2QBYB

Crystal structure of a heterodimer of cdc6/orc1 initiators bound to origin dna (from s. solfataricus)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
368
structure length
368
Chain Sequence
KNPKVFIDPLSVFKEIPFREDILRDAAIAIRYFVKNEVKFSNLFLGLTGTGKTFVSKYIFNEIEEVKKEDEEYKDVKQAYVNCREVGGTPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIRAIIYLDEVDTLVKRRGGDIVLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEYGLIKGTYDDEILSYIAAISAKEHGDARKAVNLLFRAAQLASGGGIIRKEHVDKAIVDYEQERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISELDMFGIVKIRIINRGRAGGVKKYALVEDKEKVLRALNETFEDSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (33-MER)
publication title Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Replication/dna
total genus 112
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09079 Cdc6_C CDC6, C terminal winged helix domain
B PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2qbyB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qbyB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qbyB02
1XFAA 4LMYA 1F5TA 2MC3A 2OCAA 1IY2A 4CVNA 2YPRA 4HAUA 3F8CA 1ZVQA 2DFTA 2Z5UA 1NY5A 1MRNA 2W6JD 2WWHA 4AG5A 3FMIA 3B7GA 4FIDA 3IEUA 2OAQ1 1XCBA 3H2YA 2W6JA 1O3TA 1NIJA 2EA4A 2ZE8A 2VE8A 1E79D 2OFWA 4ZYDA 2RHDA 1ZM2A 3TW4A 3GFTA 1HT2E 2XGXA 1XB4A 3TO9A 5D3MB 3K9TA 2YR2A 1JEEA 3DVLA 3DPTA 2CYYA 2YNMA 4PHHA 1TNTA 1GOTA 4QOSA 1JBKA 2ZSBA 3GO5A 4FT8A 1ELOA 4JLOA 2WM9B 4B35A 1DAMA 4IDOA 3K70D 4POAA 1QRAA 1SQ5A 1T5IA 4PPNA 5JI3E 3JAMK 2OILA 3THWB 4IVNA 2QBYA 3QVVA 5G53C 3NEJA 4HAWA 1IBRA 2DCUA 2KJBA 1L0OC 4GYGA 3SDZA 2HEOA 3FGNA 5BS6A 4MRNA 1XGMA 3FZVA 1KYIA 3H3UA 4IVPA 2ZFWA 2K4JA 3BOQA 4KLZA 5LD2C 4M1YA 3H3ZA 3QY0A 3WTSC 1KI2A 1WB9A 1NMZA 1R0YA 4XOIA 1X37A 2O8XA 4LCBA 4K2EA 4JL6A 4QXAA 5KO2A 3QBVA 3G3ZA 2OAZA 1E0SA 1RUOA 3U5ZB 3RDIA 5D4RA 2FFHA 2QM3A 3Q3JB 2F3TA 4LHYA 2FWRA 4RZXA 4YONB 1FP1D 1N6LA 1XTKA 4Q21A 4KDPA 2DWOA 5DGXA 1C4OA 5EZ6B 4BFTA 1QNTA 1V3FA 1E0KA 2VA8A 4RGXA 1KMQA 5FOSA 4ARZA 1HH4A 3J81k 4GYIA 1Z63A 1GL9B 4A4DA 3ZQ6A 5E20A 1P60A 4BLTA 1IXCA 4A0YA 2GJ8A 4NU0A 2E7WA 3VR5A 5BPDA 2WTUA 5KNBA 3KXKA 1NSTA 3G73A 2F9MA 4URZR 2C96A 1S1MA 5FD6A 1E9EA 1N25A 2BMJA 3QPWA 4L9SA 5FBWB 5LRRA 1I5ZA 2FE3A 4QM6A 5AR1A 5EE5B 5JCZA 3GF2A 2CG4A 5FLXK 1Z28A 4PZJA 3W5IA 4TYYA 3RLFA 3SHWA 4KFRA 4D4MA 3BWGA 2KIMA 4RAZA 1G20E 3P26A 3ZH9B 3ZVRA 2EV0A 2J0QA 2ZQ5A 2R6DA 1O87A 2WHXA 3BROA 2IVMA 3IGFA 4Q9JA 1SZPA 2XKPA 1XEWX 3KUCA 4HSEA 1IXSB 3CUQA 1JPJA 2XNDD 1T8UA 2ZR9A 2FDCA 4JVMA 2Y8EA 2HCJB 3JW4A 3IHLA 4JS0A 4TL6A 2QN6A 1WSUA 1AQYA 3UPUA 1OB2A 3BP8A 2EFWA 3QPTA 3VU9B 4JVSB 2IK8A 3WRYC 4CEHB 2AXNA 3NDPA 4BEJA 1NN1A 3DO6A 2W58A 2QQ9A 1MV5A 1W47A 1KK3A 3OESA 1DP7P 4JLBA 4P9FA 4OIOF 1ZLJA 4A0XA 1LNZA 2DBYA 4PANA 3ZLJA 1Z06A 4G6DA 2X1VA 5ICFA 1II8B 1NF3A 5IT3A 1BYUA 1Z6AA 1OIWA 4XWKA 2ZMEB 5FB2A 3CZPA 2XVCA 1QHNA 2ATXA 4MKIA 2PX3A 4OI1A 5EJEA 1ESNA 3RC8A 1US8B 1XSXA 3AH8A 3MZYA 3LX5A 2QVOA 3KQNA 3WE3A 3QXSA 3ZS8A 1TF2A 4WXPA 4MEYF 1R1VA 5TARA 2A30A 3WXMA 1KHTA 4EVIA 3SC3A 1L4YA 2F9LA 4ZYHA 1G3IA 3TKLA 3QIAA 1UHMA 4HV5A 2PLRA 4JBWA 4L16A 2EK5A 1CEEA 1YR7A 1K79A 5CJ2A 4JL8A 2HEIA 2Q3MA 4OHZA 2ZRFA 1IF1A 1EH6A 5EP1A 4AKHA 4PDKA 5AUOB 4UXIA 3GWZA 5KVRA 4LOAA 4WVFA 4ESJA 1XJQA 2O5VA 3SQWA 1A2KC 2O8CB 5M04A 1QQIA 2Z6VA 3C5CA 2J0UA 4HLCA 1YQAA 1EFHA 1R00A 1OYYA 2JSCA 2G77B 4QG7A 3UWOA 1UFMA 4FCTA 3BZ6A 