2QBYB

Crystal structure of a heterodimer of cdc6/orc1 initiators bound to origin dna (from s. solfataricus)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
368
structure length
368
Chain Sequence
KNPKVFIDPLSVFKEIPFREDILRDAAIAIRYFVKNEVKFSNLFLGLTGTGKTFVSKYIFNEIEEVKKEDEEYKDVKQAYVNCREVGGTPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIRAIIYLDEVDTLVKRRGGDIVLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEYGLIKGTYDDEILSYIAAISAKEHGDARKAVNLLFRAAQLASGGGIIRKEHVDKAIVDYEQERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISELDMFGIVKIRIINRGRAGGVKKYALVEDKEKVLRALNETFEDSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Replication/dna
molecule keywords DNA (33-MER)
total genus 112
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09079 Cdc6_C CDC6, C terminal winged helix domain
B PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2qbyB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qbyB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qbyB02
4TN1A 2MH9A 4FMDB 4M2LA 1STZA 2EFDB 1FX0B 3IO3A 4NDZA 4FT8A 2V4ZA 2F3TA 1B1BA 1PLLA 2JPCA 3F8MA 4A5MA 1VIYA 4YQFA 3WXMA 1O3TA 4YONB 5ILVA 3W5IA 5KNCA 1GM5A 3K0FB 3SNHA 2EWWA 2NPIA 2B7BA 2OAZA 1DELA 1TNDA 1NL3A 2VF8A 2QORA 3K8YA 3U9GA 3ZZ0A 2FGJA 3F8NA 3FM5A 2OO7A 3PUZA 3DDCA 4ENMA 4Q4JB 3G0HA 4P9FA 4M21A 1O7LA 1IY0A 4P9UA 2VONA 2AS5F 2WWWA 5LB2A 1A7JA 4G5OA 2NMVA 1D2NA 4XTRA 5C4GB 2BM0A 3H0KA 5L3SA 2FA5A 1YZKA 1RUNA 2RCNA 2JDID 1AWCA 2YINC 3NIBA 4I0AA 1Z29A 2VSFA 5F9HA 1Q1BA 3RANA 4YFXF 2JLQA 2AR7A 4JVLA 1QPMA 5JJKA 4B32A 2YX4A 3O8RA 1E9EA 1F48A 3EWSA 3PENA 3V7RA 1MDMB 2P6UA 3HWSA 5FPTA 3HYRA 4UV9A 1U8YA 1EFCA 1UAAA 1UKVY 4HB3A 4XVUA 2QP3A 1ZNXA 5H20A 2FBKA 2C5LA 4HAMA 4MUBA 2JJ2D 4DRZA 1MRSA 4F4IA 4GBMA 3KUDA 5FD5A 3BFVA 4URVR 2VBYA 2QQAA 4LB6B 3RTRA 3K2ZA 4B3BA 3KCCA 4TYPA 3TQFA 3O8DA 3WNCA 4Z2YA 1QBJA 2J41A 2R7FA 4LG0A 3IKVA 3J80Z 1G7SA 3GW2A 1SULA 1T3LA 1XJQA 4W7SA 4ZIRB 3ICEA 2FU5C 4LYHA 5BYJA 3NTUA 1XJCA 5HDKA 4ARZB 2TDXA 1Z9CA 3T8TA 1YIOA 4GYIA 1RE0A 4HAYA 4KJZA 2J3EA 4B35A 2R65A 4IW3B 3W5JA 4BEJA 1UKYA 1FP7A 2PCLA 2V3CC 4I02A 3ZJYA 1VYVA 1NKTA 2X2FA 3CUQB 2XZPA 2CVHA 3MGCA 4LJ7A 3LLUA 4C0QC 3CNLA 4RGSA 5DE3A 2J59A 3LBIA 4DIEA 2L4MA 4JS0A 3KP7A 2MLKA 1KHTA 2WWXA 4MEYF 4AURA 2DK8A 1G3YA 3D5LA 1J5YA 4XWAA 5DUKA 4BGDA 1OKKD 1KSJA 5JI2E 1UKZA 2JA1A 5F3WB 5CM8B 3C7JA 3KFXA 1ZHFA 3KP2A 1B23P 4QFMA 4M9SA 4QC2A 2FPKA 5CYPA 2I4IA 2VP9A 4A0ZA 2IYZA 1Z6RA 3FGNA 3VHXA 1KSHA 2GCOB 3E97A 4OHVA 3GLFB 4OINF 5FPYA 3TKLA 2D74A 3SQWA 3AP2A 2IBMA 1U6GA 3HR7A 3J81Z 1KI2A 1X8JA 3BBPA 3B9PA 4G1UC 2VHQA 1U78A 1DAFA 4ZCIA 3REGA 1UB9A 5D3QA 1CJMA 3R0AA 4AIKA 2B7CA 4CVNA 2H94A 1Z1DA 3FX3A 2WZQA 4KFTA 1N6IA 1XEWX 1FYMA 4B44A 5KDOA 4A6EA 2STWA 1QHNA 2ZRIA 3TGPA 3EPLA 3KDSE 1R5OA 1SVIA 4B47A 4L9TA 3K09A 4LJ5A 1CJUC 1WMSA 4LJZF 1YZNA 3RS7A 3W6OA 2IX3A 1T9HA 3RVBA 5CM9C 3Q7PA 2VP6A 1S0UA 5G41A 4RZ2A 2WICA 2ZUBA 2BWJA 2ORIA 3LQRA 2CLDX 1AA9A 4PPQA 2FFAA 2ZJOA 2KKOA 1BN5A 1UEJA 3B1ZA 1YLFA 3HU2A 1P2TA 1IY1A 4I09A 3CBQA 4B76A 4N9IA 3P7NA 3UMRA 2EFPA 1TLHB 1NVXQ 5E17F 4X8LA 4A0RA 3U1DA 2X8AA 3I4PA 2GA8A 2BYVE 1CJTC 2A2ZA 5GVSA 2HF8A 1WQ2A 4ZYEA 3EWAA 1NMZA 3RPUA 4TL8A 1R5NA 5DHFA 1OH8A 1YYVA 2HKOA 4L9NA 3WMEA 1F3OA 2OBMA 1KI6A 2RGXA 3E3VA 4DC9A 3LSTA 3SBDA 1KK3A 2ZPTX 3P4YA 5M04A 2AXPA 2QGNA 5FOWA 3THWA 3CLOA 2DZOB 1IQPA 1G8PA 4GOXA 2GXSA 1DG3A 4C30A 1R58A 1TF7A 3BORA 2LNBA 1LJ9A 3ZDQA 1TADA 1W5TA 1T0FA 3I71A 3C5CA 4H9GA 4MITA 1OKKA 2BGCA 5L3DA 1JJ7A 4M71A 1G21E 1QHHB 2KIUA 2A7QA 1IXZA 2D7CA 5HVQC 1Z2CA 3TVDA 1GITA 3IRQA 1E4VA 1XD9A 3VODA 2FF7A 2R6GA 3C41J 1ZYRF 3WBKA 4NCIA 2OA4A 4TSFD 1IM2A 1NY6A 4EPWA 5E7MA 2K02A 1XD8A 1FBSA 3QPHA 3E6BA 1COWA 3RS0A 3BH6A 3V4GA 5HLIA 5D4SA 3OIWA 3FHZA 5EE5B 2VBCA 3IQWA 2DFNA 1Y3AA 4XTCS 3GUDA 1E2HA 2M30A 1BI1A 2DPDA 1VCNA 3OE7A 2OSBA 4KBGA 2FQ3A 2VE8A 4RB1A 1UBGA 2LDUA 1K7AA 3KXIA 1JI0A 3B1YA 4BUJA 1HE8B 4HF2A 2R2AA 3ASZA 4CGZA 2STTA 1YW7A 2JCSA 4L8GA 1TQPA 5FL7A 4OI1A 1XSDA 1M7BA 5BWMA 2PJPA 4LHWA 2VL7A 4V0NA 4LMYA 4NMMA 2O8BA 2WSSA 1ZAOA 1T39A 3M8FA 4IEEA 4F4JA 3RSOA 3K0LA 3TLXA 2FDCA 1MRNA 2M5WA 4LY6A 2N46A 4BE7B 5KPDA 4NPHA 2IP2A 4A0FA 3DKWA 1K5GA 1RI7A 4XBFA 1XXHE 5HS9A 3CPHA 4Q9JA 3LV8A 2CEAA 1XB2A 3QXCA 4OJQA 2ZVPX 3FMRA 5EEGA 4CEJB 3R8FA 1W4RA 4D4LA 1XZQA 1VG8A 1Z0DA 1ZH5A 2AWNA 4ENKA 4A0XA 2B21A 2GJSA 2L0XA 3EARA 1I5ZA 3DOEA 4O2LA 5BQ5A 3T06B 1J2XA 3IHWA 5D4RA 2NO1A 2WOOA 3NBZC 4EV0A 4QGHA 1PP8F 1E94E 1AJEA 1D5VA 3MQ0A 1OSNA 5CJPA 3H1TA 2OLKA 3GEZA 3GQBA 1XCPA 2GZDA 4XWOA 4IOLA 4KT5C 4DHEA 3QU3A 1TQMA 1AK2A 4GMDA 4KVGA 4LPSA 4HLDA 4ASUA 1NF3A 1YW9A 2TMKA 4HUTA 1GIAA 2PZEA 1N25A 3IQXA 3KJHA 4JT2A 1D5CA 5KSYA 4A92A 2EFQA 3KKNA 3NEYA 4FWDA 1VHTA 4ZCMA 4US1R 1QZZA 1YW8A 2OCPA 2WTUA 2XX3A 5K8LA 3TAHA 3I5XA 5CLQA 4HF1A 3QRFF 3C7KA 4UVCA 2GK7A 3FF5A 4RSGA 4A8JC 4I4LA 3IEVA 3UMFA 1TQ4A 3I58A 4HLCA 2KIFA 2ZO4A 2XGJA 3BERA 4L15A 4BLOA 3VOEA 1F4KA 2KJBA 2AX4A 4LHXA 1L0OC 1JQLB 1TAGA 1B4AA 1WXQA 2FH5B 3EW9A 4R8HA 3MSXA 1G3SA 2CNWD 2QMOA 3ND8A 4G5GA 4TQUS 1DEKA 3GLIA 3FVQA 4BFWA 1YS7A 3P20A 3H86A 3BOQA 4WXRA 4EIWA 