3T1YM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t1yM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3t1yM02
3C58A 4PCZA 3GPXA 1IBKM 5ITXE 1MU5A 1Z5AA 4AQYM 4DR1M 5ITRA 3U6MA 1L2DA 1HNZM 3GO8A 4LF6M 2HHHM 1IBMM 4JI5M 2UXBM 5IWAM 3SAWA 2OQ4A 3T1HM 4LF5M 1EE8A 4DV2M 1XC8A 4DV3M 4DV6M 4DR3M 3DOAA 1PJJA 4GKJM 4DUYM 4DR6M 3GP1A 3GPUA 4DV7M 1L1TA 3U6OA 1XNRM 1XMQM 4B3TM 1TDHA 5A2QS 3JR5A 3JR4A 4PDGA 4JI4M 3GQ5A 4DR4M 4JI3M 4DV1M 3SBJA 2VQEM 2F5NA 4LFAM 2VQFM 3U6SA 4LF9M 3VK7A 3J7AS 1TDZA 4X66M 1I94M 4NRVA 3A42A 1KFVA 5ITUA 3JAMS 4LF7M 3U6CA 4JI7M 1FJGM 4JI0M 2UUCM 2F5PA 3TWKA 3U6DA 2F4VM 2UUBM 3GPPA 4DR5M 4OX9M 3OTOM 4DUZM 3SASA 1N36M 4DV5M 5ITTA 1N33M 2UXCM 3W0FA 3U6QA 3SAVA 4B3MM 3A45A 1N32M 4NXNM 2ZM6M 4NXMM 1XMOM 1XNQM 3U6PA 4PD2A 4YHHM 1PJIA 4MB7A 1MX0A 1Z5CA 4JV5M 1K3WA 4DR7M 4G4RA 2OPFA 2ZBKB 1NNJA 1Z5BA 4JI8M 4KHPM 5IT9S 4JI1M 1L1ZA 1HR0M 1L2CA 5ITXA 4JYAM 4B3RM 1J5EM 4CISA 3J81S 3SAUA 4LFBM 3SATA 1L2BA 1HNWM 5FLXS 3SARA 4JI2M 2EA0A 3T1YM 4DV4M 2F5QA 2UU9M 2Q2EB 5ITYA 4JI6M 1K3XA 2F5SA 4B3SM 5BR8M 4G4QA 4LF4M 3U6EA 2XZUA 1N34M 4PDIA 4X62M 3GQ4A 5LMUM 2XZFA 4GKKM 4LFCM 2F5OA 4LF8M 4X65M 1Q3BA 3GPYA 3J80S 4DV0M 1IBLM 2UUAM 1HNXM 1Z59A 4DR2M 5LMNM 3A46A 4X64M 1R2YA 1K82A 1R2ZA 1PM5A 3TWLA 3U6LA 3TWMA 3VK8A 2HKJA 4K0KM 1Q39A 2UXDM 1Q3CA 4ITQA 4YY3M 3GQ3A 5ITQA 4G4OA 2E5LM 4NRWA 4G4NA
chains in the Genus database with same CATH superfamily
4LG2A 4IBKA 3HWSA 4GHAA 3C3EA 3FD9A 3A98B 4PCZA 1IBKM 1IXRC 1E94E 4NC6A 2L4FA 2M60A 2ZAMA 4D80A 1VEGA 3L25A 1L2DA 2HHHM 2LHGA 1GKIA 3SBJA 3E9SA 4F1IA 1WIVA 4JI5M 2OQ4A 1FNNA 4LF5M 8CATA 3AKZA 4DV2M 1NNUC 5EP4A 3GLHE 3SHFA 2XF3A 2Z4SA 3J7BA 4G3OA 2JNHA 1PJJA 3FUVA 1WHCA 4MGZE 4QHSA 4L78A 4B08A 4D81A 3FTEA 2DHYA 3ZH9B 3T15A 2KDLA 2YFQA 3ILKA 1E9RA 4KLNA 5A2QS 4DR4M 3HY5A 4PDGA 4RF1A 4JI4M 4I5SA 2KXEA 2O01F 4JI3M 2ZTCA 1YE9A 1EFUB 1IXSA 2N35A 3CF0A 3FYDA 4G6ZA 4Z6YA 2CHVA 1BVSA 4B7GA 4TUWA 3NWLA 3L28A 1RU3A 1FJGM 3FUUA 4IJEA 1R6BX 5C18A 3U6CA 4IBFA 2CEAA 1IXSB 4QNRA 3FUXA 2F5PA 1GLNA 2EO2A 1DO2A 2LHCA 3SMSA 3K9PA 2F4VM 1ZMWA 2UUBM 1TR8A 4LY6A 5E6JA 4JN6A 4DUZM 3SASA 2G3QA 4R7GA 4AKIA 2XEPA 5ITTA 5KPRA 2UXCM 2JXNA 4UN2B 3SAVA 1E32A 2C9CA 4HLQA 3KOXE 4NXNM 4NXMM 3LVVA 3VFDA 3R9XB 4ANRA 4I81A 2Z3XA 4NSRA 2X49A 1TH3A 3THGA 3GRYA 3HHZA 1PJSA 3CF6E 2G5GX 2DAEA 1NNJA 1IY2A 4JI1M 1NSFA 4IBBA 2CHGA 1HR0M 3UJNA 3KP0E 1MJGM 1ZAEA 4AKGA 3VDUA 1J5EM 4IBCA 1QAOA 4GC9A 3SATA 1QDRA 4LGYA 2QQ8A 3H4JA 3HJ8A 3VDPA 2KZSA 5FLXS 3AL0C 2H5XA 3HZJA 5EJCA 5DYGA 1J7KA 2KNAA 4CIZA 1NHWC 2G8LA 2V1UA 3CF2A 3PNYA 4PT5A 2MROB 3Q8GA 4EIWA 1OKSA 2HL7A 1TH2A 3FUWA 2CUZA 4XK8F 2ZANA 4IJFA 5FTJA 3GQ4A 1T43A 1HT1E 5LMUM 2ZTDA 1OJLA 3GLIA 2F5OA 3AOEA 5FTMA 3L27A 2DI0A 5EP2A 3W0LB 1OQYA 3AJIB 3CGWA 4LCBA 2JP7A 4LZZA 2UUAM 3HJSA 1JR3A 3GRRA 7CATA 1IM2A 1R2ZA 1PM5A 1WXQA 2XH9A 1I4WA 5DYIA 1W5TA 4FWGA 5KQ8A 3TWMA 3GLHA 3VK8A 2FE8A 3F92A 2CFOA 2V1CA 2V6ZM 3Q8XA 5KPTA 2C9OA 5JI3E 1W5SA 5EXTA 4G4OA 3MJ5A 5EXPA 4NRWA 3VK7A 4FWHA 4MGHA 2XLJA 3ZCBB 3E46A 3R8FA 3GPXA 4FVMA 5EP3A 3KVWA 3U5ZB 4LJ4A 3LCUA 3PNVA 3LQQA 1Z5AA 1YSYA 5DNYA 2P5TA 4OVZB 4DR1M 1IN6A 2K0BX 3LW5F 3U6MA 1LV7A 4LF6M 1IBMM 1IY1A 2C99A 4GC5A 3SAWA 1QAQA 2K6BA 2DWLA 1NV9A 2VF7A 3RGPA 5KQDA 2JA2A 4DV3M 2DZLA 2J7OA 1N75A 3QYBA 1S3SA 1YUBA 1DO0A 2I7NA 4DUYM 2RRUA 4GHLA 1Q02A 2NQ8C 3UMMA 3GPUA 4DV7M 1XNRM 1AUAA 1JR3E 1XMQM 2DVWB 3JR4A 3U60B 3QWLA 3GQ5A 1DGGA 2ERCA 2BWEA 3AOGA 1DGHB 2RGHA 4XBOA 5KPZA 2DENA 2VQEM 4L16A 4DV1M 1N77A 2F5NA 3U6SA 3HHYA 4XGIA 2D7GA 2Y0TA 1D2NA 1GVNA 1DGBA 3A42A 1KFVA 2DAKA 1QUTA 1ZV1A 1I94M 4AG5A 4LF7M 2KRKA 3TWKA 3U6DA 2R18A 4DR5M 1WJ7A 2Z4RA 2XGNA 3KOWE 3I4VA 5E26A 2FH0A 3LMMA 5ITQA 1PJQA 3T38A 1KYIA 2QP9X 1PRBA 1OIZA 3NBXX 4M0WA 4DV5M 3MHVC 4M9ZA 1N32M 1QVRA 2L09A 1AIPC 4L4UA 3KS4A 1IQPA 2ZM6M 4AI6A 2MH8A 1XNQM 4LJAA 1PJIA 1DGHA 1R5LA 1Z5CA 1SXJD 3U5ZA 