1YW7A 2ZJ2A 1FFHA 2P65A 3RKYA 4BHPA 4IEIA 3MQ0A 5DUKA 1OJLA 3M6AA 3PEVA 4B6EA 5AUNB 5FUVA 1YZUA 1ON2A 4IDPA 4KNYA 1WQ2A 2ZTSA 3UANA 3DKWA 4KITB 1JECA 2ERXA 4P4UA 1Z0DA 4LYJA 1RRCA 3HYIA 2RAPA 3FDIA 3KP7A 2RGEA 2GCNA 2P67A 3EPKA 2VBYA 4TZ6A 1UKVY 2QRZA 3B6EA 3KKOA 4JIMA 4L5BA 4YXWD 5J8FA 1N6HA 4X8MA 3IDQA 1B0UA 2WMNB 1FMJA 2NQ2C 2EV6A 1TQ4A 5EUMA 1XMAA 2FPLA 3HDTA 5FTKA 1E2JA 4UHTA 4I99A 1TF5A 4QKQA 1R1TA 4CZZA 5EE0A 2ZRNA 1IXZA 4URWR 5G3YA 3ZS9A 4ZKEA 4ENJA 2X0LA 2JZYA 1MKMA 3HIFA 4F7WA 3QP6A 1D9XA 4Q1AA 1LEBA 1Z0KA 3LA7A 4Q48A 3ABUA 1N0WA 4XLNF 1R2QA 1G1MA 2ODBA 4DSNA 2C98A 1W4RA 1YRAA 2R6GA 4O2LA 2CL7X 4W5JA 3ADCA 1EX7A 1KK0A 1KDRA 4F4JA 3GFPA 4ZYEA 1UEJA 2V6ZM 5C18A 1NJGA 2AKYA 2IW5A 2NS0A 5AONA 4B2LA 3T1TA 2XUBA 5D8KB 4LB5A 2GF9A 3I32A 2JLUA 5ANRB 4UV8A 1PUJA 5KPDA 2HR3A 2QZ4A 5KNCA 1W36D 1XPRA 3RJPA 4GP7A 3B85A 4B75A 1KJWA 1ON1A 1T0HB 2IPQX 3CH4B 1NHAA 2ELHA 2WIBA 3DMDA 2ASEA 2R7DA 1VMAA 2OG2A 3VLFB 5TRDA 3B1YA 4AIKA 1DS6A 4GMDA 3SQXA 1V43A 2OZEA 4U02A 3K0CA 2ZRHA 5FOXA 1DAFA 2MMCA 2C99A 3C1DA 3TUJC 4D6PA 5LDDC 2ECKA 2ADUA 3GJ8A 3SE0A 2PLYA 3EPJA 1E9DA 1BH2A 4ENKA 1QZXA 2KJCA 1F48A 2GZDA 1CU1A 4KIFA 1K7AA 2QRNA 3ASZA 4PGGA 4L0ZB 1RFLA 3KZZA 1YRBA 2EYQA 4HAZA 1RRGA 2GEVA 1U90A 4WXHA 3A1VA 2AKAB 5KSZA 4GGGA 1NVVQ 1ZGAA 2IYQA 1QHSA 4KV9A 2GDJA 4NYMR 3BFKA 2OSBA 1BYIA 1SXJE 2EFNA 3K1PA 4L5IA 1W2HA 121PA 2V9PA 3A1WA 4Y15A 1FBUA 2YVUA 3FMFA 1JGSA 1U94A 2GILA 1BI1A 1X86B 3OHMA 3ICQB 4MYCA 3CO7C 3J7AO 4KU4A 1OFHA 3MLEA 1JNYA 1VCOA 4EPYA 2OZUA 5E4FA 4C0LA 5EP4A 2PQ8A 2KE5A 3SJBA 3RSLA 3MWLA 4FWTA 1WRBA 2XKOA 3LBHA 4ETSA 2M5WA 3AF4A 4A92A 3GLHA 3HU3A 4QFMA 4MGKR 1GRNA 3N2EA 1HXDA 4KA4A 1F2TB 1XTSA 2ZKZA 4LJ4A 1VG1A 1G8HA 5AUPB 5FFXA 1XEXB 4QL3A 4XD7D 3BH7A 2FRHA 4EFLA 3CNNA 3FFAA 5CVVA 4ZZLA 1E2LA 5B30A 2D2FA 3O8DA 4XLPF 3KQHA 4EPRA 3KQKA 3WG9A 2QTVB 4S2EA 1O3SA 1FZQA 4CRWB 1G3RA 3EZ9A 1MDMB 4M8NE 4UNPA 4IF4A 4JVLA 1H9GA 3M8FA 1KO8A 2V1DA 3TRFA 3RKXA 3OAAD 2ZJ8A 4LK2A 4ZCMA 4DBLC 3GLIB 2EWWA 1DAHA 3E5HA 3EC1A 3JZMA 5JSZB 3GJXC 4LB6B 4Y17A 5HDNA 1K8RA 2QMUA 1L7VC 1O3QA 4TYNA 3GJ7A 3ZGXA 3LBNA 1G291 4W5WA 5JWHA 1PLKA 8OHMA 4US2R 5LGUA 3A4LA 4I81A 4F93B 2PBRA 4BUJA 4DDTA 4PC6A 3IQWA 1KGDA 4RGRA 1ZM9A 2R6FA 3C8UA 3UMRA 4C0AC 3D3QA 3HRUA 4HF2A 2HXSA 4MYTA 5F6FA 3QKSB 3KB2A 3QG1A 1J9IA 1XCGB 2BGCA 1T6SA 1S8FA 3ZMSA 2HLDA 2B8TA 2P0EA 1BMFD 1YLFA 1KI3A 1IN6A 2FG5A 3AVPA 2GA1A 4HV6A 1BMFA 2NO9A 1UHWA 2ZETA 2GXAA 1C9KA 4IRIA 1CKEA 1CR4A 1E96A 5FL7D 2FQ3A 1SVSA 1XTJA 1LVAA 2RV8A 5TXGA 5FL7A 3GPLA 3HR7A 1FL9A 2IEZA 4MGIR 3S1AA 3LAJA 1Q12A 5BYJA 1L3LA 1KSHA 3WGHA 1MO5A 2VH5R 1Y3AA 2AXPA 2FSFA 4GP6A 3TOBA 3E5QA 4OIRF 3ZZUA 4RCZA 2IA1A 1LJ9A 4M74A 3DV8A 2BOVA 1BC8C 2DTRA 5H8WA 4DB2A 1PUEE 4LZZA 4LLLA 1VCNA 2QL6A 3OZXA 2DR3A 3THWA 2C9YA 1O7FA 4UJ3A 1LB2A 2Z99A 1CR1A 1RPZA 1OXVA 2QSYA 2XAQA 4LYFA 4PFSA 1K78B 1U8RA 1JHFA 1G3UA 3TIFA 5CVIA 3FMPB 1KDTA 2G1KA 2LKPA 1R5GA 1ZAKA 2RGCA 4A8JB 5L3FA 2IF2A 2IJLA 4IRUB 4I1SA 3NG1A 2FPMA 5KYKA 4G94A 1Y0UA 3T1VA 1T6NA 3U2QA 4ZIRB 2MLKA 4DDWA 2A7QA 5HE8A 4DCUA 1XEWY 4L8GA 2OXRA 2BKEA 5LLQA 2EJRA 1RZ3A 2QMHA 2KWIA 2RGNA 4ASUA 2D45A 4DB4A 2OAP1 1ZM4A 3M4YA 4TLCA 4F4IA 2KI5A 1WMSA 2R6CA 2ZJAA 4YC7A 2GBLC 1BOAA 3KQLA 1D2NA 1FT9A 5FTLA 2QQAA 1BO6A 1E2PA 2VHQA 3MJHA 3U3KA 3GJ0A 5DDGA 1P2SA 3SR0A 3NTUA 2FX3A 3TUZC 2FSGA 4P32A 1W4MA 5D8LB 2CLSA 1MJ9A 3R20A 1DE0A 5SZJA 1GITA 2YZ2A 