2FOIC

Synthesis, biological activity, and x-ray crystal structural analysis of diaryl ether inhibitors of malarial enoyl acp reductase.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
60
structure length
60
Chain Sequence
YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords enoyl-acyl carrier reductase
publication title X-ray Structural Analysis of Plasmodium falciparum Enoyl Acyl Carrier Protein Reductase as a Pathway toward the Optimization of Triclosan Antimalarial Efficacy.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 16
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2006-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2foiC00
1NHGC 2FOIC 1NNUC 2NQ8C 1NHWC
chains in the Genus database with same CATH superfamily
3T6PA 3M6AA 2C99A 3B7ZA 1R6BX 2G5GX 2OOBA 2HL7A 3VLFB 2APLA 3B89A 1D0MA 3B7QA 4FVMA 1L1TA 4GKKM 1XHBA 3VDPA 5IT9S 4II7A 1GJSA 1G3IA 4JV5M 4DR1M 3W0LB 1OAOC 5EJCA 5ITTA 2OO9A 4LF8M 1OKSA 1R7RA 2YFQA 3HU2A 2ZTCA 2JY8A 2DAIA 1QAMA 1TH4A 3FUXA 2DENA 1LTMA 3U6SA 2KHHA 3HJQA 3KXEC 2LBCA 2ZAMA 4FCWA 4GC5A 3T1HM 1ZQ9A 3TWMA 3KVWA 4LF9M 2XH9A 1JQJC 4LGMA 3GRUA 2KZSA 5EP3A 1TF0B 4IBGA 2EA0A 2N35A 4AKGA 2L4FA 1UM8A 2CRUA 2UUAM 1GO5A 1NJGA 3FYCA 3PFIA 1TDHA 1XC8A 2LVPC 3T15A 2GNOA 2LNHC 3GLIE 2G3QA 2C96A 3AOEC 4LFCM 4MGKE 2C98A 3UMMA 2R62A 4NOOB 3SARA 1QAOA 1LV7A 4HL4A 4WURA 3JAMS 3HY5A 3U6QA 1VEGA 1XMOM 1R2YA 4B3MM 3HKPA 2VF7A 3LVVA 4FWGA 3HU1A 3PVSA 2JNHA 4M9XA 1IXRC 3J81S 1QVRA 2XLJA 2F5PA 1W5TA 1IN8A 4B7GA 1DO2A 3FRHA 1DGBA 5KQ8A 2D7GA 1IXSA 2JZ0A 3TWKA 2UXCM 2HWJA 1IBKM 3A98B 1MN3A 2EJSA 3QYEA 3JR5A 3K9OA 2C9OA 2ERCA 4CJ6A 4Z8XA 2CE7A 4I5SA 4LZZA 1I94M 3SYLA 4F1IA 3GQ3A 3KOYE 5ITQA 3J7BA 2CV1A 4JYAM 2L7HA 2K47A 4R7GA 1I4WA 1PJJA 2UUBM 2QNJA 1OJLA 1MJGM 3NWLA 2VQEM 4GRIA 2FH0A 2W82A 1DO0A 3SAUA 1N78A 4NSRA 2L09A 1OAIA 3GLGA 1TGUA 3AV0A 3KP0E 4ANRA 3HHZA 4DR5M 2FFJA 3FUWA 3KOZE 3MJ5A 2D7EA 4DV2M 2UXBM 2MROB 3HJ8A 4L16A 3HHYA 1SXJA 2Z7JA 2NQ8C 4FCVA 4L6V6 3TPZA 3TQSA 5BPVA 1L1ZA 4QOSA 4IBBA 2J7OA 1Z5CA 1SXJD 2OOAA 2R4EA 3LQRA 4GIPA 3VFDA 3FE3A 4GMQA 4IIWA 5BR8M 1IBMM 5C18A 2DWMA 8CATA 3UJNA 5FLXS 1V92A 5FTJA 1IXSB 4IBCA 4M0WA 3U6DA 2F5SA 4M0DA 1XNQM 3IHPA 4DV3M 3U6MA 2CEAA 2JY7A 5FTMA 5ITUA 3UGJA 1XNRM 5L8RF 4JI3M 3ZQJA 4CGYB 2L6OA 4AKHA 3GO8A 2MJ5B 3ILKA 1G41A 3L2AA 3MHVC 1HJPA 4JXJA 4NSOB 1R2ZA 3CGWA 2I7NA 2V1UA 3SASA 1J09A 3CF6E 2M5ZA 4X66M 4JI5M 1VDDA 2VF8A 1G71A 3GLGB 2P5TA 2X4AA 3FTEA 1WHCA 1YE9A 2BWBA 3KS4A 3ZH9B 3FUVA 2JA2A 1R4GA 4GC9A 1ZV1A 4KLNA 1YUBA 3C3EA 5EP4A 3TE6A 3T1YM 1YLAA 3HX3A 1C7YA 3AOEA 5EP2A 1HQYE 1SXJB 4R3DA 1K3XA 4LJ9A 1DV0A 2FNAA 2JP7A 1AUAA 4MGZE 1VG5A 1P3QQ 3J2PB 3LMMA 3QYBA 5KO3A 3E4RA 2LH0A 3FTCA 3J7AS 1QAQA 5DNYA 1PRBA 2DZOB 3CTWB 4D80A 1Q3CA 4IBEA 4CHTB 4AI6A 1TH3A 4LJ5A 2RGHA 2DXIA 2CFOA 3Q8XA 1SXJC 3SYKA 1IN6A 3D8LA 3I51A 1T6OA 1QZEA 3CF0A 4WW0A 3FUTA 2JZ1A 4MGIE 3W0FA 2L2DA 3DFZA 3K8ZA 4BLCA 2EO2A 2KZUA 4AG5A 1VEJA 5ITXA 3B7NA 4DR2M 3JR4A 4QHSA 3I01M 3DZDA 4GHAA 1T43A 4MGHA 4NRVA 1OQYA 5KQDA 2O25A 1GVNA 3SBJA 2QCUA 1NNJA 2O01F 3KOXE 5H37D 4K0KM 3KSXA 3FD9A 1A5TA 3M7GA 2Z4RA 1V33A 5EQTA 4JI2M 4X64M 2DAMA 5LMUM 4RKUF 3C9PA 2D7HA 1KYIA 1TR8A 4M9ZA 3OTOM 3E46A 4LG2A 3FTDA 3LW5F 3SFZA 5KPZA 1KFVA 4L8RC 1J7KA 3K92A 1DGFA 3L26A 2JWSA 4I8OA 2DHYA 1K82A 3K1JA 2J5YA 2JY6B 2KXEA 1IM2A 1IN7A 2C9CA 5EXSA 1GJTA 4EIWA 1ORYB 4LZJA 3GLFA 1IN5A 1Z5BA 2L7IA 4AG6A 1Q39A 4RF1A 2BNKA 1NO1A 3GLGE 3PXGA 1DGHA 2JUJA 4FWDA 4X65M 4DUZM 3SAVA 2BJVA 2DZLA 1NHWC 2Y0TA 5ITRA 1H6UA 1K3WA 5EP1A 2FOIC 1N32M 1XXHB 4GKJM 