2FOIC

Synthesis, biological activity, and x-ray crystal structural analysis of diaryl ether inhibitors of malarial enoyl acp reductase.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
60
structure length
60
Chain Sequence
YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords enoyl-acyl carrier reductase
publication title X-ray Structural Analysis of Plasmodium falciparum Enoyl Acyl Carrier Protein Reductase as a Pathway toward the Optimization of Triclosan Antimalarial Efficacy.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 16
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2006-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2foiC00
2NQ8C 1NNUC 2FOIC 1NHWC 1NHGC
chains in the Genus database with same CATH superfamily
1TF0B 1VEJA 2VF8A 2XF3A 3EIEA 2CUZA 2LHCA 5KQ8A 2C5RA 2DZOB 3B89A 4LFAM 4LG2A 4S12A 3J27B 2E5LM 2FFJA 2KNAA 3UJNA 3UZUA 4ITQA 3SATA 3IG8A 3K8ZA 1EIJA 3HKPA 3Q8XA 5KPRA 5EXSA 4LRTA 4R3DA 5EQTA 2XFTA 4AG5A 2J7OA 1GJTA 3FRHA 4RF1A 2KHHA 1ZQ9A 3B7NA 2ZM6M 2UXBM 3VKGA 4W5WA 4GMQA 3U6MA 4FCWA 1VEKA 3GPYA 1IN7A 2VQFM 1IBKM 1JQJC 2CWBA 1SG9A 4DV0M 1K82A 4JV5M 3FD9A 4NXNM 3MK6A 3NWLA 5EXPA 2D7GA 3AV0A 1KYIA 1HJPA 2M5ZA 3SARA 1NHWC 2J7NA 3CGWA 5EXXA 2CP8A 1FJGM 5E26A 1IBMM 3FTDA 2CV0A 3AOGA 1UM8A 1QUSA 2KXEA 4PD2A 3UMMA 3T1YM 5ITRA 2DAGA 3GLIB 3U6SA 1I94M 3TWLA 3R9XB 3TWKA 1DGHB 1E94E 2RRUA 4QHSA 4IBEA 1EFUB 2O25A 2L7HA 4CIZA 3SASA 1JB0F 3KFUG 2K9DA 2ZTDA 3GLHA 4AG6A 1NSFA 2Q2EB 1MX0A 4QNMA 2XSZA 1Y8GA 2Z7JA 3B7ZA 3HU3A 1ZMWA 3U6DA 3TQSA 2V1UA 2XEPA 2LH0A 1GJSA 1E9SA 1L2DA 2F5OA 4LFCM 3OTOM 3VK8A 4FCTA 4LF9M 3GLFA 4G4NA 2UXDM 4LF4M 1EE8A 2KNVA 1Q3BA 2DZNB 3FUXA 1XXHA 2P5TA 3RE8A 2D7EA 2CRUA 1GL6A 5H37D 4PT5A 3I4YA 3KDSE 3DFZA 1OKSA 1T6OA 3KXEC 1GO5A 3U6LA 4AKGA 3GQ5A 3D8LA 4L78A 1VEGA 2G3QA 3GLGA 3U60A 1GABA 2V1CA 4BLCA 2QCUA 4DR4M 4TUWA 4MB7A 2UUAM 2XFSA 3KP1E 4KO8A 2FNAA 2BNKA 1XWIA 2L4FA 7CATA 2H5XA 3TPZA 3GRRA 2C9CA 4AZFA 4X62M 4AKIA 2X4AA 4WURA 1PRBA 5IT9S 2F5PA 4JI6M 2DWZB 1K3XA 1X37A 3D8BA 4GC9A 2EKFA 4GEWA 2XSZD 3HX3A 2JY7A 4GHLA 3HY5A 2OQ4A 2DWLA 1ZV1A 1NJGA 1WJ7A 1NY6A 1G3IA 3VK7A 2RKOA 4IBKA 1E9RA 1IN4A 2Y20A 3E46A 3HHYA 3SAVA 2F5QA 4YY3M 3FYDA 3IHPA 2GQFA 5ITXA 2MR9A 4KT0F 3VDUA 4PDIA 1TDZA 1G41A 3SBJA 4HLQA 2Y0QA 5FLXS 3TWMA 1N34M 1SXJA 4B3SM 1IY1A 1Z6TA 4QNRA 3U61A 3EIHA 5ITQA 4GKJM 1IXSA 4QOZC 1DV0A 1OIPA 4UN2B 1YLAA 3L25A 3FTEA 2CE7A 4DV7M 2ZAMA 3FKEA 1Z5CA 2DZLA 1QZEA 2HCBA 4NOOB 3THGA 1G59A 3HHWA 4XGIA 3H4MA 3NBXX 2Y0TA 1N32M 3KOZE 4FWHA 4IJEA 3ZQJA 4R71A 3VKHA 1TH4A 2F4VM 3I4VA 2HWJA 1G8PA 2BJVA 3AOEA 2MJ5B 4FW9A 2QBYA 4WW0A 3FTFA 4II7A 1OJLA 3U6QA 2R45A 1NV9A 1L1ZA 5KPTA 1E32A 1PGYA 1QDRA 1RU3A 1KSFX 1QZMA 2OOAA 4PCZA 1JR3E 4KLNA 2WSCF 1WXQA 5KQDA 4OX9M 3KSXA 1DO0A 2JXNA 1HT1E 2QENA 2QZ4A 4OVZB 3I04M 3A46A 3LCUA 5IZ7D 2JY8A 4JXJA 3J80S 2KDLA 5FTJA 2UU9M 4NXMM 4GRIA 3WHKA 4MGZE 3T6PA 4X65M 3GLGE 4FWDA 1SXJD 3ZH9B 1W5SA 4EIWA 1OIZA 5KPZA 1R2YA 1XHBA 1J7KA 3W0FA 2AHMA 3JR4A 4DR2M 4CISA 2GNOA 1AUAA 3LCVB 4D80A 2VQEM 3FYCA 3SMSA 3GLGB 5ITYA 4BBAA 4DUZM 3W68A 1TH3A 3PFIA 4OW0A 1QAOA 2UUBM 3K9PA 2C96A 1FNNA 2LVNC 4ZPXA 2C98A 2QPAA 2RGOA 4L15A 4AW4A 4LZJA 1IY2A 5GKNA 2FOIC 5C1BA 2DHRA 4REZA 2X8AA 2X49A 1OAIA 1HNZM 1Q02A 5KO3A 2HHHM 4GIPA 1QANA 4A3VB 2JNHA 1ZMVA 2ZANA 3KW6A 2R46A 3DZDA 3FTCA 3L27A 3B9PA 4KHPM 2BWEA 1QAQA 2XH9A 3ZC7B 1SXJC 2LTUA 3KOXE 3KOYE 4FVMA 3KSJA 1WHCA 1R7RA 4L4UA 4DBGB 3IECA 3I51A 1GLNA 2W82A 5DYGA 3MJ5A 4NSOB 2N35A 2Z4RA 3ILKA 3U5ZA 1MU5A 2XZUA 2L7IA 3FRIA 4LJAA 2JP7A 1OQYA 4Z6YA 2R0IA 