3TOAA 2GCPA 5E8IA 4JVNA 5AJXA 4WAUA 2A5FA 4NH0A 3HUGA 3I62A 3LA2A 2WV0A 4L5JA 4U88A 2WVJA 2XOKD 4TMWA 1XMJA 2VBZA 4IDNA 2DFKB 4XSXF 1Q20A 3X1WA 4DRZA 3DXJF 4O3MA 2CL0X 1LDJA 3T8RA 4H1VA 1VG9B 1C1KA 3ABTA 5CK5A 4TMTA 1OMIA 1DELA 1NBME 2QI9C 2G7UA 1ANKA 4HZFA 1CP2A 1ZC4A 3U3RA 3EG5A 1R7RA 4WX9A 1R22A 2V1XA 2IYYA 3L8YA 1G6OA 3Q5EA 4KSCA 1M7HA 3VU9A 1ZAOA 4LJYA 5KDLA 4AC9A 4EDHA 3ND9A 1TUEA 4U0VA 4CEHA 4IDHA 5JR3A 1YZLA 5JS8A 2XX3A 1EG7A 2D4HA 3KKQA 3GP8A 3CF0A 4QHTA 4YQFA 3W6KB 2A5GA 2WWFA 3TSOA 1YS6A 5F3WB 3VOEA 2DZOB 5ILSA 2E7XA 2GNOA 2ZE5A 4AD9A 1Z7UA 5D6EA 5K5RA 1KJYA 2RGAA 4TT3D 4R1HA 1GKUB 1II8A 2Z5FA 1G7RA 4PHFA 2OD5A 5E3HA 4CZ2A 4M1WA 5HZHA 2QWWA 1TPZA 5CLSA 2ZMEA 3O8BA 1U5TC 4RD2A 1US8A 4B8XA 3E2IA 3QSYA 1HURA 3WP1B 4EJSC 2IP2A 2WSMA 1JAIA 2ORIA 3ZVNA 1GSIA 2WWXA 3QNUA 4B71A 3FXRA 1XWIA 1CF7B 4Q7KA 5CYVA 1XMSA 2ODWA 2C5LA 2VYFA 5CDFE 3NBZC 4A36A 2NNYA 3AF3A 1FWZA 1GKYA 2QG6A 4DWJA 3EZFA 1SVOA 4OQMA 1OH7A 3OE7D 2HTJA 4Z2YA 2VHTA 2RMKA 3ADBA 3J81K 5KSYA 3OE7A 4G5RA 4DT1B 3LXXA 3CF2A 3C5HA 2I4IA 2FJUA 2NZJA 2V54A 5KNDA 2O8CA 2JPBA 4D0GA 1E4YA 4EQ6B 1D8TA 5FPSA 2JEOA 4PSKA 1S6LA 2OXCA 3H0KA 3O8RA 1QDEA 4JZKA 3UWKA 5K8TA 3UMFA 4JLJA 3EZ2A 4DSOA 5BMZA 4HLYA 1GRQA 1JXOA 1IAQA 1ZCBA 1EH7A 2IA2A 1QG2A 4CF7A 1RC8A 3TKYA 3C18A 1ZUNB 2ZRAA 2PMDA 5CVUA 4NONA 5GADl 4PO1A 5FI1B 3EA0A 1R0XA 2KJQA 1ZIPA 3A4MA 1ZN2A 3KFVA 4XH9B 2L02A 5J40A 3U4QB 1FW6A 2ZRMA 3B8HA 4BH9A 5C2JB 3WTZA 3K1MA 1LY1A 4PGHA 2QTFA 3A36A 3ULQB 1L8QA 4NPHA 2Z4RA 1E1RA 4N9HA 2OQGA 4AWXB 1KK1A 2ZNYA 2Q3HA 2QM8A 4NYJQ 5FPYA 4I0AA 1YZNA 5JJIA 1TQ2A 1UF9A 3LNCA 1L4UA 2GZHA 2Z83A 2WWYA 1JHHA 1FYLA 3DQVC 2RKHA 2CCKA 4NCHA 4A3VB 2GESA 3LH5A 2F5EA 3QXXA 4ZDJA 1GNRA 1DG3A 2ONKA 2WWIA 4XJXA 3IEVA 4WW0A 4JLNA 1OH6A 4A0GA 5HKKA 4BFUA 1TBXA 3WNBA 4IHTA 1K6MA 4DDUA 4YDSA 5JBQA 3P9KA 4LJ7A 4HAVA 4EKDA 2FFBA 3GLFE 4A6DA 3CR7A 1A4RA 1B9NA 2GWRA 3RRYA 4RSGA 3RWOA 1E9RA 3CW2A 3IKTA 4JBAA 3RVBA 4LYAA 4OMZA 2FV8A 2PCLA 1OHHA 1G4DA 2BCGY 1E2DA 3V9PA 2RDPA 2VLIA 2ZAMA 4FMCF 5CJPA 4Z1MA 4TQ9A 5KSOA 1HT1E 1HW2A 2R65A 1U9IA 4WXRA 2NMVA 3ETLA 1E17A 4GOKA 4DZZA 3RC3A 2BHRA 2STWA 3GFJA 2P2LA 2QP4A 3IPXA 5J5CA 1OXXK 3EXAA 3K09C 2I3BA 1KY2A 4EJVA 4Q4AB 2WBLC 2QZ8A 3A8TA 5ELXA 3WYFA 1XTIA 2IYWA 2Z0MA 5HTKA 1P75A 4IW3B 5AJZA 4ZIRA 3QPVA 1R36A 2N42A 3E97A 2V6IA 4GCVA 2FA9A 4OIQF 2R62A 4NCKA 2J0SA 4AY2A 5ILUA 1MT0A 2REOA 2HFHA 1IM2A 5L3QB 3VQTA 3SYLA 2OESA 3P27A 3R7WB 1NBMA 2HJVA 4B32A 4RJLA 3QPUA 2REBA 4HLUA 1T3LA 2FPKA 1E32A 2J41A 1ZYUA 3CONA 5LB2A 3A1SA 5E7MA 2IEYA 2VBCA 1U8YA 4D4JA 3QP5A 3F8BA 2AK2A 1BI3A 2QAGC 4RFSB 4C2TA 3GFMA 2XRNA 5DHFA 4Q5SF 3R8FA 721PA 4HDQB 3FHCB 3JSOA 3KB1A 3C4JA 2FBIA 1Z47A 3C7KA 1N6OA 5ERIA 2H94A 4V0ME 2FE4A 3U7HB 2GEDA 4EV0A 4E03A 1G41A 4HZUA 1G3YA 1ZYRF 4K8OA 4PZZA 3M1EA 1M1YE 2ZYTX 3AVOA 2GWHA 3A37A 4GI7A 3KDSE 1G18A 3AV0B 3L9FA 4WZAE 3CUEF 4F92B 1AOYA 5CVJA 3EUHA 1SFEA 2VODA 2CJWB 3PUXA 4Q7LA 2BKUA 1Q1HA 1J75A 2H17A 2CSOA 2QEQA 1M7GA 1CS4C 4A2UA 1F2TA 2KRKA 1BIAA 3WBJA 2F5CA 2QROA 2FBHA 2QQEA 2CHQA 1P5ZB 1XEXA 2ZYUX 1EFRA 3AUYA 1W7PB 1R8SA 4UQOA 3VFZA 2J59A 2CDNA 1NIPA 1IRFA 2N46A 3WE2A 4M53A 2IWHA 4M6XA 5TVKA 4W9MC 1CF4A 4RKFA 1MDMA 2B6HA 3BPVA 3BS4A 1AS0A 3ML6A 2CNWD 3V8JA 1J2JA 4PQYA 5DCFA 5J47A 2FOKA 4FHTA 1ZNYA 4JBXA 3GJ6A 5DHAA 3GLIA 4MNUA 4Q00A 2GJAA 1P61B 5KU1A 3V4RA 4A0ZA 1P2FA 2B0LA 1NLFA 4D2IA 5JSZA 4KYWA 1WBDA 2XIGA 