1HR0M 4AZFA 4G4NA 3EIHA 3KFUG 4DR6M 1I4WA 2Y0QA 1DGFA 5E26A 3MHVC 3KSJA 4B3RM 1NVMA 5KPZA 5DYGA 4LJ8A 5C1BA 3U6EA 1N78A 4FD2A 2W82A 1N32M 1NY5A 1QAQA 2NQ8C 2CUZA 4LZZA 4RNAA 3UJNA 1I94M 3UK6A 2UUBM 4JI5M 4NRWA 5KO3A 4X64M 3J81S 3GPUA 3FUXA 5EXPA 4MGHA 2DXIA 2FOIC 3B9PA 3NBIA 4LJ7A 4YY3M 2C99A 7CATA 4GKKM 1IBMM 1EE8A 2KZUA 2Z3XA 4GC9A 3UMMA 1NJGA 1TH3A 3M0EA 1XWIA 3JR4A 4AQYM 3LVWA 4G4QA 3AOEC 3FTDA 2J7OA 3TWKA 3AJIB 3KDSE 3HJ8A 3SASA 4NRVA 1T3TA 1SXJA 2XFTA 2ZANA 4OVZA 1E94E 2KEBA 1IXSB 3GRRA 2QBYA 2DZOB 3FUTA 4LG2A 1L8QA 3GRVA 4FW9A 2KA6B 3A98B 3E9SA 1N75A 3A46A 5F3WA 2BNKA 2Y20A 4LFAM 3FUVA 2DWLA 1C1KA 2BJWA 3GRUA 1IM2A 4MGIE 2CHVA 3SMPA 3SHGB 4LF8M 4R3DA 2V6ZM 4IBGA 4I5SA 2X4AA 2KXEA 2XLJA 1IN5A 2UUCM 1TH2A 4LF9M 1G8PA 4NXNM 3GPXA 4A3VB 3THGA 5FTKA 1DO2A 2KRUA 3NWLA 3CF2A 1E32A 4FWHA 3KXEC 4DR5M 2RKOA 2V1CA 3CF6E 2L7IA 2Q2EB 2Z4RA 1GKIA 5EP3A 3VKHA 4XGIA 3K92A 4LZJA 1L1ZA 3GPYA 3J7AS 4IIWA 3SYLA 3WHLA 4WURA 4PCZA 4IBDA 1H6UA 3ZC7B 1K3XA 2Z4SA 2K47A 3AFHA 4IBIA 3L27A 4BB9A 3PVSA 2FFJA 2Y0TA 4JI0M 2FNAA 1Z5AA 1G41A 1SXJB 3K2LA 4OVZB 5FTJA 3GP1A 3U6LA 1NY6A 3U6CA 2XZFA 2QBYB 4G4RA 2ZBKB 3DOAA 2BJVA 4I81A 1GLNA 2QCUA 2L6OA 1VDDA 5H37D 3HJSA 3SYKA 4M9XA 3KOWE 4GHLA 1J09A 4MGKE 3SATA 2DZNB 3H4MA 3L26A 2P5TA 1KFVA 1G59A 2CV1A 2I7NA 2M5ZA 2R4JA 4DR7M 4LGYA 2CHQA 1Q3BA 1NNUC 3J2PB 1QYRA 3KSXA 4L16A 2D7EA 3TL4X 3DA1A 5ITRA 4G6ZA 1SXJD 4JYAM 3MJ5A 1ZAEA 4DR3M 4B7FA 3FTEA 1GL7A 4DR4M 4MGZE 2EA0A 4DV1M 1TGUA 3J27B 1YUBA 3I51A 3TPZA 4DV2M 3VDUA 4X66M 3HKPA 3E4RA 2CV0A 4W5WA 2VQEM 5EP1A 4DV0M 1XNRM 3SBJA 3K8ZA 1NHGC 3GPPA 3W0FA 4FCVA 5IREB 3KOZE 3TE6A 4GC5A 4IBFA 2H1RA 4GITA 4BLCA 4KHPM 4BBAA 1Q39A 2ZAMA 3L28A 2DWZB 3LVVA 4HLQA 3IG5A 3U61A 4DUZM 1PM5A 5EQTA 3GRYA 4L8RC 1QZMA 2KRKA 3KW6A 4DR2M 4P16A 2Z7JA 4M9SA 2L7HA 1N77A 4M9ZA 4NXMM 4CISA 4AKHA 3QAUA 4QNRA 1IN6A 2KZSA 2CEAA 4LJ4A 4RF0A 3UZUA 1KSFX 3GLHA 4IBKA 3KOXE 5EXTA 2DWNA 3LQRA 5BR8M 1OFHA 1SXJE 3GLFA 3FUUA 2C9OA 4JI8M 3HHWA 1L2CA 3KS8A 1Z5BA 3T1YM 2L09A 4G4OA 3U6PA 4L4UA 1W5TA 3FKEA 3HWSA 1MU5A 1YE9A 3U6MA 2QPAA 1HT2E 4YHHM 1K3WA 3HHXA 2C5RA 3HHZA 4DV4M 4B3TM 3UGJA 2LH0A 4NSRA 3SHFA 2AHMA 2YNMD 3AL0C 4AG5A 3SAVA 2XFSA 3A42A 3JR5A 2LNHC 4MM3B 1TDZA 1K82A 4LF5M 5IT9S 1DGHA 1DGGA 3D8BA 3KOYE 3L29A 3GQ5A 5KQ8A 2YR0A 4R7GA 2CHGA 2HKJA 4IJEA 3U61B 3T15A 3RGSA 4JI2M 1HNXM 4II7A 4GH9A 3IG8A 3CF0A 1ZQ9A 4FVMA 3I4VA 3D8LA 4OW0A 4D82A 1OFIA 3SAUA 2XZUA 2R65A 3AV0A 3JAMS 4B3SM 4IBCA 4K0KM 1R2YA 5E6JA 4DUYM 2I7PA 1DGBA 2V1UA 4MH0E 4GKJM 4IBEA 2RGOA 3VKGA 2QENA 3GLHB 3J80S 1JQJC 1HQYE 3RFWA 1QAMA 2XSZA 3GLFB 2FE8A 3ZH9B 3VLFB 4DV5M 1G3IA 4LJAA 4AI6A 4NL4H 2F5QA 1LV7A 1QQWA 2OPFA 4X62M 1QVRA 2F5PA 1Z6TA 4D80A 3BOSA 5JI2E 2LWXA 1HNZM 5EP2A 1J7KA 1XHBA 2CE7A 5EXXA 1L1TA 1XC8A 5GKNA 4LRSA 2R62A 1DGHB 3DFZA 3DZDA 3GQ4A 3VK7A 1N33M 2UXDM 4IBJA 4GRIA 2ERCA 4ZPXA 1W5SA 1NJFA 5A2QS 2Y21A 3I4YA 4QHTA 5FSWA 