4JI7M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji7M02
4DV7M 1XNRM 2UUAM 3SAUA 5ITXA 4DUZM 3U6MA 1IBLM 4JYAM 4DV6M 3T1YM 4NRVA 4B3SM 1K3XA 3A42A 4DR4M 2HKJA 1L2CA 3SARA 4DUYM 4JI2M 1HNXM 2VQEM 3GO8A 3JR5A 4DR3M 2UUBM 4LF5M 4JI4M 3T1HM 1KFVA 4AQYM 3U6LA 3VK7A 1R2YA 3C58A 2E5LM 4DV3M 1K3WA 1L1ZA 1L1TA 4JV5M 3SAWA 3OTOM 1EE8A 4GKJM 1HNZM 5LMUM 3GP1A 3GPYA 2ZBKB 3U6DA 2UXCM 5ITQA 1N36M 3TWKA 1Z5AA 3U6EA 4YHHM 4LF4M 3U6SA 3U6QA 4DV1M 4B3MM 4JI5M 1TDHA 1Z5BA 4G4QA 3JAMS 4DR7M 1Z59A 2OQ4A 3TWMA 4G4RA 4DR1M 2XZUA 1Q39A 2F4VM 4X66M 1XNQM 3GQ4A 3GPXA 2ZM6M 4PCZA 4KHPM 1MX0A 1N33M 4JI1M 5ITYA 1NNJA 1N32M 4PDGA 3GPPA 3DOAA 4X62M 1IBMM 3A45A 4JI3M 5BR8M 1FJGM 4GKKM 3J80S 4JI0M 1Z5CA 4CISA 4LF7M 4OX9M 2UUCM 1MU5A 3GQ3A 3J7AS 3U6PA 3J81S 2F5SA 4PDIA 5ITTA 5A2QS 3SBJA 5ITUA 4LFBM 4DR6M 5IT9S 3JR4A 4K0KM 3A46A 2HHHM 4G4OA 4LF9M 4B3TM 4DR5M 2EA0A 2F5QA 4NXNM 1L2DA 1HNWM 4DV4M 3VK8A 3U6OA 2F5NA 3SASA 1I94M 1R2ZA 1XC8A 5FLXS 4JI7M 5IWAM 4X64M 5ITRA 4LF8M 4MB7A 1XMQM 2UU9M 1J5EM 4DV2M 4LF6M 1Q3CA 5LMNM 2F5OA 3W0FA 1Q3BA 3GPUA 4ITQA 2F5PA 1L2BA 3U6CA 1PJIA 2UXDM 3SATA 2OPFA 1PJJA 2Q2EB 4B3RM 4JI8M 4LFCM 4DV5M 4X65M 4DV0M 4NXMM 2UXBM 1XMOM 3TWLA 4G4NA 4JI6M 4DR2M 4YY3M 1TDZA 1PM5A 1N34M 4PD2A 1IBKM 5ITXE 4NRWA 4LFAM 3GQ5A 1K82A 1HR0M 3SAVA 2XZFA 2VQFM
chains in the Genus database with same CATH superfamily
4IBEA 3GRUA 3HU2A 1S3SA 3SAUA 2DWZB 4FVMA 2KNAA 2C99A 2J5YA 4F2LA 1OAIA 4AKGA 4NRVA 3B89A 2DWLA 3HHWA 2CV0A 3HJQA 4LGYA 4DR4M 1L2CA 2KXEA 3IECA 4JI2M 5F3WA 2UUBM 2WSCF 2JUJA 5EXXA 1QQWA 1GVNA 2K0BX 2RKOA 4LZZA 4OVZA 2LH0A 3VK7A 3DFZA 1JR3D 3MHVC 3UZUA 1L1ZA 1NO1A 4JV5M 3OTOM 1EE8A 1GL7A 3C9PA 2RGHA 3H4JA 3H4MA 4L15A 4L6V6 4L4UA 2CE7A 5H37D 2Y21A 3FD9A 5KPZA 3GPYA 3GLGE 3KXEC 1OIPA 2UXCM 4HLQA 1WXQA 1BVSA 2DZLA 5FTNA 3U6QA 2G5GX 2L7IA 4IBDA 4JI5M 2K47A 1OQYA 1TDHA 3GRRA 3UK6A 2RGOA 2LVOC 2O5RA 4FCVA 5C18A 2CUZA 2QENA 2Z4SA 3GLIE 3D8BA 3SMSA 3TQSA 4X66M 4CJ6A 4PCZA 4KHPM 1NJFA 1D0LA 2VF7A 3HHYA 1NNJA 3AKZA 5DYIA 2L4EA 4S12A 1IBMM 3A45A 2BWBA 1TH2A 3HWSA 3TPZA 4IBIA 5BR8M 1FJGM 4MM3B 1XXHE 2RRUA 2XGNA 2MROB 4JI0M 1G3IA 4CISA 4LF7M 1HT2E 2CHVA 2QNJA 3I4VA 3AV0A 2GNOA 2KA6B 1MU5A 2CEAA 4R3DA 2LVNC 3FUXA 4D81A 2R4EA 2NQ8C 1G41A 3ZC7B 1XHBA 2P5TA 4DR6M 2BNKA 3FE3A 4P17A 4WP2A 1GLNA 2O01F 4B08A 3A46A 3AOEA 4JN6A 2HHHM 2BJVA 2L7HA 1NHWC 4B3TM 4FCWA 2EA0A 1L2DA 1EFUB 1NHGC 3PXGA 2F5NA 3Q8GA 4IBCA 3FUVA 4I81A 1OKSA 2XFSA 1XC8A 3HJSA 4QNRA 4JI7M 1VEGA 5IWAM 1J09A 2I7NA 5KO3A 2CHQA 1E94E 2KNZA 5C1BA 3DA1A 4MB7A 3F92A 1FNNA 2C9CA 3IG8A 4DV2M 3I04M 4P16A 4LF6M 4MGYE 5FTJA 1Q3BA 2QBYA 1PJTA 2LNHC 1GJTA 2DWMA 2F5PA 4AG6A 1VEKA 2K9DA 3BOSA 1TGUA 3U6CA 4KODA 3CTWB 5FTMA 3MJ5A 1QAMA 1T6OA 2Q2EB 1KYIA 2XSZA 3E9SA 3HX3A 1PRBA 4NC6A 1QVRA 4RNAA 1NJGA 5GKNA 3SYLA 2V1CA 4NXMM 1P3QQ 4X65M 4DV0M 2UXBM 4M9XA 1GJSA 1QZMA 2J7OA 3K2LA 4ZPXA 4B3MM 3CGWA 1N75A 1N34M 2L2DA 1KSFX 3AJIB 3GLGB 1IBKM 1UM8A 3K92A 3M7GA 4QHSA 1E32A 2QCUA 3AOGA 3I01M 2MR9A 2QHOB 1HR0M 4RKUF 1XNRM 2Z7JA 1N78A 2UUAM 3THGA 2ERCA 3TE6A 3U5ZA 5EQTA 4JXJA 5ITXA 4DV1M 4LG2A 3HJ8A 1R6BX 4B3SM 2L09A 3LMMA 1V92A 3Q8XA 2JZ0A 4EIWA 1IXZA 5EP3A 4KT0F 2DZOB 1HNXM 2ZAOA 3W68A 1R7RA 3GO8A 4GHLA 4FWHA 2M5ZA 1R2YA 2E5LM 4IJFA 4A3VB 2A5YB 2Z3XA 1XXHB 3AOEC 3KVWA 3K9OA 1VQ1A 3L28A 4IBKA 2JWSA 2BWEA 1HNZM 4L8RC 3C3EA 1DGFA 1WGLA 3KSJA 4UN2B 5EXPA 3GP1A 2X49A 3FYCA 1F4IA 5IREB 2QSFX 4R7GA 3HU1A 1HQYE 1OTRA 1TH4A 2APLA 3I51A 3KW6A 7CATA 1JB0F 3QWLA 1WIVA 2QP9X 1YUBA 4LJ8A 4MGKE 5KPRA 1Z5BA 4G4QA 4G3OA 1SG9A 4DR7M 1IXSB 1Z59A 2R6FA 4NL4H 3KP0E 2OOBA 2JY8A 3WHKA 3FTDA 2XZUA 1PJQA 3C3DA 2HWJA 4LY6A 1D0MA 3GPXA 3GQ4A 3U60A 2R62A 4B7HA 4QOZC 1T43A 5ITYA 3QAUA 4PDGA 3U5ZB 4XGIA 1I4WA 1WR1B 3ZQJA 3NBXX 1OJLA 2C9OA 3V76A 1Z5CA 4OX9M 2FOIC 2KEBA 2JA2A 3T15A 2XLJA 4D82A 1IXRC 2YQZA 4MGZE 1TTEA 3AL0C 2KZSA 4MGIE 2H5XA 5A2QS 4G6ZA 