3T1YM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t1yM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3t1yM02
4X65M 2UUBM 2F5PA 1EE8A 4JI3M 4X62M 4JI0M 4DUZM 5ITUA 2Q2EB 4DV1M 1L2CA 1I94M 4AQYM 4B3MM 1K3XA 4DR3M 3T1HM 4LF4M 2UXCM 1N32M 4JV5M 3GPPA 4G4NA 4B3SM 5ITRA 2VQFM 4K0KM 1TDZA 1K3WA 3JAMS 3TWMA 1HNZM 4LF9M 1NNJA 3VK7A 1L2DA 2ZM6M 4LF8M 2EA0A 3U6DA 1Z5BA 4JI4M 4LFBM 4GKKM 4PDGA 3U6MA 2F5NA 1PJJA 1XNQM 4DR6M 3GQ5A 4LFAM 4DR5M 3J81S 5ITXE 4MB7A 2UUCM 3U6LA 1Q39A 4JI6M 1Z5AA 2F5OA 2UUAM 4G4RA 5ITTA 2UU9M 3J7AS 1IBMM 3J80S 4DV3M 2OPFA 3SASA 3TWKA 1Z59A 4DR1M 4LF6M 2UXBM 1Q3CA 3SAUA 1L2BA 1HNWM 3GQ3A 3SAVA 4DV7M 1PJIA 3W0FA 3GP1A 4DV6M 2OQ4A 4DV4M 3JR4A 1IBKM 4DR4M 4DV5M 4X64M 4DR2M 5A2QS 5ITQA 4YHHM 3SBJA 5LMNM 4LF5M 3DOAA 3TWLA 4B3TM 1K82A 4NRVA 3A45A 5ITXA 3U6CA 1R2YA 2UXDM 2ZBKB 3A46A 3VK8A 4JYAM 4JI7M 1N34M 4PDIA 1KFVA 4DR7M 3U6OA 4LFCM 2E5LM 3U6PA 1N36M 4NRWA 2HHHM 1Q3BA 1J5EM 4PD2A 2XZUA 4ITQA 5BR8M 1PM5A 4PCZA 1R2ZA 4JI2M 5IT9S 3C58A 1TDHA 5FLXS 1Z5CA 1N33M 3GPXA 3A42A 1XNRM 4DV2M 3SAWA 4DUYM 3SATA 3T1YM 5LMUM 1MX0A 3SARA 4G4QA 3JR5A 2XZFA 4YY3M 1XMQM 1XC8A 4GKJM 1MU5A 4CISA 3GQ4A 1XMOM 3U6QA 1HR0M 4DV0M 4B3RM 1L1TA 2F5QA 2F5SA 1FJGM 3GPUA 3U6SA 4JI1M 4LF7M 4OX9M 4X66M 5IWAM 3OTOM 1HNXM 1L1ZA 4G4OA 4JI8M 3GO8A 3U6EA 2F4VM 4KHPM 3GPYA 4NXMM 5ITYA 4NXNM 1IBLM 2VQEM 4JI5M 2HKJA
chains in the Genus database with same CATH superfamily
4QOSA 4FW9A 2C96A 1GABA 1EE8A 4GRIA 4X62M 4DV1M 1QVRA 2KDLA 4B7FA 3F92A 2DENA 4EIWA 1UFZA 4B3MM 1W5TA 4DR3M 4GHLA 2VIIA 4FWGA 2C98A 2CRUA 3VKGA 4GHAA 3IG8A 2MJ5B 2QNJA 3C3EA 3K9OA 3B74A 4NOOB 4ANRA 4BBAA 1QUTA 8CATA 4FCWA 3LW5F 2HWJA 2Z4SA 3PNVA 3PFIA 2CHQA 2L4EA 3LVVA 4LJ5A 3GLFB 3IECA 2DZLA 1K3WA 3FTEA 1HNZM 3J7BA 1XWIA 3NBXX 3U6DA 1J7KA 4I5SA 2FOIC 4OVZB 2LHCA 2F5NA 2BNKA 3CF0A 3FUTA 1MN3A 1PRBA 2Y0TA 4QOZC 1Y8GA 1W5SA 3NWLA 5ITXE 2UUCM 1DO0A 4LJ8A 2DAKA 2C99A 1IFYA 4BLCA 1BVSA 1Z5AA 4G4RA 2KA6B 1E9SA 2XSZD 2C9OA 3M6AA 4IBDA 5ITTA 4OU7A 4LZJA 1N75A 2QBYA 5FTMA 3J7AS 2J7NA 1E9RA 3CF2A 4DV3M 2DWMA 2OPFA 2XSZA 2KNVA 1E32A 1N78A 3L2AA 4R3DA 3TE6A 1IXSB 1Q3CA 2DZNB 2Z7JA 1L2BA 1T43A 1AUAA 3AOGA 3SMSA 2X4AA 2LHGA 2H1RA 2BJWA 2RKOA 4AKIA 5EXTA 2MR9A 3GLHA 4QHTA 5KQ8A 2MROB 3M0EA 3GP1A 2OQ4A 4DV6M 3JR4A 3GRYA 3KXEC 3I04M 2JY7A 4DV5M 3KOXE 3KSXA 2K9DA 2WZJA 2KZUA 3ZH9B 1IN5A 2DZOB 1E94E 2G8LA 1MJGM 3A45A 3C9PA 3GLIA 3U6CA 2UXDM 2ZBKB 5KPTA 3R9XB 1NJFA 3FRIA 3GLFE 4GC5A 2DXIA 4DR7M 3U6PA 2K47A 1ZMUA 1A5TA 1XXHA 5IREB 3H4MA 3KOYE 1OFIA 1H6UA 4MGZE 4AG5A 1LTMA 1S3SA 4JI2M 3HX3A 2JP7A 4Z6YA 3HHWA 1TDHA 3TL4X 4LGYA 4MGHA 2KXEA 1V34A 3D8LA 3A42A 1QDTA 3VDPA 2I7NA 1EFUB 1MX0A 1NHWC 2Y20A 3SARA 4G4QA 3ZC7B 2JWSA 4GH9A 3T15A 1XC8A 3AOEC 2HL7A 1OJLA 3HKPA 1SG9A 3AJIB 4FVMA 3MMPA 3LQRA 3C3DA 2F5SA 3W68A 4JI1M 2HCBA 5IWAM 1IN4A 2CE7A 3J27B 3GRVA 5FTKA 3GO8A 2F4VM 4NXMM 2J7OA 1NVMA 5ITYA 4NL4H 1PJQA 2R18A 4UN2B 4W5WA 4B08A 4MGYE 5FTNA 4AKGA 1TH4A 3ILKA 3E9SA 2UUBM 1R7RA 1SXJD 4PT5A 2XFSA 3CF6E 4JI0M 3AFHA 1ZMVA 1I94M 1SXJA 4TUWA 1WJ7A 2P5TA 2WSCF 3FE3A 3BOSA 3KS8A 3PNYA 1KSFX 4II7A 3SFZA 2L09A 2LVOC 2VQFM 4F1IA 1JR3D 1YLAA 2DWLA 2DAEA 2KRUA 3HU1A 4LCBA 3TWMA 4LF8M 2X8AA 2EA0A 3B7NA 4P17A 1Z5BA 2DKLA 3VLFB 4JI4M 4LFBM 4PDGA 2D7GA 2B3TA 1PJJA 1QAMA 2VF8A 4DR6M 3HHXA 3H4JA 1T6OA 3HU3A 3GQ5A 1QAQA 3EIHA 2DI0A 2DHRA 5DNYA 2LVAA 3BXWA 3GLGA 3I4YA 1QQWA 2UUAM 3SHGB 1WGNA 3AV0A 1FNNA 2UU9M 2QHOB 2G3QA 2ERCA 1IBMM 2R65A 1OQYA 4QHSA 3J80S 5JI2E 2QCUA 4DR1M 3K2LA 4B7HA 4KT0F 3VFDA 2C9CA 3VDUA 3GLHB 4MM3B 4LG2A 5DYIA 1KYIA 3L29A 1IY0A 1G41A 2A5YB 3FTFA 4BB9A 3U5ZB 3GRUA 1G8PA 4I8OA 4DV4M 1ZQ9A 3LCVB 2JY6B 2EKKA 2DNAA 3PVSA 4IBCA 1IBKM 4DR4M 3GLIB 2V1CA 5A2QS 4DR2M 3U60A 1IXRC 5LMNM 2N35A 3IHPA 2G5GX 2GQFA 3FYDA 5DYGA 1DGFA 4B3TM 4NRVA 2L2DA 3D8BA 5ITXA 5GKNA 5C18A 3A46A 2CV2A 1XXHB 2WSFF 4LJ6A 1N34M 2L6OA 3MK6A 1G59A 4PDIA 