4HEOA

Hendra virus phosphoprotein c terminal domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
MVADDASKDVVRTMIRTHIKDRELRSELMDYLNRAETDEEVQEVANTVNDIIDGNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Phosphoprotein
publication title Atomic Resolution Description of the Interaction between the Nucleoprotein and Phosphoprotein of Hendra Virus.
pubmed doi rcsb
source organism Hendra virus
total genus 19
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4heoA00
1AIPC 4DBGB 1IM2A 2KNZA 1ZMUA 2QNJA 1CUKA 2DHYA 2JNHA 2DENA 4UN2B 1XXHE 2O25A 3GLIE 2JY8A 2KHHA 3IHPA 2LVPC 1P3QQ 2HAKA 1EFUB 1PGYA 2CWBA 4F1IA 2QSFX 1WGLA 1WHCA 2LVOC 1IFYA 2BWBA 1WJ7A 4R71A 2JP7A 1MN3A 2MGWA 1UFZA 2WZJA 2LTUA 2OO9A 2MR9A 3MMPA 2MJ5B 5DFLA 1A5TA 1BVSA 2KNAA 1C7YA 1HT2E 2H5XA 1WR1B 1G3IA 1SG9A 1Q02A 2DI0A 1NV8A 2DNAA 1ZMVA 1VEKA 2K9DA 2L4EA 2JZ1A 4WP2A 2DZLA 1KYIA 2L2DA 3FRIA 4Q7JA 1OTRA 1G4AE 1OKSA 1OQYA 2G3QA 1ZMWA 3IECA 1WIVA 1GO5A 2LBCA 3GLGE 1VEJA 1TTEA 1G41A 1HQYE 3E46A 4HEOA 1QZEA 5JI2E 1Y8GA 1IXSA 1WGNA 2ZTDA 2BWEA 1R4GA 3F92A 3H4JA 3E21A 3LCVB 4G3OA 2DAIA 1E94E 2ZTCA 2DAKA 3B89A 1T43A 3FRHA 1VG5A 2LVNC 1HJPA 2RRUA 2KNVA 2EKKA 2L4FA 1VDLA 1ZV1A 1OAIA 1V92A 2LVAA 2DAMA 2EKFA 2DAGA 3BBZA 2R0IA 1JR3E 1F4IA 1VQ1A 1DO2A 4F2LA 2JZ0A 3K9OA 1TR8A 1VEGA 1NV9A 3FE3A 2JY7A 1T6OA 2DAEA 1XB2B 2MROB 3T6PA 2JY5A 2OOBA 2LVQD 2K0BX 2DKLA 4GEWA 1DV0A 2QHOB 2JUJA 1YLAA 3GLFE 2B3TA 3K9PA 2CP8A 3GLHE 2OOAA 1HT1E 2HWJA 2JY6B 3LCUA 1DO0A 2EJSA
chains in the Genus database with same CATH superfamily
1XMOM 3HJ8A 1D0MA 1AIPC 5EP4A 1PM5A 4LGYA 1DGFA 2CHQA 2KNZA 3AOEA 4X65M 2XGNA 4LF5M 1N32M 4UN2B 1XXHE 2X8AA 1IN5A 1Z59A 1DGBA 3PNVA 3IHPA 4G4NA 3SARA 4IJEA 3EIEA 3KSXA 4RF1A 3SC3A 3TWLA 4PDGA 3ZH9B 4GHAA 1MX0A 3AOEC 4F1IA 4I5SA 3H4MA 3AL0C 3C3DA 1QZMA 4KO8A 5ITXA 1X37A 3SMSA 2BWBA 1LTMA 4R71A 4LF7M 4P16A 2MGWA 3TWMA 1UFZA 1SXJA 1OAOC 1NJFA 2LTUA 2ZANA 1L2BA 2ERCA 1AUAA 4IBEA 2OO9A 4JV5M 2R65A 3LVVA 3FUTA 1K3WA 3SAUA 1NVMA 3GP1A 5DFLA 2DWLA 2RKOA 2XF3A 1C7YA 2OQ4A 2F5QA 2H5XA 3PFIA 1DGGA 1SXJC 2QENA 2BNKA 1GJTA 2M5ZA 4X66M 3PNYA 4LJ9A 3HHWA 4IBKA 2K9DA 2UUAM 2UUBM 4M9XA 4X64M 3VK7A 3J81S 2JZ1A 4OX9M 4Z6YA 1N34M 2DZLA 3AJIB 3FRIA 2L2DA 4Q7JA 4QHTA 1QDTA 3FUWA 1G4AE 1OKSA 2QBYA 4R3DA 3K8ZA 2ZAOA 3IECA 1TH2A 2FE8A 3I01M 1QDRA 4D82A 1GO5A 4KLNA 3DZDA 5BR8M 1XXHA 2ZM6M 4X62M 4FVMA 3U5ZB 1MJGM 3U6QA 2LHCA 3UZUA 4IBGA 5JI2E 4WURA 4LG2A 2BWEA 2C98A 2ZAMA 3F92A 4YHHM 3E21A 3U60A 2Y0TA 3J27B 3VKHA 2ZTCA 2DAKA 5FTLA 1HNXM 4D81A 4XGIA 2LHGA 2CV2A 2BJWA 2DVWB 2KEBA 4MGYE 3M7GA 3M6AA 1XHBA 4L8RC 1QAMA 2KNVA 3FUVA 5KPZA 2UUCM 1G8PA 1OAIA 1V92A 5KPRA 2EKFA 4G4QA 4GC9A 