4EGZA 4ESFA 1VG0B 1LB1B 2WJHA 1FBSA 2FA5A 2CLCX 3EYYA 4C0QC 1NL3A 2ZUDA 2MD5A 4HAMA 2ETHA 3I5UA 2NPFA 1PV4A 2FNAA 1U6GA 3ZP5A 4ESBA 1E2FA 2ZSDA 4IKEA 4JLAA 4JT2A 3R9IA 3G0HA 2QENA 1P62B 4G5OA 1MZBA 1EFCA 1DO2A 3LO5A 3QKSA 3O6BB 4BPBA 1DBSA 1BM9A 3V8KA 1F5NA 1IJFA 4HX8A 3J80K 1GWNA 3ZVLA 1SVIA 1BS1A 2QM7A 1HYQA 3I92A 3VMFA 2DI3A 3CX8A 4GOJA 3N70A 3O8CA 2WTEA 3FWYA 4JYCA 3CNLA 3P9CA 5EXTA 4HW0A 4OQLA 1EFUA 4G9YA 1YQTA 2PEZA 3CKLA 1I2DA 1T0JB 5C4MA 3S1AB 5DN6A 2NAZA 2H1LA 1XD2B 4M9QA 3UG7A 2IS2A 4KFTA 2VP9A 1WXQA 2VP5A 4YMSA 2ZE6A 4FMCB 1Z29A 2NYXA 5TDHA 1PVOA 3ZN0A 5H6RA 4EM1A 3QRFF 1DO0A 3FMSA 2UZKA 2A07F 2VOOA 2H5EA 4Q4ZF 1XCVA 3I4PA 4LK1F 4L0YB 2A3RA 4EFNA 3EQLF 5EZ5A 5FI0B 5A5GA 1VG8A 3HP1A 3C14C 3QBTA 2O0YA 3VODA 1I6XA 1TQMA 3BIFA 3PITA 1S9HA 2FGKA 3DOFA 1KDOA 1J90A 2VQSA 3TR0A 4BAYA 1E2KA 4NCIA 1K78A 1O7LA 5HLHA 2HKXA 4IXAA 4B6FA 4M1MA 1RZ4A 3F23A 1DPRA 3V7CA 1MO4A 2QP9X 4NB5A 3RHFA 5BW8A 1R58A 3F6OA 1Q57A 4MTDA 4JN6A 4A8JA 4BYYA 4KMUX 4UNSA 1EWQA 4TL8A 3AVWA 3CX6A 2NOAA 4G0NA 2ZNZA 1PJRA 4GPTA 5FGMA 2FNPA 4P9UA 1ZRHA 1YS7A 1J5YA 2EFQA 2GXQA 4Q4HB 5KDOA 3TVTA 2LF8A 3Q9LA 4HF0A 1J7KA 1P3JA 1TAGA 3AVUA 3ECOA 3WYGA 4URVR 5IF9A 2J3EA 2TDXA 3FX3A 3FM3A 4XVUA 4OHYA 3K2ZA 3PXGA 1EK0A 1N5IA 3K70C 4CYDA 1HKTA 3T1QA 4Q47A 2VBXA 1SMYF 1SHZA 2FH5B 3ROUA 4MRSA 4L9NA 1E2MA 4R9UC 1WI9A 5K8IA 2G3YA 3CLVA 4B3GA 2QNRA 4RB3C 2VP6A 3EPLA 2C78A 1SXJB 4QNMA 3T61A 3IL2A 5EEHA 4FWHA 3KEOA 3MFKA 2FBKA 3WTTC 3AP2A 4B2IA 2NO1A 4IEEA 4PCQA 1G17A 4YG2F 1UADA 2VP0A 2VSOA 3RNLA 1USSA 2I1VB 2GA2A 1YG2A 3CTAA 4V0MA 4TMXA 4BHCA 1TMKA 1FC3A 4ZH4F 3AVVA 2ESNA 4GFDA 3BH0A 4ENNA 2O8DA 1MH1A 2M30A 1Q1EA 3DM9B 3LDAA 4L15A 4BLSA 1P7CA 4R79A 1F2UB 5AJYA 3SFZA 2HYGD 3BE4A 3TK1A 5FOTA 3VFDA 1JR3D 1FX7A 1VYUA 1EX6A 4TMVA 4W7SA 3DHWC 5SZHB 4C2UA 2CMKA 3VX3A 3ADDA 1R0ZA 4DCTA 3FVQA 1JR3A 2W6IA 2AXLA 1OE0A 2DQRA 3I54A 3CBQA 3NHBA 4OJKA 4R7ZA 1Q22A 4LHVA 5TB5A 4A6EA 1G8FA 2ESHA 3MAJA 5J6XA 1W4CA 2M45A 2A69F 5FTNA 1G9XA 1RW4A 2GAAA 3WTWC 2V9VA 3RPUA 1WQ1R 1TU3A 2QMEA 2V7QD 3DDCA 3GCGA 4HUQB 4KXFB 2HJGA 4Q02A 3W8RA 3ZVMA 2V7QA 1KYZA 2B8WA 4DDVA 1XX6A 1B4AA 5E1XA 1OF1A 1P9WA 1XF9A 2RGGA 3MSXA 4Q9LA 4BWYA 4EAQA 5HR5A 3GZ6A 3QKTA 1W0JD 3DZDA 2DFIA 1XCPA 2OT3B 4RD1A 4KMFA 1W0JA 1P6RA 2VRWA 5ICEA 2QUFA 1IUYA 2ZPTX 4LPKA 4US0R 3ZYCA 4DKXA 2QGNA 2BCJQ 3Q85A 2CEAA 3HSFA 4XSHA 3FF5A 1VYVA 3SYKA 1ZRFA 1G4UR 3KX2A 3TBKA 3TR5A 1JE8A 2GCOB 3KP3A 2X2FA 4A6PA 2XAGA 2P5TB 1ESMA 2C77A 4I1UA 5C46F 1WDTA 5JWRA 5BYKA 5HE9A 2AFIE 1CRPA 1FSEA 3KTAB 2WZQA 4WXDA 3CUQC 1LFDB 1CF7A 1E2GA 1E9CA 2C9CA 5FL3A 1N6KA 4P5OA 1NVVR 2CK3D 2CHVA 4CHUA 3OEED 1KSGA 2CE2X 3RPQA 1KO4A 3FFBA 4O2RA 1QVRA 1S96A 2PX0A 5TMPA 3OEEA 2CK3A 3MFYA 3QOFA 1S1CA 1XGNA 3U7FB 4EM0B 2OBNA 5P21A 3I4LA 5FBQB 4EJOA 3NBFA 5LBQA 2NRAC 1DPFA 4DT1A 1RUNA 1YVDA 1FMLA 4GL2A 3LFKA 4MKGA 2C9OA 1CTQA 2IS1A 3MCZA 4NZYA 1XMIA 3LY5A 1G6HA 4BQAA 4YLGA 5EUQB 3AP3A 1G3SA 1KTVA 4GNKA 4EQ6A 1XMKA 2O8BB 3P4YA 3WTXC 3LQQA 3SOPA 3E1SA 4ZPXA 5LHGA 1E3MA 1IAWA 3CUOA 2A5YB 2A9KA 1QBJA 1YW8A 4M2LA 2Y48A 2ZRLA 4LJ5A 2NNNA 3EYIA 2CBZA 3RAPR 4CIDA 2VOPA 3F3XA 1XRJA 3EWAA 1T2KA 4I7HA 5D5UB 1ZHFA 4J0QA 2QQ0A 3QXCA 1DG1G 3EETA 1HA3A 4LWZA 1Q21A 4BXUA 4N0DA 3RRMA 4AD8A 3U4QA 5K5OA 2D7DA 4D82A 5IRCD 2GZWA 2GK7A 1BIBA 1E2HA 1U98A 2A78A 1C0WA 3K9NA 3RS5A 1CJMA 2ZJYA 3K9LA 1GNPA 4ARZB 3PQJA 4AWXA 1AA9A 3W6NA 5CM8B 1E9BA 