3T1YM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t1yM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3t1yM02
2F5PA 4DR5M 1K82A 2UUBM 3GPPA 4LFCM 3SAWA 1L1TA 2F5OA 4K0KM 4LF4M 5LMUM 2HHHM 2F5QA 4NXMM 4PDGA 4X62M 1N36M 4LF8M 3J80S 5A2QS 4YHHM 1K3XA 2EA0A 4B3RM 3A42A 1XNQM 1Z59A 2VQFM 1IBMM 3U6LA 1MU5A 1TDZA 1J5EM 4LF6M 3SAVA 2OQ4A 4LF9M 1Q3BA 4G4OA 3W0FA 2F4VM 4DV3M 4YY3M 1I94M 3SATA 1KFVA 4CISA 3J7AS 4LF7M 2VQEM 4DV1M 4LF5M 4LFAM 4JI6M 1HNWM 2UXCM 1Z5CA 1XMOM 4DUYM 4JI2M 3GQ5A 5ITTA 1XMQM 4G4NA 5ITQA 4PDIA 3SASA 1R2ZA 4PD2A 3A46A 3JR5A 5ITXA 4DR3M 5ITRA 2ZM6M 4DV6M 2Q2EB 3TWKA 3T1HM 1PJIA 4JI4M 3T1YM 3GQ4A 2ZBKB 4JI7M 1L1ZA 4NRWA 3U6CA 1Q39A 3U6QA 4DUZM 3U6DA 5ITUA 4MB7A 3GO8A 1XC8A 4G4RA 4NXNM 1N34M 3TWLA 2F5SA 4DV0M 4DV2M 5BR8M 4KHPM 5LMNM 3TWMA 4DR6M 4DR1M 1PJJA 3GQ3A 1N32M 1L2DA 3SBJA 1EE8A 2XZUA 4DR4M 1HNXM 1XNRM 1Z5AA 2UUCM 1HR0M 4PCZA 5IWAM 4GKJM 4JI8M 4JV5M 1NNJA 4JI3M 4LFBM 3OTOM 1FJGM 2HKJA 4DR7M 3A45A 4DV5M 5FLXS 5ITYA 2OPFA 4GKKM 3GPUA 1N33M 4G4QA 1R2YA 1HNZM 1L2BA 3GP1A 4ITQA 3U6SA 3JAMS 1IBLM 3GPYA 3J81S 2UXDM 3U6MA 4X64M 3DOAA 3VK7A 1PM5A 2UXBM 1Q3CA 3C58A 3GPXA 2F5NA 4B3MM 4X65M 4OX9M 4JI1M 4NRVA 1TDHA 3VK8A 2XZFA 2UU9M 4JI5M 3U6PA 3U6EA 5ITXE 4JYAM 4B3SM 4JI0M 3JR4A 1L2CA 3U6OA 2E5LM 5IT9S 4DV7M 4AQYM 4DV4M 1MX0A 2UUAM 4DR2M 1K3WA 3SAUA 1Z5BA 1IBKM 4X66M 4B3TM 3SARA
chains in the Genus database with same CATH superfamily
1XXHE 4XK8F 1K82A 4LFCM 3FYCA 2DWMA 2CEAA 2DZOB 2DAIA 2R44A 1VEGA 2L09A 2C5RA 4NXMM 3WHLA 1D0LA 2VF7A 3FUTA 4WP2A 1K3XA 2CV1A 3FTEA 1R5LA 3CF0A 1IY2A 3AV0A 4OVZA 1IBMM 5F3WA 2MH8A 1E32A 3D8LA 3I04M 1TDZA 1QAQA 3FRIA 2KDLA 1PJQA 5DFLA 2EKFA 2OQ4A 3RE8A 1QAOA 4EIWA 1ZMUA 2DAKA 2YFQA 3UZUA 2QBYB 2G3QA 3KW6A 1V33A 3FUXA 2ERCA 3SATA 2L6OA 4HL4A 1KFVA 3J7AS 4LF7M 3IHPA 1ZMWA 2XSZD 1GABA 2QCUA 2UXCM 3ZH9B 2L7IA 1PJTA 1XMOM 4RF1A 3FTCA 3GQ5A 2DKLA 1QUTA 3KOZE 1XMQM 1NV9A 3GLHE 4DBGB 5KPTA 3HHYA 1R2ZA 4I4LA 4PD2A 1DO2A 3LCUA 4F2LA 1IXZA 1Y8GA 1D0KA 2LTUA 4IBDA 5FTKA 3HHWA 4WURA 2M5ZA 4M0WA 1PJIA 1GKIA 1KSFX 3L2AA 2FOIC 5DYGA 2XH9A 5KPRA 4AI6A 1WXQA 1L1ZA 4NRWA 3HZJA 2CHQA 4QOSA 4DUZM 1XC8A 3AOGA 1OFHA 3GO8A 3AJIB 2ZAOA 1NNUC 3IG8A 3KSXA 4LF9M 1AUAA 2P5TA 5BR8M 3LVVA 4DR6M 4G3OA 3GQ3A 4MGIE 1TH3A 2FFJA 4AKGA 4IBIA 2XZUA 4DR4M 3M0EA 1YLAA 1LV7A 3W67A 4PCZA 4ZPXA 2VF8A 2C98A 1QUSA 2BJWA 2LHGA 3C3DA 3E9SA 3VLFB 1TR8A 3LQQA 3QAUA 1JB0F 1HT2E 3KDSE 1WHCA 5E6JA 7CATA 1WIVA 5FLXS 4P16A 4IBCA 2JZ1A 4GC5A 2KNAA 2LNHC 4AZFA 1VDDA 1UFZA 2Y21A 2JZ0A 3PNYA 1OIZA 2UXDM 3HY5A 2QPAA 2RRUA 3HJQA 1PM5A 2MROB 2YR0A 4Z8XA 3C58A 3KS8A 1DGFA 3L26A 4X65M 2FNAA 1N75A 4B3MM 1SXJB 5EXTA 3HJ8A 4BLCA 2XEPA 4NRVA 2CP8A 1TDHA 2J7NA 4FVMA 3VK8A 3U6PA 3U6EA 4FD2A 2X8AA 3SHGB 3M6AA 4AG6A 2YNMD 2K47A 4IBFA 1TH2A 4P17A 1DGGA 3JR4A 1WJ7A 3J7BA 1T3TA 3HKPA 3U6OA 1MX0A 3MJ5A 4FWDA 4I81A 5EJCA 3SAUA 3TL4X 1QDTA 1IBKM 4IJFA 3L25A 4B3TM 3SARA 3L27A 1R4GA 4D81A 5E26A 4DR5M 1YSYA 5EP4A 1L2CA 2UUBM 1G3IA 1D0MA 2L4FA 2Y0QA 3ZC7B 1L1TA 4K0KM 1HT1E 4D80A 4ANRA 5LMUM 1BVSA 3GLIB 4QHTA 4X62M 1N36M 2C99A 3U5ZB 3J80S 4YHHM 5DNYA 2JXNA 2CUZA 2XF3A 3A42A 1XNQM 1Z59A 3GLGB 4B3RM 2R65A 3GRYA 3U6LA 2LVNC 3U61B 1MU5A 4NOOB 2H5XA 4RNAA 5KQDA 2K6BA 4OU7A 2ZTCA 2A5YB 4F1IA 3KOWE 4GHAA 1IFYA 1DGBA 4RKUF 3UJNA 2VDBB 3SYKA 4DV3M 2R0IA 1I94M 2LBCA 1G4AE 4CISA 1JQJC 4LF5M 2JY5A 3RGSA 4M9ZA 4LY6A 2D7GA 2Y0TA 1TH4A 3KVWA 3K9PA 3HU2A 2R45A 1Z5CA 4IBEA 3KXEC 1QQWA 3QYEA 4MGYE 3SMSA 4DUYM 1F4IA 4GEWA 2GNOA 4G4NA 5ITQA 4PDIA 2KZUA 3A46A 1G71A 4LZJA 5FTJA 4DV6M 4LGMA 4NSOB 3GRVA 3TWKA 4LJ8A 3T1HM 1NVMA 4JI4M 3T1YM 1SXJE 1IN6A 2VIIA 2CV0A 4GITA 2ZBKB 1SG9A 1SXJD 4Y28F 2EUCA 4CIZA 2JP7A 1Q39A 1XXHA 3CTWB 4L15A 4R7GA 3U6DA 3T38A 2K0BX 2X49A 2YQZA 2R4JA 3I4YA 2F5SA 1C1KA 2HWJA 3AOEC 4AKIA 1QVRA 5KO3A 3Q8GA 2CWBA 1IY1A 4HLQA 2WSEF 5LMNM 1OFIA 4DR1M 1NY6A 4II7A 1N32M 1L2DA 1EE8A 2C9CA 3FYDA 3GLIE 3NBIA 1NO1A 1YE9A 5IWAM 4GKJM 2JWSA 1QZMA 1WGLA 3GLGE 3B7NA 4LFBM 1JR3E 3OTOM 3L28A 4LRSA 4S12A 3THGA 3KS4A 3A45A 4LJ5A 2XSZA 2XFTA 3ZCBB 2R4EA 1JR3D 3T15A 2OPFA 1GL7A 2KNVA 1P3QQ 3D8BA 2KXEA 2V1UA 1N33M 1MN3A 2MJ5B 3K9OA 2XLJA 1I4WA 2I7NA 3GLFB 1HNZM 1EIJA 3I01M 3GP1A 2DENA 1DGHB 2JY6B 2BWEA 4ITQA 4B7GA 3GPYA 1D2NA 3U6MA 3GLHA 3GRRA 4X64M 3VFDA 3K8ZA 4L78A 5IREB 5JI3E 4M9XA 1R6BX 4FCTA 3VK7A 2O5RA 2UXBM 2OOBA 2F5NA 1Q02A 3BXWA 1VQ1A 4OX9M 1N78A 2X4AA 4LZZA 4JI1M 2LXEA 4IIWA 4JI5M 2XZFA 3H4JA 2KEBA 3Q8XA 5ITXE 1IXRC 1E9RA 3U60B 4JI0M 3PNVA 3B74A 2E5LM 5EP3A 4AKHA 2RGOA 2UUAM 4DR2M 3KOXE 2LVPC 2GQFA 5KQ8A 2L4EA 4UN2B 2OO9A 1Z5BA 2N35A 1QANA 4JN6A 3M7GA 4HEOA 4X66M 3E21A 4LCBA 4CJ6A 3FD9A 1XWIA 2F5PA 1G41A 3GPPA 1ZV1A 2V1CA 2B3TA 5FTLA 1NV8A 1NHWC 3LMMA 1RU3A 2HHHM 3SC3A 2M60A 1NJGA 3UGJA 2KW0A 2MR9A 3KP1E 1S3SA 4LF8M 4OVZB 1X37A 3HX3A 2HAKA 2K9DA 2R18A 3SHFA 3R8FA 2KRKA 1HJPA 2R6FA 2XFSA 3HJSA 1J5EM 2W82A 4QNMA 2CV2A 3AOEA 3DA1A 2QZ4A 3LCVB 4LJ4A 3FTFA 1Q3BA 4G4OA 3B7QA 3W0FA 2F4VM 2G8LA 1L8QA 4A3VB 2QBYA 1SXJC 1AIPC 2VQEM 4DV1M 2CHGA 4TUWA 4GIPA 4LG2A 4IJEA 2KHHA 1GJSA 1WGNA 2DI0A 4M0DA 1FNNA 2KA6B 3E4RA 3GLFE 3ZQJA 2ZTDA 3SMPA 2DWNA 4AW4A 2LWXA 2Z3XA 3W68A 3HU3A 1Z6TA 3MMPA 3LW5F 3K92A 2HL7A 3LQRA 2QNJA 4BBAA 3JR5A 4DR3M 3UMMA 2R62A 1IN4A 3I51A 4IBKA 4R71A 2LH0A 3PVSA 1IXSB 1TF0B 5FSWA 4NSRA 2DZNB 1W5TA 3CF2A 3U6CA 5EP2A 1XHBA 3FTDA 1VG5A 3NBXX 1G59A 5ITUA 3FUWA 2Z7JA 1LTMA 1N34M 3RFWA 2QQ8A 1CUKA 4FW9A 4IBBA 4DV0M 4DV2M 1XB2B 1OTRA 1OAOC 1UM8A 3CGWA 3SBJA 1OQYA 2HCBA 4BB9A 4KODA 1HNXM 1OIPA 1T43A 1ORYB 1HR0M 1YUBA 2DHYA 4W5WA 2AHMA 4IBGA 3SYLA 2DVWB 1NNJA 3BOSA 3HHXA 3H4MA 4FWHA 3KSJA 4D82A 3UK6A 4MM3B 5EQTA 5ITYA 3HU1A 3K2LA 5H37D 2BWBA 5IZ7D 3GPUA 4G4QA 1R2YA 3FRHA 1N77A 2Z4RA 3QYBA 1PJSA 1NJFA 3U6SA 4KT0F 1J7KA 3A98B 4GC9A 3FE3A 3J2PB 3TPZA 3J81S 2JNHA 4Q7JA 3AL0C 1VDLA 2DWLA 2LVQD 1T6OA 2JA2A 1NSFA 4B08A 5KPZA 4NL4H 1E94E 1ZQ9A 5FTNA 4LJ9A 5EXSA 4L16A 1SXJA 2LVAA 2WZJA 2ZAMA 3QWLA 4JYAM 3EIHA 2O25A 4B3SM 2L7HA 3VKHA 1J09A 1QAMA 4G6ZA 5IT9S 3J27B 1A5TA 3TQSA 3VDUA 4GHLA 5C18A 3AFHA 4PT5A 1ZMVA 4L4UA 1K3WA 5GKNA 4CGYB 2KNZA 2DAMA 4MGZE 5BPVA 3PFIA 5DYIA 3SAWA 2F5OA 2APLA 4LF4M 1OKSA 3K1JA 1IN7A 1NY5A 4LGYA 2LHCA 2RGHA 2DNAA 2F5QA 4PDGA 3DFZA 3GLIA 5A2QS 1MJGM 1TGUA 2EA0A 1GJTA 3U5ZA 4M9SA 3ILKA 2VQFM 3GLGA 5L8RF 4FWGA 1JR3A 1DO0A 3LVWA 4I8OA 3U61A 3MK6A 1QDRA 2Y20A 1IXSA 3SAVA 4LF6M 2WSFF 1HQYE 4L6V6 1KYIA 1PGYA 3KOYE 2CRUA 1HQCA 3EIEA 4FCWA 2EJSA 4MH0E 4QHSA 4KO8A 2XGNA 2DWZB 3C3EA 1H6UA 3NWLA 4YY3M 2RKOA 3V76A 2KZSA 3HWSA 2CHVA 2J5YA 4LFAM 4JI6M 1HNWM 3KFUG 4LRTA 2J7OA 4MGHA 1W5SA 3F92A 3PXGA 4JI2M 5ITTA 3L29A 4XGIA 3T6PA 1G8PA 2DZLA 3SASA 1EFUB 2ZANA 4GH9A 3SFZA 1R7RA 3RGPA 5ITXA 5ITRA 5EXPA 4KLNA 2ZM6M 2D7EA 2Q2EB 3BBZA 1IN5A 1GVNA 2V6ZM 4GMQA 1IM2A 3GQ4A 1OAIA 2I7PA 4I5SA 2DHRA 3R9XB 3WHKA 4JI7M 1XXHB 2QHOB 3U6QA 4NC6A 3B7ZA 4AG5A 2R46A 2L2DA 4MB7A 1V92A 2C96A 4G4RA 4NXNM 4B7FA 2WSCF 2MGWA 2QSFX 3TWLA 4B7HA 1TTEA 2KRUA 5C1BA 2H1RA 1C7YA 4QOZC 2QENA 4REZA 2JY8A 3C9PA 2FS1A 1WR1B 5EXXA 4KHPM 3TWMA 2C9OA 1PJJA 3B9PA 2CE7A 4LJAA 4R3DA 2O01F 4LJ6A 1XNRM 1IQPA 1Z5AA 2BJVA 2UUCM 2JY7A 5JI2E 4JI8M 4JV5M 4LJ7A 3W0LB 4JI3M 2Z8YM 2EO2A 1QYRA 4CHTB 3VKGA 1FJGM 2HKJA 4GRIA 4FCVA 4XBOA 4DV5M 4L8RC 1GLNA 4QNRA 3TE6A 4GKKM 2FE8A 1VEJA 2CFOA 3FKEA 2LVOC 4JXJA 1PRBA 3IG5A 3I4VA 1L2BA 1V34A 2DAGA 4OW0A 1E9SA 3GLFA 3IECA 3GLHB 4MGKE 1OJLA 2NQ8C 1DGHA 3JAMS 1IBLM 1VEKA 2OOAA 2DXIA 1GL6A 3KP0E 3DOAA 3E46A 5FTMA 1IN8A 3HHZA 2D7HA 1Q3CA 3GRUA 1ZAEA 3GPXA 5EP1A 1QZEA 4RF0A 3AKZA 2BNKA 1GO5A 2G5GX 4WW0A 3MHVC 2UU9M 1DV0A 2QP9X 2DAEA 3FUUA 3U60A 4DV7M 4AQYM 2EKKA 4DV4M 2FH0A 3FUVA 3CF6E 1IY0A 3VDPA 8CATA 3HGIA 4Z6YA 3B89A 4IBJA 3DZDA 2Z4SA 4DR7M 2JUJA 1NHGC
chains in the Genus database with same CATH topology