4UVAA 5EE9A 4PO9A 1IY2A 1MZBA 4I81A 1F2UA 1HA3A 2PEXA 3B6EA 3KJEA 4B3GA 3FZVA 1SZPA 2ISZA 4V0OA 4Q7JB 4L9VA 4ZDIA 3W6KB 4ZI3A 4RB3C 4HV5A 5F9FA 2IA2A 2OUKA 4LV6A 2VIIA 1NBME 3QXXA 3K1JA 2W24A 4IHTA 2Z33A 2O0KA 3TUJC 1J75A 2CQKA 2HFHA 1N6LA 5AIPA 3FTQA 3VFDA 4JBXA 2FX3A 4KIFA 1TEVA 1CIPA 3JSOA 2G7HA 1FZQA 4ASNA 4ZDKA 1CRPA 1G3MA 1W47A 3K9LA 2LF8A 3QKTA 3AVXA 1ZINA 5FL7D 1XDSA 3U3KA 5K8UA 2D7DA 4YMSA 3RLFA 1FQJA 4LC0A 3WRYC 4WBSA 4IHSA 1P2VA 1C1YA 2WKQA 4MKHA 3WNDA 1MABB 1OXVA 4LJ6A 1TU3A 2IYXA 5J5CA 2ETHA 3B1VA 1BS1A 1FBUA 2F5DA 3W90A 2ZRPA 1YR6A 4BHCA 2XAFA 3RKYA 3GLHB 2A68F 5DUIA 3WYGA 3HTUA 1Q44A 1RJ9B 1VG9B 2AXNA 1KQ8A 3RPQA 2R6CA 2JLVA 3KB1A 1WDTA 1NG9A 4V0KA 2RKHA 2QUFA 2A30A 2XUBA 1SXJE 1MJ9A 2A5JA 4GZMA 3ECHA 4YC7A 2L02A 3UG6A 2YVUA 3ADCA 5JJIA 1CJKC 3KW6A 1II9A 1UEIA 3KFWX 4HZUA 4MRVA 3I5UA 4AYXA 1A82A 4A36A 4OI0A 3HU1A 1XF9A 2V7QA 4Q02A 3HTSB 4PPFA 5E8GA 2ZAMA 5FOSA 3BROA 5TVKA 2SHKA 5E1XA 1NBMD 4ZYHA 1UKEA 2ZI6A 1SMTA 3LWFA 4ZKDA 3W8RA 3OFND 1XSVA 1OMIA 1FQKA 2G1KA 4B71A 3VHLB 4PGHA 4NQWA 2BV3A 4GOJA 3ZQJA 3FMPB 2ODEA 1G5PA 4TTPA 1ZN2A 5FLXK 1KKLA 2KJQA 2ZE7A 3LRPA 4KBFA 3W34A 2A69F 2FMYA 3F6VA 3I59B 3GCGA 2MH2A 1N2CE 2IT0A 1GZSA 2X2EA 4LSGA 1C1KA 4WZAE 5FBLB 1V43A 4K8OA 1W7PA 5HE9A 1IXCA 3FHCB 3BWGA 2CYYA 4C0HA 2W84A 1HV8A 4CICA 1TQ2A 4JYCA 3HUGA 1CU1A 3EYIA 1W2GA 4WOPA 1VCOA 4JLMA 3QVUA 2QBYB 1II8B 2W83A 2PMHA 1J70A 4M73A 5L3RA 3GZ5A 4UKDA 2P65A 3B9QA 5H6RA 3W6PA 5HS8A 1NN1A 1SVOA 5B30A 1RZ4A 1CTQA 5JBQA 2V1DA 2O8XA 1KJZA 1T5IA 3CKLA 2FFBA 1YVDA 4LD5A 1NVUQ 4Q4AB 4IRUB 1JXOA 4ITRC 4OKSA 1RNLA 1ZIPA 3M7GA 3GJ0A 3LAWA 3R6SA 5FGMA 4KV9A 1OFUX 1Z0KA 2ZE8A 2O03A 4DJTA 4BYYA 2E9SA 3JVUA 4XJXA 1FNMA 5AJZA 4MRNA 4FINA 3SHWA 3REOA 5DEQA 3THYA 2FGKA 2F1RA 3ZMUA 2JIZA 4AVPA 3TO6A 2P6NA 1OYIA 1YTYA 3BXZA 1ZNZA 2HJGA 5DV5A 5EE3A 4BFSA 4LLLA 1Z8FA 5P21A 2QROA 3J7AO 4MGYR 2YWFA 1Z08A 2VHJA 4OI4A 1R5HA 1BO6A 2EFEB 1X1RA 1GOTA 4R2IA 4LRTA 3ZH9B 4LHVA 4TT3A 1N6KA 5IK2A 4CZ2A 2XXAB 3REFA 1G64A 3AF4A 4FWHA 1VHLA 5L3QB 3PG5A 5KOYA 3IHLA 1ZG3A 1BM9A 1S4QA 3KETA 2HTSA 2RVCA 2FNAA 2XSZD 2DQLA 4HBLA 4BAYA 5D5WB 3AM1A 3DM9B 2DI3A 4DXAA 3PFIA 2HCJB 3BJAA 5JWOA 2V1XA 3F6OA 2Q2EA 4Z8XA 1Z5ZA 1E79A 3P32A 4KVAA 2GBLC 2QZ8A 2B6HA 4Q9LA 2IYTA 2GBLA 3CRW1 5JHHB 2MLGA 2Z3YA 1P2SA 2BMFA 3FKSA 1SXJA 4IJMA 5LPNA 1XPOA 4B3DA 1J9IA 3WYAA 4DKXA 3D0SA 1SD7A 5AK0A 4JLPA 4B75A 4PZJA 3BOSA 4OHZA 3A1VA 3FMFA 4YXWA 4EQ6A 1CLUA 4MNUA 4HDCA 3X1ZA 3BC1A 3ZVLA 1QHXA 1XGSA 5F2EA 4DNCA 3RWOA 2ZI7A 3CF6R 5K5QA 4IVRA 3C8UA 3P27A 5CB6A 2NO0A 1Q20A 3C14C 5FTKA 2PJRA 5DDGA 3JTGA 3OEHD 5KSPA 1OR7A 1P9WA 1YE8A 1ZD1A 1KDOA 4BQAA 2R8RA 3EIQA 4LJYA 4BRUA 3LBNA 1I6XA 3L9FA 4A2UA 1VYTA 4Z8YA 5BPIA 4BASA 3IKTA 3IHUA 1ZGAA 2JSCA 2ZRCA 2BKEA 2Y48A 2O8CB 4E70A 2IYUA 1U9IA 2QT1A 1RW4A 2ZUDA 3RYPA 4LJ9A 2ZJYA 1H9TA 3KKPA 4GDFA 3N70A 3K69A 1RFLA 2XZLA 5AIQA 4B48A 4RVCA 2NAZA 3L00A 1ZG5A 1CP2A 2J9RA 2ORVA 1SMYF 2ZR7A 3T5XA 1FYLA 1DOAA 5SZKB 5DCMA 1AKEA 2XOKD 4Q1DA 3HPRA 1UJ2A 1ONVA 4RFSA 1KO7A 5A2QK 3WTWC 2QQ9A 1KY3A 2VOOA 2HDCA 2ZJZA 4RB2C 4Q7KA 4A0GA 3ADDA 3SEAA 4HUQA 4C0KA 2GXAA 3ZMZA 3WTZA 2QM8A 4DT1B 1O7FA 1FX0A 4P55A 2RKOA 5FFXA 3DEFA 4PZZA 1BKDR 4FMBB 2VN2A 1Z83A 4RD1A 5LEKA 4R2HA 5TV2A 3OF5A 4FCVA 1K79A 1SHZA 1BYUA 3L0PA 4QKQA 3X2SA 5HKKD 1Q1HA 3T1OA 3J81k 4U0VA 2WIAA 3OZXA 4A0HA 4EJSA 5JFRA 2WWHA 2EK5A 1TW2A 5D5XB 1D2MA 3K1NA 4ZZLA 1E69A 3ZMDA 2D2EA 2XZOA 1XNJA 1KU9A 1SFEA 2OG2A 4Q5SF 2W00A 2XKOA 2ZYVX 3NG1A 3SJZA 3FXRA 1JE8A 4XSXF 4YIFA 1BH2A 1UFQA 4QL3A 3EZ2A 3CWZA 4V0LA 1XXHB 3PUVA 2ZNZA 3TE6A 3R9WA 3DHWC 4UV8A 4KFSA 5B57C 3T1BA 4Q4ZF 2C95A 2QM3A 5AUNB 2EA4A 4CEHA 2FJUA 4P33A 3ELKA 3GFLA 2ZBKA 4UVBA 4QBFA 2OBLA 4IOMA 1EFHA 1MDMA 121PA 1ON2A 1ZCAA 3CIOA 2CWEA 4IDPA 1KZ7B 2EFCB 2RH5A 4JJKA 4MYTA 1OW3B 5B2ZA 1K78B 2AK2A 3WGIA 1CKEA 3QQ5A 2XVCA 3VFZA 1CF7A 5CLSA 4QGAA 2E87A 2NO9A 3U44A 1GNPA 1H8ED 3EG5A 521PA 3K0CA 1G8HA 8OHMA 3TW4A 1UBFA 2VYFA 4URXR 3ABUA 5ERIA 3MZHA 2V7QD 3NDBB 1EV7A 3RRYA 4ARZA 4KA4A 4HDUA 4U7BA 4W5JA 1Z6AA 3K0AA 5FPSA 4DLVA 3U60B 2ZJ2A 1RVDA 5CIQA 1W4MA 2ZNYA 4QM7A 4JZKA 2RHDA 3Q9LA 4GGGA 4XD7D 1VKJA 5G3ZA 1OH5A 3SFZA 1US8B 3TOBA 3ZVRA 2NYXA 1CR4A 3AVTA 1VIAA 2BCGY 2KSQA 3OEHA 4MTEA 1PUJA 2GJKA 3DMNA 4I1SA 5BW8A 3QF4B 3A6PC 3LO5A 1ZAKA 2D1VA 4N0BA 1QG4A 2VOPA 1R5BA 2DTRA 1TPZA 4LLGF 1S8NA 1ZM2A 4ESVA 1MD0A 3TOAA 4O0MA 3IIKA 1ZMXA 4JN6A 2FBHA 1RKBA 2IC5A 4JL8A 3MFYA 2OM2A 2EW1A 5JI3E 1QBKC 1HSTA 1T8TA 1G4DA 4Q66C 4R7ZA 4TLBA 4MQ9F 4U5XA 3I64A 3BB3A 5BYKA 1GSIA 3SYLA 2O3FA 1OIWA 1XEXB 221PA 3AUYA 1SVWA 3HP1A 2OEPA 1SHKA 4Q1CA 1XCVA 5HR5A 4A0YA 1JPNA 2WSSD 4RGRA 4RJLA 2AKYA 5FBWB 2GXUA 1MJAA 3TO9A 4ETSA 1QHYA 1XMJA 2JJ2A 3FE2A 4GNKA 2QLZA 1OLOA 1NI3A 3I4LA 3ZMSA 3PQCA 4LGWA 5J8CA 4RS8A 3QBVA 2OESA 4JBAA 4FD2A 2P6RA 2DPUA 2DFKB 2BBTA 1N0WA 1WBDA 1G6OA 5FTMA 1FC3A 3KEQA 5LHHA 1U3EM 2DFLA 2IF2A 2WSMA 3W3AA 4NYJR 3PEWA 4A2QA 1NNEA 4BFYA 3LWNA 3BP8A 1U2RA 1I4DD 1S1MA 2GAOA 2IK8A 2NZ8A 2V55B 2P5LC 2ZRLA 3F5FA 3PV0A 1KZGB 3CF2A 5FUXA 3SJCA 2PT7A 4EM1A 1XTJA 4B3XA 2IHBA 1KJWA 3AAFA 1TF2A 2Q21A 3H84A 4IHQA 2YZ2A 1E2FA 