3T1YM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3t1yM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 3t1yM02
3TWLA 1R2YA 1Z5CA 4AQYM 4DUYM 4G4QA 4PCZA 4DR2M 3A42A 1L1TA 3SATA 1K82A 1HNZM 4B3SM 4JI2M 3J7AS 3U6PA 1PM5A 4NXMM 2VQEM 4LFAM 4G4RA 4DV0M 4DR4M 3GQ4A 3TWKA 4PDGA 4JI0M 3U6QA 4MB7A 1N32M 5FLXS 2F5NA 2HHHM 4JI4M 4OX9M 1MU5A 3OTOM 4JI8M 5IT9S 3JR5A 1I94M 3GPYA 1N34M 2F5SA 4LF5M 1HNXM 4JI1M 1XMOM 1TDZA 3U6LA 4ITQA 2UXCM 2VQFM 3U6SA 2UUAM 3GQ3A 4CISA 1XNQM 4K0KM 3JAMS 3U6MA 4PDIA 3DOAA 3U6OA 2UXDM 4DV7M 3GPXA 4NXNM 5ITQA 2Q2EB 4GKJM 3T1HM 3W0FA 3GPUA 3GQ5A 4LF6M 5LMUM 1L2DA 2ZBKB 1HNWM 1HR0M 2UXBM 3SAUA 1PJJA 4B3MM 4JI7M 4DV2M 1IBKM 1XC8A 1IBMM 4LF8M 3VK7A 4JI3M 5ITTA 4NRVA 5BR8M 1Z5BA 4DR5M 4DR3M 3GPPA 5ITUA 1N36M 1K3WA 2HKJA 1L2BA 2OPFA 1Z59A 4NRWA 3T1YM 4DV1M 3SAWA 4LF9M 1FJGM 4B3TM 1Q3BA 4JI5M 1J5EM 5ITXA 4PD2A 4X64M 1EE8A 2F5OA 1K3XA 4DR6M 2ZM6M 4JI6M 1Q3CA 4YHHM 4B3RM 4DR7M 4DR1M 4X65M 5ITXE 1R2ZA 3A45A 4JYAM 1NNJA 3U6DA 1IBLM 4G4NA 1XNRM 2F5PA 4G4OA 1XMQM 1PJIA 4LF7M 4DUZM 4DV4M 3U6EA 3SASA 5ITRA 4LF4M 4X62M 1Z5AA 4DV3M 5ITYA 3SARA 2EA0A 5LMNM 1Q39A 3J81S 2XZFA 4YY3M 2UUBM 1KFVA 4DV5M 3JR4A 1TDHA 2UUCM 4GKKM 3J80S 3U6CA 3VK8A 3GO8A 2F4VM 5IWAM 4X66M 4DV6M 3SAVA 3GP1A 3C58A 1MX0A 1L1ZA 2OQ4A 2XZUA 1N33M 3A46A 4JV5M 5A2QS 2F5QA 3TWMA 4KHPM 2UU9M 1L2CA 3SBJA 4LFCM 4LFBM 2E5LM
chains in the Genus database with same CATH superfamily
3THGA 4L16A 3TWLA 1R2YA 2KRKA 4AQYM 4G4QA 1SXJD 4FCVA 1L1TA 5KPZA 4Q7JA 4LG2A 3SYLA 2MROB 4LZJA 2KA6B 3CTWB 4D80A 3LQQA 3U6PA 3Q8GA 1HQYE 4AG5A 1XWIA 2VQEM 2R46A 1YSYA 2FS1A 4LFAM 4LJ7A 2G8LA 2A5YB 4G4RA 3KDSE 4GHLA 4L15A 2EUCA 2G5GX 3GQ4A 4PDGA 4AKGA 1BVSA 1VDDA 3IG8A 1G41A 1GABA 2HHHM 1G8PA 4LF8M 3OTOM 2L4FA 4FCTA 4JI8M 4D81A 2QBYA 1WJ7A 1G3IA 1T43A 2UXCM 1OAIA 4JI1M 4ITQA 3B9PA 1RU3A 3PNVA 4M9SA 3AL0C 4GC9A 4K0KM 1GL6A 1SXJB 2QENA 2ZANA 3DOAA 2ERCA 4PDIA 2FH0A 2J5YA 3GLHB 4NXNM 1TTEA 2KEBA 1IM2A 3W0FA 3GLFB 4AG6A 2J7OA 5LMUM 3HU3A 2DZOB 2UXBM 4F1IA 3SAUA 2QNJA 4DV2M 3ZCBB 1XC8A 4Z6YA 3FRIA 5KQ8A 3KP1E 1CUKA 3HX3A 1OQYA 1N36M 2EKKA 4UN2B 1DGBA 1TH4A 1Z59A 2G3QA 4IBJA 4MGKE 5EXSA 5E6JA 1XXHB 3IECA 4DV1M 3L29A 4OU7A 4B3TM 3UK6A 4MGYE 2Z4SA 4IIWA 3KS4A 1N75A 3ZH9B 1OKSA 2DHRA 1J5EM 1C7YA 2J7NA 4PD2A 5KQDA 3VFDA 2YR0A 1YE9A 2F5OA 4DR6M 1K3XA 2WSFF 1R5LA 2ZM6M 3IHPA 2L6OA 1LTMA 3H4MA 3W67A 4QOZC 4NOOB 3FTFA 1QYRA 4NSRA 3PNYA 4REZA 2KHHA 2YNMD 1R2ZA 3FUUA 4WURA 2JWSA 1WHCA 3B7NA 4G6ZA 4FD2A 1JR3A 3U5ZA 4JYAM 2MJ5B 3ZQJA 1OIPA 1QZEA 1R4GA 1PJIA 2X4AA 4LF4M 3I51A 4X62M 2N35A 5ITYA 2AHMA 4F2LA 2EA0A 3GLIA 4FVMA 1G59A 3JR4A 1TDHA 1WGNA 2BWEA 4GKKM 3J80S 2OOBA 4BLCA 1GO5A 5DNYA 2F4VM 2QBYB 3K8ZA 3KSXA 5DYIA 1V92A 2LVPC 2CHGA 2JZ0A 3BOSA 2EJSA 5IZ7D 4R71A 4TUWA 4M0DA 3HU1A 1HT2E 2D7GA 5A2QS 4KHPM 2KNVA 1E94E 1L2CA 2V6ZM 3SBJA 2XGNA 4P16A 5IREB 2DVWB 1Z5CA 3NWLA 1TGUA 2D7HA 2OO9A 4L4UA 1JR3D 4LJ6A 2L4EA 3B7QA 4LJ5A 3A42A 3PXGA 2MH8A 1JB0F 3KOWE 1TF0B 2CV0A 4GH9A 1D0MA 1R7RA 3C3DA 1IXSB 4RKUF 3K9PA 5DFLA 3T38A 5FTKA 1Y8GA 2CP8A 2YQZA 3LVWA 5EXTA 1OTRA 1IY2A 2DAIA 3M7GA 3TWKA 3LCUA 3FUWA 1DGHA 4FW9A 1TH2A 1HQCA 1TR8A 2BWBA 4DBGB 3DA1A 5FLXS 1N32M 3E46A 3MHVC 4L6V6 3AOGA 5IT9S 1ZV1A 3AJIB 4IBCA 3MJ5A 2F5SA 1HNXM 2VDBB 1DGFA 1OAOC 2VQFM 5KPTA 3GQ3A 1XNQM 2NQ8C 3UZUA 3L26A 3U6MA 2DZNB 3SHFA 3VLFB 3M0EA 3U6OA 3U5ZB 3U61A 2UXDM 3LMMA 1NJFA 1VEJA 4KO8A 3UMMA 3RGPA 2KW0A 1QDTA 3T1HM 4GKJM 3GQ5A 3K9OA 4KLNA 1IY0A 1L2DA 2FE8A 1HR0M 3GLIB 5JI3E 1IXZA 3CGWA 2C99A 3FTEA 3FTCA 4JN6A 2BJWA 2XSZA 3CF2A 2LVOC 4HLQA 3R8FA 1UFZA 5EJCA 3IG5A 4M0WA 1IBMM 4LY6A 4NRVA 2Z4RA 1Z5BA 4DR5M 5ITUA 1K3WA 2CEAA 3DZDA 4NRWA 3T1YM 5C18A 1MJGM 2DAEA 1X37A 2FOIC 2JNHA 2WZJA 3CF6E 3CF0A 1OIZA 2DHYA 1V34A 1J7KA 5H37D 3HHWA 3QYEA 2LVQD 2GNOA 2GQFA 3K1JA 2I7PA 2LH0A 3GLHE 3HZJA 3HKPA 2ZTDA 3NBXX 2JA2A 1EE8A 1QUTA 4EIWA 4JI6M 2VF8A 4R3DA 1GLNA 