2L6OA 2K0BX 4B3TM 1IN6A 1Z5BA 4JI1M 2HAKA 2M60A 2EO2A 4B3RM 3AOEC 3CF0A 4LFBM 1R6BX 4XK8F 2O5RA 2ZAOA 3LQQA 3HZJA 5FTKA 4I5SA 2LVAA 1N33M 1L8QA 4G4QA 3HGIA 4RKUF 3L2AA 1XB2B 1WGNA 2VF7A 1IM2A 1TR8A 4P17A 5A2QS 3GPPA 2YNMD 3MHVC 1DGGA 2J5YA 3K2LA 2JWSA 3HJ8A 1ZAEA 4CHTB 3GO8A 4DV2M 4DV4M 3SMPA 4WP2A 4JI2M 3HJQA 5EXTA 2QP9X 2MROB 4K0KM 2DAIA 2FS1A 4M0DA 1DGBA 1N77A 1PJTA 3BBZA 2Z3XA 4IBGA 1VG5A 4NSRA 2OPFA 4MGKE 2MH8A 2C9OA 3CF2A 4KODA 1R5LA 2WZJA 4DV1M 1T3TA 2XZFA 3JAMS 2UXCM 5L8RF 3GRUA 4HL4A 2JZ1A 2L2DA 4LJ7A 4LCBA 5LMUM 1NNJA 2KA6B 3J2PB 2VDBB 2Z4SA 3FUUA 5ITTA 2RGHA 2ZBKB 1VDLA 5EP3A 2DXIA 4B3MM 1QQWA 2DVWB 4GH9A 3SC3A 1OFIA 1TDHA 2ZTCA 2F5SA 1D0MA 4DR1M 5JI3E 4PDGA 1IQPA 4RF0A 3BXWA 4JI5M 3RGSA 4ANRA 5FTNA 3RFWA 1W5TA 3K92A 1QYRA 3LQRA 5C18A 1J09A 4IJFA 3IG5A 1HQCA 3UGJA 1PM5A 3FUWA 1PJJA 1L2CA 4IBBA 3SFZA 1IXRC 1OAOC 2JY6B 3AJIB 4YHHM 3HHZA 4B7FA 3A42A 1YSYA 2R4JA 4Z8XA 3VDPA 5FTLA 4LJ5A 3TL4X 2OOBA 4M0WA 1V33A 2LHGA 2F5NA 4CJ6A 3I01M 5E6JA 4MH0E 3SYLA 3ZCBB 3GLIA 1DGHA 2HL7A 4Q7JA 1YE9A 4X66M 3GLHE 2JZ0A 3KVWA 1JR3D 4NRWA 1WIVA 2JA2A 3E21A 1HR0M 2DKLA 3QYBA 3J7AS 3B74A 3SAUA 3M7GA 2ERCA 3NBIA 4QHTA 1GKIA 5ITUA 3GLHB 2JY5A 2R4EA 1NO1A 4CGYB 3GLFE 2CHQA 1XXHE 1NV8A 5FSWA 1PJSA 1IN8A 1C1KA 4L6V6 3GLFB 1DO2A 1Q39A 1XNQM 1H6UA 2R62A 1XXHB 1T43A 4IIWA 4LZZA 4I81A 1TH2A 2DHYA 3SAWA 2O01F 4LRSA 3T1HM 3AFHA 4IBDA 2DNAA 3QYEA 4G3OA 2R18A 3U60B 1D0LA 3HU2A 4P16A 2YFQA 1ORYB 1V34A 3SHFA 2LVOC 3U6CA 2KEBA 2QHOB 1N36M 1PJIA 4HEOA 3F92A 3DOAA 2C99A 3LMMA 2I7PA 1KFVA 2DWMA 3Q8GA 2D7HA 4LY6A 4JI3M 1D0KA 2EJSA 3U6EA 1S3SA 4RNAA 5BPVA 1QDTA 5IWAM 3RGPA 5ITXE 3T15A 3VFDA 4IBCA 4DR6M 1DGFA 2OO9A 1NHGC 3UK6A 3JR5A 1L2BA 2CV2A 1VDDA 3C3DA 3GQ3A 4G4RA 3U6OA 3K9OA 2KNZA 4QOSA 4B7HA 1SXJE 1IN5A 1G71A 3KS4A 2R6FA 4AQYM 1G4AE 3GPXA 4I8OA 3LW5F 4R7GA 4DV6M 2CEAA 1Z59A 3H4JA 3V76A 4FD2A 2CHGA 2CV1A 4JI7M 1IFYA 3KOWE 1WR1B 3M0EA 1L1TA 4GHAA 2KZSA 4OU7A 4AI6A 1SXJB 1TTEA 2LNHC 4MM3B 3B7QA 2LWXA 2G8LA 2Y21A 3GLIE 3U61B 1IBLM 4L8RC 1NY5A 1WGLA 2XGNA 1IXSB 4NL4H 3MMPA 8CATA 2Z8YM 2K47A 3W67A 2R44A 3CTWB 1QAMA 3FUVA 4JI4M 3GP1A 5DYIA 2KRUA 4JI0M 4DV3M 1R2ZA 2YR0A 2XLJA 1OFHA 3PXGA 1V92A 3SHGB 4LF8M 4LF6M 1QUTA 3L29A 4NRVA 4DUYM 4I4LA 2G5GX 4F1IA 2QBYB 2WSEF 1VQ1A 5FTMA 3SYKA 2EKKA 3A45A 4F2LA 3GRVA 4LJ9A 1CUKA 1MN3A 3CF6E 4LJ6A 2DAKA 1QVRA 3E9SA 4MGHA 4OVZA 3KS8A 4LF7M 1J5EM 2VIIA 4LJ4A 5JI2E 4L16A 4X64M 3GQ4A 2DAEA 4G6ZA 4NC6A 1JR3A 2UUCM 5EP2A 1LTMA 5IREB 2HKJA 1ZMUA 3KP0E 5DNYA 4JYAM 3LVWA 2K6BA 3C3EA 3PNVA 2QNJA 2KW0A 1PJQA 1F4IA 2EUCA 1C7YA 2R65A 3GRYA 1HT2E 2DWNA 4BB9A 4B08A 2B3TA 4XBOA 4FCVA 3DA1A 1K3WA 1D2NA 3LVVA 2DAMA 4AKHA 2CHVA 5LMNM 4GITA 3AL0C 1GVNA 2NQ8C 2BJWA 4M9ZA 2FE8A 4D81A 3J81S 3AKZA 2KZUA 4FWGA 3L26A 2FH0A 3K1JA 4IBFA 1YUBA 1AIPC 5EP4A 4M9XA 3U6PA 2EA0A 1HNXM 3GPUA 2V6ZM 4JN6A 3VLFB 3M6AA 3L28A 3PNYA 4B7GA 4GKKM 2BWBA 2I7NA 3C58A 1A5TA 4DR7M 2QQ8A 2A5YB 1P3QQ 2QSFX 3PVSA 2CFOA 3WHLA 2MGWA 1XC8A 3QWLA 3TE6A 4LGYA 1NNUC 2LVPC 1MJGM 1R4GA 1BVSA 4G4OA 3U5ZB 1Q3CA 1N78A 1HNWM 2KRKA 3HJSA 2L4EA 4Y28F 1LV7A 1Z5AA 1HQYE 3FUTA 4MGIE 3J7BA 4DV5M 4JI8M 5BR8M 1GL7A 4DR5M 5F3WA 3C9PA 1XNRM 3HHXA 3QAUA 1UFZA 4IBIA 4DR3M 1TGUA 5DFLA 2H1RA 1NVMA 1XMOM 3FE3A 3T38A 3R8FA 3E4RA 2DENA 5EP1A 1NJFA 1OTRA 2LBCA 2APLA 4LGMA 3A98B 4GC5A 2WSFF 4LJ8A 1XMQM 5EJCA 4MGYE 3HWSA 1IXZA 4IBJA 4D82A 1IY0A 4M9SA 2DI0A 2JUJA 3BOSA 2LVQD 2YQZA 3HU1A 1I4WA 4LF5M 2LXEA 3W0LB 1N75A 2L09A
chains in the Genus database with same CATH topology