4TTRA 2K4BA 2DU9A 2ZSFA 1U2WA 1ZU4A 3TGNA 5JHUA 3LX8A 5D5WB 3SYNA 3NH9A 3LAPA 2GZAA 2XZPA 4NCJA 4IJAA 2IXFA 2ZR7A 2E1NA 4U0WA 3CPJB 1XMVA 3P1JA 3HR8A 1E2NA 5FOUA 5DISB 2MSDB 3D31A 3GYHX 1BKDR 2ZYWX 2JJ1D 3KJGA 5JJKA 2ZRBA 2PL3A 2ZYVX 4LC1A 3SU8A 3PFIA 1DDNA 3EAQA 5IHPA 5IT9Z 2JJ1A 4HQMA 2RGDA 1FLIA 3K0EA 4QBFA 5CIQA 1FUUA 1NNEA 1OH5A 2O8EB 2X4HA 2A2ZA 2NG1A 5JFGA 1Z6GA 2GJKA 3ONWA 2GJ9A 3RRZA 2G6BA 4RCYA 3A6PC 1MJAA 1GUAA 1IQPA 1O57A 2K02A 4KUMA 1WA5A 1Z0FA 3BJIC 3WMEA 1S29A 4LHXA 4CO8A 5L3VA 1WKMA 4N0BA 1AWCA 3B9QA 3DKPA 3WTVC 1W2GA 4G01B 5AWFC 4FINA 2IWRA 2VC1A 3AGPA 1H8ED 4Q4AA 2RGXA 2V1UA 3B73A 3WU1B 2BYVE 1KI1A 3NDBB 3FMRA 1KI4A 1RVDA 4KFUA 1H8EA 4KHZA 4BRUA 1AK2A 2CWEA 4RGSA 3AKDA 4AK9A 4UNOA 3MWJA 3O47A 1QZZA 1SD6A 1N5KA 3MWMA 1KQ0A 5LRSA 1OT3A 2DYKA 2STTA 1XEFA 1OSNA 2EFEB 2O0JA 2JGNA 3ZPLA 3ISPA 3W6PA 3K0AB 1Q44A 1YR6A 3IBGA 1FP6A 4XRFA 5L3QA 2GVZC 4Q1FA 4M1SA 4B76A 1E0AA 2QPAA 2DBBA 2BJVA 4HX7A 1OW3B 3R7WA 2OHFA 3KL4A 4RD6A 5D5XB 1QG4A 3I72A 4BLRA 3BB4A 1XJ0A 4US1R 5L3DA 3UIEA 5E17F 3CRRA 3RS0A 3ZMDA 3G82C 1W0KD 2O03A 3OIWA 2FOLA 4RFSA 5L3GA 4KVAA 2QQBA 2ZSEA 3K9HA 5E7JA 3L00A 3Q9SA 1W0KA 1XPUA 3R6SA 3TGPA 1W36C 3LBIA 4ON9A 3KP2A 2IYVA 1ZBDA 1ZD1A 2XROA 5HDGA 1P2UA 1PZNA 4NE2A 3VR3A 2XITA 5AK0A 5JECA 4OI2A 1ZG5A 2OBPA 4HZUB 4OU0A 5F9FA 2LF7A 1Z2CA 2CVHA 4KYUA 4TYWA 3L09A 3EC2A 1HTWA 2OBLA 2IUTA 2Q2EA 2IRFG 3HOTA 1AGRA 4DLZA 1XPOA 1JR6A 4KN4X 5DUIA 4HF1A 5BN5A 3W3ZB 1COWD 4D81A 1XN7A 2CJWA 4QHSA 3TSZA 3OIYA 1HQYE 1L2TA 2OBMA 1COWA 4QJ4A 3I58A 1ZH5A 4DLSA 5DYIA 2P5LC 1UKEA 1YE8A 2IYXA 2JJ2D 3WTUC 2V6JA 4HEJA 3WNCA 1KGSA 2IX3A 4R2HA 2EFOA 1LEAA 4NQWA 5BQTA 2JJ2A 1W7PA 3KJIA 3AJIB 3SJZA 3W34A 1XZQA 1ZARA 2B7BA 2PMKA 3AVXA 4IDQA 3FE2A 4JQFA 5TY0A 2V79A 2P5SA 2IA0A 2IYLD 4CT5A 1E0JA 2ACJA 1CXZA 3FB4A 2EB7A 4ITRC 1MO3A 4JLDA 3ZD7A 1FUKA 2O0KA 3FXQA 2ZCWA 3O2PE 1G3TA 4W5HA 5F9HA 1J2XA 4UV9A 2AK3A 2DT5A 2RGVA 4OMYA 5C1BA 3F8FA 5H70A 2ZUCA 2DAOA 3BJOA 4RB1A 2ZVQX 4C0HA 2CGPA 3BRWD 4HDOB 2RCNA 5EP3A 2IXEA 2J0VA 4LUCA 4U00A 1RRFA 2JLSA 3MWKA 1FZPB 2P6UA 4UNQA 3KXLA 5FPKA 1IW7F 3ZMUA 5CYOA 1U3EM 3ELKA 1B23P 4FX0A 4GMXA 1KJZA 2V6CA 4RB2C 5L3RA 2DB3A 4G5GA 5GJWC 4DC9A 1LTQA 3CLOA 2HLDD 4CEJB 5H6QA 2PG4A 1NLZA 1NVMA 2NO0A 3VNVA 2W0MA 4Q66C 1AN0A 2QAJA 3FKSD 3P9IA 1N6RA 1N5JA 1RJ9A 4IPAA 1XU4A 5DO9A 1O3YA 3B82A 3FKSA 2FSHA 1UEIA 2LNBA 4MQBA 1G5RA 4ZYGA 2P8TA 2FF7A 2XASA 2CXXA 4GT1A 3HU2A 2IHBA 4PC1A 3G5UA 4MKFA 3QXJA 4Q4LA 1QHXA 1BJAA 1EH8A 521PA 1X3SA 4MDFA 3CWZA 1DTSA 2WSSD 1G19A 4EPXA 3RABA 3PG5A 2WV9A 1Z0AA 2XXAB 2J5XA 2WSSA 1XD2A 1S9DA 3A58B 3CPHA 1S3JA 4FMDF 2IS4A 1KSJA 4P31A 4TZ0A 2YWHA 4YIIA 2OEPA 2Z4SA 3GLFB 2HTSA 1ZLKA 4F7ZA 4HLXA 1N5LA 1SVKA 2QT0A 2JTVA 1DARA 1UPTA 1NG1A 2VT2A 1HY3A 3VB2A 1OR7A 2HF8A 4E09A 4M73A 2O8EA 3HPRA 4E22A 4I0BA 3NWJA 4Y13A 2KIUA 1K6OA 4Q18A 3FKQA 1J8MF 4A5MA 2O52A 4YMUA 5LD2B 3AF1A 1E1QD 2P6TA 2PLFA 1HW1A 1KAGA 2XTMA 5GJVC 3QOPA 4PAQA 1E94E 1E1QA 4XVQA 4ZDWA 1OV4A 4BLQA 3LV8A 4OOIA 3MRSA 1QHGA 2N1BA 4A12A 4GSYA 1UDWA 3F0TA 4I01A 1UKZA 3UATA 3K1JA 3BORA 1MR3F 1GXPA 1D8KA 3WU0A 1A82A 4G5SA 3EW9A 3KJHA 2FMXA 2YJTD 1XDBA 2FZLA 1XBTA 4Q4HA 4ASUD 2ZBKA 2ISZA 2XJ9A 1UAAA 2GBLA 2GXUA 3F6VA 1XXHB 5EXPA 3UXMA 1B59A 4KFSA 1S0UA 1Z2AA 4A2WA 1EESA 2UZ3A 3THYB 1KSFX 3F22A 1D9ZA 5LBIA 4IXMA 2YKGA 4D26A 1NJFA 2QORA 4R98A 4LJ9A 4ON0A 1OXUA 4CICA 1A2BA 2HGCA 1Z22A 1SXJD 2JLRA 