4A3VB 5BPVA 4X65M 5ITXE 3VDUA 3AFHA 1ZMWA 1IQPA 4QNMA 1VQ1A 2R0IA 2Y0TA 3AOEA 1DGGA 3C9PA 3NBIA 4LGYA 4G4NA 1XNRM 2P5TA 3FUVA 3QYBA 3HY5A 2XSZD 2Z8YM 2RKOA 1XXHE 2KZSA 1IY1A 4DUZM 3SASA 1NJGA 4LF7M 1Z5AA 3KOZE 3SARA 2BJVA 4GC5A 5LMNM 3J81S 2Y21A 4YY3M 4QNRA 2Z7JA 4FWDA 1DGHB 1H6UA 2EKFA 4RF0A 3TPZA 4GEWA 3RFWA 4XBOA 1DV0A 3VK8A 5EP2A 5FTJA 4NC6A 3GO8A 2QPAA 3U60A 1XB2B 3I4VA 2LTUA 2QP9X 3SMSA 2DAMA 4XGIA 1NHGC 2Y0QA 5GKNA 2KNAA 4CIZA 2XZUA 3VKGA 2R4JA 3A46A 2RGHA 2F5QA 1SG9A 2DWLA 2RRUA 2DKLA 3KOYE 4LFCM 4FWHA 3D8LA 4AW4A 2E5LM 4LFBM 4WP2A 2C5RA 2I7NA 1OFHA 3T6PA 4IJFA 2OOAA 3E21A 3W0LB 3AKZA 3KFUG 1J09A 3A98B 4CHTB 2DAKA 4LGMA 2ZAOA 3HJSA 4DR2M 2HWJA 4QOSA 2Y20A 3FYCA 3SHGB 5EXPA 1K82A 1D0KA 3SATA 1HNZM 2R6FA 4B3SM 4M9ZA 1E9RA 2KRUA 2R44A 4JI2M 4NXMM 1GJTA 3EIHA 4AI6A 2XF3A 3SC3A 3J2PB 2ZTCA 2WSCF 1G4AE 3SYKA 2VF7A 2L2DA 4DV0M 4DR4M 4JI0M 2L7IA 4MB7A 2MGWA 1EFUB 1VEKA 1ZQ9A 2DAGA 3HGIA 3K92A 4GMQA 5EP4A 2JY7A 1MU5A 2R62A 2KXEA 1PRBA 3FTDA 3L2AA 1W5TA 3FYDA 2LBCA 3RE8A 1QDRA 3MK6A 2BNKA 1C1KA 2R65A 3GPYA 3GLGE 3U6LA 5DYGA 1TDZA 4LF5M 1PJTA 2APLA 3U6SA 2C9OA 4ZPXA 4CISA 1PJQA 3AOEC 3UGJA 2DWNA 2WSEF 3JAMS 2DI0A 1DO0A 4B7FA 4DV7M 1DO2A 2Q2EB 1D2NA 1V33A 4HL4A 3W68A 4B7GA 5ITQA 3LVVA 3GPUA 4GITA 4LF6M 1HNWM 2XEPA 3BBZA 1PJJA 1MN3A 4QHTA 5JI2E 1WIVA 1NHWC 1IBKM 1G71A 4JI3M 2QQ8A 5ITTA 3KVWA 1UM8A 4W5WA 4LZZA 5EP3A 3HHYA 4B08A 3GPPA 1N77A 2HKJA 2LHGA 2HL7A 3B89A 3GLHA 1I4WA 4MGIE 4Y28F 2CUZA 3TL4X 1FNNA 1LV7A 2CWBA 4OW0A 4MGHA 4BBAA 1TH3A 3E4RA 4B7HA 1Q3BA 2O25A 4JI5M 4RNAA 3HJ8A 5FTMA 2C9CA 4IBDA 1QUSA 4I8OA 3I01M 5ITXA 2XLJA 2C96A 2XFSA 1OJLA 1NO1A 4LRSA 2HCBA 4QHSA 7CATA 1QZMA 4B3RM 1QAMA 5C1BA 2FFJA 2JY6B 3VKHA 4DR1M 3RGSA 3M6AA 4OVZA 2CHVA 3KSJA 2B3TA 2X8AA 3FUTA 3HU2A 1NNJA 2ZAMA 3U6DA 1IBLM 1QQWA 1NSFA 2F5PA 3T15A 3TQSA 5EP1A 2JZ1A 3U6EA 4HEOA 4P17A 1Q39A 4LRTA 3L25A 4IJEA 2XZFA 2UUBM 3SFZA 1KFVA 2KDLA 3L28A 3FD9A 2UUCM 3LW5F 2R45A 1IN6A 3PVSA 5E26A 1SXJE 3HHXA 2C98A 3I04M 2LNHC 2FNAA 3GRUA 1IXRC 3GRYA 4X66M 3GLFE 3V76A 4RF1A 1S3SA 4DV6M 1D0LA 1KSFX 4MGZE 3GP1A 4IBKA 3C58A 1MX0A 2K6BA 4BB9A 3FE3A 1NY5A 2JY5A 4PT5A 2QCUA 4I4LA 4R7GA 5FSWA 4LJ4A 3PFIA 3B74A 2KNZA 3L27A 2CFOA 4D82A 2M5ZA 2R18A 2UU9M 2W82A 1A5TA 1JQJC 2XFTA 3KP0E 4LJ8A 4DUYM 3B7ZA 3KOXE 5KPRA 1QAQA 1WGLA 1GL7A 4LJ9A 1SXJC 4PCZA 3H4JA 2CV2A 1GJSA 2HAKA 5KO3A 1WR1B 2DENA 1Q02A 3VDPA 3R9XB 4MM3B 3J7AS 1NV9A 1PM5A 3ILKA 4II7A 2O01F 1IN7A 2X49A 2Z3XA 4AZFA 4AKIA 4ANRA 2CHQA 8CATA 4JXJA 1ORYB 3FRHA 4IBFA 3GLGA 1KYIA 4KODA 3LCVB 4GRIA 1ZMUA 3Q8XA 4IBBA 1ZMVA 2EO2A 3U6QA 3TE6A 3U61B 2F5NA 4NL4H 1YUBA 2LHCA 3GRRA 4JI4M 4OX9M 1ZAEA 2L09A 1YLAA 1XHBA 2JXNA 3JR5A 1IXSA 4S12A 1I94M 2DWMA 1N34M 1XMOM 1QVRA 3K2LA 4GHAA 4OVZB 2UUAM 3QAUA 3MMPA 1PJSA 3ZC7B 2DXIA 4L8RC 3GPXA 3QWLA 2VIIA 2JUJA 5EXXA 3WHKA 4NSOB 2ZBKB 1NY6A 3FUXA 1AUAA 4L78A 4B3MM 4JI7M 3J7BA 3E9SA 4LJAA 3VK7A 2KZUA 1F4IA 5BR8M 2LVNC 2QSFX 3DFZA 4DR3M 1E9SA 1HT1E 1L2BA 2OPFA 3FKEA 4FWGA 1P3QQ 2M60A 4I81A 3GRVA 1QAOA 3SAWA 1Z6TA 4LF9M 4KT0F 1PGYA 1FJGM 4G3OA 2LVAA 3KS8A 2K0BX 2V1CA 3LQRA 5FTLA 4Z8XA 2YFQA 2R4EA 2D7EA 4X64M 1T3TA 4LCBA 1NVMA 2L7HA 1EIJA 1NV8A 5FTNA 4WW0A 3KW6A 2JY8A 2K9DA 4XK8F 3HJQA 1Q3CA 5EQTA 4YHHM 2H1RA 4DR7M 5L8RF 2V1UA 2DWZB 1N78A 2LWXA 3AV0A 3EIEA 3BXWA 4IBGA 2QHOB 2K47A 4IBIA 3A45A 3J27B 4CGYB 1SXJA 3SMPA 4IBEA 3U60B 2CRUA 1VDLA 4G4OA 1XMQM 4DV4M 1T6OA 5ITRA 2MR9A 3D8BA 1IN5A 3GLFA 3GLGB 3I4YA 4DV3M 3C3EA 4CJ6A 2CV1A 3KXEC 4DV5M 2H5XA 1E32A 1R6BX 3U6CA 1JR3E 2XH9A 1OFIA 1QANA 2CE7A 2DNAA 1GKIA 5IWAM 1IFYA 1HJPA 1NNUC 2JP7A 3SAVA 3GLIE 4AKHA 1W5SA 1XXHA 1L1ZA 1VG5A 2DZLA 2QZ4A 5F3WA 1WXQA 3HWSA 1IN8A 4FCWA 4MH0E 3WHLA 3HHZA 2OQ4A 1N33M 4GIPA 3UJNA 2LXEA 4JV5M 1GVNA 2O5RA 3TWMA 3F92A 1VEGA 1AIPC 1IN4A 4M9XA 1L8QA 4I5SA 2RGOA
chains in the Genus database with same CATH topology