2XF3A 3EIEA 2CUZA 5KQ8A 2C5RA 2DZOB 4LFAM 4LG2A 4S12A 3J27B 2E5LM 2FFJA 3UJNA 3UZUA 4ITQA 3SATA 3IG8A 3K8ZA 3HKPA 3Q8XA 5KPRA 5EXSA 4LRTA 4R3DA 5EQTA 2XFTA 4AG5A 2J7OA 2ZM6M 4RF1A 1ZQ9A 2UXBM 3VKGA 4W5WA 4GMQA 3U6MA 4FCWA 3GPYA 1IN7A 2VQFM 1IBKM 1JQJC 4DV0M 1K82A 3FD9A 4NXNM 3MK6A 3NWLA 5EXPA 2D7GA 3AV0A 1KYIA 3SARA 2M5ZA 1NHWC 2J7NA 5EXXA 1FJGM 5E26A 1IBMM 3FTDA 2CV0A 3AOGA 1UM8A 2KXEA 4PD2A 3UMMA 3T1YM 5ITRA 3GLIB 3U6SA 1I94M 3R9XB 3TWLA 3TWKA 1DGHB 1E94E 4QHSA 4IBEA 2L7HA 3SASA 3KFUG 4AG6A 3GLHA 1NSFA 2Q2EB 1MX0A 4QNMA 2XSZA 2Z7JA 3HU3A 3U6DA 3TQSA 2V1UA 2XEPA 2LH0A 1E9SA 1L2DA 2F5OA 4LFCM 3OTOM 3VK8A 4FCTA 4LF9M 3GLFA 4G4NA 2UXDM 4LF4M 1EE8A 1Q3BA 2DZNB 3FUXA 1XXHA 2P5TA 3RE8A 2D7EA 1GL6A 5H37D 4PT5A 3I4YA 3KDSE 3DFZA 3KXEC 3U6LA 4AKGA 3GQ5A 3D8LA 4L78A 3U60A 3GLGA 2V1CA 4BLCA 2QCUA 4DR4M 4TUWA 4MB7A 2UUAM 2XFSA 3KP1E 4KO8A 2FNAA 2BNKA 1XWIA 7CATA 3TPZA 3GRRA 2C9CA 4AZFA 4X62M 4AKIA 2X4AA 4WURA 5IT9S 2F5PA 4JI6M 2DWZB 1K3XA 1X37A 3D8BA 4GC9A 2XSZD 4GHLA 2OQ4A 2DWLA 1NJGA 1NY6A 1G3IA 3VK7A 2RKOA 4IBKA 1E9RA 1IN4A 2Y20A 3HHYA 3SAVA 2F5QA 4YY3M 3FYDA 5ITXA 3VDUA 4PDIA 1TDZA 1G41A 3SBJA 4HLQA 2Y0QA 5FLXS 3TWMA 1N34M 1SXJA 4B3SM 1IY1A 1Z6TA 4QNRA 3U61A 3EIHA 5ITQA 4GKJM 4QOZC 3L25A 3FTEA 2CE7A 4DV7M 2ZAMA 3FKEA 1Z5CA 4NOOB 2HCBA 3THGA 1G59A 3HHWA 4XGIA 3H4MA 2Y0TA 1N32M 3KOZE 4FWHA 4IJEA 3VKHA 1TH4A 2F4VM 3I4VA 1G8PA 2BJVA 3AOEA 4FW9A 2QBYA 4WW0A 3FTFA 4II7A 1OJLA 3U6QA 2R45A 1L1ZA 5KPTA 1E32A 1KSFX 1QZMA 4PCZA 4KLNA 1WXQA 5KQDA 4OX9M 3KSXA 1DO0A 4OVZB 1HT1E 2QENA 2QZ4A 3A46A 5IZ7D 4JXJA 3J80S 5FTJA 2UU9M 4NXMM 4GRIA 3WHKA 4MGZE 4X65M 4FWDA 1SXJD 3ZH9B 1W5SA 4EIWA 5KPZA 1R2YA 1XHBA 1J7KA 3W0FA 2AHMA 3JR4A 4DR2M 4CISA 4D80A 2VQEM 3FYCA 3SMSA 3GLGB 5ITYA 4BBAA 4DUZM 1TH3A 3PFIA 4OW0A 1QAOA 2UUBM 2C96A 1FNNA 4ZPXA 2C98A 2QPAA 2RGOA 4L15A 4AW4A 4LZJA 1IY2A 5GKNA 2FOIC 5C1BA 2DHRA 4REZA 2X8AA 2X49A 1HNZM 5KO3A 2HHHM 4GIPA 1QANA 4A3VB 2ZANA 3KW6A 2R46A 3DZDA 3FTCA 3L27A 3B9PA 4KHPM 1QAQA 2XH9A 3ZC7B 1SXJC 3KOXE 3KOYE 4FVMA 3KSJA 1R7RA 4L4UA 3I51A 1GLNA 2W82A 5DYGA 3MJ5A 4NSOB 2Z4RA 3ILKA 3U5ZA 1MU5A 2XZUA 2L7IA 4LJAA 4Z6YA 2L6OA 4B3TM 1IN6A 1Z5BA 4JI1M 2M60A 2EO2A 4B3RM 3AOEC 3CF0A 4LFBM 1R6BX 2O5RA 2ZAOA 3LQQA 5FTKA 4I5SA 1N33M 1L8QA 4G4QA 3HGIA 3L2AA 1IM2A 5A2QS 3GPPA 2YNMD 3MHVC 1DGGA 3K2LA 3HJ8A 1ZAEA 4CHTB 3GO8A 4DV2M 4DV4M 3SMPA 4JI2M 3HJQA 5EXTA 2QP9X 4K0KM 1N77A 4M0DA 1DGBA 4IBGA 4NSRA 2OPFA 4MGKE 3CF2A 2C9OA 4KODA 4DV1M 1T3TA 2XZFA 3JAMS 2UXCM 3GRUA 4HL4A 4LJ7A 1NNJA 4LCBA 5LMUM 2KA6B 3J2PB 2Z4SA 3FUUA 5ITTA 2RGHA 2ZBKB 5EP3A 4B3MM 2DXIA 1QQWA 2DVWB 4GH9A 3SC3A 1OFIA 1TDHA 2F5SA 4DR1M 5JI3E 4PDGA 1IQPA 4RF0A 4JI5M 3RGSA 5FTNA 3RFWA 1W5TA 3K92A 1QYRA 3LQRA 5C18A 1J09A 4IJFA 3IG5A 1HQCA 3UGJA 1PM5A 3FUWA 1PJJA 1L2CA 4IBBA 3SFZA 1IXRC 3AJIB 2Z3XA 4YHHM 3HHZA 4B7FA 3A42A 1YSYA 2R4JA 4Z8XA 3VDPA 5FTLA 4LJ5A 3TL4X 4M0WA 2F5NA 5E6JA 4MH0E 3SYLA 3ZCBB 3GLIA 1DGHA 2HL7A 1YE9A 4X66M 3KVWA 1JR3D 4NRWA 2JA2A 1HR0M 3J7AS 3SAUA 3M7GA 2ERCA 3NBIA 4QHTA 1GKIA 5ITUA 3GLHB 2R4EA 4CGYB 2CHQA 5FSWA 1IN8A 1C1KA 3GLFB 1DO2A 1Q39A 1XNQM 1H6UA 2R62A 1XXHB 4IIWA 4LZZA 4I81A 1TH2A 3SAWA 4LRSA 3T1HM 3AFHA 4IBDA 2R18A 3U60B 3HU2A 4P16A 2YFQA 1ORYB 3SHFA 3U6CA 2KEBA 1N36M 1PJIA 3DOAA 2C99A 3LMMA 2I7PA 1KFVA 2DWMA 2D7HA 4LY6A 4JI3M 3U6EA 1S3SA 4RNAA 5BPVA 5IWAM 3RGPA 5ITXE 3T15A 3VFDA 4IBCA 4DR6M 1DGFA 1L2BA 1NHGC 3UK6A 3JR5A 2CV2A 1VDDA 3GQ3A 4G4RA 3U6OA 4QOSA 4B7HA 1SXJE 1IN5A 3KS4A 4AQYM 1G4AE 3GPXA 4I8OA 4R7GA 4DV6M 2CEAA 1Z59A 2CV1A 4FD2A 2CHGA 4JI7M 3KOWE 3M0EA 1L1TA 4GHAA 2KZSA 4OU7A 4AI6A 1SXJB 2LNHC 4MM3B 2LWXA 2Y21A 2G8LA 