2HWVA 3DZ8A 2FFAA 4LY6A 1W1WA 3F3YA 1QHYA 2C04A 1SXJA 3ZMTA 1E9SA 4LK0F 1LS1A 2E87A 1ULYA 3LQRA 2VHJA 2WJJA 4GOXA 2RH5A 4NYJR 3U44B 1LQ1A 2ZRIA 1G6NA 2ZJ5A 4PC7A 3LSTA 4LSGA 4TLEA 5JHHB 2YC4C 1Z9CA 1G7SA 4X8OA 3RWMB 5JLJA 2VSXA 5EQTA 4TL9A 3K53A 2VHCA 1VDZA 2BDTA 2WKPA 2MA3A 1Z0JA 1GIAA 2GRJA 1KDPA 4B3CA 4ZKDA 4LRWA 4M1KA 1F2UA 2BBOA 1NKTA 1RRPA 3HSRA 5BQ5A 2LCFA 4A0RA 2RGNC 3WBKA 3FMOB 1HUQA 1JI0A 1MO6A 4PSVA 1XCMA 2JRTA 4FCWA 1U78A 3CPEA 1A5TA 3Q7PA 4LG0B 2PMHA 4WIAA 3WRXC 2D74A 2JASA 1XZPA 1JXMA 1TNDA 4BNCA 5CB6A 4CXFA 4NHJA 1QHHB 2OU2A 5JJLA 1RIFA 4HUQA 1TUIA 4OIPF 2X19A 1HSJA 2X2EA 2DVWB 1GILA 3WNDA 4JK1X 1Z08A 3ND8A 4CT4B 1S8NA 1IY0A 2CQKA 5CLQA 2FFQA 1KI7A 1G7CA 4ERNA 4G5QA 2XGJA 3VR2A 3NKVA 5JRZA 5LHHA 2J7KA 3IUYA 2BBYA 4MGYR 4QBHA 3QUSA 4XTCS 5LGTA 2XNSA 3RANA 4M1OA 5AUQA 2GCOA 4FMBB 2VIIA 3NBYC 4TQAA 1FX0A 1LV7A 4L9VA 1S4QA 2IA5A 3BAFA 1ZW6A 3JTGA 1ZRDA 3MMPA 4GO1A 2ZS8A 3RRNA 3U3JA 3MJRA 2ZVPX 4L9JA 3LA6A 4QWQA 2EU8A 5EP2A 1GL7A 3KTAA 1XDSA 1CBUA 4V0OA 4JKIA 2UWMA 1CJTC 1LVGA 4EPWA 1P92A 3KCCA 4JMPA 3VKGA 3BDDA 3EIEA 3L7WA 5EXSA 5JI2E 2H6BA 3SQNA 1SD5A 1QZMA 2Z9OA 3DFGA 2CLDX 3N4MA 3I8XA 3R8CA 3VR4A 1B9MA 2VL7A 1VKJA 3WODF 1KYWA 5JS7A 5HOOA 1EGAA 4CGZA 3EASA 2Z3YA 4P33A 4KIBA 5F1RA 3PQCA 4FMDB 5IT5A 5J4KA 1WBBA 2GETA 4PC2A 4DNCA 1VHLA 3CNOA 4M1TA 1TQPA 2O6GE 3CRMA 5LEJA 4YDHB 1A7JA 3CX7A 4JLKA 1TEVA 2WOJA 1XP8A 3DKVA 4AKGA 2D3WA 1GTVA 1R10A 3LA3A 1ZUIA 2BVNA 4HB3A 4B33A 2O8BA 3FHOA 3F8TA 2VBWA 1GNQA 2XZLA 2J9RA 2R7FA 2C2HA 1NKSA 4LYHA 3B1WA 3Q72A 4DLUA 3TAHA 3W9YA 5KOYA 1GG2A 2ONJA 1YIOA 6PAXA 4BZXA 2ZROA 3GEHA 1Z6TA 2GQQA 1G3MA 3HJNA 1TLHB 2W84A 4G1UC 4LC0A 1LW7A 2QPTA 5LPNA 1UBCA 4OI4A 1HE8B 2B21A 2XZOA 3MHVC 1E1RD 1HW5A 2M8EA 1FP2A 4WF2A 1GDDA 1JQLB 2H57A 2SHKA 3DMNA 4OK5A 4PHGA 4MYHA 4WOPA 2HDCA 3BJ6A 4FX4A 3PIRA 3QI2A 1YZQA 3KEQA 1DUXC 1G16A 1M74A 2J7PD 2XTNA 2ZE7A 4EGYA 1G21E 3TSWA 3M1IA 1XB2A 4V0NA 4DCSA 5K5QA 4DCVA 2J7PA 4V03A 2ANBA 4D80A 1DVRA 3IHWA 5LB4A 5DI3B 4BLOA 3U6BA 3ZQJA 4U5XA 3RKWA 5HKKD 4M22A 4Q1CA 3RIRA 4FN5A 3QJYA 4RZ3A 3KFWX 3GJ5A 5FFZA 3QPHA 4BZPA 4CYMA 1UFQA 2DWQA 4CW7A 2L4AA 2YINC 3LFUA 5CLLA 3QKUA 1VECA 4JLMA 2ZS7A 4ZDKA 4ACAA 2Q21A 2A61A 1Q3TA 3COAC 3RSOA 4TWZA 4A9AA 4KVGA 3KP6A 4U0YA 4HYYA 3AEZA 1OHHD 1FNMA 2UKDA 4E5UA 3EA5A 2XSZA 2OM2A 4XTRA 1DAGA 3PQKA 3QG5A 3CJNA 4KICA 1JQJC 2H16A 4LDJA 4Z1MD 3HSEA 3WMGA 4ZDIA 2O3FA 2HYDA 4L9WA 5JRJA 3EWSA 5FPHA 4IVQA 2ZI7A 1SMTA 3QVUA 1S7AA 2IUUA 2RC4A 3CDHA 1ZNXA 4M21A 2W2XA 4AIJA 1ZREA 4O5VA 4PZYA 5GJCA 1R5NA 3T15A 3SZTA 4U7DA 5FBLB 4FWIB 3EIHA 3F8MA 4B74A 3LAWA 5TV2A 3KKNA 1FOKA 1QGPA 2F5DA 1UBGA 3O3KA 3BBPA 4HLDA 5FOWA 2RQPA 2AX4A 2EWVA 4IVRA 1E9AA 5JWOA 4TLAA 4KBGA 4I98B 3VEPA 4Q1BA 1HEIA 2OA4A 2F3RA 2M1BA 3K0AA 3N2IA 4I4LA 4P96A 4XWAA 3SBDA 4FW9A 2LSOA 2D62A 2PJRA 1NBMD 3WHLA 2FEMA 4QNRA 5HS9A 1XXHE 2QLZA 2P4WA 3BD9A 1ZIOA 1W7AA 3EZ6A 3IKJA 1KI9A 1REPC 1M2OB 3W90A 3IIMA 3FMQA 2QAGA 4OQFA 3IWFA 5J8CA 2VEDA 1U9IC 1XNJA 1T4GA 1P9NA 2DWPA 2F5FA 5B2ZA 4KN7X 5CIWA 1SVWA 3TMKA 3U60B 4LD5A 1TX4B 4QGAA 3R61A 4B3XA 4KODA 1TNSA 1DOAA 1D8JA 3SZPA 4PSAA 3T8TA 3JAMZ 4EJWA 1GAJA 1N6PA 1RKBA 1UKYA 2ZEJA 3L0OA 3V4FA 4BFSA 2WAYA 2PEXA 1P6XA 1TQ6A 4EIWA 2XTZA 3FTQA 3H92A 1ZNWA 2RNJA 1AGPA 5EE1A 1KMHB 1AZSC 4MDEA 3MWYW 1QVAA 1OLOA 3DP7A 3IKVA 1TL7C 2BWJA 2WJVA 1NSFA 4YFKF 3QENA 2DQLA 1TQDA 2ZJOA 3ECHA 2J87A 3CO5A 5HLGA 1W5SA 