3THGA 1R5LA 1D0KA 4JXJA 1QAOA 1NV9A 2E5LM 2YFQA 3I01M 4LY6A 4LFCM 1EIJA 1Q3BA 3LVWA 1J5EM 4L6V6 5BR8M 2NQ8C 3FTCA 2LH0A 1IM2A 3UK6A 3FKEA 4A3VB 4AW4A 2D7EA 5FLXS 2XEPA 3LMMA 4F2LA 2Y21A 1OAOC 3NBIA 4M0DA 4AI6A 1YE9A 3KOWE 3PXGA 1ZMWA 1RU3A 3K1JA 1GVNA 1C1KA 1HJPA 4FCVA 2VF7A 1XMQM 2X49A 4CJ6A 3IG5A 2C5RA 3L25A 1NO1A 2BWEA 3HU2A 1GJSA 1MU5A 2JZ1A 4CISA 1XMOM 2MGWA 4QNMA 2WSEF 1HR0M 3KP0E 4B3RM 4RF0A 4L78A 1GO5A 2F5QA 1CUKA 1FJGM 1TR8A 1VEJA 1J09A 1HQYE 4X66M 1JB0F 5E6JA 3FD9A 4LJ9A 3WHLA 3GLFA 2KHHA 1L1ZA 2L7HA 4G4OA 4JI8M 2RRUA 1QDRA 3KDSE 5KQDA 4IBJA 3GPYA 1DV0A 2R45A 4WW0A 1XB2B 1HT2E 3UMMA 4XBOA 1SXJB 3FYCA 3GLIE 1QZMA 4JI5M 2I7PA 2AHMA 2F5PA 2BJVA 2RGOA 1OAIA 4JI3M 4DUZM 2KRKA 4IJFA 2Q2EB 5ITUA 1L2CA 2CEAA 2D7HA 4IBKA 3U61A 3B7QA 2MH8A 4LF4M 1N32M 5FTJA 4L16A 3HWSA 3GPPA 2LVNC 4G4NA 4B3SM 1V33A 2H5XA 5EXPA 2Z4RA 2CV0A 2R4EA 1TH3A 3KOZE 1OFHA 7CATA 1G3IA 2R62A 2EUCA 4ZPXA 4LJ7A 2EO2A 1IQPA 4KO8A 3JAMS 1NNJA 1NY5A 2Z3XA 2M60A 1P3QQ 3I4VA 2O5RA 4M9XA 1T3TA 3GLGB 1G4AE 2O01F 1QUSA 2QZ4A 3KS4A 1IXZA 1VQ1A 4R7GA 4M9ZA 1XNQM 2LXEA 1R4GA 1V92A 3R8FA 3EIEA 2ZTDA 3FUWA 4DR5M 3J81S 4GEWA 2JXNA 2JNHA 1NY6A 1Q39A 3CTWB 2LWXA 4IBGA 4JI6M 3SHFA 1G71A 4P16A 3KVWA 1D2NA 3HJ8A 4DBGB 4HEOA 4XGIA 2ZTCA 1VDLA 2KNZA 1WXQA 3HY5A 3SASA 3TWKA 5JI3E 2CHGA 2LNHC 2UXBM 2XLJA 3SAUA 1GJTA 2ZAMA 3ZQJA 1SXJC 2APLA 3TPZA 4NSOB 1HNWM 4KLNA 2JA2A 5KO3A 1PJIA 3K92A 2XH9A 1OIZA 1TF0B 4REZA 1GL6A 3AKZA 1SXJE 3U60B 3RGSA 5IZ7D 3FRHA 4IBBA 1LV7A 3QYBA 2R44A 1ZAEA 3T6PA 4YHHM 5ITQA 2CUZA 3SBJA 3B7ZA 1DGHA 2Y0QA 2QBYB 2DAMA 3TWLA 1NV8A 2FH0A 1K82A 2M5ZA 1UM8A 3E46A 2K6BA 2KNAA 3HJQA 1YUBA 4JN6A 4JYAM 2DAIA 3VK8A 1JR3E 5EP4A 4CHTB 2ZANA 3B9PA 5KPZA 2YNMD 3RE8A 3DFZA 3W0LB 2J5YA 3UGJA 3U6OA 1KFVA 2QSFX 4I81A 2HHHM 4Z8XA 1IN8A 4PD2A 2XZUA 4LRTA 3HHYA 1PM5A 1GLNA 1NHGC 3HJSA 4B7GA 5IT9S 1IY2A 3B89A 4L15A 4LZZA 1Q02A 1Z5CA 3AL0C 2KW0A 1N33M 1WHCA 4S12A 3WHKA 3GPXA 4LGMA 2LVQD 3E4RA 1XNRM 3SAWA 3SATA 3CGWA 5LMUM 3JR5A 1QYRA 3L27A 1XHBA 3SMPA 4GITA 4GKJM 4FD2A 4LJ4A 4HL4A 2XF3A 3GQ4A 3U6QA 4L4UA 3RFWA 3LQQA 4DV0M 5EP3A 2KEBA 1L1TA 1IN6A 5FTLA 4OX9M 3A98B 5H37D 2L7IA 1JQJC 4M9SA 5EP2A 3V76A 4IBIA 4XK8F 4NXNM 1IBLM 1NSFA 4IBEA 2QP9X 4CIZA 4G6ZA 1PJTA 4X65M 3J2PB 4MGKE 3U61B 2CHVA 3I51A 1NNUC 2KZSA 2L4FA 4AQYM 1VDDA 3QWLA 4GC9A 5KPRA 1K3XA 5E26A 1ORYB 3T1HM 5EP1A 2UXCM 4JV5M 4RNAA 3UZUA 3ZCBB 3MHVC 2ZAOA 3SC3A 4M0WA 5ITRA 4K0KM 2YR0A 3MJ5A 3GLHE 1TDZA 2FFJA 1AIPC 4WP2A 4MGIE 1X37A 4CGYB 4LF9M 1QZEA 1PJSA 2DHYA 2QENA 4IIWA 2ZM6M 3VK7A 1L2DA 1VEKA 2FNAA 1OKSA 4NSRA 4AZFA 1GL7A 2OOAA 2JZ0A 3M7GA 4D82A 2DWZB 3U6MA 3E21A 4OW0A 4GKKM 2R0IA 5F3WA 1R6BX 3U5ZA 2DVWB 3GRRA 5EQTA 4LFAM 1DGGA 4KODA 2FS1A 4MB7A 3FTDA 2K0BX 2Z8YM 4OVZA 3U6LA 2CP8A 2O25A 3K8ZA 2V1UA 1C7YA 3K9PA 2F5OA 3Q8XA 2CV1A 2HAKA 4FCTA 2DWNA 3SYLA 1TH2A 5EJCA 1DO2A 4LRSA 1XXHE 3FUXA 2R4JA 3L26A 3KP1E 5EXXA 1Z59A 4LF6M 2BWBA 4D80A 1N77A 2CFOA 2V6ZM 2YQZA 1VEGA 4HLQA 4GMQA 2OO9A 4RF1A 3T38A 4RKUF 2LBCA 2LVPC 3GQ3A 3SAVA 4DV7M 1YSYA 3W0FA 3AOEA 1WR1B 3BBZA 1IXSA 2QPAA 3FUUA 3SYKA 2CWBA 3VKHA 5FSWA 1DGHB 2OOBA 4MH0E 1D0MA 5DFLA 4L8RC 4X64M 3DA1A 3DZDA 1TTEA 2GNOA 3FUVA 1QANA 4AG6A 4LF5M 1NJGA 3DOAA 4FWDA 1IN7A 2EJSA 2W82A 2RGHA 2R6FA 2XGNA 5C1BA 5BPVA 3HGIA 1R2YA 3KFUG 3Q8GA 4D81A 4JI7M 1I4WA 4AKHA 3RGPA 3LCUA 5L8RF 1N36M 4NRWA 1IY1A 3QAUA 4ITQA 4G3OA 4PCZA 1R2ZA 4I4LA 4FWHA 3C58A 1ZV1A 4WURA 1OIPA 2LTUA 3KSJA 1GKIA 4DV2M 2JY8A 2XFTA 4DUYM 1HT1E 1WGLA 3T1YM 3KW6A 2FE8A 4Q7JA 2XZFA 2R46A 4YY3M 2EKFA 2JY5A 2VDBB 3HZJA 2DAGA 1L8QA 1PGYA 2QQ8A 3L28A 1HQCA 4LJAA 4IBFA 4QNRA 4GIPA 4NC6A 3W67A 3TQSA 4Y28F 3GPUA 3U6SA 3UJNA 1F4IA 4IJEA 4LF7M 1D0LA 5EXSA 4R71A 3OTOM 1HNXM 1DGBA 1JR3A 1TGUA 3GLGE 2JUJA 3U6EA 4KHPM 1OTRA 1VG5A 1WIVA 3HHZA 1Z6TA 2VQEM 3QYEA 2HKJA
chains in the Genus database with same CATH topology