2IHYA 2DBYA 3IIMA 5CITA 2UWMA 2WKPA 5TXGA 4PHGA 4EQ6B 5HZKA 4HAUA 3K9TA 2QENA 4NYJQ 2RHMA 6Q21A 2YX7A 3GXOA 2C77A 3EIHA 1B6AA 2DZNB 5C18A 3QP5A 4AWXB 5K1YA 3GFIA 4JLDA 5A5GA 2BKUA 1ZGJA 2CJWA 3LXRA 4B2PA 1GVNB 2YYZA 1KNXA 1UBCA 4CYDA 5ILUA 1Q1EA 3QIAA 4RKEA 3L7WA 1KI7A 2PCJA 2ZETA 2IL1A 3AVOA 3BD9A 3I73A 4BRWA 4DUGA 3ISPA 3AF2A 1T3SA 1TMKA 4JLVA 4XIGS 1E2MA 1E9DA 1GXQA 2D62A 3CRMA 4BWYA 1P4XA 1JXMA 3THOA 4G7OF 1LNZA 3QOPA 2CFXA 2FSGA 3HPQA 2QRZA 3W3ZB 4HSEA 1QHHA 2PG4A 3EC2A 5KSOA 1XB4A 3IL2A 5D5VB 2CG4A 4Q01A 5EP4A 3LLMA 2R3SA 1JGSA 5JHUA 4LYJA 3PJRA 3QPUA 1R2QA 1Z06A 5FOVA 4EFLA 2QP4A 1KMHB 4KMUX 3H92A 5E7IA 3V7SA 3COAC 4KXFB 5A4JA 1YQTA 3DFGA 3SXYA 1ZJ6A 3Q5FA 3L43A 3OESA 2Y75A 2GZAA 3RNLA 5SZIA 1G16A 1XZPA 4KYIB 3QKRB 1ANKA 5CVRA 1ESMA 2BEJA 2JTVA 4X8MA 2VBZA 1I2DA 1YZGA 3WODF 2VP0A 3LVQE 2HDNB 4GYGA 5JR3A 2WWIA 4M53A 1N6PA 1SXJC 3RSLA 1JEDA 1CR2A 1DAGA 3CLVA 4RCYA 4Y13A 4OIRF 2GKSA 1AKYA 3LA2A 3T1QA 2XOKA 3FMSA 1O87A 3LAPA 4HDQB 4NL4H 1XD7A 3TK1A 4DLZA 3GF2A 2O61A 4UJ5A 1HYQA 2CW0F 3EQLF 4Q1FA 2ZRKA 4YDSA 1Z3IX 3I5YA 3H3UA 4C7OB 1HQCA 1BJAA 3NH6A 4DSTA 3X1WA 4Q7LA 2K5UA 2QL6A 1XPUA 5KDDA 5EP1A 2QA5A 1E2JA 2CHQA 2XV4S 1E2IA 1E1RA 5CB8A 1OKRA 3CNOA 2DWOA 4RZUA 5DN6A 3SJAA 3TMKA 3WRXC 5LDDC 1S7OA 2YWGA 4YDHB 2KE5A 4P3YA 1W36D 1P72A 2GWRA 2C04A 3P26A 4PZYA 2W25A 3DQVC 1ZP6A 1X8LA 3LA6A 2ZI5A 1JEEA 3P9KA 2MBFA 1AGPA 2EFHB 2G7UA 4EGYA 1GWNA 4D25A 4BLQA 2CCKA 4MGKR 3GJ3A 1I1GA 5GADl 4L16A 1BBYA 3WGHA 1PP7U 1FFHA 2CO5A 3MWLA 2IXEA 2O8DA 1W4AA 2ZREA 3PUWA 2C6YA 2J7PA 1QNTA 1YR7A 4TLEA 4C0BA 2Z83A 4TLAA 1FSEA 1LEBA 2ZXJA 2WV9A 4Q21A 3DF8A 4JQFA 4Q48A 1ZM7A 3EZ9A 2VO1A 3NEUA 4F38A 5JWRA 3EAQA 1O3QA 2KIMA 3FXQA 2WIBA 3ERED 2A9KA 2WWFA 5E4FA 2REOA 2O0HA 1OIXA 2ZI9A 1LB1B 2C78A 2W58A 1NIPA 1U0HC 2DHRA 4IRGA 1SD5A 2ZS7A 3ECCA 3VEPA 2HEOA 1FPMA 2YOGA 3C3WA 3I3SR 2CE7A 2QE7A 5KSZA 2XJ9A 1Q0UA 1T6SA 3ETLA 1AZSC 2P5KA 2WJHA 3OEEA 4NBSA 2IW3A 2GCNA 5L3CA 2J5XA 5HPYB 3R60A 3ZVNA 3QY0A 1NSFA 1P2FA 1O57A 2PX3A 4EAQA 1OXTA 3AF3A 4NYIQ 4TZ0A 2REBA 2QSZA 1S3JA 2GEVA 1WB9A 1JAHA 3RYTC 4DUGD 4BXUA 3PEVA 5KYKA 3GLIB 1R1TA 4RD6A 4M9XA 1G5RA 1NRJB 3KEOA 4PX9A 4NHJA 2V6ZM 4PHTA 2H27A 5DNYB 5K8TA 3AF1A 2W6ID 3OE7D 3V00A 5IT9Z 2EWNA 3OOPA 4GCVA 4HUQB 1D3YA 2G9WA 3S1AA 1UDWA 2F1HA 4Y17A 4XVRA 2DAOA 3C18A 1HEIA 1B0UA 1FMJA 2VRWA 3H2YA 2NTYC 4PC1A 1Y0UA 2IWHA 3UKDA 1TBXA 3ZZTA 1PUEE 2XNDD 1OFIA 1IONA 2PH1A 4B73A 1C0WA 2Q0HA 2WJJA 1YQAA 3OHMA 4ZH4F 4M6YA 1KAOA 2HCBA 1OHHA 4AYWA 3P4XA 3CUOA 4O5VA 1E17A 3AJIB 1B9MA 1JECA 4TWZA 4E09A 2GEDA 4KICA 1KQ0A 4I1UA 2FBIA 4OJKA 2A5DA 2OZUA 2EA2A 2YR2A 5GJWC 5HZHA 1WI9A 1GUAA 2EV6A 5E3HA 3R9IA 3TDZC 3VKHA 5CVJA 3HHHA 1VTNC 2PJZA 2WJVA 4G0NA 2O8EB 1N0VC 5ICGA 5HCNA 3ZVMA 4KYUA 2BMJA 2IA5A 5JS7A 4XSGA 4C0JA 2M8EA 1FZPB 821PA 1LNWA 1TU4A 1YFHA 1N5JA 2HWVA 2GDJA 1JR3D 4GRAA 2QPTA 2J5PA 5FTNA 3H3ZA 4UHTA 1YKSA 4D81A 3K0FA 4D0LB 3THXA 5E1WA 1DTSA 1XP8A 3BJIC 4B2LA 2GF9A 5SZHB 4A15A 4M1OA 1QZYA 2ZYWX 4JVMA 4ZCLA 2AL7A 2BOVA 4ASUD 4EKDA 1R6BX 1EH8A 3ND9A 3AUXA 3QKUA 4CRWB 3ZP5A 1P60A 1XMIA 4XH9B 5FUVA 4URWR 4C2TA 3OEED 1G3RA 4LB5A 1DPFA 2WBLC 1NSTA 5F98A 1CBUA 3ZD7A 4YG2F 4E5UA 1EWQA 4IKEA 2I1VB 4EPVA 4JBWA 2QTHA 2DW4A 5ICEA 3MHVC 4JLKA 3B73A 1D9ZA 4ON9A 3C16C 2IW5A 1P4AA 1DUXC 1DVRA 3RYRA 1NLYA 2W6JD 3B2EA 4N3NA 4OHYA 2BC9A 1B59A 4NTZA 1R1VA 2OLJA 4P4TA 4BFVA 4D6PA 5L3EA 4ZYDA 3GLFE 2VQSA 2CSOA 1NP6A 3L0IB 4M1WA 1JHHA 4HX8A 2GVDC 1Q1QA 4KODA 1W7PB 1HW5A 4RD3A 2F9LA 1LS6A 4YMWA 2XGXA 3HSFA 4FCWA 3LFKA 3BB4A 4DLXA 2W0MA 2J1LA 1L8QA 1A04A 5AUQA 3E5XA 3HOSA 2NGRA 3AP3A 1Z0IA 3TIFA 3MAAC 4ZIRA 1II8A 1M1YE 4D4MA 2CBZA 2D45A 2KBEA 3A4LA 4KIGA 4PC6A 4US2R 2C8VA 4ACBA 1P5ZB 5JCZA 5JLJA 4Q9HA 4R79A 4DEYA 2RN7A 2A61A 2MMCA 3GJ7A 1E2QA 3O3KA 4WXHA 2P5VA 4UJ3A 1T0JB 3VU9B 4Q4AA 4O2RA 1MOZA 1T98A 1XBTA 5BMZA 2EYQA 2FA9A 2XNSA 2M1BA 3VR2A 1W4BA 3IGFA 4L4UA 4G8XA 5CIWA 5JRZA 3E70C 5KK1A 1E79D 1TL7C 1XDBA 2JIZD 4XLNF 2BM1A 4MGIR 4OQLA 2IXGA 4OHWA 1KSGA 1Q3TA 2W6IA 3T15A 3QXSA 3THYB 2VODA 2IUUA 4TL9A 2OZ6A 3V4RA 1ELOA 3DP7A 1U99A 3D3QA 3ONWA 4OBEA 3ROUA 2FE4A 4YIIA 3OV8A 5BOXA 1WP9A 4NYMR 4Q1EA 1R4AA 3U7HB 4HB0A 1PVOA 1PLJA 1UCRA 2BMDA 4YXWD 1GKYA 1WE2A 4TMVA 4HX4A 1HKSA 5DYMA 5DSZA 3R7WB 1USSA 3E2IA 2EJRA 3TGNA 5EZ6B 3MCAA 5JSZB 1Q21A 1OH7A 3AVPA 2GCOA 3GLFA 3K09C 2Q9BA 1XCGB 2YU3A 4AD8A 4U00A 2OBPA 3K0EA 4CDGA 1S96A 5K8IA 1SVLA 4PC2A 3CF0A 1Q1ZA 2UKDA 2WHXA 3GJ4A 1T5LA 5DI9A 2E1NA 3RS5A 4UNRA 2LF7A 2OCBA 3WGGA 3LXXA 1YO5C 3WYFA 2IRFG 3UMSA 1Z0AA 3WE3A 3BGWA 2F6RA 3SI7A 3GFOA 2IUTA 4KLZA 3TDUC 4E03A 2ZVQX 4S35A 2OQRA 3R0JA 4EQQA 3SZTA 1IN8A 1E2DA 2V79A 1YZTA 3LD9A 4OMYA 2VP2A 4UNSA 5EE0A 5EJEA 2BCJQ 4A8JB 1R0WA 4BLPA 3EPHA 5GJBA 4YLGA 2J7PD 3U3JA 2HR3A 2K4JA 3B8HA 5DIFA 1FBQA 2FNPA 2Y0MA 1PDNC 4KAXA 1W48A 3TR5A 5C2JB 5J4KA 4CO8A 2WWYA 1LS1A 2WAYA 3DO6A 3BPVA 1E9FA 3CZPA 3GZ6A 3UK6A 2FEMA 2CHGA 3GJ5A 4DDTA 1X37A 2XAGA 2EQBA 4IVPA 3U4QB 5CJ2A 4TYQA 4AY2A 3OIYA 1GNRA 4PPGA 1RPZA 5CLLA 1W7PD 2VTKA 2ZTSA 1AZTA 2WC2A 2L4AA 2ZROA 3KJIA 4A2PA 5HKKA 2O8CA 1E2PA 1KDTA 4ZI2A 1P7CA 3NBFA 3NEJA 3TSZA 4M8NE 