4LFCM 1K82A 3FYCA 2DWMA 2CEAA 2DZOB 2L09A 2C5RA 4NXMM 3WHLA 3FUTA 2CV1A 3FTEA 1K3XA 3CF0A 1IY2A 3AV0A 4OVZA 1IBMM 5F3WA 1E32A 3D8LA 1TDZA 1QAQA 2OQ4A 3RE8A 1QAOA 4EIWA 2YFQA 2QBYB 3UZUA 3KW6A 3FUXA 2ERCA 3SATA 2L6OA 4HL4A 1KFVA 3J7AS 4LF7M 2XSZD 2QCUA 2UXCM 3ZH9B 2L7IA 1XMOM 4RF1A 3FTCA 3GQ5A 1XMQM 3KOZE 5KPTA 3HHYA 1R2ZA 4I4LA 4PD2A 1DO2A 1IXZA 4IBDA 5FTKA 3HHWA 4WURA 2M5ZA 4M0WA 1PJIA 1GKIA 1KSFX 3L2AA 2FOIC 5DYGA 2XH9A 5KPRA 4AI6A 1WXQA 1L1ZA 4NRWA 2CHQA 4QOSA 4DUZM 1XC8A 3AOGA 1OFHA 3GO8A 3AJIB 2ZAOA 1NNUC 3IG8A 3KSXA 2P5TA 5BR8M 3LVVA 4DR6M 3GQ3A 4MGIE 1TH3A 2FFJA 4AKGA 4IBIA 2XZUA 4DR4M 3M0EA 1LV7A 4PCZA 4ZPXA 2C98A 2BJWA 3E9SA 3VLFB 3LQQA 3QAUA 1HT2E 3KDSE 5E6JA 7CATA 5FLXS 4P16A 4IBCA 4GC5A 2LNHC 4AZFA 1VDDA 2Y21A 3PNYA 2UXDM 2QPAA 3HJQA 1PM5A 2YR0A 4Z8XA 3C58A 3KS8A 1DGFA 3L26A 4X65M 2FNAA 1N75A 4B3MM 1SXJB 5EXTA 3HJ8A 4BLCA 2XEPA 4NRVA 2J7NA 1TDHA 3VK8A 4FVMA 3U6PA 3U6EA 4FD2A 2X8AA 3SHGB 3M6AA 4AG6A 2YNMD 2K47A 4IBFA 1TH2A 3JR4A 1DGGA 3U6OA 1L2CA 3J7BA 1T3TA 3HKPA 1MX0A 3MJ5A 4FWDA 4I81A 5EJCA 3SAUA 3TL4X 1IBKM 4IJFA 3L25A 4B3TM 3SARA 3L27A 4D81A 5E26A 4DR5M 1YSYA 5EP4A 2UUBM 1G3IA 2Y0QA 3ZC7B 1L1TA 4K0KM 1HT1E 4D80A 5LMUM 3GLIB 4QHTA 4X62M 1N36M 2C99A 3U5ZB 3J80S 4YHHM 5DNYA 2XF3A 2CUZA 4B3RM 3A42A 1XNQM 1Z59A 3GLGB 2R65A 3GRYA 3U6LA 3U61B 1MU5A 4NOOB 4RNAA 5KQDA 4OU7A 2A5YB 4GHAA 3KOWE 1DGBA 3UJNA 3SYKA 4DV3M 1I94M 1G4AE 4CISA 1JQJC 4LF5M 3RGSA 4M9ZA 4LY6A 2D7GA 2Y0TA 1TH4A 3KVWA 3HU2A 2R45A 1Z5CA 4IBEA 3KXEC 1QQWA 4MGYE 4DUYM 3SMSA 4G4NA 5ITQA 4PDIA 2KZUA 3A46A 4LZJA 5FTJA 4DV6M 4LGMA 4NSOB 3GRVA 3TWKA 4LJ8A 3T1HM 1NVMA 4JI4M 3T1YM 1SXJE 1IN6A 2VIIA 2CV0A 4GITA 2ZBKB 1SXJD 2EUCA 1Q39A 1XXHA 3CTWB 4L15A 4R7GA 3U6DA 3T38A 2X49A 2YQZA 2R4JA 3I4YA 2F5SA 1C1KA 3AOEC 4AKIA 1QVRA 5KO3A 1IY1A 4HLQA 5LMNM 4DR1M 1OFIA 1NY6A 4II7A 1N32M 1L2DA 1EE8A 2C9CA 3FYDA 3NBIA 1YE9A 5IWAM 4GKJM 1QZMA 4LFBM 3OTOM 3L28A 4LRSA 4S12A 3THGA 3KS4A 3A45A 4LJ5A 2XSZA 2XFTA 3ZCBB 2R4EA 1JR3D 3T15A 2OPFA 1GL7A 3D8BA 2V1UA 2KXEA 1N33M 2XLJA 1I4WA 2I7NA 3GLFB 1HNZM 3GP1A 1DGHB 4ITQA 4B7GA 3GPYA 1D2NA 3U6MA 3GLHA 3GRRA 4X64M 3VFDA 3K8ZA 4L78A 5IREB 5JI3E 4M9XA 1R6BX 4FCTA 3VK7A 2O5RA 2UXBM 2F5NA 4OX9M 1N78A 2X4AA 4LZZA 4JI1M 2LXEA 4IIWA 4JI5M 2XZFA 2KEBA 3Q8XA 5ITXE 1IXRC 1E9RA 3U60B 4JI0M 3PNVA 2E5LM 4AKHA 5EP3A 2RGOA 2UUAM 4DR2M 3KOXE 5KQ8A 1Z5BA 1QANA 4JN6A 3M7GA 4X66M 4LCBA 3FD9A 1XWIA 2F5PA 1G41A 3GPPA 2V1CA 5FTLA 1NHWC 3LMMA 2HHHM 3SC3A 2M60A 1NJGA 3UGJA 2KW0A 4LF8M 3KP1E 1S3SA 4OVZB 1X37A 2R18A 3SHFA 3R8FA 2KRKA 2XFSA 1J5EM 3HJSA 2W82A 4QNMA 2CV2A 3AOEA 3DA1A 2QZ4A 4LJ4A 3FTFA 1Q3BA 4G4OA 3W0FA 2F4VM 2G8LA 1L8QA 4A3VB 2QBYA 1SXJC 2VQEM 4DV1M 2CHGA 4TUWA 4GIPA 4LG2A 4IJEA 4M0DA 1FNNA 2KA6B 3E4RA 3SMPA 2DWNA 4AW4A 2LWXA 2Z3XA 3HU3A 1Z6TA 3K92A 2HL7A 3LQRA 4BBAA 3JR5A 4DR3M 3UMMA 2R62A 1IN4A 3I51A 4IBKA 2LH0A 3PVSA 1IXSB 5FSWA 4NSRA 2DZNB 1W5TA 3CF2A 3U6CA 5EP2A 1XHBA 3FTDA 1G59A 5ITUA 3FUWA 2Z7JA 1N34M 3RFWA 4FW9A 4DV0M 4IBBA 4DV2M 1UM8A 3SBJA 2HCBA 4BB9A 4KODA 1HNXM 1ORYB 1HR0M 1YUBA 4W5WA 2AHMA 4IBGA 3SYLA 2DVWB 1NNJA 3BOSA 3HHXA 3H4MA 4FWHA 3KSJA 4D82A 3UK6A 4MM3B 5EQTA 5ITYA 3HU1A 3K2LA 5H37D 5IZ7D 3GPUA 4G4QA 1R2YA 1N77A 2Z4RA 1NJFA 3U6SA 1J7KA 3A98B 4GC9A 3TPZA 3J2PB 3J81S 3AL0C 2DWLA 2JA2A 1NSFA 4B08A 5KPZA 4NL4H 1E94E 1ZQ9A 5FTNA 4LJ9A 5EXSA 4L16A 1SXJA 2ZAMA 3QWLA 4JYAM 3EIHA 4B3SM 2L7HA 3VKHA 1J09A 1QAMA 4G6ZA 5IT9S 3J27B 3TQSA 3VDUA 4GHLA 5C18A 3AFHA 4PT5A 4L4UA 1K3WA 5GKNA 4CGYB 4MGZE 5BPVA 3PFIA 5DYIA 3SAWA 2F5OA 4LF4M 3K1JA 1IN7A 1NY5A 4LGYA 2RGHA 2F5QA 4PDGA 3DFZA 3GLIA 5A2QS 1TGUA 2EA0A 3U5ZA 4M9SA 3ILKA 2VQFM 3GLGA 4FWGA 1JR3A 1DO0A 3LVWA 4I8OA 3U61A 3MK6A 2Y20A 3SAVA 4LF6M 1HQYE 4MH0E 1KYIA 3KOYE 4FCWA 3EIEA 1HQCA 4LF9M 4QHSA 4KO8A 2XGNA 2DWZB 1H6UA 3NWLA 4YY3M 2RKOA 2KZSA 3HWSA 2CHVA 4LFAM 4JI6M 1HNWM 3KFUG 4LRTA 2J7OA 4MGHA 1W5SA 3PXGA 4JI2M 5ITTA 3L29A 4XGIA 1G8PA 