1W5TA 5HDKA 3MZHA 4IJMA 5DH9A 4HLUC 1VPLA 4TLDA 1EFRD 2GF0A 3P32A 4BFXA 3THXB 2G88A 2OLJA 5DYGA 1KU9A 3ZMVA 5SZIA 1I4LD 5CDFA 5JI6A 1SD7A 3NXSA 3FHTA 4WZ6A 5J4YA 2ZI6A 1VIYA 3HRMA 3V4GA 3ZMZA 1KO5A 2OFOA 3THOA 3E6BA 5ICGA 1NG9A 2K27A 2QE7D 1PUIA 1P72A 3KKMA 4NYIQ 3QXHA 1S3SA 2L3DA 3I8SA 1I4TD 2QE7A 3RI4A 4S05A 2A5DA 1AM4D 2BMDA 5BXQC 3MUFA 4RS8A 2GAOA 2ZRJA 5HCIA 3KP5A 2VF7A 1AS3A 2ERYA 1KAOA 1N3BA 3KP4A 4OQXA 1T91A 2WWGA 4PR0A 5A0FA 4OYHA 2GEUA 1ZCAA 4RZUA 1FQKA 1KNXA 4NBSA 4UVCA 1TTTA 3V8LA 1FPQA 1F1ZA 4C7OB 4YFXF 4LLNA 1NMYA 2CVFA 1N2CE 4I1OA 1SD4A 4ILEA 5FLXZ 1ZRCA 4HDUA 3FWEA 3E6CC 4CEJA 2BMEA 4OINF 4EJTA 4BRWA 4XWOA 2W85A 2O0HA 4B2PA 1KO7A 1T39A 4WZBE 4R8HA 1RJ9B 4HAYA 4TQUS 5DLQC 5FUXA 3NC1C 4RY2A 3T5DA 3TNFA 3WP0A 3D8BA 3AVYA 4AKIA 2V8OA 2VP2A 2AD5A 2LKDA 3S2WA 3FPAA 3LRPA 2HDNB 4P3YA 3AQ4A 2A6EF 3K69A 3IHUA 1JB1A 3AM1A 2CO5A 4OQNA 4L9TA 5DN6D 1XGSA 2Q9CA 4TMZA 3W8NA 3WYAA 5GVRA 3U1DA 2XXAA 2R8RA 2BBSA 4B73A 5SZKB 1ZM3A 4HQEA 2PMUA 1AS2A 1JALA 1Y63A 2AL7A 3PUVA 2XEXA 3AF2A 4HB4A 4YMTA 5CK4A 3GLFA 4KT5C 2MSCB 4QGHA 2RKOA 2BV3A 5EE9A 3TLXA 3ZZ0A 3L2OB 4LX0A 5CB8A 2ZO4A 1U81A 5CJ9A 4A1FA 1GXQA 2BMFA 2F6RA 1G8PA 2H92A 4TSFD 2DHRA 2J46A 2A3SA 2OE2A 2WJIA 5FBRB 4YMVA 2DPDA 4X8LA 4GBMA 1PLLA 4TSFA 2GTPA 3KZYA 1SHKA 2ODNA 1X1SA 1D2MA 4LHWA 2JATA 2OCBA 3A4NA 1P2VA 4M9SA 3EZ7A 2ODEA 2Z43A 3UKDA 1HE1C 4Q4JB 1M8PA 3QF4B 2Z33A 3IRRA 3IILA 4M6YA 1O3RA 1E79A 1MGTA 1WRJA 1OXTA 1QBKC 3L8ZA 3U3MA 4H1UA 2IYZA 4NKRA 3X2SA 4AIHA 1QPMA 2JLYA 1GZSA 3B2EA 3Q5DA 3FM5A 3QKRB 4NHOA 4BFWA 4TYQA 2DPXA 3ECCA 4ESHA 1Q1BA 2F1JA 3GFIA 2D2EA 3TQCA 1XXHA 1ETUA 1KKLA 3I3SR 2P7CB 2MLGA 5L3CA 2E1CA 3THYA 1JPNA 2ZJZA 1G3WA 1Z0IA 2Q9AA 4IOMA 4TTQA 1YR8A 4C0JA 4PHTA 2VE9A 1MOZA 4AG6A 2DK5A 4BLPA 1OYIA 2L01A 2FU5C 1FYKA 5HS8A 2JAQA 4V02A 1UBEA 1KI6B 2WC2A 4NTZA 5D4SA 4KIGA 4RD0A 4DSUA 1GVNB 3T5XA 4UNNA 3ZQ7A 2HV8A 5BWMA 1TU4A 2IHYA 4ZI2A 4UJ5A 3RYTC 3EIQA 3U44A 1NN0A 4LV5B 3BFVA 2AFHE 5JZVA 4DEYA 3I61A 1Z3IX 1P4AA 4PAOA 5EE3A 2C95A 5FTJA 2QU8A 1OYWA 3H4MA 1OFTA 1HKQA 1R0WA 2V55B 1U8ZA 2WWWA 2YC2C 1E4VA 3SEAA 4N0EA 1OPCA 1VCMA 2XAHA 3PUZA 3H84A 1R5HA 1NRJB 1WP9A 3IPYA 3NEYA 4Q1EA 2R2AA 1LS6A 5L3BA 4MITA 2HS5A 1J8YF 1OH8A 2W6ID 5TJJA 3K1NA 2ZU0C 1S2MA 4Y0VA 1NVWQ 4URUR 5JCPA 4HYEA 5G41A 5F64A 2GHIA 4BASA 4LG0A 3OF5A 3I1FA 3IIJA 1I4DD 2ANCA 3LWNA 1YR9A 4LBWA 3AVQA 4OK3A 2OO7A 1NLYA 1QHHA 1SKQA 2XHKA 1W4AA 4RAYA 2R44A 4PAMA 4M9XA 3C3WA 3WGGA 4RD4A 3VAAA 3FOZA 2BM0A 2FU4A 3HRTA 2HYIC 3SHFA 1AZTA 1T3SA 1VTKA 4YIFA 1XGOA 1F6BA 2QY9A 2H8KA 2QA5A 2VTKA 3TJZA 1XD8A 2XV4S 5CYPA 2B92A 1P4WA 2YV5A 4EPVA 4WXCA 1IXRC 4TV7A 4AYWA 1YTYA 2C6YA 1U5TB 3BY6A 2AS5F 2ZANA 2ORWA 3E6DA 4V0LA 4B47A 3A1TA 1EFTA 4BFVA 4DLTA 4EJSB 4L18B 2ZREA 4Q5IA 2IT1A 3ZIAD 3TQNA 1G8YA 1Q0UA 1KY3A 2A5JA 2Q8KA 1FQJA 3P4XA 3NIBA 1FX0B 3TQFA 4DXAA 1KOFA 3ZIAA 1ZG1A 4MQ9F 5K1YA 3PEWA 3CZQA 1KK2A 2F7SA 2WKQA 4U7BA 2XNDA 4DUGD 2FEZA 1G7TA 4OHVA 1HKSA 1ZNZA 2QP3A 3LD9A 2QYOA 4HATA 1KO1A 1XTQA 4TN1A 4DUGA 4DIEA 2G0NA 1JJVA 4MHGA 2ZAOA 2H6CA 1QO0D 2ZRPA 2DY1A 3AKYA 2NIPA 2ZIAA 3GEEA 2PJPA 3GMTA 3DF8A 4A2PA 3T5GA 1RIOH 4QBIA 3CH5A 4IRGA 4Q7JB 1IY1A 2YSRA 2NZ8A 3D7MA 2VONA 2QSZA 4C3ZA 2HT1A 1FP7A 3WMFA 1Z91A 3WHKA 4LLGF 2IUSA 4M9ZA 1X8JA 5LHIA 5KK1A 3BPXA 4A5NA 3GLHE 4KSBA 1YO5C 4RD3A 4F4CA 2GA8A 3I5YA 4BEBA 5DNYB 1ZM7A 2EQBA 1STZA 4WCGA 3KJEA 2BEOA 4B43A 5B57C 3T1BA 3QEJA 