1IOZA 1XMSA 5LLQA 4IXNA 1YRAA 1JR6A 4HB4A 1S3GA 4ZYGA 2D06A 2J0SA 3U5ZB 3THWB 2RC4A 1DDNA 3V8JA 1VPLA 2H6CA 3TBKA 3VR3A 4GP7A 2ZSBA 1R7RA 2VEDA 3RRZA 4KIBA 1DP7P 4B33A 4M72A 3TKYA 5BQTA 1QVRA 3L09A 4LX0A 4EJOA 3SZPA 1YR9A 2ELHA 2HF9A 4FXPA 4LRWA 1M34E 1A5TA 3E6DA 2AD5A 1CR0A 3IWZA 1M6NA 5ICCA 4B3FX 1C4OA 1C9KA 2DFIA 2I3BA 2XEXA 4G5SA 4QNMA 4EMSA 1G5TA 4BFTA 5L8VA 3ADBA 2JLUA 1QHGA 2CE2X 3EA0A 1GTVA 3L8YA 1XN7A 1NBMA 4U7DA 3K70D 2LCFA 3U7EB 5H6QA 1AS0A 3B60A 1VYUA 4IVNA 3FHTA 5D8LB 2CL0X 3OFNA 2QQBA 3WG9A 3Q9VA 1BIFA 4PQYA 4Q19A 3U3RA 4MQVA 2AWOA 1WSUA 4NCHA 4QXAA 1HTWA 4TYYA 1U5TA 2HZTA 4NYIR 3MZYA 5DD4A 3BDDA 1HKQA 2Z5FA 3B78A 2FE3A 3MWJA 3QBTA 2P5TB 2V6JA 1E2GA 3FMOB 5KU1A 4MGRA 4CEHB 4G6DA 1XD2B 1J59A 4UNOA 2D3WA 4RAZA 3F21A 1BMFD 1OXXK 2HS5A 4BLRA 3SC3A 2PFBA 3PQJA 5FBVB 1SXJD 4LI0A 5JHGB 3HIFA 4IOKA 1CRQA 4QRHA 1S9HA 4PZLA 2CXXA 5JZVA 3A8TA 4UXJA 2HT6A 2HYIC 5AONA 3KXLA 2JLYA 1ZBDA 2QY9A 3QG1A 4LWZA 3RAPR 3I1FA 1CF7B 4UXIA 3U2QA 3T0YA 4MH0R 4DCTA 2JATA 3GD7A 4MUAA 2G9NA 1DARA 2R7DA 3WMFA 1JPJA 2IYLD 4S2EA 3TAUA 2YSRA 4NH0A 4P31A 3WU0A 4KLNA 1UADA 4C0AC 4F93B 3ML6A 1NKSA 2Q8KA 3BFKA 5JCPA 2PQ8A 2Q9CA 5HTKA 2DYKA 5C4MA 4G3XA 1TTYA 2ZIAA 3MUFA 2AD1A 2HQRA 1UF9A 2DCUA 1Z0JA 2UZ3A 3LY5A 2PBRA 4AYTA 1XTSA 4EPTA 2GESA 4YMVA 1MJBA 1R7JA 1O3YA 1W0KA 5HCIA 2YC4C 4HV6A 4QGFA 1CR1A 3KZYA 4PCQA 5LGUA 3FMQA 1KO8A 1F2TB 5D6FA 2W6JA 2QYOA 2ZYUX 1S3SA 4IDHA 2OCYC 2VBXA 4FMCF 4BFZA 2JLZA 4RZXA 4D26A 3B02A 1L4UA 1TQDA 4OOIA 4QNRA 2OD5A 1GXPA 2EU8A 2NZJA 5AJYA 2ZANA 2GXQA 3AP1A 2AHOA 3V7CA 1JQJC 2LSOA 1PLKA 3B85A 2C96A 4Z54A 3D8BA 4WZ6A 4KHZA 2YNMA 3AKCA 1KI8A 1EG7A 2RNJA 1K6OA 3LH5A 3U3OA 4AG6A 4P5OA 2YC2C 1IAWA 3WHLA 5D5UB 5DGXA 3ASYA 1W0JD 4IEIA 5G53C 3HYIA 2GEUA 4LHYA 3FWYA 1U0JA 4OK5A 1P6RA 4JJZA 2ZAOA 1Z7UA 2GA1A 1J2JA 4JYBA 1OYWA 1IXRC 4LYFA 1OB5A 3I61A 4XRFA 2RMKA 2QUZA 3W9YA 3N97A 2B8TA 4MRRA 3KQNA 4R9UC 2GWHA 1Z05A 4BFUA 1W36C 5ILSA 3ZLJA 4BH9A 5JFGA 2FXAA 1LVAA 1X3UA 2D4HA 2QPAA 2VBWA 3Q3JB 4R98A 4EJVA 3F8BA 2OFXA 3DM5A 3KP4A 2HUPA 1WRJA 4TSFA 4XSZF 2C9YA 4M6XA 3O8CA 2BV6A 2QP9X 5D6EA 3NBYC 1KU7A 2IS2A 2HV8A 2PX0A 4M22A 4EM0B 1XMVA 1FLIA 4FIDA 3QU6A 1H0MA 3ABTA 1JB1A 1J8YF 2G88A 3BIFA 1KJYA 4QJ4A 3T1TA 5DCFA 4ESJA 2FOLA 2ZYTX 4WWCA 5F6FA 3KXKA 3VKWA 5FPHA 2JLXA 2H6BA 2X4HA 3PXGA 2GAUA 1FSHA 2FEOA 5CK4A 3WY9A 1SVMA 1X86B 1X8KA 2F43A 3C5HA 1OV4A 1EFRA 5AWFC 3ZGXA 4C4PA 3QG5A 3X1XA 1DAIA 2DPXA 2ORWA 2Q3HA 1U8ZA 5E8IA 2JZYA 4LGMA 1MABA 1G8FA 3EZ6A 3LW7A 1T2KA 4OYHA 5DI3A 1IJEA 1AN0A 2R62A 3UXMA 3CRVA 1R10A 5LGNA 3TO7A 5EZ5A 2C9OA 4PPNA 4QJ3A 4GOKA 4EPXA 4OMZA 4ACAA 2FN4A 4CW7A 3T35A 2J87A 2VT3A 1OT3A 2G6BA 4MYUA 3FXUA 4WXCA 4ON0A 2FPLA 2VHCA 2XJ4A 4DZZA 4BHBA 4RKFA 1E0KA 1WF3A 3QAHA 3IIJA 2NS0A 5TDHA 3SDZA 3CRRA 4Q1AA 1GHCA 3K9HA 2ANBA 3ZQ6A 1D6JA 3CO5A 4BEBA 3AV0B 3KQLA 4A12A 2GA2A 4ESFA 3WU1B 1EFUA 1HE1C 2GCPA 2W2TA 1TTTA 2QN6A 1IHUA 1O3RA 5LHIA 3K1PA 1UBEA 3DZ8A 1NMXA 1MKYA 5BS6A 4M1YA 4DLTA 2OAP1 2AN9A 2FSFA 1KMHA 2ZJ8A 4LZZA 2L01A 2FV8A 3WTXC 1S29A 4D4KA 2ACJA 2G83A 3KJGA 1ONBA 1O3SA 5LRRA 3E6MA 4P4SA 2H8KA 3B1WA 4GMXA 5ANRB 5GVRA 2W2VA 3BS4A 3DXJF 3IUYA 3X1YA 2H1LA 3I59A 2QG6A 1OH6A 4DDUA 4TV7A 4Z1MD 2ZU0C 1F5NA 2QMEA 3JAMZ 4G5RA 3FOZA 2DQRA 2VHTA 2IS4A 3U61B 2ZUCA 4KFRA 5IDVA 3SS8A 1OFHA 4YMTA 1BC7C 2JDIA 2J5OA 3K0SA 2VC1A 1N5IA 1YRBA 3A58B 4ZDJA 3T12A 2QBYA 4N1AA 1FY7A 1NN5A 1R23A 2KRFA 2QAGA 1E0SA 1G4UR 3BPXA 2OFOA 3WBJA 1UM8A 3GEEA 1Z6GA 1X3SA 1Q12A 3E1SA 4MKIA 5FD6A 3QPWA 3VR1A 3TSWA 1RRFA 2QTFA 1KI3A 6PAXA 5DO9A 5KDLA 1HSJA 3RC3A 2K7LA 3QKSA 2XKPA 1BYIA 3RRMA 4B6FA 3CONA 1H9GA 1I4LD 2C99A 1U2WA 1W46A 3SBEA 2HYFA 3BZ6A 3HSEA 3GWZA 1COWD 5J4LA 2QSYA 3KTAB 3GLIE 2ZRFA 2JAQA 4BLSA 2JPBA 1W4CA 2ERYA 4B8XA 3CO6C 3C15C 3ZS8A 1E3MA 1Z91A 5FTLA 1DAEA 1MO3A 4X8OA 2V54A 3MWMA 5FLXZ 1WKMA 2EVWX 4XWKA 3O8BA 2QNRA 2CLCX 3CX8A 1QZMA 3EDPA 4DWJA 1W49A 3U7FB 3K1MA 1JXSA 2B0LA 4NCKA 3BE4A 4WZBE 4V02A 3WTTC 5L3QA 2DWZB 3I0TA 2YV5A 4PQFA 5EP3A 3ZMVA 4PHHA 4IRIA 1M74A 1RYHA 3ZIAD 3CB4A 1S1CA 3CWQA 4NKRA 2QI9C 2X19A 1E9CA 1W44A 2RGGA 4TL6A 4RD4A 2ZMEB 4ZO4A 4OL0A 1T6NA 3P1JA 1KTVA 1LVGA 1LF5A 3CX7A 3IILA 4DLUA 2WV0A 1SQ5A 2H5EA 4E07A 2Z0MA 2GXGA 1KI9A 4R71A 4CEIB 1ULYA 4LYAA 4PAMA 3K70B 1TW3A 2O0JA 3GX4X 2AK3A 1HY3A 1RRCA 2YOHA 4KSBA 4DB2A 4D82A 1EWRA 2A07F 4ERNA 4QG7A 3M1IA 5FL3A 5JMTA 5J6XA 3JZMA 2E1RA 1Y63A 2XSZA 3ECOA 1GRNA 4M0LA 2IYVA 4MGZR 1FOKA 1V5WA 2PZFA 2VHUA 4HQEA 1A2BA 4JSTA 4D0NA 1II0A 3QF7A 1XFAA 2ONKA 3CTAA 4L5BA 1LDDA 2R6DA 5TMPA 1IRFA 5TRDA 5G40A 5JS8A 2HXSA 5CYVA 2EV0A 2JRTA 2HGCA 2CVFA 2XAUA 3SU8A 3R4KA 1KYIA 1FL9A 2IYQA 2DB3A 3S1AB 5TY0A 4L9JA 1KU3A 5AJXA 4A1FA 1Z6TA 2UXXA 4ENNA 1E2NA 1G8GA 1X6VA 3AF0A 5LHGA 4WK8F 2P4WA 3DEUA 3Q9SA 2OZEA 2QTVB 3QI2A 3KL4A 2J0UA 3RS3A 4PTLA 4S04A 3LA3A 1T8UA 2BVNA 5EXTA 1FT9A 2WKRA 4RD2A 4AG5A 4BECA 1RRPA 2GQQA 1DBSA 3W8NA 2KJCA 3NHAA 2WMOB 2EV5A 2FG5A 1E2XA 2GIVA 2XB4A 4OQFA 1X1SA 5K5RA 1F5TA 2D2WA 5IT5A 3VNUA 4JL6A 3EETA 2NQ2C 1YR8A 2Z6VA 1E2LA 4OU0A 4XOIA 3CRQA 1XTIA 5L3SB 2ODBA 2O8EA 4LFUA 2DVWB 3PEUA 5D3MA 3EPJA 1VMAA 1G18A 1S9DA 3QUSA 