3LVVA 4LFBM 2XFTA 5IT9S 3JR4A 3FYDA 2LBCA 3CF2A 3NBIA 3T38A 1IM2A 1CUKA 1ZMUA 4CIZA 3PFIA 4DR5M 1C1KA 4NXNM 3GLIA 1ZAEA 2L6OA 1SXJE 2KDLA 5EJCA 2DAIA 3T6PA 3LQRA 1Q02A 2CHGA 2N35A 2FE8A 3B7ZA 3LW5F 2OOAA 3ZCBB 2LVPC 2QPAA 5ITRA 3RGSA 5JI3E 3RFWA 4IBJA 1DV0A 3CF0A 2DZNB 2VDBB 2YR0A 3KOWE 5FTKA 2KHHA 1J5EM 3BXWA 2O25A 4QOSA 3SHGB 3LCUA 4OVZB 4AW4A 3GPUA 4AG5A 3MMPA 1C7YA 1GABA 1MN3A 4MGHA 3B7NA 1PJIA 2D7HA 2UXDM 2D7EA 1GL6A 1HQCA 2K6BA 2OPFA 4B3RM 1R4GA 3CF6E 3ILKA 3RGPA 4LFCM 2WZJA 1Z6TA 3TWLA 1G8PA 4OU7A 4REZA 2DHYA 1TDZA 5FTLA 2Y0QA 1NVMA 4M9ZA 5ITXE 3VKHA 2EKKA 1VG5A 3M0EA 4LFAM 2LVAA 1SXJA 3J27B 3GLIB 3SAVA 1GO5A 3B9PA 4WURA 3E46A 4AZFA 2AHMA 2DI0A 3UMMA 2X8AA 2KZUA 4DUZM 4CHTB 1JR3E 1G4AE 2CFOA 4JYAM 2Z4RA 4GITA 4Z6YA 5FSWA 1YSYA 3KOZE 2HKJA 3SARA 2FH0A 2LXEA 4DUYM 1WGNA 3R9XB 2VQEM 4DR3M 1OFHA 5DNYA 4LF5M 1E9RA 1VDLA 4PT5A 3T1HM 1KFVA 1QZEA 3KOYE 4AQYM 5EP1A 3VFDA 1IN5A 4DV3M 3LCVB 1L1TA 3SAWA 2HCBA 4M9SA 3L2AA 4GKJM 3QYBA 2CV2A 1NNUC 4QHTA 4IJEA 3A98B 1IN6A 3U6DA 1QDRA 1N36M 3GLFE 3TWKA 4YHHM 4DBGB 3MK6A 4LZJA 4IBFA 8CATA 1V34A 3U61A 1ORYB 2MH8A 3VDPA 3TWMA 1EIJA 2GQFA 1RU3A 3BBZA 4G4RA 1SXJB 1XB2B 1AUAA 4HEOA 2JXNA 1AIPC 1JQJC 1Y8GA 2HAKA 1NSFA 2ZAMA 1XNQM 3L27A 1N33M 3QYEA 4FWGA 3KS8A 1N32M 1PGYA 1JR3A 4KO8A 2C98A 3E21A 2QBYB 3GPPA 4X62M 2JNHA 2M60A 5EXTA 2LWXA 2HL7A 1MJGM 3LVWA 2KRUA 1D0KA 1ZV1A 2DNAA 2UUCM 3GQ3A 4RF0A 3U6PA 4GEWA 4XBOA 3J81S 1N77A 2F5SA 4KLNA 2DENA 3SBJA 5ITUA 4CGYB 1QAOA 5KPTA 3GLHE 1GKIA 3FUUA 3W0LB 3KFUG 1SXJC 4LGMA 3FUTA 2L4FA 4LCBA 4NSOB 3VLFB 3GLFA 4G4OA 1G59A 2XF3A 2MGWA 2XSZD 3FRIA 3IHPA 2J7NA 3VK8A 1DGGA 2D7GA 4L16A 3PVSA 4AI6A 1J7KA 1X37A 1DGHA 2FS1A 5FLXS 3KDSE 2V1UA 3SC3A 4Y28F 4Z8XA 1XWIA 4L78A 1D2NA 1ZMWA 3SHFA 1DO2A 1ZMVA 4B7GA 1T3TA 3FKEA 4LF8M 2YNMD 1XMQM 1IFYA 1V33A 1PJSA 4LJ4A 1Q3CA 2F5OA 3W0FA 1QAQA 4IIWA 2BJWA 4I5SA 4IBGA 4GMQA 3SATA 1W5TA 3HHZA 2QQ8A 1A5TA 1PJJA 2FFJA 3W67A 4JI8M 1W5SA 5EP2A 2EJSA 4DV5M 3VDUA 2R45A 1LV7A 1TH3A 5EXSA 4JI6M 3GLHA 2Z8YM 2LHGA 4DR2M 3SFZA 1TF0B 4GH9A 1UFZA 2YFQA 3KP1E 2MJ5B 3GLFB 2DWNA 4NRWA 4ANRA 2XEPA 1K82A 3FTCA 2DAGA 4AKIA 2VF8A 3U60B 3WHLA 2VQFM 3B74A 2XZFA 2JY5A 4DV7M 1YLAA 3FUWA 3I4YA 1DGHB 3EIHA 2R46A 3U6MA 2JP7A 1IBLM 4DV6M 2V6ZM 3T1YM 1K3XA 1VEJA 3A42A 4B7FA 4LJ9A 3KS4A 3K9PA 3FRHA 2R65A 3JR5A 3SMPA 4JI4M 1IY1A 2H1RA 2EO2A 3HY5A 3U6LA 1QUSA 3C58A 2LHCA 4LJ7A 1K3WA 2Y0TA 4QNMA 5DYGA 5E6JA 1R5LA 5KQ8A 1QANA 1IN8A 2LTUA 3IG5A 1NV8A 4LJ5A 1HJPA 4LJAA 2DHRA 2X4AA 4GHAA 5LMUM 3J2PB 1H6UA 2DKLA 2ZBKB 2WSFF 3ZH9B 5ITQA 2R18A 1Z5AA 4LRSA 3U6EA 1G71A 1DGBA 4LF4M 1E9SA 2R0IA 1L8QA 3U6SA 3GLHB 2KW0A 1OFIA 2R44A 3HKPA 4LRTA 3JAMS 3GLGA 2DAKA 2B3TA 1QUTA 2OQ4A 4DR1M 1VDDA 1Q39A 2KRKA 1HT1E 2F4VM 2CRUA 4Q7JA 5JI2E 2WSEF 2ZM6M 1MX0A 4D80A 4JI1M 1LTMA 2JY6B 3KOXE 3DOAA 4F1IA 1NY6A 2C5RA 4JI3M 1WJ7A 4NOOB 3R8FA 4FW9A 1OIZA 2DAEA 5E26A 4GKKM 3TL4X 3J80S 4BBAA 2CV1A 3HGIA 4TUWA 3HHXA 2EKFA 4GC5A 1IY0A 5L8RF 3J7AS 4HL4A 4XK8F 3UGJA 4W5WA 2CWBA 4PDIA 5ITTA 1XXHA 3SYKA 2G3QA 4M0DA 4NSRA 2ZANA 2JZ1A 3HZJA 3M6AA 3PNYA 3K8ZA 4II7A 4K0KM 2LVQD 1IQPA 3FTEA 2XH9A 1QYRA 3UJNA 4FCTA 4LF9M 1IN7A 1WHCA 1YE9A 2F5QA 1HNWM 4BLCA 3HU3A 5DFLA 3GRVA 2QZ4A 4DV4M 3U6OA 4LJ6A 2Y20A 2ZTCA 1R2ZA 1I94M 3SASA 5EP4A 3FTFA 3VKGA 1OAOC 2I7PA 2CP8A 4GIPA 1IXSA 4X64M 5BPVA 2OO9A 2KNVA 4I8OA 2EUCA 3KSXA 2FNAA 1SXJD 3E4RA 2UU9M 1IY2A 3B7QA 3LQQA 4AKHA 1NY5A 1TR8A 4IBBA 3GRYA 5LMNM 3K1JA 2R4JA 4ITQA 3D8LA 1L2BA 3J7BA 4BB9A 4RF1A 3DZDA 3PNVA 1QDTA 2C96A 4I4LA 5KQDA 4FWDA 3RE8A 1DO0A 3EIEA 3L29A 1NV9A 4MH0E 4FD2A 4WW0A 2ZTDA 1XMOM 2G8LA 5IZ7D 4G4NA 2DAMA 4GRIA 2DXIA 3L25A 1IN4A 2W82A 4GC9A 4OW0A 2DVWB 4PD2A 4YY3M 3U61B 3L26A 2JY7A 4M0WA 3GQ5A 3NWLA 2VIIA 3AFHA 1PM5A 4R71A 1ZQ9A
chains in the Genus database with same CATH topology
