3T1YM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t1yM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3t1yM02
1Q3CA 1N36M 3U6CA 3DOAA 1Z5CA 4PDIA 4DR2M 4B3RM 2OPFA 2F5NA 4DR6M 2HKJA 2UXBM 3U6QA 4PD2A 1XNQM 3OTOM 3T1YM 4LF4M 5ITUA 1L2CA 2UU9M 4MB7A 1FJGM 1K3WA 1L2DA 2UUAM 1R2ZA 4YY3M 2XZUA 4LF7M 3C58A 1TDZA 3U6MA 3TWLA 4DV1M 4B3TM 4LF8M 1Z5BA 5ITXE 3VK7A 5LMNM 4DV6M 3GQ5A 4LF5M 1EE8A 4JI3M 5ITRA 3GQ3A 1IBKM 4JI4M 4DV5M 4DR3M 1MX0A 4G4QA 4B3MM 3A42A 1N33M 4PDGA 4JYAM 4B3SM 3SAUA 5ITXA 4DR4M 2ZM6M 2VQFM 2EA0A 1IBLM 3TWKA 3SAVA 4OX9M 1R2YA 1XMQM 4DUZM 2HHHM 4G4NA 1L1TA 5ITTA 3VK8A 3SAWA 4X66M 4LF6M 3GPXA 3JAMS 4DV7M 1XMOM 4KHPM 3SBJA 1PM5A 4DV2M 1HNZM 3A45A 4AQYM 1PJIA 5FLXS 4JI5M 3SARA 3T1HM 4JV5M 4X65M 3GP1A 1K82A 1HNXM 4X62M 3U6SA 1J5EM 1Q3BA 3JR4A 1Q39A 1KFVA 3U6OA 4PCZA 3W0FA 3J81S 3GO8A 4JI0M 4NXMM 3U6EA 4DR5M 5LMUM 1K3XA 2Q2EB 4ITQA 4CISA 1L2BA 4JI8M 4DR1M 2F4VM 5IWAM 5ITQA 2OQ4A 2XZFA 4JI1M 4NRVA 2E5LM 1XNRM 4G4OA 3SATA 4YHHM 2F5OA 3JR5A 4DV3M 3SASA 3U6DA 1L1ZA 5BR8M 5A2QS 4DV4M 3J7AS 3J80S 1N32M 1Z5AA 3U6PA 2F5QA 2F5PA 2UXDM 2UUBM 1Z59A 4LFAM 4NRWA 4LFCM 2ZBKB 4DV0M 1HNWM 4K0KM 2VQEM 1MU5A 1HR0M 2F5SA 4LF9M 4GKKM 4NXNM 4LFBM 3GPUA 1TDHA 5ITYA 1NNJA 2UXCM 4X64M 3GPPA 4JI2M 4JI7M 4DR7M 3GPYA 3U6LA 4JI6M 2UUCM 1IBMM 4GKJM 1PJJA 3A46A 1N34M 4G4RA 1XC8A 1I94M 5IT9S 3GQ4A 4DUYM 3TWMA
chains in the Genus database with same CATH superfamily
2QHOB 4LJ8A 5FTJA 1IN6A 5EP3A 3U6CA 2G3QA 2C99A 1Z5CA 4GC5A 1N77A 4F2LA 5EJCA 2V1CA 1SXJC 3TQSA 3GLGE 2CWBA 2HKJA 4QNMA 2DZNB 3ZQJA 3FTCA 2UXBM 4PD2A 1J09A 2LVQD 3OTOM 3FYDA 2DENA 4LF4M 1EIJA 3HZJA 2X49A 1VEJA 5E26A 3SYKA 2UUAM 4YY3M 4NC6A 2WSCF 4R7GA 3LW5F 3PFIA 3C58A 1TDZA 4L15A 1NJFA 2MROB 1GL6A 2JNHA 3U6MA 2CHGA 2JY7A 2ZAMA 2C9OA 5ITXE 1C7YA 5LMNM 3GQ5A 2RRUA 1JQJC 1C1KA 3L27A 3GQ3A 1IBKM 1ORYB 4KT0F 1N33M 2L4EA 3SAUA 4DR4M 5KO3A 1PRBA 2ZTCA 4P16A 2R46A 1NV9A 1QZMA 3THGA 1HJPA 3TE6A 2DI0A 1IBLM 2XFTA 1R2YA 2XSZD 2JZ1A 2HHHM 3RGPA 4F1IA 1SG9A 2K6BA 4PT5A 4MGYE 2JA2A 3E21A 2R65A 4DV7M 1XMOM 5JI2E 4DV2M 4JXJA 3J27B 1PJIA 1DO0A 3DZDA 4AG6A 1V92A 1Z6TA 1Q02A 2ZANA 2FE8A 1OAOC 4IBFA 1E9SA 1ZAEA 3EIEA 3VDPA 4X65M 1N78A 1WGLA 3HU2A 1K82A 1R4GA 3U6SA 8CATA 5KPRA 2XFSA 3D8BA 3GLHB 1J5EM 1Q3BA 1D2NA 2Z7JA 3GLHA 1KFVA 2R45A 1JR3E 4JN6A 3W0FA 4JI0M 3KXEC 4B7GA 4NXMM 2R62A 2YQZA 4AKIA 5KPTA 2QSFX 5IWAM 5DYGA 1E94E 1QVRA 4NRVA 2LH0A 1XNRM 1YUBA 1JR3D 3SMPA 1GLNA 1T6OA 2YFQA 3CF0A 4FWGA 4LY6A 5C18A 1TH4A 2OOBA 3VKGA 4XGIA 3U61B 2D7HA 1G4AE 3U61A 3SASA 1A5TA 1IXZA 5BR8M 3CF6E 5IZ7D 1YSYA 1KYIA 5L8RF 5F3WA 3W68A 2K9DA 3HX3A 4AZFA 2UXDM 3PNVA 2O5RA 2RGHA 2OOAA 5DFLA 2BWBA 1QANA 4IJEA 4LFCM 5EQTA 1WXQA 4D82A 1AUAA 5FTLA 2G5GX 2Y0QA 3FUUA 1NHWC 1HR0M 4LF9M 1E32A 4GKKM 1D0LA 1ZV1A 4LGYA 3SYLA 4LFBM 1TDHA 3SC3A 1G59A 2I7NA 3PVSA 2JP7A 3LVVA 4I4LA 3AKZA 2QPAA 3HJQA 3GPPA 2KXEA 3GPYA 3UMMA 2UUCM 5EXXA 2EO2A 3B7QA 3DFZA 1TTEA 2XSZA 4I81A 3KOWE 2V6ZM 1GABA 3LVWA 3FTEA 1GO5A 4DUYM 3R8FA 4FCWA 1OAIA 3C9PA 2A5YB 1GL7A 3DOAA 2N35A 4PDIA 4I5SA 4DR2M 3HU1A 1TH2A 1XWIA 5EXPA 3PXGA 4BBAA 1HQYE 4MGKE 4AI6A 1WJ7A 1NHGC 2MJ5B 4G6ZA 1QAMA 3PNYA 2MH8A 1TF0B 1QDRA 3WHKA 4DR6M 3B9PA 2YR0A 4QHTA 1E9RA 3KOYE 2V1UA 3AL0C 1L8QA 4LJ7A 3B7NA 2G8LA 2W82A 5E6JA 4FVMA 1FJGM 4MB7A 2L09A 4FCTA 2XH9A 4LJ9A 2VIIA 5KQ8A 2QZ4A 4QOSA 4LF7M 2M60A 1PJSA 2BJWA 1IN7A 3VLFB 4HL4A 4DV1M 4B3TM 1D0KA 1Z5BA 1P3QQ 3UZUA 3SHGB 2CUZA 3M7GA 2LHGA 3L28A 1IN4A 4LF5M 1OIPA 3GRYA 4JI3M 3HHXA 4CHTB 2MGWA 2DWMA 2KW0A 1HT2E 2P5TA 3IG5A 4JI4M 1NO1A 3DA1A 4L78A 2CE7A 4MGHA 4DR3M 1YE9A 1MX0A 4G4QA 4NSOB 2R18A 2VDBB 1JB0F 4L8RC 3UK6A 4M9XA 3ILKA 2BWEA 2VQFM 2LVOC 3B89A 3TWKA 5DYIA 4OX9M 4OU7A 2QNJA 4OW0A 5ITTA 3VK8A 3SAWA 4X66M 3GPXA 4Q7JA 4CGYB 2L7HA 3SBJA 2D7GA 2WSEF 4CIZA 2H5XA 2L2DA 3FE3A 1SXJB 1SXJA 2H1RA 4GC9A 3T38A 1UM8A 2FNAA 3AOEC 5EP1A 1HNXM 4X62M 1ZMWA 1QDTA 