4OIOF 2QE7D 1N5LA 1LQ1A 4HAXA 3V8KA 1QF9A 3U7GA 3A1TA 1YZUA 4OIQF 3F8TA 2VT2A 4O6JA 1YHNA 1ZC4A 1ZD8A 2OILA 4PSVA 1JNYA 3SFVA 4EJSB 2WWGA 2PMDA 5EQTA 1ZLKA 2DO7A 2FZ4A 5EUMA 5J47A 1XCBA 4DLSA 4LK2A 5FOTA 5J4HA 1KI1A 3A37A 3CR8A 5DD8A 4Y15A 2XB2A 4LC1A 2XAHA 2A5YB 3G5UA 3OIUA 4OQNA 2BBWA 3TVTA 3BK7A 3L2OB 4C9BA 1GKIA 4EGZA 3E5UA 4MHGA 1N5KA 2I1QA 1BC8C 4LG0B 2REXB 2Z9OA 1WRBA 2IUSA 3HRMA 3GFMA 4TMTA 4Y0VA 4FWTA 4O25A 2VF7A 4KSCA 1UHWA 1BI0A 1EH6A 3GJ8A 4D4JA 2FMXA 3HRSA 1D8TA 2BDTA 5HDNA 2WOJA 3NWJA 1ZM3A 2XNDA 1G1MA 2P0EA 5FTJA 1XJ0A 3BH7A 1P2UA 2CLSA 3EX7C 1G7TA 2QEQA 3NDPA 2ZFWA 5GJCA 2K86A 4CIDA 1IAQA 4LOAA 4II7A 4HA8A 4IVQA 1NLFA 3AKYA 1OFTA 1GDDA 3IDQA 4HDOB 3GO5A 5JVTA 5FI0B 2ZRBA 1P4SA 2ATXA 3UATA 4XLPF 1EK0A 1ODFA 5CK5A 3PEYA 2RGCA 2LKDA 1J8MF 1CGPA 1YZLA 1SKYE 2P3SA 3OIVA 2CMKA 4I1VA 4HQMA 4KN4X 3QE0A 4RY2A 2XTZA 1WWXA 4IPAA 3IC7A 3ZPLA 4DLYA 1F60A 2ZE5A 3UWOA 4W9MC 2WPDA 2BMEA 4F7WA 3A36A 1US8A 3AGQA 3RDPA 4URYR 3D31A 4OI2A 1AQYA 2Y8EA 1L3LA 1I27A 3L82B 3TJZA 5AUPB 1XPRA 1MO6A 4DCSA 5ELXA 3BWDD 1E2KA 2IYRA 3QF4A 1ZRFA 1QHSA 1HW1A 4OHXA 3W6NA 3N5CA 3LA7A 3GJ6A 3MMPA 4GFDA 1OB2A 1A1VA 3I32A 4M1TA 2QMUA 3K70C 1OXUA 1S7AA 3HSRA 2H16A 3RABA 3KE2A 2NIPA 5FBQB 4U88A 4LBZA 5KUTA 1E1RD 2F1IA 2ISYA 1FOEB 3SR0A 4FMCB 3EZFA 1SAXA 3Q7QA 2IYSA 2ZCWA 4TYWA 4NE2A 3TH5A 1TQIA 1GVJA 5JSZA 1LF0A 2L3DA 4Q4LA 3VNVA 1WBBA 3LVRE 2IA1A 4JBYA 1RUOA 3MFKA 2HYGD 1G17A 1GRRA 3QPTA 4H0EA 2FSHA 1GNQA 1FWZA 3HJNA 4A3VB 1JR3A 4LBVA 1IN6A 3P9CA 5LD2C 3V8LA 2HEIA 1R0XA 1ZU5A 4J0QA 1FTNA 5AJVB 2OT3B 1G41A 1BIBA 2K27A 2W85A 3F23A 4LLNA 4DDVA 1KGDA 3UPUA 5JEEA 2IXFA 3VR5A 1HT2E 4A2WA 4A4DA 3T61A 4YMUA 2OXRA 2XIGA 1N6HA 1ZM9A 4YFNF 4JLNA 5JEDA 3N2EA 3WTUC 5TARA 1KI6B 2WTEA 4K2EA 4JK1X 3WE2A 2BBYA 2F7SA 3FMIA 2IS6A 4JSYA 2Z43A 2JLRA 4AKEA 1IN7A 2HLDD 2QWWA 1G3QA 2XTMA 4QJ5A 1VG1A 4BZPA 4TMKA 2GJAA 1OF1A 1JHFA 2E7WA 3CR7A 5CYOA 1M7GA 1KDPA 2UVQA 3JZAA 1CULC 1E0JA 1N0UA 1U81A 1W0JA 3WTYC 1W0KD 3AKDA 3SHFA 3NH9A 5H1YA 3TW8B 3U4QA 2ZRHA 2V6IA 3H4MA 2G3YA 4NYMQ 5FOUA 4HB2A 4I0BA 4DDWA 1ZG1A 4RCZA 2PBIA 5TJJA 1EX6A 2JLSA 3AKEA 2HLDA 421PA 3KQKA 3SQXA 1AQUA 3HRUA 2WAXA 4D0PA 2IWRA 3GLXA 2WJYA 1SKYB 5GJVC 2PLFA 3QXHA 4MYCA 4P32A 5DISB 1FUUA 1V3FA 3QXJA 3KX2A 4DSUA 4I98B 3RI4A 1E32A 2GILA 4KN7X 2A3RA 2GHIA 3SOPA 3AQ4A 2YPRA 4FWIB 3JVVA 1EXMA 2QAGC 2EB7A 4Q4HB 4QBGB 3MLEA 1ZW6A 4I1OA 1GILA 4KNYA 3DPLC 3FYHA 3KB2A 1BMFA 1KI4A 5H68A 4D2IA 5B64A 1YU9A 3BB1A 2VA8A 3G82C 4E22A 5E20A 1TF5A 3VLFB 4I7HA 1AGRA 2W2XA 3GLGE 2CL6X 4TTRA 3L2CA 4LRSA 5L3VA 4GZLA 1ESNA 2EFNA 4HLXA 1VCMA 1ZRHA 3DMDA 3CZQA 2PN6A 4U0WA 5JWHA 3QKRA 5F1RA 3ZZUA 4QLCU 2W57A 1HURA 1QVAA 1DAMA 2RGDA 1SVSA 2C2HA 2IA0A 2ZJBA 3K53A 4KFUA 2MC3A 5FR1A 2COMA 4QBHA 2OCAA 4TMZA 1W2HA 5DYIA 4QBIA 4ZDWA 2BE5F 2Z5UA 5HS7A 1N3BA 4HAWA 4JL5A 3LX5A 4LHZA 5DLQC 4IJAA 1IUYA 3MJRA 2F3RA 1OIVA 1NVVQ 1DE0A 4DCNA 4AIIA 3BJ6A 4ESBA 4DBLC 4URZR 2BJWA 1P9RA 1DADA 2FF4A 1XTKA 3B13B 1DG1G 1XD2A 4HATA 2O8FA 4OK3A 2ECKA 3D6TB 2ZS9A 2Q0OA 2ZRMA 5IF9A 3P9IA 5AR1A 2A5GA 2OV2A 3CUQC 1SD4A 2ASEA 2Q3MA 3SE0A 4G7HF 2G0NA 3NQOA 2ODNA 1KY2A 4MKGA 3G3ZA 4I99A 3VX4A 4POAA 5FUWA 5EE1A 4TTQA 3ZMTA 1W1WA 3RC8A 3ICQB 3FWEA 4K46A 3WMGA 3J81K 1WQ1R 2O8DB 3VQTA 2CK3A 3GLGA 3SZRA 2YWHA 1WCV1 4GO1A 5IK2D 5HLGA 1U9IC 4CZZA 4HYYA 1E4YA 4MYHA 2JGNA 2R44A 621PA 1ZC3A 4QM6A 1Z28A 2PLRA 4WF2A 2A5FA 4KU4A 4WXPA 4DQ2A 1G3UA 5HOOA 2C03A 4Q00A 2D1HA 4FHTA 1A2KC 1FX7A 3EPKA 1IRGA 4MA4A 3L8ZA 1PV4A 2GF0A 1VCIA 4NB5A 4GP6A 2PEYA 1RC8A 4MRSA 3A1WA 3EA5A 1PZNA 1F2UB 3N4MA 3FFAA 3DZDA 4Z1MA 1LDJA 2R6FA 1KQ9A 2H17A 4GT1A 3U6KA 3FKSD 2ODWA 2XAQA 3M9AA 4RB0A 1TUIA 2FFHA 2ZE6A 2P6TA 4KMFA 1P61B 3AVVA 5DHAA 4ILEA 4TT3D 4AIHA 1G8YA 2RV8A 2KRKA 3CH5A 4XSHA 4MRPA 1NHAA 3LQQA 3F8CA 4IFEA 3AEZA 4F4CA 2KBFA 3IPYA 2Z4RA 4V0MA 5AJWA 4HYEA 2N42A 5SZJA 5FUYA 1K8RA 1T0HB 3EIEA 5CDFE 1SD6A 3IWFA 1RIFA 2VP5A 5E95A 4B2IA 3F3XA 2ZRAA 2Q9AA 1NVWQ 3QEJA 5L3GA 4BZQA 3RDIA 3E6CC 4DVGA 4RD0A 4FWGA 4OQMA 3SJBA 1I2MA 1NVVR 3FHOA 1VDZA 5EEHA 3W6JB 3F22A 4IFBA 4EFMA 2F55A 3RIRA 2J46A 3Q5DA 1OE0A 3U3MA 3WP0A 2RQPA 3CPEA 1G9XA 2V8OA 2C98A 2QVOA 4LV5B 1JAIA 3PIRA 1K5DA 4KYWA 1GG2A 1MR3F 2IF0A 4JT4A 1MGTA 3GLHA 4TMXA 1QDEA 4WIAA 1RJ9A 1ZM4A 3CW2A 3KKOA 1E0AA 2L54A 2X0LA 2PEZA 4Y0AA 2ZS8A 3WNBA 2QQ0A 2ZRGA 4G94A 2RGAA 2JT1A 2UXNA 3FPAA 1LY1A 1J0RA 3UANA 4GI7A 4Q4JA 4HLUA 1GL9B 1XMAA 2H92A 3GFJA 4HZUB 1XEWY 5FR2A 3EUHA 1VTKA 1RRGA 3CX6A 5FPKA 2P8TA 2OE2A 5FB2A 2QPOA 1FTSA 2V6CA 2B92A 4B34A 1SKQA 4N0EA 1EX7A 5FFZA 3VB2A 1BIAA 1KAGA 4AKHA 4C0SA 1FMLA 5D8KB 1P73A 2IS1A 2VH5R 1QGPA 3NC0C 4AIJA 3T5DA 2E7XA 2A6HF 2AFIE 2VLIA 3GEHA 3QVVA 4HOBA 1MV5A 3EASA 1D2EA 1Z07A 3V4FA 3THXB 1HXDA 1PUIA 2BIFA 4EDHA 5IRCD 2CGPA 5IT9K 5IHPA 5DN6D 5UKDA 4KITB 4WCGA 1ZU4A 2H18A 2WJGA 1VG0B 4WVFA 4B3CA 3NHBA 2MA3A 2J0VA 2BEOA 4LDJA 3CM0A 5JRJA 5HE8A 4EM2A 1P9NA 3GFTA 3LDAA 3B1XA 4PSKA 5L3BA 3DOFA 3JSPA 2BHRA 2PL3A 3MD0A 2B8WA 3UG7A 3V9PA 1U5TC 4W5WA 1UPTA 1REPC 3I62A 3EXAA 4EPYA 4BFXA 1YS6A 1L4YA 4LK1F 1B9NA 3DPTA 4M9ZA 1I4TD 2PMUA 1W36B 3R8CA 2F5FA 1SFUA 5C1BA 1ZUNB 4P4SB 