4IBEA 3GRUA 3HU2A 1S3SA 3SAUA 2DWZB 4FVMA 2C99A 4AKGA 4NRVA 2DWLA 3HHWA 2CV0A 3HJQA 4LGYA 4DR4M 1L2CA 2KXEA 4JI2M 5F3WA 2UUBM 5EXXA 1QQWA 1GVNA 2RKOA 4LZZA 4OVZA 2LH0A 3VK7A 3DFZA 1JR3D 3MHVC 3UZUA 1L1ZA 4JV5M 3OTOM 1EE8A 1GL7A 2RGHA 3H4MA 4L15A 4L4UA 2CE7A 5H37D 2Y21A 3FD9A 5KPZA 3GPYA 3KXEC 2UXCM 4HLQA 1WXQA 5FTNA 3U6QA 2G5GX 2L7IA 4IBDA 4JI5M 2K47A 3UK6A 1TDHA 3GRRA 2RGOA 2O5RA 4FCVA 5C18A 2CUZA 2QENA 2Z4SA 3D8BA 3SMSA 3TQSA 4X66M 4PCZA 4KHPM 1NJFA 3HHYA 1NNJA 3AKZA 5DYIA 4S12A 1IBMM 3A45A 1TH2A 3HWSA 3TPZA 4IBIA 5BR8M 1FJGM 4MM3B 2XGNA 4JI0M 1G3IA 4CISA 4LF7M 3I4VA 1HT2E 2CHVA 3AV0A 2KA6B 1MU5A 2CEAA 4R3DA 3FUXA 4D81A 2R4EA 2NQ8C 1G41A 3ZC7B 1XHBA 2P5TA 4DR6M 2BNKA 1GLNA 4B08A 3A46A 3AOEA 4JN6A 2HHHM 2BJVA 2L7HA 1NHWC 4B3TM 4FCWA 2EA0A 1L2DA 1NHGC 3PXGA 2F5NA 4IBCA 3FUVA 4I81A 1XC8A 2XFSA 3HJSA 4QNRA 4JI7M 5IWAM 1J09A 2I7NA 5KO3A 2CHQA 1E94E 5C1BA 3DA1A 4MB7A 1FNNA 2C9CA 3IG8A 4DV2M 4P16A 4LF6M 4MGYE 5FTJA 1Q3BA 2QBYA 2LNHC 2DWMA 2F5PA 4AG6A 3BOSA 1TGUA 3U6CA 4KODA 3CTWB 5FTMA 3MJ5A 1QAMA 2Q2EB 1KYIA 2XSZA 3E9SA 5GKNA 3TE6A 4RNAA 1QVRA 1NJGA 3SYLA 2V1CA 4NXMM 4X65M 4DV0M 2UXBM 4M9XA 1QZMA 2J7OA 3K2LA 4ZPXA 1N75A 1N34M 1KSFX 3AJIB 3GLGB 1IBKM 1UM8A 3K92A 3M7GA 4QHSA 1E32A 2QCUA 3AOGA 1HR0M 1XNRM 2Z7JA 1N78A 2UUAM 3THGA 2ERCA 3U5ZA 5EQTA 4JXJA 5ITXA 4LG2A 3HJ8A 1R6BX 4B3SM 2L09A 3LMMA 3Q8XA 4EIWA 1IXZA 5EP3A 2DZOB 1HNXM 2ZAOA 4GHLA 1R7RA 3GO8A 4FWHA 2M5ZA 1R2YA 2E5LM 4IJFA 4A3VB 2A5YB 2Z3XA 1XXHB 3AOEC 3KVWA 3L28A 4IBKA 1HNZM 4L8RC 3KSJA 1DGFA 5EXPA 3GP1A 2X49A 3FYCA 5IREB 4R7GA 3HU1A 1HQYE 1TH4A 3I51A 7CATA 3KW6A 5KPRA 4DV1M 3QWLA 2QP9X 4MGKE 1YUBA 4LJ8A 4B3MM 1Z5BA 4G4QA 4DR7M 1IXSB 1Z59A 4NL4H 3KP0E 3WHKA 3FTDA 2XZUA 4LY6A 3GQ4A 3GPXA 3U60A 2R62A 4B7HA 4QOZC 5ITYA 3QAUA 4PDGA 3U5ZB 4XGIA 1I4WA 1OJLA 2C9OA 1Z5CA 4OX9M 2FOIC 2KEBA 2JA2A 3T15A 2XLJA 4D82A 1IXRC 2YQZA 4MGZE 3AL0C 2KZSA 4MGIE 5A2QS 4G6ZA 3LVVA 4LFBM 2XFTA 5IT9S 3JR4A 3FYDA 3CF2A 3NBIA 3T38A 1IM2A 3PFIA 4DR5M 1C1KA 4NXNM 3GLIA 1ZAEA 2L6OA 1SXJE 5EJCA 3LQRA 2CHGA 2FE8A 3ZCBB 2QPAA 5ITRA 3RGSA 5JI3E 3RFWA 4IBJA 3CF0A 2DZNB 2YR0A 3KOWE 5FTKA 1J5EM 4QOSA 3SHGB 4OVZB 4AW4A 3GPUA 4AG5A 4MGHA 1PJIA 2D7HA 2UXDM 2D7EA 1GL6A 1HQCA 2OPFA 4B3RM 3CF6E 3ILKA 3RGPA 4LFCM 1Z6TA 3TWLA 1G8PA 4OU7A 4REZA 1TDZA 5FTLA 2Y0QA 1NVMA 4M9ZA 5ITXE 3VKHA 4LFAM 3M0EA 1SXJA 3J27B 3GLIB 3SAVA 3B9PA 4WURA 4AZFA 2AHMA 3UMMA 2X8AA 2KZUA 4DUZM 4CHTB 1G4AE 2CFOA 4JYAM 2Z4RA 4GITA 4Z6YA 5FSWA 1YSYA 3KOZE 2HKJA 3SARA 2LXEA 4DUYM 3R9XB 2VQEM 4DR3M 1OFHA 5DNYA 4LF5M 1E9RA 4PT5A 3T1HM 1KFVA 3KOYE 4AQYM 5EP1A 3VFDA 1IN5A 4DV3M 1L1TA 3SAWA 2HCBA 4M9SA 3L2AA 4GKJM 2CV2A 1NNUC 4QHTA 4IJEA 3A98B 1IN6A 3U6DA 1N36M 3TWKA 4YHHM 3MK6A 4LZJA 4IBFA 8CATA 3U61A 1ORYB 3VDPA 3TWMA 4G4RA 1SXJB 1XNQM 1JQJC 2ZAMA 1NSFA 3L27A 1N33M 4FWGA 3KS8A 1N32M 1JR3A 4KO8A 2C98A 2QBYB 3GPPA 4X62M 2M60A 5EXTA 2LWXA 2HL7A 3LVWA 2KRUA 2UUCM 3GQ3A 4RF0A 3U6PA 4XBOA 3J81S 2F5SA 1N77A 4KLNA 3SBJA 5ITUA 4CGYB 1QAOA 5KPTA 3W0LB 1GKIA 3FUUA 3KFUG 1SXJC 4LGMA 3FUTA 4LCBA 4NSOB 3VLFB 3GLFA 4G4OA 1G59A 2XF3A 2XSZD 2J7NA 3VK8A 1DGGA 2D7GA 4L16A 3PVSA 4AI6A 1J7KA 1X37A 1DGHA 5FLXS 2V1UA 3KDSE 3SC3A 4Z8XA 1XWIA 4L78A 1D2NA 3SHFA 1DO2A 4B7GA 1T3TA 3FKEA 4LF8M 2YNMD 1XMQM 4LJ4A 1Q3CA 2F5OA 3W0FA 1QAQA 4IIWA 2BJWA 4I5SA 4IBGA 4GMQA 3SATA 1W5TA 3HHZA 1PJJA 2FFJA 4JI8M 1W5SA 5EP2A 4DV5M 3VDUA 2R45A 1LV7A 1TH3A 5EXSA 4JI6M 3GLHA 4DR2M 3SFZA 4GH9A 3KP1E 2YFQA 3GLFB 2DWNA 4NRWA 2XEPA 1K82A 3FTCA 4AKIA 3U60B 3WHLA 2VQFM 2XZFA 4DV7M 3FUWA 3I4YA 1DGHB 3EIHA 2R46A 3U6MA 1IBLM 4DV6M 2V6ZM 3T1YM 1K3XA 3A42A 4B7FA 4LJ9A 3KS4A 2R65A 3JR5A 3SMPA 4JI4M 1IY1A 2H1RA 2EO2A 3U6LA 3C58A 4LJ7A 1K3WA 2Y0TA 4QNMA 5DYGA 5E6JA 5KQ8A 1QANA 1IN8A 3IG5A 4LJ5A 4LJAA 2DHRA 2X4AA 4GHAA 5LMUM 3J2PB 1H6UA 2ZBKB 3ZH9B 5ITQA 2R18A 1Z5AA 4LRSA 3U6EA 1DGBA 4LF4M 1E9SA 1L8QA 3U6SA 3GLHB 2KW0A 1OFIA 3HKPA 4LRTA 3JAMS 3GLGA 2OQ4A 4DR1M 1VDDA 1Q39A 2KRKA 1HT1E 2F4VM 