3BBZA 4DV3M 1N77A 3K2LA 5GKNA 1F4IA 3U6OA 1NNJA 1VEGA 3HHZA 3GLHB 3GQ5A 2L09A 3B9PA 2P5TA 2I7NA 3KOXE 1D2NA 1T6OA 1R7RA 3I51A 1DGHB 4LF9M 3GQ4A 2C5RA 4KODA 2Z3XA 2XZFA 4XBOA 3T6PA 5L8RF 1HQCA 1Z6TA 2OOBA 2Y20A 4RNAA 3NBXX 2DKLA 4M9SA 4AI6A 5ITUA 2C96A 3MHVC 4AG6A 3SATA 4CIZA 4AZFA 2CE7A 3FKEA 2JA2A 4B7GA 2WSFF 4NRVA 2B3TA 3OTOM 3KOYE 1I4WA 1ZQ9A 2CP8A 1IY1A 1W5TA 3GLHE 1N36M 2UXCM 4MGIE 4B7FA 3CF6E 4RF0A 4GMQA 3AKZA 2FFJA 4DBGB 3SASA 1QAQA 3PVSA 2QNJA 3C58A 4LZJA 2DHYA 2JNHA 2R45A 3KVWA 5ITQA 5DNYA 4LFBM 1Z5AA 4B3SM 1HR0M 4QOZC 3BOSA 3NBIA 2QQ8A 1XC8A 2QBYB 3GRRA 2KHHA 3A98B 2L7IA 5EP3A 1FJGM 3J80S 2HAKA 4LF4M 3FD9A 3KDSE 1PGYA 2CWBA 3L29A 4DR6M 1FNNA 1J09A 3U6CA 4QNRA 2LVOC 4RKUF 4CGYB 3U5ZA 3U6EA 2UXBM 4DV4M 2CFOA 2K6BA 3L27A 4OVZB 2VQFM 3U60B 4HLQA 3GO8A 1T3TA 3B7QA 4IBDA 1V34A 3KP0E 1QQWA 3T15A 4AKIA 3W68A 4ANRA 3HGIA 4OW0A 3WHLA 2MJ5B 3GPYA 2X49A 1A5TA 2G8LA 2R44A 3AFHA 3LMMA 4L16A 4WW0A 1HT2E 2FS1A 1IN8A 3UK6A 1H6UA 3IG8A 4NXNM 2CUZA 2K47A 3JR4A 2LH0A 2F5NA 1SG9A 3NWLA 5EXXA 1NV8A 2JXNA 2KZUA 2VIIA 3JR5A 3HHXA 4DR3M 1NO1A 1NSFA 1PJTA 1W5SA 2L4EA 3SMPA 4AW4A 4B3MM 4LCBA 4WP2A 1C1KA 3FTDA 4IBFA 2HCBA 5KQ8A 3GLHA 3E9SA 2JWSA 4LJ7A 1E32A 1R6BX 2F5SA 3DOAA 3TPZA 2XFSA 2QPAA 3MJ5A 3UJNA 1DGHA 1ZMWA 3I04M 1WIVA 2C9CA 2OPFA 3B7ZA 4CISA 1VEJA 3LQRA 1TTEA 1NHGC 3W0LB 3UGJA 4MB7A 3A46A 1HQYE 3SHGB 5IT9S 3E46A 1SXJD 5FTNA 4DV7M 1QZEA 5FLXS 3FUXA 4DV2M 3SHFA 1WGNA 2ZTDA 5E26A 1IXZA 1L2CA 3KS8A 2DAIA 4I8OA 4IIWA 3LW5F 2Z4SA 4LZZA 2DWMA 5ITTA 1ORYB 2KRUA 2LVNC 7CATA 2GQFA 3B74A 4FWGA 5FTKA 2DZNB 3K1JA 1VDLA 2FOIC 4CHTB 2UU9M 3LQQA 3W0FA 3J2PB 1IN4A 3QYEA 3U6SA 2FH0A 2DAGA 1R2YA 4A3VB 3LVWA 2Z4RA 1R5LA 3SBJA 3KW6A 1JR3E 1WXQA 1VQ1A 4IBIA 3Q8GA 2JZ0A 3HHYA 3GLFB 4DV6M 1LV7A 2DHRA 2YFQA 4S12A 3RE8A 4KT0F 3FE3A 3D8LA 8CATA 4P17A 3ZQJA 3KS4A 3GPPA 2DAEA 2MH8A 4OVZA 1OIPA 4IBJA 1N33M 4BB9A 4DR2M 2VQEM 2MROB 3A45A 2F5PA 4DV1M 4GITA 2BJVA 2K0BX 3GRVA 4I4LA 4L15A 3L26A 3GLIB 3SAWA 4JYAM 3RGSA 3HU2A 4D80A 5KPTA 1DV0A 3DFZA 2CV1A 3ZCBB 5ITYA 3THGA 4JN6A 2DWZB 2JUJA 3TWKA 1IXSB 1EE8A 3GLFE 4JI0M 4JXJA 3ILKA 2O01F 1PJQA 4G4OA 5EXSA 2HWJA 2NQ8C 1QUSA 1OFIA 3HZJA 2KRKA 2I7PA 4M9ZA 4KHPM 4FWDA 4LFAM 3PXGA 4B3TM 1IN6A 3GLIE 3C3EA 2JY8A 2QCUA 3VK8A 3KSJA 4GRIA 1NHWC 2KXEA 3U6MA 2YR0A 2LVPC 1P3QQ 5EQTA 4PD2A 1EFUB 2R46A 2N35A 5EXTA 2QSFX 4NL4H 1Z5CA 2YNMD 1IFYA 3HY5A 4GC5A 4JI7M 3VDUA 2O5RA 1L8QA 1J7KA 3U61B 2WZJA 2R4EA 1JR3A 4IBBA 4MGHA 3HX3A 2C9OA 4MGZE 1J5EM 1VDDA 1NY6A 2MR9A 4FWHA 2D7EA 4CJ6A 1BVSA 1QANA 3L25A 4ZPXA 3GLGB 3HU3A 1EIJA 3T38A 4IJFA 1G3IA 4AG5A 4DUYM 2DI0A 2Y21A 3T1HM 2DNAA 5ITRA 1Z5BA 2XSZA 5IWAM 1V33A 1GL6A 1XWIA 2VDBB 4NOOB 