3THGA 4L16A 3TWLA 1R2YA 2KRKA 4AQYM 4G4QA 1SXJD 4FCVA 1L1TA 5KPZA 4LG2A 3SYLA 4LZJA 2KA6B 3CTWB 4D80A 3LQQA 3U6PA 1HQYE 4AG5A 1XWIA 2VQEM 2R46A 1YSYA 4LFAM 4LJ7A 2G8LA 2A5YB 4G4RA 3KDSE 4GHLA 4L15A 2EUCA 2G5GX 3GQ4A 4PDGA 4AKGA 1VDDA 3IG8A 1G41A 2HHHM 1G8PA 3OTOM 4FCTA 4JI8M 4D81A 2QBYA 1G3IA 2UXCM 4JI1M 4ITQA 3B9PA 3PNVA 4M9SA 3AL0C 4GC9A 4K0KM 1GL6A 1SXJB 2QENA 2ZANA 3DOAA 2ERCA 4PDIA 3GLHB 4NXNM 2KEBA 1IM2A 3W0FA 3GLFB 4AG6A 2J7OA 5LMUM 3HU3A 2DZOB 2UXBM 3SAUA 4DV2M 3ZCBB 1XC8A 4Z6YA 5KQ8A 3KP1E 1N36M 1DGBA 1TH4A 1Z59A 4IBJA 4MGKE 5EXSA 5E6JA 1XXHB 4DV1M 3L29A 4OU7A 4B3TM 3UK6A 4MGYE 2Z4SA 4IIWA 3KS4A 1N75A 3ZH9B 2DHRA 1J5EM 2J7NA 4PD2A 5KQDA 3VFDA 2YR0A 1YE9A 2F5OA 4DR6M 1K3XA 2ZM6M 2L6OA 3H4MA 4QOZC 4NOOB 3FTFA 1QYRA 4NSRA 3PNYA 4REZA 2YNMD 1R2ZA 3FUUA 4WURA 4JYAM 4G6ZA 4FD2A 1JR3A 3U5ZA 1PJIA 2X4AA 4LF4M 3I51A 4X62M 5ITYA 2AHMA 2EA0A 3GLIA 4FVMA 1G59A 3JR4A 1TDHA 4GKKM 3J80S 4BLCA 5DNYA 2F4VM 2QBYB 3K8ZA 3KSXA 5DYIA 2CHGA 3BOSA 5IZ7D 4TUWA 4M0DA 3HU1A 1HT2E 2D7GA 5A2QS 4KHPM 1E94E 1L2CA 2V6ZM 3SBJA 2XGNA 4P16A 5IREB 2DVWB 1Z5CA 3NWLA 1TGUA 2D7HA 4L4UA 1JR3D 4LJ6A 4LJ5A 3A42A 3PXGA 3KOWE 2CV0A 4GH9A 1R7RA 1IXSB 3T38A 5FTKA 2YQZA 3LVWA 5EXTA 1IY2A 3M7GA 3TWKA 3FUWA 1DGHA 4FW9A 1TH2A 1HQCA 1N32M 5FLXS 3DA1A 3MHVC 3AOGA 5IT9S 3AJIB 4IBCA 3MJ5A 1HNXM 1DGFA 2VQFM 5KPTA 3GQ3A 1XNQM 2NQ8C 3UZUA 3L26A 3U6MA 2DZNB 3SHFA 3VLFB 3M0EA 3U6OA 3U5ZB 3U61A 2UXDM 3LMMA 1NJFA 4KO8A 3UMMA 3RGPA 2KW0A 4GKJM 3T1HM 3GQ5A 4KLNA 1IY0A 1L2DA 2FE8A 1HR0M 3GLIB 5JI3E 1IXZA 2C99A 3FTEA 3FTCA 4JN6A 2BJWA 2XSZA 3CF2A 1IBMM 4HLQA 3R8FA 4LF8M 5EJCA 3IG5A 4M0WA 4LY6A 4NRVA 2Z4RA 1Z5BA 4DR5M 5ITUA 1K3WA 2CEAA 3DZDA 4NRWA 3T1YM 5C18A 2FOIC 1X37A 3CF6E 3CF0A 1J7KA 5H37D 3HHWA 3K1JA 2I7PA 2LH0A 3HKPA 2JA2A 1EE8A 4EIWA 4JI6M 4R3DA 1GLNA 4A3VB 5BPVA 4X65M 5ITXE 3VDUA 3AFHA 4QNMA 1IQPA 2Y0TA 3AOEA 1DGGA 3NBIA 4LGYA 4G4NA 1XNRM 2P5TA 3FUVA 2XSZD 4LF7M 2RKOA 2KZSA 4DUZM 1IY1A 3SASA 1NJGA 1Z5AA 3KOZE 3SARA 2BJVA 4GC5A 5LMNM 3J81S 2Y21A 4YY3M 4QNRA 2Z7JA 4FWDA 1DGHB 1H6UA 4RF0A 3TPZA 3RFWA 4XBOA 3VK8A 5EP2A 5FTJA 3GO8A 2QPAA 3U60A 3I4VA 2QP9X 3SMSA 4XGIA 1NHGC 2Y0QA 5GKNA 2XZUA 3VKGA 2R4JA 3A46A 2RGHA 2F5QA 2DWLA 3KOYE 4LFCM 4FWHA 3D8LA 4AW4A 2E5LM 4LFBM 2C5RA 2I7NA 1OFHA 4IJFA 3W0LB 3AKZA 3KFUG 1J09A 3A98B 4CHTB 4LGMA 2ZAOA 3HJSA 4DR2M 4QOSA 2Y20A 3FYCA 3SHGB 5EXPA 1K82A 3SATA 1HNZM 4B3SM 4JI2M 4M9ZA 1E9RA 2KRUA 4NXMM 3EIHA 4AI6A 2XF3A 3SC3A 3J2PB 1G4AE 3SYKA 4DV0M 4DR4M 4JI0M 2L7IA 4MB7A 1ZQ9A 3HGIA 3K92A 4GMQA 5EP4A 1MU5A 2R62A 2KXEA 3FTDA 3L2AA 1W5TA 3FYDA 3RE8A 3GPYA 2F5SA 3MK6A 2BNKA 1C1KA 2R65A 4LF5M 1TDZA 3U6LA 5DYGA 3U6SA 2C9OA 4ZPXA 4CISA 3AOEC 3UGJA 2DWNA 3JAMS 1DO0A 4B7FA 4DV7M 1DO2A 2Q2EB 1D2NA 4HL4A 5ITQA 4B7GA 3GPUA 3LVVA 4LF6M 4GITA 1HNWM 2XEPA 1PJJA 5JI2E 4QHTA 1NHWC 1IBKM 4JI3M 5ITTA 3KVWA 1UM8A 4W5WA 4LZZA 5EP3A 3HHYA 4B08A 3GPPA 1N77A 2HKJA 2HL7A 3GLHA 1I4WA 4MGIE 2CUZA 3TL4X 1FNNA 1LV7A 4OW0A 4MGHA 4BBAA 1TH3A 3E4RA 4B7HA 1Q3BA 4JI5M 4RNAA 3HJ8A 5FTMA 2C9CA 4IBDA 4I8OA 2XLJA 5ITXA 2C96A 2XFSA 1OJLA 4LRSA 2HCBA 4QHSA 7CATA 1QZMA 4B3RM 1QAMA 5C1BA 2FFJA 3VKHA 4DR1M 3RGSA 3M6AA 4OVZA 2CHVA 3KSJA 2X8AA 3FUTA 3HU2A 1NNJA 2ZAMA 3U6DA 1IBLM 1QQWA 1NSFA 2F5PA 3T15A 3TQSA 5EP1A 3U6EA 1Q39A 4LRTA 3L25A 4IJEA 2XZFA 2UUBM 3SFZA 1KFVA 3L28A 3FD9A 2UUCM 2R45A 1IN6A 3PVSA 5E26A 1SXJE 3HHXA 2C98A 2LNHC 2FNAA 3GRUA 1IXRC 3GRYA 4X66M 4RF1A 1S3SA 4DV6M 1KSFX 4MGZE 3GP1A 4IBKA 3C58A 1MX0A 4BB9A 1NY5A 4PT5A 2QCUA 4I4LA 4R7GA 5FSWA 4LJ4A 3PFIA 3L27A 2CFOA 4D82A 2M5ZA 2R18A 2UU9M 2W82A 1JQJC 2XFTA 3KP0E 4LJ8A 4DUYM 3KOXE 5KPRA 1QAQA 1GL7A 4LJ9A 1SXJC 4PCZA 2CV2A 5KO3A 3VDPA 3R9XB 4MM3B 3J7AS 1PM5A 3ILKA 4II7A 1IN7A 2X49A 2Z3XA 4AZFA 4AKIA 2CHQA 8CATA 4JXJA 1ORYB 4IBFA 3GLGA 1KYIA 4KODA 4GRIA 3Q8XA 4IBBA 2EO2A 3U6QA 3TE6A 3U61B 2F5NA 4NL4H 1YUBA 3GRRA 4JI4M 4OX9M 1ZAEA 2L09A 1XHBA 3JR5A 4S12A 1I94M 2DWMA 1N34M 