5JI2E 2ZM6M 1MX0A 4D80A 4JI1M 3KOXE 3DOAA 2C5RA 1NY6A 4JI3M 4NOOB 3R8FA 4FW9A 5E26A 4GKKM 3TL4X 3J80S 4BBAA 2CV1A 3HGIA 4TUWA 3HHXA 4GC5A 1IY0A 3J7AS 4HL4A 3UGJA 4W5WA 4PDIA 5ITTA 1XXHA 3SYKA 4M0DA 4NSRA 2ZANA 3M6AA 3PNYA 3K8ZA 4II7A 4K0KM 1IQPA 3FTEA 2XH9A 1QYRA 3UJNA 4FCTA 4LF9M 1IN7A 2F5QA 1YE9A 1HNWM 4BLCA 3HU3A 3GRVA 2QZ4A 4DV4M 3U6OA 4LJ6A 2Y20A 1R2ZA 1I94M 3SASA 3FTFA 5EP4A 3VKGA 2I7PA 4GIPA 4X64M 5BPVA 4I8OA 2EUCA 3KSXA 2FNAA 1SXJD 3E4RA 2UU9M 1IY2A 3LQQA 4AKHA 1NY5A 4IBBA 5LMNM 3GRYA 3K1JA 2R4JA 4ITQA 3D8LA 1L2BA 3J7BA 4BB9A 4RF1A 3DZDA 3PNVA 2C96A 4I4LA 5KQDA 4FWDA 3RE8A 1DO0A 3EIEA 3L29A 4MH0E 4FD2A 4WW0A 1XMOM 2G8LA 5IZ7D 4G4NA 4GRIA 2DXIA 3L25A 1IN4A 2W82A 4GC9A 4OW0A 2DVWB 4PD2A 4YY3M 3U61B 3L26A 4M0WA 3GQ5A 3NWLA 2VIIA 3AFHA 1PM5A 1ZQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 M;  1XNR M;  2UUA M;  3SAU A;  5ITX A;  4DUZ M;  3U6M A;  1IBL M;  4JYA M;  4DV6 M;  3T1Y M;  4NRV A;  4B3S M;  1K3X A;  3A42 A;  4DR4 M;  2HKJ A;  1L2C A;  3SAR A;  4DUY M;  4JI2 M;  1HNX M;  2VQE M;  3GO8 A;  3JR5 A;  4DR3 M;  2UUB M;  4LF5 M;  4JI4 M;  3T1H M;  1KFV A;  4AQY M;  3U6L A;  3VK7 A;  1R2Y A;  3C58 A;  2E5L M;  4DV3 M;  1K3W A;  1L1Z A;  1L1T A;  4JV5 M;  3SAW A;  3OTO M;  1EE8 A;  4GKJ M;  1HNZ M;  5LMU M;  3GP1 A;  3GPY A;  2ZBK B;  3U6D A;  2UXC M;  5ITQ A;  1N36 M;  3TWK A;  1Z5A A;  3U6E A;  4YHH M;  4LF4 M;  3U6S A;  3U6Q A;  4DV1 M;  4B3M M;  4JI5 M;  1TDH A;  1Z5B A;  4G4Q A;  3JAM S;  4DR7 M;  1Z59 A;  2OQ4 A;  3TWM A;  4G4R A;  4DR1 M;  2XZU A;  1Q39 A;  2F4V M;  4X66 M;  1XNQ M;  3GQ4 A;  3GPX A;  2ZM6 M;  4PCZ A;  4KHP M;  1MX0 A;  1N33 M;  4JI1 M;  5ITY A;  1NNJ A;  1N32 M;  4PDG A;  3GPP A;  3DOA A;  4X62 M;  1IBM M;  3A45 A;  4JI3 M;  5BR8 M;  1FJG M;  4GKK M;  3J80 S;  4JI0 M;  1Z5C A;  4CIS A;  4LF7 M;  4OX9 M;  2UUC M;  1MU5 A;  3GQ3 A;  3J7A S;  3U6P A;  3J81 S;  2F5S A;  4PDI A;  5ITT A;  5A2Q S;  3SBJ A;  5ITU A;  4LFB M;  4DR6 M;  5IT9 S;  3JR4 A;  4K0K M;  3A46 A;  2HHH M;  4G4O A;  4LF9 M;  4B3T M;  4DR5 M;  2EA0 A;  2F5Q A;  4NXN M;  1L2D A;  1HNW M;  4DV4 M;  3VK8 A;  3U6O A;  2F5N A;  3SAS A;  1I94 M;  1R2Z A;  1XC8 A;  5FLX S;  4JI7 M;  5IWA M;  4X64 M;  5ITR A;  4LF8 M;  4MB7 A;  1XMQ M;  2UU9 M;  1J5E M;  4DV2 M;  4LF6 M;  1Q3C A;  5LMN M;  2F5O A;  3W0F A;  1Q3B A;  3GPU A;  4ITQ A;  2F5P A;  1L2B A;  3U6C A;  1PJI A;  2UXD M;  3SAT A;  2OPF A;  1PJJ A;  2Q2E B;  4B3R M;  4JI8 M;  4LFC M;  4DV5 M;  4X65 M;  4DV0 M;  4NXM M;  2UXB M;  1XMO M;  3TWL A;  4G4N A;  4JI6 M;  4DR2 M;  4YY3 M;  1TDZ A;  1PM5 A;  1N34 M;  4PD2 A;  1IBK M;  5ITX E;  4NRW A;  4LFA M;  3GQ5 A;  1K82 A;  1HR0 M;  3SAV A;  2XZF A;  2VQF M; 
#chains in the Genus database with same CATH topology
 4IBE A;  3GRU A;  3HU2 A;  1S3S A;  3SAU A;  2DWZ B;  4FVM A;  2KNA A;  2C99 A;  2J5Y A;  4F2L A;  1OAI A;  4AKG A;  4NRV A;  3B89 A;  2DWL A;  3HHW A;  2CV0 A;  3HJQ A;  4LGY A;  4DR4 M;  1L2C A;  2KXE A;  3IEC A;  4JI2 M;  5F3W A;  2UUB M;  2WSC F;  2JUJ A;  5EXX A;  1QQW A;  1GVN A;  2K0B X;  2RKO A;  4LZZ A;  4OVZ A;  2LH0 A;  3VK7 A;  3DFZ A;  1JR3 D;  3MHV C;  3UZU A;  1L1Z A;  1NO1 A;  4JV5 M;  3OTO M;  1EE8 A;  1GL7 A;  3C9P A;  2RGH A;  3H4J A;  3H4M A;  4L15 A;  4L6V 6;  4L4U A;  2CE7 A;  5H37 D;  2Y21 A;  3FD9 A;  5KPZ A;  3GPY A;  3GLG E;  3KXE C;  1OIP A;  2UXC M;  4HLQ A;  1WXQ A;  1BVS A;  2DZL A;  5FTN A;  3U6Q A;  2G5G X;  2L7I A;  4IBD A;  4JI5 M;  2K47 A;  1OQY A;  1TDH A;  3GRR A;  3UK6 A;  2RGO A;  2LVO C;  2O5R A;  4FCV A;  5C18 A;  2CUZ A;  2QEN A;  2Z4S A;  3GLI E;  3D8B A;  3SMS A;  3TQS A;  4X66 M;  4CJ6 A;  4PCZ A;  4KHP M;  1NJF A;  1D0L A;  2VF7 A;  3HHY A;  1NNJ A;  3AKZ A;  5DYI A;  2L4E A;  4S12 A;  1IBM M;  3A45 A;  2BWB A;  1TH2 A;  3HWS A;  3TPZ A;  4IBI A;  5BR8 M;  1FJG M;  4MM3 B;  1XXH E;  