2B3TA 4FW9A 3Q8XA 3FUWA 2EJSA 5FTMA 4KO8A 3GO8A 1V34A 4DR5M 1UFZA 5LMUM 1DGBA 4RNAA 3VDUA 3GLIB 3J2PB 4BLCA 3GLIA 3H4JA 4BB9A 4R71A 5ITQA 5EP4A 2OQ4A 2XZFA 5C1BA 4G4OA 2F5OA 3TPZA 4L4UA 1DGFA 1G3IA 3HHYA 3V76A 4DV3M 3E46A 3T15A 1VG5A 2LVPC 2R44A 3KDSE 2AHMA 4GMQA 4LJAA 2CV0A 3KFUG 2KDLA 3K92A 5A2QS 2KNAA 1MJGM 2KNVA 1N32M 4LJ6A 4AG5A 1VDLA 3I04M 1OFIA 2DAGA 3KOZE 4S12A 4WP2A 4LFAM 2CHQA 2ZBKB 4DV0M 2CV2A 2JZ0A 3HWSA 3FUVA 3I4VA 3HHWA 4Z8XA 3ZCBB 2KRKA 3IG8A 4FWHA 4EIWA 2HWJA 2Z4SA 3AFHA 1H6UA 3CF2A 1T3TA 2XGNA 1XXHB 2FFJA 3GPUA 2UXCM 1XXHA 1NSFA 2RGOA 2LXEA 2Z4RA 5BPVA 4DR7M 3U6LA 1X37A 1S3SA 3A46A 4R3DA 1TH3A 5KPZA 1N34M 1QAQA 2JY8A 3HY5A 3T6PA 1N75A 1I94M 3GQ4A 3M0EA 1ZMUA 1N36M 4QNRA 1AIPC 2QQ8A 4D80A 4LJ5A 5JI3E 1WIVA 1HT1E 2C9CA 2KNZA 2J7NA 1D0MA 2VF7A 4MGZE 3ZH9B 4B3RM 4IBKA 4GRIA 3GLFB 4MH0E 3GLFA 3MHVC 5IREB 5EXSA 3NWLA 1R7RA 1VDDA 3T1YM 4GHLA 1TGUA 2LVAA 2KZSA 3I4YA 3L29A 2LBCA 4IBJA 4WURA 5ITUA 4AKGA 3GRVA 3TL4X 3SHFA 3GRUA 1R2ZA 1SXJD 2O01F 3FRHA 3FKEA 1VEKA 4IBCA 1WR1B 3GLIE 3VK7A 4IBIA 2C5RA 1IXSB 3MK6A 1IXSA 1EE8A 4L16A 4M9ZA 2DAIA 4HLQA 4B7FA 2XLJA 3KS8A 4D81A 2Y0TA 1MN3A 3W67A 5FTKA 2JUJA 3LQQA 1XB2B 4XK8F 2DAEA 5IT9S 1NJGA 1NY5A 4JYAM 4A3VB 5ITXA 2LTUA 2ZM6M 2HL7A 1GJSA 3SAVA 1R6BX 4LGMA 2QBYB 1OQYA 2QBYA 3FUTA 7CATA 4G4NA 4Y28F 2KEBA 4GIPA 4LF6M 1IFYA 3K9OA 4M0DA 4GH9A 4KHPM 1ZMVA 3GLHE 1PM5A 4IBEA 3FRIA 4AQYM 2DZOB 2NQ8C 5FLXS 4JI5M 2ZTDA 4OVZB 4LJ4A 4OVZA 2APLA 4I8OA 3RFWA 1LV7A 3KVWA 1G41A 2X8AA 2RKOA 4CJ6A 3A98B 2FOIC 4XBOA 3JR4A 4G3OA 2Y20A 3J81S 1G8PA 3AV0A 4UN2B 3U6EA 3EIHA 3F92A 1K3XA 4ITQA 4JI8M 4QOZC 2YNMD 2ZAOA 4DR1M 2F4VM 1LTMA 4WW0A 3AOGA 2LHCA 3SATA 2D7EA 4Z6YA 2CRUA 1PGYA 3KS4A 3NBIA 3U6DA 3E9SA 2KZUA 3KOXE 3GLFE 1G71A 1IQPA 4DV4M 3J7AS 2WSFF 1DV0A 1J7KA 2M5ZA 2R6FA 2DAKA 4RF1A 3J80S 2J5YA 1Z5AA 3I51A 3U6PA 3BXWA 2F5QA 2DXIA 4II7A 4AKHA 2F5PA 3HGIA 2UUBM 4MGIE 3B7ZA 1DGHB 2LVNC 3CTWB 3LCVB 1DGHA 3IECA 4IIWA 4NSRA 1HNWM 2CP8A 4M0WA 3J7BA 2F5SA 3HJSA 4HEOA 2X4AA 5ITYA 4P17A 1R5LA 4FCVA 1QYRA 2DWNA 4JI2M 1GJTA 3SFZA 1IY1A 3AOEA 1IBMM 4GKJM 1I4WA 3VFDA 1QUSA 4MM3B 3C3EA 3K8ZA 2QENA 3D8LA 3QAUA 2LWXA 1NV8A 2C98A 2DZLA 2QCUA 1Q3CA 3MJ5A 4RF0A 2Z3XA 2QP9X 5GKNA 3BOSA 2Z8YM 2KA6B 1RU3A 1DGGA 2OPFA 4FD2A 2F5NA 4L6V6 4NL4H 1IN8A 1ZQ9A 1VQ1A 1QAOA 3HHZA 1W5TA 1W5SA 3U6QA 1XNQM 2JXNA 1WHCA 5EP2A 3L2AA 1V33A 1NY6A 2CHVA 4IJFA 1NVMA 2WZJA 4ZPXA 3ZC7B 1L2CA 2UU9M 1K3WA 1L2DA 2O25A 4KLNA 3CGWA 3K1JA 1KSFX 2XZUA 2DWLA 2OO9A 3KSJA 2CEAA 2HAKA 3KSXA 2Y21A 2DAMA 3TWLA 1FNNA 2EKKA 2KHHA 4LZJA 2XF3A 4LF8M 3RGSA 1F4IA 2C96A 3BBZA 4RKUF 1BVSA 4DV6M 1IM2A 2J7OA 4LCBA 3QYEA 1TR8A 5ITRA 4IBDA 3E4RA 2BJVA 4DV5M 4GEWA 2JY5A 3GRRA 4B3MM 3A42A 4PDGA 1OJLA 4GITA 3LCUA 4B3SM 1YLAA 3TWMA 3UJNA 2DHYA 2EA0A 4B7HA 4M9SA 4KODA 1SXJE 4ANRA 3M6AA 1XMQM 3FUXA 4DUZM 4IBBA 2VF8A 3K2LA 3HKPA 1L1TA 2L6OA 2FS1A 3K9PA 3C3DA 4QHSA 1HQCA 2JWSA 3GLGB 1Y8GA 3JAMS 1IXRC 2R4EA 3GLGA 4JI6M 2LNHC 2CFOA 1HNZM 3A45A 3LMMA 2DKLA 1IY0A 2R4JA 3LQRA 3SARA 3T1HM 1OFHA 4JV5M 4TUWA 3HU3A 1PJTA 2BNKA 3GP1A 1QQWA 3SMSA 3I01M 4LZZA 1Q39A 3U6OA 4PCZA 5KQDA 3KP0E 2K0BX 2Q2EB 4CISA 1L2BA 3KP1E 3FD9A 4DBGB 1T43A 4JI1M 2E5LM 4B08A 1WGNA 2ERCA 2FH0A 2HCBA 2DVWB 1GVNA 5DNYA 3MMPA 4YHHM 4W5WA 1IY2A 4AW4A 3JR5A 3R9XB 3QWLA 1GKIA 2JY6B 3AJIB 3H4MA 3B74A 1L1ZA 3WHLA 3IHPA 3L26A 3L25A 2GQFA 1PJQA 3FTDA 4LG2A 2R0IA 1QZEA 1IN5A 2EKFA 4LRSA 1XXHE 1Z59A 3RE8A 3Q8GA 2DNAA 2EUCA 2DWZB 4NRWA 2DHRA 5FSWA 3U5ZB 4K0KM 2VQEM 3U5ZA 1MU5A 2CV1A 3VKHA 3QYBA 4REZA 4NXNM 2K47A 5EXTA 5FTNA 4GHAA 1NNJA 1OKSA 3UGJA 4X64M 3FYCA 4JI7M 1XHBA 1NNUC 4IBGA 1CUKA 1VEGA 2MR9A 5H37D 3KW6A 1EFUB 1JR3A 3NBXX 2L4FA 3W0LB 3U60A 3U60B 2GNOA 1PJJA 2XEPA 3HJ8A 3FTFA 4FWDA 1OIZA 4LRTA 4NOOB 4G4RA 1XC8A 2I7PA 2KRUA 2L7IA 1QUTA 1OTRA 1DO2A
chains in the Genus database with same CATH topology