2LVNC 3U60A 2YNMD 2DWZB 5FTKA 4G4RA 3K8ZA 2QCUA 2ZBKB 1TF0B 3L29A 2AHMA 4KHPM 3RGSA 4A3VB 4L8RC 3T6PA 3L2AA 3D8LA 1XWIA 3GLIE 4REZA 5FTLA 4CISA 4QOSA 2FS1A 4LGMA 2JUJA 3TL4X 2DXIA 1P3QQ 3HJQA 4FWDA 3KP1E 3HU2A 1GL7A 5EXXA 3DFZA 2KRUA 2Y20A 4GEWA 3BXWA 1HQCA 3SARA 3IG5A 4Q7JA 1VG5A 3QYEA 4KT0F 3WHLA 3T1YM 2CE7A 4DBGB 3UK6A 3GLIB 4RNAA 5ITYA 2F5SA 3B89A 4AG6A 4G4QA 1V33A 1YLAA 3EIEA 2HAKA 3FRIA 3J2PB 3WHKA 4PDIA 4X62M 4GIPA 3TQSA 2XZFA 4LFCM 3PVSA 2O5RA 4NOOB 1G3IA 1L8QA 3KDSE 4ZPXA 3BOSA 2O25A 4FCTA 3LQRA 1HNXM 4P17A 2H1RA 1Z6TA 2C5RA 2DAGA 3KFUG 2BJVA 1NJGA 1OAOC 1Y8GA 3U6LA 3IG8A 1DGFA 2WSCF 3KOYE 4I4LA 2VIIA 3KXEC 2HKJA 2UXDM 2X4AA 4IBGA 2JY5A 3C9PA 4YY3M 2L7HA 1IN7A 2E5LM 4AQYM 2RKOA 3KS8A 1QZEA 2R4JA 2JWSA 2CV0A 4GITA 4M9SA 4NL4H 4FCWA 1HQYE 1WGNA 1GO5A 1V34A 1F4IA 5C1BA 4AKHA 2KZUA 5ITRA 3FYCA 4WW0A 3GO8A 4LJ5A 1XB2B 2LWXA 2DHRA 1HNZM 4L6V6 1NV8A 4LJ6A 1WR1B 3RE8A 4LZJA 1MN3A 1D0LA 1H6UA 4DV6M 4R3DA 2JY6B 2CRUA 4GKJM 1PGYA 4CHTB 2LNHC 4DR6M 2EJSA 4QOZC 2A5YB 1L1TA 1GABA 1TDHA 3JR5A 3M0EA 4W5WA 4FCVA 2R65A 4LFAM 1ZQ9A 2LTUA 4S12A 4LF9M 2FNAA 3J7AS 3SHGB 3W68A 4X66M 2QPAA 2J7NA 2WSFF 4IBJA 4NRVA 3E21A 3MK6A 5JI2E 1G71A 5ITUA 4I8OA 1GJSA 2I7PA 2FOIC 1VDLA 1N78A 3IECA 4GRIA 3HGIA 2X8AA 4OX9M 2GNOA 1EIJA 5KO3A 3OTOM 5FTNA 1N36M 2C96A 4BB9A 1UFZA 2WZJA 4P16A 1OFHA 4B3MM 3FRHA 1GL6A 1UM8A 1NJFA 2DAMA 1XMOM 3AOEC 2L2DA 3TPZA 3U6PA 2L6OA 3KSJA 1OTRA 2YQZA 1NVMA 4MB7A 1IFYA 4JV5M 4IBEA 3K1JA 2DZOB 4NSOB 2KEBA 3K92A 3GRVA 1C7YA 4KO8A 5IT9S 1SXJA 1L2CA 1QQWA 4JYAM 4B3RM 2JZ1A 4MH0E 1DV0A 5EQTA 1TTEA 1OFIA 2Z7JA 3ZQJA 3L26A 1VEKA 1L2BA 2DWNA 3AFHA 1G4AE 3K2LA 3AV0A 4Z8XA 2EA0A 2W82A 4IBDA 4MGYE 1NHGC 2MR9A 3B7NA 4JXJA 2R6FA 5DFLA 2UU9M 5EP1A 1IY0A 2D7HA 4B3SM 1QAMA 1IN4A 1XHBA 4LF4M 3FTDA 1G8PA 4IIWA 1N34M 1QZMA 3HU3A 4D82A 2L7IA 1Q3BA 2Y0QA 2R45A 2K9DA 3GPYA 4F2LA 1ORYB 2OO9A 4M0DA 4DR2M 5LMNM 3A46A 5BPVA 3C3DA 2K47A 2OOAA 3KW6A 4BBAA 2EKKA 3PFIA 3PXGA 3LVWA 2RGOA 4K0KM 4HL4A 4ITQA 4Y28F 4OW0A 2LBCA 2EUCA 4FD2A 4L15A 4CGYB 3BBZA 1VQ1A 4HEOA 4MGKE 3B7ZA 3FTFA 4WURA 3LCVB 3MMPA 3SYKA 3C58A 2XSZA 4AZFA 1WGLA 1IN8A 3SFZA 5ITXE 3V76A 2QSFX 1MU5A 1QANA 1X37A 2LVAA 2DNAA 3GLGB 2R0IA 3B9PA 1XXHA 3HHWA 2XSZD 3I51A 2UXBM 4WP2A 3E4RA 1KSFX 2ZAOA 5IWAM 3T1HM 2CV2A 1EE8A 1OIPA 3I04M 4LRSA 1XC8A 3EIHA 2MJ5B 3M6AA 3DOAA 4DR3M 2HWJA 2DKLA 3GLFB 1G59A 1IN5A 2CV1A 2BWBA 1G41A 2KNVA 3GLGE 3GP1A 2KA6B 3U6OA 2B3TA 4B3TM 3FTCA 1OAIA 4RF0A 3U61A 1SG9A 4MGIE 1JB0F 4IBIA 2VQFM 3SMPA 4RKUF 3FUTA 2QZ4A 3GLFE 4KODA 3VKHA 1TDZA 2QNJA 3ZC7B 2QBYB 1V92A 1D0MA 2MGWA 5GKNA 3JAMS 4JI7M 4JI0M 3H4MA 1NY5A 4B7HA 2UUCM 4GMQA 3HX3A 3I4YA 3FE3A 3UGJA 2XFSA 2BJWA 2C98A 2VDBB 3GPPA 4M9XA 3QAUA 4LJ9A 1GJTA 1SXJC 3KSXA 5L8RF 1N33M 2KHHA 3W0FA 3U6QA 1T3TA 2JY7A 2BNKA 3A45A 4FW9A 3RFWA 1CUKA 2QBYA 2R44A 4AW4A 1HJPA 4PD2A 4YHHM 2DWMA 2OOBA 3GLGA 3CTWB 1MX0A 3IHPA 3U61B 1J09A 1K3WA 4DR7M 1XXHE 2OPFA 2M5ZA 2QHOB 2WSEF 1Z5BA 4MM3B 1NO1A 4JI8M 2DAIA 2EKFA 4CJ6A 3K9OA 3GLFA 1L1ZA 3J27B 2JY8A 5ITXA 3GRUA 2R46A 5FSWA 4II7A 3GLHB 2YR0A 1A5TA 2KNZA 4B7FA 3J81S 3SAUA 4LFBM 1PJTA 2J5YA 1R7RA 4QHTA 2APLA 2CP8A 2CWBA 1XXHB 3NBIA 1C1KA 1E9SA 1HNWM 3HHXA 1IXZA 4OVZA 1TH4A 5IZ7D 1ZMVA 3M7GA 5EXSA 4R71A 3DA1A 2D7EA 4JI2M 3VKGA 4DV4M 2F5QA 2GQFA 2Q2EB 1R4GA 2XFTA 3SYLA 2VF8A 1K3XA 2CHQA 4JI6M 2LVOC 3B74A 5BR8M 2R62A 3U6EA 3D8BA 2XZUA 1QUSA 1HT2E 1JR3D 4GKKM 2QENA 1QDTA 5IREB 2KW0A 4LF8M 1D0KA 3HKPA 4X65M 1LTMA 1SXJE 3I01M 2LVPC 2JZ0A 3DZDA 3J80S 4DV0M 1IBLM 1Z59A 4LJ8A 4LRTA 4OU7A 4X64M 1R2YA 1K82A 3W67A 2DZNB 3B7QA 3UZUA 3FKEA 2Y21A 4BLCA 1QYRA 3TWLA 5H37D 1JQJC 1NY6A 1T6OA 2LVQD 2Z8YM 2R4EA 3HU1A 4GH9A 1TGUA 5F3WA 4QNMA 1Q39A 2FFJA 1Q3CA 1VEJA 1VDDA 1SXJB 1ZMUA 2HCBA 2L4EA 2LH0A 2LXEA 4LJ7A 3SC3A 3GQ3A 3VLFB 3TE6A 3KOZE 4G4NA
chains in the Genus database with same CATH topology