1XMOM 1QVRA 3K2LA 4GHAA 4OVZB 2UUAM 3QAUA 3ZC7B 2DXIA 4L8RC 3GPXA 3QWLA 2VIIA 5EXXA 3WHKA 4NSOB 2ZBKB 1NY6A 3FUXA 4L78A 4B3MM 4JI7M 3J7BA 3E9SA 4LJAA 3VK7A 2KZUA 5BR8M 3DFZA 4DR3M 1E9SA 1HT1E 1L2BA 2OPFA 3FKEA 4FWGA 2M60A 4I81A 3GRVA 1QAOA 3SAWA 1Z6TA 4LF9M 1FJGM 3KS8A 2V1CA 3LQRA 5FTLA 4Z8XA 2YFQA 2R4EA 2D7EA 4X64M 1T3TA 4LCBA 1NVMA 2L7HA 5FTNA 4WW0A 3KW6A 3HJQA 1Q3CA 5EQTA 4YHHM 2H1RA 4DR7M 2V1UA 2DWZB 1N78A 2LWXA 3AV0A 3EIEA 4IBGA 2K47A 4IBIA 3A45A 3J27B 4CGYB 1SXJA 3SMPA 4IBEA 3U60B 4G4OA 1XMQM 4DV4M 5ITRA 3D8BA 1IN5A 3GLFA 3GLGB 3I4YA 4DV3M 2CV1A 3KXEC 4DV5M 1E32A 1R6BX 3U6CA 2XH9A 1OFIA 1QANA 2CE7A 1GKIA 5IWAM 1NNUC 3SAVA 4AKHA 1W5SA 1XXHA 1L1ZA 2QZ4A 5F3WA 1WXQA 3HWSA 1IN8A 4FCWA 4MH0E 3WHLA 3HHZA 2OQ4A 1N33M 4GIPA 3UJNA 2LXEA 4JV5M 1GVNA 2O5RA 3TWMA 1IN4A 4M9XA 1L8QA 4I5SA 2RGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWL A;  1R2Y A;  1Z5C A;  4AQY M;  4DUY M;  4G4Q A;  4PCZ A;  4DR2 M;  3A42 A;  1L1T A;  3SAT A;  1K82 A;  1HNZ M;  4B3S M;  4JI2 M;  3J7A S;  3U6P A;  1PM5 A;  4NXM M;  2VQE M;  4LFA M;  4G4R A;  4DV0 M;  4DR4 M;  3GQ4 A;  3TWK A;  4PDG A;  4JI0 M;  3U6Q A;  4MB7 A;  1N32 M;  5FLX S;  2F5N A;  2HHH M;  4JI4 M;  4OX9 M;  1MU5 A;  3OTO M;  4JI8 M;  5IT9 S;  3JR5 A;  1I94 M;  3GPY A;  1N34 M;  2F5S A;  4LF5 M;  1HNX M;  4JI1 M;  1XMO M;  1TDZ A;  3U6L A;  4ITQ A;  2UXC M;  2VQF M;  3U6S A;  2UUA M;  3GQ3 A;  4CIS A;  1XNQ M;  4K0K M;  3JAM S;  3U6M A;  4PDI A;  3DOA A;  3U6O A;  2UXD M;  4DV7 M;  3GPX A;  4NXN M;  5ITQ A;  2Q2E B;  4GKJ M;  3T1H M;  3W0F A;  3GPU A;  3GQ5 A;  4LF6 M;  5LMU M;  1L2D A;  2ZBK B;  1HNW M;  1HR0 M;  2UXB M;  3SAU A;  1PJJ A;  4B3M M;  4JI7 M;  4DV2 M;  1IBK M;  1XC8 A;  1IBM M;  4LF8 M;  3VK7 A;  4JI3 M;  5ITT A;  4NRV A;  5BR8 M;  1Z5B A;  4DR5 M;  4DR3 M;  3GPP A;  5ITU A;  1N36 M;  1K3W A;  2HKJ A;  1L2B A;  2OPF A;  1Z59 A;  4NRW A;  3T1Y M;  4DV1 M;  3SAW A;  4LF9 M;  1FJG M;  4B3T M;  1Q3B A;  4JI5 M;  1J5E M;  5ITX A;  4PD2 A;  4X64 M;  1EE8 A;  2F5O A;  1K3X A;  4DR6 M;  2ZM6 M;  4JI6 M;  1Q3C A;  4YHH M;  4B3R M;  4DR7 M;  4DR1 M;  4X65 M;  5ITX E;  1R2Z A;  3A45 A;  4JYA M;  1NNJ A;  3U6D A;  1IBL M;  4G4N A;  1XNR M;  2F5P A;  4G4O A;  1XMQ M;  1PJI A;  4LF7 M;  4DUZ M;  4DV4 M;  3U6E A;  3SAS A;  5ITR A;  4LF4 M;  4X62 M;  1Z5A A;  4DV3 M;  5ITY A;  3SAR A;  2EA0 A;  5LMN M;  1Q39 A;  3J81 S;  2XZF A;  4YY3 M;  2UUB M;  1KFV A;  4DV5 M;  3JR4 A;  1TDH A;  2UUC M;  4GKK M;  3J80 S;  3U6C A;  3VK8 A;  3GO8 A;  2F4V M;  5IWA M;  4X66 M;  4DV6 M;  3SAV A;  3GP1 A;  3C58 A;  1MX0 A;  1L1Z A;  2OQ4 A;  2XZU A;  1N33 M;  3A46 A;  4JV5 M;  5A2Q S;  2F5Q A;  3TWM A;  4KHP M;  2UU9 M;  1L2C A;  3SBJ A;  4LFC M;  4LFB M;  2E5L M; 
#chains in the Genus database with same CATH topology
 3THG A;  4L16 A;  3TWL A;  1R2Y A;  2KRK A;  4AQY M;  4G4Q A;  1SXJ D;  4FCV A;  1L1T A;  5KPZ A;  4Q7J A;  4LG2 A;  3SYL A;  2MRO B;  4LZJ A;  2KA6 B;  3CTW B;  4D80 A;  3LQQ A;  3U6P A;  3Q8G A;  1HQY E;  4AG5 A;  1XWI A;  2VQE M;  2R46 A;  1YSY A;  2FS1 A;  4LFA M;  4LJ7 A;  2G8L A;  2A5Y B;  4G4R A;  3KDS E;  4GHL A;  4L15 A;  2EUC A;  2G5G X;  3GQ4 A;  4PDG A;  4AKG A;  1BVS A;  1VDD A;  3IG8 A;  1G41 A;  1GAB A;  2HHH M;  1G8P A;  4LF8 M;  3OTO M;  2L4F A;  4FCT A;  4JI8 M;  4D81 A;  2QBY A;  1WJ7 A;  1G3I A;  1T43 A;  2UXC M;  1OAI A;  4JI1 M;  4ITQ A;  3B9P A;  1RU3 A;  3PNV A;  4M9S A;  3AL0 C;  4GC9 A;  4K0K M;  1GL6 A;  1SXJ B;  2QEN A;  2ZAN A;  3DOA A;  2ERC A;  4PDI A;  2FH0 A;  2J5Y A;  3GLH B;  4NXN M;  1TTE A;  2KEB A;  1IM2 A;  3W0F A;  3GLF B;  4AG6 A;  2J7O A;  5LMU M;  3HU3 A;  2DZO B;  2UXB M;  4F1I A;  3SAU A;  2QNJ A;  4DV2 M;  3ZCB B;  1XC8 A;  4Z6Y A;  3FRI A;  5KQ8 A;  3KP1 E;  1CUK A;  3HX3 A;  1OQY A;  1N36 M;  2EKK A;  4UN2 B;  1DGB A;  1TH4 A;  1Z59 A;  2G3Q A;  4IBJ A;  4MGK E;  5EXS A;  5E6J A;  1XXH B;  3IEC A;  4DV1 M;  3L29 A;  4OU7 A;  4B3T M;  3UK6 A;  4MGY E;  2Z4S A;  4IIW A;  3KS4 A;  1N75 A;  3ZH9 B;  1OKS A;  2DHR A;  1J5E M;  1C7Y A;  2J7N A;  4PD2 A;  5KQD A;  3VFD A;  2YR0 A;  1YE9 A;  2F5O A;  4DR6 M;  1K3X A;  2WSF F;  1R5L A;  2ZM6 M;  3IHP A;  2L6O A;  1LTM A;  3H4M A;  3W67 A;  4QOZ C;  4NOO B;  3FTF A;  1QYR A;  4NSR A;  3PNY A;  4REZ A;  2KHH A;  2YNM D;  1R2Z A;  3FUU A;  4WUR A;  2JWS A;  1WHC A;  3B7N A;  4G6Z A;  4FD2 A;  1JR3 A;  3U5Z A;  4JYA M;  2MJ5 B;  3ZQJ A;  1OIP A;  1QZE A;  1R4G A;  1PJI A;  2X4A A;  4LF4 M;  3I51 A;  4X62 M;  2N35 A;  5ITY A;  2AHM A;  4F2L A;  2EA0 A;  3GLI A;  4FVM A;  1G59 A;  3JR4 A;  1TDH A;  1WGN A;  2BWE A;  4GKK M;  3J80 S;  2OOB A;  4BLC A;  1GO5 A;  5DNY A;  2F4V M;  2QBY B;  3K8Z A;  3KSX A;  5DYI A;  1V92 A;  2LVP C;  2CHG A;  2JZ0 A;  3BOS A;  2EJS A;  5IZ7 D;  4R71 A;  4TUW A;  4M0D A;  3HU1 A;  1HT2 E;  2D7G A;  5A2Q S;  4KHP M;  2KNV A;  1E94 E;  1L2C A;  2V6Z M;  3SBJ A;  2XGN A;  4P16 A;  5IRE B;  2DVW B;  1Z5C A;  3NWL A;  1TGU A;  2D7H A;  2OO9 A;  4L4U A;  1JR3 D;  4LJ6 A;  2L4E A;  3B7Q A;  4LJ5 A;  3A42 A;  3PXG A;  2MH8 A;  1JB0 F;  3KOW E;  1TF0 B;  2CV0 A;  4GH9 A;  1D0M A;  1R7R A;  3C3D A;  1IXS B;  4RKU F;  3K9P A;  5DFL A;  3T38 A;  5FTK A;  1Y8G A;  2CP8 A;  2YQZ A;  3LVW A;  5EXT A;  1OTR A;  1IY2 A;  2DAI A;  3M7G A;  3TWK A;  3LCU A;  3FUW A;  1DGH A;  4FW9 A;  1TH2 A;  1HQC A;  1TR8 A;  2BWB A;  4DBG B;  3DA1 A;  5FLX S;  1N32 M;  3E46 A;  3MHV C;  4L6V 6;  3AOG A;  5IT9 S;  1ZV1 A;  3AJI B;  4IBC A;  3MJ5 A;  2F5S A;  1HNX M;  2VDB B;  1DGF A;  1OAO C;  2VQF M;  5KPT A;  3GQ3 A;  1XNQ M;  2NQ8 C;  3UZU A;  3L26 A;  3U6M A;  2DZN B;  3SHF A;  3VLF B;  3M0E A;  3U6O A;  3U5Z B;  3U61 A;  2UXD M;  3LMM A;  1NJF A;  1VEJ A;  4KO8 A;  3UMM A;  3RGP A;  2KW0 A;  1QDT A;  3T1H M;  4GKJ M;  3GQ5 A;  3K9O A;  4KLN A;  1IY0 A;  1L2D A;  2FE8 A;  1HR0 M;  3GLI B;  5JI3 E;  1IXZ A;  3CGW A;  2C99 A;  3FTE A;  3FTC A;  4JN6 A;  2BJW A;  2XSZ A;  3CF2 A;  2LVO C;  4HLQ A;  3R8F A;  1UFZ A;  5EJC A;  3IG5 A;  4M0W A;  1IBM M;  4LY6 A;  4NRV A;  2Z4R A;  1Z5B A;  4DR5 M;  5ITU A;  1K3W A;  2CEA A;  3DZD A;  4NRW A;  3T1Y M;  5C18 A;  1MJG M;  2DAE A;  1X37 A;  2FOI C;  2JNH A;  2WZJ A;  3CF6 E;  3CF0 A;  1OIZ A;  2DHY A;  1V34 A;  1J7K A;  5H37 D;  3HHW A;  3QYE A;  2LVQ D;  2GNO A;  2GQF A;  3K1J A;  2I7P A;  2LH0 A;  3GLH E;  3HZJ A;  3HKP A;  2ZTD A;  3NBX X;  2JA2 A;  1EE8 A;  1QUT A;  4EIW A;  4JI6 M;  2VF8 A;  4R3D A;  1GLN A;  4A3V B;  5BPV A;  4X65 M;  5ITX E;  3VDU A;  3AFH A;  1ZMW A;  1IQP A;  4QNM A;  1VQ1 A;  2R0I A;  2Y0T A;  3AOE A;  1DGG A;  3C9P A;  3NBI A;  4LGY A;  4G4N A;  1XNR M;  2P5T A;  3FUV A;  3QYB A;  3HY5 A;  2XSZ D;  2Z8Y M;  2RKO A;  1XXH E;  2KZS A;  1IY1 A;  4DUZ M;  3SAS A;  1NJG A;  4LF7 M;  1Z5A A;  3KOZ E;  3SAR A;  2BJV A;  4GC5 A;  5LMN M;  3J81 S;  2Y21 A;  4YY3 M;  4QNR A;  2Z7J A;  4FWD A;  1DGH B;  1H6U A;  2EKF A;  4RF0 A;  3TPZ A;  4GEW A;  3RFW A;  4XBO A;  1DV0 A;  3VK8 A;  5EP2 A;  5FTJ A;  4NC6 A;  3GO8 A;  2QPA A;  3U60 A;  1XB2 B;  3I4V A;  2LTU A;  2QP9 X;  3SMS A;  2DAM A;  4XGI A;  1NHG C;  2Y0Q A;  5GKN A;  2KNA A;  4CIZ A;  2XZU A;  3VKG A;  2R4J A;  3A46 A;  2RGH A;  2F5Q A;  1SG9 A;  2DWL A;  2RRU A;  2DKL A;  3KOY E;  4LFC M;  4FWH A;  3D8L A;  4AW4 A;  2E5L M;  4LFB M;  4WP2 A;  2C5R A;  2I7N A;  1OFH A;  3T6P A;  4IJF A;  2OOA A;  3E21 A;  3W0L B;  3AKZ A;  3KFU G;  1J09 A;  3A98 B;  4CHT B;  2DAK A;  4LGM A;  2ZAO A;  3HJS A;  4DR2 M;  2HWJ A;  4QOS A;  2Y20 A;  3FYC A;  3SHG B;  5EXP A;  1K82 A;  1D0K A;  3SAT A;  1HNZ M;  2R6F A;  4B3S M;  4M9Z A;  1E9R A;  2KRU A;  2R44 A;  4JI2 M;  4NXM M;  1GJT A;  3EIH A;  4AI6 A;  2XF3 A;  3SC3 A;  3J2P B;  2ZTC A;  2WSC F;  1G4A