3U61B 1IBLM 4L8RC 2XGNA 1NY5A 1IXSB 4NL4H 8CATA 2K47A 3CTWB 1QAMA 3FUVA 4JI4M 3GP1A 5DYIA 2KRUA 4JI0M 4DV3M 1R2ZA 2YR0A 2XLJA 1OFHA 3PXGA 3SHGB 4LF8M 4LF6M 3L29A 4NRVA 4DUYM 4I4LA 2G5GX 2QBYB 5FTMA 3SYKA 3A45A 3GRVA 4LJ9A 4LJ6A 3CF6E 1QVRA 3E9SA 4MGHA 4OVZA 3KS8A 4LF7M 1J5EM 2VIIA 4LJ4A 5JI2E 4L16A 4X64M 3GQ4A 4G6ZA 1JR3A 2UUCM 5EP2A 5IREB 2HKJA 5DNYA 3KP0E 4JYAM 3LVWA 3PNVA 2KW0A 2EUCA 2R65A 3GRYA 1HT2E 2DWNA 4BB9A 4B08A 4XBOA 4FCVA 3DA1A 1K3WA 1D2NA 3LVVA 4AKHA 2CHVA 5LMNM 4GITA 3AL0C 1GVNA 2NQ8C 2BJWA 4M9ZA 2FE8A 4D81A 3J81S 3AKZA 2KZUA 4FWGA 3L26A 4IBFA 3K1JA 1YUBA 5EP4A 4M9XA 3U6PA 2EA0A 1HNXM 3GPUA 2V6ZM 4JN6A 3VLFB 3M6AA 3L28A 3PNYA 4B7GA 4GKKM 2I7NA 3C58A 4DR7M 2A5YB 1XC8A 4JV5M 3PVSA 2CFOA 3WHLA 3QWLA 3TE6A 4LGYA 1NNUC 4G4OA 3U5ZB 1Q3CA 1N78A 1HNWM 2KRKA 3HJSA 1LV7A 1Z5AA 1HQYE 3FUTA 4MGIE 3J7BA 4DV5M 4JI8M 5BR8M 1GL7A 4DR5M 5F3WA 1XNRM 3HHXA 3QAUA 4IBIA 4DR3M 1TGUA 2H1RA 1NVMA 1XMOM 3T38A 3R8FA 3E4RA 5EP1A 1NJFA 4LGMA 3A98B 4GC5A 4LJ8A 1XMQM 5EJCA 4MGYE 3HWSA 1IXZA 4IBJA 4D82A 1IY0A 4M9SA 3BOSA 2YQZA 3HU1A 1I4WA 4LF5M 2LXEA 3W0LB 1N75A 2L09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQ8 C;  1NNU C;  2FOI C;  1NHW C;  1NHG C; 
#chains in the Genus database with same CATH topology
 1TF0 B;  1VEJ A;  2VF8 A;  2XF3 A;  3EIE A;  2CUZ A;  2LHC A;  5KQ8 A;  2C5R A;  2DZO B;  3B89 A;  4LFA M;  4LG2 A;  4S12 A;  3J27 B;  2E5L M;  2FFJ A;  2KNA A;  3UJN A;  3UZU A;  4ITQ A;  3SAT A;  3IG8 A;  3K8Z A;  1EIJ A;  3HKP A;  3Q8X A;  5KPR A;  5EXS A;  4LRT A;  4R3D A;  5EQT A;  2XFT A;  4AG5 A;  2J7O A;  1GJT A;  3FRH A;  4RF1 A;  2KHH A;  1ZQ9 A;  3B7N A;  2ZM6 M;  2UXB M;  3VKG A;  4W5W A;  4GMQ A;  3U6M A;  4FCW A;  1VEK A;  3GPY A;  1IN7 A;  2VQF M;  1IBK M;  1JQJ C;  2CWB A;  1SG9 A;  4DV0 M;  1K82 A;  4JV5 M;  3FD9 A;  4NXN M;  3MK6 A;  3NWL A;  5EXP A;  2D7G A;  3AV0 A;  1KYI A;  1HJP A;  2M5Z A;  3SAR A;  1NHW C;  2J7N A;  3CGW A;  5EXX A;  2CP8 A;  1FJG M;  5E26 A;  1IBM M;  3FTD A;  2CV0 A;  3AOG A;  1UM8 A;  1QUS A;  2KXE A;  4PD2 A;  3UMM A;  3T1Y M;  5ITR A;  2DAG A;  3GLI B;  3U6S A;  1I94 M;  3TWL A;  3R9X B;  3TWK A;  1DGH B;  1E94 E;  2RRU A;  4QHS A;  4IBE A;  1EFU B;  2O25 A;  2L7H A;  4CIZ A;  3SAS A;  1JB0 F;  3KFU G;  2K9D A;  2ZTD A;  3GLH A;  4AG6 A;  1NSF A;  2Q2E B;  1MX0 A;  4QNM A;  2XSZ A;  1Y8G A;  2Z7J A;  3B7Z A;  3HU3 A;  1ZMW A;  3U6D A;  3TQS A;  2V1U A;  2XEP A;  2LH0 A;  1GJS A;  1E9S A;  1L2D A;  2F5O A;  4LFC M;  3OTO M;  3VK8 A;  4FCT A;  4LF9 M;  3GLF A;  4G4N A;  2UXD M;  4LF4 M;  1EE8 A;  2KNV A;  1Q3B A;  2DZN B;  3FUX A;  1XXH A;  2P5T A;  3RE8 A;  2D7E A;  2CRU A;  1GL6 A;  5H37 D;  4PT5 A;  3I4Y A;  3KDS E;  3DFZ A;  1OKS A;  1T6O A;  3KXE C;  1GO5 A;  3U6L A;  4AKG A;  3GQ5 A;  3D8L A;  4L78 A;  1VEG A;  2G3Q A;  3GLG A;  3U60 A;  1GAB A;  2V1C A;  4BLC A;  2QCU A;  4DR4 M;  4TUW A;  4MB7 A;  2UUA M;  2XFS A;  3KP1 E;  4KO8 A;  2FNA A;  2BNK A;  1XWI A;  2L4F A;  7CAT A;  2H5X A;  3TPZ A;  3GRR A;  2C9C A;  4AZF A;  4X62 M;  4AKI A;  2X4A A;  4WUR A;  1PRB A;  5IT9 S;  2F5P A;  4JI6 M;  2DWZ B;  1K3X A;  1X37 A;  3D8B A;  4GC9 A;  2EKF A;  4GEW A;  2XSZ D;  3HX3 A;  2JY7 A;  4GHL A;  3HY5 A;  2OQ4 A;  2DWL A;  1ZV1 A;  1NJG A;  1WJ7 A;  1NY6 A;  1G3I A;  3VK7 A;  2RKO A;  4IBK A;  1E9R A;  1IN4 A;  2Y20 A;  3E46 A;  3HHY A;  3SAV A;  2F5Q A;  4YY3 M;  3FYD A;  3IHP A;  2GQF A;  5ITX A;  2MR9 A;  4KT0 F;  3VDU A;  4PDI A;  1TDZ A;  1G41 A;  3SBJ A;  4HLQ A;  2Y0Q A;  5FLX S;  3TWM A;  1N34 M;  1SXJ A;  