4LG2A 4IBKA 3HWSA 4GHAA 3FD9A 4PCZA 3A98B 1IBKM 1IXRC 1E94E 2M60A 2ZAMA 4D80A 3L25A 1L2DA 2HHHM 1GKIA 4JI5M 3E9SA 2OQ4A 1FNNA 4LF5M 8CATA 3AKZA 4DV2M 1NNUC 5EP4A 3SHFA 2XF3A 2Z4SA 3J7BA 1PJJA 3FUVA 4MGZE 4QHSA 4L78A 4B08A 4D81A 3FTEA 3ZH9B 3T15A 2YFQA 3ILKA 1E9RA 4KLNA 5A2QS 4DR4M 4PDGA 4RF1A 4JI4M 4I5SA 2KXEA 4JI3M 1YE9A 3CF0A 3FYDA 4Z6YA 4G6ZA 2CHVA 4B7GA 4TUWA 3NWLA 3L28A 1FJGM 3FUUA 4IJEA 1R6BX 5C18A 3U6CA 4IBFA 2CEAA 1IXSB 4QNRA 3FUXA 2F5PA 1GLNA 2EO2A 1DO2A 3SMSA 2F4VM 2UUBM 4LY6A 5E6JA 4JN6A 4DUZM 3SASA 4R7GA 4AKIA 2XEPA 5ITTA 5KPRA 2UXCM 3SAVA 1E32A 2C9CA 4HLQA 3KOXE 4NXNM 4NXMM 3LVVA 3VFDA 3R9XB 4I81A 2Z3XA 4NSRA 2X49A 1TH3A 3THGA 3GRYA 3HHZA 3CF6E 2G5GX 1NNJA 1IY2A 4JI1M 1NSFA 4IBBA 2CHGA 1HR0M 3UJNA 3KP0E 1ZAEA 4AKGA 3VDUA 1J5EM 4IBCA 1QAOA 4GC9A 3SATA 4LGYA 3HJ8A 3VDPA 2KZSA 5FLXS 3AL0C 5EJCA 5DYGA 1J7KA 1NHWC 2G8LA 2V1UA 3CF2A 3PNYA 4PT5A 4EIWA 2HL7A 1TH2A 3FUWA 2CUZA 2ZANA 4IJFA 5FTJA 3GQ4A 1HT1E 5LMUM 1OJLA 3GLIA 2F5OA 3AOEA 5FTMA 3L27A 5EP2A 3W0LB 3AJIB 4LCBA 4LZZA 2UUAM 3HJSA 1JR3A 3GRRA 7CATA 1IM2A 1R2ZA 1PM5A 1WXQA 2XH9A 1I4WA 5DYIA 4FWGA 1W5TA 5KQ8A 3TWMA 3GLHA 3VK8A 2FE8A 2CFOA 2V1CA 3Q8XA 2V6ZM 5KPTA 2C9OA 5JI3E 1W5SA 5EXTA 4G4OA 3MJ5A 5EXPA 4NRWA 3VK7A 4FWHA 4MGHA 2XLJA 3ZCBB 3R8FA 3GPXA 4FVMA 5EP3A 3KVWA 3U5ZB 4LJ4A 3PNVA 3LQQA 1Z5AA 1YSYA 5DNYA 2P5TA 4OVZB 4DR1M 1IN6A 3U6MA 1LV7A 4LF6M 1IBMM 1IY1A 2C99A 4GC5A 3SAWA 1QAQA 2DWLA 3RGPA 5KQDA 4DV3M 2JA2A 2J7OA 1N75A 1S3SA 1YUBA 1DO0A 2I7NA 4DUYM 4GHLA 2NQ8C 3UMMA 3GPUA 4DV7M 1XNRM 1XMQM 2DVWB 3JR4A 3U60B 3QWLA 3GQ5A 1DGGA 2ERCA 3AOGA 4XBOA 1DGHB 2RGHA 5KPZA 4DV1M 3SBJA 2VQEM 4L16A 1N77A 2F5NA 3U6SA 3HHYA 4XGIA 2D7GA 2Y0TA 1D2NA 1GVNA 1DGBA 3A42A 1KFVA 1I94M 4LF7M 4AG5A 2KRKA 3TWKA 3U6DA 2R18A 4DR5M 2Z4RA 2XGNA 3KOWE 3I4VA 5E26A 3LMMA 3T38A 1KYIA 2QP9X 4M0WA 4DV5M 3MHVC 4M9ZA 1N32M 1QVRA 2L09A 4L4UA 3KS4A 1IQPA 2ZM6M 4AI6A 1XNQM 4LJAA 1PJIA 1DGHA 1Z5CA 1SXJD 3U5ZA 3U60A 2YNMD 2DWZB 5FTKA 4G4RA 3K8ZA 3L29A 2QCUA 2ZBKB 2AHMA 4KHPM 3RGSA 4A3VB 4L8RC 3L2AA 3D8LA 1XWIA 4REZA 5FTLA 4CISA 4QOSA 4LGMA 3TL4X 2DXIA 3HJQA 4FWDA 3KP1E 3HU2A 1GL7A 5EXXA 3DFZA 2KRUA 2Y20A 1HQCA 3SARA 3IG5A 3WHLA 3T1YM 2CE7A 3UK6A 3GLIB 4RNAA 5ITYA 2F5SA 4AG6A 4G4QA 3EIEA 3J2PB 3WHKA 4PDIA 4X62M 4GIPA 3TQSA 2XZFA 4LFCM 3PVSA 2O5RA 4NOOB 1G3IA 1L8QA 3KDSE 4ZPXA 3BOSA 4FCTA 3LQRA 1HNXM 2H1RA 1Z6TA 2C5RA 3KFUG 2BJVA 1NJGA 3U6LA 3IG8A 1DGFA 3KOYE 4I4LA 2VIIA 3KXEC 2HKJA 2UXDM 2X4AA 4IBGA 4YY3M 2L7HA 1IN7A 2E5LM 4AQYM 2RKOA 3KS8A 2R4JA 2CV0A 4GITA 4M9SA 4NL4H 4FCWA 1HQYE 5C1BA 4AKHA 2KZUA 5ITRA 3FYCA 4WW0A 3GO8A 4LJ5A 2LWXA 1HNZM 2DHRA 4LJ6A 3RE8A 4LZJA 4DV6M 1H6UA 4R3DA 4GKJM 4CHTB 2LNHC 4DR6M 4QOZC 2A5YB 1L1TA 1TDHA 3JR5A 3M0EA 4W5WA 4FCVA 2R65A 4LFAM 1ZQ9A 4S12A 4LF9M 2FNAA 3J7AS 3SHGB 4X66M 2J7NA 2QPAA 4IBJA 4NRVA 5JI2E 3MK6A 5ITUA 4I8OA 2I7PA 2FOIC 1N78A 4GRIA 3HGIA 2X8AA 4OX9M 5KO3A 3OTOM 5FTNA 1N36M 2C96A 4BB9A 4P16A 1OFHA 4B3MM 1GL6A 1UM8A 1NJFA 1XMOM 3AOEC 3TPZA 3U6PA 2L6OA 3KSJA 2YQZA 1NVMA 4MB7A 4JV5M 4IBEA 3K1JA 2DZOB 4NSOB 2KEBA 3K92A 3GRVA 4KO8A 5IT9S 1SXJA 1L2CA 1QQWA 4JYAM 4B3RM 4MH0E 5EQTA 1OFIA 2Z7JA 3L26A 1L2BA 2DWNA 3AFHA 1G4AE 3K2LA 3AV0A 4Z8XA 2EA0A 2W82A 4IBDA 4MGYE 1NHGC 4JXJA 2UU9M 5EP1A 1IY0A 2D7HA 4B3SM 1QAMA 1IN4A 1XHBA 4LF4M 3FTDA 1G8PA 4IIWA 1N34M 1QZMA 3HU3A 4D82A 2L7IA 1Q3BA 2Y0QA 2R45A 3GPYA 1ORYB 4M0DA 4DR2M 5LMNM 3A46A 5BPVA 2K47A 3KW6A 4BBAA 3PFIA 3PXGA 3LVWA 2RGOA 4K0KM 4HL4A 4ITQA 4OW0A 2EUCA 4FD2A 4L15A 4CGYB 3FTFA 4MGKE 4WURA 3SYKA 3C58A 2XSZA 4AZFA 1IN8A 3SFZA 5ITXE 1MU5A 1QANA 1X37A 3GLGB 3B9PA 1XXHA 3HHWA 2XSZD 3I51A 2UXBM 5IWAM 3E4RA 1KSFX 2ZAOA 2CV2A 3T1HM 1EE8A 4LRSA 1XC8A 3EIHA 4DR3M 3M6AA 3DOAA 3GLFB 1G59A 1IN5A 2CV1A 1G41A 3GP1A 2KA6B 3U6OA 4B3TM 3FTCA 4RF0A 3U61A 4MGIE 4IBIA 2VQFM 3SMPA 3FUTA 2QZ4A 3VKHA 4KODA 1TDZA 2QBYB 3ZC7B 5GKNA 3JAMS 4JI7M 4JI0M 3H4MA 1NY5A 4B7HA 2UUCM 4GMQA 3I4YA 