4QOSA 4FW9A 2C96A 1EE8A 4GRIA 4X62M 4DV1M 1QVRA 4B7FA 4B3MM 4GHLA 4EIWA 1W5TA 4DR3M 2VIIA 4FWGA 2C98A 3VKGA 4GHAA 3IG8A 4NOOB 8CATA 4BBAA 4FCWA 2Z4SA 3PNVA 3PFIA 2CHQA 3LVVA 3GLFB 4LJ5A 1K3WA 3FTEA 1HNZM 3J7BA 1XWIA 3U6DA 1J7KA 4I5SA 2FOIC 4OVZB 2F5NA 2BNKA 3CF0A 3FUTA 2Y0TA 4QOZC 1W5SA 3NWLA 5ITXE 2UUCM 1DO0A 4LJ8A 2C99A 4BLCA 1Z5AA 4G4RA 2KA6B 1E9SA 2XSZD 2C9OA 3M6AA 4IBDA 5ITTA 4OU7A 4LZJA 1N75A 2QBYA 5FTMA 3J7AS 2J7NA 1E9RA 3CF2A 4DV3M 2DWMA 2OPFA 2XSZA 1E32A 1N78A 3L2AA 4R3DA 3TE6A 1IXSB 1Q3CA 2DZNB 2Z7JA 1L2BA 3AOGA 3SMSA 2X4AA 2H1RA 2BJWA 2RKOA 4AKIA 5EXTA 3GLHA 4QHTA 5KQ8A 3GP1A 2OQ4A 3M0EA 4DV6M 3JR4A 3GRYA 3KXEC 4DV5M 3KOXE 3KSXA 3ZH9B 2KZUA 1IN5A 2DZOB 1E94E 2G8LA 3GLIA 3A45A 3U6CA 2UXDM 2ZBKB 5KPTA 3R9XB 1NJFA 4GC5A 2DXIA 4DR7M 3U6PA 2K47A 1XXHA 5IREB 3H4MA 3KOYE 1OFIA 1H6UA 4MGZE 4AG5A 1S3SA 4JI2M 4Z6YA 3HHWA 1TDHA 3TL4X 4LGYA 4MGHA 2KXEA 3D8LA 3A42A 3VDPA 2I7NA 1MX0A 1NHWC 2Y20A 3SARA 4G4QA 3ZC7B 4GH9A 3T15A 1XC8A 3AOEC 2HL7A 1OJLA 3HKPA 3AJIB 4FVMA 3LQRA 2F5SA 4JI1M 2HCBA 5IWAM 1IN4A 2CE7A 3J27B 3GRVA 5FTKA 3GO8A 2F4VM 4NXMM 2J7OA 1NVMA 5ITYA 4NL4H 4B08A 2R18A 4W5WA 4MGYE 5FTNA 4AKGA 1TH4A 3ILKA 3E9SA 2UUBM 1R7RA 1SXJD 4PT5A 2XFSA 3CF6E 4JI0M 3AFHA 1I94M 1SXJA 4TUWA 2P5TA 3KS8A 3BOSA 3PNYA 1KSFX 4II7A 3SFZA 2L09A 2VQFM 1JR3D 2DWLA 2KRUA 3HU1A 4LCBA 3TWMA 4LF8M 2X8AA 2EA0A 1Z5BA 3VLFB 4JI4M 4LFBM 4PDGA 2D7GA 1PJJA 1QAMA 4DR6M 3HHXA 3HU3A 3GQ5A 1QAQA 3EIHA 2DHRA 5DNYA 3GLGA 3I4YA 1QQWA 2UUAM 3SHGB 3AV0A 1FNNA 2UU9M 2ERCA 1IBMM 2R65A 4QHSA 3J80S 5JI2E 2QCUA 4DR1M 3K2LA 4B7HA 3VFDA 2C9CA 3VDUA 3GLHB 4MM3B 4LG2A 5DYIA 1KYIA 3L29A 1IY0A 1G41A 2A5YB 3FTFA 4BB9A 3U5ZB 3GRUA 1G8PA 4I8OA 4DV4M 1ZQ9A 3PVSA 4IBCA 1IBKM 4DR4M 3GLIB 2V1CA 5A2QS 4DR2M 3U60A 1IXRC 5LMNM 2G5GX 3FYDA 5DYGA 1DGFA 4B3TM 4NRVA 3D8BA 5ITXA 5GKNA 5C18A 3A46A 2CV2A 1XXHB 4LJ6A 1N34M 2L6OA 3MK6A 1G59A 4PDIA 3THGA 4JXJA 1QAOA 2E5LM 4LFCM 2YFQA 4LY6A 1Q3BA 3LVWA 1J5EM 5BR8M 2NQ8C 3FTCA 2LH0A 1IM2A 3UK6A 3FKEA 4A3VB 4AW4A 2D7EA 5FLXS 2XEPA 3LMMA 2Y21A 3NBIA 4M0DA 4AI6A 1YE9A 3KOWE 3PXGA 3K1JA 1GVNA 1C1KA 4FCVA 1XMQM 2X49A 2C5RA 3IG5A 3L25A 3HU2A 1MU5A 4CISA 1XMOM 4QNMA 1HR0M 3KP0E 4B3RM 4RF0A 4L78A 2F5QA 1FJGM 1J09A 1HQYE 4X66M 5E6JA 3FD9A 4LJ9A 3WHLA 3GLFA 1L1ZA 2L7HA 4G4OA 4JI8M 3KDSE 5KQDA 4IBJA 3GPYA 2R45A 4WW0A 3UMMA 1HT2E 4XBOA 3FYCA 1SXJB 4JI5M 1QZMA 2I7PA 2AHMA 2F5PA 2BJVA 2RGOA 4JI3M 4DUZM 2KRKA 4IJFA 2Q2EB 5ITUA 1L2CA 2CEAA 2D7HA 4IBKA 3U61A 4LF4M 1N32M 5FTJA 4L16A 3HWSA 3GPPA 4G4NA 4B3SM 5EXPA 2Z4RA 2CV0A 2R4EA 1TH3A 3KOZE 1OFHA 7CATA 1G3IA 2R62A 2EUCA 4ZPXA 4LJ7A 2EO2A 1IQPA 4KO8A 3JAMS 1NNJA 1NY5A 2Z3XA 2M60A 3I4VA 2O5RA 4M9XA 1T3TA 3GLGB 1G4AE 2QZ4A 3KS4A 4R7GA 1IXZA 4M9ZA 1XNQM 2LXEA 3R8FA 3EIEA 3FUWA 4DR5M 3J81S 1NY6A 1Q39A 3CTWB 2LWXA 4IBGA 4JI6M 3SHFA 4P16A 3KVWA 1D2NA 3HJ8A 4XGIA 1WXQA 3SASA 3TWKA 5JI3E 2CHGA 2LNHC 2UXBM 2XLJA 3SAUA 2ZAMA 1SXJC 3TPZA 4NSOB 1HNWM 4KLNA 2JA2A 5KO3A 1PJIA 3K92A 2XH9A 3AKZA 4REZA 1GL6A 1SXJE 3U60B 3RGSA 5IZ7D 4IBBA 1LV7A 1ZAEA 4YHHM 5ITQA 2CUZA 3SBJA 1DGHA 2Y0QA 2QBYB 3TWLA 1K82A 2M5ZA 1UM8A 3HJQA 1YUBA 4JN6A 4JYAM 3VK8A 5EP4A 4CHTB 2ZANA 3B9PA 5KPZA 2YNMD 3RE8A 3DFZA 3W0LB 3UGJA 1KFVA 3U6OA 4I81A 2HHHM 4Z8XA 1IN8A 4PD2A 2XZUA 4LRTA 3HHYA 1PM5A 1GLNA 1NHGC 3HJSA 4B7GA 5IT9S 1IY2A 4L15A 4LZZA 1Z5CA 1N33M 3AL0C 2KW0A 4S12A 3WHKA 3GPXA 4LGMA 3E4RA 1XNRM 3SAWA 3SATA 5LMUM 3JR5A 1QYRA 3L27A 1XHBA 3SMPA 4GITA 4GKJM 4FD2A 4LJ4A 4HL4A 2XF3A 3GQ4A 3U6QA 4L4UA 3RFWA 3LQQA 4DV0M 5EP3A 2KEBA 1L1TA 1IN6A 5FTLA 4OX9M 3A98B 5H37D 2L7IA 1JQJC 4M9SA 5EP2A 4IBIA 4NXNM 1IBLM 1NSFA 4IBEA 2QP9X 4G6ZA 4X65M 3J2PB 4MGKE 3U61B 2CHVA 3I51A 1NNUC 2KZSA 4AQYM 1VDDA 3QWLA 4GC9A 5KPRA 1K3XA 5E26A 1ORYB 3T1HM 5EP1A 2UXCM 4JV5M 4RNAA 3UZUA 3ZCBB 3MHVC 2ZAOA 3SC3A 4M0WA 5ITRA 4K0KM 2YR0A 3MJ5A 1TDZA 2FFJA 4MGIE 1X37A 4CGYB 4LF9M 4IIWA 1L2DA 3VK7A 2QENA 2ZM6M 2FNAA 4NSRA 4AZFA 1GL7A 