4GMQA 1NSFA 4QNMA 4PDGA 3FUWA 2G8LA 3ILKA 2XEPA 3HHYA 3SAWA 1XXHA 4LY6A 4QOSA 4QOZC 5FLXS 4LF4M 3HU2A 2R18A 1MX0A 8CATA 3FTFA 3OTOM 3W0LB 3KP1E 3U5ZA 2ZAOA 3HGIA 4FWGA 4I8OA 4IJFA 5KPTA 2EO2A 3AOEA 2XH9A 1J5EM 2D7GA 2M60A 1G4AE 3GLIA 2R45A 4AW4A 4GIPA 4WW0A 3SARA 5C18A 2F4VM 4OX9M 1TDHA 3T38A 4M0WA 2QZ4A 2J7NA 5KQDA 3VDPA 1PJIA 4JN6A 4NOOB 2KW0A 3ZCBB 4LF6M 4Z6YA 1R6BX 1Z59A 4LFCM 2A5YB 2XSZD 4AKIA 1E9RA 2C96A 2F5SA 2R46A 2X8AA 1IY2A 2XGNA 4B7HA 1IXRC 1KYIA 4NSOB 4JV5M 1XXHB 2OQ4A 4I4LA 3GLGA 1HT1E 1GVNA 4DV3M 3FD9A 3VFDA 1OJLA 2DVWB 3U6OA 3J7BA 5ITQA 3U6QA 1FJGM 3U5ZB 1GL6A 3HU1A 3GO8A 3PNVA 3HU3A 1HQCA 5FTMA 3AOGA 1IQPA 5ITUA 4JI3M 4D81A 2QP9X 1IBKM 4B3MM 2D7HA 4DR1M 4LJ5A 3GLIB 4KODA 4FWDA 1XMOM 2YFQA 4CHTB 1N34M 2R4EA 3C58A 3PNYA 3Q8XA 5EP4A 1IBLM 4LF7M 5FTNA 3PXGA 3M7GA 5DNYA 1XNQM 2HCBA 5ITYA 3SC3A 4LJ9A 5LMUM 5EXSA 3HJQA 4M0DA 3PFIA 3VK8A 3KVWA 1L2BA 4LRTA 3GQ3A 4JI7M 2DWMA 5IWAM 3TWMA 4REZA 1IXZA 1Q3CA 2F5NA 4IBBA 1R7RA 3CTWB 3U6SA 4MB7A 3GLGB 1IN4A 4FCWA 4CGYB 4TUWA 3K1JA 3WHKA 1E9SA 4DV6M 4L15A 2UXCM 3MK6A 2C98A 2LXEA 4DV7M 3R8FA 3FTCA 4L78A 4AG6A 3FYCA 1NNJA 4JI6M 1JR3D 4LJ6A 1X37A 3U60A 1QAOA 5ITTA 1D2NA 1R2ZA 3LMMA 2XF3A 3L2AA 2UUAM 3T1HM 1S3SA 1SXJC 3RGPA 4RF1A 3U6DA 4KLNA 4KO8A 5IZ7D 1L2DA 5EJCA 1FNNA 4LCBA 1NHWC 4B08A 4PD2A 4HL4A 1N36M 2UU9M 1QANA 1WXQA 4JXJA 4OU7A 3TWLA 3SMSA 2ZM6M 3LQQA 4PDIA 3R9XB 5KPRA 2UXBM 5LMNM 1Z5CA 2RGHA 1XMQM 4JI1M 3FYDA 4GHAA 4EIWA 1IN7A 3A45A 1YSYA 3AKZA 1IY1A 4AKGA 1DO0A 3L25A 2G5GX 2VIIA 5ITXE 2VQFM 4XBOA 2DHRA 5BPVA 1PJJA 1TH4A 3TQSA 3KP0E 3KS4A 3M6AA 2JA2A 3QWLA 3U60B 1HNWM 2HHHM 2E5LM 4ITQA 4PT5A 5FTLA 4Z8XA 5ITXA 2O5RA 2HL7A 4X65M 1ORYB 3RE8A 4QHSA 2CV2A 4JI4M 5DYIA 4FCTA 1IY0A 1UM8A 1JR3A 4LGMA 4LFBM 3EIEA 4S12A 2F5OA 2X49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 M;  3C58 A;  1KFV A;  1IBL M;  4LF7 M;  1HR0 M;  4DR7 M;  4DV5 M;  1Q3B A;  4G4N A;  4DR6 M;  5ITR A;  1XNQ M;  5ITY A;  2F5Q A;  5LMU M;  2OPF A;  4X62 M;  4B3R M;  2F5P A;  4JYA M;  3VK8 A;  4DR3 M;  1L2B A;  3GQ3 A;  4JI7 M;  4DR4 M;  3U6E A;  5IWA M;  1HNZ M;  2EA0 A;  4DV1 M;  3TWM A;  1N32 M;  1L1T A;  1Q3C A;  1XC8 A;  1I94 M;  2F5N A;  2UUB M;  3GQ4 A;  3VK7 A;  4JI5 M;  1N33 M;  4NRW A;  4X64 M;  4DV2 M;  3J81 S;  4X66 M;  4MB7 A;  3GPU A;  3U6S A;  2VQE M;  2UXD M;  4DV0 M;  1XNR M;  3SBJ A;  4YY3 M;  5A2Q S;  3GPP A;  3W0F A;  4GKK M;  2F4V M;  1IBM M;  4DV6 M;  1EE8 A;  1FJG M;  2UXC M;  4PDG A;  4DV7 M;  3JR4 A;  4AQY M;  4G4Q A;  3TWK A;  3SAW A;  4KHP M;  1NNJ A;  4JI6 M;  3SAS A;  1Q39 A;  4NRV A;  5FLX S;  4LF4 M;  1MX0 A;  3OTO M;  5ITT A;  4DUZ M;  1R2Z A;  1PM5 A;  3A46 A;  2UUA M;  3T1H M;  4DR2 M;  4LFA M;  4NXM M;  4CIS A;  3U6D A;  1J5E M;  1L2D A;  4LF8 M;  5BR8 M;  4JI8 M;  1L2C A;  3SAR A;  4PD2 A;  1N36 M;  2UU9 M;  2UUC M;  4OX9 M;  4LF9 M;  1Z5B A;  4NXN M;  3T1Y M;  1TDH A;  