3UGJA 2XFSA 2BJWA 2C98A 3GPPA 4M9XA 3QAUA 4LJ9A 1SXJC 3KSXA 1N33M 3W0FA 3U6QA 1T3TA 2BNKA 3A45A 4FW9A 3RFWA 2QBYA 4AW4A 4PD2A 4YHHM 2DWMA 3GLGA 3CTWB 1MX0A 3U61B 1J09A 1K3WA 4DR7M 2OPFA 2M5ZA 4MM3B 1Z5BA 4JI8M 1L1ZA 3GLFA 3J27B 5ITXA 3GRUA 2R46A 5FSWA 4II7A 3GLHB 2YR0A 4B7FA 3J81S 3SAUA 4LFBM 4QHTA 1R7RA 1HNWM 1XXHB 3NBIA 1C1KA 1E9SA 3HHXA 1IXZA 4OVZA 1TH4A 5IZ7D 3VKGA 3M7GA 5EXSA 4JI2M 3DA1A 2D7EA 4DV4M 2F5QA 2Q2EB 2XFTA 3SYLA 4JI6M 1K3XA 2CHQA 5BR8M 2R62A 3U6EA 3D8BA 2XZUA 1HT2E 1JR3D 4GKKM 2QENA 5IREB 2KW0A 4LF8M 3HKPA 4X65M 1SXJE 3J80S 3DZDA 4DV0M 1IBLM 1Z59A 4LJ8A 4LRTA 4OU7A 4X64M 1R2YA 1K82A 2DZNB 3UZUA 3FKEA 2Y21A 4BLCA 1QYRA 3TWLA 1JQJC 1NY6A 2R4EA 3HU1A 4GH9A 1TGUA 5F3WA 4QNMA 1Q39A 2FFJA 1Q3CA 2HCBA 1VDDA 1SXJB 4LJ7A 5H37D 3GQ3A 2LH0A 2LXEA 3SC3A 5ITQA 3VLFB 3TE6A 3KOZE 4G4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C58 A;  4PCZ A;  3GPX A;  1IBK M;  5ITX E;  1MU5 A;  1Z5A A;  4AQY M;  4DR1 M;  5ITR A;  3U6M A;  1L2D A;  1HNZ M;  3GO8 A;  4LF6 M;  2HHH M;  1IBM M;  4JI5 M;  2UXB M;  5IWA M;  3SAW A;  2OQ4 A;  3T1H M;  4LF5 M;  1EE8 A;  4DV2 M;  1XC8 A;  4DV3 M;  4DV6 M;  4DR3 M;  3DOA A;  1PJJ A;  4GKJ M;  4DUY M;  4DR6 M;  3GP1 A;  3GPU A;  4DV7 M;  1L1T A;  3U6O A;  1XNR M;  1XMQ M;  4B3T M;  1TDH A;  5A2Q S;  3JR5 A;  3JR4 A;  4PDG A;  4JI4 M;  3GQ5 A;  4DR4 M;  4JI3 M;  4DV1 M;  3SBJ A;  2VQE M;  2F5N A;  4LFA M;  2VQF M;  3U6S A;  4LF9 M;  3VK7 A;  3J7A S;  1TDZ A;  4X66 M;  1I94 M;  4NRV A;  3A42 A;  1KFV A;  5ITU A;  3JAM S;  4LF7 M;  3U6C A;  4JI7 M;  1FJG M;  4JI0 M;  2UUC M;  2F5P A;  3TWK A;  3U6D A;  2F4V M;  2UUB M;  3GPP A;  4DR5 M;  4OX9 M;  3OTO M;  4DUZ M;  3SAS A;  1N36 M;  4DV5 M;  5ITT A;  1N33 M;  2UXC M;  3W0F A;  3U6Q A;  3SAV A;  4B3M M;  3A45 A;  1N32 M;  4NXN M;  2ZM6 M;  4NXM M;  1XMO M;  1XNQ M;  3U6P A;  4PD2 A;  4YHH M;  1PJI A;  4MB7 A;  1MX0 A;  1Z5C A;  4JV5 M;  1K3W A;  4DR7 M;  4G4R A;  2OPF A;  2ZBK B;  1NNJ A;  1Z5B A;  4JI8 M;  4KHP M;  5IT9 S;  4JI1 M;  1L1Z A;  1HR0 M;  1L2C A;  5ITX A;  4JYA M;  4B3R M;  1J5E M;  4CIS A;  3J81 S;  3SAU A;  4LFB M;  3SAT A;  1L2B A;  1HNW M;  5FLX S;  3SAR A;  4JI2 M;  2EA0 A;  3T1Y M;  4DV4 M;  2F5Q A;  2UU9 M;  2Q2E B;  5ITY A;  4JI6 M;  1K3X A;  2F5S A;  4B3S M;  5BR8 M;  4G4Q A;  4LF4 M;  3U6E A;  2XZU A;  1N34 M;  4PDI A;  4X62 M;  3GQ4 A;  5LMU M;  2XZF A;  4GKK M;  4LFC M;  2F5O A;  4LF8 M;  4X65 M;  1Q3B A;  3GPY A;  3J80 S;  4DV0 M;  1IBL M;  2UUA M;  1HNX M;  1Z59 A;  4DR2 M;  5LMN M;  3A46 A;  4X64 M;  1R2Y A;  1K82 A;  1R2Z A;  1PM5 A;  3TWL A;  3U6L A;  3TWM A;  3VK8 A;  2HKJ A;  4K0K M;  1Q39 A;  2UXD M;  1Q3C A;  4ITQ A;  4YY3 M;  3GQ3 A;  5ITQ A;  4G4O A;  2E5L M;  4NRW A;  4G4N A; 
#chains in the Genus database with same CATH topology
 4LG2 A;  4IBK A;  3HWS A;  4GHA A;  3C3E A;  3FD9 A;  3A98 B;  4PCZ A;  1IBK M;  1IXR C;  1E94 E;  4NC6 A;  2L4F A;  2M60 A;  2ZAM A;  4D80 A;  1VEG A;  3L25 A;  1L2D A;  2HHH M;  2LHG A;  1GKI A;  3SBJ A;  3E9S A;  4F1I A;  1WIV A;  4JI5 M;  2OQ4 A;  1FNN A;  4LF5 M;  8CAT A;  3AKZ A;  4DV2 M;  1NNU C;  5EP4 A;  3GLH E;  3SHF A;  2XF3 A;  2Z4S A;  3J7B A;  4G3O A;  2JNH A;  1PJJ A;  3FUV A;  1WHC A;  4MGZ E;  4QHS A;  4L78 A;  4B08 A;  4D81 A;  3FTE A;  2DHY A;  3ZH9 B;  3T15 A;  2KDL A;  2YFQ A;  3ILK A;  1E9R A;  4KLN A;  5A2Q S;  4DR4 M;  3HY5 A;  4PDG A;  4RF1 A;  4JI4 M;  4I5S A;  2KXE A;  2O01 F;  4JI3 M;  2ZTC A;  1YE9 A;  1EFU B;  1IXS A;  2N35 A;  3CF0 A;  3FYD A;  4G6Z A;  4Z6Y A;  2CHV A;  1BVS A;  4B7G A;  4TUW A;  3NWL A;  3L28 A;  1RU3 A;  1FJG M;  3FUU A;  4IJE A;  1R6B X;  5C18 A;  3U6C A;  4IBF A;  2CEA A;  1IXS B;  4QNR A;  3FUX A;  2F5P A;  1GLN A;  2EO2 A;  1DO2 A;  2LHC A;  3SMS A;  3K9P A;  2F4V M;  1ZMW A;  2UUB M;  1TR8 A;  4LY6 A;  5E6J A;  4JN6 A;  4DUZ M;  3SAS A;  2G3Q A;  