3SASA 2ZANA 4GH9A 3SFZA 1R7RA 3RGPA 5ITXA 5ITRA 5EXPA 4KLNA 2ZM6M 2D7EA 2Q2EB 1IN5A 1GVNA 2V6ZM 4GMQA 1IM2A 3GQ4A 2I7PA 4I5SA 2DHRA 3R9XB 3WHKA 4JI7M 1XXHB 3U6QA 4AG5A 2R46A 4MB7A 2C96A 4G4RA 4NXNM 4B7FA 4B7HA 3TWLA 5C1BA 4QOZC 2KRUA 2H1RA 2QENA 4REZA 5EXXA 4KHPM 3TWMA 2C9OA 1PJJA 3B9PA 2CE7A 4LJAA 4R3DA 4LJ6A 1XNRM 1IQPA 1Z5AA 2BJVA 2UUCM 5JI2E 4JI8M 4JV5M 4LJ7A 3W0LB 4JI3M 3VKGA 2EO2A 1QYRA 4CHTB 1FJGM 2HKJA 4GRIA 4FCVA 4XBOA 4DV5M 1GLNA 4QNRA 3TE6A 4GKKM 2FE8A 2CFOA 3FKEA 4JXJA 3IG5A 3I4VA 1L2BA 4OW0A 1E9SA 3GLFA 4MGKE 3GLHB 3JAMS 1OJLA 2NQ8C 1DGHA 1IBLM 4L8RC 2DXIA 1GL6A 3KP0E 3DOAA 5FTMA 1IN8A 3HHZA 2D7HA 1Q3CA 3GRUA 1ZAEA 3GPXA 5EP1A 4RF0A 3AKZA 2BNKA 2G5GX 4WW0A 3MHVC 2UU9M 2QP9X 3FUUA 3U60A 4DV7M 4AQYM 4DV4M 3FUVA 3CF6E 1IY0A 3VDPA 8CATA 3HGIA 4Z6YA 4IBJA 3DZDA 2Z4SA 4DR7M 1NHGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5P A;  4DR5 M;  1K82 A;  2UUB M;  3GPP A;  4LFC M;  3SAW A;  1L1T A;  2F5O A;  4K0K M;  4LF4 M;  5LMU M;  2HHH M;  2F5Q A;  4NXM M;  4PDG A;  4X62 M;  1N36 M;  4LF8 M;  3J80 S;  5A2Q S;  4YHH M;  1K3X A;  2EA0 A;  4B3R M;  3A42 A;  1XNQ M;  1Z59 A;  2VQF M;  1IBM M;  3U6L A;  1MU5 A;  1TDZ A;  1J5E M;  4LF6 M;  3SAV A;  2OQ4 A;  4LF9 M;  1Q3B A;  4G4O A;  3W0F A;  2F4V M;  4DV3 M;  4YY3 M;  1I94 M;  3SAT A;  1KFV A;  4CIS A;  3J7A S;  4LF7 M;  2VQE M;  4DV1 M;  4LF5 M;  4LFA M;  4JI6 M;  1HNW M;  2UXC M;  1Z5C A;  1XMO M;  4DUY M;  4JI2 M;  3GQ5 A;  5ITT A;  1XMQ M;  4G4N A;  5ITQ A;  4PDI A;  3SAS A;  1R2Z A;  4PD2 A;  3A46 A;  3JR5 A;  5ITX A;  4DR3 M;  5ITR A;  2ZM6 M;  4DV6 M;  2Q2E B;  3TWK A;  3T1H M;  1PJI A;  4JI4 M;  3T1Y M;  3GQ4 A;  2ZBK B;  4JI7 M;  1L1Z A;  4NRW A;  3U6C A;  1Q39 A;  3U6Q A;  4DUZ M;  3U6D A;  5ITU A;  4MB7 A;  3GO8 A;  1XC8 A;  4G4R A;  4NXN M;  1N34 M;  3TWL A;  2F5S A;  4DV0 M;  4DV2 M;  5BR8 M;  4KHP M;  5LMN M;  3TWM A;  4DR6 M;  4DR1 M;  1PJJ A;  3GQ3 A;  1N32 M;  1L2D A;  3SBJ A;  1EE8 A;  2XZU A;  4DR4 M;  1HNX M;  1XNR M;  1Z5A A;  2UUC M;  1HR0 M;  4PCZ A;  5IWA M;  4GKJ M;  4JI8 M;  4JV5 M;  1NNJ A;  4JI3 M;  4LFB M;  3OTO M;  1FJG M;  2HKJ A;  4DR7 M;  3A45 A;  4DV5 M;  5FLX S;  5ITY A;  2OPF A;  4GKK M;  3GPU A;  1N33 M;  4G4Q A;  1R2Y A;  1HNZ M;  1L2B A;  3GP1 A;  4ITQ A;  3U6S A;  3JAM S;  1IBL M;  3GPY A;  3J81 S;  2UXD M;  3U6M A;  4X64 M;  3DOA A;  3VK7 A;  1PM5 A;  2UXB M;  1Q3C A;  3C58 A;  3GPX A;  2F5N A;  4B3M M;  4X65 M;  4OX9 M;  4JI1 M;  4NRV A;  1TDH A;  3VK8 A;  2XZF A;  2UU9 M;  4JI5 M;  3U6P A;  3U6E A;  5ITX E;  4JYA M;  4B3S M;  4JI0 M;  3JR4 A;  1L2C A;  3U6O A;  2E5L M;  5IT9 S;  4DV7 M;  4AQY M;  4DV4 M;  1MX0 A;  2UUA M;  4DR2 M;  1K3W A;  3SAU A;  1Z5B A;  1IBK M;  4X66 M;  4B3T M;  3SAR A; 
#chains in the Genus database with same CATH topology
 1XXH E;  4XK8 F;  1K82 A;  4LFC M;  3FYC A;  2DWM A;  2CEA A;  2DZO B;  2DAI A;  2R44 A;  1VEG A;  2L09 A;  2C5R A;  4NXM M;  3WHL A;  1D0L A;  2VF7 A;  3FUT A;  4WP2 A;  1K3X A;  2CV1 A;  3FTE A;  1R5L A;  3CF0 A;  1IY2 A;  3AV0 A;  4OVZ A;  1IBM M;  5F3W A;  2MH8 A;  1E32 A;  3D8L A;  3I04 M;  1TDZ A;  1QAQ A;  3FRI A;  2KDL A;  1PJQ A;  5DFL A;  2EKF A;  2OQ4 A;  3RE8 A;  1QAO A;  4EIW A;  1ZMU A;  2DAK A;  2YFQ A;  3UZU A;  2QBY B;  2G3Q A;  3KW6 A;  1V33 A;  3FUX A;  2ERC A;  3SAT A;  2L6O A;  4HL4 A;  1KFV A;  3J7A S;  4LF7 M;  3IHP A;  1ZMW A;  2XSZ D;  1GAB A;  2QCU A;  2UXC M;  3ZH9 B;  2L7I A;  1PJT A;  1XMO M;  4RF1 A;  3FTC A;  3GQ5 A;  2DKL A;  1QUT A;  3KOZ E;  1XMQ M;  1NV9 A;  3GLH E;  4DBG B;  5KPT A;  3HHY A;  1R2Z A;  4I4L A;  4PD2 A;  1DO2 A;  3LCU A;  4F2L A;  1IXZ A;  1Y8G A;  1D0K A;  2LTU A;  4IBD A;  5FTK A;  3HHW A;  4WUR A;  2M5Z A;  4M0W A;  1PJI A;  1GKI A;  1KSF X;  3L2A A;  2FOI C;  5DYG A;  2XH9 A;  5KPR A;  4AI6 A;  1WXQ A;  1L1Z A;  4NRW A;  3HZJ A;  2CHQ A;  4QOS A;  