2RRU A;  2XGN A;  2MRO B;  4JI0 M;  1G3I A;  4CIS A;  4LF7 M;  1HT2 E;  2CHV A;  2QNJ A;  3I4V A;  3AV0 A;  2GNO A;  2KA6 B;  1MU5 A;  2CEA A;  4R3D A;  2LVN C;  3FUX A;  4D81 A;  2R4E A;  2NQ8 C;  1G41 A;  3ZC7 B;  1XHB A;  2P5T A;  4DR6 M;  2BNK A;  3FE3 A;  4P17 A;  4WP2 A;  1GLN A;  2O01 F;  4B08 A;  3A46 A;  3AOE A;  4JN6 A;  2HHH M;  2BJV A;  2L7H A;  1NHW C;  4B3T M;  4FCW A;  2EA0 A;  1L2D A;  1EFU B;  1NHG C;  3PXG A;  2F5N A;  3Q8G A;  4IBC A;  3FUV A;  4I81 A;  1OKS A;  2XFS A;  1XC8 A;  3HJS A;  4QNR A;  4JI7 M;  1VEG A;  5IWA M;  1J09 A;  2I7N A;  5KO3 A;  2CHQ A;  1E94 E;  2KNZ A;  5C1B A;  3DA1 A;  4MB7 A;  3F92 A;  1FNN A;  2C9C A;  3IG8 A;  4DV2 M;  3I04 M;  4P16 A;  4LF6 M;  4MGY E;  5FTJ A;  1Q3B A;  2QBY A;  1PJT A;  2LNH C;  1GJT A;  2DWM A;  2F5P A;  4AG6 A;  1VEK A;  2K9D A;  3BOS A;  1TGU A;  3U6C A;  4KOD A;  3CTW B;  5FTM A;  3MJ5 A;  1QAM A;  1T6O A;  2Q2E B;  1KYI A;  2XSZ A;  3E9S A;  3HX3 A;  1PRB A;  4NC6 A;  1QVR A;  4RNA A;  1NJG A;  5GKN A;  3SYL A;  2V1C A;  4NXM M;  1P3Q Q;  4X65 M;  4DV0 M;  2UXB M;  4M9X A;  1GJS A;  1QZM A;  2J7O A;  3K2L A;  4ZPX A;  4B3M M;  3CGW A;  1N75 A;  1N34 M;  2L2D A;  1KSF X;  3AJI B;  3GLG B;  1IBK M;  1UM8 A;  3K92 A;  3M7G A;  4QHS A;  1E32 A;  2QCU A;  3AOG A;  3I01 M;  2MR9 A;  2QHO B;  1HR0 M;  4RKU F;  1XNR M;  2Z7J A;  1N78 A;  2UUA M;  3THG A;  2ERC A;  3TE6 A;  3U5Z A;  5EQT A;  4JXJ A;  5ITX A;  4DV1 M;  4LG2 A;  3HJ8 A;  1R6B X;  4B3S M;  2L09 A;  3LMM A;  1V92 A;  3Q8X A;  2JZ0 A;  4EIW A;  1IXZ A;  5EP3 A;  4KT0 F;  2DZO B;  1HNX M;  2ZAO A;  3W68 A;  1R7R A;  3GO8 A;  4GHL A;  4FWH A;  2M5Z A;  1R2Y A;  2E5L M;  4IJF A;  4A3V B;  2A5Y B;  2Z3X A;  1XXH B;  3AOE C;  3KVW A;  3K9O A;  1VQ1 A;  3L28 A;  4IBK A;  2JWS A;  2BWE A;  1HNZ M;  4L8R C;  3C3E A;  1DGF A;  1WGL A;  3KSJ A;  4UN2 B;  5EXP A;  3GP1 A;  2X49 A;  3FYC A;  1F4I A;  5IRE B;  2QSF X;  4R7G A;  3HU1 A;  1HQY E;  1OTR A;  1TH4 A;  2APL A;  3I51 A;  3KW6 A;  7CAT A;  1JB0 F;  3QWL A;  1WIV A;  2QP9 X;  1YUB A;  4LJ8 A;  4MGK E;  5KPR A;  1Z5B A;  4G4Q A;  4G3O A;  1SG9 A;  4DR7 M;  1IXS B;  1Z59 A;  2R6F A;  4NL4 H;  3KP0 E;  2OOB A;  2JY8 A;  3WHK A;  3FTD A;  2XZU A;  1PJQ A;  3C3D A;  2HWJ A;  4LY6 A;  1D0M A;  3GPX A;  3GQ4 A;  3U60 A;  2R62 A;  4B7H A;  4QOZ C;  1T43 A;  5ITY A;  3QAU A;  4PDG A;  3U5Z B;  4XGI A;  1I4W A;  1WR1 B;  3ZQJ A;  3NBX X;  1OJL A;  2C9O A;  3V76 A;  1Z5C A;  4OX9 M;  2FOI C;  2KEB A;  2JA2 A;  3T15 A;  2XLJ A;  4D82 A;  1IXR C;  2YQZ A;  4MGZ E;  1TTE A;  3AL0 C;  2KZS A;  4MGI E;  2H5X A;  5A2Q S;  4G6Z A;  3LVV A;  4LFB M;  2XFT A;  5IT9 S;  3JR4 A;  3FYD A;  2LBC A;  3CF2 A;  3NBI A;  3T38 A;  1IM2 A;  1CUK A;  1ZMU A;  4CIZ A;  3PFI A;  4DR5 M;  1C1K A;  4NXN M;  3GLI A;  1ZAE A;  2L6O A;  1SXJ E;  2KDL A;  5EJC A;  2DAI A;  3T6P A;  3LQR A;  1Q02 A;  2CHG A;  2N35 A;  2FE8 A;  3B7Z A;  3LW5 F;  2OOA A;  3ZCB B;  2LVP C;  2QPA A;  5ITR A;  3RGS A;  5JI3 E;  3RFW A;  4IBJ A;  1DV0 A;  3CF0 A;  2DZN B;  2VDB B;  2YR0 A;  3KOW E;  5FTK A;  2KHH A;  1J5E M;  3BXW A;  2O25 A;  4QOS A;  3SHG B;  3LCU A;  4OVZ B;  4AW4 A;  3GPU A;  4AG5 A;  3MMP A;  1C7Y A;  1GAB A;  1MN3 A;  4MGH A;  3B7N A;  1PJI A;  2D7H A;  2UXD M;  2D7E A;  1GL6 A;  1HQC A;  2K6B A;  2OPF A;  4B3R M;  1R4G A;  3CF6 E;  3ILK A;  3RGP A;  4LFC M;  2WZJ A;  1Z6T A;  3TWL A;  1G8P A;  4OU7 A;  4REZ A;  2DHY A;  1TDZ A;  5FTL A;  2Y0Q A;  1NVM A;  4M9Z A;  5ITX E;  3VKH A;  2EKK A;  1VG5 A;  3M0E A;  4LFA M;  2LVA A;  1SXJ A;  3J27 B;  3GLI B;  3SAV A;  1GO5 A;  3B9P A;  4WUR A;  3E46 A;  4AZF A;  2AHM A;  2DI0 A;  3UMM A;  2X8A A;  2KZU A;  4DUZ M;  4CHT B;  1JR3 E;  1G4A E;  2CFO A;  4JYA M;  2Z4R A;  4GIT A;  4Z6Y A;  5FSW A;  1YSY A;  3KOZ E;  2HKJ A;  3SAR A;  2FH0 A;  2LXE A;  4DUY M;  1WGN