4B3S M;  1IY1 A;  1Z6T A;  4QNR A;  3U61 A;  3EIH A;  5ITQ A;  4GKJ M;  1IXS A;  4QOZ C;  1DV0 A;  1OIP A;  4UN2 B;  1YLA A;  3L25 A;  3FTE A;  2CE7 A;  4DV7 M;  2ZAM A;  3FKE A;  1Z5C A;  2DZL A;  1QZE A;  2HCB A;  4NOO B;  3THG A;  1G59 A;  3HHW A;  4XGI A;  3H4M A;  3NBX X;  2Y0T A;  1N32 M;  3KOZ E;  4FWH A;  4IJE A;  3ZQJ A;  4R71 A;  3VKH A;  1TH4 A;  2F4V M;  3I4V A;  2HWJ A;  1G8P A;  2BJV A;  3AOE A;  2MJ5 B;  4FW9 A;  2QBY A;  4WW0 A;  3FTF A;  4II7 A;  1OJL A;  3U6Q A;  2R45 A;  1NV9 A;  1L1Z A;  5KPT A;  1E32 A;  1PGY A;  1QDR A;  1RU3 A;  1KSF X;  1QZM A;  2OOA A;  4PCZ A;  1JR3 E;  4KLN A;  2WSC F;  1WXQ A;  5KQD A;  4OX9 M;  3KSX A;  1DO0 A;  2JXN A;  1HT1 E;  2QEN A;  2QZ4 A;  4OVZ B;  3I04 M;  3A46 A;  3LCU A;  5IZ7 D;  2JY8 A;  4JXJ A;  3J80 S;  2KDL A;  5FTJ A;  2UU9 M;  4NXM M;  4GRI A;  3WHK A;  4MGZ E;  3T6P A;  4X65 M;  3GLG E;  4FWD A;  1SXJ D;  3ZH9 B;  1W5S A;  4EIW A;  1OIZ A;  5KPZ A;  1R2Y A;  1XHB A;  1J7K A;  3W0F A;  2AHM A;  3JR4 A;  4DR2 M;  4CIS A;  2GNO A;  1AUA A;  3LCV B;  4D80 A;  2VQE M;  3FYC A;  3SMS A;  3GLG B;  5ITY A;  4BBA A;  4DUZ M;  3W68 A;  1TH3 A;  3PFI A;  4OW0 A;  1QAO A;  2UUB M;  3K9P A;  2C96 A;  1FNN A;  2LVN C;  4ZPX A;  2C98 A;  2QPA A;  2RGO A;  4L15 A;  4AW4 A;  4LZJ A;  1IY2 A;  5GKN A;  2FOI C;  5C1B A;  2DHR A;  4REZ A;  2X8A A;  2X49 A;  1OAI A;  1HNZ M;  1Q02 A;  5KO3 A;  2HHH M;  4GIP A;  1QAN A;  4A3V B;  2JNH A;  1ZMV A;  2ZAN A;  3KW6 A;  2R46 A;  3DZD A;  3FTC A;  3L27 A;  3B9P A;  4KHP M;  2BWE A;  1QAQ A;  2XH9 A;  3ZC7 B;  1SXJ C;  2LTU A;  3KOX E;  3KOY E;  4FVM A;  3KSJ A;  1WHC A;  1R7R A;  4L4U A;  4DBG B;  3IEC A;  3I51 A;  1GLN A;  2W82 A;  5DYG A;  3MJ5 A;  4NSO B;  2N35 A;  2Z4R A;  3ILK A;  3U5Z A;  1MU5 A;  2XZU A;  2L7I A;  3FRI A;  4LJA A;  2JP7 A;  1OQY A;  4Z6Y A;  2R0I A;  2L6O A;  2K0B X;  4B3T M;  1IN6 A;  1Z5B A;  4JI1 M;  2HAK A;  2M60 A;  2EO2 A;  4B3R M;  3AOE C;  3CF0 A;  4LFB M;  1R6B X;  4XK8 F;  2O5R A;  2ZAO A;  3LQQ A;  3HZJ A;  5FTK A;  4I5S A;  2LVA A;  1N33 M;  1L8Q A;  4G4Q A;  3HGI A;  4RKU F;  3L2A A;  1XB2 B;  1WGN A;  2VF7 A;  1IM2 A;  1TR8 A;  4P17 A;  5A2Q S;  3GPP A;  2YNM D;  3MHV C;  1DGG A;  2J5Y A;  3K2L A;  2JWS A;  3HJ8 A;  1ZAE A;  4CHT B;  3GO8 A;  4DV2 M;  4DV4 M;  3SMP A;  4WP2 A;  4JI2 M;  3HJQ A;  5EXT A;  2QP9 X;  2MRO B;  4K0K M;  2DAI A;  2FS1 A;  4M0D A;  1DGB A;  1N77 A;  1PJT A;  3BBZ A;  2Z3X A;  4IBG A;  1VG5 A;  4NSR A;  2OPF A;  4MGK E;  2MH8 A;  2C9O A;  3CF2 A;  4KOD A;  1R5L A;  2WZJ A;  4DV1 M;  1T3T A;  2XZF A;  3JAM S;  2UXC M;  5L8R F;  3GRU A;  4HL4 A;  2JZ1 A;  2L2D A;  4LJ7 A;  4LCB A;  5LMU M;  1NNJ A;  2KA6 B;  3J2P B;  2VDB B;  2Z4S A;  3FUU A;  5ITT A;  2RGH A;  2ZBK B;  1VDL A;  5EP3 A;  2DXI A;  4B3M M;  1QQW A;  2DVW B;  4GH9 A;  3SC3 A;  1OFI A;  1TDH A;  2ZTC A;  2F5S A;  1D0M A;  4DR1 M;  5JI3 E;  4PDG A;  1IQP A;  4RF0 A;  3BXW A;  4JI5 M;  3RGS A;  4ANR A;  5FTN A;  3RFW A;  1W5T A;  3K92 A;  1QYR A;  3LQR A;  5C18 A;  1J09 A;  4IJF A;  3IG5 A;  1HQC A;  3UGJ A;  1PM5 A;  3FUW A;  1PJJ A;  1L2C A;  4IBB A;  3SFZ A;  1IXR C;  1OAO C;  2JY6 B;  3AJI B;  4YHH M;  3HHZ A;  4B7F A;  3A42 A;  1YSY A;  2R4J A;  4Z8X A;  3VDP A;  5FTL A;  4LJ5 A;  3TL4 X;  2OOB A;  4M0W A;  1V33 A;  2LHG A;  2F5N A;  4CJ6 A;  3I01 M;  5E6J A;  4MH0 E;  3SYL A;  3ZCB B;  3GLI A;  1DGH A;  2HL7 A;  4Q7J A;  1YE9 A;  4X66 M;  3GLH E;  2JZ0 A;  3KVW A;  1JR3 D;  4NRW A;  1WIV A;  2JA2 A;  3E21 A;  1HR0 M;  2DKL A;  3QYB A;  3J7A