4LJ8A 5FTJA 1IN6A 5EP3A 3U6CA 2C99A 1Z5CA 4GC5A 1N77A 5EJCA 2V1CA 1SXJC 3TQSA 2HKJA 4QNMA 2DZNB 3FTCA 2UXBM 4PD2A 1J09A 3OTOM 3FYDA 4LF4M 2X49A 5E26A 3SYKA 2UUAM 4YY3M 4R7GA 3PFIA 3C58A 1TDZA 1NJFA 1GL6A 3U6MA 2CHGA 2ZAMA 2C9OA 5ITXE 5LMNM 3GQ5A 1JQJC 1C1KA 3L27A 3GQ3A 1IBKM 1ORYB 1N33M 3SAUA 4DR4M 5KO3A 4P16A 2R46A 1QZMA 3THGA 1IBLM 3TE6A 2XFTA 1R2YA 2XSZD 2HHHM 3RGPA 4PT5A 4MGYE 2JA2A 2R65A 4DV7M 1XMOM 5JI2E 4DV2M 4JXJA 3J27B 1PJIA 1DO0A 3DZDA 4AG6A 2ZANA 1Z6TA 4IBFA 3VDPA 2FE8A 1E9SA 1ZAEA 3EIEA 4X65M 1N78A 3HU2A 1K82A 3U6SA 8CATA 5KPRA 2XFSA 3D8BA 3GLHB 1J5EM 1Q3BA 1D2NA 2Z7JA 3GLHA 1KFVA 2R45A 4JN6A 3W0FA 4JI0M 3KXEC 4B7GA 4NXMM 2R62A 2YQZA 4AKIA 5KPTA 5IWAM 5DYGA 1E94E 1QVRA 4NRVA 2LH0A 1XNRM 1YUBA 1JR3D 3SMPA 1GLNA 2YFQA 3CF0A 4FWGA 4LY6A 5C18A 1TH4A 3VKGA 4XGIA 3U61B 2D7HA 1G4AE 3U61A 3SASA 1IXZA 5BR8M 3CF6E 5IZ7D 1YSYA 1KYIA 5F3WA 4AZFA 2UXDM 3PNVA 2O5RA 2RGHA 1QANA 4IJEA 4LFCM 5EQTA 1WXQA 4D82A 5FTLA 2G5GX 2Y0QA 3FUUA 1NHWC 1HR0M 4LF9M 1E32A 4GKKM 4LGYA 3SYLA 4LFBM 1TDHA 3SC3A 1G59A 2I7NA 3PVSA 4I4LA 3LVVA 3AKZA 2QPAA 3HJQA 3GPPA 2KXEA 3GPYA 3UMMA 2UUCM 5EXXA 2EO2A 3DFZA 2XSZA 4I81A 3KOWE 2V6ZM 3LVWA 3FTEA 4DUYM 3R8FA 4FCWA 3DOAA 2A5YB 1GL7A 4PDIA 4DR2M 4I5SA 3HU1A 1TH2A 1XWIA 5EXPA 3PXGA 4BBAA 1HQYE 4MGKE 4AI6A 1NHGC 4G6ZA 1QAMA 3PNYA 3WHKA 4DR6M 3B9PA 2YR0A 4QHTA 1E9RA 3KOYE 2V1UA 3AL0C 1L8QA 4LJ7A 2G8LA 2W82A 5E6JA 4FVMA 1FJGM 4MB7A 2L09A 4FCTA 2XH9A 4LJ9A 2VIIA 5KQ8A 2QZ4A 4QOSA 4LF7M 2M60A 2BJWA 1IN7A 3VLFB 4HL4A 4DV1M 4B3TM 1Z5BA 3UZUA 3SHGB 2CUZA 3M7GA 3L28A 1IN4A 4LF5M 3GRYA 4JI3M 3HHXA 4CHTB 2DWMA 2KW0A 1HT2E 2P5TA 3IG5A 4JI4M 3DA1A 4L78A 2CE7A 4MGHA 4DR3M 1YE9A 1MX0A 4G4QA 4NSOB 2R18A 4L8RC 3UK6A 4M9XA 3ILKA 2VQFM 3TWKA 5DYIA 4OX9M 4OU7A 4OW0A 5ITTA 3VK8A 3SAWA 4X66M 3GPXA 3SBJA 4CGYB 2L7HA 2D7GA 1SXJB 1SXJA 2H1RA 4GC9A 3T38A 1UM8A 2FNAA 3AOEC 5EP1A 1HNXM 4X62M 4FW9A 3Q8XA 3FUWA 5FTMA 4KO8A 3GO8A 4DR5M 5LMUM 1DGBA 4RNAA 3VDUA 3GLIB 3J2PB 4BLCA 3GLIA 4BB9A 5ITQA 5EP4A 2OQ4A 2XZFA 5C1BA 4G4OA 2F5OA 3TPZA 4L4UA 1DGFA 1G3IA 3HHYA 4DV3M 3T15A 3KDSE 4GMQA 3KFUG 2AHMA 4LJAA 2CV0A 3K92A 5A2QS 1N32M 4LJ6A 4AG5A 1OFIA 3KOZE 4S12A 4LFAM 2CHQA 2ZBKB 4DV0M 2CV2A 3HWSA 3FUVA 3I4VA 3HHWA 4Z8XA 3ZCBB 2KRKA 3IG8A 4FWHA 4EIWA 2Z4SA 3AFHA 1H6UA 3CF2A 1T3TA 2XGNA 1XXHB 2FFJA 3GPUA 2UXCM 1XXHA 1NSFA 2RGOA 2LXEA 2Z4RA 5BPVA 4DR7M 3U6LA 1X37A 1S3SA 3A46A 4R3DA 1TH3A 5KPZA 1N34M 1QAQA 1N75A 1I94M 3GQ4A 3M0EA 1N36M 4QNRA 4D80A 4LJ5A 5JI3E 1HT1E 2C9CA 2J7NA 4B3RM 3ZH9B 4MGZE 4IBKA 4GRIA 3GLFB 4MH0E 3GLFA 3MHVC 5IREB 5EXSA 3NWLA 1R7RA 1VDDA 3T1YM 4GHLA 1TGUA 3I4YA 2KZSA 4IBJA 3L29A 5ITUA 4WURA 4AKGA 3GRVA 3TL4X 3SHFA 3GRUA 1R2ZA 1SXJD 3FKEA 4IBCA 3VK7A 4IBIA 2C5RA 1IXSB 3MK6A 1EE8A 4L16A 4M9ZA 2XLJA 4HLQA 4B7FA 3KS8A 4D81A 2Y0TA 5FTKA 3LQQA 5IT9S 1NJGA 1NY5A 4JYAM 4A3VB 5ITXA 2ZM6M 2HL7A 3SAVA 1R6BX 4LGMA 2QBYB 2QBYA 3FUTA 7CATA 4G4NA 2KEBA 4GIPA 4LF6M 4M0DA 4GH9A 4KHPM 1PM5A 4IBEA 4AQYM 2DZOB 2NQ8C 5FLXS 4JI5M 4OVZB 4LJ4A 4OVZA 4I8OA 3RFWA 1LV7A 3KVWA 1G41A 2X8AA 2RKOA 3A98B 2FOIC 4XBOA 3JR4A 2Y20A 3J81S 1G8PA 3AV0A 3U6EA 3EIHA 1K3XA 4ITQA 4JI8M 4QOZC 2YNMD 2ZAOA 4DR1M 2F4VM 4WW0A 3AOGA 3SATA 2D7EA 4Z6YA 3KS4A 3NBIA 3U6DA 3E9SA 2KZUA 3KOXE 1IQPA 4DV4M 3J7AS 1J7KA 2M5ZA 4RF1A 3J80S 1Z5AA 3I51A 3U6PA 2F5QA 2DXIA 4II7A 4AKHA 2F5PA 3HGIA 2UUBM 4MGIE 1DGHB 3CTWB 1DGHA 4IIWA 4NSRA 1HNWM 4M0WA 3J7BA 2F5SA 3HJSA 2X4AA 5ITYA 4FCVA 1QYRA 2DWNA 4JI2M 3SFZA 1IY1A 3AOEA 1IBMM 1I4WA 3VFDA 4MM3B 3K8ZA 3D8LA 2QENA 3QAUA 2LWXA 2QCUA 2C98A 3MJ5A 4RF0A 1Q3CA 2Z3XA 4GKJM 2QP9X 5GKNA 3BOSA 2KA6B 1DGGA 2OPFA 4FD2A 2F5NA 4NL4H 1IN8A 1ZQ9A 1QAOA 3HHZA 1W5TA 1W5SA 3U6QA 1XNQM 5EP2A 3L2AA 1NY6A 2CHVA 4IJFA 1NVMA 4ZPXA 3ZC7B 1L2CA 2UU9M 1K3WA 1L2DA 4KLNA 3K1JA 1KSFX 2XZUA 2DWLA 3KSJA 2CEAA 3KSXA 2Y21A 3TWLA 1FNNA 4LZJA 2XF3A 4LF8M 3RGSA 2C96A 4DV6M 1IM2A 2J7OA 4LCBA 5ITRA 4IBDA 3E4RA 2BJVA 4DV5M 3GRRA 