2GNOA 3GLFA 4DR1M 4JI8M 4LRSA 3SYKA 4EIWA 3EIHA 3L2AA 1OTRA 2G3QA 1G71A 2L7HA 2CV0A 3A42A 3VLFB 4NC6A 1GJSA 3VFDA 1HNWM 3BXWA 1N78A 3GLGE 2FNAA 2J7NA 5F3WA 1IN7A 2M60A 4LRTA 3GLIA 3JAMS 4GKKM 4NSRA 1Q3CA 3KOZE 5FSWA 1Y8GA 2V1UA 1IXSA 2CHVA 1ZAEA 3L28A 3FUUA 1GVNA 1E9SA 2KZSA 4G3OA 3J7AS 4MH0E 3AOGA 1PJIA 4QNMA 1T43A 1JB0F 3FRHA 2KW0A 1QVRA 1HJPA 2RRUA 4LF8M 1PRBA 2CRUA 2EKKA 4QOSA 2L4FA 5EXPA 1D0LA 1MU5A 4M0DA 3GPXA 2LVAA 4DR4M 2DAMA 3C9PA 5C1BA 2D7GA 2R0IA 4L6V6 3R8FA 3FYDA 1DO2A 1UM8A 4L4UA 2H1RA 3T1YM 1TR8A 1TH3A 5JI3E 1IBKM 1TDZA 1NV9A 2XFTA 4GHLA 2YQZA 3M0EA 3SAVA 4LGMA 1L1TA 2A5YB 3FYCA 4JI2M 1K82A 3UMMA 3U61A 4LFCM 5EJCA 4AKHA 3WHKA 4GIPA 4GEWA 5IREB 3B7NA 1K3XA 3TQSA 4NXMM 2WSEF 2EUCA 2QHOB 4NRWA 4DV5M 1YLAA 3GLGA 5H37D 1NJGA 1S3SA 3K9PA 5KO3A 3HU1A 2EA0A 1IBMM 1HT1E 3GRUA 1XMQM 1XNQM 2JY6B 2VF8A 1DO0A 3KXEC 4QHSA 1KFVA 2LWXA 1I94M 3DA1A 1IM2A 3I4YA 1ZMUA 5BPVA 1CUKA 4G4RA 3TL4X 2DENA 4XK8F 4DR5M 2O25A 2R4JA 5LMNM 2XH9A 4DUZM 1D0KA 2UXDM 1Q39A 1QUTA 4MM3B 3FTEA 2VF7A 5EP1A 3IG5A 1IXRC 1IQPA 3U6PA 2APLA 2QZ4A 1WGLA 1WHCA 3QYBA 2X4AA 2R6FA 4AQYM 1PJJA 2DWNA 4FW9A 4JI3M 3MK6A 1WJ7A 3CF0A 4G6ZA 2JP7A 1MN3A 3RFWA 3FTFA 1L2DA 2R18A 1OIZA 2Y0QA 4LJ5A 1IY2A 2J5YA 4PDIA 2HL7A 2Q2EB 1TGUA 3SFZA 1GLNA 3MMPA 5LMUM 1NY5A 2CHGA 3HJSA 1TF0B 2Z7JA 4LJ4A 1Q3BA 1TDHA 1YUBA 2KNAA 1IBLM 4ITQA 1YSYA 2RGHA 2XEPA 4Y28F 2HHHM 3CF2A 4BLCA 3GQ3A 1WR1B 4LJ8A 1YE9A 2L6OA 1Q02A 3K92A 4I81A 4Z8XA 4OU7A 4JI4M 3Q8XA 1ZMVA 2F5OA 1JQJC 1VEKA 4BBAA 2LNHC 2Z8YM 2E5LM 2ZBKB 4LJ6A 4JI5M 5EP2A 2C99A 4B7HA 1QAOA 2F4VM 1KYIA 3KP1E 2DXIA 4II7A 2HKJA 4K0KM 2AHMA 1OQYA 4PCZA 2DZOB 3D8BA 1QYRA 5DYIA 4MGKE 4AKGA 3VKGA 2LBCA 4JI1M 2J7OA 2LXEA 4FCWA 3GRYA 1G41A 4B08A 3HKPA 3HJQA 4YY3M 4B3RM 4HEOA 1JR3D 3QWLA 1GKIA 1G59A 4JI6M 3V76A 4TUWA 1R4GA 1SXJB 3H4JA 1L1ZA 4FCTA 3KOWE 3LCVB 1E94E 1RU3A 4IBCA 5E6JA 3B89A 1VG5A 3FTCA 4W5WA 1IY0A 1OJLA 1TH4A 2V6ZM 2QP9X 4HL4A 1NNUC 4L78A 4LY6A 3RGPA 2XSZD 4REZA 3QAUA 2EO2A 1ZV1A 5FTMA 5ITXE 2XZUA 3W67A 4DR7M 5KQDA 3SYLA 2WSCF 3R9XB 2XLJA 4GKJM 1SXJE 4LF6M 4F2LA 2G5GX 1R2ZA 1OFHA 3AV0A 3K9OA 2V1CA 1GL7A 5DYGA 3U6LA 3HWSA 1XNRM 2JY7A 3KFUG 3GPUA 2KA6B 1XB2B 5C18A 4FD2A 3ZC7B 4NSOB 3E4RA 4R7GA 4PT5A 2JY5A 1HNZM 2LVQD 1XXHB 2R62A 1KSFX 4GH9A 4M0WA 2W82A 3TE6A 1GABA 2D7HA 5A2QS 2CEAA 3I4VA 3J7BA 5FTJA 5IZ7D 3VDPA 4LJAA 1N75A 1E9RA 3CGWA 4FCVA 4DV0M 2OOAA 3CTWB 3U6DA 2RGOA 1PJSA 3LCUA 2KDLA 2EJSA
chains in the Genus database with same CATH topology