5IZ7D 4B3SM 3U6CA 1SXJE 2XFTA 3DOAA 4Z6YA 4GHLA 2LVQD 1PJQA 4HEOA 4MH0E 2VQFM 4LF4M 1JR3A 3T38A 3H4MA 1OTRA 1JR3D 4FWHA 3AL0C 2ZTDA 1Z59A 2EKKA 1IY2A 3I4VA 4X62M 1J5EM 3TL4X 4OU7A 2DVWB 2ZANA 1QUTA 3VKHA 2KRKA 1QYRA 2H5XA 4IBJA 2UUCM 1QDTA 5LMNM 2RGOA 1WGLA 4Q7JA 1DGGA 4QHTA 3LVWA 3VDUA 1WJ7A 2ZM6M 1EFUB 2Y20A 4YHHM 1NV8A 4CIZA 3SMPA 3GLFB 3W67A 1HQCA 1N34M 2KA6B 2J7NA 1HT2E 2G8LA 2HAKA 3GLIA 4G4RA 4JI6M 1DGHB 3GPXA 3IG8A 1XWIA 1R5LA 4L15A 4B7HA 1IBLM 1Q3BA 2I7PA 3GPUA 3B9PA 4LFBM 3AOGA 2LVNC 3WHKA 3LQQA 3FRIA 4LJ4A 4IBIA 4LJ8A 3UZUA 1HNWM 2O5RA 3IECA 5ITYA 3NBXX 3C58A 1WIVA 4BBAA 3HU3A 1IN4A 1L8QA 4R71A 4G4NA 1W5SA 1JB0F 1Z5AA 2KW0A 1QZMA 4GEWA 2A5YB 2R4JA 1FJGM 2R18A 3FKEA 3GRYA 2CV2A 2YNMD 3HWSA 1X37A 1VEKA 3EIEA 3U6EA 2C5RA 4CISA 2EUCA 3KW6A 3KDSE 5DYGA 2KNAA 3H4JA 4LRSA 4DR4M 1NY6A 4IBDA 4LFAM 2BWEA 4REZA 5FSWA 1BVSA 1OFIA 1OIPA 4G6ZA 5ITXE 2F4VM 4FW9A 5IWAM 1MX0A 3VKGA 2R46A 2MGWA 3RFWA 3GLIB 4HLQA 4IJFA 4B3TM 3FUUA 5DFLA 4LCBA 5C1BA 4KHPM 1S3SA 2DWNA 3KSJA 4UN2B 2Q2EB 4PDIA 2DWZB 5E26A 2CV0A 3DA1A 3FYDA 3V76A 2DZNB 5EXTA 1EIJA 4PCZA 2UXDM 4I4LA 4NC6A 4JI7M 2OPFA 3GPYA 3R9XB 3RGSA 1CUKA 4QNRA 2ZAOA 4FCTA 2F5QA 2DHRA 4YY3M 3HZJA 3A42A 1L2CA 2VDBB 2E5LM 1XB2B 1EE8A 5JI2E 3J27B 3QWLA 1NVMA 2QHOB 1E32A 2WSEF 3ZCBB 2UU9M 1NNUC 3IG5A 3BBZA 1F4IA 1XXHA 1Y8GA 1GL6A 3D8BA 3MK6A 3GLFE 1PJIA 4NL4H 3PNYA 3MMPA 2B3TA 2R0IA 3M0EA 4DBGB 2HCBA 4DV6M 4AQYM 1PGYA 3LCVB 3BXWA 1Q02A 3L28A 4B7FA 1XMQM 4LGYA 1IQPA 3R8FA 1E94E 1NJFA 2CHQA 2HHHM 2HKJA 5EXPA 2LXEA 3E21A 1PJSA 3GQ4A 1HNXM 1N77A 1JR3E 2LVAA 3RGPA 2MR9A 4GITA 2Z3XA 3HHWA 4ITQA 1QQWA 3CF2A 3I4YA 3SC3A 5JI3E 4G4OA 2X49A 1NSFA 2F5OA 3UK6A 1WGNA 4D82A 2L4EA 3U61A 4AKIA 3U60B 4PD2A 3GLHA 4NXNM 3C3DA 1UFZA 3B74A 4G3OA 4JI1M 4JN6A 5KPRA 3HGIA 4OVZB 3GRRA 2FE8A 3SATA 4RNAA 1WXQA 4S12A 4AW4A 2DAKA 4LJ7A 2QENA 3U6OA 1GKIA 3WHLA 2QQ8A 3AFHA 5EXXA 1N36M 4B08A 1N33M 4F2LA 2CHGA 4RF0A 4KO8A 2BJWA 1PJTA 1MU5A 3SHFA 3ZC7B 2QP9X 4OX9M 2XGNA 4XBOA 1L2DA 3LCUA 3PNVA 3A46A 4LJAA 4G4QA 3U5ZA 4B3RM 4P17A 2DNAA 4IJEA 3QAUA 2CHVA 1IXZA 2V6ZM 2LVOC 1KSFX 1N75A 2FS1A 2LHGA 2CWBA 2R65A 4QNMA 4PDGA 4DV4M 2K9DA 2H1RA 1TH2A 3U61B 4NXMM 4DR7M 2XZUA 2GQFA 4OW0A 3L25A 3KP1E 4LRTA 2DKLA 3GLHB 1NV9A 3L27A 3L29A 2VIIA 4IBKA 3RE8A 3FTFA 4NRWA 4W5WA 3K2LA 4JI0M 4AZFA 1TTEA 4DUYM 3J80S 3U6LA 2XF3A 1D0LA 1ZMWA 2DI0A 1QUSA 3A45A 1RU3A 4I81A 2M60A 5A2QS 4FD2A 2DWLA 1G8PA 4JI4M 1T3TA 2XFSA 5IREB 4LF5M 2X8AA 4L4UA 2R44A 2KRUA 4MM3B 5FTKA 2JY5A 1PM5A 3EIHA 1V34A 2DAGA 1NHGC 4KODA 1G4AE 2K6BA 4LF7M 3VK7A 4DV1M 4DR6M 2EKFA 3GQ5A 2QPAA 2KDLA 2RKOA 2YR0A 4XK8F 3I04M 1D2NA 4BB9A 2QBYA 2WZJA 3HJSA 2JXNA 4ZPXA 4P16A 2QSFX 1FNNA 3K9PA 1IY0A 4A3VB 3THGA 1L2BA 4MGYE 2K0BX 3U5ZB 4QOZC 4DV5M 2XSZA 1NY5A 2QZ4A 3SAWA 3GRVA 2YQZA 2CP8A 2LHCA 3TWLA 3VK8A 2XSZD 2AHMA 2KNZA 3KFUG 1E9SA 4LF6M 2OQ4A 2LTUA 4DV0M 1VDLA 5KPTA 1QDRA 1TDZA 2R6FA 4MB7A 2LWXA 1XXHE 1IFYA 1AIPC 7CATA 3Q8GA 1E9RA 1IY1A 2MH8A 3E9SA 1GLNA 2XZFA 4DV7M 2RRUA 3NBIA 1D0KA 3BOSA 3U6PA 2R45A 4DR3M 2CUZA 2XEPA 2DAEA 5GKNA 2KEBA 2V1CA 4WP2A 1OFHA 2Z4SA 1HNZM 1GABA 1QANA 1G59A 1HR0M 3U60A 3AKZA 1WR1B 3SHGB 1HT1E 3HHXA 5F3WA 1C1KA 1ZAEA 3SMSA 4IBFA 2QBYB 4TUWA 3F92A 1Z6TA 4LY6A 2F5NA 1OIZA 4LJ6A 1ZMUA 5FTNA 5FTLA 2WSFF 1YSYA 4OVZA 1SG9A 3GPPA 3KS8A 1VQ1A 4Y28F 2ZBKB 4KT0F 4GH9A 2Z8YM 4M9SA 3GLHE 4L78A 2Y0QA 3AJIB 3KOWE 5E6JA 2WSCF 4D81A 2KNVA 4XGIA 5DYIA 2Y21A 3W68A 1GL7A 4JI8M 4PT5A 3GP1A 1ZMVA
chains in the Genus database with same CATH topology