3GPX A;  3TWL A;  4G4O A;  3U6P A;  2ZM6 M;  4PDI A;  1MU5 A;  3U6M A;  4YHH M;  2UXB M;  1K3W A;  5LMN M;  1Z5C A;  1XMQ M;  1PJI A;  4DV4 M;  4B3T M;  4JI1 M;  4LF6 M;  1Z59 A;  4DR5 M;  4LFC M;  3A45 A;  2Q2E B;  3SAV A;  3A42 A;  3JR5 A;  2F5S A;  1K82 A;  1L1Z A;  1TDZ A;  3SAT A;  3GPY A;  4LF5 M;  5IT9 S;  3J7A S;  5ITX E;  4PCZ A;  3GQ5 A;  2VQF M;  4JV5 M;  2OQ4 A;  1K3X A;  1PJJ A;  4DV3 M;  2HKJ A;  4JI0 M;  1HNW M;  3U6O A;  3U6Q A;  1Z5A A;  5ITQ A;  2HHH M;  3GP1 A;  3U6C A;  3U6L A;  1HNX M;  2E5L M;  2XZF A;  4ITQ A;  3GO8 A;  4JI2 M;  5ITX A;  4G4R A;  2ZBK B;  4X65 M;  3SAU A;  3DOA A;  2XZU A;  3JAM S;  4B3S M;  4K0K M;  4JI4 M;  5ITU A;  4JI3 M;  1R2Y A;  4DUY M;  4GKJ M;  1IBK M;  4B3M M;  4LFB M;  4DR1 M;  2F5O A;  3J80 S;  1XMO M; 
#chains in the Genus database with same CATH topology
 1IN8 A;  2JZ1 A;  2YQZ A;  4MGY E;  2EUC A;  2C9C A;  3SFZ A;  3V76 A;  2CFO A;  5JI3 E;  4B7G A;  1HR0 M;  4AZF A;  4G4N A;  3EIH A;  1VDL A;  3KFU G;  4DR6 M;  1I4W A;  2Y0Q A;  1DGF A;  5E26 A;  3MHV C;  1QDT A;  3KSJ A;  4B3R M;  1GAB A;  1NVM A;  2K0B X;  1WR1 B;  5KPZ A;  5DYG A;  4LJ8 A;  5C1B A;  3U6E A;  1N78 A;  4FD2 A;  2W82 A;  4CJ6 A;  1N32 M;  1NY5 A;  1QAQ A;  2NQ8 C;  2CUZ A;  2MR9 A;  4LZZ A;  4RNA A;  3UJN A;  3UK6 A;  1I94 M;  1WIV A;  2UUB M;  4JI5 M;  4NRW A;  5KO3 A;  4X64 M;  4DBG B;  3J81 S;  3GPU A;  3FUX A;  5EXP A;  3LCV B;  4MGH A;  2DXI A;  2FOI C;  3B9P A;  3NBI A;  4LJ7 A;  4YY3 M;  2C99 A;  7CAT A;  4GKK M;  3W67 A;  1IBM M;  1R5L A;  1EE8 A;  2KZU A;  2Z3X A;  4GC9 A;  3UMM A;  2L2D A;  1NJG A;  1TH3 A;  3B7Z A;  1XWI A;  3M0E A;  1QUT A;  3JR4 A;  4AQY M;  3LVW A;  4G4Q A;  3AOE C;  3FTD A;  2J7O A;  3TWK A;  3AJI B;  3KDS E;  3HJ8 A;  3SAS A;  3C9P A;  2OOA A;  2VDB B;  4NRV A;  1T3T A;  1WJ7 A;  1SXJ A;  2XFT A;  1PRB A;  2ZAN A;  1E94 E;  4OVZ A;  2KEB A;  3C3E A;  1IXS B;  3GRR A;  2QBY A;  1BVS A;  2DZO B;  3FUT A;  4LG2 A;  1L8Q A;  3GRV A;  4FW9 A;  1WGN A;  2KA6 B;  3A98 B;  3E9S A;  1N75 A;  5L8R F;  3A46 A;  2G3Q A;  2BNK A;  5F3W A;  2Y20 A;  4LFA M;  3FUV A;  2DWL A;  2WSE F;  1C1K A;  2BJW A;  3GRU A;  3B74 A;  2APL A;  1IM2 A;  4MGI E;  4G3O A;  2CHV A;  3SMP A;  3SHG B;  4LF8 M;  4R3D A;  2V6Z M;  4IBG A;  1WGL A;  4I5S A;  2X4A A;  2KXE A;  1D0K A;  2XLJ A;  1IN5 A;  1TF0 B;  2UUC M;  1TH2 A;  1UFZ A;  1G8P A;  4NXN M;  4LF9 M;  3GPX A;  2MJ5 B;  4A3V B;  3THG A;  2DEN A;  5FTK A;  1DO2 A;  2KRU A;  3NWL A;  2HWJ A;  3CF2 A;  1E32 A;  3HY5 A;  4FWH A;  3KXE C;  1LTM A;  3IHP A;  2RKO A;  2V1C A;  4DR5 M;  2JY5 A;  2L7I A;  2Q2E B;  2Z4R A;  1GKI A;  3CF6 E;  4Q7J A;  4XGI A;  5EP3 A;  3VKH A;  3K92 A;  4LZJ A;  1L1Z A;  3GPY A;  3J7A S;  4IIW A;  3SYL A;  3WHL A;  4WUR A;  3CGW A;  4PCZ A;  1G71 A;  4IBD A;  1H6U A;  2CP8 A;  3W68 A;  3ZC7 B;  1PGY A;  1K3X A;  2Z4S A;  2JZ0 