E;  3SYK A;  2VF7 A;  2L2D A;  4DV0 M;  4DR4 M;  4JI0 M;  2L7I A;  4MB7 A;  2MGW A;  1EFU B;  1VEK A;  1ZQ9 A;  2DAG A;  3HGI A;  3K92 A;  4GMQ A;  5EP4 A;  2JY7 A;  1MU5 A;  2R62 A;  2KXE A;  1PRB A;  3FTD A;  3L2A A;  1W5T A;  3FYD A;  2LBC A;  3RE8 A;  1QDR A;  3MK6 A;  2BNK A;  1C1K A;  2R65 A;  3GPY A;  3GLG E;  3U6L A;  5DYG A;  1TDZ A;  4LF5 M;  1PJT A;  2APL A;  3U6S A;  2C9O A;  4ZPX A;  4CIS A;  1PJQ A;  3AOE C;  3UGJ A;  2DWN A;  2WSE F;  3JAM S;  2DI0 A;  1DO0 A;  4B7F A;  4DV7 M;  1DO2 A;  2Q2E B;  1D2N A;  1V33 A;  4HL4 A;  3W68 A;  4B7G A;  5ITQ A;  3LVV A;  3GPU A;  4GIT A;  4LF6 M;  1HNW M;  2XEP A;  3BBZ A;  1PJJ A;  1MN3 A;  4QHT A;  5JI2 E;  1WIV A;  1NHW C;  1IBK M;  1G71 A;  4JI3 M;  2QQ8 A;  5ITT A;  3KVW A;  1UM8 A;  4W5W A;  4LZZ A;  5EP3 A;  3HHY A;  4B08 A;  3GPP A;  1N77 A;  2HKJ A;  2LHG A;  2HL7 A;  3B89 A;  3GLH A;  1I4W A;  4MGI E;  4Y28 F;  2CUZ A;  3TL4 X;  1FNN A;  1LV7 A;  2CWB A;  4OW0 A;  4MGH A;  4BBA A;  1TH3 A;  3E4R A;  4B7H A;  1Q3B A;  2O25 A;  4JI5 M;  4RNA A;  3HJ8 A;  5FTM A;  2C9C A;  4IBD A;  1QUS A;  4I8O A;  3I01 M;  5ITX A;  2XLJ A;  2C96 A;  2XFS A;  1OJL A;  1NO1 A;  4LRS A;  2HCB A;  4QHS A;  7CAT A;  1QZM A;  4B3R M;  1QAM A;  5C1B A;  2FFJ A;  2JY6 B;  3VKH A;  4DR1 M;  3RGS A;  3M6A A;  4OVZ A;  2CHV A;  3KSJ A;  2B3T A;  2X8A A;  3FUT A;  3HU2 A;  1NNJ A;  2ZAM A;  3U6D A;  1IBL M;  1QQW A;  1NSF A;  2F5P A;  3T15 A;  3TQS A;  5EP1 A;  2JZ1 A;  3U6E A;  4HEO A;  4P17 A;  1Q39 A;  4LRT A;  3L25 A;  4IJE A;  2XZF A;  2UUB M;  3SFZ A;  1KFV A;  2KDL A;  3L28 A;  3FD9 A;  2UUC M;  3LW5 F;  2R45 A;  1IN6 A;  3PVS A;  5E26 A;  1SXJ E;  3HHX A;  2C98 A;  3I04 M;  2LNH C;  2FNA A;  3GRU A;  1IXR C;  3GRY A;  4X66 M;  3GLF E;  3V76 A;  4RF1 A;  1S3S A;  4DV6 M;  1D0L A;  1KSF X;  4MGZ E;  3GP1 A;  4IBK A;  3C58 A;  1MX0 A;  2K6B A;  4BB9 A;  3FE3 A;  1NY5 A;  2JY5 A;  4PT5 A;  2QCU A;  4I4L A;  4R7G A;  5FSW A;  4LJ4 A;  3PFI A;  3B74 A;  2KNZ A;  3L27 A;  2CFO A;  4D82 A;  2M5Z A;  2R18 A;  2UU9 M;  2W82 A;  1A5T A;  1JQJ C;  2XFT A;  3KP0 E;  4LJ8 A;  4DUY M;  3B7Z A;  3KOX E;  5KPR A;  1QAQ A;  1WGL A;  1GL7 A;  4LJ9 A;  1SXJ C;  4PCZ A;  3H4J A;  2CV2 A;  1GJS A;  2HAK A;  5KO3 A;  1WR1 B;  2DEN A;  1Q02 A;  3VDP A;  3R9X B;  4MM3 B;  3J7A S;  1NV9 A;  1PM5 A;  3ILK A;  4II7 A;  2O01 F;  1IN7 A;  2X49 A;  2Z3X A;  4AZF A;  4AKI A;  4ANR A;  2CHQ A;  8CAT A;  4JXJ A;  1ORY B;  3FRH A;  4IBF A;  3GLG A;  1KYI A;  4KOD A;  3LCV B;  4GRI A;  1ZMU A;  3Q8X A;  4IBB A;  1ZMV A;  2EO2 A;  3U6Q A;  3TE6 A;  3U61 B;  2F5N A;  4NL4 H;  1YUB A;  2LHC A;  3GRR A;  4JI4 M;  4OX9 M;  1ZAE A;  2L09 A;  1YLA A;  1XHB A;  2JXN A;  3JR5 A;  1IXS A;  4S12 A;  1I94 M;  2DWM A;  1N34 M;  1XMO M;  1QVR A;  3K2L A;  4GHA A;  4OVZ B;  2UUA M;  3QAU A;  3MMP A;  1PJS A;  3ZC7 B;  2DXI A;  4L8R C;  3GPX A;  3QWL A;  2VII A;  2JUJ A;  5EXX A;  3WHK A;  4NSO B;  2ZBK B;  1NY6 A;  3FUX A;  1AUA A;  4L78 A;  4B3M M;  4JI7 M;  3J7B A;  3E9S A;  4LJA A;  3VK7 A;  2KZU A;  1F4I A;  5BR8 M;  2LVN C;  2QSF X;  3DFZ A;  4DR3 M;  1E9S A;  1HT1 E;  1L2B A;  2OPF A;  3FKE A;  4FWG A;  1P3Q Q;  2M60 A;  4I81 A;  3GRV A;  1QAO A;  3SAW A;  1Z6T A;  4LF9 M;  4KT0 F;  1PGY A;  1FJG M;  4G3O A;  2LVA A;  3KS8 A;  2K0B X;  2V1C A;  3LQR A;  5FTL A;  4Z8X A;  2YFQ A;  2R4E A;  2D7E A;  4X64 M;  1T3T A;  4LCB A;  1NVM A;  2L7H A;  1EIJ A;  1NV8 A;  5FTN A;  4WW0 A;  3KW6 A;  2JY8 A;  2K9D A;  4XK8 F;  3HJQ A;  1Q3C A;  5EQT A;  4YHH M;  2H1R A;  4DR7 M;  5L8R F;  2V1U A;  2DWZ B;  1N78 A;  2LWX A;  3AV0 A;  3EIE A;  3BXW A;  4IBG A;  2QHO B;  2K47 A;  4IBI A;  3A45 A;  3J27 B;  4CGY B;  1SXJ A;  3SMP A;  4IBE A;  3U60 B;  2CRU A;  1VDL A;  4G4O A;  1XMQ M;  4DV4 M;  1T6O A;  5ITR A;  2MR9 A;  3D8B A;  1IN5 A;  3GLF A;  3GLG B;  3I4Y A;  4DV3 M;  3C3E A;  4CJ6 A;  2CV1 A;  3KXE C;  4DV5 M;  2H5X A;  1E32 A;  1R6B X;  3U6C A;  1JR3 E;  2XH9 A;  1OFI A;  1QAN A;  2CE7 A;  2DNA A;  1GKI A;  5IWA M;  1IFY A;  1HJP A;  1NNU C;  2JP7 A;  3SAV A;  3GLI E;  4AKH A;  1W5S A;  1XXH A;  1L1Z A;  1VG5 A;  2DZL A;  2QZ4 A;  5F3W A;  1WXQ A;  3HWS A;  1IN8 A;  4FCW A;  4MH0 E;  3WHL A;  3HHZ A;  2OQ4 A;  1N33 M;  4GIP A;  3UJN A;  2LXE A;  4JV5 M;  1GVN A;  2O5R A;  3TWM A;  3F92 A;  1VEG A;  1AIP C;  1IN4 A;  4M9X A;  1L8Q A;  4I5S A;  2RGO A; 