3M6AA 2C99A 3VLFB 1R6BX 2G5GX 2HL7A 4FVMA 4GKKM 1L1TA 1XHBA 3VDPA 5IT9S 4II7A 1G3IA 4JV5M 4DR1M 3W0LB 5EJCA 5ITTA 4LF8M 1R7RA 2YFQA 3HU2A 1QAMA 1TH4A 3FUXA 3U6SA 3HJQA 3KXEC 2ZAMA 4FCWA 3T1HM 4GC5A 1ZQ9A 3TWMA 3KVWA 4LF9M 2XH9A 1JQJC 4LGMA 3GRUA 2KZSA 5EP3A 2EA0A 4IBGA 4AKGA 1UM8A 2UUAM 1NJGA 3FYCA 3PFIA 1TDHA 1XC8A 3T15A 2LNHC 2C96A 3AOEC 4LFCM 4MGKE 2C98A 3UMMA 2R62A 4NOOB 3SARA 1QAOA 1LV7A 4HL4A 4WURA 3JAMS 3U6QA 1XMOM 4B3MM 1R2YA 3HKPA 3LVVA 4FWGA 3HU1A 3PVSA 4M9XA 1IXRC 3J81S 1QVRA 2XLJA 2F5PA 1W5TA 1IN8A 4B7GA 1DO2A 1DGBA 5KQ8A 2D7GA 3TWKA 2UXCM 1IBKM 3A98B 3JR5A 2C9OA 2ERCA 4Z8XA 2CE7A 4I5SA 4LZZA 1I94M 3SYLA 3GQ3A 2CV1A 3KOYE 5ITQA 3J7BA 2DXIA 4JYAM 2L7HA 2K47A 4R7GA 1I4WA 1PJJA 2UUBM 1OJLA 3NWLA 2VQEM 4GRIA 2W82A 1DO0A 3SAUA 1N78A 4NSRA 2L09A 3GLGA 1TGUA 3AV0A 3KP0E 3HHZA 4DR5M 2FFJA 3FUWA 3KOZE 3MJ5A 2D7EA 4DV2M 2UXBM 3HJ8A 4L16A 3HHYA 1SXJA 2Z7JA 2NQ8C 4FCVA 3TPZA 3TQSA 5BPVA 1L1ZA 4QOSA 4IBBA 2J7OA 1Z5CA 1SXJD 3LQRA 2R4EA 4GIPA 3VFDA 4GMQA 4IIWA 5BR8M 1IBMM 2DWMA 5C18A 8CATA 3UJNA 5FLXS 5FTJA 1IXSB 4IBCA 4M0WA 3U6DA 2F5SA 4M0DA 1XNQM 4DV3M 3U6MA 2CEAA 5FTMA 5ITUA 3UGJA 1XNRM 4JI3M 4CGYB 2L6OA 4AKHA 3GO8A 3SATA 3ILKA 1G41A 3L2AA 3MHVC 4JXJA 4NSOB 2V1UA 1R2ZA 3SASA 2I7NA 1J09A 3CF6E 2M5ZA 4X66M 4JI5M 1VDDA 3GLGB 2P5TA 2X4AA 3FTEA 1YE9A 3ZH9B 3KS4A 3FUVA 2JA2A 4GC9A 4KLNA 1YUBA 5EP4A 3TE6A 3T1YM 3AOEA 5EP2A 1HQYE 1SXJB 4R3DA 1K3XA 4LJ9A 2FNAA 4MGZE 3J2PB 3LMMA 5KO3A 3E4RA 2LH0A 3FTCA 3J7AS 1QAQA 5DNYA 2DZOB 3CTWB 4D80A 1Q3CA 4IBEA 4CHTB 4AI6A 1TH3A 4LJ5A 2RGHA 2CFOA 3Q8XA 1SXJC 3SYKA 1IN6A 3D8LA 3I51A 3CF0A 4WW0A 3FUTA 3W0FA 4MGIE 3DFZA 3K8ZA 4BLCA 2EO2A 2KZUA 4AG5A 5ITXA 4DR2M 3JR4A 4QHSA 3DZDA 4GHAA 4MGHA 4NRVA 5KQDA 1GVNA 3SBJA 2QCUA 1NNJA 3KOXE 5H37D 4K0KM 3KSXA 3FD9A 3M7GA 2Z4RA 5EQTA 4JI2M 4X64M 5LMUM 2D7HA 1KYIA 4M9ZA 3OTOM 4LG2A 3FTDA 3SFZA 5KPZA 4L8RC 1KFVA 1J7KA 3K92A 1DGFA 3L26A 4I8OA 1K82A 3K1JA 2KXEA 1IN7A 1IM2A 2C9CA 5EXSA 4EIWA 1ORYB 4LZJA 3GLFA 1IN5A 1Z5BA 2L7IA 4AG6A 1Q39A 4RF1A 2BNKA 3PXGA 1DGHA 4X65M 4FWDA 4DUZM 3SAVA 2BJVA 1NHWC 2Y0TA 5ITRA 1H6UA 1K3WA 5EP1A 2FOIC 1N32M 1XXHB 4GKJM 5IZ7D 4B3SM 3U6CA 1SXJE 2XFTA 3DOAA 4Z6YA 4GHLA 4MH0E 4LF4M 2VQFM 1JR3A 3T38A 3H4MA 1JR3D 4FWHA 3AL0C 1Z59A 3I4VA 1IY2A 4X62M 1J5EM 3TL4X 4OU7A 2DVWB 2ZANA 3VKHA 2KRKA 1QYRA 4IBJA 2UUCM 5LMNM 2RGOA 1DGGA 4QHTA 3LVWA 3VDUA 2ZM6M 2Y20A 4YHHM 3SMPA 3GLFB 1HQCA 1N34M 2KA6B 2J7NA 1HT2E 2G8LA 3GLIA 4G4RA 4JI6M 1DGHB 3GPXA 3IG8A 1XWIA 4L15A 4B7HA 1IBLM 1Q3BA 2I7PA 3GPUA 3B9PA 4LFBM 3AOGA 3WHKA 3LQQA 4LJ4A 4IBIA 4LJ8A 3UZUA 1HNWM 2O5RA 5ITYA 3C58A 4BBAA 3HU3A 1IN4A 1L8QA 4G4NA 1W5SA 1Z5AA 2KW0A 1QZMA 2A5YB 2R4JA 1FJGM 2R18A 3FKEA 3GRYA 2CV2A 2YNMD 3HWSA 1X37A 3EIEA 3U6EA 2C5RA 4CISA 2EUCA 3KW6A 3KDSE 5DYGA 4LRSA 4DR4M 1NY6A 4IBDA 4LFAM 4REZA 5FSWA 1OFIA 5ITXE 2F4VM 4G6ZA 4FW9A 5IWAM 1MX0A 3VKGA 2R46A 3RFWA 3GLIB 4HLQA 4IJFA 4B3TM 3FUUA 4LCBA 5C1BA 4KHPM 1S3SA 2DWNA 3KSJA 2Q2EB 4PDIA 2DWZB 5E26A 2CV0A 3DA1A 3FYDA 2DZNB 5EXTA 4PCZA 2UXDM 4I4LA 4JI7M 2OPFA 3GPYA 3R9XB 3RGSA 4QNRA 2ZAOA 4FCTA 2F5QA 2DHRA 4YY3M 3A42A 1L2CA 2E5LM 1EE8A 5JI2E 3J27B 3QWLA 1NVMA 3ZCBB 1E32A 2UU9M 1NNUC 3IG5A 1XXHA 1GL6A 3D8BA 3MK6A 1PJIA 4NL4H 3PNYA 3M0EA 2HCBA 4DV6M 4AQYM 4B7FA 3L28A 1XMQM 4LGYA 1IQPA 3R8FA 1E94E 1NJFA 2CHQA 2HHHM 2HKJA 5EXPA 2LXEA 3GQ4A 1HNXM 1N77A 3RGPA 4GITA 2Z3XA 3HHWA 4ITQA 1QQWA 3CF2A 3I4YA 3SC3A 5JI3E 4G4OA 2X49A 1NSFA 2F5OA 3UK6A 4D82A 3U61A 4AKIA 3U60B 4PD2A 3GLHA 4NXNM 4JI1M 4JN6A 5KPRA 3HGIA 4OVZB 3GRRA 2FE8A 4RNAA 1WXQA 4S12A 4AW4A 4LJ7A 2QENA 3U6OA 1GKIA 3WHLA 3AFHA 5EXXA 1N36M 4B08A 1N33M 2CHGA 4RF0A 