4B3MM 3A42A 4PDGA 1OJLA 4GITA 4B3SM 3TWMA 3UJNA 2EA0A 4B7HA 4M9SA 4KODA 1SXJE 3M6AA 1XMQM 3FUXA 4DUZM 4IBBA 3K2LA 3HKPA 1L1TA 2L6OA 4QHSA 1HQCA 3GLGB 3JAMS 1IXRC 2R4EA 3GLGA 2LNHC 2CFOA 1HNZM 3A45A 3LMMA 1IY0A 2R4JA 3LQRA 3SARA 3T1HM 1OFHA 4JV5M 4TUWA 3HU3A 2BNKA 3GP1A 1QQWA 3SMSA 4LZZA 1Q39A 3U6OA 4PCZA 5KQDA 3KP0E 2Q2EB 4CISA 1L2BA 3KP1E 3FD9A 4JI1M 2E5LM 4B08A 2ERCA 2HCBA 2DVWB 1GVNA 5DNYA 4YHHM 4W5WA 1IY2A 4AW4A 3JR5A 3R9XB 3QWLA 1GKIA 3AJIB 3H4MA 1L1ZA 3WHLA 3L26A 3L25A 3FTDA 4LG2A 1IN5A 4LRSA 1Z59A 3RE8A 2EUCA 4NRWA 2DWZB 2DHRA 5FSWA 3U5ZB 4K0KM 2VQEM 3U5ZA 1MU5A 2CV1A 4REZA 4NXNM 2K47A 5EXTA 5FTNA 4GHAA 1NNJA 4X64M 3UGJA 3FYCA 4JI7M 1XHBA 1NNUC 4IBGA 4JI6M 5H37D 3U60B 3KW6A 1JR3A 3W0LB 3U60A 1PJJA 2XEPA 3HJ8A 3FTFA 4FWDA 4LRTA 4NOOB 4G4RA 1XC8A 2I7PA 2KRUA 2L7IA 4L15A 3VKHA 1DO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3C A;  1N36 M;  3U6C A;  3DOA A;  1Z5C A;  4PDI A;  4DR2 M;  4B3R M;  2OPF A;  2F5N A;  4DR6 M;  2HKJ A;  2UXB M;  3U6Q A;  4PD2 A;  1XNQ M;  3OTO M;  3T1Y M;  4LF4 M;  5ITU A;  1L2C A;  2UU9 M;  4MB7 A;  1FJG M;  1K3W A;  1L2D A;  2UUA M;  1R2Z A;  4YY3 M;  2XZU A;  4LF7 M;  3C58 A;  1TDZ A;  3U6M A;  3TWL A;  4DV1 M;  4B3T M;  4LF8 M;  1Z5B A;  5ITX E;  3VK7 A;  5LMN M;  4DV6 M;  3GQ5 A;  4LF5 M;  1EE8 A;  4JI3 M;  5ITR A;  3GQ3 A;  1IBK M;  4JI4 M;  4DV5 M;  4DR3 M;  1MX0 A;  4G4Q A;  4B3M M;  3A42 A;  1N33 M;  4PDG A;  4JYA M;  4B3S M;  3SAU A;  5ITX A;  4DR4 M;  2ZM6 M;  2VQF M;  2EA0 A;  1IBL M;  3TWK A;  3SAV A;  4OX9 M;  1R2Y A;  1XMQ M;  4DUZ M;  2HHH M;  4G4N A;  1L1T A;  5ITT A;  3VK8 A;  3SAW A;  4X66 M;  4LF6 M;  3GPX A;  3JAM S;  4DV7 M;  1XMO M;  4KHP M;  3SBJ A;  1PM5 A;  4DV2 M;  1HNZ M;  3A45 A;  4AQY M;  1PJI A;  5FLX S;  4JI5 M;  3SAR A;  3T1H M;  4JV5 M;  4X65 M;  3GP1 A;  1K82 A;  1HNX M;  4X62 M;  3U6S A;  1J5E M;  1Q3B A;  3JR4 A;  1Q39 A;  1KFV A;  3U6O A;  4PCZ A;  3W0F A;  3J81 S;  3GO8 A;  4JI0 M;  4NXM M;  3U6E A;  4DR5 M;  5LMU M;  1K3X A;  2Q2E B;  4ITQ A;  4CIS A;  1L2B A;  4JI8 M;  4DR1 M;  2F4V M;  5IWA M;  5ITQ A;  2OQ4 A;  2XZF A;  4JI1 M;  4NRV A;  2E5L M;  1XNR M;  4G4O A;  3SAT A;  4YHH M;  2F5O A;  3JR5 A;  4DV3 M;  3SAS A;  3U6D A;  1L1Z A;  5BR8 M;  5A2Q S;  4DV4 M;  3J7A S;  3J80 S;  1N32 M;  1Z5A A;  3U6P A;  2F5Q A;  2F5P A;  2UXD M;  2UUB M;  1Z59 A;  4LFA M;  4NRW A;  4LFC M;  2ZBK B;  4DV0 M;  1HNW M;  4K0K M;  2VQE M;  1MU5 A;  1HR0 M;  2F5S A;  4LF9 M;  4GKK M;  4NXN M;  4LFB M;  3GPU A;  1TDH A;  5ITY A;  1NNJ A;  2UXC M;  4X64 M;  3GPP A;  4JI2 M;  4JI7 M;  4DR7 M;  3GPY A;  3U6L A;  4JI6 M;  2UUC M;  1IBM M;  4GKJ M;  1PJJ A;  3A46 A;  1N34 M;  4G4R A;  1XC8 A;  1I94 M;  5IT9 S;  3GQ4 A;  4DUY M;  3TWM A; 
#chains in the Genus database with same CATH topology
 2QHO B;  4LJ8 A;  5FTJ A;  1IN6 A;  5EP3 A;  3U6C A;  2G3Q A;  2C99 A;  1Z5C A;  4GC5 A;  1N77 A;  4F2L A;  5EJC A;  2V1C A;  1SXJ C;  3TQS A;  3GLG E;  2CWB A;  2HKJ A;  4QNM A;  2DZN B;  3ZQJ A;  3FTC A;  2UXB M;  4PD2 A;  1J09 A;  2LVQ D;  3OTO M;  3FYD A;  2DEN A;  4LF4 M;  1EIJ A;  3HZJ A;  2X49 A;  1VEJ A;  5E26 A;  3SYK A;  2UUA M;  4YY3 M;  4NC6 A;  2WSC F;  4R7G A;  3LW5 F;  3PFI A;  3C58 A;  1TDZ A;  4L15 A;  1NJF A;  2MRO B;  1GL6 A;  2JNH A;  3U6M A;  2CHG A;  2JY7 A;  2ZAM A;  2C9O A;  5ITX E;  1C7Y A;  5LMN M;  3GQ5 A;  2RRU A;  1JQJ C;  1C1K A;  3L27 A;  3GQ3 A;  1IBK M;  1ORY B;  4KT0 F;  1N33 M;  2L4E A;  3SAU A;  4DR4 M;  5KO3 A;  1PRB A;  2ZTC A;  4P16 A;  2R46 A;  1NV9 A;  1QZM A;  3THG A;  1HJP A;  3TE6 A;  2DI0 A;  1IBL M;  2XFT A;  1R2Y A;  2XSZ D;  2JZ1 A;  2HHH M;  3RGP A;  4F1I A;  1SG9 A;  2K6B A;  4PT5 A;  4MGY E;  2JA2 A;  3E21 A;  2R65 A;  4DV7 M;  1XMO M;  5JI2 E;  4DV2 M;  4JXJ A;  3J27 B;  1PJI A;  1DO0 A;  3DZD A;  4AG6 A;  1V92 A;  1Z6T A;  1Q02 A;  2ZAN A;  2FE8 A;  