4DUZ M;  1XC8 A;  3AOG A;  1OFH A;  3GO8 A;  3AJI B;  2ZAO A;  1NNU C;  3IG8 A;  3KSX A;  4LF9 M;  1AUA A;  2P5T A;  5BR8 M;  3LVV A;  4DR6 M;  4G3O A;  3GQ3 A;  4MGI E;  1TH3 A;  2FFJ A;  4AKG A;  4IBI A;  2XZU A;  4DR4 M;  3M0E A;  1YLA A;  1LV7 A;  3W67 A;  4PCZ A;  4ZPX A;  2VF8 A;  2C98 A;  1QUS A;  2BJW A;  2LHG A;  3C3D A;  3E9S A;  3VLF B;  1TR8 A;  3LQQ A;  3QAU A;  1JB0 F;  1HT2 E;  3KDS E;  1WHC A;  5E6J A;  7CAT A;  1WIV A;  5FLX S;  4P16 A;  4IBC A;  2JZ1 A;  4GC5 A;  2KNA A;  2LNH C;  4AZF A;  1VDD A;  1UFZ A;  2Y21 A;  2JZ0 A;  3PNY A;  1OIZ A;  2UXD M;  3HY5 A;  2QPA A;  2RRU A;  3HJQ A;  1PM5 A;  2MRO B;  2YR0 A;  4Z8X A;  3C58 A;  3KS8 A;  1DGF A;  3L26 A;  4X65 M;  2FNA A;  1N75 A;  4B3M M;  1SXJ B;  5EXT A;  3HJ8 A;  4BLC A;  2XEP A;  4NRV A;  2CP8 A;  1TDH A;  2J7N A;  4FVM A;  3VK8 A;  3U6P A;  3U6E A;  4FD2 A;  2X8A A;  3SHG B;  3M6A A;  4AG6 A;  2YNM D;  2K47 A;  4IBF A;  1TH2 A;  4P17 A;  1DGG A;  3JR4 A;  1WJ7 A;  3J7B A;  1T3T A;  3HKP A;  3U6O A;  1MX0 A;  3MJ5 A;  4FWD A;  4I81 A;  5EJC A;  3SAU A;  3TL4 X;  1QDT A;  1IBK M;  4IJF A;  3L25 A;  4B3T M;  3SAR A;  3L27 A;  1R4G A;  4D81 A;  5E26 A;  4DR5 M;  1YSY A;  5EP4 A;  1L2C A;  2UUB M;  1G3I A;  1D0M A;  2L4F A;  2Y0Q A;  3ZC7 B;  1L1T A;  4K0K M;  1HT1 E;  4D80 A;  4ANR A;  5LMU M;  1BVS A;  3GLI B;  4QHT A;  4X62 M;  1N36 M;  2C99 A;  3U5Z B;  3J80 S;  4YHH M;  5DNY A;  2JXN A;  2CUZ A;  2XF3 A;  3A42 A;  1XNQ M;  1Z59 A;  3GLG B;  4B3R M;  2R65 A;  3GRY A;  3U6L A;  2LVN C;  3U61 B;  1MU5 A;  4NOO B;  2H5X A;  4RNA A;  5KQD A;  2K6B A;  4OU7 A;  2ZTC A;  2A5Y B;  4F1I A;  3KOW E;  4GHA A;  1IFY A;  1DGB A;  4RKU F;  3UJN A;  2VDB B;  3SYK A;  4DV3 M;  2R0I A;  1I94 M;  2LBC A;  1G4A E;  4CIS A;  1JQJ C;  4LF5 M;  2JY5 A;  3RGS A;  4M9Z A;  4LY6 A;  2D7G A;  2Y0T A;  1TH4 A;  3KVW A;  3K9P A;  3HU2 A;  2R45 A;  1Z5C A;  4IBE A;  3KXE C;  1QQW A;  3QYE A;  4MGY E;  3SMS A;  4DUY M;  1F4I A;  4GEW A;  2GNO A;  4G4N A;  5ITQ A;  4PDI A;  2KZU A;  3A46 A;  1G71 A;  4LZJ A;  5FTJ A;  4DV6 M;  4LGM A;  4NSO B;  3GRV A;  3TWK A;  4LJ8 A;  3T1H M;  1NVM A;  4JI4 M;  3T1Y M;  1SXJ E;  1IN6 A;  2VII A;  2CV0 A;  4GIT A;  2ZBK B;  1SG9 A;  1SXJ D;  4Y28 F;  2EUC A;  4CIZ A;  2JP7 A;  1Q39 A;  1XXH A;  3CTW B;  4L15 A;  4R7G A;  3U6D A;  3T38 A;  2K0B X;  2X49 A;  2YQZ A;  2R4J A;  3I4Y A;  2F5S A;  1C1K A;  2HWJ A;  3AOE C;  4AKI A;  1QVR A;  5KO3 A;  3Q8G A;  2CWB A;  1IY1 A;  4HLQ A;  2WSE F;  5LMN M;  1OFI A;  4DR1 M;  1NY6 A;  4II7 A;  1N32 M;  1L2D A;  1EE8 A;  2C9C A;  3FYD A;  3GLI E;  3NBI A;  1NO1 A;  1YE9 A;  5IWA M;  4GKJ M;  2JWS A;  1QZM A;  1WGL A;  3GLG E;  3B7N A;  4LFB M;  1JR3 E;  3OTO M;  3L28 A;  4LRS A;  4S12 A;  3THG A;  3KS4 A;  3A45 A;  4LJ5 A;  2XSZ A;  2XFT A;  3ZCB B;  2R4E A;  1JR3 D;  3T15 A;  2OPF A;  1GL7 A;  2KNV A;  1P3Q Q;  3D8B A;  2KXE A;  2V1U A;  1N33 M;  1MN3 A;  2MJ5 B;  3K9O A;  2XLJ A;  1I4W A;  2I7N A;  3GLF B;  1HNZ M;  1EIJ A;  3I01 M;  3GP1 A;  2DEN A;  1DGH B;  2JY6 B;  2BWE A;  4ITQ A;  4B7G A;  3GPY A;  1D2N A;  3U6M A;  3GLH A;  3GRR A;  4X64 M;  3VFD A;  3K8Z A;  4L78 A;  5IRE B;  5JI3 E;  4M9X A;  1R6B X;  4FCT A;  3VK7 A;  2O5R A;  2UXB M;  2OOB A;  2F5N A;  1Q02 A;  3BXW A;  1VQ1 A;  4OX9 M;  1N78 A;  2X4A A;  4LZZ A;  4JI1 M;  2LXE A;  4IIW A;  4JI5 M;  2XZF A;  3H4J A;  2KEB A;  3Q8X A;  5ITX E;  1IXR C;  1E9R A;  3U60 B;  4JI0 M;  3PNV A;  3B74 A;  2E5L M;  5EP3 A;  4AKH A;  2RGO A;  2UUA M;  4DR2 M;  3KOX E;  2LVP C;  2GQF A;  5KQ8 A;  2L4E A;  4UN2 B;  2OO9 A;  1Z5B A;  2N35 A;  1QAN A;  4JN6 A;  3M7G A;  4HEO A;  4X66 M;  3E21 A;  4LCB A;  4CJ6 A;  3FD9 A;  1XWI A;  2F5P A;  1G41 A;  3GPP A;  1ZV1 A;  2V1C A;  2B3T A;  5FTL A;  1NV8 A;  1NHW C;  3LMM A;  1RU3 A;  2HHH M;  3SC3 A;  2M60 A;  1NJG A;  3UGJ A;  