4KO8A 2BJWA 1MU5A 3SHFA 3ZC7B 2QP9X 4OX9M 2XGNA 4XBOA 1L2DA 3PNVA 3A46A 4LJAA 4G4QA 3U5ZA 4B3RM 4IJEA 3QAUA 2CHVA 1IXZA 2V6ZM 4QNMA 1KSFX 1N75A 2R65A 4PDGA 4DV4M 4DR7M 4NXMM 3U61B 2H1RA 1TH2A 2XZUA 4OW0A 3L25A 3KP1E 4LRTA 3GLHB 3L27A 3L29A 2VIIA 4IBKA 3RE8A 3FTFA 4NRWA 4W5WA 3K2LA 4JI0M 4AZFA 4DUYM 3J80S 3U6LA 2XF3A 3A45A 4I81A 2M60A 5A2QS 4FD2A 2DWLA 1G8PA 4JI4M 1T3TA 2XFSA 5IREB 4LF5M 2X8AA 4L4UA 4MM3B 2KRUA 5FTKA 1PM5A 3EIHA 4KODA 4LF7M 1NHGC 1G4AE 3VK7A 4DV1M 4DR6M 3GQ5A 2QPAA 2RKOA 2YR0A 1D2NA 4BB9A 2QBYA 4ZPXA 3HJSA 4P16A 1FNNA 4A3VB 1IY0A 3THGA 1L2BA 4MGYE 3U5ZB 4QOZC 4DV5M 2XSZA 1NY5A 2QZ4A 3SAWA 3GRVA 2YQZA 3TWLA 3VK8A 2XSZD 2AHMA 3KFUG 1E9SA 4LF6M 2OQ4A 1TDZA 4DV0M 5KPTA 4MB7A 2LWXA 7CATA 1E9RA 1IY1A 3E9SA 1GLNA 2XZFA 4DV7M 3NBIA 3BOSA 3U6PA 2R45A 4DR3M 2CUZA 2XEPA 5GKNA 2KEBA 2V1CA 1OFHA 2Z4SA 1HNZM 1QANA 1G59A 1HR0M 3U60A 3AKZA 3SHGB 1HT1E 3HHXA 5F3WA 1C1KA 1ZAEA 3SMSA 4IBFA 2QBYB 4TUWA 1Z6TA 4LY6A 2F5NA 4LJ6A 5FTNA 5FTLA 1YSYA 4OVZA 3GPPA 3KS8A 2ZBKB 4GH9A 4M9SA 4L78A 2Y0QA 3AJIB 3KOWE 5E6JA 4D81A 4XGIA 5DYIA 2Y21A 1GL7A 4JI8M 4PT5A 3GP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHG C;  2FOI C;  1NNU C;  2NQ8 C;  1NHW C; 
#chains in the Genus database with same CATH topology
 3T6P A;  3M6A A;  2C99 A;  3B7Z A;  1R6B X;  2G5G X;  2OOB A;  2HL7 A;  3VLF B;  2APL A;  3B89 A;  1D0M A;  3B7Q A;  4FVM A;  1L1T A;  4GKK M;  1XHB A;  3VDP A;  5IT9 S;  4II7 A;  1GJS A;  1G3I A;  4JV5 M;  4DR1 M;  3W0L B;  1OAO C;  5EJC A;  5ITT A;  2OO9 A;  4LF8 M;  1OKS A;  1R7R A;  2YFQ A;  3HU2 A;  2ZTC A;  2JY8 A;  2DAI A;  1QAM A;  1TH4 A;  3FUX A;  2DEN A;  1LTM A;  3U6S A;  2KHH A;  3HJQ A;  3KXE C;  2LBC A;  2ZAM A;  4FCW A;  4GC5 A;  3T1H M;  1ZQ9 A;  3TWM A;  3KVW A;  4LF9 M;  2XH9 A;  1JQJ C;  4LGM A;  3GRU A;  2KZS A;  5EP3 A;  1TF0 B;  4IBG A;  2EA0 A;  2N35 A;  4AKG A;  2L4F A;  1UM8 A;  2CRU A;  2UUA M;  1GO5 A;  1NJG A;  3FYC A;  3PFI A;  1TDH A;  1XC8 A;  2LVP C;  3T15 A;  2GNO A;  2LNH C;  3GLI E;  2G3Q A;  2C96 A;  3AOE C;  4LFC M;  4MGK E;  2C98 A;  3UMM A;  2R62 A;  4NOO B;  3SAR A;  1QAO A;  1LV7 A;  4HL4 A;  4WUR A;  3JAM S;  3HY5 A;  3U6Q A;  1VEG A;  1XMO M;  1R2Y A;  4B3M M;  3HKP A;  2VF7 A;  3LVV A;  4FWG A;  3HU1 A;  3PVS A;  2JNH A;  4M9X A;  1IXR C;  3J81 S;  1QVR A;  2XLJ A;  2F5P A;  1W5T A;  1IN8 A;  4B7G A;  1DO2 A;  3FRH A;  1DGB A;  5KQ8 A;  2D7G A;  1IXS A;  2JZ0 A;  3TWK A;  2UXC M;  2HWJ A;  1IBK M;  3A98 B;  1MN3 A;  2EJS A;  3QYE A;  3JR5 A;  3K9O A;  2C9O A;  2ERC A;  4CJ6 A;  4Z8X A;  2CE7 A;  4I5S A;  4LZZ A;  1I94 M;  3SYL A;  4F1I A;  3GQ3 A;  3KOY E;  5ITQ A;  3J7B A;  2CV1 A;  4JYA M;  2L7H A;  2K47 A;  4R7G A;  1I4W A;  1PJJ A;  2UUB M;  2QNJ A;  1OJL A;  1MJG M;  3NWL A;  2VQE M;  4GRI A;  2FH0 A;  2W82 A;  1DO0 A;  3SAU A;  1N78 A;  4NSR A;  2L09 A;  1OAI A;  3GLG A;  1TGU A;  3AV0 A;  3KP0 E;  4ANR A;  3HHZ A;  4DR5 M;  2FFJ A;  3FUW A;  3KOZ E;  3MJ5 A;  2D7E A;  4DV2 M;  2UXB M;  2MRO B;  3HJ8 A;  4L16 A;  3HHY A;  1SXJ A;  2Z7J A;  2NQ8 C;  4FCV A;  4L6V 6;  3TPZ A;  3TQS A;  5BPV A;  1L1Z A;  4QOS A;  4IBB A;  2J7O A;  1Z5C A;  1SXJ D;  2OOA A;  2R4E A;  3LQR A;  4GIP A;  3VFD A;  3FE3 A;  4GMQ A;  4IIW A;  5BR8 M;  1IBM M;  5C18 A;  2DWM A;  8CAT A;  3UJN A;  5FLX S;  1V92 A;  5FTJ A;  1IXS B;  4IBC A;  4M0W A;  3U6D A;  2F5S A;  4M0D A;  1XNQ M;  3IHP A;  4DV3 M;  3U6M A;  2CEA A;  2JY7 A;  5FTM A;  5ITU A;  3UGJ A;  1XNR M;  5L8R F;  4JI3 M;  3ZQJ A;  4CGY B;  2L6O A;  4AKH A;  3GO8 A;  2MJ5 B;  