1OAO C;  4IBF A;  1E9S A;  1ZAE A;  3EIE A;  3VDP A;  4X65 M;  1N78 A;  1WGL A;  3HU2 A;  1K82 A;  1R4G A;  3U6S A;  8CAT A;  5KPR A;  2XFS A;  3D8B A;  3GLH B;  1J5E M;  1Q3B A;  1D2N A;  2Z7J A;  3GLH A;  1KFV A;  2R45 A;  1JR3 E;  4JN6 A;  3W0F A;  4JI0 M;  3KXE C;  4B7G A;  4NXM M;  2R62 A;  2YQZ A;  4AKI A;  5KPT A;  2QSF X;  5IWA M;  5DYG A;  1E94 E;  1QVR A;  4NRV A;  2LH0 A;  1XNR M;  1YUB A;  1JR3 D;  3SMP A;  1GLN A;  1T6O A;  2YFQ A;  3CF0 A;  4FWG A;  4LY6 A;  5C18 A;  1TH4 A;  2OOB A;  3VKG A;  4XGI A;  3U61 B;  2D7H A;  1G4A E;  3U61 A;  3SAS A;  1A5T A;  1IXZ A;  5BR8 M;  3CF6 E;  5IZ7 D;  1YSY A;  1KYI A;  5L8R F;  5F3W A;  3W68 A;  2K9D A;  3HX3 A;  4AZF A;  2UXD M;  3PNV A;  2O5R A;  2RGH A;  2OOA A;  5DFL A;  2BWB A;  1QAN A;  4IJE A;  4LFC M;  5EQT A;  1WXQ A;  4D82 A;  1AUA A;  5FTL A;  2G5G X;  2Y0Q A;  3FUU A;  1NHW C;  1HR0 M;  4LF9 M;  1E32 A;  4GKK M;  1D0L A;  1ZV1 A;  4LGY A;  3SYL A;  4LFB M;  1TDH A;  3SC3 A;  1G59 A;  2I7N A;  3PVS A;  2JP7 A;  3LVV A;  4I4L A;  3AKZ A;  2QPA A;  3HJQ A;  3GPP A;  2KXE A;  3GPY A;  3UMM A;  2UUC M;  5EXX A;  2EO2 A;  3B7Q A;  3DFZ A;  1TTE A;  2XSZ A;  4I81 A;  3KOW E;  2V6Z M;  1GAB A;  3LVW A;  3FTE A;  1GO5 A;  4DUY M;  3R8F A;  4FCW A;  1OAI A;  3C9P A;  2A5Y B;  1GL7 A;  3DOA A;  2N35 A;  4PDI A;  4I5S A;  4DR2 M;  3HU1 A;  1TH2 A;  1XWI A;  5EXP A;  3PXG A;  4BBA A;  1HQY E;  4MGK E;  4AI6 A;  1WJ7 A;  1NHG C;  2MJ5 B;  4G6Z A;  1QAM A;  3PNY A;  2MH8 A;  1TF0 B;  1QDR A;  3WHK A;  4DR6 M;  3B9P A;  2YR0 A;  4QHT A;  1E9R A;  3KOY E;  2V1U A;  3AL0 C;  1L8Q A;  4LJ7 A;  3B7N A;  2G8L A;  2W82 A;  5E6J A;  4FVM A;  1FJG M;  4MB7 A;  2L09 A;  4FCT A;  2XH9 A;  4LJ9 A;  2VII A;  5KQ8 A;  2QZ4 A;  4QOS A;  4LF7 M;  2M60 A;  1PJS A;  2BJW A;  1IN7 A;  3VLF B;  4HL4 A;  4DV1 M;  4B3T M;  1D0K A;  1Z5B A;  1P3Q Q;  3UZU A;  3SHG B;  2CUZ A;  3M7G A;  2LHG A;  3L28 A;  1IN4 A;  4LF5 M;  1OIP A;  3GRY A;  4JI3 M;  3HHX A;  4CHT B;  2MGW A;  2DWM A;  2KW0 A;  1HT2 E;  2P5T A;  3IG5 A;  4JI4 M;  1NO1 A;  3DA1 A;  4L78 A;  2CE7 A;  4MGH A;  4DR3 M;  1YE9 A;  1MX0 A;  4G4Q A;  4NSO B;  2R18 A;  2VDB B;  1JB0 F;  4L8R C;  3UK6 A;  4M9X A;  3ILK A;  2BWE A;  2VQF M;  2LVO C;  3B89 A;  3TWK A;  5DYI A;  4OX9 M;  4OU7 A;  2QNJ A;  4OW0 A;  5ITT A;  3VK8 A;  3SAW A;  4X66 M;  3GPX A;  4Q7J A;  4CGY B;  2L7H A;  3SBJ A;  2D7G A;  2WSE F;  4CIZ A;  2H5X A;  2L2D A;  3FE3 A;  1SXJ B;  1SXJ A;  2H1R A;  4GC9 A;  3T38 A;  1UM8 A;  2FNA A;  3AOE C;  5EP1 A;  1HNX M;  4X62 M;  1ZMW A;  1QDT A;  2B3T A;  4FW9 A;  3Q8X A;  3FUW A;  2EJS A;  5FTM A;  4KO8 A;  3GO8 A;  1V34 A;  4DR5 M;  1UFZ A;  5LMU M;  1DGB A;  4RNA A;  3VDU A;  3GLI B;  3J2P B;  4BLC A;  3GLI A;  3H4J A;  4BB9 A;  4R71 A;  5ITQ A;  5EP4 A;  2OQ4 A;  2XZF A;  5C1B A;  4G4O A;  2F5O A;  3TPZ A;  4L4U A;  1DGF A;  1G3I A;  3HHY A;  3V76 A;  4DV3 M;  3E46 A;  3T15 A;  1VG5 A;  2LVP C;  2R44 A;  3KDS E;  2AHM A;  4GMQ A;  4LJA A;  2CV0 A;  3KFU G;  2KDL A;  3K92 A;  5A2Q S;  2KNA A;  1MJG M;  2KNV A;  1N32 M;  4LJ6 A;  4AG5 A;  1VDL A;  3I04 M;  1OFI A;  2DAG A;  3KOZ E;  4S12 A;  4WP2 A;  4LFA M;  2CHQ A;  2ZBK B;  4DV0 M;  2CV2 A;  2JZ0 A;  3HWS A;  3FUV A;  3I4V A;  3HHW A;  4Z8X A;  3ZCB B;  2KRK A;  3IG8 A;  4FWH A;  4EIW A;  2HWJ A;  2Z4S A;  3AFH A;  1H6U A;  3CF2 A;  1T3T A;  2XGN A;  1XXH B;  2FFJ A;  3GPU A;  2UXC M;  1XXH A;  1NSF A;  2RGO A;  2LXE A;  2Z4R A;  5BPV A;  4DR7 M;  3U6L A;  1X37 A;  1S3S A;  3A46 A;  4R3D A;  1TH3 A;  5KPZ A;  1N34 M;  1QAQ A;  2JY8 A;  3HY5 A;  3T6P A;  1N75 A;  1I94 M;  3GQ4 A;  3M0E A;  1ZMU A;  1N36 M;  4QNR A;  1AIP C;  2QQ8 A;  4D80 A;  4LJ5 A;  5JI3 E;  1WIV A;  1HT1 E;  2C9C A;  2KNZ A;  2J7N A;  1D0M A;  2VF7 A;  4MGZ E;  3ZH9 B;  4B3R M;  4IBK A;  4GRI A;  3GLF B;  4MH0 E;  3GLF A;  