A;  3R9X B;  2VQE M;  4DR3 M;  1OFH A;  5DNY A;  4LF5 M;  1E9R A;  1VDL A;  4PT5 A;  3T1H M;  1KFV A;  1QZE A;  3KOY E;  4AQY M;  5EP1 A;  3VFD A;  1IN5 A;  4DV3 M;  3LCV B;  1L1T A;  3SAW A;  2HCB A;  4M9S A;  3L2A A;  4GKJ M;  3QYB A;  2CV2 A;  1NNU C;  4QHT A;  4IJE A;  3A98 B;  1IN6 A;  3U6D A;  1QDR A;  1N36 M;  3GLF E;  3TWK A;  4YHH M;  4DBG B;  3MK6 A;  4LZJ A;  4IBF A;  8CAT A;  1V34 A;  3U61 A;  1ORY B;  2MH8 A;  3VDP A;  3TWM A;  1EIJ A;  2GQF A;  1RU3 A;  3BBZ A;  4G4R A;  1SXJ B;  1XB2 B;  1AUA A;  4HEO A;  2JXN A;  1AIP C;  1JQJ C;  1Y8G A;  2HAK A;  1NSF A;  2ZAM A;  1XNQ M;  3L27 A;  1N33 M;  3QYE A;  4FWG A;  3KS8 A;  1N32 M;  1PGY A;  1JR3 A;  4KO8 A;  2C98 A;  3E21 A;  2QBY B;  3GPP A;  4X62 M;  2JNH A;  2M60 A;  5EXT A;  2LWX A;  2HL7 A;  1MJG M;  3LVW A;  2KRU A;  1D0K A;  1ZV1 A;  2DNA A;  2UUC M;  3GQ3 A;  4RF0 A;  3U6P A;  4GEW A;  4XBO A;  3J81 S;  1N77 A;  2F5S A;  4KLN A;  2DEN A;  3SBJ A;  5ITU A;  4CGY B;  1QAO A;  5KPT A;  3GLH E;  1GKI A;  3FUU A;  3W0L B;  3KFU G;  1SXJ C;  4LGM A;  3FUT A;  2L4F A;  4LCB A;  4NSO B;  3VLF B;  3GLF A;  4G4O A;  1G59 A;  2XF3 A;  2MGW A;  2XSZ D;  3FRI A;  3IHP A;  2J7N A;  3VK8 A;  1DGG A;  2D7G A;  4L16 A;  3PVS A;  4AI6 A;  1J7K A;  1X37 A;  1DGH A;  2FS1 A;  5FLX S;  3KDS E;  2V1U A;  3SC3 A;  4Y28 F;  4Z8X A;  1XWI A;  4L78 A;  1D2N A;  1ZMW A;  3SHF A;  1DO2 A;  1ZMV A;  4B7G A;  1T3T A;  3FKE A;  4LF8 M;  2YNM D;  1XMQ M;  1IFY A;  1V33 A;  1PJS A;  4LJ4 A;  1Q3C A;  2F5O A;  3W0F A;  1QAQ A;  4IIW A;  2BJW A;  4I5S A;  4IBG A;  4GMQ A;  3SAT A;  1W5T A;  3HHZ A;  2QQ8 A;  1A5T A;  1PJJ A;  2FFJ A;  3W67 A;  4JI8 M;  1W5S A;  5EP2 A;  2EJS A;  4DV5 M;  3VDU A;  2R45 A;  1LV7 A;  1TH3 A;  5EXS A;  4JI6 M;  3GLH A;  2Z8Y M;  2LHG A;  4DR2 M;  3SFZ A;  1TF0 B;  4GH9 A;  1UFZ A;  2YFQ A;  3KP1 E;  2MJ5 B;  3GLF B;  2DWN A;  4NRW A;  4ANR A;  2XEP A;  1K82 A;  3FTC A;  2DAG A;  4AKI A;  2VF8 A;  3U60 B;  3WHL A;  2VQF M;  3B74 A;  2XZF A;  2JY5 A;  4DV7 M;  1YLA A;  3FUW A;  3I4Y A;  1DGH B;  3EIH A;  2R46 A;  3U6M A;  2JP7 A;  1IBL M;  4DV6 M;  2V6Z M;  3T1Y M;  1K3X A;  1VEJ A;  3A42 A;  4B7F A;  4LJ9 A;  3KS4 A;  3K9P A;  3FRH A;  2R65 A;  3JR5 A;  3SMP A;  4JI4 M;  1IY1 A;  2H1R A;  2EO2 A;  3HY5 A;  3U6L A;  1QUS A;  3C58 A;  2LHC A;  4LJ7 A;  1K3W A;  2Y0T A;  4QNM A;  5DYG A;  5E6J A;  1R5L A;  5KQ8 A;  1QAN A;  1IN8 A;  2LTU A;  3IG5 A;  1NV8 A;  4LJ5 A;  1HJP A;  4LJA A;  2DHR A;  2X4A A;  4GHA A;  5LMU M;  3J2P B;  1H6U A;  2DKL A;  2ZBK B;  2WSF F;  3ZH9 B;  5ITQ A;  2R18 A;  1Z5A A;  4LRS A;  3U6E A;  1G71 A;  1DGB A;  4LF4 M;  1E9S A;  2R0I A;  1L8Q A;  3U6S A;  3GLH B;  2KW0 A;  1OFI A;  2R44 A;  3HKP A;  4LRT A;  3JAM S;  3GLG A;  2DAK A;  2B3T A;  1QUT A;  2OQ4 A;  4DR1 M;  1VDD A;  1Q39 A;  2KRK A;  1HT1 E;  2F4V M;  2CRU A;  4Q7J A;  5JI2 E;  2WSE F;  2ZM6 M;  1MX0 A;  4D80 A;  4JI1 M;  1LTM A;  2JY6 B;  3KOX E;  3DOA A;  4F1I A;  1NY6 A;  2C5R A;  4JI3 M;  1WJ7 A;  4NOO B;  3R8F A;  4FW9 A;  1OIZ A;  2DAE A;  5E26 A;  4GKK M;  3TL4 X;  3J80 S;  4BBA A;  2CV1 A;  3HGI A;  4TUW A;  3HHX A;  2EKF A;  4GC5 A;  1IY0 A;  5L8R F;  3J7A S;  4HL4 A;  4XK8 F;  3UGJ A;  4W5W A;  2CWB A;  4PDI A;  5ITT A;  1XXH A;  3SYK A;  2G3Q A;  4M0D A;  4NSR A;  2ZAN A;  2JZ1 A;  3HZJ A;  3M6A A;  3PNY A;  3K8Z A;  4II7 A;  4K0K M;  2LVQ D;  1IQP A;  3FTE A;  2XH9 A;  1QYR A;  3UJN A;  4FCT A;  4LF9 M;  1IN7 A;  1WHC A;  1YE9 A;  2F5Q A;  1HNW M;  4BLC A;  3HU3 A;  5DFL A;  3GRV A;  2QZ4 A;  4DV4 M;  3U6O A;  4LJ6 A;  2Y20 A;  2ZTC A;  1R2Z A;  1I94 M;  3SAS A;  5EP4 A;  3FTF A;  3VKG A;  1OAO C;  2I7P A;  2CP8 A;  4GIP A;  1IXS A;  4X64 M;  5BPV A;  2OO9 A;  2KNV A;  4I8O A;  2EUC A;  3KSX A;  2FNA A;  1SXJ D;  3E4R A;  2UU9 M;  1IY2 A;  3B7Q A;  3LQQ A;  4AKH A;  1NY5 A;  1TR8 A;  4IBB A;  3GRY A;  5LMN M;  3K1J A;  2R4J A;  4ITQ A;  3D8L A;  1L2B A;  3J7B A;  4BB9 A;  4RF1 A;  3DZD A;  3PNV A;  1QDT A;  2C96 A;  4I4L A;  5KQD A;  4FWD A;  3RE8 A;  1DO0 A;  3EIE A;  3L29 A;  1NV9 A;  4MH0 E;  4FD2 A;  4WW0 A;  2ZTD A;  1XMO M;  2G8L A;  5IZ7 D;  4G4N A;  2DAM A;  4GRI A;  2DXI A;  3L25 A;  1IN4 A;  2W82 A;  4GC9 A;  4OW0 A;  2DVW B;  4PD2 A;  4YY3 M;  3U61 B;  3L26 A;  2JY7 A;  4M0W A;  3GQ5 A;  3NWL A;  2VII A;  3AFH A;  1PM5 A;  4R71 A;  1ZQ9 A; 