2KW0 A;  2MR9 A;  3KP1 E;  1S3S A;  4LF8 M;  4OVZ B;  1X37 A;  3HX3 A;  2HAK A;  2K9D A;  2R18 A;  3SHF A;  3R8F A;  2KRK A;  1HJP A;  2R6F A;  2XFS A;  3HJS A;  1J5E M;  2W82 A;  4QNM A;  2CV2 A;  3AOE A;  3DA1 A;  2QZ4 A;  3LCV B;  4LJ4 A;  3FTF A;  1Q3B A;  4G4O A;  3B7Q A;  3W0F A;  2F4V M;  2G8L A;  1L8Q A;  4A3V B;  2QBY A;  1SXJ C;  1AIP C;  2VQE M;  4DV1 M;  2CHG A;  4TUW A;  4GIP A;  4LG2 A;  4IJE A;  2KHH A;  1GJS A;  1WGN A;  2DI0 A;  4M0D A;  1FNN A;  2KA6 B;  3E4R A;  3GLF E;  3ZQJ A;  2ZTD A;  3SMP A;  2DWN A;  4AW4 A;  2LWX A;  2Z3X A;  3W68 A;  3HU3 A;  1Z6T A;  3MMP A;  3LW5 F;  3K92 A;  2HL7 A;  3LQR A;  2QNJ A;  4BBA A;  3JR5 A;  4DR3 M;  3UMM A;  2R62 A;  1IN4 A;  3I51 A;  4IBK A;  4R71 A;  2LH0 A;  3PVS A;  1IXS B;  1TF0 B;  5FSW A;  4NSR A;  2DZN B;  1W5T A;  3CF2 A;  3U6C A;  5EP2 A;  1XHB A;  3FTD A;  1VG5 A;  3NBX X;  1G59 A;  5ITU A;  3FUW A;  2Z7J A;  1LTM A;  1N34 M;  3RFW A;  2QQ8 A;  1CUK A;  4FW9 A;  4IBB A;  4DV0 M;  4DV2 M;  1XB2 B;  1OTR A;  1OAO C;  1UM8 A;  3CGW A;  3SBJ A;  1OQY A;  2HCB A;  4BB9 A;  4KOD A;  1HNX M;  1OIP A;  1T43 A;  1ORY B;  1HR0 M;  1YUB A;  2DHY A;  4W5W A;  2AHM A;  4IBG A;  3SYL A;  2DVW B;  1NNJ A;  3BOS A;  3HHX A;  3H4M A;  4FWH A;  3KSJ A;  4D82 A;  3UK6 A;  4MM3 B;  5EQT A;  5ITY A;  3HU1 A;  3K2L A;  5H37 D;  2BWB A;  5IZ7 D;  3GPU A;  4G4Q A;  1R2Y A;  3FRH A;  1N77 A;  2Z4R A;  3QYB A;  1PJS A;  1NJF A;  3U6S A;  4KT0 F;  1J7K A;  3A98 B;  4GC9 A;  3FE3 A;  3J2P B;  3TPZ A;  3J81 S;  2JNH A;  4Q7J A;  3AL0 C;  1VDL A;  2DWL A;  2LVQ D;  1T6O A;  2JA2 A;  1NSF A;  4B08 A;  5KPZ A;  4NL4 H;  1E94 E;  1ZQ9 A;  5FTN A;  4LJ9 A;  5EXS A;  4L16 A;  1SXJ A;  2LVA A;  2WZJ A;  2ZAM A;  3QWL A;  4JYA M;  3EIH A;  2O25 A;  4B3S M;  2L7H A;  3VKH A;  1J09 A;  1QAM A;  4G6Z A;  5IT9 S;  3J27 B;  1A5T A;  3TQS A;  3VDU A;  4GHL A;  5C18 A;  3AFH A;  4PT5 A;  1ZMV A;  4L4U A;  1K3W A;  5GKN A;  4CGY B;  2KNZ A;  2DAM A;  4MGZ E;  5BPV A;  3PFI A;  5DYI A;  3SAW A;  2F5O A;  2APL A;  4LF4 M;  1OKS A;  3K1J A;  1IN7 A;  1NY5 A;  4LGY A;  2LHC A;  2RGH A;  2DNA A;  2F5Q A;  4PDG A;  3DFZ A;  3GLI A;  5A2Q S;  1MJG M;  1TGU A;  2EA0 A;  1GJT A;  3U5Z A;  4M9S A;  3ILK A;  2VQF M;  3GLG A;  5L8R F;  4FWG A;  1JR3 A;  1DO0 A;  3LVW A;  4I8O A;  3U61 A;  3MK6 A;  1QDR A;  2Y20 A;  1IXS A;  3SAV A;  4LF6 M;  2WSF F;  1HQY E;  4L6V 6;  1KYI A;  1PGY A;  3KOY E;  2CRU A;  1HQC A;  3EIE A;  4FCW A;  2EJS A;  4MH0 E;  4QHS A;  4KO8 A;  2XGN A;  2DWZ B;  3C3E A;  1H6U A;  3NWL A;  4YY3 M;  2RKO A;  3V76 A;  2KZS A;  3HWS A;  2CHV A;  2J5Y A;  4LFA M;  4JI6 M;  1HNW M;  3KFU G;  4LRT A;  2J7O A;  4MGH A;  1W5S A;  3F92 A;  3PXG A;  4JI2 M;  5ITT A;  3L29 A;  4XGI A;  3T6P A;  1G8P A;  2DZL A;  3SAS A;  1EFU B;  2ZAN A;  4GH9 A;  3SFZ A;  1R7R A;  3RGP A;  5ITX A;  5ITR A;  5EXP A;  4KLN A;  2ZM6 M;  2D7E A;  2Q2E B;  3BBZ A;  1IN5 A;  1GVN A;  2V6Z M;  4GMQ A;  1IM2 A;  3GQ4 A;  1OAI A;  2I7P A;  4I5S A;  2DHR A;  3R9X B;  3WHK A;  4JI7 M;  1XXH B;  2QHO B;  3U6Q A;  4NC6 A;  3B7Z A;  4AG5 A;  2R46 A;  2L2D A;  4MB7 A;  1V92 A;  2C96 A;  4G4R A;  4NXN M;  4B7F A;  2WSC F;  2MGW A;  2QSF X;  3TWL A;  4B7H A;  1TTE A;  2KRU A;  5C1B A;  2H1R A;  1C7Y A;  4QOZ C;  2QEN A;  4REZ A;  2JY8 A;  3C9P A;  2FS1 A;  1WR1 B;  5EXX A;  4KHP M;  3TWM A;  2C9O A;  1PJJ A;  3B9P A;  2CE7 A;  4LJA A;  4R3D A;  2O01 F;  4LJ6 A;  1XNR M;  1IQP A;  1Z5A A;  2BJV A;  2UUC M;  2JY7 A;  5JI2 E;  4JI8 M;  4JV5 M;  4LJ7 A;  3W0L B;  4JI3 M;  2Z8Y M;  2EO2 A;  1QYR A;  4CHT B;  3VKG A;  1FJG M;  2HKJ A;  4GRI A;  4FCV A;  4XBO A;  4DV5 M;  4L8R C;  1GLN A;  4QNR A;  3TE6 A;  4GKK M;  2FE8 A;  1VEJ A;  2CFO A;  3FKE A;  2LVO C;  4JXJ A;  1PRB A;  3IG5 A;  3I4V A;  1L2B A;  1V34 A;  2DAG A;  4OW0 A;  1E9S A;  3GLF A;  3IEC A;  3GLH B;  4MGK E;  1OJL A;  2NQ8 C;  1DGH A;  3JAM S;  1IBL M;  1VEK A;  2OOA A;  2DXI A;  1GL6 A;  3KP0 E;  3DOA A;  3E46 A;  5FTM A;  1IN8 A;  3HHZ A;  2D7H A;  1Q3C A;  3GRU A;  1ZAE A;  3GPX A;  5EP1 A;  1QZE A;  4RF0 A;  3AKZ A;  2BNK A;  1GO5 A;  2G5G X;  4WW0 A;  3MHV C;  2UU9 M;  1DV0 A;  2QP9 X;  2DAE A;  3FUU A;  3U60 A;  4DV7 M;  4AQY M;  2EKK A;  4DV4 M;  2FH0 A;  3FUV A;  3CF6 E;  1IY0 A;  3VDP A;  8CAT A;  3HGI A;  4Z6Y A;  3B89 A;  4IBJ A;  3DZD A;  2Z4S A;  4DR7 M;  2JUJ A;  1NHG C; 