3M7GA 4D82A 4GKKM 2DWZB 3U6MA 4OW0A 5F3WA 1R6BX 3U5ZA 2DVWB 3GRRA 5EQTA 4LFAM 1DGGA 4KODA 4MB7A 3FTDA 4OVZA 3U6LA 3K8ZA 2V1UA 2F5OA 3Q8XA 2CV1A 4FCTA 2DWNA 3SYLA 1TH2A 5EJCA 1DO2A 4LRSA 3FUXA 2R4JA 3L26A 3KP1E 5EXXA 1Z59A 4LF6M 4D80A 1N77A 2CFOA 2V6ZM 2YQZA 4HLQA 4GMQA 4RF1A 3T38A 3GQ3A 3SAVA 4DV7M 1YSYA 3W0FA 3AOEA 2QPAA 3FUUA 3SYKA 3VKHA 5FSWA 1DGHB 4MH0E 4L8RC 4X64M 3DA1A 3DZDA 3FUVA 1QANA 4AG6A 4LF5M 1NJGA 3DOAA 4FWDA 1IN7A 2W82A 2RGHA 2XGNA 5C1BA 5BPVA 3HGIA 1R2YA 3KFUG 4D81A 4JI7M 1I4WA 4AKHA 3RGPA 1N36M 4NRWA 1IY1A 3QAUA 4ITQA 4PCZA 1R2ZA 4I4LA 4FWHA 3C58A 4WURA 3KSJA 1GKIA 4DV2M 2XFTA 4DUYM 1HT1E 3T1YM 3KW6A 2FE8A 2XZFA 2R46A 4YY3M 1L8QA 3L28A 1HQCA 4LJAA 4IBFA 4QNRA 4GIPA 3TQSA 3GPUA 3U6SA 3UJNA 4IJEA 4LF7M 5EXSA 3OTOM 1HNXM 1DGBA 1JR3A 1TGUA 3U6EA 4KHPM 2VQEM 3HHZA 1Z6TA 2HKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 M;  2UUB M;  2F5P A;  1EE8 A;  4JI3 M;  4X62 M;  4JI0 M;  4DUZ M;  5ITU A;  2Q2E B;  4DV1 M;  1L2C A;  1I94 M;  4AQY M;  4B3M M;  1K3X A;  4DR3 M;  3T1H M;  4LF4 M;  2UXC M;  1N32 M;  4JV5 M;  3GPP A;  4G4N A;  4B3S M;  5ITR A;  2VQF M;  4K0K M;  1TDZ A;  1K3W A;  3JAM S;  3TWM A;  1HNZ M;  4LF9 M;  1NNJ A;  3VK7 A;  1L2D A;  2ZM6 M;  4LF8 M;  2EA0 A;  3U6D A;  1Z5B A;  4JI4 M;  4LFB M;  4GKK M;  4PDG A;  3U6M A;  2F5N A;  1PJJ A;  1XNQ M;  4DR6 M;  3GQ5 A;  4LFA M;  4DR5 M;  3J81 S;  5ITX E;  4MB7 A;  2UUC M;  3U6L A;  1Q39 A;  4JI6 M;  1Z5A A;  2F5O A;  2UUA M;  4G4R A;  5ITT A;  2UU9 M;  3J7A S;  1IBM M;  3J80 S;  4DV3 M;  2OPF A;  3SAS A;  3TWK A;  1Z59 A;  4DR1 M;  4LF6 M;  2UXB M;  1Q3C A;  3SAU A;  1L2B A;  1HNW M;  3GQ3 A;  3SAV A;  4DV7 M;  1PJI A;  3W0F A;  3GP1 A;  4DV6 M;  2OQ4 A;  4DV4 M;  3JR4 A;  1IBK M;  4DR4 M;  4DV5 M;  4X64 M;  4DR2 M;  5A2Q S;  5ITQ A;  4YHH M;  3SBJ A;  5LMN M;  4LF5 M;  3DOA A;  3TWL A;  4B3T M;  1K82 A;  4NRV A;  3A45 A;  5ITX A;  3U6C A;  1R2Y A;  2UXD M;  2ZBK B;  3A46 A;  3VK8 A;  4JYA M;  4JI7 M;  1N34 M;  4PDI A;  1KFV A;  4DR7 M;  3U6O A;  4LFC M;  2E5L M;  3U6P A;  1N36 M;  4NRW A;  2HHH M;  1Q3B A;  1J5E M;  4PD2 A;  2XZU A;  4ITQ A;  5BR8 M;  1PM5 A;  4PCZ A;  1R2Z A;  4JI2 M;  5IT9 S;  3C58 A;  1TDH A;  5FLX S;  1Z5C A;  1N33 M;  3GPX A;  3A42 A;  1XNR M;  4DV2 M;  3SAW A;  4DUY M;  3SAT A;  3T1Y M;  5LMU M;  1MX0 A;  3SAR A;  4G4Q A;  3JR5 A;  2XZF A;  4YY3 M;  1XMQ M;  1XC8 A;  4GKJ M;  1MU5 A;  4CIS A;  3GQ4 A;  1XMO M;  3U6Q A;  1HR0 M;  4DV0 M;  4B3R M;  1L1T A;  2F5Q A;  2F5S A;  1FJG M;  3GPU A;  3U6S A;  4JI1 M;  4LF7 M;  4OX9 M;  4X66 M;  5IWA M;  3OTO M;  1HNX M;  1L1Z A;  4G4O A;  4JI8 M;  3GO8 A;  3U6E A;  2F4V M;  4KHP M;  3GPY A;  4NXM M;  5ITY A;  4NXN M;  1IBL M;  2VQE M;  4JI5 M;  2HKJ A; 
#chains in the Genus database with same CATH topology
 4QOS A;  4FW9 A;  2C96 A;  1GAB A;  1EE8 A;  4GRI A;  4X62 M;  4DV1 M;  1QVR A;  2KDL A;  4B7F A;  3F92 A;  2DEN A;  4EIW A;  1UFZ A;  4B3M M;  1W5T A;  4DR3 M;  4GHL A;  2VII A;  4FWG A;  2C98 A;  2CRU A;  3VKG A;  4GHA A;  3IG8 A;  2MJ5 B;  2QNJ A;  3C3E A;  3K9O A;  3B74 A;  4NOO B;  4ANR A;  4BBA A;  1QUT A;  8CAT A;  4FCW A;  3LW5 F;  2HWJ A;  2Z4S A;  3PNV A;  3PFI A;  2CHQ A;  2L4E A;  3LVV A;  4LJ5 A;  3GLF B;  3IEC A;  2DZL A;  1K3W A;  3FTE A;  1HNZ M;  3J7B A;  1XWI A;  3NBX X;  3U6D A;  1J7K A;  4I5S A;  2FOI C;  4OVZ B;  2LHC A;  2F5N A;  2BNK A;  3CF0 A;  3FUT A;  1MN3 A;  1PRB A;  2Y0T A;  4QOZ C;  1Y8G A;  1W5S A;  3NWL A;  5ITX E;  2UUC M;  1DO0 A;  4LJ8 A;  2DAK A;  2C99 A;  1IFY A;  4BLC A;  1BVS A;  1Z5A A;  4G4R A;  2KA6 B;  1E9S A;  2XSZ D;  2C9O A;  3M6A A;  4IBD A;  5ITT A;  4OU7 A;  4LZJ A;  1N75 A;  2QBY A;  5FTM A;  3J7A S;  2J7N A;  1E9R A;  3CF2 A;  4DV3 M;  2DWM A;  2OPF A;  2XSZ A;  2KNV A;  1E32 A;  1N78 A;  3L2A A;  4R3D A;  3TE6 A;  1IXS B;  1Q3C A;  2DZN B;  2Z7J A;  