#chains in the Genus database with same CATH homology
 4IBE A;  3GRU A;  3HU2 A;  1S3S A;  3SAU A;  2DWZ B;  4FVM A;  2C99 A;  4AKG A;  4NRV A;  2DWL A;  3HHW A;  2CV0 A;  3HJQ A;  4LGY A;  4DR4 M;  1L2C A;  2KXE A;  4JI2 M;  5F3W A;  2UUB M;  5EXX A;  1QQW A;  1GVN A;  2RKO A;  4LZZ A;  4OVZ A;  2LH0 A;  3VK7 A;  3DFZ A;  1JR3 D;  3MHV C;  3UZU A;  1L1Z A;  4JV5 M;  3OTO M;  1EE8 A;  1GL7 A;  2RGH A;  3H4M A;  4L15 A;  4L4U A;  2CE7 A;  5H37 D;  2Y21 A;  3FD9 A;  5KPZ A;  3GPY A;  3KXE C;  2UXC M;  4HLQ A;  1WXQ A;  5FTN A;  3U6Q A;  2G5G X;  2L7I A;  4IBD A;  4JI5 M;  2K47 A;  3UK6 A;  1TDH A;  3GRR A;  2RGO A;  2O5R A;  4FCV A;  5C18 A;  2CUZ A;  2QEN A;  2Z4S A;  3D8B A;  3SMS A;  3TQS A;  4X66 M;  4PCZ A;  4KHP M;  1NJF A;  3HHY A;  1NNJ A;  3AKZ A;  5DYI A;  4S12 A;  1IBM M;  3A45 A;  1TH2 A;  3HWS A;  3TPZ A;  4IBI A;  5BR8 M;  1FJG M;  4MM3 B;  2XGN A;  4JI0 M;  1G3I A;  4CIS A;  4LF7 M;  3I4V A;  1HT2 E;  2CHV A;  3AV0 A;  2KA6 B;  1MU5 A;  2CEA A;  4R3D A;  3FUX A;  4D81 A;  2R4E A;  2NQ8 C;  1G41 A;  3ZC7 B;  1XHB A;  2P5T A;  4DR6 M;  2BNK A;  1GLN A;  4B08 A;  3A46 A;  3AOE A;  4JN6 A;  2HHH M;  2BJV A;  2L7H A;  1NHW C;  4B3T M;  4FCW A;  2EA0 A;  1L2D A;  1NHG C;  3PXG A;  2F5N A;  4IBC A;  3FUV A;  4I81 A;  1XC8 A;  2XFS A;  3HJS A;  4QNR A;  4JI7 M;  5IWA M;  1J09 A;  2I7N A;  5KO3 A;  2CHQ A;  1E94 E;  5C1B A;  3DA1 A;  4MB7 A;  1FNN A;  2C9C A;  3IG8 A;  4DV2 M;  4P16 A;  4LF6 M;  4MGY E;  5FTJ A;  1Q3B A;  2QBY A;  2LNH C;  2DWM A;  2F5P A;  4AG6 A;  3BOS A;  1TGU A;  3U6C A;  4KOD A;  3CTW B;  5FTM A;  3MJ5 A;  1QAM A;  2Q2E B;  1KYI A;  2XSZ A;  3E9S A;  5GKN A;  3TE6 A;  4RNA A;  1QVR A;  1NJG A;  3SYL A;  2V1C A;  4NXM M;  4X65 M;  4DV0 M;  2UXB M;  4M9X A;  1QZM A;  2J7O A;  3K2L A;  4ZPX A;  1N75 A;  1N34 M;  1KSF X;  3AJI B;  3GLG B;  1IBK M;  1UM8 A;  3K92 A;  3M7G A;  4QHS A;  1E32 A;  2QCU A;  3AOG A;  1HR0 M;  1XNR M;  2Z7J A;  1N78 A;  2UUA M;  3THG A;  2ERC A;  3U5Z A;  5EQT A;  4JXJ A;  5ITX A;  4LG2 A;  3HJ8 A;  1R6B X;  4B3S M;  2L09 A;  3LMM A;  3Q8X A;  4EIW A;  1IXZ A;  5EP3 A;  2DZO B;  1HNX M;  2ZAO A;  4GHL A;  1R7R A;  3GO8 A;  4FWH A;  2M5Z A;  1R2Y A;  2E5L M;  4IJF A;  4A3V B;  2A5Y B;  2Z3X A;  1XXH B;  3AOE C;  3KVW A;  3L28 A;  4IBK A;  1HNZ M;  4L8R C;  3KSJ A;  1DGF A;  5EXP A;  3GP1 A;  2X49 A;  3FYC A;  5IRE B;  4R7G A;  3HU1 A;  1HQY E;  1TH4 A;  3I51 A;  7CAT A;  3KW6 A;  5KPR A;  4DV1 M;  3QWL A;  2QP9 X;  4MGK E;  1YUB A;  4LJ8 A;  4B3M M;  1Z5B A;  4G4Q A;  4DR7 M;  1IXS B;  1Z59 A;  4NL4 H;  3KP0 E;  3WHK A;  3FTD A;  2XZU A;  4LY6 A;  3GQ4 A;  3GPX A;  3U60 A;  2R62 A;  4B7H A;  4QOZ C;  5ITY A;  3QAU A;  4PDG A;  3U5Z B;  4XGI A;  1I4W A;  1OJL A;  2C9O A;  1Z5C A;  4OX9 M;  2FOI C;  2KEB A;  2JA2 A;  3T15 A;  2XLJ A;  4D82 A;  1IXR C;  2YQZ A;  4MGZ E;  3AL0 C;  2KZS A;  4MGI E;  5A2Q S;  4G6Z A;  3LVV A;  4LFB M;  2XFT A;  5IT9 S;  3JR4 A;  3FYD A;  3CF2 A;  3NBI A;  3T38 A;  1IM2 A;  3PFI A;  4DR5 M;  1C1K A;  4NXN M;  3GLI A;  1ZAE A;  2L6O A;  1SXJ E;  5EJC A;  3LQR A;  2CHG A;  2FE8 A;  3ZCB B;  2QPA A;  5ITR A;  3RGS A;  5JI3 E;  3RFW A;  4IBJ A;  3CF0 A;  2DZN B;  2YR0 A;  3KOW E;  5FTK A;  1J5E M;  4QOS A;  3SHG B;  4OVZ B;  4AW4 A;  3GPU A;  4AG5 A;  4MGH A;  1PJI A;  2D7H A;  2UXD