#chains in the Genus database with same CATH homology
 4LFC M;  1K82 A;  3FYC A;  2DWM A;  2CEA A;  2DZO B;  2L09 A;  2C5R A;  4NXM M;  3WHL A;  3FUT A;  2CV1 A;  3FTE A;  1K3X A;  3CF0 A;  1IY2 A;  3AV0 A;  4OVZ A;  1IBM M;  5F3W A;  1E32 A;  3D8L A;  1TDZ A;  1QAQ A;  2OQ4 A;  3RE8 A;  1QAO A;  4EIW A;  2YFQ A;  2QBY B;  3UZU A;  3KW6 A;  3FUX A;  2ERC A;  3SAT A;  2L6O A;  4HL4 A;  1KFV A;  3J7A S;  4LF7 M;  2XSZ D;  2QCU A;  2UXC M;  3ZH9 B;  2L7I A;  1XMO M;  4RF1 A;  3FTC A;  3GQ5 A;  1XMQ M;  3KOZ E;  5KPT A;  3HHY A;  1R2Z A;  4I4L A;  4PD2 A;  1DO2 A;  1IXZ A;  4IBD A;  5FTK A;  3HHW A;  4WUR A;  2M5Z A;  4M0W A;  1PJI A;  1GKI A;  1KSF X;  3L2A A;  2FOI C;  5DYG A;  2XH9 A;  5KPR A;  4AI6 A;  1WXQ A;  1L1Z A;  4NRW A;  2CHQ A;  4QOS A;  4DUZ M;  1XC8 A;  3AOG A;  1OFH A;  3GO8 A;  3AJI B;  2ZAO A;  1NNU C;  3IG8 A;  3KSX A;  2P5T A;  5BR8 M;  3LVV A;  4DR6 M;  3GQ3 A;  4MGI E;  1TH3 A;  2FFJ A;  4AKG A;  4IBI A;  2XZU A;  4DR4 M;  3M0E A;  1LV7 A;  4PCZ A;  4ZPX A;  2C98 A;  2BJW A;  3E9S A;  3VLF B;  3LQQ A;  3QAU A;  1HT2 E;  3KDS E;  5E6J A;  7CAT A;  5FLX S;  4P16 A;  4IBC A;  4GC5 A;  2LNH C;  4AZF A;  1VDD A;  2Y21 A;  3PNY A;  2UXD M;  2QPA A;  3HJQ A;  1PM5 A;  2YR0 A;  4Z8X A;  3C58 A;  3KS8 A;  1DGF A;  3L26 A;  4X65 M;  2FNA A;  1N75 A;  4B3M M;  1SXJ B;  5EXT A;  3HJ8 A;  4BLC A;  2XEP A;  4NRV A;  2J7N A;  1TDH A;  3VK8 A;  4FVM A;  3U6P A;  3U6E A;  4FD2 A;  2X8A A;  3SHG B;  3M6A A;  4AG6 A;  2YNM D;  2K47 A;  4IBF A;  1TH2 A;  3JR4 A;  1DGG A;  3U6O A;  1L2C A;  3J7B A;  1T3T A;  3HKP A;  1MX0 A;  3MJ5 A;  4FWD A;  4I81 A;  5EJC A;  3SAU A;  3TL4 X;  1IBK M;  4IJF A;  3L25 A;  4B3T M;  3SAR A;  3L27 A;  4D81 A;  5E26 A;  4DR5 M;  1YSY A;  5EP4 A;  2UUB M;  1G3I A;  2Y0Q A;  3ZC7 B;  1L1T A;  4K0K M;  1HT1 E;  4D80 A;  5LMU M;  3GLI B;  4QHT A;  4X62 M;  1N36 M;  2C99 A;  3U5Z B;  3J80 S;  4YHH M;  5DNY A;  2XF3 A;  2CUZ A;  4B3R M;  3A42 A;  1XNQ M;  1Z59 A;  3GLG B;  2R65 A;  3GRY A;  3U6L A;  3U61 B;  1MU5 A;  4NOO B;  4RNA A;  5KQD A;  4OU7 A;  2A5Y B;  4GHA A;  3KOW E;  1DGB A;  3UJN A;  3SYK A;  4DV3 M;  1I94 M;  1G4A E;  4CIS A;  1JQJ C;  4LF5 M;  3RGS A;  4M9Z A;  4LY6 A;  2D7G A;  2Y0T A;  1TH4 A;  3KVW A;  3HU2 A;  2R45 A;  1Z5C A;  4IBE A;  3KXE C;  1QQW A;  4MGY E;  4DUY M;  3SMS A;  4G4N A;  5ITQ A;  4PDI A;  2KZU A;  3A46 A;  4LZJ A;  5FTJ A;  4DV6 M;  4LGM A;  4NSO B;  3GRV A;  3TWK A;  4LJ8 A;  3T1H M;  1NVM A;  4JI4 M;  3T1Y M;  1SXJ E;  1IN6 A;  2VII A;  2CV0 A;  4GIT A;  2ZBK B;  1SXJ D;  2EUC A;  1Q39 A;  1XXH A;  3CTW B;  4L15 A;  4R7G A;  3U6D A;  3T38 A;  2X49 A;  2YQZ A;  2R4J A;  3I4Y A;  2F5S A;  1C1K A;  3AOE C;  4AKI A;  1QVR A;  5KO3 A;  1IY1 A;  4HLQ A;  5LMN M;  4DR1 M;  1OFI A;  1NY6 A;  4II7 A;  1N32 M;  1L2D A;  1EE8 A;  2C9C A;  3FYD A;  3NBI A;  1YE9 A;  5IWA M;  4GKJ M;  1QZM A;  4LFB M;  3OTO M;  3L28 A;  4LRS A;  4S12 A;  3THG A;  3KS4 A;  3A45 A;  4LJ5 A;  2XSZ A;  2XFT A;  3ZCB B;  2R4E A;  1JR3 D;  3T15 A;  2OPF A;  1GL7 A;  3D8B A;  2V1U A;  2KXE A;  1N33 M;  2XLJ A;  1I4W A;  2I7N A;  3GLF B;  1HNZ M;  3GP1 A;  1DGH B;  4ITQ A;  4B7G A;  3GPY A;  1D2N A;  3U6M A;  3GLH A;  3GRR A;  4X64 M;  3VFD A;  3K8Z A;  4L78 A;  5IRE B;  5JI3 E;  4M9X A;  1R6B X;  4FCT A;  3VK7 A;  2O5R