1L2B A;  1T43 A;  1AUA A;  3AOG A;  3SMS A;  2X4A A;  2LHG A;  2H1R A;  2BJW A;  2RKO A;  4AKI A;  5EXT A;  2MR9 A;  3GLH A;  4QHT A;  5KQ8 A;  2MRO B;  3M0E A;  3GP1 A;  2OQ4 A;  4DV6 M;  3JR4 A;  3GRY A;  3KXE C;  3I04 M;  2JY7 A;  4DV5 M;  3KOX E;  3KSX A;  2K9D A;  2WZJ A;  2KZU A;  3ZH9 B;  1IN5 A;  2DZO B;  1E94 E;  2G8L A;  1MJG M;  3A45 A;  3C9P A;  3GLI A;  3U6C A;  2UXD M;  2ZBK B;  5KPT A;  3R9X B;  1NJF A;  3FRI A;  3GLF E;  4GC5 A;  2DXI A;  4DR7 M;  3U6P A;  2K47 A;  1ZMU A;  1A5T A;  1XXH A;  5IRE B;  3H4M A;  3KOY E;  1OFI A;  1H6U A;  4MGZ E;  4AG5 A;  1LTM A;  1S3S A;  4JI2 M;  3HX3 A;  2JP7 A;  4Z6Y A;  3HHW A;  1TDH A;  3TL4 X;  4LGY A;  4MGH A;  2KXE A;  1V34 A;  3D8L A;  3A42 A;  1QDT A;  3VDP A;  2I7N A;  1EFU B;  1MX0 A;  1NHW C;  2Y20 A;  3SAR A;  4G4Q A;  3ZC7 B;  2JWS A;  4GH9 A;  3T15 A;  1XC8 A;  3AOE C;  2HL7 A;  1OJL A;  3HKP A;  1SG9 A;  3AJI B;  4FVM A;  3MMP A;  3LQR A;  3C3D A;  2F5S A;  3W68 A;  4JI1 M;  2HCB A;  5IWA M;  1IN4 A;  2CE7 A;  3J27 B;  3GRV A;  5FTK A;  3GO8 A;  2F4V M;  4NXM M;  2J7O A;  1NVM A;  5ITY A;  4NL4 H;  1PJQ A;  2R18 A;  4UN2 B;  4W5W A;  4B08 A;  4MGY E;  5FTN A;  4AKG A;  1TH4 A;  3ILK A;  3E9S A;  2UUB M;  1R7R A;  1SXJ D;  4PT5 A;  2XFS A;  3CF6 E;  4JI0 M;  3AFH A;  1ZMV A;  1I94 M;  1SXJ A;  4TUW A;  1WJ7 A;  2P5T A;  2WSC F;  3FE3 A;  3BOS A;  3KS8 A;  3PNY A;  1KSF X;  4II7 A;  3SFZ A;  2L09 A;  2LVO C;  2VQF M;  4F1I A;  1JR3 D;  1YLA A;  2DWL A;  2DAE A;  2KRU A;  3HU1 A;  4LCB A;  3TWM A;  4LF8 M;  2X8A A;  2EA0 A;  3B7N A;  4P17 A;  1Z5B A;  2DKL A;  3VLF B;  4JI4 M;  4LFB M;  4PDG A;  2D7G A;  2B3T A;  1PJJ A;  1QAM A;  2VF8 A;  4DR6 M;  3HHX A;  3H4J A;  1T6O A;  3HU3 A;  3GQ5 A;  1QAQ A;  3EIH A;  2DI0 A;  2DHR A;  5DNY A;  2LVA A;  3BXW A;  3GLG A;  3I4Y A;  1QQW A;  2UUA M;  3SHG B;  1WGN A;  3AV0 A;  1FNN A;  2UU9 M;  2QHO B;  2G3Q A;  2ERC A;  1IBM M;  2R65 A;  1OQY A;  4QHS A;  3J80 S;  5JI2 E;  2QCU A;  4DR1 M;  3K2L A;  4B7H A;  4KT0 F;  3VFD A;  2C9C A;  3VDU A;  3GLH B;  4MM3 B;  4LG2 A;  5DYI A;  1KYI A;  3L29 A;  1IY0 A;  1G41 A;  2A5Y B;  3FTF A;  4BB9 A;  3U5Z B;  3GRU A;  1G8P A;  4I8O A;  4DV4 M;  1ZQ9 A;  3LCV B;  2JY6 B;  2EKK A;  2DNA A;  3PVS A;  4IBC A;  1IBK M;  4DR4 M;  3GLI B;  2V1C A;  5A2Q S;  4DR2 M;  3U60 A;  1IXR C;  5LMN M;  2N35 A;  3IHP A;  2G5G X;  2GQF A;  3FYD A;  5DYG A;  1DGF A;  4B3T M;  4NRV A;  2L2D A;  3D8B A;  5ITX A;  5GKN A;  5C18 A;  3A46 A;  2CV2 A;  1XXH B;  2WSF F;  4LJ6 A;  1N34 M;  2L6O A;  3MK6 A;  1G59 A;  4PDI A;  3THG A;  1R5L A;  1D0K A;  4JXJ A;  1QAO A;  1NV9 A;  2E5L M;  2YFQ A;  3I01 M;  4LY6 A;  4LFC M;  1EIJ A;  1Q3B A;  3LVW A;  1J5E M;  4L6V 6;  5BR8 M;  2NQ8 C;  3FTC A;  2LH0 A;  1IM2 A;  3UK6 A;  3FKE A;  4A3V B;  4AW4 A;  2D7E A;  5FLX S;  2XEP A;  3LMM A;  4F2L A;  2Y21 A;  1OAO C;  3NBI A;  4M0D A;  4AI6 A;  1YE9 A;  3KOW E;  3PXG A;  1ZMW A;  1RU3 A;  3K1J A;  1GVN A;  1C1K A;  1HJP A;  4FCV A;  2VF7 A;  1XMQ M;  2X49 A;  4CJ6 A;  3IG5 A;  2C5R A;  3L25 A;  1NO1 A;  2BWE A;  3HU2 A;  1GJS A;  1MU5 A;  2JZ1 A;  4CIS A;  1XMO M;  2MGW A;  4QNM A;  2WSE F;  1HR0 M;  3KP0 E;  4B3R M;  4RF0 A;  4L78 A;  1GO5 A;  2F5Q A;  1CUK A;  1FJG M;  1TR8 A;  1VEJ A;  1J09 A;  1HQY E;  4X66 M;  1JB0 F;  5E6J A;  3FD9 A;  4LJ9 A;  3WHL A;  3GLF A;  2KHH A;  1L1Z A;  2L7H A;  4G4O A;  4JI8 M;  2RRU A;  1QDR A;  3KDS E;  5KQD A;  4IBJ A;  3GPY A;  1DV0 A;  2R45 A;  4WW0 A;  1XB2 B;  1HT2 E;  3UMM A;  4XBO A;  1SXJ B;  3FYC A;  3GLI E;  1QZM A;  4JI5 M;  2I7P A;  2AHM A;  2F5P A;  2BJV A;  2RGO A;  1OAI A;  4JI3 M;  4DUZ M;  2KRK A;  4IJF A;  2Q2E B;  5ITU A;  1L2C A;  2CEA A;  2D7H A;  4IBK A;  3U61 A;  3B7Q A;  2MH8 A;  4LF4 M;  1N32 M;  5FTJ A;  4L16 A;  3HWS A;  3GPP A;  2LVN C;  4G4N A;  4B3S M;  1V33 A;  2H5X A;  