3ILK A;  1G41 A;  3L2A A;  3MHV C;  1HJP A;  4JXJ A;  4NSO B;  1R2Z A;  3CGW A;  2I7N A;  2V1U A;  3SAS A;  1J09 A;  3CF6 E;  2M5Z A;  4X66 M;  4JI5 M;  1VDD A;  2VF8 A;  1G71 A;  3GLG B;  2P5T A;  2X4A A;  3FTE A;  1WHC A;  1YE9 A;  2BWB A;  3KS4 A;  3ZH9 B;  3FUV A;  2JA2 A;  1R4G A;  4GC9 A;  1ZV1 A;  4KLN A;  1YUB A;  3C3E A;  5EP4 A;  3TE6 A;  3T1Y M;  1YLA A;  3HX3 A;  1C7Y A;  3AOE A;  5EP2 A;  1HQY E;  1SXJ B;  4R3D A;  1K3X A;  4LJ9 A;  1DV0 A;  2FNA A;  2JP7 A;  1AUA A;  4MGZ E;  1VG5 A;  1P3Q Q;  3J2P B;  3LMM A;  3QYB A;  5KO3 A;  3E4R A;  2LH0 A;  3FTC A;  3J7A S;  1QAQ A;  5DNY A;  1PRB A;  2DZO B;  3CTW B;  4D80 A;  1Q3C A;  4IBE A;  4CHT B;  4AI6 A;  1TH3 A;  4LJ5 A;  2RGH A;  2DXI A;  2CFO A;  3Q8X A;  1SXJ C;  3SYK A;  1IN6 A;  3D8L A;  3I51 A;  1T6O A;  1QZE A;  3CF0 A;  4WW0 A;  3FUT A;  2JZ1 A;  4MGI E;  3W0F A;  2L2D A;  3DFZ A;  3K8Z A;  4BLC A;  2EO2 A;  2KZU A;  4AG5 A;  1VEJ A;  5ITX A;  3B7N A;  4DR2 M;  3JR4 A;  4QHS A;  3I01 M;  3DZD A;  4GHA A;  1T43 A;  4MGH A;  4NRV A;  1OQY A;  5KQD A;  2O25 A;  1GVN A;  3SBJ A;  2QCU A;  1NNJ A;  2O01 F;  3KOX E;  5H37 D;  4K0K M;  3KSX A;  3FD9 A;  1A5T A;  3M7G A;  2Z4R A;  1V33 A;  5EQT A;  4JI2 M;  4X64 M;  2DAM A;  5LMU M;  4RKU F;  3C9P A;  2D7H A;  1KYI A;  1TR8 A;  4M9Z A;  3OTO M;  3E46 A;  4LG2 A;  3FTD A;  3LW5 F;  3SFZ A;  5KPZ A;  1KFV A;  4L8R C;  1J7K A;  3K92 A;  1DGF A;  3L26 A;  2JWS A;  4I8O A;  2DHY A;  1K82 A;  3K1J A;  2J5Y A;  2JY6 B;  2KXE A;  1IM2 A;  1IN7 A;  2C9C A;  5EXS A;  1GJT A;  4EIW A;  1ORY B;  4LZJ A;  3GLF A;  1IN5 A;  1Z5B A;  2L7I A;  4AG6 A;  1Q39 A;  4RF1 A;  2BNK A;  1NO1 A;  3GLG E;  3PXG A;  1DGH A;  2JUJ A;  4FWD A;  4X65 M;  4DUZ M;  3SAV A;  2BJV A;  2DZL A;  1NHW C;  2Y0T A;  5ITR A;  1H6U A;  1K3W A;  5EP1 A;  2FOI C;  1N32 M;  1XXH B;  4GKJ M;  5IZ7 D;  4B3S M;  3U6C A;  1SXJ E;  2XFT A;  3DOA A;  4Z6Y A;  4GHL A;  2LVQ D;  1PJQ A;  4HEO A;  4MH0 E;  2VQF M;  4LF4 M;  1JR3 A;  3T38 A;  3H4M A;  1OTR A;  1JR3 D;  4FWH A;  3AL0 C;  2ZTD A;  1Z59 A;  2EKK A;  1IY2 A;  3I4V A;  4X62 M;  1J5E M;  3TL4 X;  4OU7 A;  2DVW B;  2ZAN A;  1QUT A;  3VKH A;  2KRK A;  1QYR A;  2H5X A;  4IBJ A;  2UUC M;  1QDT A;  5LMN M;  2RGO A;  1WGL A;  4Q7J A;  1DGG A;  4QHT A;  3LVW A;  3VDU A;  1WJ7 A;  2ZM6 M;  1EFU B;  2Y20 A;  4YHH M;  1NV8 A;  4CIZ A;  3SMP A;  3GLF B;  3W67 A;  1HQC A;  1N34 M;  2KA6 B;  2J7N A;  1HT2 E;  2G8L A;  2HAK A;  3GLI A;  4G4R A;  4JI6 M;  1DGH B;  3GPX A;  3IG8 A;  1XWI A;  1R5L A;  4L15 A;  4B7H A;  1IBL M;  1Q3B A;  2I7P A;  3GPU A;  3B9P A;  4LFB M;  3AOG A;  2LVN C;  3WHK A;  3LQQ A;  3FRI A;  4LJ4 A;  4IBI A;  4LJ8 A;  3UZU A;  1HNW M;  2O5R A;  3IEC A;  5ITY A;  3NBX X;  3C58 A;  1WIV A;  4BBA A;  3HU3 A;  1IN4 A;  1L8Q A;  4R71 A;  4G4N A;  1W5S A;  1JB0 F;  1Z5A A;  2KW0 A;  1QZM A;  4GEW A;  2A5Y B;  2R4J A;  1FJG M;  2R18 A;  3FKE A;  3GRY A;  2CV2 A;  2YNM D;  3HWS A;  1X37 A;  1VEK A;  3EIE A;  3U6E A;  2C5R A;  4CIS A;  2EUC A;  3KW6 A;  3KDS E;  5DYG A;  2KNA A;  3H4J A;  4LRS A;  4DR4 M;  1NY6 A;  4IBD A;  4LFA M;  2BWE A;  4REZ A;  5FSW A;  1BVS A;  1OFI A;  1OIP A;  4G6Z A;  5ITX E;  2F4V M;  4FW9 A;  5IWA M;  1MX0 A;  3VKG A;  2R46 A;  2MGW A;  3RFW A;  3GLI B;  4HLQ A;  4IJF A;  4B3T M;  3FUU A;  5DFL A;  4LCB A;  5C1B A;  4KHP M;  1S3S A;  2DWN A;  3KSJ A;  4UN2 B;  2Q2E B;  4PDI A;  2DWZ B;  5E26 A;  2CV0 A;  3DA1 A;  3FYD A;  3V76 A;  2DZN B;  5EXT A;  1EIJ A;  4PCZ A;  2UXD M;  4I4L A;  4NC6 A;  4JI7 M;  2OPF