4R7G A;  4AKI A;  2XEP A;  5ITT A;  5KPR A;  2UXC M;  2JXN A;  4UN2 B;  3SAV A;  1E32 A;  2C9C A;  4HLQ A;  3KOX E;  4NXN M;  4NXM M;  3LVV A;  3VFD A;  3R9X B;  4ANR A;  4I81 A;  2Z3X A;  4NSR A;  2X49 A;  1TH3 A;  3THG A;  3GRY A;  3HHZ A;  1PJS A;  3CF6 E;  2G5G X;  2DAE A;  1NNJ A;  1IY2 A;  4JI1 M;  1NSF A;  4IBB A;  2CHG A;  1HR0 M;  3UJN A;  3KP0 E;  1MJG M;  1ZAE A;  4AKG A;  3VDU A;  1J5E M;  4IBC A;  1QAO A;  4GC9 A;  3SAT A;  1QDR A;  4LGY A;  2QQ8 A;  3H4J A;  3HJ8 A;  3VDP A;  2KZS A;  5FLX S;  3AL0 C;  2H5X A;  3HZJ A;  5EJC A;  5DYG A;  1J7K A;  2KNA A;  4CIZ A;  1NHW C;  2G8L A;  2V1U A;  3CF2 A;  3PNY A;  4PT5 A;  2MRO B;  3Q8G A;  4EIW A;  1OKS A;  2HL7 A;  1TH2 A;  3FUW A;  2CUZ A;  4XK8 F;  2ZAN A;  4IJF A;  5FTJ A;  3GQ4 A;  1T43 A;  1HT1 E;  5LMU M;  2ZTD A;  1OJL A;  3GLI A;  2F5O A;  3AOE A;  5FTM A;  3L27 A;  2DI0 A;  5EP2 A;  3W0L B;  1OQY A;  3AJI B;  3CGW A;  4LCB A;  2JP7 A;  4LZZ A;  2UUA M;  3HJS A;  1JR3 A;  3GRR A;  7CAT A;  1IM2 A;  1R2Z A;  1PM5 A;  1WXQ A;  2XH9 A;  1I4W A;  5DYI A;  1W5T A;  4FWG A;  5KQ8 A;  3TWM A;  3GLH A;  3VK8 A;  2FE8 A;  3F92 A;  2CFO A;  2V1C A;  2V6Z M;  3Q8X A;  5KPT A;  2C9O A;  5JI3 E;  1W5S A;  5EXT A;  4G4O A;  3MJ5 A;  5EXP A;  4NRW A;  3VK7 A;  4FWH A;  4MGH A;  2XLJ A;  3ZCB B;  3E46 A;  3R8F A;  3GPX A;  4FVM A;  5EP3 A;  3KVW A;  3U5Z B;  4LJ4 A;  3LCU A;  3PNV A;  3LQQ A;  1Z5A A;  1YSY A;  5DNY A;  2P5T A;  4OVZ B;  4DR1 M;  1IN6 A;  2K0B X;  3LW5 F;  3U6M A;  1LV7 A;  4LF6 M;  1IBM M;  1IY1 A;  2C99 A;  4GC5 A;  3SAW A;  1QAQ A;  2K6B A;  2DWL A;  1NV9 A;  2VF7 A;  3RGP A;  5KQD A;  2JA2 A;  4DV3 M;  2DZL A;  2J7O A;  1N75 A;  3QYB A;  1S3S A;  1YUB A;  1DO0 A;  2I7N A;  4DUY M;  2RRU A;  4GHL A;  1Q02 A;  2NQ8 C;  3UMM A;  3GPU A;  4DV7 M;  1XNR M;  1AUA A;  1JR3 E;  1XMQ M;  2DVW B;  3JR4 A;  3U60 B;  3QWL A;  3GQ5 A;  1DGG A;  2ERC A;  2BWE A;  3AOG A;  1DGH B;  2RGH A;  4XBO A;  5KPZ A;  2DEN A;  2VQE M;  4L16 A;  4DV1 M;  1N77 A;  2F5N A;  3U6S A;  3HHY A;  4XGI A;  2D7G A;  2Y0T A;  1D2N A;  1GVN A;  1DGB A;  3A42 A;  1KFV A;  2DAK A;  1QUT A;  1ZV1 A;  1I94 M;  4AG5 A;  4LF7 M;  2KRK A;  3TWK A;  3U6D A;  2R18 A;  4DR5 M;  1WJ7 A;  2Z4R A;  2XGN A;  3KOW E;  3I4V A;  5E26 A;  2FH0 A;  3LMM A;  5ITQ A;  1PJQ A;  3T38 A;  1KYI A;  2QP9 X;  1PRB A;  1OIZ A;  3NBX X;  4M0W A;  4DV5 M;  3MHV C;  4M9Z A;  1N32 M;  1QVR A;  2L09 A;  1AIP C;  4L4U A;  3KS4 A;  1IQP A;  2ZM6 M;  4AI6 A;  2MH8 A;  1XNQ M;  4LJA A;  1PJI A;  1DGH A;  1R5L A;  1Z5C A;  1SXJ D;  3U5Z A;  2LVN C;  3U60 A;  2YNM D;  2DWZ B;  5FTK A;  4G4R A;  3K8Z A;  2QCU A;  2ZBK B;  1TF0 B;  3L29 A;  2AHM A;  4KHP M;  3RGS A;  4A3V B;  4L8R C;  3T6P A;  3L2A A;  3D8L A;  1XWI A;  3GLI E;  4REZ A;  5FTL A;  4CIS A;  4QOS A;  2FS1 A;  4LGM A;  2JUJ A;  3TL4 X;  2DXI A;  1P3Q Q;  3HJQ A;  4FWD A;  3KP1 E;  3HU2 A;  1GL7 A;  5EXX A;  3DFZ A;  2KRU A;  2Y20 A;  4GEW A;  3BXW A;  1HQC A;  3SAR A;  3IG5 A;  4Q7J A;  1VG5 A;  3QYE A;  4KT0 F;  3WHL A;  3T1Y M;  2CE7 A;  4DBG B;  3UK6 A;  3GLI B;  4RNA A;  5ITY A;  2F5S A;  3B89 A;  4AG6 A;  4G4Q A;  1V33 A;  1YLA A;  3EIE A;  2HAK A;  3FRI A;  3J2P B;  3WHK A;  4PDI A;  4X62 M;  4GIP A;  3TQS A;  2XZF A;  4LFC M;  3PVS A;  2O5R A;  4NOO B;  1G3I A;  1L8Q A;  3KDS E;  4ZPX A;  3BOS A;  2O25 A;  4FCT A;  3LQR A;  1HNX M;  4P17 A;  2H1R A;  1Z6T A;  2C5R A;  2DAG A;  3KFU G;  2BJV A;  1NJG A;  1OAO C;  1Y8G A;  3U6L A;  3IG8 A;  1DGF A;  2WSC F;  3KOY E;  4I4L A;  2VII A;  3KXE C;  2HKJ A;  2UXD M;  2X4A A;  4IBG A;  2JY5 A;  3C9P A;  4YY3 M;  2L7H A;  1IN7 A;  2E5L M;  4AQY M;  2RKO A;  3KS8 A;  1QZE A;  2R4J A;  2JWS A;  2CV0 A;  4GIT A;  4M9S A;  4NL4 H;  4FCW A;  1HQY E;  1WGN A;  1GO5 A;  1V34 A;  1F4I A;  5C1B A;  4AKH A;  2KZU A;  5ITR A;  3FYC A;  4WW0 A;  