3MHV C;  5IRE B;  5EXS A;  3NWL A;  1R7R A;  1VDD A;  3T1Y M;  4GHL A;  1TGU A;  2LVA A;  2KZS A;  3I4Y A;  3L29 A;  2LBC A;  4IBJ A;  4WUR A;  5ITU A;  4AKG A;  3GRV A;  3TL4 X;  3SHF A;  3GRU A;  1R2Z A;  1SXJ D;  2O01 F;  3FRH A;  3FKE A;  1VEK A;  4IBC A;  1WR1 B;  3GLI E;  3VK7 A;  4IBI A;  2C5R A;  1IXS B;  3MK6 A;  1IXS A;  1EE8 A;  4L16 A;  4M9Z A;  2DAI A;  4HLQ A;  4B7F A;  2XLJ A;  3KS8 A;  4D81 A;  2Y0T A;  1MN3 A;  3W67 A;  5FTK A;  2JUJ A;  3LQQ A;  1XB2 B;  4XK8 F;  2DAE A;  5IT9 S;  1NJG A;  1NY5 A;  4JYA M;  4A3V B;  5ITX A;  2LTU A;  2ZM6 M;  2HL7 A;  1GJS A;  3SAV A;  1R6B X;  4LGM A;  2QBY B;  1OQY A;  2QBY A;  3FUT A;  7CAT A;  4G4N A;  4Y28 F;  2KEB A;  4GIP A;  4LF6 M;  1IFY A;  3K9O A;  4M0D A;  4GH9 A;  4KHP M;  1ZMV A;  3GLH E;  1PM5 A;  4IBE A;  3FRI A;  4AQY M;  2DZO B;  2NQ8 C;  5FLX S;  4JI5 M;  2ZTD A;  4OVZ B;  4LJ4 A;  4OVZ A;  2APL A;  4I8O A;  3RFW A;  1LV7 A;  3KVW A;  1G41 A;  2X8A A;  2RKO A;  4CJ6 A;  3A98 B;  2FOI C;  4XBO A;  3JR4 A;  4G3O A;  2Y20 A;  3J81 S;  1G8P A;  3AV0 A;  4UN2 B;  3U6E A;  3EIH A;  3F92 A;  1K3X A;  4ITQ A;  4JI8 M;  4QOZ C;  2YNM D;  2ZAO A;  4DR1 M;  2F4V M;  1LTM A;  4WW0 A;  3AOG A;  2LHC A;  3SAT A;  2D7E A;  4Z6Y A;  2CRU A;  1PGY A;  3KS4 A;  3NBI A;  3U6D A;  3E9S A;  2KZU A;  3KOX E;  3GLF E;  1G71 A;  1IQP A;  4DV4 M;  3J7A S;  2WSF F;  1DV0 A;  1J7K A;  2M5Z A;  2R6F A;  2DAK A;  4RF1 A;  3J80 S;  2J5Y A;  1Z5A A;  3I51 A;  3U6P A;  3BXW A;  2F5Q A;  2DXI A;  4II7 A;  4AKH A;  2F5P A;  3HGI A;  2UUB M;  4MGI E;  3B7Z A;  1DGH B;  2LVN C;  3CTW B;  3LCV B;  1DGH A;  3IEC A;  4IIW A;  4NSR A;  1HNW M;  2CP8 A;  4M0W A;  3J7B A;  2F5S A;  3HJS A;  4HEO A;  2X4A A;  5ITY A;  4P17 A;  1R5L A;  4FCV A;  1QYR A;  2DWN A;  4JI2 M;  1GJT A;  3SFZ A;  1IY1 A;  3AOE A;  1IBM M;  4GKJ M;  1I4W A;  3VFD A;  1QUS A;  4MM3 B;  3C3E A;  3K8Z A;  2QEN A;  3D8L A;  3QAU A;  2LWX A;  1NV8 A;  2C98 A;  2DZL A;  2QCU A;  1Q3C A;  3MJ5 A;  4RF0 A;  2Z3X A;  2QP9 X;  5GKN A;  3BOS A;  2Z8Y M;  2KA6 B;  1RU3 A;  1DGG A;  2OPF A;  4FD2 A;  2F5N A;  4L6V 6;  4NL4 H;  1IN8 A;  1ZQ9 A;  1VQ1 A;  1QAO A;  3HHZ A;  1W5T A;  1W5S A;  3U6Q A;  1XNQ M;  2JXN A;  1WHC A;  5EP2 A;  3L2A A;  1V33 A;  1NY6 A;  2CHV A;  4IJF A;  1NVM A;  2WZJ A;  4ZPX A;  3ZC7 B;  1L2C A;  2UU9 M;  1K3W A;  1L2D A;  2O25 A;  4KLN A;  3CGW A;  3K1J A;  1KSF X;  2XZU A;  2DWL A;  2OO9 A;  3KSJ A;  2CEA A;  2HAK A;  3KSX A;  2Y21 A;  2DAM A;  3TWL A;  1FNN A;  2EKK A;  2KHH A;  4LZJ A;  2XF3 A;  4LF8 M;  3RGS A;  1F4I A;  2C96 A;  3BBZ A;  4RKU F;  1BVS A;  4DV6 M;  1IM2 A;  2J7O A;  4LCB A;  3QYE A;  1TR8 A;  5ITR A;  4IBD A;  3E4R A;  2BJV A;  4DV5 M;  4GEW A;  2JY5 A;  3GRR A;  4B3M M;  3A42 A;  4PDG A;  1OJL A;  4GIT A;  3LCU A;  4B3S M;  1YLA A;  3TWM A;  3UJN A;  2DHY A;  2EA0 A;  4B7H A;  4M9S A;  4KOD A;  1SXJ E;  4ANR A;  3M6A A;  1XMQ M;  3FUX A;  4DUZ M;  4IBB A;  2VF8 A;  3K2L A;  3HKP A;  1L1T A;  2L6O A;  2FS1 A;  3K9P A;  3C3D A;  4QHS A;  1HQC A;  2JWS A;  3GLG B;  1Y8G A;  3JAM S;  1IXR C;  2R4E A;  3GLG A;  4JI6 M;  2LNH C;  2CFO A;  1HNZ M;  3A45 A;  3LMM A;  2DKL A;  1IY0 A;  2R4J A;  3LQR A;  3SAR A;  3T1H M;  1OFH A;  4JV5 M;  4TUW A;  3HU3 A;  1PJT A;  2BNK A;  3GP1 A;  1QQW A;  3SMS A;  3I01 M;  4LZZ A;  1Q39 A;  3U6O A;  4PCZ A;  5KQD A;  3KP0 E;  2K0B X;  2Q2E B;  4CIS A;  1L2B A;  3KP1 E;  3FD9 A;  4DBG B;  1T43 A;  4JI1 M;  2E5L M;  4B08 A;  1WGN A;  2ERC A;  2FH0 A;  2HCB A;  2DVW B;  1GVN A;  5DNY A;  3MMP A;  4YHH M;  4W5W A;  1IY2 A;  4AW4 A;  3JR5 A;  3R9X B;  3QWL A;  1GKI A;  2JY6 B;  3AJI B;  3H4M A;  3B74 A;  1L1Z A;  3WHL A;  3IHP A;  3L26 A;  3L25 A;  2GQF A;  1PJQ A;  3FTD A;  4LG2 A;  2R0I A;  1QZE A;  1IN5 A;  2EKF A;  4LRS A;  1XXH E;  1Z59 A;  3RE8 A;  3Q8G A;  2DNA A;  2EUC A;  2DWZ B;  4NRW A;  2DHR A;  5FSW A;  3U5Z B;  4K0K M;  2VQE M;  3U5Z A;  1MU5 A;  2CV1 A;  3VKH A;  3QYB A;  4REZ A;  4NXN M;  2K47 A;  5EXT A;  5FTN A;  4GHA A;  1NNJ A;  1OKS A;  3UGJ A;  4X64 M;  3FYC A;  4JI7 M;  1XHB A;  1NNU C;  4IBG A;  1CUK A;  1VEG A;  2MR9 A;  5H37 D;  3KW6 A;  1EFU B;  1JR3 A;  3NBX X;  2L4F A;  3W0L B;  3U60 A;  3U60 B;  2GNO A;  1PJJ A;  2XEP A;  3HJ8 A;  3FTF A;  4FWD A;  1OIZ A;  4LRT A;  4NOO B;  4G4R A;  1XC8 A;  2I7P A;  2KRU A;  2L7I A;  1QUT A;  1OTR A;  1DO2 A; 