A;  3GPY A;  3R9X B;  3RGS A;  1CUK A;  4QNR A;  2ZAO A;  4FCT A;  2F5Q A;  2DHR A;  4YY3 M;  3HZJ A;  3A42 A;  1L2C A;  2VDB B;  2E5L M;  1XB2 B;  1EE8 A;  5JI2 E;  3J27 B;  3QWL A;  1NVM A;  2QHO B;  1E32 A;  2WSE F;  3ZCB B;  2UU9 M;  1NNU C;  3IG5 A;  3BBZ A;  1F4I A;  1XXH A;  1Y8G A;  1GL6 A;  3D8B A;  3MK6 A;  3GLF E;  1PJI A;  4NL4 H;  3PNY A;  3MMP A;  2B3T A;  2R0I A;  3M0E A;  4DBG B;  2HCB A;  4DV6 M;  4AQY M;  1PGY A;  3LCV B;  3BXW A;  1Q02 A;  3L28 A;  4B7F A;  1XMQ M;  4LGY A;  1IQP A;  3R8F A;  1E94 E;  1NJF A;  2CHQ A;  2HHH M;  2HKJ A;  5EXP A;  2LXE A;  3E21 A;  1PJS A;  3GQ4 A;  1HNX M;  1N77 A;  1JR3 E;  2LVA A;  3RGP A;  2MR9 A;  4GIT A;  2Z3X A;  3HHW A;  4ITQ A;  1QQW A;  3CF2 A;  3I4Y A;  3SC3 A;  5JI3 E;  4G4O A;  2X49 A;  1NSF A;  2F5O A;  3UK6 A;  1WGN A;  4D82 A;  2L4E A;  3U61 A;  4AKI A;  3U60 B;  4PD2 A;  3GLH A;  4NXN M;  3C3D A;  1UFZ A;  3B74 A;  4G3O A;  4JI1 M;  4JN6 A;  5KPR A;  3HGI A;  4OVZ B;  3GRR A;  2FE8 A;  3SAT A;  4RNA A;  1WXQ A;  4S12 A;  4AW4 A;  2DAK A;  4LJ7 A;  2QEN A;  3U6O A;  1GKI A;  3WHL A;  2QQ8 A;  3AFH A;  5EXX A;  1N36 M;  4B08 A;  1N33 M;  4F2L A;  2CHG A;  4RF0 A;  4KO8 A;  2BJW A;  1PJT A;  1MU5 A;  3SHF A;  3ZC7 B;  2QP9 X;  4OX9 M;  2XGN A;  4XBO A;  1L2D A;  3LCU A;  3PNV A;  3A46 A;  4LJA A;  4G4Q A;  3U5Z A;  4B3R M;  4P17 A;  2DNA A;  4IJE A;  3QAU A;  2CHV A;  1IXZ A;  2V6Z M;  2LVO C;  1KSF X;  1N75 A;  2FS1 A;  2LHG A;  2CWB A;  2R65 A;  4QNM A;  4PDG A;  4DV4 M;  2K9D A;  2H1R A;  1TH2 A;  3U61 B;  4NXM M;  4DR7 M;  2XZU A;  2GQF A;  4OW0 A;  3L25 A;  3KP1 E;  4LRT A;  2DKL A;  3GLH B;  1NV9 A;  3L27 A;  3L29 A;  2VII A;  4IBK A;  3RE8 A;  3FTF A;  4NRW A;  4W5W A;  3K2L A;  4JI0 M;  4AZF A;  1TTE A;  4DUY M;  3J80 S;  3U6L A;  2XF3 A;  1D0L A;  1ZMW A;  2DI0 A;  1QUS A;  3A45 A;  1RU3 A;  4I81 A;  2M60 A;  5A2Q S;  4FD2 A;  2DWL A;  1G8P A;  4JI4 M;  1T3T A;  2XFS A;  5IRE B;  4LF5 M;  2X8A A;  4L4U A;  2R44 A;  2KRU A;  4MM3 B;  5FTK A;  2JY5 A;  1PM5 A;  3EIH A;  1V34 A;  2DAG A;  1NHG C;  4KOD A;  1G4A E;  2K6B A;  4LF7 M;  3VK7 A;  4DV1 M;  4DR6 M;  2EKF A;  3GQ5 A;  2QPA A;  2KDL A;  2RKO A;  2YR0 A;  4XK8 F;  3I04 M;  1D2N A;  4BB9 A;  2QBY A;  2WZJ A;  3HJS A;  2JXN A;  4ZPX A;  4P16 A;  2QSF X;  1FNN A;  3K9P A;  1IY0 A;  4A3V B;  3THG A;  1L2B A;  4MGY E;  2K0B X;  3U5Z B;  4QOZ C;  4DV5 M;  2XSZ A;  1NY5 A;  2QZ4 A;  3SAW A;  3GRV A;  2YQZ A;  2CP8 A;  2LHC A;  3TWL A;  3VK8 A;  2XSZ D;  2AHM A;  2KNZ A;  3KFU G;  1E9S A;  4LF6 M;  2OQ4 A;  2LTU A;  4DV0 M;  1VDL A;  5KPT A;  1QDR A;  1TDZ A;  2R6F A;  4MB7 A;  2LWX A;  1XXH E;  1IFY A;  1AIP C;  7CAT A;  3Q8G A;  1E9R A;  1IY1 A;  2MH8 A;  3E9S A;  1GLN A;  2XZF A;  4DV7 M;  2RRU A;  3NBI A;  1D0K A;  3BOS A;  3U6P A;  2R45 A;  4DR3 M;  2CUZ A;  2XEP A;  2DAE A;  5GKN A;  2KEB A;  2V1C A;  4WP2 A;  1OFH A;  2Z4S A;  1HNZ M;  1GAB A;  1QAN A;  1G59 A;  1HR0 M;  3U60 A;  3AKZ A;  1WR1 B;  3SHG B;  1HT1 E;  3HHX A;  5F3W A;  1C1K A;  1ZAE A;  3SMS A;  4IBF A;  2QBY B;  4TUW A;  3F92 A;  1Z6T A;  4LY6 A;  2F5N A;  1OIZ A;  4LJ6 A;  1ZMU A;  5FTN A;  5FTL A;  2WSF F;  1YSY A;  4OVZ A;  1SG9 A;  3GPP A;  3KS8 A;  1VQ1 A;  4Y28 F;  2ZBK B;  4KT0 F;  4GH9 A;  2Z8Y M;  4M9S A;  3GLH E;  4L78 A;  2Y0Q A;  3AJI B;  3KOW E;  5E6J A;  2WSC F;  4D81 A;  2KNV A;  4XGI A;  5DYI A;  2Y21 A;  3W68 A;  1GL7 A;  4JI8 M;  4PT5 A;  3GP1 A;  1ZMV A; 
#chains in the Genus database with same CATH homology