3GO8 A;  4LJ5 A;  1XB2 B;  2LWX A;  2DHR A;  1HNZ M;  4L6V 6;  1NV8 A;  4LJ6 A;  1WR1 B;  3RE8 A;  4LZJ A;  1MN3 A;  1D0L A;  1H6U A;  4DV6 M;  4R3D A;  2JY6 B;  2CRU A;  4GKJ M;  1PGY A;  4CHT B;  2LNH C;  4DR6 M;  2EJS A;  4QOZ C;  2A5Y B;  1L1T A;  1GAB A;  1TDH A;  3JR5 A;  3M0E A;  4W5W A;  4FCV A;  2R65 A;  4LFA M;  1ZQ9 A;  2LTU A;  4S12 A;  4LF9 M;  2FNA A;  3J7A S;  3SHG B;  3W68 A;  4X66 M;  2QPA A;  2J7N A;  2WSF F;  4IBJ A;  4NRV A;  3E21 A;  3MK6 A;  5JI2 E;  1G71 A;  5ITU A;  4I8O A;  1GJS A;  2I7P A;  2FOI C;  1VDL A;  1N78 A;  3IEC A;  4GRI A;  3HGI A;  2X8A A;  4OX9 M;  2GNO A;  1EIJ A;  5KO3 A;  3OTO M;  5FTN A;  1N36 M;  2C96 A;  4BB9 A;  1UFZ A;  2WZJ A;  4P16 A;  1OFH A;  4B3M M;  3FRH A;  1GL6 A;  1UM8 A;  1NJF A;  2DAM A;  1XMO M;  3AOE C;  2L2D A;  3TPZ A;  3U6P A;  2L6O A;  3KSJ A;  1OTR A;  2YQZ A;  1NVM A;  4MB7 A;  1IFY A;  4JV5 M;  4IBE A;  3K1J A;  2DZO B;  4NSO B;  2KEB A;  3K92 A;  3GRV A;  1C7Y A;  4KO8 A;  5IT9 S;  1SXJ A;  1L2C A;  1QQW A;  4JYA M;  4B3R M;  2JZ1 A;  4MH0 E;  1DV0 A;  5EQT A;  1TTE A;  1OFI A;  2Z7J A;  3ZQJ A;  3L26 A;  1VEK A;  1L2B A;  2DWN A;  3AFH A;  1G4A E;  3K2L A;  3AV0 A;  4Z8X A;  2EA0 A;  2W82 A;  4IBD A;  4MGY E;  1NHG C;  2MR9 A;  3B7N A;  4JXJ A;  2R6F A;  5DFL A;  2UU9 M;  5EP1 A;  1IY0 A;  2D7H A;  4B3S M;  1QAM A;  1IN4 A;  1XHB A;  4LF4 M;  3FTD A;  1G8P A;  4IIW A;  1N34 M;  1QZM A;  3HU3 A;  4D82 A;  2L7I A;  1Q3B A;  2Y0Q A;  2R45 A;  2K9D A;  3GPY A;  4F2L A;  1ORY B;  2OO9 A;  4M0D A;  4DR2 M;  5LMN M;  3A46 A;  5BPV A;  3C3D A;  2K47 A;  2OOA A;  3KW6 A;  4BBA A;  2EKK A;  3PFI A;  3PXG A;  3LVW A;  2RGO A;  4K0K M;  4HL4 A;  4ITQ A;  4Y28 F;  4OW0 A;  2LBC A;  2EUC A;  4FD2 A;  4L15 A;  4CGY B;  3BBZ A;  1VQ1 A;  4HEO A;  4MGK E;  3B7Z A;  3FTF A;  4WUR A;  3LCV B;  3MMP A;  3SYK A;  3C58 A;  2XSZ A;  4AZF A;  1WGL A;  1IN8 A;  3SFZ A;  5ITX E;  3V76 A;  2QSF X;  1MU5 A;  1QAN A;  1X37 A;  2LVA A;  2DNA A;  3GLG B;  2R0I A;  3B9P A;  1XXH A;  3HHW A;  2XSZ D;  3I51 A;  2UXB M;  4WP2 A;  3E4R A;  1KSF X;  2ZAO A;  5IWA M;  3T1H M;  2CV2 A;  1EE8 A;  1OIP A;  3I04 M;  4LRS A;  1XC8 A;  3EIH A;  2MJ5 B;  3M6A A;  3DOA A;  4DR3 M;  2HWJ A;  2DKL A;  3GLF B;  1G59 A;  1IN5 A;  2CV1 A;  2BWB A;  1G41 A;  2KNV A;  3GLG E;  3GP1 A;  2KA6 B;  3U6O A;  2B3T A;  4B3T M;  3FTC A;  1OAI A;  4RF0 A;  3U61 A;  1SG9 A;  4MGI E;  1JB0 F;  4IBI A;  2VQF M;  3SMP A;  4RKU F;  3FUT A;  2QZ4 A;  3GLF E;  4KOD A;  3VKH A;  1TDZ A;  2QNJ A;  3ZC7 B;  2QBY B;  1V92 A;  1D0M A;  2MGW A;  5GKN A;  3JAM S;  4JI7 M;  4JI0 M;  3H4M A;  1NY5 A;  4B7H A;  2UUC M;  4GMQ A;  3HX3 A;  3I4Y A;  3FE3 A;  3UGJ A;  2XFS A;  2BJW A;  2C98 A;  2VDB B;  3GPP A;  4M9X A;  3QAU A;  4LJ9 A;  1GJT A;  1SXJ C;  3KSX A;  5L8R F;  1N33 M;  2KHH A;  3W0F A;  3U6Q A;  1T3T A;  2JY7 A;  2BNK A;  3A45 A;  4FW9 A;  3RFW A;  1CUK A;  2QBY A;  2R44 A;  4AW4 A;  1HJP A;  4PD2 A;  4YHH M;  2DWM A;  2OOB A;  3GLG A;  3CTW B;  1MX0 A;  3IHP A;  3U61 B;  1J09 A;  1K3W A;  4DR7 M;  1XXH E;  2OPF A;  2M5Z A;  2QHO B;  2WSE F;  1Z5B A;  4MM3 B;  1NO1 A;  4JI8 M;  2DAI A;  2EKF A;  4CJ6 A;  3K9O A;  3GLF A;  1L1Z A;  3J27 B;  2JY8 A;  5ITX A;  3GRU A;  2R46 A;  5FSW A;  4II7 A;  3GLH B;  2YR0 A;  1A5T A;  2KNZ A;  4B7F A;  3J81 S;  3SAU A;  4LFB M;  1PJT A;  2J5Y A;  1R7R A;  4QHT A;  2APL A;  2CP8 A;  2CWB A;  1XXH B;  3NBI A;  1C1K A;  1E9S A;  1HNW M;  3HHX A;  1IXZ A;  4OVZ A;  1TH4 A;  5IZ7 D;  1ZMV A;  3M7G A;  5EXS A;  4R71 A;  3DA1 A;  2D7E A;  4JI2 M;  3VKG A;  4DV4 M;  2F5Q A;  2GQF A;  2Q2E B;  1R4G A;  2XFT A;  3SYL A;  2VF8 A;  1K3X A;  2CHQ A;  4JI6 M;  2LVO C;  3B74 A;  5BR8 M;  2R62 A;  3U6E A;  3D8B A;  2XZU A;  1QUS A;  1HT2 E;  1JR3 D;  4GKK M;  2QEN A;  1QDT A;  5IRE B;  2KW0 A;  4LF8 M;  1D0K A;  3HKP A;  4X65 M;  1LTM A;  1SXJ E;  3I01 M;  2LVP C;  2JZ0 A;  3DZD A;  3J80 S;  4DV0 M;  1IBL M;  1Z59 A;  4LJ8 A;  4LRT A;  4OU7 A;  4X64 M;  1R2Y A;  1K82 A;  3W67 A;  2DZN B;  3B7Q A;  3UZU A;  3FKE A;  2Y21 A;  4BLC A;  1QYR A;  3TWL A;  5H37 D;  1JQJ C;  1NY6 A;  1T6O A;  2LVQ D;  2Z8Y M;  2R4E A;  3HU1 A;  4GH9 A;  1TGU A;  5F3W A;  4QNM A;  1Q39 A;  2FFJ A;  1Q3C A;  1VEJ A;  1VDD A;  1SXJ B;  1ZMU A;  2HCB A;  2L4E A;  2LH0 A;  2LXE A;  4LJ7 A;  3SC3 A;  3GQ3 A;  3VLF B;  3TE6 A;  3KOZ E;  4G4N A; 