5EXP A;  2Z4R A;  2CV0 A;  2R4E A;  1TH3 A;  3KOZ E;  1OFH A;  7CAT A;  1G3I A;  2R62 A;  2EUC A;  4ZPX A;  4LJ7 A;  2EO2 A;  1IQP A;  4KO8 A;  3JAM S;  1NNJ A;  1NY5 A;  2Z3X A;  2M60 A;  1P3Q Q;  3I4V A;  2O5R A;  4M9X A;  1T3T A;  3GLG B;  1G4A E;  2O01 F;  1QUS A;  2QZ4 A;  3KS4 A;  1IXZ A;  1VQ1 A;  4R7G A;  4M9Z A;  1XNQ M;  2LXE A;  1R4G A;  1V92 A;  3R8F A;  3EIE A;  2ZTD A;  3FUW A;  4DR5 M;  3J81 S;  4GEW A;  2JXN A;  2JNH A;  1NY6 A;  1Q39 A;  3CTW B;  2LWX A;  4IBG A;  4JI6 M;  3SHF A;  1G71 A;  4P16 A;  3KVW A;  1D2N A;  3HJ8 A;  4DBG B;  4HEO A;  4XGI A;  2ZTC A;  1VDL A;  2KNZ A;  1WXQ A;  3HY5 A;  3SAS A;  3TWK A;  5JI3 E;  2CHG A;  2LNH C;  2UXB M;  2XLJ A;  3SAU A;  1GJT A;  2ZAM A;  3ZQJ A;  1SXJ C;  2APL A;  3TPZ A;  4NSO B;  1HNW M;  4KLN A;  2JA2 A;  5KO3 A;  1PJI A;  3K92 A;  2XH9 A;  1OIZ A;  1TF0 B;  4REZ A;  1GL6 A;  3AKZ A;  1SXJ E;  3U60 B;  3RGS A;  5IZ7 D;  3FRH A;  4IBB A;  1LV7 A;  3QYB A;  2R44 A;  1ZAE A;  3T6P A;  4YHH M;  5ITQ A;  2CUZ A;  3SBJ A;  3B7Z A;  1DGH A;  2Y0Q A;  2QBY B;  2DAM A;  3TWL A;  1NV8 A;  2FH0 A;  1K82 A;  2M5Z A;  1UM8 A;  3E46 A;  2K6B A;  2KNA A;  3HJQ A;  1YUB A;  4JN6 A;  4JYA M;  2DAI A;  3VK8 A;  1JR3 E;  5EP4 A;  4CHT B;  2ZAN A;  3B9P A;  5KPZ A;  2YNM D;  3RE8 A;  3DFZ A;  3W0L B;  2J5Y A;  3UGJ A;  3U6O A;  1KFV A;  2QSF X;  4I81 A;  2HHH M;  4Z8X A;  1IN8 A;  4PD2 A;  2XZU A;  4LRT A;  3HHY A;  1PM5 A;  1GLN A;  1NHG C;  3HJS A;  4B7G A;  5IT9 S;  1IY2 A;  3B89 A;  4L15 A;  4LZZ A;  1Q02 A;  1Z5C A;  3AL0 C;  2KW0 A;  1N33 M;  1WHC A;  4S12 A;  3WHK A;  3GPX A;  4LGM A;  2LVQ D;  3E4R A;  1XNR M;  3SAW A;  3SAT A;  3CGW A;  5LMU M;  3JR5 A;  1QYR A;  3L27 A;  1XHB A;  3SMP A;  4GIT A;  4GKJ M;  4FD2 A;  4LJ4 A;  4HL4 A;  2XF3 A;  3GQ4 A;  3U6Q A;  4L4U A;  3RFW A;  3LQQ A;  4DV0 M;  5EP3 A;  2KEB A;  1L1T A;  1IN6 A;  5FTL A;  4OX9 M;  3A98 B;  5H37 D;  2L7I A;  1JQJ C;  4M9S A;  5EP2 A;  3V76 A;  4IBI A;  4XK8 F;  4NXN M;  1IBL M;  1NSF A;  4IBE A;  2QP9 X;  4CIZ A;  4G6Z A;  1PJT A;  4X65 M;  3J2P B;  4MGK E;  3U61 B;  2CHV A;  3I51 A;  1NNU C;  2KZS A;  2L4F A;  4AQY M;  1VDD A;  3QWL A;  4GC9 A;  5KPR A;  1K3X A;  5E26 A;  1ORY B;  3T1H M;  5EP1 A;  2UXC M;  4JV5 M;  4RNA A;  3UZU A;  3ZCB B;  3MHV C;  2ZAO A;  3SC3 A;  4M0W A;  5ITR A;  4K0K M;  2YR0 A;  3MJ5 A;  3GLH E;  1TDZ A;  2FFJ A;  1AIP C;  4WP2 A;  4MGI E;  1X37 A;  4CGY B;  4LF9 M;  1QZE A;  1PJS A;  2DHY A;  2QEN A;  4IIW A;  2ZM6 M;  3VK7 A;  1L2D A;  1VEK A;  2FNA A;  1OKS A;  4NSR A;  4AZF A;  1GL7 A;  2OOA A;  2JZ0 A;  3M7G A;  4D82 A;  2DWZ B;  3U6M A;  3E21 A;  4OW0 A;  4GKK M;  2R0I A;  5F3W A;  1R6B X;  3U5Z A;  2DVW B;  3GRR A;  5EQT A;  4LFA M;  1DGG A;  4KOD A;  2FS1 A;  4MB7 A;  3FTD A;  2K0B X;  2Z8Y M;  4OVZ A;  3U6L A;  2CP8 A;  2O25 A;  3K8Z A;  2V1U A;  1C7Y A;  3K9P A;  2F5O A;  3Q8X A;  2CV1 A;  2HAK A;  4FCT A;  2DWN A;  3SYL A;  1TH2 A;  5EJC A;  1DO2 A;  4LRS A;  1XXH E;  3FUX A;  2R4J A;  3L26 A;  3KP1 E;  5EXX A;  1Z59 A;  4LF6 M;  2BWB A;  4D80 A;  1N77 A;  2CFO A;  2V6Z M;  2YQZ A;  1VEG A;  4HLQ A;  4GMQ A;  2OO9 A;  4RF1 A;  3T38 A;  4RKU F;  2LBC A;  2LVP C;  3GQ3 A;  3SAV A;  4DV7 M;  1YSY A;  3W0F A;  3AOE A;  1WR1 B;  3BBZ A;  1IXS A;  2QPA A;  3FUU A;  3SYK A;  2CWB A;  3VKH A;  5FSW A;  1DGH B;  2OOB A;  4MH0 E;  1D0M A;  5DFL A;  4L8R C;  4X64 M;  3DA1 A;  3DZD A;  1TTE A;  2GNO A;  3FUV A;  1QAN A;  4AG6 A;  4LF5 M;  1NJG A;  3DOA A;  4FWD A;  1IN7 A;  2EJS A;  2W82 A;  2RGH A;  2R6F A;  2XGN A;  5C1B A;  5BPV A;  3HGI A;  1R2Y A;  3KFU G;  3Q8G A;  4D81 A;  4JI7 M;  1I4W A;  4AKH A;  3RGP A;  3LCU A;  5L8R F;  1N36 M;  4NRW A;  1IY1 A;  3QAU A;  4ITQ A;  4G3O A;  4PCZ A;  1R2Z A;  4I4L A;  4FWH A;  3C58 A;  1ZV1 A;  4WUR A;  1OIP A;  2LTU A;  3KSJ A;  1GKI A;  4DV2 M;  2JY8 A;  2XFT A;  4DUY M;  1HT1 E;  1WGL A;  3T1Y M;  3KW6 A;  2FE8 A;  4Q7J A;  2XZF A;  2R46 A;  4YY3 M;  2EKF A;  2JY5 A;  2VDB B;  3HZJ A;  2DAG A;  1L8Q A;  1PGY A;  2QQ8 A;  3L28 A;  1HQC A;  4LJA A;  4IBF A;  4QNR A;  4GIP A;  4NC6 A;  3W67 A;  3TQS A;  4Y28 F;  3GPU A;  3U6S A;  3UJN A;  1F4I A;  4IJE A;  4LF7 M;  1D0L A;  5EXS A;  4R71 A;  3OTO M;  1HNX M;  1DGB A;  1JR3 A;  1TGU A;  3GLG E;  2JUJ A;  3U6E A;  4KHP M;  1OTR A;  1VG5 A;  1WIV A;  3HHZ A;  1Z6T A;  2VQE M;  3QYE A;  2HKJ A; 