M;  2D7E A;  1GL6 A;  1HQC A;  2OPF A;  4B3R M;  3CF6 E;  3ILK A;  3RGP A;  4LFC M;  1Z6T A;  3TWL A;  1G8P A;  4OU7 A;  4REZ A;  1TDZ A;  5FTL A;  2Y0Q A;  1NVM A;  4M9Z A;  5ITX E;  3VKH A;  4LFA M;  3M0E A;  1SXJ A;  3J27 B;  3GLI B;  3SAV A;  3B9P A;  4WUR A;  4AZF A;  2AHM A;  3UMM A;  2X8A A;  2KZU A;  4DUZ M;  4CHT B;  1G4A E;  2CFO A;  4JYA M;  2Z4R A;  4GIT A;  4Z6Y A;  5FSW A;  1YSY A;  3KOZ E;  2HKJ A;  3SAR A;  2LXE A;  4DUY M;  3R9X B;  2VQE M;  4DR3 M;  1OFH A;  5DNY A;  4LF5 M;  1E9R A;  4PT5 A;  3T1H M;  1KFV A;  3KOY E;  4AQY M;  5EP1 A;  3VFD A;  1IN5 A;  4DV3 M;  1L1T A;  3SAW A;  2HCB A;  4M9S A;  3L2A A;  4GKJ M;  2CV2 A;  1NNU C;  4QHT A;  4IJE A;  3A98 B;  1IN6 A;  3U6D A;  1N36 M;  3TWK A;  4YHH M;  3MK6 A;  4LZJ A;  4IBF A;  8CAT A;  3U61 A;  1ORY B;  3VDP A;  3TWM A;  4G4R A;  1SXJ B;  1XNQ M;  1JQJ C;  2ZAM A;  1NSF A;  3L27 A;  1N33 M;  4FWG A;  3KS8 A;  1N32 M;  1JR3 A;  4KO8 A;  2C98 A;  2QBY B;  3GPP A;  4X62 M;  2M60 A;  5EXT A;  2LWX A;  2HL7 A;  3LVW A;  2KRU A;  2UUC M;  3GQ3 A;  4RF0 A;  3U6P A;  4XBO A;  3J81 S;  2F5S A;  1N77 A;  4KLN A;  3SBJ A;  5ITU A;  4CGY B;  1QAO A;  5KPT A;  3W0L B;  1GKI A;  3FUU A;  3KFU G;  1SXJ C;  4LGM A;  3FUT A;  4LCB A;  4NSO B;  3VLF B;  3GLF A;  4G4O A;  1G59 A;  2XF3 A;  2XSZ D;  2J7N A;  3VK8 A;  1DGG A;  2D7G A;  4L16 A;  3PVS A;  4AI6 A;  1J7K A;  1X37 A;  1DGH A;  5FLX S;  2V1U A;  3KDS E;  3SC3 A;  4Z8X A;  1XWI A;  4L78 A;  1D2N A;  3SHF A;  1DO2 A;  4B7G A;  1T3T A;  3FKE A;  4LF8 M;  2YNM D;  1XMQ M;  4LJ4 A;  1Q3C A;  2F5O A;  3W0F A;  1QAQ A;  4IIW A;  2BJW A;  4I5S A;  4IBG A;  4GMQ A;  3SAT A;  1W5T A;  3HHZ A;  1PJJ A;  2FFJ A;  4JI8 M;  1W5S A;  5EP2 A;  4DV5 M;  3VDU A;  2R45 A;  1LV7 A;  1TH3 A;  5EXS A;  4JI6 M;  3GLH A;  4DR2 M;  3SFZ A;  4GH9 A;  3KP1 E;  2YFQ A;  3GLF B;  2DWN A;  4NRW A;  2XEP A;  1K82 A;  3FTC A;  4AKI A;  3U60 B;  3WHL A;  2VQF M;  2XZF A;  4DV7 M;  3FUW A;  3I4Y A;  1DGH B;  3EIH A;  2R46 A;  3U6M A;  1IBL M;  4DV6 M;  2V6Z M;  3T1Y M;  1K3X A;  3A42 A;  4B7F A;  4LJ9 A;  3KS4 A;  2R65 A;  3JR5 A;  3SMP A;  4JI4 M;  1IY1 A;  2H1R A;  2EO2 A;  3U6L A;  3C58 A;  4LJ7 A;  1K3W A;  2Y0T A;  4QNM A;  5DYG A;  5E6J A;  5KQ8 A;  1QAN A;  1IN8 A;  3IG5 A;  4LJ5 A;  4LJA A;  2DHR A;  2X4A A;  4GHA A;  5LMU M;  3J2P B;  1H6U A;  2ZBK B;  3ZH9 B;  5ITQ A;  2R18 A;  1Z5A A;  4LRS A;  3U6E A;  1DGB A;  4LF4 M;  1E9S A;  1L8Q A;  3U6S A;  3GLH B;  2KW0 A;  1OFI A;  3HKP A;  4LRT A;  3JAM S;  3GLG A;  2OQ4 A;  4DR1 M;  1VDD A;  1Q39 A;  2KRK A;  1HT1 E;  2F4V M;  5JI2 E;  2ZM6 M;  1MX0 A;  4D80 A;  4JI1 M;  3KOX E;  3DOA A;  2C5R A;  1NY6 A;  4JI3 M;  4NOO B;  3R8F A;  4FW9 A;  5E26 A;  4GKK M;  3TL4 X;  3J80 S;  4BBA A;  2CV1 A;  3HGI A;  4TUW A;  3HHX A;  4GC5 A;  1IY0 A;  3J7A S;  4HL4 A;  3UGJ A;  4W5W A;  4PDI A;  5ITT A;  1XXH A;  3SYK A;  4M0D A;  4NSR A;  2ZAN A;  3M6A A;  3PNY A;  3K8Z A;  4II7 A;  4K0K M;  1IQP A;  3FTE A;  2XH9 A;  1QYR A;  3UJN A;  4FCT A;  4LF9 M;  1IN7 A;  2F5Q A;  1YE9 A;  1HNW M;  4BLC A;  3HU3 A;  3GRV A;  2QZ4 A;  4DV4 M;  3U6O A;  4LJ6 A;  2Y20 A;  1R2Z A;  1I94 M;  3SAS A;  3FTF A;  5EP4 A;  3VKG A;  2I7P A;  4GIP A;  4X64 M;  5BPV A;  4I8O A;  2EUC A;  3KSX A;  2FNA A;  1SXJ D;  3E4R A;  2UU9 M;  1IY2 A;  3LQQ A;  4AKH A;  1NY5 A;  4IBB A;  5LMN M;  3GRY A;  3K1J A;  2R4J A;  4ITQ A;  3D8L A;  1L2B A;  3J7B A;  4BB9 A;  4RF1 A;  3DZD A;  3PNV A;  2C96 A;  4I4L A;  5KQD A;  4FWD A;  3RE8 A;  1DO0 A;  3EIE A;  3L29 A;  4MH0 E;  4FD2 A;  4WW0 A;  1XMO M;  2G8L A;  5IZ7 D;  4G4N A;  4GRI A;  2DXI A;  3L25 A;  1IN4 A;  2W82 A;  4GC9 A;  4OW0 A;  2DVW B;  4PD2 A;  4YY3 M;  3U61 B;  3L26 A;  4M0W A;  3GQ5 A;  3NWL A;  2VII A;  3AFH A;  1PM5 A;  1ZQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...