#chains in the Genus database with same CATH homology
 3THG A;  4L16 A;  3TWL A;  1R2Y A;  2KRK A;  4AQY M;  4G4Q A;  1SXJ D;  4FCV A;  1L1T A;  5KPZ A;  4LG2 A;  3SYL A;  4LZJ A;  2KA6 B;  3CTW B;  4D80 A;  3LQQ A;  3U6P A;  1HQY E;  4AG5 A;  1XWI A;  2VQE M;  2R46 A;  1YSY A;  4LFA M;  4LJ7 A;  2G8L A;  2A5Y B;  4G4R A;  3KDS E;  4GHL A;  4L15 A;  2EUC A;  2G5G X;  3GQ4 A;  4PDG A;  4AKG A;  1VDD A;  3IG8 A;  1G41 A;  2HHH M;  1G8P A;  3OTO M;  4FCT A;  4JI8 M;  4D81 A;  2QBY A;  1G3I A;  2UXC M;  4JI1 M;  4ITQ A;  3B9P A;  3PNV A;  4M9S A;  3AL0 C;  4GC9 A;  4K0K M;  1GL6 A;  1SXJ B;  2QEN A;  2ZAN A;  3DOA A;  2ERC A;  4PDI A;  3GLH B;  4NXN M;  2KEB A;  1IM2 A;  3W0F A;  3GLF B;  4AG6 A;  2J7O A;  5LMU M;  3HU3 A;  2DZO B;  2UXB M;  3SAU A;  4DV2 M;  3ZCB B;  1XC8 A;  4Z6Y A;  5KQ8 A;  3KP1 E;  1N36 M;  1DGB A;  1TH4 A;  1Z59 A;  4IBJ A;  4MGK E;  5EXS A;  5E6J A;  1XXH B;  4DV1 M;  3L29 A;  4OU7 A;  4B3T M;  3UK6 A;  4MGY E;  2Z4S A;  4IIW A;  3KS4 A;  1N75 A;  3ZH9 B;  2DHR A;  1J5E M;  2J7N A;  4PD2 A;  5KQD A;  3VFD A;  2YR0 A;  1YE9 A;  2F5O A;  4DR6 M;  1K3X A;  2ZM6 M;  2L6O A;  3H4M A;  4QOZ C;  4NOO B;  3FTF A;  1QYR A;  4NSR A;  3PNY A;  4REZ A;  2YNM D;  1R2Z A;  3FUU A;  4WUR A;  4JYA M;  4G6Z A;  4FD2 A;  1JR3 A;  3U5Z A;  1PJI A;  2X4A A;  4LF4 M;  3I51 A;  4X62 M;  5ITY A;  2AHM A;  2EA0 A;  3GLI A;  4FVM A;  1G59 A;  3JR4 A;  1TDH A;  4GKK M;  3J80 S;  4BLC A;  5DNY A;  2F4V M;  2QBY B;  3K8Z A;  3KSX A;  5DYI A;  2CHG A;  3BOS A;  5IZ7 D;  4TUW A;  4M0D A;  3HU1 A;  1HT2 E;  2D7G A;  5A2Q S;  4KHP M;  1E94 E;  1L2C A;  2V6Z M;  3SBJ A;  2XGN A;  4P16 A;  5IRE B;  2DVW B;  1Z5C A;  3NWL A;  1TGU A;  2D7H A;  4L4U A;  1JR3 D;  4LJ6 A;  4LJ5 A;  3A42 A;  3PXG A;  3KOW E;  2CV0 A;  4GH9 A;  1R7R A;  1IXS B;  3T38 A;  5FTK A;  2YQZ A;  3LVW A;  5EXT A;  1IY2 A;  3M7G A;  3TWK A;  3FUW A;  1DGH A;  4FW9 A;  1TH2 A;  1HQC A;  1N32 M;  5FLX S;  3DA1 A;  3MHV C;  3AOG A;  5IT9 S;  3AJI B;  4IBC A;  3MJ5 A;  1HNX M;  1DGF A;  2VQF M;  5KPT A;  3GQ3 A;  1XNQ M;  2NQ8 C;  3UZU A;  3L26 A;  3U6M A;  2DZN B;  3SHF A;  3VLF B;  3M0E A;  3U6O A;  3U5Z B;  3U61 A;  2UXD M;  3LMM A;  1NJF A;  4KO8 A;  3UMM A;  3RGP A;  2KW0 A;  4GKJ M;  3T1H M;  3GQ5 A;  4KLN A;  1IY0 A;  1L2D A;  2FE8 A;  1HR0 M;  3GLI B;  5JI3 E;  1IXZ A;  2C99 A;  3FTE A;  3FTC A;  4JN6 A;  2BJW A;  2XSZ A;  3CF2 A;  1IBM M;  4HLQ A;  3R8F A;  4LF8 M;  5EJC A;  3IG5 A;  4M0W A;  4LY6 A;  4NRV A;  2Z4R A;  1Z5B A;  4DR5 M;  5ITU A;  1K3W A;  2CEA A;  3DZD A;  4NRW A;  3T1Y M;  5C18 A;  2FOI C;  1X37 A;  3CF6 E;  3CF0 A;  1J7K A;  5H37 D;  3HHW A;  3K1J A;  2I7P A;  2LH0 A;  3HKP A;  2JA2 A;  1EE8 A;  4EIW A;  4JI6 M;  4R3D A;  1GLN A;  4A3V B;  5BPV A;  4X65 M;  5ITX E;  3VDU A;  3AFH A;  4QNM A;  1IQP A;  2Y0T A;  3AOE A;  1DGG A;  3NBI A;  4LGY A;  4G4N A;  1XNR M;  2P5T A;  3FUV A;  2XSZ D;  4LF7 M;  2RKO A;  2KZS A;  4DUZ M;  1IY1 A;  3SAS A;  1NJG A;  1Z5A A;  3KOZ E;  3SAR A;  2BJV A;  4GC5 A;  5LMN M;  3J81 S;  2Y21 A;  4YY3 M;  4QNR A;  2Z7J A;  4FWD A;  1DGH B;  1H6U A;  4RF0 A;  3TPZ A;  3RFW A;  4XBO A;  3VK8 A;  5EP2 A;  5FTJ A;  3GO8 A;  2QPA A;  3U60 A;  3I4V A;  2QP9 X;  3SMS A;  4XGI A;  1NHG C;  2Y0Q A;  5GKN A;  2XZU A;  3VKG A;  2R4J A;  3A46 A;  2RGH