A;  2K47 A;  3AFH A;  4IBI A;  2JUJ A;  3L27 A;  4BB9 A;  3PVS A;  2FFJ A;  2Y0T A;  4JI0 M;  2FNA A;  1Z5A A;  1G41 A;  1SXJ B;  3K2L A;  4OVZ B;  5FTJ A;  1XB2 B;  3GP1 A;  1NY6 A;  3U6L A;  3U6C A;  2XZF A;  2QBY B;  4G4R A;  1EIJ A;  2ZBK B;  3DOA A;  2BJV A;  2BWB A;  4I81 A;  1GLN A;  2QCU A;  2L6O A;  1VDD A;  5H37 D;  1VEG A;  3HJS A;  3SYK A;  4P17 A;  4M9X A;  3KOW E;  4GHL A;  1J09 A;  4MGK E;  3SAT A;  2LVO C;  2DZN B;  3H4M A;  1MJG M;  3L26 A;  2R44 A;  2P5T A;  1KFV A;  1G59 A;  1PJT A;  2CV1 A;  2LHG A;  2I7N A;  2M5Z A;  2R4J A;  4DR7 M;  3K9P A;  2CHQ A;  4LGY A;  1Q3B A;  1NNU C;  3J2P B;  1QYR A;  1RU3 A;  3KSX A;  2D7E A;  4L16 A;  3DA1 A;  3TL4 X;  5ITR A;  4G6Z A;  2LVQ D;  2FH0 A;  1MN3 A;  1SXJ D;  4JYA M;  1GJT A;  1ZAE A;  3MJ5 A;  4DR3 M;  4B7F A;  3FTE A;  1GL7 A;  4DR4 M;  4MGZ E;  2EA0 A;  4DV1 M;  4GEW A;  1TGU A;  3J27 B;  1YUB A;  3I51 A;  2DNA A;  3TPZ A;  2JP7 A;  4DV2 M;  3VDU A;  2KNV A;  4KT0 F;  2DAK A;  3HKP A;  3E4R A;  4X66 M;  4W5W A;  2VQE M;  2JWS A;  2CV0 A;  5EP1 A;  4DV0 M;  1XNR M;  3SBJ A;  3K8Z A;  1NHG C;  3GPP A;  3W0F A;  4FCV A;  5IRE B;  3KOZ E;  3TE6 A;  4GC5 A;  4IBF A;  2H1R A;  2JY7 A;  4GIT A;  4BLC A;  4KHP M;  3I04 M;  4BBA A;  1Q39 A;  1P3Q Q;  2ZAM A;  3L28 A;  1ZMW A;  2DWZ B;  3LVV A;  1OIP A;  4HLQ A;  1GO5 A;  3IG5 A;  3U61 A;  4DUZ M;  2LTU A;  2DHY A;  2J5Y A;  1PM5 A;  2LBC A;  5EQT A;  3GRY A;  4L8R C;  1QZM A;  2KRK A;  3B7Q A;  3KW6 A;  3GLH E;  4DR2 M;  2KNA A;  4P16 A;  2LVP C;  2Z7J A;  2EKF A;  2L7H A;  2DAG A;  4M9S A;  3GLF E;  1N77 A;  4M9Z A;  4NXM M;  4CIS A;  4AKH A;  3QAU A;  4QNR A;  1AIP C;  1IN6 A;  2KZS A;  2CEA A;  4LJ4 A;  4RF0 A;  3UZU A;  1KSF X;  3GLH A;  4IBK A;  3KOX E;  5EXT A;  2DWN A;  3LQR A;  5BR8 M;  1OFH A;  1SXJ E;  3GLF A;  3FUU A;  2C9O A;  4JI8 M;  2KNZ A;  2VF8 A;  3HHW A;  3K9O A;  1L2C A;  3KS8 A;  1Z5B A;  3T1Y M;  2L09 A;  3Q8G A;  4G4O A;  4L4U A;  4F2L A;  1OQY A;  1W5T A;  2FS1 A;  2ZTC A;  1MU5 A;  1YE9 A;  3FKE A;  2DKL A;  3HWS A;  3U6M A;  2QPA A;  1HT2 E;  1TR8 A;  1VEK A;  4Y28 F;  4YHH M;  1K3W A;  2K9D A;  3HHX A;  2C5R A;  3HHZ A;  4DV4 M;  4B3T M;  3UGJ A;  2LH0 A;  4NSR A;  2QHO B;  3SHF A;  2AHM A;  2YNM D;  3AL0 C;  4AG5 A;  3SAV A;  3FRH A;  2XFS A;  3A42 A;  1PJS A;  3JR5 A;  2LNH C;  4MM3 B;  1TDZ A;  4NC6 A;  1K82 A;  4LF5 M;  5IT9 S;  1DGH A;  1DGG A;  3D8B A;  3KOY E;  3L29 A;  3GQ5 A;  1C7Y A;  4WP2 A;  1JB0 F;  2N35 A;  5KQ8 A;  1OTR A;  2YR0 A;  4R7G A;  2CHG A;  2HKJ A;  4IJE A;  3U61 B;  3T15 A;  3RGS A;  4JI2 M;  1HNX M;  4II7 A;  4GH9 A;  3IG8 A;  3B7N A;  3CF0 A;  1ZQ9 A;  4FVM A;  1T6O A;  2KDL A;  2OOB A;  3I4V A;  3D8L A;  4OW0 A;  4D82 A;  1OFI A;  3SAU A;  2XZU A;  2R65 A;  3AV0 A;  3JAM S;  4B3S M;  4IBC A;  4K0K M;  2O25 A;  1R2Y A;  5E6J A;  4DUY M;  2I7P A;  1DGB A;  2V1U A;  