2D2FA 2JLWA 4TZ6A 3NBXX 4IDQA 4FW9A 4YFKF 5H70A 4OK6A 4RFVA 4WX9A 3RS2A 3CUQA 1XGOA 1J90A 2QU8A 3KP3A 1J99A 3MCZA 1DPRA 4KFCA 1XGNA 2LKPA 3I53A 1BI2A 3BY6A 3KLOA 2XRNA 2FRHA 2RGVA 1S6LA 3F8FA 1QRAA 4DEXA 5A0FA 4GPTA 4TLDA 5EUQB 2RGNA 2ONJA 4A82A 4HAZA 3M6AA 1G7RA 2F2EA 1KK1A 2YOFA 4OIPF 1EFRD 2UZKA 4FX0A 4FX4A 2ZSDA 3PUXA 3Q72A 1NN3A 4NZYA 5BN5A 3U2RA 4L5JA 3A1SA 1NJFA 1R22A 4QWQA 2XXAA 5CVVA 1T3HA 2FMLA 5F64A 1FPQA 1WA5A 3VU9A 1ZUIA 1NMYA 1ZNYA 1KO1A 3ZYCA 1Z63A 2ATVA 3DV8A 3TQNA 3QKSB 4DIDA 2KB0A 3HU3A 1TX4B 4RAYA 1Z47A 3QENA 2VP4A 4JKYA 4M1MA 4L18B 3HDTA 2ZI3A 2GK6A 2ZU6A 4LUCA 1KYWA 2MD5A 2OQGA 2GZWA 4URUR 2Q3FA 1IBRA 4G01B 4I01A 3S2WA 2KI5A 5J8FA 1U8RA 1KOFA 2CCJA 3KP6A 5A2QZ 4QHTA 1FW6A 2P6SA 5DH9A 2M45A 4MDFA 4UUVA 1LEAA 1UHMA 3CPJB 1YZQA 1E6CA 1HUQA 4L0ZB 1EGAA 1FP1D 5HLHA 1DAHA 1GL6A 1Z22A 2HKXA 2AKAB 2BBOA 2QT0A 3I8XA 3QPVA 2QRNA 3R7WA 1R0YA 4Z51A 4IDNA 1GKUB 3KFVA 5EXPA 3ZIAA 1KO4A 2IYWA 4PFSA 1YJ5A 4OQXA 1R8SA 1M7HA 1N6RA 3PR1A 1P6XA 4P96A 2DFTA 4UXHA 3SYKA 2ZMEA 1JBKA 1N6OA 4DB4A 2IT1A 5DYGA 3FFBA 3O2PE 3IKJA 2J7KA 3EC1A 4QHSA 3TR0A 3I8SA 1TNSA 1S8FA 1DAKA 1VECA 4L5IA 5LBIA 4N9HA 2MSEB 3KP5A 3MAJA 2XROA 5ICFA 1G6HA 4LV8B 4LK0F 4R1HA 1HQYE 1ZARA 3I72A 3L0SA 4ENJA 1R1UA 2PZGA 4TLCA 4B09A 1DS6A 2NNNA 4US0R 3TSOA 2XTNA 4PC7A 2EFGA 5EP2A 2X1VA 4A8JA 2O52A 1OXSC 1G7CA 1HH4A 2WMNB 2QAJA 1XX6A 1MKMA 3UIEA 2WM9B 2ESHA 2NG1A 1M8PA 2ZM5A 1XGMA 1KU2A 3MG9A 2CHVA 5TB5A 4RFSB 1TNTA 1G3IA 5HDGA 1G20E 721PA 2ZITA 2VC0A 4LJ8A 3M8EA 1NY5A 1XDUA 1AM4D 4M9QA 4B74A 4LBWA 4BLTA 4EJSC 1GRQA 3IRRA 2ZI4A 2P7CB 1OJLA 1XTQA 4B43A 1P4WA 1T4GA 2N1BA 4C3ZA 4DT1A 1QO0D 2ZSEA 1DO0A 1R00A 4AKIA 4MQBA 1RZ3A 4HAVA 2G0TA 2J0UB 4G6QA 3F0TA 3BH0A 4JMPA 2ZKZA 4H1VA 2CL7X 1QQIA 1ZLJA 2OFWA 1HT1E 2K4BA 4GXOA 1MO5A 3F3YA 4Q9KA 2MSDB 4NP6A 3X1DA 3R61A 2H09A 1E9RA 1TEXA 3B7GA 1NLZA 2PMKA 3K9NA 4TMWA 1M2OB 4DSNA 1ETUA 2F9MA 1OPCA 4G9YA 3T34A 4L9WA 4PDKA 4ABYA 1XXHA 3RWMB 3QEOA 5D3MB 4JLOA 5LB4A 1E2EA 1QHIA 1KK2A 3MJHA 3WHKA 4LBYA 4GL2A 2O8BB 1EESA 3VR6A 4ZPXA 2ZSFA 4V0ME 2DU9A 2HTJA 3RKXA 3BFXA 4RZ3A 3AVUA 1ZIOA 3B82A 4HZFA 4ESHA 3LNCA 1ZREA 1ZRDA 2ZEJA 3O6BB 2XASA 3HR8A 3ZN1A 4EJWA 3WTSC 1K78A 4PAOA 4UQOA 2E1CA 3A4NA 3SYNA 2ZXUA 4TQ9A 3ZD6A 1XCMA 4ZKEA 3VMFA 4IXMA 4XD7A 1OPXA 2DT5A 3AVQA 3TQCA 3VAAA 4CEJA 3TUZC 3U44B 1E9BA 2FSWA 4HEJA 3PQKA 1R36A 4ZZDA 1KYZA 2IJLA 2ZRNA 4TQAA 3M4YA 3R9XA 1U5TB 2NRAC 3B5JA 3ZS9A 1OHHD 4C0LA 3N2IA 5CJ9A 1E1QD 1KIMA 3GMTA 2JJ1D 3CH4B 3RS4A 3K0AB 1BOAA 1ZRCA 4PAQA 3CJNA 2DR3A 2Q6TA 1KMQA 2RAPA 3JAMK 4AD9A 4Q47A 4EVIA 1OYYA 4EJUA 4L0YB 4PGGA 1UDXA 3NKVA 2H57A 2QMHA 2ERXA 4JIMA 4RGXA 4CF7A 2R9VA 1KGSA 3RHFA 4PXAA 1SVKA 2P5SA 1H65A 5KTYA 2LWIA 3NXSA 1RYFA 5FH9A 5KHOC 1ON1A 1NG1A 2MSCB 3GVAA 3QJYA 4BQSA 4RGUA 4GITA 2DBBA 1G6NA 5JI6A 4PR0A 4DLRA 4EFNA 4DSOA 5EXXA 1XMKA 3J80K 5IT3A 3PCRB 3KLNA 4DCUA 1U0LA 2O6GE 3FB4A 1AS2A 3IPXA 1ZUHA 3K0CC 3D7MA 5J40A 1D8JA 1XTRA 3GPLA 4A6PA 1XEXA 4X8HA 4HW0A 1MH1A 2NNYA 5CVIA 1E96A 3MWKA 4PANA 4JLJA 4WAUA 5KNBA 2X77A 3LBHA 4LJAA 3GP8A 2QZ4A 3O47A 4PO1A 1AOYA 3GJXC 4V03A 5BN3A 2VE9A 2VXZA 2OXCA 2YJTD 2ZRJA 3MEXA 1IF1A 1F2TA 2OHFA 5E7JA 1I1SA 2ADUA 2FOKA 4HX7A 2A3SA 2XHKA 1KK0A 2P67A 4FI3C 2FU4A 2W0SA 1KSFX 1U98A 2QQEA 3SQNA 1HBXG 2HYDA 5KNDA 4QHYA 1ZD9A 1S2MA 2AFHE 1YG2A 4F7ZA 2AXLA 1USTA 2XAJA 4HF0A 1FUKA 2BJVA 1SGWA 4NU0A 5JECA 4BPBA 4PQRA 1SFXA 1GP2A 2BBSA 2J45A 2EFWA 2MMGA 3JW4A 2FWRA 3VKGA 3WP1B 2JASA 1BOFA 3G73A 1Q57A 2YHSA 3T1VA 3GLHE 1E9AA 1CXZA 1KO5A 2R6AA 2ZRDA 4HLUC 4JKIA 3PUYA 4BZXA 3EZ7A 3I54A 4WA7A 3HHGA 2CK3D 3DKPA 3K9GA 3UWKA 2HJVA 3NC1C 3PITA 3LW8A 3BRWD 4PHFA 4Q1BA 5LRSA 4EJTA 2IVMA 2V9PA 3L0OA 1T91A 2QGZA 1P62B 2ZQ5A 3HRTA 1JR3E 1IW7F 4QOSA 3JTHA 2HXYA 3QOFA 1QZXA 1U90A 1NJGA 2VSXA 2PI0A 2IEYA 2DWQA 5LGTA 4LJ4A 4AWXA 2VPPA 2RGBA 2ZR9A 1EFTA 3Q85A 3CO7C 2CJWB 2YWEA 1G4AE 4Q5IA 2PT5A 4TYNA 3KQHA 2F5EA 2VSOA 3Q8XB 1G3TA 4JVSB 1FYKA 3C4JA 2EFOA 3KZ1E 5LEJA 4LPKA 4M1KA 4K81B 2GJ8A 4PSAA 3BAFA 2EYUA 2ZSAA 3A4MA 1LFDB 2GZHA 4QGGA 4BNCA 1GAJA 4KO8A 5LBQA 1PJRA 5KO2A 3KKQA 4JVNA 1CJVC 1L2TA 2RB4A 1HW2A 2DK5A 1TUEA 1R5GA 4A6DA 5ED4A 1U8AA 2F1JA 2IYYA 1V4RA 3R20A 2NPFA 5L3FA 3FDIA 1QG2A 5J4YA 2HT1A 4D0GA 3AVWA 2F43B 3F72A 1LTQA 3M0EA 1CEEA 1F9NA 2DLLA 2JJ1A 4L9SA 5E1ZB 1AS3A 2EWVA 2H7VA 3T5GA 3QP6A 1T38A 1HKTA 3GFPA 5DI3B 5C46F 1H8EA 1ZNWA 5FBRB 4NCJA 3AVYA 1G19A 3A1UA 4ZV4A 2ZJAA 4KI0A 4Q18A 5E18F 4GSYA 1ODDA 1IJFA 1LV7A 1R0ZA 4A6XA 4B6EA 2PLYA 2HQNA 2CDNA 2GXBA 4G5QA 1RIOH 1MT0A 1IN4A 5JJLA 3E5HA 3BJOA 4NONA 2J0QA 2G1JA 2WPDD 4HI0E 2YKGA 1CS4C 3DPUA 4UNNA 1N6NA 5H8WA 4MDEA 2ANCA 5EXSA 2GRJA 2FEZA 3U6BA 4IDOA 4Q4HA 4CHUA 2GAAA 1ZCBA 3DVLA 4PO8A 4HDVA 2Z99A 1XWIA 4DLWA 1Z6XA 2CNWA 3LFUA 1IZ1A 4CT4B 5G3YA 3KQUA 1IN5A 3IEUA 3VX3A 4EPRA 2GJ9A 4C7OA 1H8HA 1Z0FA 2FPMA 4IRHA 1TQ6A 2FZLA 5FFMA 4G7ZF 4M74A 1P75A 2V9VA 4NCNA 3SN6A 5K5OA 2DWPA 3NRVA 1ZVQA 1K6MA 3RKWA 4IF4A 1AIPA 2V1UA 4TL7A 4BHPA 2LKCA 3LX8A 4UNPA 4FMDF 5KPJA 1H8HD 3IO5A 4U02A 1E98A 3CNNA 1W5SA 2GETA 2NOAA 1BI3A 1G3WA 3ZN0A 4HLQB 1EH7A 1LB2A 2G77B 4MTDA 4S05A 2GTPA 2KWIA 4JLAA 2WJIA 