#chains in the Genus database with same CATH homology
 4LJ8 A;  5FTJ A;  1IN6 A;  5EP3 A;  3U6C A;  2C99 A;  1Z5C A;  4GC5 A;  1N77 A;  5EJC A;  2V1C A;  1SXJ C;  3TQS A;  2HKJ A;  4QNM A;  2DZN B;  3FTC A;  2UXB M;  4PD2 A;  1J09 A;  3OTO M;  3FYD A;  4LF4 M;  2X49 A;  5E26 A;  3SYK A;  2UUA M;  4YY3 M;  4R7G A;  3PFI A;  3C58 A;  1TDZ A;  1NJF A;  1GL6 A;  3U6M A;  2CHG A;  2ZAM A;  2C9O A;  5ITX E;  5LMN M;  3GQ5 A;  1JQJ C;  1C1K A;  3L27 A;  3GQ3 A;  1IBK M;  1ORY B;  1N33 M;  3SAU A;  4DR4 M;  5KO3 A;  4P16 A;  2R46 A;  1QZM A;  3THG A;  1IBL M;  3TE6 A;  2XFT A;  1R2Y A;  2XSZ D;  2HHH M;  3RGP A;  4PT5 A;  4MGY E;  2JA2 A;  2R65 A;  4DV7 M;  1XMO M;  5JI2 E;  4DV2 M;  4JXJ A;  3J27 B;  1PJI A;  1DO0 A;  3DZD A;  4AG6 A;  2ZAN A;  1Z6T A;  4IBF A;  3VDP A;  2FE8 A;  1E9S A;  1ZAE A;  3EIE A;  4X65 M;  1N78 A;  3HU2 A;  1K82 A;  3U6S A;  8CAT A;  5KPR A;  2XFS A;  3D8B A;  3GLH B;  1J5E M;  1Q3B A;  1D2N A;  2Z7J A;  3GLH A;  1KFV A;  2R45 A;  4JN6 A;  3W0F A;  4JI0 M;  3KXE C;  4B7G A;  4NXM M;  2R62 A;  2YQZ A;  4AKI A;  5KPT A;  5IWA M;  5DYG A;  1E94 E;  1QVR A;  4NRV A;  2LH0 A;  1XNR M;  1YUB A;  1JR3 D;  3SMP A;  1GLN A;  2YFQ A;  3CF0 A;  4FWG A;  4LY6 A;  5C18 A;  1TH4 A;  3VKG A;  4XGI A;  3U61 B;  2D7H A;  1G4A E;  3U61 A;  3SAS A;  1IXZ A;  5BR8 M;  3CF6 E;  5IZ7 D;  1YSY A;  1KYI A;  5F3W A;  4AZF A;  2UXD M;  3PNV A;  2O5R A;  2RGH A;  1QAN A;  4IJE A;  4LFC M;  5EQT A;  1WXQ A;  4D82 A;  5FTL A;  2G5G X;  2Y0Q A;  3FUU A;  1NHW C;  1HR0 M;  4LF9 M;  1E32 A;  4GKK M;  4LGY A;  3SYL A;  4LFB M;  1TDH A;  3SC3 A;  1G59 A;  2I7N A;  3PVS A;  4I4L A;  3LVV A;  3AKZ A;  2QPA A;  3HJQ A;  3GPP A;  2KXE A;  3GPY A;  3UMM A;  2UUC M;  5EXX A;  2EO2 A;  3DFZ A;  2XSZ A;  4I81 A;  3KOW E;  2V6Z M;  3LVW A;  3FTE A;  4DUY M;  3R8F A;  4FCW A;  3DOA A;  2A5Y B;  1GL7 A;  4PDI A;  4DR2 M;  4I5S A;  3HU1 A;  1TH2 A;  1XWI A;  5EXP A;  3PXG A;  4BBA A;  1HQY E;  4MGK E;  4AI6 A;  1NHG C;  4G6Z A;  1QAM A;  3PNY A;  3WHK A;  4DR6 M;  3B9P A;  2YR0 A;  4QHT A;  1E9R A;  3KOY E;  2V1U A;  3AL0 C;  1L8Q A;  4LJ7 A;  2G8L A;  2W82 A;  5E6J A;  4FVM A;  1FJG M;  4MB7 A;  2L09 A;  4FCT A;  2XH9 A;  4LJ9 A;  2VII A;  5KQ8 A;  2QZ4 A;  4QOS A;  4LF7 M;  2M60 A;  2BJW A;  1IN7 A;  3VLF B;  4HL4 A;  4DV1 M;  4B3T M;  1Z5B A;  3UZU A;  3SHG B;  2CUZ A;  3M7G A;  3L28 A;  1IN4 A;  4LF5 M;  3GRY A;  4JI3 M;  3HHX A;  4CHT B;  2DWM A;  2KW0 A;  1HT2 E;  2P5T A;  3IG5 A;  4JI4 M;  3DA1 A;  4L78 A;  2CE7 A;  4MGH A;  4DR3 M;  1YE9 A;  1MX0 A;  4G4Q A;  4NSO B;  2R18 A;  4L8R C;  3UK6 A;  4M9X A;  3ILK A;  2VQF M;  3TWK A;  5DYI A;  4OX9 M;  4OU7 A;  4OW0 A;  5ITT A;  3VK8 A;  3SAW A;  4X66 M;  3GPX A;  3SBJ A;  4CGY B;  2L7H A;  2D7G A;  1SXJ B;  1SXJ A;  2H1R A;  4GC9 A;  3T38 A;  1UM8 A;  2FNA A;  3AOE C;  5EP1 A;  1HNX M;  4X62 M;  4FW9 A;  3Q8X A;  3FUW A;  5FTM A;  4KO8 A;  3GO8 A;  4DR5 M;  5LMU M;  1DGB A;  4RNA A;  3VDU A;  3GLI B;  3J2P B;  4BLC A;  3GLI A;  4BB9 A;  5ITQ A;  5EP4 A;  2OQ4 A;  2XZF A;  5C1B A;  4G4O A;  2F5O A;  3TPZ A;  4L4U A;  1DGF A;  1G3I A;  3HHY A;  4DV3 M;  3T15 A;  3KDS E;  4GMQ A;  3KFU G;  2AHM A;  4LJA A;  2CV0 A;  3K92 A;  5A2Q S;  1N32 M;  4LJ6 A;  4AG5 A;  1OFI A;  3KOZ E;  4S12 A;  4LFA M;  2CHQ A;  2ZBK B;  4DV0 