1AIPC 4DBGB 1IM2A 2KNZA 1ZMUA 2QNJA 1CUKA 2DHYA 2JNHA 2DENA 4UN2B 1XXHE 2O25A 3GLIE 2JY8A 2KHHA 3IHPA 2LVPC 1P3QQ 2HAKA 1EFUB 1PGYA 2CWBA 4F1IA 2QSFX 1WGLA 1WHCA 2LVOC 1IFYA 2BWBA 1WJ7A 4R71A 2JP7A 1MN3A 2MGWA 1UFZA 2WZJA 2LTUA 2OO9A 2MR9A 3MMPA 2MJ5B 5DFLA 1A5TA 1BVSA 2KNAA 1C7YA 1HT2E 2H5XA 1WR1B 1G3IA 1SG9A 1Q02A 2DI0A 1NV8A 2DNAA 1ZMVA 1VEKA 2K9DA 2L4EA 2JZ1A 4WP2A 2DZLA 1KYIA 2L2DA 3FRIA 4Q7JA 1OTRA 1G4AE 1OKSA 1OQYA 2G3QA 1ZMWA 3IECA 1WIVA 1GO5A 2LBCA 3GLGE 1VEJA 1TTEA 1G41A 1HQYE 3E46A 4HEOA 1QZEA 5JI2E 1Y8GA 1IXSA 1WGNA 2ZTDA 2BWEA 1R4GA 3F92A 3H4JA 3E21A 3LCVB 4G3OA 2DAIA 1E94E 2ZTCA 2DAKA 3B89A 1T43A 3FRHA 1VG5A 2LVNC 1HJPA 2RRUA 2KNVA 2EKKA 2L4FA 1VDLA 1ZV1A 1OAIA 1V92A 2LVAA 2DAMA 2EKFA 2DAGA 3BBZA 2R0IA 1JR3E 1F4IA 1VQ1A 1DO2A 4F2LA 2JZ0A 3K9OA 1TR8A 1VEGA 1NV9A 3FE3A 2JY7A 1T6OA 2DAEA 1XB2B 2MROB 3T6PA 2JY5A 2OOBA 2LVQD 2K0BX 2DKLA 4GEWA 1DV0A 2QHOB 2JUJA 1YLAA 3GLFE 2B3TA 3K9PA 2CP8A 3GLHE 2OOAA 1HT1E 2HWJA 2JY6B 3LCUA 1DO0A 2EJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AIP C;  4DBG B;  1IM2 A;  2KNZ A;  1ZMU A;  2QNJ A;  1CUK A;  2DHY A;  2JNH A;  2DEN A;  4UN2 B;  1XXH E;  2O25 A;  3GLI E;  2JY8 A;  2KHH A;  3IHP A;  2LVP C;  1P3Q Q;  2HAK A;  1EFU B;  1PGY A;  2CWB A;  4F1I A;  2QSF X;  1WGL A;  1WHC A;  2LVO C;  1IFY A;  2BWB A;  1WJ7 A;  4R71 A;  2JP7 A;  1MN3 A;  2MGW A;  1UFZ A;  2WZJ A;  2LTU A;  2OO9 A;  2MR9 A;  3MMP A;  2MJ5 B;  5DFL A;  1A5T A;  1BVS A;  2KNA A;  1C7Y A;  1HT2 E;  2H5X A;  1WR1 B;  1G3I A;  1SG9 A;  1Q02 A;  2DI0 A;  1NV8 A;  2DNA A;  1ZMV A;  1VEK A;  2K9D A;  2L4E A;  2JZ1 A;  4WP2 A;  2DZL A;  1KYI A;  2L2D A;  3FRI A;  4Q7J A;  1OTR A;  1G4A E;  1OKS A;  1OQY A;  2G3Q A;  1ZMW A;  3IEC A;  1WIV A;  1GO5 A;  2LBC A;  3GLG E;  1VEJ A;  1TTE A;  1G41 A;  1HQY E;  3E46 A;  4HEO A;  1QZE A;  5JI2 E;  1Y8G A;  1IXS A;  1WGN A;  2ZTD A;  2BWE A;  1R4G A;  3F92 A;  3H4J A;  3E21 A;  3LCV B;  4G3O A;  2DAI A;  1E94 E;  2ZTC A;  2DAK A;  3B89 A;  1T43 A;  3FRH A;  1VG5 A;  2LVN C;  1HJP A;  2RRU A;  2KNV A;  2EKK A;  2L4F A;  1VDL A;  1ZV1 A;  1OAI A;  1V92 A;  2LVA A;  2DAM A;  2EKF A;  2DAG A;  3BBZ A;  2R0I A;  1JR3 E;  1F4I A;  1VQ1 A;  1DO2 A;  4F2L A;  2JZ0 A;  3K9O A;  1TR8 A;  1VEG A;  1NV9 A;  3FE3 A;  2JY7 A;  1T6O A;  2DAE A;  1XB2 B;  2MRO B;  3T6P A;  2JY5 A;  2OOB A;  2LVQ D;  2K0B X;  2DKL A;  4GEW A;  1DV0 A;  2QHO B;  2JUJ A;  1YLA A;  3GLF E;  2B3T A;  3K9P A;  2CP8 A;  3GLH E;  2OOA A;  1HT1 E;  2HWJ A;  2JY6 B;  3LCU A;  1DO0 A;  2EJS A; 
#chains in the Genus database with same CATH topology