4MH0 E;  4GKJ M;  4IBE A;  2RGO A;  3BBZ A;  3VKG A;  2QEN A;  3GLH B;  3J80 S;  1JQJ C;  1HQY E;  4XK8 F;  1NV8 A;  3RFW A;  1QAM A;  2XSZ A;  3GLF B;  2FE8 A;  1V33 A;  3HZJ A;  3ZH9 B;  4R71 A;  3VLF B;  4DV5 M;  1G3I A;  1OAO C;  4LJA A;  4AI6 A;  2R6F A;  4NL4 H;  4ANR A;  2F5Q A;  1DV0 A;  1LV7 A;  1QQW A;  2OPF A;  3MMP A;  4X62 M;  1QVR A;  2BWE A;  2F5P A;  1Z6T A;  3E21 A;  2WSC F;  4D80 A;  3BOS A;  1QUS A;  5JI2 E;  2LWX A;  1HNZ M;  5EP2 A;  1J7K A;  1XHB A;  2CE7 A;  5EXX A;  1L1T A;  1XC8 A;  5GKN A;  4LRS A;  2R62 A;  1DGH B;  3DFZ A;  3DZD A;  3GQ4 A;  3VK7 A;  1N33 M;  2CWB A;  2UXD M;  1PJQ A;  4IBJ A;  4GRI A;  2CRU A;  1XXH E;  2ERC A;  4ZPX A;  1W5S A;  1NJF A;  5A2Q S;  2Y21 A;  3I4Y A;  4QHT A;  5FSW A;  1TTE A;  4GMQ A;  1NSF A;  2OO9 A;  4QNM A;  4PDG A;  1CUK A;  1VG5 A;  3FUW A;  2G8L A;  3ILK A;  2XEP A;  3HHY A;  3SAW A;  1XXH A;  4LY6 A;  4QOS A;  2R0I A;  5FLX S;  4LF4 M;  3HU2 A;  4QOZ C;  2R18 A;  1MX0 A;  8CAT A;  3FTF A;  2JY6 B;  3OTO M;  3W0L B;  3KP1 E;  1SG9 A;  3U5Z A;  2ZAO A;  1R4G A;  1EFU B;  4F1I A;  3HGI A;  4FWG A;  3GLI E;  4I8O A;  1Y8G A;  2KHH A;  4IJF A;  5KPT A;  2EO2 A;  3AOE A;  1IFY A;  2XH9 A;  1J5E M;  2D7G A;  2M60 A;  1G4A E;  3GLI A;  2R45 A;  4AW4 A;  4GIP A;  2JNH A;  2QQ8 A;  4WW0 A;  3SAR A;  2LVA A;  5C18 A;  2F4V M;  4OX9 M;  1TDH A;  3F92 A;  1VQ1 A;  4M0W A;  2MRO B;  3T38 A;  1WHC A;  2QZ4 A;  2J7N A;  5KQD A;  3VDP A;  1PJI A;  4JN6 A;  4NOO B;  2RRU A;  2HAK A;  2KW0 A;  3ZCB B;  4LF6 M;  4Z6Y A;  1R6B X;  1Z59 A;  3GLG E;  4LFC M;  2A5Y B;  2JY8 A;  2XSZ D;  4AKI A;  1E9R A;  2C96 A;  2F5S A;  2Z8Y M;  2R46 A;  2JXN A;  2X8A A;  1IY2 A;  2XGN A;  4B7H A;  4CIZ A;  1IXR C;  1KYI A;  2VF7 A;  1ZMV A;  4NSO B;  1XXH B;  2OQ4 A;  4JV5 M;  4I4L A;  1NV9 A;  3GLG A;  1HT1 E;  1GVN A;  4DV3 M;  2MGW A;  3FD9 A;  1ZV1 A;  3VFD A;  1OJL A;  2DVW B;  3U6O A;  3J7B A;  5ITQ A;  3FRI A;  3U6Q A;  1FJG M;  3U5Z B;  1GL6 A;  2L4E A;  2QSF X;  3B89 A;  3HU1 A;  3IEC A;  3GO8 A;  3PNV A;  3HU3 A;  1HQC A;  5FTM A;  3AOG A;  1IQP A;  2DAI A;  5ITU A;  4JI3 M;  2EKK A;  4D81 A;  2LVN C;  2QP9 X;  2WSF F;  1IBK M;  4B3M M;  1QZE A;  1D0M A;  3ZQJ A;  2D7H A;  4DR1 M;  4LJ5 A;  3GLI B;  4KOD A;  4FWD A;  1XMO M;  2YFQ A;  4CHT B;  1N34 M;  2R4E A;  3C58 A;  3PNY A;  3Q8X A;  4HEO A;  5EP4 A;  1IBL M;  3QYB A;  4LF7 M;  5FTN A;  3PXG A;  1NO1 A;  3M7G A;  5DNY A;  1XNQ M;  1D0L A;  2HCB A;  4UN2 B;  5ITY A;  3SC3 A;  4LJ9 A;  3T6P A;  5LMU M;  5EXS A;  3HJQ A;  2L4F A;  4M0D A;  3PFI A;  3VK8 A;  3KVW A;  1L2B A;  4LRT A;  3GQ3 A;  4JI7 M;  1GJS A;  2DWM A;  5IWA M;  3TWM A;  4REZ A;  1IXZ A;  1Q3C A;  2F5N A;  1Q02 A;  4IBB A;  1YLA A;  4RKU F;  2B3T A;  1R7R A;  3E46 A;  1F4I A;  3CTW B;  3HX3 A;  3U6S A;  4MB7 A;  3GLG B;  1IN4 A;  4FCW A;  4CGY B;  4TUW A;  2EJS A;  3K1J A;  