M;  2CV2 A;  3HWS A;  3FUV A;  3I4V A;  3HHW A;  4Z8X A;  3ZCB B;  2KRK A;  3IG8 A;  4FWH A;  4EIW A;  2Z4S A;  3AFH A;  1H6U A;  3CF2 A;  1T3T A;  2XGN A;  1XXH B;  2FFJ A;  3GPU A;  2UXC M;  1XXH A;  1NSF A;  2RGO A;  2LXE A;  2Z4R A;  5BPV A;  4DR7 M;  3U6L A;  1X37 A;  1S3S A;  3A46 A;  4R3D A;  1TH3 A;  5KPZ A;  1N34 M;  1QAQ A;  1N75 A;  1I94 M;  3GQ4 A;  3M0E A;  1N36 M;  4QNR A;  4D80 A;  4LJ5 A;  5JI3 E;  1HT1 E;  2C9C A;  2J7N A;  4B3R M;  3ZH9 B;  4MGZ E;  4IBK A;  4GRI A;  3GLF B;  4MH0 E;  3GLF A;  3MHV C;  5IRE B;  5EXS A;  3NWL A;  1R7R A;  1VDD A;  3T1Y M;  4GHL A;  1TGU A;  3I4Y A;  2KZS A;  4IBJ A;  3L29 A;  5ITU A;  4WUR A;  4AKG A;  3GRV A;  3TL4 X;  3SHF A;  3GRU A;  1R2Z A;  1SXJ D;  3FKE A;  4IBC A;  3VK7 A;  4IBI A;  2C5R A;  1IXS B;  3MK6 A;  1EE8 A;  4L16 A;  4M9Z A;  2XLJ A;  4HLQ A;  4B7F A;  3KS8 A;  4D81 A;  2Y0T A;  5FTK A;  3LQQ A;  5IT9 S;  1NJG A;  1NY5 A;  4JYA M;  4A3V B;  5ITX A;  2ZM6 M;  2HL7 A;  3SAV A;  1R6B X;  4LGM A;  2QBY B;  2QBY A;  3FUT A;  7CAT A;  4G4N A;  2KEB A;  4GIP A;  4LF6 M;  4M0D A;  4GH9 A;  4KHP M;  1PM5 A;  4IBE A;  4AQY M;  2DZO B;  2NQ8 C;  5FLX S;  4JI5 M;  4OVZ B;  4LJ4 A;  4OVZ A;  4I8O A;  3RFW A;  1LV7 A;  3KVW A;  1G41 A;  2X8A A;  2RKO A;  3A98 B;  2FOI C;  4XBO A;  3JR4 A;  2Y20 A;  3J81 S;  1G8P A;  3AV0 A;  3U6E A;  3EIH A;  1K3X A;  4ITQ A;  4JI8 M;  4QOZ C;  2YNM D;  2ZAO A;  4DR1 M;  2F4V M;  4WW0 A;  3AOG A;  3SAT A;  2D7E A;  4Z6Y A;  3KS4 A;  3NBI A;  3U6D A;  3E9S A;  2KZU A;  3KOX E;  1IQP A;  4DV4 M;  3J7A S;  1J7K A;  2M5Z A;  4RF1 A;  3J80 S;  1Z5A A;  3I51 A;  3U6P A;  2F5Q A;  2DXI A;  4II7 A;  4AKH A;  2F5P A;  3HGI A;  2UUB M;  4MGI E;  1DGH B;  3CTW B;  1DGH A;  4IIW A;  4NSR A;  1HNW M;  4M0W A;  3J7B A;  2F5S A;  3HJS A;  2X4A A;  5ITY A;  4FCV A;  1QYR A;  2DWN A;  4JI2 M;  3SFZ A;  1IY1 A;  3AOE A;  1IBM M;  1I4W A;  3VFD A;  4MM3 B;  3K8Z A;  3D8L A;  2QEN A;  3QAU A;  2LWX A;  2QCU A;  2C98 A;  3MJ5 A;  4RF0 A;  1Q3C A;  2Z3X A;  4GKJ M;  2QP9 X;  5GKN A;  3BOS A;  2KA6 B;  1DGG A;  2OPF A;  4FD2 A;  2F5N A;  4NL4 H;  1IN8 A;  1ZQ9 A;  1QAO A;  3HHZ A;  1W5T A;  1W5S A;  3U6Q A;  1XNQ M;  5EP2 A;  3L2A A;  1NY6 A;  2CHV A;  4IJF A;  1NVM A;  4ZPX A;  3ZC7 B;  1L2C A;  2UU9 M;  1K3W A;  1L2D A;  4KLN A;  3K1J A;  1KSF X;  2XZU A;  2DWL A;  3KSJ A;  2CEA A;  3KSX A;  2Y21 A;  3TWL A;  1FNN A;  4LZJ A;  2XF3 A;  4LF8 M;  3RGS A;  2C96 A;  4DV6 M;  1IM2 A;  2J7O A;  4LCB A;  5ITR A;  4IBD A;  3E4R A;  2BJV A;  4DV5 M;  3GRR A;  4B3M M;  3A42 A;  4PDG A;  1OJL A;  4GIT A;  4B3S M;  3TWM A;  3UJN A;  2EA0 A;  4B7H A;  4M9S A;  4KOD A;  1SXJ E;  3M6A A;  1XMQ M;  3FUX A;  4DUZ M;  4IBB A;  3K2L A;  3HKP A;  1L1T A;  2L6O A;  4QHS A;  1HQC A;  3GLG B;  3JAM S;  1IXR C;  2R4E A;  3GLG A;  2LNH C;  2CFO A;  1HNZ M;  3A45 A;  3LMM A;  1IY0 A;  2R4J A;  3LQR A;  3SAR A;  3T1H M;  1OFH A;  4JV5 M;  4TUW A;  3HU3 A;  2BNK A;  3GP1 A;  1QQW A;  3SMS A;  4LZZ A;  1Q39 A;  3U6O A;  4PCZ A;  5KQD A;  3KP0 E;  2Q2E B;  4CIS A;  1L2B A;  3KP1 E;  3FD9 A;  4JI1 M;  2E5L M;  4B08 A;  2ERC A;  2HCB A;  2DVW B;  1GVN A;  5DNY A;  4YHH M;  4W5W A;  1IY2 A;  4AW4 A;  3JR5 A;  3R9X B;  3QWL A;  1GKI A;  3AJI B;  3H4M A;  1L1Z A;  3WHL A;  3L26 A;  3L25 A;  3FTD A;  4LG2 A;  1IN5 A;  4LRS A;  1Z59 A;  3RE8 A;  2EUC A;  4NRW A;  2DWZ B;  2DHR A;  5FSW A;  3U5Z B;  4K0K M;  2VQE M;  3U5Z A;  1MU5 A;  2CV1 A;  4REZ A;  4NXN M;  2K47 A;  5EXT A;  5FTN A;  4GHA A;  1NNJ A;  4X64 M;  3UGJ A;  3FYC A;  4JI7 M;  1XHB A;  1NNU C;  4IBG A;  4JI6 M;  5H37 D;  3U60 B;  3KW6 A;  1JR3 A;  3W0L B;  3U60 A;  1PJJ A;  2XEP A;  3HJ8 A;  3FTF A;  4FWD A;  4LRT A;  4NOO B;  4G4R A;  1XC8 A;  2I7P A;  2KRU A;  2L7I A;  4L15 A;  3VKH A;  1DO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...