 1XMO M;  3HJ8 A;  1D0M A;  1AIP C;  5EP4 A;  1PM5 A;  4LGY A;  1DGF A;  2CHQ A;  2KNZ A;  3AOE A;  4X65 M;  2XGN A;  4LF5 M;  1N32 M;  4UN2 B;  1XXH E;  2X8A A;  1IN5 A;  1Z59 A;  1DGB A;  3PNV A;  3IHP A;  4G4N A;  3SAR A;  4IJE A;  3EIE A;  3KSX A;  4RF1 A;  3SC3 A;  3TWL A;  4PDG A;  3ZH9 B;  4GHA A;  1MX0 A;  3AOE C;  4F1I A;  4I5S A;  3H4M A;  3AL0 C;  3C3D A;  1QZM A;  4KO8 A;  5ITX A;  1X37 A;  3SMS A;  2BWB A;  1LTM A;  4R71 A;  4LF7 M;  4P16 A;  2MGW A;  3TWM A;  1UFZ A;  1SXJ A;  1OAO C;  1NJF A;  2LTU A;  2ZAN A;  1L2B A;  2ERC A;  1AUA A;  4IBE A;  2OO9 A;  4JV5 M;  2R65 A;  3LVV A;  3FUT A;  1K3W A;  3SAU A;  1NVM A;  3GP1 A;  5DFL A;  2DWL A;  2RKO A;  2XF3 A;  1C7Y A;  2OQ4 A;  2F5Q A;  2H5X A;  3PFI A;  1DGG A;  1SXJ C;  2QEN A;  2BNK A;  1GJT A;  2M5Z A;  4X66 M;  3PNY A;  4LJ9 A;  3HHW A;  4IBK A;  2K9D A;  2UUA M;  2UUB M;  4M9X A;  4X64 M;  3VK7 A;  3J81 S;  2JZ1 A;  4OX9 M;  4Z6Y A;  1N34 M;  2DZL A;  3AJI B;  3FRI A;  2L2D A;  4Q7J A;  4QHT A;  1QDT A;  3FUW A;  1G4A E;  1OKS A;  2QBY A;  4R3D A;  3K8Z A;  2ZAO A;  3IEC A;  1TH2 A;  2FE8 A;  3I01 M;  1QDR A;  4D82 A;  1GO5 A;  4KLN A;  3DZD A;  5BR8 M;  1XXH A;  2ZM6 M;  4X62 M;  4FVM A;  3U5Z B;  1MJG M;  3U6Q A;  2LHC A;  3UZU A;  4IBG A;  5JI2 E;  4WUR A;  4LG2 A;  2BWE A;  2C98 A;  2ZAM A;  3F92 A;  4YHH M;  3E21 A;  3U60 A;  2Y0T A;  3J27 B;  3VKH A;  2ZTC A;  2DAK A;  5FTL A;  1HNX M;  4D81 A;  4XGI A;  2LHG A;  2CV2 A;  2BJW A;  2DVW B;  2KEB A;  4MGY E;  3M7G A;  3M6A A;  1XHB A;  4L8R C;  1QAM A;  2KNV A;  3FUV A;  5KPZ A;  2UUC M;  1G8P A;  1OAI A;  1V92 A;  5KPR A;  2EKF A;  4G4Q A;  4GC9 A;  3BBZ A;  4DV3 M;  1N77 A;  3K2L A;  5GKN A;  1F4I A;  3U6O A;  1NNJ A;  1VEG A;  3HHZ A;  3GLH B;  3GQ5 A;  2L09 A;  3B9P A;  2P5T A;  2I7N A;  3KOX E;  1D2N A;  1T6O A;  1R7R A;  3I51 A;  1DGH B;  4LF9 M;  3GQ4 A;  2C5R A;  4KOD A;  2Z3X A;  2XZF A;  4XBO A;  3T6P A;  5L8R F;  1HQC A;  1Z6T A;  2OOB A;  2Y20 A;  4RNA A;  3NBX X;  2DKL A;  4M9S A;  4AI6 A;  5ITU A;  2C96 A;  3MHV C;  4AG6 A;  3SAT A;  4CIZ A;  4AZF A;  2CE7 A;  3FKE A;  2JA2 A;  4B7G A;  2WSF F;  4NRV A;  2B3T A;  3OTO M;  3KOY E;  1I4W A;  1ZQ9 A;  2CP8 A;  1IY1 A;  1W5T A;  3GLH E;  1N36 M;  2UXC M;  4MGI E;  4B7F A;  3CF6 E;  4RF0 A;  4GMQ A;  3AKZ A;  2FFJ A;  4DBG B;  3SAS A;  1QAQ A;  3PVS A;  2QNJ A;  3C58 A;  4LZJ A;  2DHY A;  2JNH A;  2R45 A;  3KVW A;  5ITQ A;  5DNY A;  4LFB M;  1Z5A A;  4B3S M;  1HR0 M;  4QOZ C;  3BOS A;  3NBI A;  2QQ8 A;  1XC8 A;  2QBY B;  3GRR A;  2KHH A;  3A98 B;  2L7I A;  5EP3 A;  1FJG M;  3J80 S;  2HAK A;  4LF4 M;  3FD9 A;  3KDS E;  1PGY A;  2CWB A;  3L29 A;  4DR6 M;  1FNN A;  1J09 A;  3U6C A;  4QNR A;  2LVO C;  4RKU F;  4CGY B;  3U5Z A;  3U6E A;  2UXB M;  4DV4 M;  2CFO A;  2K6B A;  3L27 A;  4OVZ B;  2VQF M;  3U60 B;  4HLQ A;  3GO8 A;  1T3T A;  3B7Q A;  4IBD A;  1V34 A;  3KP0 E;  