#chains in the Genus database with same CATH homology
 4LG2 A;  4IBK A;  3HWS A;  4GHA A;  3FD9 A;  4PCZ A;  3A98 B;  1IBK M;  1IXR C;  1E94 E;  2M60 A;  2ZAM A;  4D80 A;  3L25 A;  1L2D A;  2HHH M;  1GKI A;  4JI5 M;  3E9S A;  2OQ4 A;  1FNN A;  4LF5 M;  8CAT A;  3AKZ A;  4DV2 M;  1NNU C;  5EP4 A;  3SHF A;  2XF3 A;  2Z4S A;  3J7B A;  1PJJ A;  3FUV A;  4MGZ E;  4QHS A;  4L78 A;  4B08 A;  4D81 A;  3FTE A;  3ZH9 B;  3T15 A;  2YFQ A;  3ILK A;  1E9R A;  4KLN A;  5A2Q S;  4DR4 M;  4PDG A;  4RF1 A;  4JI4 M;  4I5S A;  2KXE A;  4JI3 M;  1YE9 A;  3CF0 A;  3FYD A;  4Z6Y A;  4G6Z A;  2CHV A;  4B7G A;  4TUW A;  3NWL A;  3L28 A;  1FJG M;  3FUU A;  4IJE A;  1R6B X;  5C18 A;  3U6C A;  4IBF A;  2CEA A;  1IXS B;  4QNR A;  3FUX A;  2F5P A;  1GLN A;  2EO2 A;  1DO2 A;  3SMS A;  2F4V M;  2UUB M;  4LY6 A;  5E6J A;  4JN6 A;  4DUZ M;  3SAS A;  4R7G A;  4AKI A;  2XEP A;  5ITT A;  5KPR A;  2UXC M;  3SAV A;  1E32 A;  2C9C A;  4HLQ A;  3KOX E;  4NXN M;  4NXM M;  3LVV A;  3VFD A;  3R9X B;  4I81 A;  2Z3X A;  4NSR A;  2X49 A;  1TH3 A;  3THG A;  3GRY A;  3HHZ A;  3CF6 E;  2G5G X;  1NNJ A;  1IY2 A;  4JI1 M;  1NSF A;  4IBB A;  2CHG A;  1HR0 M;  3UJN A;  3KP0 E;  1ZAE A;  4AKG A;  3VDU A;  1J5E M;  4IBC A;  1QAO A;  4GC9 A;  3SAT A;  4LGY A;  3HJ8 A;  3VDP A;  2KZS A;  5FLX S;  3AL0 C;  5EJC A;  5DYG A;  1J7K A;  1NHW C;  2G8L A;  2V1U A;  3CF2 A;  3PNY A;  4PT5 A;  4EIW A;  2HL7 A;  1TH2 A;  3FUW A;  2CUZ A;  2ZAN A;  4IJF A;  5FTJ A;  3GQ4 A;  1HT1 E;  5LMU M;  1OJL A;  3GLI A;  2F5O A;  3AOE A;  5FTM A;  3L27 A;  5EP2 A;  3W0L B;  3AJI B;  4LCB A;  4LZZ A;  2UUA M;  3HJS A;  1JR3 A;  3GRR A;  7CAT A;  1IM2 A;  1R2Z A;  1PM5 A;  1WXQ A;  2XH9 A;  1I4W A;  5DYI A;  4FWG A;  1W5T A;  5KQ8 A;  3TWM A;  3GLH A;  3VK8 A;  2FE8 A;  2CFO A;  2V1C A;  3Q8X A;  2V6Z M;  5KPT A;  2C9O A;  5JI3 E;  1W5S A;  5EXT A;  4G4O A;  3MJ5 A;  5EXP A;  4NRW A;  3VK7 A;  4FWH A;  4MGH A;  2XLJ A;  3ZCB B;  3R8F A;  3GPX A;  4FVM A;  5EP3 A;  3KVW A;  3U5Z B;  4LJ4 A;  3PNV A;  3LQQ A;  1Z5A A;  1YSY A;  5DNY A;  2P5T A;  4OVZ B;  4DR1 M;  1IN6 A;  3U6M A;  1LV7 A;  4LF6 M;  1IBM M;  1IY1 A;  2C99 A;  4GC5 A;  3SAW A;  1QAQ A;  2DWL A;  3RGP A;  5KQD A;  4DV3 M;  2JA2 A;  2J7O A;  1N75 A;  1S3S A;  1YUB A;  1DO0 A;  2I7N A;  4DUY M;  4GHL A;  2NQ8 C;  3UMM A;  3GPU A;  4DV7 M;  1XNR M;  1XMQ M;  2DVW B;  3JR4 A;  3U60 B;  3QWL A;  3GQ5 A;  1DGG A;  2ERC A;  3AOG A;  4XBO A;  1DGH B;  2RGH A;  5KPZ A;  4DV1 M;  3SBJ A;  2VQE M;  4L16 A;  1N77 A;  2F5N A;  3U6S A;  3HHY A;  4XGI A;  2D7G A;  2Y0T A;  1D2N A;  1GVN A;  1DGB A;  3A42 A;  1KFV A;  1I94 M;  4LF7 M;  4AG5 A;  2KRK A;  3TWK A;  3U6D A;  2R18 A;  4DR5 M;  2Z4R A;  2XGN A;  3KOW E;  3I4V A;  5E26 A;  3LMM A;  3T38 A;  1KYI A;  2QP9 X;  4M0W A;  4DV5 M;  3MHV C;  4M9Z A;  1N32 M;  1QVR A;  2L09 A;  4L4U A;  3KS4 A;  1IQP A;  2ZM6 M;  4AI6 A;  1XNQ M;  4LJA A;  1PJI A;  1DGH A;  1Z5C A;  1SXJ D;  3U5Z A;  3U60 A;  2YNM D;  2DWZ B;  5FTK A;  4G4R A;  3K8Z A;  3L29 A;  2QCU A;  2ZBK B;  2AHM A;  4KHP M;  3RGS A;  4A3V B;  4L8R C;  3L2A A;  3D8L A;  1XWI A;  4REZ A;  5FTL A;  4CIS A;  4QOS A;  4LGM A;  3TL4 X;  2DXI A;  3HJQ A;  4FWD A;  3KP1 E;  3HU2 A;  1GL7 A;  5EXX A;  3DFZ A;  2KRU A;  2Y20 A;  1HQC A;  3SAR A;  3IG5 A;  3WHL A;  3T1Y M;  2CE7 