 3M6A A;  2C99 A;  3VLF B;  1R6B X;  2G5G X;  2HL7 A;  4FVM A;  4GKK M;  1L1T A;  1XHB A;  3VDP A;  5IT9 S;  4II7 A;  1G3I A;  4JV5 M;  4DR1 M;  3W0L B;  5EJC A;  5ITT A;  4LF8 M;  1R7R A;  2YFQ A;  3HU2 A;  1QAM A;  1TH4 A;  3FUX A;  3U6S A;  3HJQ A;  3KXE C;  2ZAM A;  4FCW A;  3T1H M;  4GC5 A;  1ZQ9 A;  3TWM A;  3KVW A;  4LF9 M;  2XH9 A;  1JQJ C;  4LGM A;  3GRU A;  2KZS A;  5EP3 A;  2EA0 A;  4IBG A;  4AKG A;  1UM8 A;  2UUA M;  1NJG A;  3FYC A;  3PFI A;  1TDH A;  1XC8 A;  3T15 A;  2LNH C;  2C96 A;  3AOE C;  4LFC M;  4MGK E;  2C98 A;  3UMM A;  2R62 A;  4NOO B;  3SAR A;  1QAO A;  1LV7 A;  4HL4 A;  4WUR A;  3JAM S;  3U6Q A;  1XMO M;  4B3M M;  1R2Y A;  3HKP A;  3LVV A;  4FWG A;  3HU1 A;  3PVS A;  4M9X A;  1IXR C;  3J81 S;  1QVR A;  2XLJ A;  2F5P A;  1W5T A;  1IN8 A;  4B7G A;  1DO2 A;  1DGB A;  5KQ8 A;  2D7G A;  3TWK A;  2UXC M;  1IBK M;  3A98 B;  3JR5 A;  2C9O A;  2ERC A;  4Z8X A;  2CE7 A;  4I5S A;  4LZZ A;  1I94 M;  3SYL A;  3GQ3 A;  2CV1 A;  3KOY E;  5ITQ A;  3J7B A;  2DXI A;  4JYA M;  2L7H A;  2K47 A;  4R7G A;  1I4W A;  1PJJ A;  2UUB M;  1OJL A;  3NWL A;  2VQE M;  4GRI A;  2W82 A;  1DO0 A;  3SAU A;  1N78 A;  4NSR A;  2L09 A;  3GLG A;  1TGU A;  3AV0 A;  3KP0 E;  3HHZ A;  4DR5 M;  2FFJ A;  3FUW A;  3KOZ E;  3MJ5 A;  2D7E A;  4DV2 M;  2UXB M;  3HJ8 A;  4L16 A;  3HHY A;  1SXJ A;  2Z7J A;  2NQ8 C;  4FCV A;  3TPZ A;  3TQS A;  5BPV A;  1L1Z A;  4QOS A;  4IBB A;  2J7O A;  1Z5C A;  1SXJ D;  3LQR A;  2R4E A;  4GIP A;  3VFD A;  4GMQ A;  4IIW A;  5BR8 M;  1IBM M;  2DWM A;  5C18 A;  8CAT A;  3UJN A;  5FLX S;  5FTJ A;  1IXS B;  4IBC A;  4M0W A;  3U6D A;  2F5S A;  4M0D A;  1XNQ M;  4DV3 M;  3U6M A;  2CEA A;  5FTM A;  5ITU A;  3UGJ A;  1XNR M;  4JI3 M;  4CGY B;  2L6O A;  4AKH A;  3GO8 A;  3SAT A;  3ILK A;  1G41 A;  3L2A A;  3MHV C;  4JXJ A;  4NSO B;  2V1U A;  1R2Z A;  3SAS A;  2I7N A;  1J09 A;  3CF6 E;  2M5Z A;  4X66 M;  4JI5 M;  1VDD A;  3GLG B;  2P5T A;  2X4A A;  3FTE A;  1YE9 A;  3ZH9 B;  3KS4 A;  3FUV A;  2JA2 A;  4GC9 A;  4KLN A;  1YUB A;  5EP4 A;  3TE6 A;  3T1Y M;  3AOE A;  5EP2 A;  1HQY E;  1SXJ B;  4R3D A;  1K3X A;  4LJ9 A;  2FNA A;  4MGZ E;  3J2P B;  3LMM A;  5KO3 A;  3E4R A;  2LH0 A;  3FTC A;  3J7A S;  1QAQ A;  5DNY A;  2DZO B;  3CTW B;  4D80 A;  1Q3C A;  4IBE A;  4CHT B;  4AI6 A;  1TH3 A;  4LJ5 A;  2RGH A;  2CFO A;  3Q8X A;  1SXJ C;  3SYK A;  1IN6 A;  3D8L A;  3I51 A;  3CF0 A;  4WW0 A;  3FUT A;  3W0F A;  4MGI E;  3DFZ A;  3K8Z A;  4BLC A;  2EO2 A;  2KZU A;  4AG5 A;  5ITX A;  4DR2 M;  3JR4 A;  4QHS A;  3DZD A;  4GHA A;  4MGH A;  4NRV A;  5KQD A;  1GVN A;  3SBJ A;  2QCU A;  1NNJ A;  3KOX E;  5H37 D;  4K0K M;  3KSX A;  3FD9 A;  3M7G A;  2Z4R A;  5EQT A;  4JI2 M;  4X64 M;  5LMU M;  2D7H A;  1KYI A;  4M9Z A;  3OTO M;  4LG2 A;  3FTD A;  3SFZ A;  5KPZ A;  4L8R C;  1KFV A;  1J7K A;  3K92 A;  1DGF A;  3L26 A;  4I8O A;  1K82 A;  3K1J A;  2KXE A;  1IN7 A;  1IM2 A;  2C9C A;  5EXS A;  4EIW A;  1ORY B;  4LZJ A;  3GLF A;  1IN5 A;  1Z5B A;  2L7I A;  4AG6 A;  1Q39 A;  4RF1 A;  2BNK A;  3PXG A;  1DGH A;  4X65 M;  4FWD A;  4DUZ M;  3SAV A;  2BJV A;  1NHW C;  2Y0T A;  5ITR A;  1H6U A;  1K3W A;  5EP1 A;  2FOI C;  1N32 M;  1XXH B;  4GKJ M;  5IZ7 D;  4B3S M;  3U6C A;  1SXJ E;  2XFT A;  3DOA A;  4Z6Y A;  4GHL A;  4MH0 E;  4LF4 M;  2VQF M;  1JR3 A;  3T38 A;  3H4M A;  1JR3 D;  4FWH A;  3AL0 C;  1Z59 A;  3I4V A;  1IY2 A;  4X62 M;  1J5E M;  3TL4 X;  4OU7 A;  2DVW B;  2ZAN A;  3VKH A;  2KRK A;  1QYR A;  4IBJ A;  2UUC M;  5LMN M;  2RGO A;  1DGG A;  4QHT A;  3LVW A;  3VDU A;  2ZM6 M;  2Y20 A;  4YHH M;  3SMP A;  3GLF