S;  3B74 A;  3SAU A;  3M7G A;  2ERC A;  3NBI A;  4QHT A;  1GKI A;  5ITU A;  3GLH B;  2JY5 A;  2R4E A;  1NO1 A;  4CGY B;  3GLF E;  2CHQ A;  1XXH E;  1NV8 A;  5FSW A;  1PJS A;  1IN8 A;  1C1K A;  4L6V 6;  3GLF B;  1DO2 A;  1Q39 A;  1XNQ M;  1H6U A;  2R62 A;  1XXH B;  1T43 A;  4IIW A;  4LZZ A;  4I81 A;  1TH2 A;  2DHY A;  3SAW A;  2O01 F;  4LRS A;  3T1H M;  3AFH A;  4IBD A;  2DNA A;  3QYE A;  4G3O A;  2R18 A;  3U60 B;  1D0L A;  3HU2 A;  4P16 A;  2YFQ A;  1ORY B;  1V34 A;  3SHF A;  2LVO C;  3U6C A;  2KEB A;  2QHO B;  1N36 M;  1PJI A;  4HEO A;  3F92 A;  3DOA A;  2C99 A;  3LMM A;  2I7P A;  1KFV A;  2DWM A;  3Q8G A;  2D7H A;  4LY6 A;  4JI3 M;  1D0K A;  2EJS A;  3U6E A;  1S3S A;  4RNA A;  5BPV A;  1QDT A;  5IWA M;  3RGP A;  5ITX E;  3T15 A;  3VFD A;  4IBC A;  4DR6 M;  1DGF A;  2OO9 A;  1NHG C;  3UK6 A;  3JR5 A;  1L2B A;  2CV2 A;  1VDD A;  3C3D A;  3GQ3 A;  4G4R A;  3U6O A;  3K9O A;  2KNZ A;  4QOS A;  4B7H A;  1SXJ E;  1IN5 A;  1G71 A;  3KS4 A;  2R6F A;  4AQY M;  1G4A E;  3GPX A;  4I8O A;  3LW5 F;  4R7G A;  4DV6 M;  2CEA A;  1Z59 A;  3H4J A;  3V76 A;  4FD2 A;  2CHG A;  2CV1 A;  4JI7 M;  1IFY A;  3KOW E;  1WR1 B;  3M0E A;  1L1T A;  4GHA A;  2KZS A;  4OU7 A;  4AI6 A;  1SXJ B;  1TTE A;  2LNH C;  4MM3 B;  3B7Q A;  2LWX A;  2G8L A;  2Y21 A;  3GLI E;  3U61 B;  1IBL M;  4L8R C;  1NY5 A;  1WGL A;  2XGN A;  1IXS B;  4NL4 H;  3MMP A;  8CAT A;  2Z8Y M;  2K47 A;  3W67 A;  2R44 A;  3CTW B;  1QAM A;  3FUV A;  4JI4 M;  3GP1 A;  5DYI A;  2KRU A;  4JI0 M;  4DV3 M;  1R2Z A;  2YR0 A;  2XLJ A;  1OFH A;  3PXG A;  1V92 A;  3SHG B;  4LF8 M;  4LF6 M;  1QUT A;  3L29 A;  4NRV A;  4DUY M;  4I4L A;  2G5G X;  4F1I A;  2QBY B;  2WSE F;  1VQ1 A;  5FTM A;  3SYK A;  2EKK A;  3A45 A;  4F2L A;  3GRV A;  4LJ9 A;  1CUK A;  1MN3 A;  3CF6 E;  4LJ6 A;  2DAK A;  1QVR A;  3E9S A;  4MGH A;  4OVZ A;  3KS8 A;  4LF7 M;  1J5E M;  2VII A;  4LJ4 A;  5JI2 E;  4L16 A;  4X64 M;  3GQ4 A;  2DAE A;  4G6Z A;  4NC6 A;  1JR3 A;  2UUC M;  5EP2 A;  1LTM A;  5IRE B;  2HKJ A;  1ZMU A;  3KP0 E;  5DNY A;  4JYA M;  3LVW A;  2K6B A;  3C3E A;  3PNV A;  2QNJ A;  2KW0 A;  1PJQ A;  1F4I A;  2EUC A;  1C7Y A;  2R65 A;  3GRY A;  1HT2 E;  2DWN A;  4BB9 A;  4B08 A;  2B3T A;  4XBO A;  4FCV A;  3DA1 A;  1K3W A;  1D2N A;  3LVV A;  2DAM A;  4AKH A;  2CHV A;  5LMN M;  4GIT A;  3AL0 C;  1GVN A;  2NQ8 C;  2BJW A;  4M9Z A;  2FE8 A;  4D81 A;  3J81 S;  3AKZ A;  2KZU A;  4FWG A;  3L26 A;  2FH0 A;  3K1J A;  4IBF A;  1YUB A;  1AIP C;  5EP4 A;  4M9X A;  3U6P A;  2EA0 A;  1HNX M;  3GPU A;  2V6Z M;  4JN6 A;  3VLF B;  3M6A A;  3L28 A;  3PNY A;  4B7G A;  4GKK M;  2BWB A;  2I7N A;  3C58 A;  1A5T A;  4DR7 M;  2QQ8 A;  2A5Y B;  1P3Q Q;  2QSF X;  3PVS A;  2CFO A;  3WHL A;  2MGW A;  1XC8 A;  3QWL A;  3TE6 A;  4LGY A;  1NNU C;  2LVP C;  1MJG M;  1R4G A;  1BVS A;  4G4O A;  3U5Z B;  1Q3C A;  1N78 A;  1HNW M;  2KRK A;  3HJS A;  2L4E A;  4Y28 F;  1LV7 A;  1Z5A A;  1HQY E;  3FUT A;  4MGI E;  3J7B A;  4DV5 M;  4JI8 M;  5BR8 M;  1GL7 A;  4DR5 M;  5F3W A;  3C9P A;  1XNR M;  3HHX A;  3QAU A;  1UFZ A;  4IBI A;  4DR3 M;  1TGU A;  5DFL A;  2H1R A;  1NVM A;  1XMO M;  3FE3 A;  3T38 A;  3R8F A;  3E4R A;  2DEN A;  5EP1 A;  1NJF A;  1OTR A;  2LBC A;  2APL A;  4LGM A;  3A98 B;  4GC5 A;  2WSF F;  4LJ8 A;  1XMQ M;  5EJC A;  4MGY E;  3HWS A;  1IXZ A;  4IBJ A;  4D82 A;  1IY0 A;  4M9S A;  2DI0 A;  2JUJ A;  3BOS A;  2LVQ D;  2YQZ A;  3HU1 A;  1I4W A;  4LF5 M;  2LXE A;  3W0L B;  1N75 A;  2L09 A; 
#chains in the Genus database with same CATH homology