A;  3UK6 A;  3GLI B;  4RNA A;  5ITY A;  2F5S A;  4AG6 A;  4G4Q A;  3EIE A;  3J2P B;  3WHK A;  4PDI A;  4X62 M;  4GIP A;  3TQS A;  2XZF A;  4LFC M;  3PVS A;  2O5R A;  4NOO B;  1G3I A;  1L8Q A;  3KDS E;  4ZPX A;  3BOS A;  4FCT A;  3LQR A;  1HNX M;  2H1R A;  1Z6T A;  2C5R A;  3KFU G;  2BJV A;  1NJG A;  3U6L A;  3IG8 A;  1DGF A;  3KOY E;  4I4L A;  2VII A;  3KXE C;  2HKJ A;  2UXD M;  2X4A A;  4IBG A;  4YY3 M;  2L7H A;  1IN7 A;  2E5L M;  4AQY M;  2RKO A;  3KS8 A;  2R4J A;  2CV0 A;  4GIT A;  4M9S A;  4NL4 H;  4FCW A;  1HQY E;  5C1B A;  4AKH A;  2KZU A;  5ITR A;  3FYC A;  4WW0 A;  3GO8 A;  4LJ5 A;  2LWX A;  1HNZ M;  2DHR A;  4LJ6 A;  3RE8 A;  4LZJ A;  4DV6 M;  1H6U A;  4R3D A;  4GKJ M;  4CHT B;  2LNH C;  4DR6 M;  4QOZ C;  2A5Y B;  1L1T A;  1TDH A;  3JR5 A;  3M0E A;  4W5W A;  4FCV A;  2R65 A;  4LFA M;  1ZQ9 A;  4S12 A;  4LF9 M;  2FNA A;  3J7A S;  3SHG B;  4X66 M;  2J7N A;  2QPA A;  4IBJ A;  4NRV A;  5JI2 E;  3MK6 A;  5ITU A;  4I8O A;  2I7P A;  2FOI C;  1N78 A;  4GRI A;  3HGI A;  2X8A A;  4OX9 M;  5KO3 A;  3OTO M;  5FTN A;  1N36 M;  2C96 A;  4BB9 A;  4P16 A;  1OFH A;  4B3M M;  1GL6 A;  1UM8 A;  1NJF A;  1XMO M;  3AOE C;  3TPZ A;  3U6P A;  2L6O A;  3KSJ A;  2YQZ A;  1NVM A;  4MB7 A;  4JV5 M;  4IBE A;  3K1J A;  2DZO B;  4NSO B;  2KEB A;  3K92 A;  3GRV A;  4KO8 A;  5IT9 S;  1SXJ A;  1L2C A;  1QQW A;  4JYA M;  4B3R M;  4MH0 E;  5EQT A;  1OFI A;  2Z7J A;  3L26 A;  1L2B A;  2DWN A;  3AFH A;  1G4A E;  3K2L A;  3AV0 A;  4Z8X A;  2EA0 A;  2W82 A;  4IBD A;  4MGY E;  1NHG C;  4JXJ A;  2UU9 M;  5EP1 A;  1IY0 A;  2D7H A;  4B3S M;  1QAM A;  1IN4 A;  1XHB A;  4LF4 M;  3FTD A;  1G8P A;  4IIW A;  1N34 M;  1QZM A;  3HU3 A;  4D82 A;  2L7I A;  1Q3B A;  2Y0Q A;  2R45 A;  3GPY A;  1ORY B;  4M0D A;  4DR2 M;  5LMN M;  3A46 A;  5BPV A;  2K47 A;  3KW6 A;  4BBA A;  3PFI A;  3PXG A;  3LVW A;  2RGO A;  4K0K M;  4HL4 A;  4ITQ A;  4OW0 A;  2EUC A;  4FD2 A;  4L15 A;  4CGY B;  3FTF A;  4MGK E;  4WUR A;  3SYK A;  3C58 A;  2XSZ A;  4AZF A;  1IN8 A;  3SFZ A;  5ITX E;  1MU5 A;  1QAN A;  1X37 A;  3GLG B;  3B9P A;  1XXH A;  3HHW A;  2XSZ D;  3I51 A;  2UXB M;  5IWA M;  3E4R A;  1KSF X;  2ZAO A;  2CV2 A;  3T1H M;  1EE8 A;  4LRS A;  1XC8 A;  3EIH A;  4DR3 M;  3M6A A;  3DOA A;  3GLF B;  1G59 A;  1IN5 A;  2CV1 A;  1G41 A;  3GP1 A;  2KA6 B;  3U6O A;  4B3T M;  3FTC A;  4RF0 A;  3U61 A;  4MGI E;  4IBI A;  2VQF M;  3SMP A;  3FUT A;  2QZ4 A;  3VKH A;  4KOD A;  1TDZ A;  2QBY B;  3ZC7 B;  5GKN A;  3JAM S;  4JI7 M;  4JI0 M;  3H4M A;  1NY5 A;  4B7H A;  2UUC M;  4GMQ A;  3I4Y A;  3UGJ A;  2XFS A;  2BJW A;  2C98 A;  3GPP A;  4M9X A;  3QAU A;  4LJ9 A;  1SXJ C;  3KSX A;  1N33 M;  3W0F A;  3U6Q A;  1T3T A;  2BNK A;  3A45 A;  4FW9 A;  3RFW A;  2QBY A;  4AW4 A;  4PD2 A;  4YHH M;  2DWM A;  3GLG A;  3CTW B;  1MX0 A;  3U61 B;  1J09 A;  1K3W A;  4DR7 M;  2OPF A;  2M5Z A;  4MM3 B;  1Z5B A;  4JI8 M;  1L1Z A;  3GLF A;  3J27 B;  5ITX A;  3GRU A;  2R46 A;  5FSW A;  4II7 A;  3GLH B;  2YR0 A;  4B7F A;  3J81 S;  3SAU A;  4LFB M;  4QHT A;  1R7R A;  1HNW M;  1XXH B;  3NBI A;  1C1K A;  1E9S A;  3HHX A;  1IXZ A;  4OVZ A;  1TH4 A;  5IZ7 D;  3VKG A;  3M7G A;  5EXS A;  4JI2 M;  3DA1 A;  2D7E A;  4DV4 M;  2F5Q A;  2Q2E B;  2XFT A;  3SYL A;  4JI6 M;  1K3X A;  2CHQ A;  5BR8 M;  2R62 A;  3U6E A;  3D8B A;  2XZU A;  1HT2 E;  1JR3 D;  4GKK M;  2QEN A;  5IRE B;  2KW0 A;  4LF8 M;  3HKP A;  4X65 M;  1SXJ E;  3J80 S;  3DZD A;  4DV0 M;  1IBL M;  1Z59 A;  4LJ8 A;  4LRT A;  4OU7 A;  4X64 M;  1R2Y A;  1K82 A;  2DZN B;  3UZU A;  3FKE A;  2Y21 A;  4BLC A;  1QYR A;  3TWL A;  1JQJ C;  1NY6 A;  2R4E A;  3HU1 A;  4GH9 A;  1TGU A;  5F3W A;  4QNM A;  1Q39 A;  2FFJ A;  1Q3C A;  2HCB A;  1VDD A;  1SXJ B;  4LJ7 A;  5H37 D;  3GQ3 A;  2LH0 A;  2LXE A;  3SC3 A;  5ITQ A;  3VLF B;  3TE6 A;  3KOZ E;  4G4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...