B;  1HQC A;  1N34 M;  2KA6 B;  2J7N A;  1HT2 E;  2G8L A;  3GLI A;  4G4R A;  4JI6 M;  1DGH B;  3GPX A;  3IG8 A;  1XWI A;  4L15 A;  4B7H A;  1IBL M;  1Q3B A;  2I7P A;  3GPU A;  3B9P A;  4LFB M;  3AOG A;  3WHK A;  3LQQ A;  4LJ4 A;  4IBI A;  4LJ8 A;  3UZU A;  1HNW M;  2O5R A;  5ITY A;  3C58 A;  4BBA A;  3HU3 A;  1IN4 A;  1L8Q A;  4G4N A;  1W5S A;  1Z5A A;  2KW0 A;  1QZM A;  2A5Y B;  2R4J A;  1FJG M;  2R18 A;  3FKE A;  3GRY A;  2CV2 A;  2YNM D;  3HWS A;  1X37 A;  3EIE A;  3U6E A;  2C5R A;  4CIS A;  2EUC A;  3KW6 A;  3KDS E;  5DYG A;  4LRS A;  4DR4 M;  1NY6 A;  4IBD A;  4LFA M;  4REZ A;  5FSW A;  1OFI A;  5ITX E;  2F4V M;  4G6Z A;  4FW9 A;  5IWA M;  1MX0 A;  3VKG A;  2R46 A;  3RFW A;  3GLI B;  4HLQ A;  4IJF A;  4B3T M;  3FUU A;  4LCB A;  5C1B A;  4KHP M;  1S3S A;  2DWN A;  3KSJ A;  2Q2E B;  4PDI A;  2DWZ B;  5E26 A;  2CV0 A;  3DA1 A;  3FYD A;  2DZN B;  5EXT A;  4PCZ A;  2UXD M;  4I4L A;  4JI7 M;  2OPF A;  3GPY A;  3R9X B;  3RGS A;  4QNR A;  2ZAO A;  4FCT A;  2F5Q A;  2DHR A;  4YY3 M;  3A42 A;  1L2C A;  2E5L M;  1EE8 A;  5JI2 E;  3J27 B;  3QWL A;  1NVM A;  3ZCB B;  1E32 A;  2UU9 M;  1NNU C;  3IG5 A;  1XXH A;  1GL6 A;  3D8B A;  3MK6 A;  1PJI A;  4NL4 H;  3PNY A;  3M0E A;  2HCB A;  4DV6 M;  4AQY M;  4B7F A;  3L28 A;  1XMQ M;  4LGY A;  1IQP A;  3R8F A;  1E94 E;  1NJF A;  2CHQ A;  2HHH M;  2HKJ A;  5EXP A;  2LXE A;  3GQ4 A;  1HNX M;  1N77 A;  3RGP A;  4GIT A;  2Z3X A;  3HHW A;  4ITQ A;  1QQW A;  3CF2 A;  3I4Y A;  3SC3 A;  5JI3 E;  4G4O A;  2X49 A;  1NSF A;  2F5O A;  3UK6 A;  4D82 A;  3U61 A;  4AKI A;  3U60 B;  4PD2 A;  3GLH A;  4NXN M;  4JI1 M;  4JN6 A;  5KPR A;  3HGI A;  4OVZ B;  3GRR A;  2FE8 A;  4RNA A;  1WXQ A;  4S12 A;  4AW4 A;  4LJ7 A;  2QEN A;  3U6O A;  1GKI A;  3WHL A;  3AFH A;  5EXX A;  1N36 M;  4B08 A;  1N33 M;  2CHG A;  4RF0 A;  4KO8 A;  2BJW A;  1MU5 A;  3SHF A;  3ZC7 B;  2QP9 X;  4OX9 M;  2XGN A;  4XBO A;  1L2D A;  3PNV A;  3A46 A;  4LJA A;  4G4Q A;  3U5Z A;  4B3R M;  4IJE A;  3QAU A;  2CHV A;  1IXZ A;  2V6Z M;  4QNM A;  1KSF X;  1N75 A;  2R65 A;  4PDG A;  4DV4 M;  4DR7 M;  4NXM M;  3U61 B;  2H1R A;  1TH2 A;  2XZU A;  4OW0 A;  3L25 A;  3KP1 E;  4LRT A;  3GLH B;  3L27 A;  3L29 A;  2VII A;  4IBK A;  3RE8 A;  3FTF A;  4NRW A;  4W5W A;  3K2L A;  4JI0 M;  4AZF A;  4DUY M;  3J80 S;  3U6L A;  2XF3 A;  3A45 A;  4I81 A;  2M60 A;  5A2Q S;  4FD2 A;  2DWL A;  1G8P A;  4JI4 M;  1T3T A;  2XFS A;  5IRE B;  4LF5 M;  2X8A A;  4L4U A;  4MM3 B;  2KRU A;  5FTK A;  1PM5 A;  3EIH A;  4KOD A;  4LF7 M;  1NHG C;  1G4A E;  3VK7 A;  4DV1 M;  4DR6 M;  3GQ5 A;  2QPA A;  2RKO A;  2YR0 A;  1D2N A;  4BB9 A;  2QBY A;  4ZPX A;  3HJS A;  4P16 A;  1FNN A;  4A3V B;  1IY0 A;  3THG A;  1L2B A;  4MGY E;  3U5Z B;  4QOZ C;  4DV5 M;  2XSZ A;  1NY5 A;  2QZ4 A;  3SAW A;  3GRV A;  2YQZ A;  3TWL A;  3VK8 A;  2XSZ D;  2AHM A;  3KFU G;  1E9S A;  4LF6 M;  2OQ4 A;  1TDZ A;  4DV0 M;  5KPT A;  4MB7 A;  2LWX A;  7CAT A;  1E9R A;  1IY1 A;  3E9S A;  1GLN A;  2XZF A;  4DV7 M;  3NBI A;  3BOS A;  3U6P A;  2R45 A;  4DR3 M;  2CUZ A;  2XEP A;  5GKN A;  2KEB A;  2V1C A;  1OFH A;  2Z4S A;  1HNZ M;  1QAN A;  1G59 A;  1HR0 M;  3U60 A;  3AKZ A;  3SHG B;  1HT1 E;  3HHX A;  5F3W A;  1C1K A;  1ZAE A;  3SMS A;  4IBF A;  2QBY B;  4TUW A;  1Z6T A;  4LY6 A;  2F5N A;  4LJ6 A;  5FTN A;  5FTL A;  1YSY A;  4OVZ A;  3GPP A;  3KS8 A;  2ZBK B;  4GH9 A;  4M9S A;  4L78 A;  2Y0Q A;  3AJI B;  3KOW E;  5E6J A;  4D81 A;  4XGI A;  5DYI A;  2Y21 A;  1GL7 A;  4JI8 M;  4PT5 A;  3GP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...