 2XF3 A;  3EIE A;  2CUZ A;  5KQ8 A;  2C5R A;  2DZO B;  4LFA M;  4LG2 A;  4S12 A;  3J27 B;  2E5L M;  2FFJ A;  3UJN A;  3UZU A;  4ITQ A;  3SAT A;  3IG8 A;  3K8Z A;  3HKP A;  3Q8X A;  5KPR A;  5EXS A;  4LRT A;  4R3D A;  5EQT A;  2XFT A;  4AG5 A;  2J7O A;  2ZM6 M;  4RF1 A;  1ZQ9 A;  2UXB M;  3VKG A;  4W5W A;  4GMQ A;  3U6M A;  4FCW A;  3GPY A;  1IN7 A;  2VQF M;  1IBK M;  1JQJ C;  4DV0 M;  1K82 A;  3FD9 A;  4NXN M;  3MK6 A;  3NWL A;  5EXP A;  2D7G A;  3AV0 A;  1KYI A;  3SAR A;  2M5Z A;  1NHW C;  2J7N A;  5EXX A;  1FJG M;  5E26 A;  1IBM M;  3FTD A;  2CV0 A;  3AOG A;  1UM8 A;  2KXE A;  4PD2 A;  3UMM A;  3T1Y M;  5ITR A;  3GLI B;  3U6S A;  1I94 M;  3R9X B;  3TWL A;  3TWK A;  1DGH B;  1E94 E;  4QHS A;  4IBE A;  2L7H A;  3SAS A;  3KFU G;  4AG6 A;  3GLH A;  1NSF A;  2Q2E B;  1MX0 A;  4QNM A;  2XSZ A;  2Z7J A;  3HU3 A;  3U6D A;  3TQS A;  2V1U A;  2XEP A;  2LH0 A;  1E9S A;  1L2D A;  2F5O A;  4LFC M;  3OTO M;  3VK8 A;  4FCT A;  4LF9 M;  3GLF A;  4G4N A;  2UXD M;  4LF4 M;  1EE8 A;  1Q3B A;  2DZN B;  3FUX A;  1XXH A;  2P5T A;  3RE8 A;  2D7E A;  1GL6 A;  5H37 D;  4PT5 A;  3I4Y A;  3KDS E;  3DFZ A;  3KXE C;  3U6L A;  4AKG A;  3GQ5 A;  3D8L A;  4L78 A;  3U60 A;  3GLG A;  2V1C A;  4BLC A;  2QCU A;  4DR4 M;  4TUW A;  4MB7 A;  2UUA M;  2XFS A;  3KP1 E;  4KO8 A;  2FNA A;  2BNK A;  1XWI A;  7CAT A;  3TPZ A;  3GRR A;  2C9C A;  4AZF A;  4X62 M;  4AKI A;  2X4A A;  4WUR A;  5IT9 S;  2F5P A;  4JI6 M;  2DWZ B;  1K3X A;  1X37 A;  3D8B A;  4GC9 A;  2XSZ D;  4GHL A;  2OQ4 A;  2DWL A;  1NJG A;  1NY6 A;  1G3I A;  3VK7 A;  2RKO A;  4IBK A;  1E9R A;  1IN4 A;  2Y20 A;  3HHY A;  3SAV A;  2F5Q A;  4YY3 M;  3FYD A;  5ITX A;  3VDU A;  4PDI A;  1TDZ A;  1G41 A;  3SBJ A;  4HLQ A;  2Y0Q A;  5FLX S;  3TWM A;  1N34 M;  1SXJ A;  4B3S M;  1IY1 A;  1Z6T A;  4QNR A;  3U61 A;  3EIH A;  5ITQ A;  4GKJ M;  4QOZ C;  3L25 A;  3FTE A;  2CE7 A;  4DV7 M;  2ZAM A;  3FKE A;  1Z5C A;  4NOO B;  2HCB A;  3THG A;  1G59 A;  3HHW A;  4XGI A;  3H4M A;  2Y0T A;  1N32 M;  3KOZ E;  4FWH A;  4IJE A;  3VKH A;  1TH4 A;  2F4V M;  3I4V A;  1G8P A;  2BJV A;  3AOE A;  4FW9 A;  2QBY A;  4WW0 A;  3FTF A;  4II7 A;  1OJL A;  3U6Q A;  2R45 A;  1L1Z A;  5KPT A;  1E32 A;  1KSF X;  1QZM A;  4PCZ A;  4KLN A;  1WXQ A;  5KQD A;  4OX9 M;  3KSX A;  1DO0 A;  4OVZ B;  1HT1 E;  2QEN A;  2QZ4 A;  3A46 A;  5IZ7 D;  4JXJ A;  3J80 S;  5FTJ A;  2UU9 M;  4NXM M;  4GRI A;  3WHK A;  4MGZ E;  4X65 M;  4FWD A;  1SXJ D;  3ZH9 B;  1W5S A;  4EIW A;  5KPZ A;  1R2Y A;  1XHB A;  1J7K A;  3W0F A;  2AHM A;  3JR4 A;  4DR2 M;  4CIS A;  4D80 A;  2VQE M;  3FYC A;  3SMS A;  3GLG B;  5ITY A;  4BBA A;  4DUZ M;  1TH3 A;  3PFI A;  4OW0 A;  1QAO A;  2UUB M;  2C96 A;  1FNN A;  4ZPX A;  2C98 A;  2QPA A;  2RGO A;  4L15 A;  4AW4 A;  4LZJ A;  1IY2 A;  5GKN A;  2FOI C;  5C1B A;  2DHR A;  4REZ A;  2X8A A;  2X49 A;  1HNZ M;  5KO3 A;  2HHH M;  4GIP A;  1QAN A;  4A3V B;  2ZAN A;  3KW6 A;  2R46 A;  3DZD A;  3FTC A;  3L27 A;  3B9P A;  4KHP M;  1QAQ A;  2XH9 A;  3ZC7 B;  1SXJ C;  3KOX E;  3KOY E;  4FVM A;  3KSJ A;  1R7R A;  4L4U A;  3I51 A;  1GLN A;  2W82 A;  5DYG A;  3MJ5 A;  4NSO B;  2Z4R A;  3ILK A;  3U5Z A;  1MU5 A;  2XZU A;  2L7I A;  4LJA A;  4Z6Y A;  2L6O A;  4B3T M;  1IN6 A;  1Z5B A;  4JI1 M;  2M60 A;  2EO2 A;  4B3R M;  3AOE C;  3CF0 A;  4LFB M;  1R6B X;  2O5R A;  2ZAO A;  3LQQ A;  5FTK A;  4I5S A;  1N33 M;  1L8Q A;  4G4Q A;  3HGI A;  3L2A A;  1IM2 A;  5A2Q S;  3GPP A;  2YNM D;  3MHV C;  1DGG A;  3K2L A;  3HJ8 A;  1ZAE A;  4CHT B;  3GO8 A;  4DV2 M;  4DV4 M;  3SMP A;  4JI2 M;  3HJQ A;  5EXT A;  2QP9 X;  4K0K