#chains in the Genus database with same CATH homology
 4QOS A;  4FW9 A;  2C96 A;  1EE8 A;  4GRI A;  4X62 M;  4DV1 M;  1QVR A;  4B7F A;  4B3M M;  4GHL A;  4EIW A;  1W5T A;  4DR3 M;  2VII A;  4FWG A;  2C98 A;  3VKG A;  4GHA A;  3IG8 A;  4NOO B;  8CAT A;  4BBA A;  4FCW A;  2Z4S A;  3PNV A;  3PFI A;  2CHQ A;  3LVV A;  3GLF B;  4LJ5 A;  1K3W A;  3FTE A;  1HNZ M;  3J7B A;  1XWI A;  3U6D A;  1J7K A;  4I5S A;  2FOI C;  4OVZ B;  2F5N A;  2BNK A;  3CF0 A;  3FUT A;  2Y0T A;  4QOZ C;  1W5S A;  3NWL A;  5ITX E;  2UUC M;  1DO0 A;  4LJ8 A;  2C99 A;  4BLC A;  1Z5A A;  4G4R A;  2KA6 B;  1E9S A;  2XSZ D;  2C9O A;  3M6A A;  4IBD A;  5ITT A;  4OU7 A;  4LZJ A;  1N75 A;  2QBY A;  5FTM A;  3J7A S;  2J7N A;  1E9R A;  3CF2 A;  4DV3 M;  2DWM A;  2OPF A;  2XSZ A;  1E32 A;  1N78 A;  3L2A A;  4R3D A;  3TE6 A;  1IXS B;  1Q3C A;  2DZN B;  2Z7J A;  1L2B A;  3AOG A;  3SMS A;  2X4A A;  2H1R A;  2BJW A;  2RKO A;  4AKI A;  5EXT A;  3GLH A;  4QHT A;  5KQ8 A;  3GP1 A;  2OQ4 A;  3M0E A;  4DV6 M;  3JR4 A;  3GRY A;  3KXE C;  4DV5 M;  3KOX E;  3KSX A;  3ZH9 B;  2KZU A;  1IN5 A;  2DZO B;  1E94 E;  2G8L A;  3GLI A;  3A45 A;  3U6C A;  2UXD M;  2ZBK B;  5KPT A;  3R9X B;  1NJF A;  4GC5 A;  2DXI A;  4DR7 M;  3U6P A;  2K47 A;  1XXH A;  5IRE B;  3H4M A;  3KOY E;  1OFI A;  1H6U A;  4MGZ E;  4AG5 A;  1S3S A;  4JI2 M;  4Z6Y A;  3HHW A;  1TDH A;  3TL4 X;  4LGY A;  4MGH A;  2KXE A;  3D8L A;  3A42 A;  3VDP A;  2I7N A;  1MX0 A;  1NHW C;  2Y20 A;  3SAR A;  4G4Q A;  3ZC7 B;  4GH9 A;  3T15 A;  1XC8 A;  3AOE C;  2HL7 A;  1OJL A;  3HKP A;  3AJI B;  4FVM A;  3LQR A;  2F5S A;  4JI1 M;  2HCB A;  5IWA M;  1IN4 A;  2CE7 A;  3J27 B;  3GRV A;  5FTK A;  3GO8 A;  2F4V M;  4NXM M;  2J7O A;  1NVM A;  5ITY A;  4NL4 H;  4B08 A;  2R18 A;  4W5W A;  4MGY E;  5FTN A;  4AKG A;  1TH4 A;  3ILK A;  3E9S A;  2UUB M;  1R7R A;  1SXJ D;  4PT5 A;  2XFS A;  3CF6 E;  4JI0 M;  3AFH A;  1I94 M;  1SXJ A;  4TUW A;  2P5T A;  3KS8 A;  3BOS A;  3PNY A;  1KSF X;  4II7 A;  3SFZ A;  2L09 A;  2VQF M;  1JR3 D;  2DWL A;  2KRU A;  3HU1 A;  4LCB A;  3TWM A;  4LF8 M;  2X8A A;  2EA0 A;  1Z5B A;  3VLF B;  4JI4 M;  4LFB M;  4PDG A;  2D7G A;  1PJJ A;  1QAM A;  4DR6 M;  3HHX A;  3HU3 A;  3GQ5 A;  1QAQ A;  3EIH A;  2DHR A;  5DNY A;  3GLG A;  3I4Y A;  1QQW A;  2UUA M;  3SHG B;  3AV0 A;  1FNN A;  2UU9 M;  2ERC A;  1IBM M;  2R65 A;  4QHS A;  3J80 S;  5JI2 E;  2QCU A;  4DR1 M;  3K2L A;  4B7H A;  3VFD A;  2C9C A;  3VDU A;  3GLH B;  4MM3 B;  4LG2 A;  5DYI A;  1KYI A;  3L29 A;  1IY0 A;  1G41 A;  2A5Y B;  3FTF A;  4BB9 A;  3U5Z B;  3GRU A;  1G8P A;  4I8O A;  4DV4 M;  1ZQ9 A;  3PVS A;  4IBC A;  1IBK M;  4DR4 M;  3GLI B;  2V1C A;  5A2Q S;  4DR2 M;  3U60 A;  1IXR C;  5LMN M;  2G5G X;  3FYD A;  5DYG A;  1DGF A;  4B3T M;  4NRV A;  3D8B A;  5ITX A;  5GKN A;  5C18 A;  3A46 A;  2CV2 A;  1XXH B;  4LJ6 A;  1N34 M;  2L6O A;  3MK6 A;  1G59 A;  4PDI A;  3THG A;  4JXJ A;  1QAO A;  2E5L M;  4LFC M;  2YFQ A;  4LY6 A;  1Q3B A;  3LVW A;  1J5E M;  5BR8 M;  2NQ8 C;  3FTC A;  2LH0 A;  1IM2 A;  3UK6 A;  3FKE A;  4A3V B;  4AW4 A;  2D7E A;  5FLX S;  2XEP A;  3LMM A;  2Y21 A;  3NBI A;  4M0D A;  4AI6 A;  1YE9 A;  3KOW E;  3PXG A;  3K1J A;  1GVN A;  1C1K A;  4FCV A;  1XMQ M;  2X49 A;  2C5R A;  3IG5 A;  3L25 A;  3HU2 A;  1MU5 A;  4CIS A;  1XMO M;  4QNM A;  1HR0 M;  3KP0 E;  4B3R M;  4RF0 