2P2LA 3Q5EA 2O8FB 1CF4A 1J7KA 4IXAA 5KVRA 2QAGB 1KDRA 2XITA 3KZZA 3ADKA 4H1UA 3FKQA 2C9CA 4DCVA 1Z2AA 2HOEA 3LAJA 5BPDA 4P4UA 3TNFA 2GNOA 4M1SA 4WXDA 4N0DA 4P0TA 3HYTA 2WVJA 1Z6YA 1GFIA 4I2OA 1JALA 2ZR0A 3MRSA 3C1DA 1XU4A 4KCGA 1KA8A 2F5CA 2QM7A 3HOTA 4HZIA 3AH8A 2BEKA 3KTAA 1XEFA 2IPQX 3RJPA 2FFQA 2O0YA 1Q22A 3TRFA 5BXQC 1F6BA 4M4SA 3VTKA 4UXNA 3GLGB 5FOXA 5J4VA 4IOJA 1SXJB 2CCGA 1FP2A 3IBYA 4LCBA 4FCTA 1G291 4AI6A 1L7VC 1MO4A 5AUOB 3OAAD 3QSYA 4EUNA 1UFMA 1U94A 4O3MA 3DKVA 2ESNA 1E1QA 1KNQA 5BN4A 4F91B 3VR4A 5CDFA 5CVUA 2GVZC 2OBNA 3EYYA 3ZQ7A 3WTVC 2A78A 2Z4SA 1XSXA 1XRJA 2IEZA 2UZIR 1FP6A 3KUCA 3NVAA 4A9AA 4AKGA 4AC9A 3OAAA 4NHOA 2P7VB 4WW0A 1E99A 4C2UA 3QNUA 3AB3A 1LW7A 3CUEF 4CYMA 3M1EA 4Q7MB 4KDPA 5FI1B 3GYHX 4CEIA 1Q3HA 4U0YA 3ULQB 3PVSA 2OAQ1 4CT5A 3IBGA 3DL0A 1E9SA 3MWYW 3AGPA 2ZJ5A 4PC3A 4F92B 3CDHA 2M87A 1LDKB 1NIJA 2O5VA 2JEOA 3FM3A 5FO5A 3GEIA 1R8QA 2RGNC 1W7AA 3KKMA 3RRNA 1D8KA 1GL7A 1P92A 1P3JA 4W5HA 4Q9IA 5LD2B 1NVMA 2A6EF 4KUMA 3TUIC 4AK9A 2JJ8A 4FN5A 3I92A 4XVQA 4Q03A 3T8RA 4A5NA 5DCMB 2NO7A 2NO6A 1IXSB 1NN0A 2RDPA 4JLBA 2RGEA 4MKFA 1KKMA 5B58C 1DO2A 4MEXF 1DPUA 4UNQA 1D9XA 1ZYUA 2FSIA 4CXFA 4D80A 1A4RA 2DY1A 1JJVA 4HLYA 1F1ZA 2OU2A 1FNNA 3E5QA
chains in the Genus database with same CATH superfamily
2I55A 4CMEA 2EFDB 3TW6A 3U1KA 4A5MA 1G8AA 5A9TA 3EB9A 2FGJA 4U1RA 3FM5A 2Q6KA 1CNFA 4PSWA 1XPJA 3W5VA 3M1YA 1BS9A 2RCNA 4DPMA 3WLRA 3Q0TA 3OT1B 3SSMA 3F1KA 3NCTA 4XVUA 2VIXA 3KUDA 4TYPA 1P7JA 3MT8A 3L4BA 1SULA 1Q3KA 1T3LA 2GM4A 1Z56C 3TRIA 2TDXA 3GRFA 3PU6A 2AFIB 5IN4A 2GM9A 4OU5A 1N1GA 4WCVA 1M8FA 1NQWA 5EERA 4C0QC 5FLEX 3QX3A 1E1KA 3NUQA 5JAIA 1X1PA 2QDKA 1ORKA 1XMQB 4QFMA 3MCTA 1KSHA 3DE2X 3U09A 3U26A 4IIBA 5DK4A 4D6XA 1G21A 3HM2A 4CMIA 5JMOA 2C2MA 4EITA 1Z1DA 4YUXA 2WZQA 4KFTA 3FPKA 4RTQA 1WMSA 1XNQB 3RS7A 5DBHX 3RVBA 3ZWPA 3LQRA 2CLDX 4HDKA 3PYXA 4M3EA 4D9NA 4B76A 2YASA 4A0RA 1W85A 2HF8A 3NJ8A 2OBMA 5FYQA 3MZ8A 4COOA 2QQ8A 1IQPA 3D3NA 3RV4A 3VR4D 2AF4C 2P9CA 3GJYA 4ZAGA 3U4DA 3T1VA 1E8NA 1YR2A 3JQGB 1DC3A 4MR8B 1XD9A 1MF7A 4M76B 2OA4A 1GPYA 3E6BA 1BXGA 4N7MA 4OGKA 2OSBA 1HE8B 1CUDA 3PNSA 2LH0A 4G0OA 4LMYA 1B2RA 4A93J 4NMMA 1ZAOA 3OMYA 2K6GA 2PO7A 3K0LA 5D87A 1H88C 3GZ4A 5H2FC 3QXCA 1BROA 1QCYA 5EEGA 3NHMA 1H5NA 4TLLB 3UXMA 1QANA 1XTZA 2AJCA 4Z9XA 3Q7EA 3K31A 3HXMA 2GZDA 5I5GA 4LPSA 4D79A 4NX2A 2EFQA 4ZCMA 2I6GA 4LG3A 5M5WJ 2XX3A 2V03A 3C7KA 2ADFA 3FF5A 4A8JC 3UMFA 3HWX1 3DDSA 1V7QA 2KJBA 3SEFA 1PK7A 2FEPA 4EKIA 3C8HA 1Z59A 1Z21A 1UXJA 4BFWA 4WZBB 1J2UA 4UVAA 2WF8A 1F2UA 3V7FA 3AFOA 2ZXIA 3GK3A 2ISZA 5HF8A 4RB3C 4OH1A 3QOXA 2JFGA 5BQ3A 2BSAA 5CH8A 3KNZA 3GUCA 1XVVA 1DIHA 3NHUA 1KRWA 3PP8A 4RS3A 1TEVA 2H52A 3GLUA 3KOUA 3SK0A 2N1MA 1P7YA 4K8RB 3NNSA 3WRYC 2DSTA 1QK3A 3D1JA 1M2VA 3NBAA 4AS1A 5A0TA 4CKBA 4YC7A 3L0DA 5AHKA 3UG6A 1CJKC 3KW6A 1ZN8A 2FR0A 3HHEA 2YWXA 5B2FA 1YIAA 3HUEA 3KTFA 4R51A 2WU8A 1EVJA 1CUJA 2X0JA 5FBLB 1VBMA 3KS8A 2CYYA 1IHYA 4CICA 3U6CA 2NV6A 5FQOA 2QBYB 2P65A 5KO3A 5B30A 3NXKA 4DLBA 3MLAA 3B3GA 5DGIA 2W7TA 1X1TA 3DV9A 5I45A 1Z0KA 3GT3A 1ST3A 2V9CA 3ZMUA 1NBIA 4AVPA 2HJGA 4CLHA 4BFSA 3PX3A 1K6JA 5IYDJ 5C4JJ 3IDFA 2C7BA 1J5EB 1YZ3A 4YCSA 1VHLA 2I7CA 3T3GA 5FB3A 1RI5A 5D5WB 1M0TA 2WM8A 2O2XA 2B6HA 3BULA 2R7VA 4Q24A 5EMMA 2BMFA 1PM5A 3D0SA 2XZDA 4C4YA 2BGUA 3CUUA 1XDGA 2H07A 3BX1A 5K3EA 4IVRA 1Y9AA 2XCLA 5FDFA 2PBFA 1IC8A 3T9EA 2JSCA 3HNRA 4NU5A 4YP6A 1O54A 3PHLA 3EBLA 1RETA 5DCMA 4AS3A 3ACBA 3DMTC 1IL0A 5FULA 3ZGZA 4HUQA 4RVSA 3MTEA 5FFXA 1AQNA 4OLHA 2KNZA 1RC0A 3SJZA 3Q1KA 4YIFA 2QZZA 4B3SB 4QBFA 2HIGA 4UVGA 4MARA 2GHTA 2QVXX 2K47A 2XVCA 3VFZA 3FYUB 1SQ6A 3N3BC 4NRDA 1G8HA 5HDQA 4K0KB 4ND5A 3T0IA 4S2UA 3VBCA 5CDSA 4RDXA 2JWSA 4AY6A 2P62A 4LLGF 2I4OA 2VI6A 3V97A 4MCHA 4EA8A 3EGDA 4U5XA 3DU5A 1GSIA 2JFWA 2ATIA 1SHKA 4IBDA 4HLNA 3EDCA 2GS9A 3SP1A 4FYMA 3S1NJ 4LGWA 2VTBA 1FRVA 1AUQA 1R6XA 1OZFA 3KQQA 3SJCA 5ESRA 3FBGA 1XQ1A 2IHBA 1TF2A 3KSBC 4Q15A 2QTWB 1AUAA 5AVRA 5LXTF 5A5GA 5C18A 5DTEA 2AFHB 2CJWA 4F21A 3ONFA 5F5LA 3GHHA 3EUFA 4CWAA 4JLVA 1U5AA 1E9DA 1CUWA 3VH1A 1Y39A 1RC9A 4HSEA 2VQLA 2LRHA 3EC2A 1UZMA 5CVCA 2WM2A 3JD2A 3CZ4A 2VK8A 2RRUA 1BDMA 2GZAA 4ZREA 1KJ8A 1YZGA 1YVUA 4UB6C 2IXSA 2X14A 1T2CA 1JEDA 3ESWB 5AM5A 4C7OB 3WRXC 1QPZA 2WG2A 3ELDA 4LOJA 4ZRNA 3P26A 2K9SA 3G1MA 4BLQA 3LYAA 4ZZ2A 4I3FA 3BWMA 3JTEA 1NXXA 1YMQA 2MGWA 3PUWA 4CDMA 1HL7A 4FCYA 3MMZA 3AR4A 1TYEB 4TQGA 2XRFA 3A02A 2QW1A 1OV6A 5LWQA 4N5HX 2DHRA 1V2HE 2WJPA 2QE7A 2GYYA 5HPYB 2GOMA 3QY0A 4OAOA 1DWPA 3EYAA 3GLIB 4MI3A 2VKEA 3F5DA 1G5RA 1NRJB 3PHGA 1JIIA 2HHLA 2V6ZM 2WYUA 4F6LA 4MFEA 1UHSA 4G0ZA 5BUCA 4OFWA 1UDWA 1TGUA 2YMMA 3PHBE 4NEQA 4X95A 5JC1A 1PJ3A 1RWPA 3F5SA 5ELMA 1ZVKA 1X74A 5AM0A 3OYHA 3HCRA 3GPYA 3FDZA 2PJZA 3QU5A 2IA5A 3LU1A 4ZAVA 4BKQA 1LNWA 1CNMA 4E5PA 3PFGA 5FTNA 3RI3A 2LZ0A 4YRKA 1QZYA 4G5HA 2GPNA 2F5OA 1VQ6I 3BXPA 2ZWVA 5IHXA 1G3RA 3RCBA 1NVKA 3H2KA 1AA7A 5F98A 5CB4B 3TFQA 4IIJB 2PA0A 3GTMJ 4I50A 2EW8A 1H1LA 2HRDA 4I8XA 2P1DA 1A5SB 2VQSA 5IBCA 3PT5A 4LAFA 3CG0A 3L8GA 1JPUA 3CUSA 4PC6A 2XKJE 1HNZB 2L7ZA 2JEZA 5IJXA 4UJ3A 2J6BA 1T98A 2VPTA 2E36A 2P1RA 4ZHSA 2CT8A 