M;  1N77 A;  4M0D A;  1DGB A;  4IBG A;  4NSR A;  2OPF A;  4MGK E;  3CF2 A;  2C9O A;  4KOD A;  4DV1 M;  1T3T A;  2XZF A;  3JAM S;  2UXC M;  3GRU A;  4HL4 A;  4LJ7 A;  1NNJ A;  4LCB A;  5LMU M;  2KA6 B;  3J2P B;  2Z4S A;  3FUU A;  5ITT A;  2RGH A;  2ZBK B;  5EP3 A;  4B3M M;  2DXI A;  1QQW A;  2DVW B;  4GH9 A;  3SC3 A;  1OFI A;  1TDH A;  2F5S A;  4DR1 M;  5JI3 E;  4PDG A;  1IQP A;  4RF0 A;  4JI5 M;  3RGS A;  5FTN A;  3RFW A;  1W5T A;  3K92 A;  1QYR A;  3LQR A;  5C18 A;  1J09 A;  4IJF A;  3IG5 A;  1HQC A;  3UGJ A;  1PM5 A;  3FUW A;  1PJJ A;  1L2C A;  4IBB A;  3SFZ A;  1IXR C;  3AJI B;  2Z3X A;  4YHH M;  3HHZ A;  4B7F A;  3A42 A;  1YSY A;  2R4J A;  4Z8X A;  3VDP A;  5FTL A;  4LJ5 A;  3TL4 X;  4M0W A;  2F5N A;  5E6J A;  4MH0 E;  3SYL A;  3ZCB B;  3GLI A;  1DGH A;  2HL7 A;  1YE9 A;  4X66 M;  3KVW A;  1JR3 D;  4NRW A;  2JA2 A;  1HR0 M;  3J7A S;  3SAU A;  3M7G A;  2ERC A;  3NBI A;  4QHT A;  1GKI A;  5ITU A;  3GLH B;  2R4E A;  4CGY B;  2CHQ A;  5FSW A;  1IN8 A;  1C1K A;  3GLF B;  1DO2 A;  1Q39 A;  1XNQ M;  1H6U A;  2R62 A;  1XXH B;  4IIW A;  4LZZ A;  4I81 A;  1TH2 A;  3SAW A;  4LRS A;  3T1H M;  3AFH A;  4IBD A;  2R18 A;  3U60 B;  3HU2 A;  4P16 A;  2YFQ A;  1ORY B;  3SHF A;  3U6C A;  2KEB A;  1N36 M;  1PJI A;  3DOA A;  2C99 A;  3LMM A;  2I7P A;  1KFV A;  2DWM A;  2D7H A;  4LY6 A;  4JI3 M;  3U6E A;  1S3S A;  4RNA A;  5BPV A;  5IWA M;  3RGP A;  5ITX E;  3T15 A;  3VFD A;  4IBC A;  4DR6 M;  1DGF A;  1L2B A;  1NHG C;  3UK6 A;  3JR5 A;  2CV2 A;  1VDD A;  3GQ3 A;  4G4R A;  3U6O A;  4QOS A;  4B7H A;  1SXJ E;  1IN5 A;  3KS4 A;  4AQY M;  1G4A E;  3GPX A;  4I8O A;  4R7G A;  4DV6 M;  2CEA A;  1Z59 A;  2CV1 A;  4FD2 A;  2CHG A;  4JI7 M;  3KOW E;  3M0E A;  1L1T A;  4GHA A;  2KZS A;  4OU7 A;  4AI6 A;  1SXJ B;  2LNH C;  4MM3 B;  2LWX A;  2Y21 A;  2G8L A;  3U61 B;  1IBL M;  4L8R C;  2XGN A;  1NY5 A;  1IXS B;  4NL4 H;  8CAT A;  2K47 A;  3CTW B;  1QAM A;  3FUV A;  4JI4 M;  3GP1 A;  5DYI A;  2KRU A;  4JI0 M;  4DV3 M;  1R2Z A;  2YR0 A;  2XLJ A;  1OFH A;  3PXG A;  3SHG B;  4LF8 M;  4LF6 M;  3L29 A;  4NRV A;  4DUY M;  4I4L A;  2G5G X;  2QBY B;  5FTM A;  3SYK A;  3A45 A;  3GRV A;  4LJ9 A;  4LJ6 A;  3CF6 E;  1QVR A;  3E9S A;  4MGH A;  4OVZ A;  3KS8 A;  4LF7 M;  1J5E M;  2VII A;  4LJ4 A;  5JI2 E;  4L16 A;  4X64 M;  3GQ4 A;  4G6Z A;  1JR3 A;  2UUC M;  5EP2 A;  5IRE B;  2HKJ A;  5DNY A;  3KP0 E;  4JYA M;  3LVW A;  3PNV A;  2KW0 A;  2EUC A;  2R65 A;  3GRY A;  1HT2 E;  2DWN A;  4BB9 A;  4B08 A;  4XBO A;  4FCV A;  3DA1 A;  1K3W A;  1D2N A;  3LVV A;  4AKH A;  2CHV A;  5LMN M;  4GIT A;  3AL0 C;  1GVN A;  2NQ8 C;  2BJW A;  4M9Z A;  2FE8 A;  4D81 A;  3J81 S;  3AKZ A;  2KZU A;  4FWG A;  3L26 A;  4IBF A;  3K1J A;  1YUB A;  5EP4 A;  4M9X A;  3U6P A;  2EA0 A;  1HNX M;  3GPU A;  2V6Z M;  4JN6 A;  3VLF B;  3M6A A;  3L28 A;  3PNY A;  4B7G A;  4GKK M;  2I7N A;  3C58 A;  4DR7 M;  2A5Y B;  1XC8 A;  4JV5 M;  3PVS A;  2CFO A;  3WHL A;  3QWL A;  3TE6 A;  4LGY A;  1NNU C;  4G4O A;  3U5Z B;  1Q3C A;  1N78 A;  1HNW M;  2KRK A;  3HJS A;  1LV7 A;  1Z5A A;  1HQY E;  3FUT A;  4MGI E;  3J7B A;  4DV5 M;  4JI8 M;  5BR8 M;  1GL7 A;  4DR5 M;  5F3W A;  1XNR M;  3HHX A;  3QAU A;  4IBI A;  4DR3 M;  1TGU A;  2H1R A;  1NVM A;  1XMO M;  3T38 A;  3R8F A;  3E4R A;  5EP1 A;  1NJF A;  4LGM A;  3A98 B;  4GC5 A;  4LJ8 A;  1XMQ M;  5EJC A;  4MGY E;  3HWS A;  1IXZ A;  4IBJ A;  4D82 A;  1IY0 A;  4M9S A;  3BOS A;  2YQZ A;  3HU1 A;  1I4W A;  4LF5 M;  2LXE A;  3W0L B;  1N75 A;  2L09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...