A;  4L78 A;  2F5Q A;  1FJG M;  1J09 A;  1HQY E;  4X66 M;  5E6J A;  3FD9 A;  4LJ9 A;  3WHL A;  3GLF A;  1L1Z A;  2L7H A;  4G4O A;  4JI8 M;  3KDS E;  5KQD A;  4IBJ A;  3GPY A;  2R45 A;  4WW0 A;  3UMM A;  1HT2 E;  4XBO A;  3FYC A;  1SXJ B;  4JI5 M;  1QZM A;  2I7P A;  2AHM A;  2F5P A;  2BJV A;  2RGO A;  4JI3 M;  4DUZ M;  2KRK A;  4IJF A;  2Q2E B;  5ITU A;  1L2C A;  2CEA A;  2D7H A;  4IBK A;  3U61 A;  4LF4 M;  1N32 M;  5FTJ A;  4L16 A;  3HWS A;  3GPP A;  4G4N A;  4B3S M;  5EXP A;  2Z4R A;  2CV0 A;  2R4E A;  1TH3 A;  3KOZ E;  1OFH A;  7CAT A;  1G3I A;  2R62 A;  2EUC A;  4ZPX A;  4LJ7 A;  2EO2 A;  1IQP A;  4KO8 A;  3JAM S;  1NNJ A;  1NY5 A;  2Z3X A;  2M60 A;  3I4V A;  2O5R A;  4M9X A;  1T3T A;  3GLG B;  1G4A E;  2QZ4 A;  3KS4 A;  4R7G A;  1IXZ A;  4M9Z A;  1XNQ M;  2LXE A;  3R8F A;  3EIE A;  3FUW A;  4DR5 M;  3J81 S;  1NY6 A;  1Q39 A;  3CTW B;  2LWX A;  4IBG A;  4JI6 M;  3SHF A;  4P16 A;  3KVW A;  1D2N A;  3HJ8 A;  4XGI A;  1WXQ A;  3SAS A;  3TWK A;  5JI3 E;  2CHG A;  2LNH C;  2UXB M;  2XLJ A;  3SAU A;  2ZAM A;  1SXJ C;  3TPZ A;  4NSO B;  1HNW M;  4KLN A;  2JA2 A;  5KO3 A;  1PJI A;  3K92 A;  2XH9 A;  3AKZ A;  4REZ A;  1GL6 A;  1SXJ E;  3U60 B;  3RGS A;  5IZ7 D;  4IBB A;  1LV7 A;  1ZAE A;  4YHH M;  5ITQ A;  2CUZ A;  3SBJ A;  1DGH A;  2Y0Q A;  2QBY B;  3TWL A;  1K82 A;  2M5Z A;  1UM8 A;  3HJQ A;  1YUB A;  4JN6 A;  4JYA M;  3VK8 A;  5EP4 A;  4CHT B;  2ZAN A;  3B9P A;  5KPZ A;  2YNM D;  3RE8 A;  3DFZ A;  3W0L B;  3UGJ A;  1KFV A;  3U6O A;  4I81 A;  2HHH M;  4Z8X A;  1IN8 A;  4PD2 A;  2XZU A;  4LRT A;  3HHY A;  1PM5 A;  1GLN A;  1NHG C;  3HJS A;  4B7G A;  5IT9 S;  1IY2 A;  4L15 A;  4LZZ A;  1Z5C A;  1N33 M;  3AL0 C;  2KW0 A;  4S12 A;  3WHK A;  3GPX A;  4LGM A;  3E4R A;  1XNR M;  3SAW A;  3SAT A;  5LMU M;  3JR5 A;  1QYR A;  3L27 A;  1XHB A;  3SMP A;  4GIT A;  4GKJ M;  4FD2 A;  4LJ4 A;  4HL4 A;  2XF3 A;  3GQ4 A;  3U6Q A;  4L4U A;  3RFW A;  3LQQ A;  4DV0 M;  5EP3 A;  2KEB A;  1L1T A;  1IN6 A;  5FTL A;  4OX9 M;  3A98 B;  5H37 D;  2L7I A;  1JQJ C;  4M9S A;  5EP2 A;  4IBI A;  4NXN M;  1IBL M;  1NSF A;  4IBE A;  2QP9 X;  4G6Z A;  4X65 M;  3J2P B;  4MGK E;  3U61 B;  2CHV A;  3I51 A;  1NNU C;  2KZS A;  4AQY M;  1VDD A;  3QWL A;  4GC9 A;  5KPR A;  1K3X A;  5E26 A;  1ORY B;  3T1H M;  5EP1 A;  2UXC M;  4JV5 M;  4RNA A;  3UZU A;  3ZCB B;  3MHV C;  2ZAO A;  3SC3 A;  4M0W A;  5ITR A;  4K0K M;  2YR0 A;  3MJ5 A;  1TDZ A;  2FFJ A;  4MGI E;  1X37 A;  4CGY B;  4LF9 M;  4IIW A;  1L2D A;  3VK7 A;  2QEN A;  2ZM6 M;  2FNA A;  4NSR A;  4AZF A;  1GL7 A;  3M7G A;  4D82 A;  4GKK M;  2DWZ B;  3U6M A;  4OW0 A;  5F3W A;  1R6B X;  3U5Z A;  2DVW B;  3GRR A;  5EQT A;  4LFA M;  1DGG A;  4KOD A;  4MB7 A;  3FTD A;  4OVZ A;  3U6L A;  3K8Z A;  2V1U A;  2F5O A;  3Q8X A;  2CV1 A;  4FCT A;  2DWN A;  3SYL A;  1TH2 A;  5EJC A;  1DO2 A;  4LRS A;  3FUX A;  2R4J A;  3L26 A;  3KP1 E;  5EXX A;  1Z59 A;  4LF6 M;  4D80 A;  1N77 A;  2CFO A;  2V6Z M;  2YQZ A;  4HLQ A;  4GMQ A;  4RF1 A;  3T38 A;  3GQ3 A;  3SAV A;  4DV7 M;  1YSY A;  3W0F A;  3AOE A;  2QPA A;  3FUU A;  3SYK A;  3VKH A;  5FSW A;  1DGH B;  4MH0 E;  4L8R C;  4X64 M;  3DA1 A;  3DZD A;  3FUV A;  1QAN A;  4AG6 A;  4LF5 M;  1NJG A;  3DOA A;  4FWD A;  1IN7 A;  2W82 A;  2RGH A;  2XGN A;  5C1B A;  5BPV A;  3HGI A;  1R2Y A;  3KFU G;  4D81 A;  4JI7 M;  1I4W A;  4AKH A;  3RGP A;  1N36 M;  4NRW A;  1IY1 A;  3QAU A;  4ITQ A;  4PCZ A;  1R2Z A;  4I4L A;  4FWH A;  3C58 A;  4WUR A;  3KSJ A;  1GKI A;  4DV2 M;  2XFT A;  4DUY M;  1HT1 E;  3T1Y M;  3KW6 A;  2FE8 A;  2XZF A;  2R46 A;  4YY3 M;  1L8Q A;  3L28 A;  1HQC A;  4LJA A;  4IBF A;  4QNR A;  4GIP A;  3TQS A;  3GPU A;  3U6S A;  3UJN A;  4IJE A;  4LF7 M;  5EXS A;  3OTO M;  1HNX M;  1DGB A;  1JR3 A;  1TGU A;  3U6E A;  4KHP M;  2VQE M;  3HHZ A;  1Z6T A;  2HKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...