A;  2F5Q A;  2DWL A;  3KOY E;  4LFC M;  4FWH A;  3D8L A;  4AW4 A;  2E5L M;  4LFB M;  2C5R A;  2I7N A;  1OFH A;  4IJF A;  3W0L B;  3AKZ A;  3KFU G;  1J09 A;  3A98 B;  4CHT B;  4LGM A;  2ZAO A;  3HJS A;  4DR2 M;  4QOS A;  2Y20 A;  3FYC A;  3SHG B;  5EXP A;  1K82 A;  3SAT A;  1HNZ M;  4B3S M;  4JI2 M;  4M9Z A;  1E9R A;  2KRU A;  4NXM M;  3EIH A;  4AI6 A;  2XF3 A;  3SC3 A;  3J2P B;  1G4A E;  3SYK A;  4DV0 M;  4DR4 M;  4JI0 M;  2L7I A;  4MB7 A;  1ZQ9 A;  3HGI A;  3K92 A;  4GMQ A;  5EP4 A;  1MU5 A;  2R62 A;  2KXE A;  3FTD A;  3L2A A;  1W5T A;  3FYD A;  3RE8 A;  3GPY A;  2F5S A;  3MK6 A;  2BNK A;  1C1K A;  2R65 A;  4LF5 M;  1TDZ A;  3U6L A;  5DYG A;  3U6S A;  2C9O A;  4ZPX A;  4CIS A;  3AOE C;  3UGJ A;  2DWN A;  3JAM S;  1DO0 A;  4B7F A;  4DV7 M;  1DO2 A;  2Q2E B;  1D2N A;  4HL4 A;  5ITQ A;  4B7G A;  3GPU A;  3LVV A;  4LF6 M;  4GIT A;  1HNW M;  2XEP A;  1PJJ A;  5JI2 E;  4QHT A;  1NHW C;  1IBK M;  4JI3 M;  5ITT A;  3KVW A;  1UM8 A;  4W5W A;  4LZZ A;  5EP3 A;  3HHY A;  4B08 A;  3GPP A;  1N77 A;  2HKJ A;  2HL7 A;  3GLH A;  1I4W A;  4MGI E;  2CUZ A;  3TL4 X;  1FNN A;  1LV7 A;  4OW0 A;  4MGH A;  4BBA A;  1TH3 A;  3E4R A;  4B7H A;  1Q3B A;  4JI5 M;  4RNA A;  3HJ8 A;  5FTM A;  2C9C A;  4IBD A;  4I8O A;  2XLJ A;  5ITX A;  2C96 A;  2XFS A;  1OJL A;  4LRS A;  2HCB A;  4QHS A;  7CAT A;  1QZM A;  4B3R M;  1QAM A;  5C1B A;  2FFJ A;  3VKH A;  4DR1 M;  3RGS A;  3M6A A;  4OVZ A;  2CHV A;  3KSJ A;  2X8A A;  3FUT A;  3HU2 A;  1NNJ A;  2ZAM A;  3U6D A;  1IBL M;  1QQW A;  1NSF A;  2F5P A;  3T15 A;  3TQS A;  5EP1 A;  3U6E A;  1Q39 A;  4LRT A;  3L25 A;  4IJE A;  2XZF A;  2UUB M;  3SFZ A;  1KFV A;  3L28 A;  3FD9 A;  2UUC M;  2R45 A;  1IN6 A;  3PVS A;  5E26 A;  1SXJ E;  3HHX A;  2C98 A;  2LNH C;  2FNA A;  3GRU A;  1IXR C;  3GRY A;  4X66 M;  4RF1 A;  1S3S A;  4DV6 M;  1KSF X;  4MGZ E;  3GP1 A;  4IBK A;  3C58 A;  1MX0 A;  4BB9 A;  1NY5 A;  4PT5 A;  2QCU A;  4I4L A;  4R7G A;  5FSW A;  4LJ4 A;  3PFI A;  3L27 A;  2CFO A;  4D82 A;  2M5Z A;  2R18 A;  2UU9 M;  2W82 A;  1JQJ C;  2XFT A;  3KP0 E;  4LJ8 A;  4DUY M;  3KOX E;  5KPR A;  1QAQ A;  1GL7 A;  4LJ9 A;  1SXJ C;  4PCZ A;  2CV2 A;  5KO3 A;  3VDP A;  3R9X B;  4MM3 B;  3J7A S;  1PM5 A;  3ILK A;  4II7 A;  1IN7 A;  2X49 A;  2Z3X A;  4AZF A;  4AKI A;  2CHQ A;  8CAT A;  4JXJ A;  1ORY B;  4IBF A;  3GLG A;  1KYI A;  4KOD A;  4GRI A;  3Q8X A;  4IBB A;  2EO2 A;  3U6Q A;  3TE6 A;  3U61 B;  2F5N A;  4NL4 H;  1YUB A;  3GRR A;  4JI4 M;  4OX9 M;  1ZAE A;  2L09 A;  1XHB A;  3JR5 A;  4S12 A;  1I94 M;  2DWM A;  1N34 M;  1XMO M;  1QVR A;  3K2L A;  4GHA A;  4OVZ B;  2UUA M;  3QAU A;  3ZC7 B;  2DXI A;  4L8R C;  3GPX A;  3QWL A;  2VII A;  5EXX A;  3WHK A;  4NSO B;  2ZBK B;  1NY6 A;  3FUX A;  4L78 A;  4B3M M;  4JI7 M;  3J7B A;  3E9S A;  4LJA A;  3VK7 A;  2KZU A;  5BR8 M;  3DFZ A;  4DR3 M;  1E9S A;  1HT1 E;  1L2B A;  2OPF A;  3FKE A;  4FWG A;  2M60 A;  4I81 A;  3GRV A;  1QAO A;  3SAW A;  1Z6T A;  4LF9 M;  1FJG M;  3KS8 A;  2V1C A;  3LQR A;  5FTL A;  4Z8X A;  2YFQ A;  2R4E A;  2D7E A;  4X64 M;  1T3T A;  4LCB A;  1NVM A;  2L7H A;  5FTN A;  4WW0 A;  3KW6 A;  3HJQ A;  1Q3C A;  5EQT A;  4YHH M;  2H1R A;  4DR7 M;  2V1U A;  2DWZ B;  1N78 A;  2LWX A;  3AV0 A;  3EIE A;  4IBG A;  2K47 A;  4IBI A;  3A45 A;  3J27 B;  4CGY B;  1SXJ A;  3SMP A;  4IBE A;  3U60 B;  4G4O A;  1XMQ M;  4DV4 M;  5ITR A;  3D8B A;  1IN5 A;  3GLF A;  3GLG B;  3I4Y A;  4DV3 M;  2CV1 A;  3KXE C;  4DV5 M;  1E32 A;  1R6B X;  3U6C A;  2XH9 A;  1OFI A;  1QAN A;  2CE7 A;  1GKI A;  5IWA M;  1NNU C;  3SAV A;  4AKH A;  1W5S A;  1XXH A;  1L1Z A;  2QZ4 A;  5F3W A;  1WXQ A;  3HWS A;  1IN8 A;  4FCW A;  4MH0 E;  3WHL A;  3HHZ A;  2OQ4 A;  1N33 M;  4GIP A;  3UJN A;  2LXE A;  4JV5 M;  1GVN A;  2O5R A;  3TWM A;  1IN4 A;  4M9X A;  1L8Q A;  4I5S A;  2RGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...