3NBX X;  3WHK A;  1E9S A;  2ZTD A;  1A5T A;  4DV6 M;  4L15 A;  2UXC M;  3MK6 A;  2C98 A;  2LXE A;  4DV7 M;  3R8F A;  3LCU A;  3FTC A;  4L78 A;  2DAM A;  3FYC A;  4AG6 A;  1NNJ A;  4JI6 M;  1VEJ A;  1JR3 D;  2K6B A;  1X37 A;  3LW5 F;  2LHC A;  4LJ6 A;  3U60 A;  1QAO A;  2DZL A;  5ITT A;  1D2N A;  1R2Z A;  3LMM A;  2XF3 A;  2H5X A;  1AUA A;  2O01 F;  3L2A A;  3T1H M;  3U6P A;  2UUA M;  1S3S A;  1SXJ C;  3RGP A;  4RF1 A;  1V34 A;  3U6D A;  1OIZ A;  4KLN A;  1QDR A;  4KO8 A;  4L6V 6;  5IZ7 D;  1L2D A;  5EJC A;  1ZMU A;  1FNN A;  3H4J A;  1HJP A;  2GNO A;  4LCB A;  2QNJ A;  1NHW C;  3BXW A;  3I01 M;  4B08 A;  1OAI A;  4HL4 A;  4PD2 A;  1N36 M;  2UU9 M;  1QAN A;  1WXQ A;  4JXJ A;  4OU7 A;  2WZJ A;  1OKS A;  3TWL A;  3SMS A;  2ZM6 M;  3LQQ A;  4PDI A;  3R9X B;  5KPR A;  2UXB M;  5LMN M;  1Z5C A;  2RGH A;  1XMQ M;  4JI1 M;  3FYD A;  2DAE A;  4GHA A;  2MH8 A;  4EIW A;  1IN7 A;  1T43 A;  3A45 A;  1YSY A;  3AKZ A;  1IY1 A;  4AKG A;  1DO0 A;  3L25 A;  2G5G X;  2VII A;  5ITX E;  5DFL A;  2VQF M;  4XBO A;  2DHR A;  3QYE A;  5BPV A;  1PJJ A;  1TH4 A;  3TQS A;  3C3D A;  3KP0 E;  3KS4 A;  3M6A A;  2JA2 A;  3QWL A;  3U60 B;  1HNW M;  2HHH M;  1JR3 E;  2E5L M;  4PT5 A;  4ITQ A;  5FTL A;  4Z8X A;  5ITX A;  2O5R A;  2HL7 A;  4X65 M;  1ORY B;  3FE3 A;  2DI0 A;  3RE8 A;  4QHS A;  2CV2 A;  4JI4 M;  5DYI A;  4FCT A;  1IY0 A;  1UM8 A;  1JR3 A;  4LGM A;  4LFB M;  2GQF A;  3EIE A;  4S12 A;  2F5O A;  2X49 A;  1IXS A;  1V92 A; 
#chains in the Genus database with same CATH homology
 1IN8 A;  2YQZ A;  4MGY E;  2EUC A;  2C9C A;  3SFZ A;  2CFO A;  5JI3 E;  4B7G A;  1HR0 M;  4AZF A;  4G4N A;  3EIH A;  3KFU G;  4DR6 M;  1I4W A;  2Y0Q A;  1DGF A;  5E26 A;  3MHV C;  3KSJ A;  4B3R M;  1NVM A;  5KPZ A;  5DYG A;  4LJ8 A;  5C1B A;  3U6E A;  1N78 A;  4FD2 A;  2W82 A;  1N32 M;  1NY5 A;  1QAQ A;  2NQ8 C;  2CUZ A;  4LZZ A;  4RNA A;  3UJN A;  1I94 M;  3UK6 A;  2UUB M;  4JI5 M;  4NRW A;  5KO3 A;  4X64 M;  3J81 S;  3GPU A;  3FUX A;  5EXP A;  4MGH A;  2DXI A;  2FOI C;  3B9P A;  3NBI A;  4LJ7 A;  4YY3 M;  2C99 A;  7CAT A;  4GKK M;  1IBM M;  1EE8 A;  2KZU A;  2Z3X A;  4GC9 A;  3UMM A;  1NJG A;  1TH3 A;  3M0E A;  1XWI A;  3JR4 A;  4AQY M;  3LVW A;  4G4Q A;  3AOE C;  3FTD A;  2J7O A;  3TWK A;  3AJI B;  3KDS E;  3HJ8 A;  3SAS A;  4NRV A;  1T3T A;  1SXJ A;  2XFT A;  2ZAN A;  4OVZ A;  1E94 E;  2KEB A;  1IXS B;  3GRR A;  2QBY A;  2DZO B;  3FUT A;  4LG2 A;  1L8Q A;  3GRV A;  4FW9 A;  2KA6 B;  3A98 B;  3E9S A;  1N75 A;  3A46 A;  5F3W A;  2BNK A;  2Y20 A;  4LFA M;  3FUV A;  2DWL A;  1C1K A;  2BJW A;  3GRU A;  1IM2 A;  4MGI E;  2CHV A;  3SMP A;  3SHG B;  4LF8 M;  4R3D A;  2V6Z M;  4IBG A;  4I5S A;  2X4A A;  2KXE A;  2XLJ A;  1IN5 A;  2UUC M;  1TH2 A;  4LF9 M;  1G8P A;  4NXN M;  3GPX A;  4A3V B;  3THG A;  5FTK A;  1DO2 A;  2KRU A;  3NWL A;  3CF2 A;  1E32 A;  4FWH A;  3KXE C;  4DR5 M;  2RKO