A;  2UXB M;  2F5N A;  4OX9 M;  1N78 A;  2X4A A;  4LZZ A;  4JI1 M;  2LXE A;  4IIW A;  4JI5 M;  2XZF A;  2KEB A;  3Q8X A;  5ITX E;  1IXR C;  1E9R A;  3U60 B;  4JI0 M;  3PNV A;  2E5L M;  4AKH A;  5EP3 A;  2RGO A;  2UUA M;  4DR2 M;  3KOX E;  5KQ8 A;  1Z5B A;  1QAN A;  4JN6 A;  3M7G A;  4X66 M;  4LCB A;  3FD9 A;  1XWI A;  2F5P A;  1G41 A;  3GPP A;  2V1C A;  5FTL A;  1NHW C;  3LMM A;  2HHH M;  3SC3 A;  2M60 A;  1NJG A;  3UGJ A;  2KW0 A;  4LF8 M;  3KP1 E;  1S3S A;  4OVZ B;  1X37 A;  2R18 A;  3SHF A;  3R8F A;  2KRK A;  2XFS A;  1J5E M;  3HJS A;  2W82 A;  4QNM A;  2CV2 A;  3AOE A;  3DA1 A;  2QZ4 A;  4LJ4 A;  3FTF A;  1Q3B A;  4G4O A;  3W0F A;  2F4V M;  2G8L A;  1L8Q A;  4A3V B;  2QBY A;  1SXJ C;  2VQE M;  4DV1 M;  2CHG A;  4TUW A;  4GIP A;  4LG2 A;  4IJE A;  4M0D A;  1FNN A;  2KA6 B;  3E4R A;  3SMP A;  2DWN A;  4AW4 A;  2LWX A;  2Z3X A;  3HU3 A;  1Z6T A;  3K92 A;  2HL7 A;  3LQR A;  4BBA A;  3JR5 A;  4DR3 M;  3UMM A;  2R62 A;  1IN4 A;  3I51 A;  4IBK A;  2LH0 A;  3PVS A;  1IXS B;  5FSW A;  4NSR A;  2DZN B;  1W5T A;  3CF2 A;  3U6C A;  5EP2 A;  1XHB A;  3FTD A;  1G59 A;  5ITU A;  3FUW A;  2Z7J A;  1N34 M;  3RFW A;  4FW9 A;  4DV0 M;  4IBB A;  4DV2 M;  1UM8 A;  3SBJ A;  2HCB A;  4BB9 A;  4KOD A;  1HNX M;  1ORY B;  1HR0 M;  1YUB A;  4W5W A;  2AHM A;  4IBG A;  3SYL A;  2DVW B;  1NNJ A;  3BOS A;  3HHX A;  3H4M A;  4FWH A;  3KSJ A;  4D82 A;  3UK6 A;  4MM3 B;  5EQT A;  5ITY A;  3HU1 A;  3K2L A;  5H37 D;  5IZ7 D;  3GPU A;  4G4Q A;  1R2Y A;  1N77 A;  2Z4R A;  1NJF A;  3U6S A;  1J7K A;  3A98 B;  4GC9 A;  3TPZ A;  3J2P B;  3J81 S;  3AL0 C;  2DWL A;  2JA2 A;  1NSF A;  4B08 A;  5KPZ A;  4NL4 H;  1E94 E;  1ZQ9 A;  5FTN A;  4LJ9 A;  5EXS A;  4L16 A;  1SXJ A;  2ZAM A;  3QWL A;  4JYA M;  3EIH A;  4B3S M;  2L7H A;  3VKH A;  1J09 A;  1QAM A;  4G6Z A;  5IT9 S;  3J27 B;  3TQS A;  3VDU A;  4GHL A;  5C18 A;  3AFH A;  4PT5 A;  4L4U A;  1K3W A;  5GKN A;  4CGY B;  4MGZ E;  5BPV A;  3PFI A;  5DYI A;  3SAW A;  2F5O A;  4LF4 M;  3K1J A;  1IN7 A;  1NY5 A;  4LGY A;  2RGH A;  2F5Q A;  4PDG A;  3DFZ A;  3GLI A;  5A2Q S;  1TGU A;  2EA0 A;  3U5Z A;  4M9S A;  3ILK A;  2VQF M;  3GLG A;  4FWG A;  1JR3 A;  1DO0 A;  3LVW A;  4I8O A;  3U61 A;  3MK6 A;  2Y20 A;  3SAV A;  4LF6 M;  1HQY E;  4MH0 E;  1KYI A;  3KOY E;  4FCW A;  3EIE A;  1HQC A;  4LF9 M;  4QHS A;  4KO8 A;  2XGN A;  2DWZ B;  1H6U A;  3NWL A;  4YY3 M;  2RKO A;  2KZS A;  3HWS A;  2CHV A;  4LFA M;  4JI6 M;  1HNW M;  3KFU G;  4LRT A;  2J7O A;  4MGH A;  1W5S A;  3PXG A;  4JI2 M;  5ITT A;  3L29 A;  4XGI A;  1G8P A;  3SAS A;  2ZAN A;  4GH9 A;  3SFZ A;  1R7R A;  3RGP A;  5ITX A;  5ITR A;  5EXP A;  4KLN A;  2ZM6 M;  2D7E A;  2Q2E B;  1IN5 A;  1GVN A;  2V6Z M;  4GMQ A;  1IM2 A;  3GQ4 A;  2I7P A;  4I5S A;  2DHR A;  3R9X B;  3WHK A;  4JI7 M;  1XXH B;  3U6Q A;  4AG5 A;  2R46 A;  4MB7 A;  2C96 A;  4G4R A;  4NXN M;  4B7F A;  4B7H A;  3TWL A;  5C1B A;  4QOZ C;  2KRU A;  2H1R A;  2QEN A;  4REZ A;  5EXX A;  4KHP M;  3TWM A;  2C9O A;  1PJJ A;  3B9P A;  2CE7 A;  4LJA A;  4R3D A;  4LJ6 A;  1XNR M;  1IQP A;  1Z5A A;  2BJV A;  2UUC M;  5JI2 E;  4JI8 M;  4JV5 M;  4LJ7 A;  3W0L B;  4JI3 M;  3VKG A;  2EO2 A;  1QYR A;  4CHT B;  1FJG M;  2HKJ A;  4GRI A;  4FCV A;  4XBO A;  4DV5 M;  1GLN A;  4QNR A;  3TE6 A;  4GKK M;  2FE8 A;  2CFO A;  3FKE A;  4JXJ A;  3IG5 A;  3I4V A;  1L2B A;  4OW0 A;  1E9S A;  3GLF A;  4MGK E;  3GLH B;  3JAM S;  1OJL A;  2NQ8 C;  1DGH A;  1IBL M;  4L8R C;  2DXI A;  1GL6 A;  3KP0 E;  3DOA A;  5FTM A;  1IN8 A;  3HHZ A;  2D7H A;  1Q3C A;  3GRU A;  1ZAE A;  3GPX A;  5EP1 A;  4RF0 A;  3AKZ A;  2BNK A;  2G5G X;  4WW0 A;  3MHV C;  2UU9 M;  2QP9 X;  3FUU A;  3U60 A;  4DV7 M;  4AQY M;  4DV4 M;  3FUV A;  3CF6 E;  1IY0 A;  3VDP A;  8CAT A;  3HGI A;  4Z6Y A;  4IBJ A;  3DZD A;  2Z4S A;  4DR7 M;  1NHG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...