1QQW A;  3T15 A;  4AKI A;  3W68 A;  4ANR A;  3HGI A;  4OW0 A;  3WHL A;  2MJ5 B;  3GPY A;  2X49 A;  1A5T A;  2G8L A;  2R44 A;  3AFH A;  3LMM A;  4L16 A;  4WW0 A;  1HT2 E;  2FS1 A;  1IN8 A;  3UK6 A;  1H6U A;  3IG8 A;  4NXN M;  2CUZ A;  2K47 A;  3JR4 A;  2LH0 A;  2F5N A;  1SG9 A;  3NWL A;  5EXX A;  1NV8 A;  2JXN A;  2KZU A;  2VII A;  3JR5 A;  3HHX A;  4DR3 M;  1NO1 A;  1NSF A;  1PJT A;  1W5S A;  2L4E A;  3SMP A;  4AW4 A;  4B3M M;  4LCB A;  4WP2 A;  1C1K A;  3FTD A;  4IBF A;  2HCB A;  5KQ8 A;  3GLH A;  3E9S A;  2JWS A;  4LJ7 A;  1E32 A;  1R6B X;  2F5S A;  3DOA A;  3TPZ A;  2XFS A;  2QPA A;  3MJ5 A;  3UJN A;  1DGH A;  1ZMW A;  3I04 M;  1WIV A;  2C9C A;  2OPF A;  3B7Z A;  4CIS A;  1VEJ A;  3LQR A;  1TTE A;  1NHG C;  3W0L B;  3UGJ A;  4MB7 A;  3A46 A;  1HQY E;  3SHG B;  5IT9 S;  3E46 A;  1SXJ D;  5FTN A;  4DV7 M;  1QZE A;  5FLX S;  3FUX A;  4DV2 M;  3SHF A;  1WGN A;  2ZTD A;  5E26 A;  1IXZ A;  1L2C A;  3KS8 A;  2DAI A;  4I8O A;  4IIW A;  3LW5 F;  2Z4S A;  4LZZ A;  2DWM A;  5ITT A;  1ORY B;  2KRU A;  2LVN C;  7CAT A;  2GQF A;  3B74 A;  4FWG A;  5FTK A;  2DZN B;  3K1J A;  1VDL A;  2FOI C;  4CHT B;  2UU9 M;  3LQQ A;  3W0F A;  3J2P B;  1IN4 A;  3QYE A;  3U6S A;  2FH0 A;  2DAG A;  1R2Y A;  4A3V B;  3LVW A;  2Z4R A;  1R5L A;  3SBJ A;  3KW6 A;  1JR3 E;  1WXQ A;  1VQ1 A;  4IBI A;  3Q8G A;  2JZ0 A;  3HHY A;  3GLF B;  4DV6 M;  1LV7 A;  2DHR A;  2YFQ A;  4S12 A;  3RE8 A;  4KT0 F;  3FE3 A;  3D8L A;  8CAT A;  4P17 A;  3ZQJ A;  3KS4 A;  3GPP A;  2DAE A;  2MH8 A;  4OVZ A;  1OIP A;  4IBJ A;  1N33 M;  4BB9 A;  4DR2 M;  2VQE M;  2MRO B;  3A45 A;  2F5P A;  4DV1 M;  4GIT A;  2BJV A;  2K0B X;  3GRV A;  4I4L A;  4L15 A;  3L26 A;  3GLI B;  3SAW A;  4JYA M;  3RGS A;  3HU2 A;  4D80 A;  5KPT A;  1DV0 A;  3DFZ A;  2CV1 A;  3ZCB B;  5ITY A;  3THG A;  4JN6 A;  2DWZ B;  2JUJ A;  3TWK A;  1IXS B;  1EE8 A;  3GLF E;  4JI0 M;  4JXJ A;  3ILK A;  2O01 F;  1PJQ A;  4G4O A;  5EXS A;  2HWJ A;  2NQ8 C;  1QUS A;  1OFI A;  3HZJ A;  2KRK A;  2I7P A;  4M9Z A;  4KHP M;  4FWD A;  4LFA M;  3PXG A;  4B3T M;  1IN6 A;  3GLI E;  3C3E A;  2JY8 A;  2QCU A;  3VK8 A;  3KSJ A;  4GRI A;  1NHW C;  2KXE A;  3U6M A;  2YR0 A;  2LVP C;  1P3Q Q;  5EQT A;  4PD2 A;  1EFU B;  2R46 A;  2N35 A;  5EXT A;  2QSF X;  4NL4 H;  1Z5C A;  2YNM D;  1IFY A;  3HY5 A;  4GC5 A;  4JI7 M;  3VDU A;  2O5R A;  1L8Q A;  1J7K A;  3U61 B;  2WZJ A;  2R4E A;  1JR3 A;  4IBB A;  4MGH A;  3HX3 A;  2C9O A;  4MGZ E;  1J5E M;  1VDD A;  1NY6 A;  2MR9 A;  4FWH A;  2D7E A;  4CJ6 A;  1BVS A;  1QAN A;  3L25 A;  4ZPX A;  3GLG B;  3HU3 A;  1EIJ A;  3T38 A;  4IJF A;  1G3I A;  4AG5 A;  4DUY M;  2DI0 A;  2Y21 A;  3T1H M;  2DNA