A;  2V1C A;  3CF6 E;  2L7I A;  2Q2E B;  2Z4R A;  1GKI A;  5EP3 A;  3VKH A;  4XGI A;  3K92 A;  4LZJ A;  1L1Z A;  3GPY A;  3J7A S;  4IIW A;  3SYL A;  3WHL A;  4WUR A;  4PCZ A;  4IBD A;  1H6U A;  3ZC7 B;  1K3X A;  2Z4S A;  2K47 A;  3AFH A;  4IBI A;  3L27 A;  4BB9 A;  3PVS A;  2FFJ A;  2Y0T A;  4JI0 M;  2FNA A;  1Z5A A;  1G41 A;  1SXJ B;  3K2L A;  4OVZ B;  5FTJ A;  3GP1 A;  3U6L A;  1NY6 A;  3U6C A;  2XZF A;  2QBY B;  4G4R A;  2ZBK B;  3DOA A;  2BJV A;  4I81 A;  1GLN A;  2QCU A;  2L6O A;  1VDD A;  5H37 D;  3HJS A;  3SYK A;  4M9X A;  3KOW E;  4GHL A;  1J09 A;  4MGK E;  3SAT A;  2DZN B;  3H4M A;  3L26 A;  2P5T A;  1KFV A;  1G59 A;  2CV1 A;  2I7N A;  2M5Z A;  2R4J A;  4DR7 M;  4LGY A;  2CHQ A;  1Q3B A;  1NNU C;  3J2P B;  1QYR A;  3KSX A;  4L16 A;  2D7E A;  3TL4 X;  3DA1 A;  5ITR A;  4G6Z A;  1SXJ D;  4JYA M;  3MJ5 A;  1ZAE A;  4DR3 M;  4B7F A;  3FTE A;  1GL7 A;  4DR4 M;  4MGZ E;  2EA0 A;  4DV1 M;  1TGU A;  3J27 B;  1YUB A;  3I51 A;  3TPZ A;  4DV2 M;  3VDU A;  4X66 M;  3HKP A;  3E4R A;  2CV0 A;  4W5W A;  2VQE M;  5EP1 A;  4DV0 M;  1XNR M;  3SBJ A;  3K8Z A;  1NHG C;  3GPP A;  3W0F A;  4FCV A;  5IRE B;  3KOZ E;  3TE6 A;  4GC5 A;  4IBF A;  2H1R A;  4GIT A;  4BLC A;  4KHP M;  4BBA A;  1Q39 A;  2ZAM A;  3L28 A;  2DWZ B;  3LVV A;  4HLQ A;  3IG5 A;  3U61 A;  4DUZ M;  1PM5 A;  5EQT A;  3GRY A;  4L8R C;  1QZM A;  2KRK A;  3KW6 A;  4DR2 M;  4P16 A;  2Z7J A;  4M9S A;  2L7H A;  1N77 A;  4M9Z A;  4NXM M;  4CIS A;  4AKH A;  3QAU A;  4QNR A;  1IN6 A;  2KZS A;  2CEA A;  4LJ4 A;  4RF0 A;  3UZU A;  1KSF X;  3GLH A;  4IBK A;  3KOX E;  5EXT A;  2DWN A;  3LQR A;  5BR8 M;  1OFH A;  1SXJ E;  3GLF A;  3FUU A;  2C9O A;  4JI8 M;  3HHW A;  1L2C A;  3KS8 A;  1Z5B A;  3T1Y M;  2L09 A;  4G4O A;  3U6P A;  4L4U A;  1W5T A;  3FKE A;  3HWS A;  1MU5 A;  1YE9 A;  3U6M A;  2QPA A;  1HT2 E;  4YHH M;  1K3W A;  3HHX A;  2C5R A;  3HHZ A;  4DV4 M;  4B3T M;  3UGJ A;  2LH0 A;  4NSR A;  3SHF A;  2AHM A;  2YNM D;  3AL0 C;  4AG5 A;  3SAV A;  2XFS A;  3A42 A;  3JR5 A;  2LNH C;  4MM3 B;  1TDZ A;  1K82 A;  4LF5 M;  5IT9 S;  1DGH A;  1DGG A;  3D8B A;  3KOY E;  3L29 A;  3GQ5 A;  5KQ8 A;  2YR0 A;  4R7G A;  2CHG A;  2HKJ A;  4IJE A;  3U61 B;  3T15 A;  3RGS A;  4JI2 M;  1HNX M;  4II7 A;  4GH9 A;  3IG8 A;  3CF0 A;  1ZQ9 A;  4FVM A;  3I4V A;  3D8L A;  4OW0 A;  4D82 A;  1OFI A;  3SAU A;  2XZU A;  2R65 A;  3AV0 A;  3JAM S;  4B3S M;  4IBC A;  4K0K M;  1R2Y A;  5E6J A;  4DUY M;  2I7P A;  1DGB A;  2V1U A;  4MH0 E;  4GKJ M;  4IBE A;  2RGO A;  3VKG A;  2QEN A;  3GLH B;  3J80 S;  1JQJ C;  1HQY E;  3RFW A;  1QAM A;  2XSZ A;  3GLF B;  2FE8 A;  3ZH9 B;  3VLF B;  4DV5 M;  1G3I A;  4LJA A;  4AI6 A;  4NL4 H;  2F5Q A;  1LV7 A;  1QQW A;  2OPF A;  4X62 M;  1QVR A;  2F5P A;  1Z6T A;  4D80 A;  3BOS A;  5JI2 E;  2LWX A;  1HNZ M;  5EP2 A;  1J7K A;  1XHB A;  2CE7 A;  5EXX A;  1L1T A;  1XC8 A;  5GKN A;  4LRS A;  