3K9QO 4MLOA 4BJ3A 2FQXA 4RLQA 2FE8A 2E85A 1GGMA 1QX3A 1R4AA 2JLAA 2DMRA 1R6UA 4NE7A 5LKRA 4C21A 3PDIB 3GLFA 3G8AA 1JAZA 1GYQA 2UKDA 4M6WB 1QORA 1OU4A 4REOA 1U6JA 4XYMA 3QJGA 4DSAA 1X15A 3WHPA 2V79A 2E19A 2QYTA 3LVWA 2A67A 2VZ9A 3R75A 1PDNC 4YQZA 3Q12A 4P5DA 3GZ6A 4C4XA 2AEFA 2CFSA 3ODPA 4CKCB 2MH8A 4TVBA 1F9AA 2O8CA 3TI7A 1WXDA 2XBMA 3TSZA 3UJ6A 5IUNC 3ZDCA 4GXRA 5DW3A 1U1DA 1DDNA 5K6RA 1M1YA 3AYXB 4R8RA 1DMRA 4ARSA 1A7AA 1QVRA 3DTIA 1Q17A 1KWKA 2W2NA 1AURA 4C0XA 3UJBA 3NB0A 1XN7A 3K70D 1U65A 1QJCA 5B12A 3CKKA 3PXUA 3R9XB 1HTWA 1V34A 5CR9A 1ONOA 3OC6A 4CEHB 5FLMJ 2D3WA 3F21A 1BMFD 1T08B 3PSFA 1ZL0A 2FJ0A 1QH1A 4NH0A 1AKMA 1XLUA 3URKA 3SC2A 1JG1A 2DYKA 1XQ6A 5TF4A 1X1EA 1BXRA 1XTSA 1LPPA 1AK9A 4DUZB 4RZXA 4JEMA 1R5ID 4RC9A 3L7KA 4LISA 1GXPA 3LC7O 1CFJA 5FUQA 4UBMA 1PLKA 4WT7A 1CV2A 4XR6A 5BR8M 1GABA 2FPSA 4LHYA 4WK0B 3JD1A 2A6TA 2O48X 2CFOA 1OYWA 1Y4SA 3I1JA 4XRFA 4B7UA 3W9YA 4R9UC 3WNQA 2OYSA 2R7KA 3Q3JB 3Q3IA 2DQYA 3KQYA 2PX0A 1NR5A 2K85A 1QDRA 1FLIA 1XDDA 5F0FA 4QUHA 3ABTA 1KQOA 1F8GA 1PZFA 2H6BA 2OSVA 5CK4A 1UJBA 4W1SA 2ACWA 2UUBM 2ORWA 2ATCA 1NDHA 4NIMA 4OYHA 3GIDA 1IJEA 2KHMA 1GDHA 4QJ3A 5FJIA 4ACAA 2FN4A 4GG1A 1WF3A 3MN2A 3K9HA 1D6JA 2QTMA 3AV0B 1SAYA 2KPMA 1SWWA 4B4WA 4K6KA 1KMHA 1TDZA 3L6DA 4KOEC 1S29A 5MN4A 3SFIA 3J81S 5LRRA 1QC5B 4DYVA 3DHVA 3H9JA 3UJAA 4ZT6A 3JAMZ 3PQ8A 2XHZA 4QTRA 3SS8A 3KQMA 4ZDJA 3K16A 5KNCH 2RHCA 2QUHA 2OFOA 1UM8A 3QPWA 1A1SA 2QTFA 1BYIA 4PSCA 1QOPB 3L79A 1UBLS 4M0EA 4QPCA 3U7QB 1E3MA 1Z91A 5B66C 2QJRA 2H31A 5K4HA 2CFCA 4V02A 3AY7A 2L7IA 5TC4A 4IRIA 3QFRA 1G2QA 1FTTA 4Y2XA 3GZTB 2Z95A 5COBA 1TW3A 3Q3VA 4JI7B 2A07F 5DP1A 2IBTA 4ZT4A 2XF2A 2PNFA 3E03A 4AJIA 2OOKA 1TOAA 5G40A 2W2MA 2B1QA 1T9GS 2BFMA 4BVJA 5BV8A 5TY0A 1ZSNA 1KU3A 5AJXA 4E2WA 3DEUA 3QITA 2LY9A 4MUKA 4S04A 3GLKA 4BOYA 3NRBA 3NHAA 1WJAA 4FONA 1TRHA 2R8XA 3MWGA 2F48A 3BF7A 4MAAA 4AT1A 1FIPA 3OYIA 2O50A 1S9DA 4OIOF 1QF9A 1RI4A 4X44A 2VJ5A 4OIQF 2QRMA 3B6CA 2QJFA 3SFVA 3BF8A 4EJSB 5EQTA 3WGVA 1R4NB 1QK5A 1NP7A 5FOTA 3A37A 1U3DA 3P5SA 1N5KA 1MTOA 1OXMA 1T9DA 3W2EA 1SCKA 3DW3X 4O25A 3CX3A 1QGED 1VIVA 2FMXA 2AFIA 3JQEA 3GRVA 2WOJA 4Y52J 3EEQA 5FTJA 1XJ0A 4J49A 2CLSA 2VYVD 1FYVA 5IKOA 4ZWNA 2K2QB 4IJVA 1CJBA 2C7RA 2QV0A 4AZ0A 3BE5A 2R11A 3KU4A 4I1VA 4O2AA 5DU2A 4HQMA 1A2QA 3AOEC 1T2UA 3UEOA 5ALPA 1PR3A 1DGHB 3PI7A 1Z0XA 5I51A 1XPRA 3K4JA 4DS3A 3SQMA 3LA7A 3PDUA 3HSRA 1E1RD 1SAXA 1NDUA 1U8FO 3E7XA 3I2HA 3BREA 3SM9A 2LDBA 1GRRA 3QPTA 4BMVA 1GZVA 1OWPA 5JY1A 2IJGX 2K27A 1VE3A 5KMGA 3DAHA 2C97A 3Q7RA 3A3YA 3T61A 3LVVA 2VUIB 4JSYA 2Z43A 2JY6B 4MUNA 2O1XA 2C7VA 2VJAA 3DYVA 4TMKA 2L17A 1PBTA 2NN3C 3QUBA 5EHGA 1SCIA 3H4MA 3WBBA 1VKZA 3ITNA 4K6HA 3AWDA 3GLXA 4B3RB 4AW9A 1VQ5I 5DISB 3OFSA 2GILA 3WNZA 1W9HA 2LGJA 2EB7A 1T4MA 4I1OA 4KNYA 1T1RA 2ZRQA 3KWLA 1QCDA 1I24A 5L3VA 2RAFA 3UGJA 5F1RA 2D7JA 3TLMA 4KFUA 5DYIA 1IE3A 2HKIA 3OD1A 4ZHQA 1P9RA 1DADA 1M6VA 3D6TB 2PFSA 1DPGA 3NQOA 3D2BA 2K7FA 2YXPX 6PFKA 1SY7A 4K9OA 4MP6A 2CLEB 3DDOA 3SZRA 2V3VA 4RGVA 1FVFA 3PQEA 4CF6A 2PLRA 3BMOB 5HOOA 1A4XA 4KN8A 1QKKA 2D1HA 4FHTA 2GBYA 1VE9A 2JFVA 3Q2IA 4MA4A 3T7SA 2GF0A 4AL4A 1F2UB 5CX4A 2PJUA 1U28A 1T4CB 1R0CA 4G65A 4HXEB 5DHAA 2R8BA 4TV8F 3L7AA 4HL6A 3TOXA 1UJNA 2GEFA 3I04M 2VPWA 5I9IA 5EWJA 5KI6A 4FBLA 2LTAA 2C9ZA 2LVBA 3U16A 1M2VB 3CPEA 3COVA 4EUEA 1UP6A 1BVRA 1NR7A 4IJ6A 3WNBA 3PKZA 1K4TA 1RCFA 2LBFA 4HO1X 3IR5A 1LY1A 3UANA 3OT4A 3OZIA 4FC7A 4P0PB 1HE2A 5FFZA 4B7AA 1ND6A 5F4BA 3TNYA 1WXXA 5TE9A 3HOVJ 2VLIA 3FOEC 1Z07A 2VWGA 5IRCD 5IT9K 4ER0A 3VYRB 3LWDA 4WVFA 1XLWA 2EZ8A 1B0ZA 4KQ9A 1X77A 5HE8A 1RYBA 4I8IA 3I0ZA 1U5TC 3PPIA 3K15A 2BHYA 2COKA 1CQTA 4K9RA 3T5BA 4TZ6A 3NBXX 3VTAA 1PT8A 3KZCA 3QVGB 3I4MJ 2DA1A 2YV1A 4X66M 5EUQB 2RGNA 4D5CA 3MPOA 1DCFA 4NZYA 2Q1TA 2IOFA 3BZUA 1KO1A 1U6KA 5BW4A 2IYEA 2PKEA 1Z47A 3DWIA 4B3MB 4QHTA 2HNAA 3FSRA 4UUVA 1HUQA 1H5QA 1YFZA 3STUA 2HKXA 1R0YA 2UUPA 2ZPUA 4EGSA 4MWZA 1N6RA 2H1RA 3O2PE 1DAKA 5CPFA 2XROA 1R0SA 1C7IA 2WMYA 1OXSC 2V7BA 3DUFA 4ZC1A 1B73A 2V96A 3GGPA 1UG2A 3SHGB 3FR8A 1JLHA 2N1BA 4L57A 4X61A 1I36A 5CFPA 5ECDA 2J0UB 4LF8B 3O9ZA 5M2QA 3K9FC 4GXOA 1MO5A 3VSAA 4IBJA 2IKSA 1NLZA 1IBMB 4DLLA 4LQ4A 1ETUA 4PDKA 2FSPA 3BA6A 1CNEA 3K4KA 2E1CA 10MHA 1RZUA 3JR7A 4GW3A 1PNRA 3R40A 3G88A 1TECE 4Y18A 5CW1A 3GQBB 1ZRCA 2B8JA 2CXNA 3WL7A 1BHJA 1ORVA 2DBQA 3RHFA 3G2LA 2P5SA 2O7RA 3LX6A 4B17A 4GITA 3G2HA 3VKUA 1MJNA 1BG6A 5AXDA 3D7MA 3GPLA 3ESAA 1E96A 4PANA 3A1CA 3O47A 1CZHA 4PO1A 3QVMA 2HM7A 2YJTD 3IDOA 5BUQA 3SXPA 2I2XB 2HNBA 3H2HA 4MPTA 2W6CX 4TS9A 3PHHA 1GP2A 2J45A 4LCJA 2FWRA 4YY3M 3SJUA 3OQIB 2YX1A 2JVHA 1WCXA 1N1EA 2CK3D 1EP2B 1YA8A 4PHFA 4KQCA 1GZ6A 2CYAA 1IW7F 3QLVA 4QOSA 3V55A 2DH6A 3F6CA 2CJWB 2BUCA 2Z5GA 2VSOA 1FYKA 2Q0SA 4M1KA 4S1NA 2A05A 5HUJA 2GZHA 3BQYA 1W87A 3HXTA 3OE1A 1TUEA 2NPFA 1DBRA 2J6IA 4CQMB 5BOSB 3AVWA 1MGPA 3H5IA 2DLLA 4L9SA 2EWVA 3DQPA 2ST1A 4UBNA 3GN1A 3Q8MA 4RELA 4QOEA 3BJOA 4HI0E 1N6NA 5HHTA 2XMPA 1XWIA 5K0FA 2NQ8C 1U1GA 4CT4B 4PLTA 3X44A 1PNOA 4MVCA 3A42A 4B4CA 4DF3A 1V5FA 4IRHA 1TQ6A 5J5VA 4X97A 1GAEO 5CGQB 1DL5A 2V1UA 3D8RA 3VHQA 4EJFA 1HL3A 2FW8A 1BI3A