A;  5ITR A;  1Z5B A;  2XSZ A;  5IWA M;  1V33 A;  1GL6 A;  1XWI A;  2VDB B;  4NOO B;  2GNO A;  3GLF A;  4DR1 M;  4JI8 M;  4LRS A;  3SYK A;  4EIW A;  3EIH A;  3L2A A;  1OTR A;  2G3Q A;  1G71 A;  2L7H A;  2CV0 A;  3A42 A;  3VLF B;  4NC6 A;  1GJS A;  3VFD A;  1HNW M;  3BXW A;  1N78 A;  3GLG E;  2FNA A;  2J7N A;  5F3W A;  1IN7 A;  2M60 A;  4LRT A;  3GLI A;  3JAM S;  4GKK M;  4NSR A;  1Q3C A;  3KOZ E;  5FSW A;  1Y8G A;  2V1U A;  1IXS A;  2CHV A;  1ZAE A;  3L28 A;  3FUU A;  1GVN A;  1E9S A;  2KZS A;  4G3O A;  3J7A S;  4MH0 E;  3AOG A;  1PJI A;  4QNM A;  1T43 A;  1JB0 F;  3FRH A;  2KW0 A;  1QVR A;  1HJP A;  2RRU A;  4LF8 M;  1PRB A;  2CRU A;  2EKK A;  4QOS A;  2L4F A;  5EXP A;  1D0L A;  1MU5 A;  4M0D A;  3GPX A;  2LVA A;  4DR4 M;  2DAM A;  3C9P A;  5C1B A;  2D7G A;  2R0I A;  4L6V 6;  3R8F A;  3FYD A;  1DO2 A;  1UM8 A;  4L4U A;  2H1R A;  3T1Y M;  1TR8 A;  1TH3 A;  5JI3 E;  1IBK M;  1TDZ A;  1NV9 A;  2XFT A;  4GHL A;  2YQZ A;  3M0E A;  3SAV A;  4LGM A;  1L1T A;  2A5Y B;  3FYC A;  4JI2 M;  1K82 A;  3UMM A;  3U61 A;  4LFC M;  5EJC A;  4AKH A;  3WHK A;  4GIP A;  4GEW A;  5IRE B;  3B7N A;  1K3X A;  3TQS A;  4NXM M;  2WSE F;  2EUC A;  2QHO B;  4NRW A;  4DV5 M;  1YLA A;  3GLG A;  5H37 D;  1NJG A;  1S3S A;  3K9P A;  5KO3 A;  3HU1 A;  2EA0 A;  1IBM M;  1HT1 E;  3GRU A;  1XMQ M;  1XNQ M;  2JY6 B;  2VF8 A;  1DO0 A;  3KXE C;  4QHS A;  1KFV A;  2LWX A;  1I94 M;  3DA1 A;  1IM2 A;  3I4Y A;  1ZMU A;  5BPV A;  1CUK A;  4G4R A;  3TL4 X;  2DEN A;  4XK8 F;  4DR5 M;  2O25 A;  2R4J A;  5LMN M;  2XH9 A;  4DUZ M;  1D0K A;  2UXD M;  1Q39 A;  1QUT A;  4MM3 B;  3FTE A;  2VF7 A;  5EP1 A;  3IG5 A;  1IXR C;  1IQP A;  3U6P A;  2APL A;  2QZ4 A;  1WGL A;  1WHC A;  3QYB A;  2X4A A;  2R6F A;  4AQY M;  1PJJ A;  2DWN A;  4FW9 A;  4JI3 M;  3MK6 A;  1WJ7 A;  3CF0 A;  4G6Z A;  2JP7 A;  1MN3 A;  3RFW A;  3FTF A;  1L2D A;  2R18 A;  1OIZ A;  2Y0Q A;  4LJ5 A;  1IY2 A;  2J5Y A;  4PDI A;  2HL7 A;  2Q2E B;  1TGU A;  3SFZ A;  1GLN A;  3MMP A;  5LMU M;  1NY5 A;  2CHG A;  3HJS A;  1TF0 B;  2Z7J A;  4LJ4 A;  1Q3B A;  1TDH A;  1YUB A;  2KNA A;  1IBL M;  4ITQ A;  1YSY A;  2RGH A;  2XEP A;  4Y28 F;  2HHH M;  3CF2 A;  4BLC A;  3GQ3 A;  1WR1 B;  4LJ8 A;  1YE9 A;  2L6O A;  1Q02 A;  3K92 A;  4I81 A;  4Z8X A;  4OU7 A;  4JI4 M;  3Q8X A;  1ZMV A;  2F5O A;  1JQJ C;  1VEK A;  4BBA A;  2LNH C;  2Z8Y M;  2E5L M;  2ZBK B;  4LJ6 A;  4JI5 M;  5EP2 A;  2C99 A;  4B7H A;  1QAO A;  2F4V M;  1KYI A;  3KP1 E;  2DXI A;  4II7 A;  2HKJ A;  4K0K M;  2AHM A;  1OQY A;  4PCZ A;  2DZO B;  3D8B A;  1QYR A;  5DYI A;  4MGK E;  4AKG A;  3VKG A;  2LBC A;  4JI1 M;  2J7O A;  2LXE A;  4FCW A;  3GRY A;  1G41 A;  