2R62 A;  1DGH B;  3DFZ A;  3DZD A;  3GQ4 A;  3VK7 A;  1N33 M;  2UXD M;  4IBJ A;  4GRI A;  2ERC A;  4ZPX A;  1W5S A;  1NJF A;  5A2Q S;  2Y21 A;  3I4Y A;  4QHT A;  5FSW A;  4GMQ A;  1NSF A;  4QNM A;  4PDG A;  3FUW A;  2G8L A;  3ILK A;  2XEP A;  3HHY A;  3SAW A;  1XXH A;  4LY6 A;  4QOS A;  4QOZ C;  5FLX S;  4LF4 M;  3HU2 A;  2R18 A;  1MX0 A;  8CAT A;  3FTF A;  3OTO M;  3W0L B;  3KP1 E;  3U5Z A;  2ZAO A;  3HGI A;  4FWG A;  4I8O A;  4IJF A;  5KPT A;  2EO2 A;  3AOE A;  2XH9 A;  1J5E M;  2D7G A;  2M60 A;  1G4A E;  3GLI A;  2R45 A;  4AW4 A;  4GIP A;  4WW0 A;  3SAR A;  5C18 A;  2F4V M;  4OX9 M;  1TDH A;  3T38 A;  4M0W A;  2QZ4 A;  2J7N A;  5KQD A;  3VDP A;  1PJI A;  4JN6 A;  4NOO B;  2KW0 A;  3ZCB B;  4LF6 M;  4Z6Y A;  1R6B X;  1Z59 A;  4LFC M;  2A5Y B;  2XSZ D;  4AKI A;  1E9R A;  2C96 A;  2F5S A;  2R46 A;  2X8A A;  1IY2 A;  2XGN A;  4B7H A;  1IXR C;  1KYI A;  4NSO B;  4JV5 M;  1XXH B;  2OQ4 A;  4I4L A;  3GLG A;  1HT1 E;  1GVN A;  4DV3 M;  3FD9 A;  3VFD A;  1OJL A;  2DVW B;  3U6O A;  3J7B A;  5ITQ A;  3U6Q A;  1FJG M;  3U5Z B;  1GL6 A;  3HU1 A;  3GO8 A;  3PNV A;  3HU3 A;  1HQC A;  5FTM A;  3AOG A;  1IQP A;  5ITU A;  4JI3 M;  4D81 A;  2QP9 X;  1IBK M;  4B3M M;  2D7H A;  4DR1 M;  4LJ5 A;  3GLI B;  4KOD A;  4FWD A;  1XMO M;  2YFQ A;  4CHT B;  1N34 M;  2R4E A;  3C58 A;  3PNY A;  3Q8X A;  5EP4 A;  1IBL M;  4LF7 M;  5FTN A;  3PXG A;  3M7G A;  5DNY A;  1XNQ M;  2HCB A;  5ITY A;  3SC3 A;  4LJ9 A;  5LMU M;  5EXS A;  3HJQ A;  4M0D A;  3PFI A;  3VK8 A;  3KVW A;  1L2B A;  4LRT A;  3GQ3 A;  4JI7 M;  2DWM A;  5IWA M;  3TWM A;  4REZ A;  1IXZ A;  1Q3C A;  2F5N A;  4IBB A;  1R7R A;  3CTW B;  3U6S A;  4MB7 A;  3GLG B;  1IN4 A;  4FCW A;  4CGY B;  4TUW A;  3K1J A;  3WHK A;  1E9S A;  4DV6 M;  4L15 A;  2UXC M;  3MK6 A;  2C98 A;  2LXE A;  4DV7 M;  3R8F A;  3FTC A;  4L78 A;  4AG6 A;  3FYC A;  1NNJ A;  4JI6 M;  1JR3 D;  4LJ6 A;  1X37 A;  3U60 A;  1QAO A;  5ITT A;  1D2N A;  1R2Z A;  3LMM A;  2XF3 A;  3L2A A;  2UUA M;  3T1H M;  1S3S A;  1SXJ C;  3RGP A;  4RF1 A;  3U6D A;  4KLN A;  4KO8 A;  5IZ7 D;  1L2D A;  5EJC A;  1FNN A;  4LCB A;  1NHW C;  4B08 A;  4PD2 A;  4HL4 A;  1N36 M;  2UU9 M;  1QAN A;  1WXQ A;  4JXJ A;  4OU7 A;  3TWL A;  3SMS A;  2ZM6 M;  3LQQ A;  4PDI A;  3R9X B;  5KPR A;  2UXB M;  5LMN M;  1Z5C A;  2RGH A;  1XMQ M;  4JI1 M;  3FYD A;  4GHA A;  4EIW A;  1IN7 A;  3A45 A;  1YSY A;  3AKZ A;  1IY1 A;  4AKG A;  1DO0 A;  3L25 A;  2G5G X;  2VII A;  5ITX E;  2VQF M;  4XBO A;  2DHR A;  5BPV A;  1PJJ A;  1TH4 A;  3TQS A;  3KP0 E;  3KS4 A;  3M6A A;  2JA2 A;  3QWL A;  3U60 B;  1HNW M;  2HHH M;  2E5L M;  4ITQ A;  4PT5 A;  5FTL A;  4Z8X A;  5ITX A;  2O5R A;  2HL7 A;  4X65 M;  1ORY B;  3RE8 A;  4QHS A;  2CV2 A;  4JI4 M;  5DYI A;  4FCT A;  1IY0 A;  1UM8 A;  1JR3 A;  4LGM A;  4LFB M;  3EIE A;  4S12 A;  2F5O A;  2X49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...