4B08 A;  3HKP A;  3HJQ A;  4YY3 M;  4B3R M;  4HEO A;  1JR3 D;  3QWL A;  1GKI A;  1G59 A;  4JI6 M;  3V76 A;  4TUW A;  1R4G A;  1SXJ B;  3H4J A;  1L1Z A;  4FCT A;  3KOW E;  3LCV B;  1E94 E;  1RU3 A;  4IBC A;  5E6J A;  3B89 A;  1VG5 A;  3FTC A;  4W5W A;  1IY0 A;  1OJL A;  1TH4 A;  2V6Z M;  2QP9 X;  4HL4 A;  1NNU C;  4L78 A;  4LY6 A;  3RGP A;  2XSZ D;  4REZ A;  3QAU A;  2EO2 A;  1ZV1 A;  5FTM A;  5ITX E;  2XZU A;  3W67 A;  4DR7 M;  5KQD A;  3SYL A;  2WSC F;  3R9X B;  2XLJ A;  4GKJ M;  1SXJ E;  4LF6 M;  4F2L A;  2G5G X;  1R2Z A;  1OFH A;  3AV0 A;  3K9O A;  2V1C A;  1GL7 A;  5DYG A;  3U6L A;  3HWS A;  1XNR M;  2JY7 A;  3KFU G;  3GPU A;  2KA6 B;  1XB2 B;  5C18 A;  4FD2 A;  3ZC7 B;  4NSO B;  3E4R A;  4R7G A;  4PT5 A;  2JY5 A;  1HNZ M;  2LVQ D;  1XXH B;  2R62 A;  1KSF X;  4GH9 A;  4M0W A;  2W82 A;  3TE6 A;  1GAB A;  2D7H A;  5A2Q S;  2CEA A;  3I4V A;  3J7B A;  5FTJ A;  5IZ7 D;  3VDP A;  4LJA A;  1N75 A;  1E9R A;  3CGW A;  4FCV A;  4DV0 M;  2OOA A;  3CTW B;  3U6D A;  2RGO A;  1PJS A;  3LCU A;  2KDL A;  2EJS A; 
#chains in the Genus database with same CATH homology
 1AIP C;  4DBG B;  1IM2 A;  2KNZ A;  1ZMU A;  2QNJ A;  1CUK A;  2DHY A;  2JNH A;  2DEN A;  4UN2 B;  1XXH E;  2O25 A;  3GLI E;  2JY8 A;  2KHH A;  3IHP A;  2LVP C;  1P3Q Q;  2HAK A;  1EFU B;  1PGY A;  2CWB A;  4F1I A;  2QSF X;  1WGL A;  1WHC A;  2LVO C;  1IFY A;  2BWB A;  1WJ7 A;  4R71 A;  2JP7 A;  1MN3 A;  2MGW A;  1UFZ A;  2WZJ A;  2LTU A;  2OO9 A;  2MR9 A;  3MMP A;  2MJ5 B;  5DFL A;  1A5T A;  1BVS A;  2KNA A;  1C7Y A;  1HT2 E;  2H5X A;  1WR1 B;  1G3I A;  1SG9 A;  1Q02 A;  2DI0 A;  1NV8 A;  2DNA A;  1ZMV A;  1VEK A;  2K9D A;  2L4E A;  2JZ1 A;  4WP2 A;  2DZL A;  1KYI A;  2L2D A;  3FRI A;  4Q7J A;  1OTR A;  1G4A E;  1OKS A;  1OQY A;  2G3Q A;  1ZMW A;  3IEC A;  1WIV A;  1GO5 A;  2LBC A;  3GLG E;  1VEJ A;  1TTE A;  1G41 A;  1HQY E;  3E46 A;  4HEO A;  1QZE A;  5JI2 E;  1Y8G A;  1IXS A;  1WGN A;  2ZTD A;  2BWE A;  1R4G A;  3F92 A;  3H4J A;  3E21 A;  3LCV B;  4G3O A;  2DAI A;  1E94 E;  2ZTC A;  2DAK A;  3B89 A;  1T43 A;  3FRH A;  1VG5 A;  2LVN C;  1HJP A;  2RRU A;  2KNV A;  2EKK A;  2L4F A;  1VDL A;  1ZV1 A;  1OAI A;  1V92 A;  2LVA A;  2DAM A;  2EKF A;  2DAG A;  3BBZ A;  2R0I A;  1JR3 E;  1F4I A;  1VQ1 A;  1DO2 A;  4F2L A;  2JZ0 A;  3K9O A;  1TR8 A;  1VEG A;  1NV9 A;  3FE3 A;  2JY7 A;  1T6O A;  2DAE A;  1XB2 B;  2MRO B;  3T6P A;  2JY5 A;  2OOB A;  2LVQ D;  2K0B X;  2DKL A;  4GEW A;  1DV0 A;  2QHO B;  2JUJ A;  1YLA A;  3GLF E;  2B3T A;  3K9P A;  2CP8 A;  3GLH E;  2OOA A;  1HT1 E;  2HWJ A;  2JY6 B;  3LCU A;  1DO0 A;  2EJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...