2WIAA 3NBXX 4OK6A 4HB0A 2ORVA 1Z05A 1J70A 1N0UA 4FWDA 2YOHA 1AKEA 3L82B 3K8YA 1G3QA 5IDVA 4DLWA 5H20A 4B09A 1OIXA 2KBEA 5A4JA 4XSZF 2JLWA 3GJ3A 4MRRA 4N9IA 2FF4A 3FXUA 1E2IA 1OFIA 2DLLA 1GKIA 3SI7A 4UNRA 1II0A 2WKRA 4WK8F 1DADA 4LBYA 1K5DA 4B48A 1DPUA 4JKYA 5DI3A 2YX4A 3GXOA 1ZINA 4IRHA 3C15C 1AQUA 4BHBA 2L54A 1NVXQ 3L0PA 1AKYA 3EPHA 2V4ZA 3GEIA 3TO7A 2NO7A 3KETA 2R6AA 2VN2A 4MKHA 1CR0A 1Q1ZA 3B5JA 1GL6A 1XTRA 2PZGA 4CEIA 2QGZA 4AURA 1LDKB 5E1ZB 4YMWA 2MH9A 3Q7QA 1USTA 3TDZC 2ISYA 1B1BA 1BC7C 2D1HA 2XAFA 4C0KA 3ZDQA 1WCV1 2C03A 1X8KA 3KLOA 4O0MA 4OHXA 4MGRA 3HYRA 3U9GA 1II9A 1R8QA 2GXSA 2O8DB 2DPUA 4BQSA 4YXWA 3B1VA 5ICCA 2EFGA 3A1UA 3KW6A 1V5WA 2EW1A 2FSIA 1OKKD 3PUYA 1E69A 2HT6A 2JJ8A 3SJCA 2IL1A 3ZJYA 1SULA 1W49A 3MGCA 1OKKA 3PV0A 4NMMA 1KIMA 1YYVA 3QEOA 1KU3A 4N3NA 4NDZA 4AYXA 2IC5A 3GEZA 2EVWX 4F91B 2ZJBA 1G64A 5FD5A 1YZTA 3I0TA 3SN6A 3NEUA 4KJZA 2EV5A 3F5FA 2F43B 1BBYA 5L3SB 1IRGA 1XSVA 4JLVA 4JLPA 2AWNA 5D3QA 2VF8A 2JCSA 4QJ3A 4OI0A 1D5CA 1M6NA 4I1VA 4JT4A 1QF9A 1CJUC 2ZRKA 2YWFA 4O6JA 3OV8A 1BI0A 2J5PA 1F3OA 4M4SA 1RE0A 4Z51A 4LJZF 1S3GA 5FUYA 2Q0OA 5HVQC 3RTRA 2QAGB 2VPPA 4PO8A 3JVVA 4YFNF 5AJWA 4MA4A 3BOSA 3ZN1A 3X1YA 2KBFA 2MMGA 1PP7U 1YZGA 4HDCA 3AVTA 2PT5A 1Z6RA 3N97A 1XJCA 2CCJA 3LXRA 4D0LB 4Z54A 2W2TA 4IXNA 1RYHA 2Q3FA 3TVDA 2AD1A 1KQ9A 3QAHA 3E5XA 1FTSA 3CB4A 3L43A 4QBGB 4ZZDA 1CR2A 1IHUA 5DCMB 1VHTA 2YX7A 4XSGA 5E7IA 3U7EB 3KE2A 1Z83A 4AKEA 4D25A 1BOFA 3Q8XB 2IW3A 3UMSA 4URXR 4TMKA 3K0CC 5FBVB 3R9WA 1M34E 5CITA 3EDPA 1KMHA 2BE5F 4MTEA 1FYMA 1TW2A 3BB1A 1XSDA 3WY9A 3LWFA 1DAIA 3U7GA 4A15A 2AHOA 1MABB 1ZMXA 4ZO4A 1R7JA 1G4AE 4RB0A 2ZRCA 4KBFA 1LF0A 4G3XA 3NVAA 1TTYA 3M7GA 2JA1A 3HRSA 1HV8A 1EV7A 5JFRA 2ZI5A 3THXA 2IXGA 3W6OA 2DWZB 1W7PD 1W48A 4DQ2A 2BIFA 3B78A 2PFBA 3RYRA 3NRVA 4EMSA 2OFXA 4LJ8A 4LGWA 4UVBA 4IOJA 2HYFA 4B34A 4FI3C 3GLGB 2ATVA 2AR7A 2PH1A 2ZI4A 4Q7MB 2EFCB 3UK6A 2JPCA 3BB3A 2ZU6A 3BK7A 3VR1A 1Q1QA 5DI9A 4P4SB 2O8FB 4G7OF 2WPDD 4EJUA 4QGGA 1V4RA 2IYUA 4LBVA 5AIQA 4D0NA 1GP2A 2F1IA 3RS2A 2I1QA 4LFUA 1KZ7B 2WPDA 3K0FA 4HUTA 3F21A 2Y75A 3DOEA 2L4MA 1TW3A 1CJVC 3OIVA 4O25A 4B44A 3RS3A 1AIPA 1JEDA 3AKCA 4DLRA 3TO6A 2WAXA 1CULC 2ZI3A 3JTHA 4ZV4A 1A1VA 3CF6R 4C30A 4MQVA 3CRW1 4LGMA 1QZYA 1I1GA 3D0SA 4LPSA 4Q9KA 5CM9C 3D5LA 5A2QZ 3M8EA 2ZITA 1MKYA 1H8HD 4C7OA 3BJAA 1FOEB 2FEOA 5FUWA 3R0JA 3U3OA 1SKYB 2BJWA 4XD7A 421PA 4KFCA 1H8HA 3TAUA 3GUDA 1KNQA 2CE7A 2RN7A 3I64A 2WJYA 221PA 1KU2A 1Z1DA 3L0IB 1UM8A 3HTUA 3MCAA 2PI0A 1SGWA 2HUPA 4Q03A 2W57A 1ODFA 2JLVA 4ESVA 1KQ8A 4HDVA 1RYFA 2PZFA 4B3BA 2HCBA 5LEKA 5IT9K 2ZI9A 5G40A 2FGJA 2BV6A 4GXOA 4FXPA 4I02A 2E1RA 3OAAA 3EARA 4DSTA 1VCIA 1Z8FA 2MSEB 3KUDA 2YU3A 1PDNC 1NI3A 2OUKA 3LW8A 5HLIA 3CRVA 3C16C 3QQ5A 3GQBA 1U2RA 1XDUA 3AAFA 2KB0A 1ZP6A 1A04A 2RB4A 4PTLA 3X1DA 4C0BA 3ASYA 5H1YA 2AN9A 1UDXA 4B3DA 2J1LA 2ZS9A 4GZMA 2V3CC 4TYPA 3CO6C 3I59B 1UCRA 5DYMA 4V0KA 5J4VA 2D06A 3LLUA 1N6NA 2RHMA 3GFOA 2VO1A 4LHZA 4QGFA 4UXHA 3NQOA 4HAXA 3SS8A 4RVCA 4DHEA 4FCVA 1X1RA 4KAXA 2PN6A 2GVDC 3QU3A 2DZNB 3D6TB 4JJKA 3E3VA 1DAKA 4TL7A 3CWQA 1P4XA 1EWRA 1ZC3A 3NH6A 1MJBA 5KDDA 2G0TA 4RFVA 4DLYA 1OXSC 1P2TA 3M0EA 4PQFA 5G3ZA 4LBZA 2ZRDA 2GJSA 3BC1A 1E99A 2REXB 1KA8A 5E1WA 1OIVA 4Q4JA 2GXGA 3QF4A 1CLUA 3KKPA 5D3MA 2VHUA 5LGNA 3W5JA 5FOVA 2M87A 4R2IA 1ZJ6A 2A68F 3RDPA 4QM7A 4UKDA 2R9VA 1X6VA 3L2CA 1UJ2A 2RGBA 3J81Z 2EFPA 4D4KA 3SXYA 3LLMA 4IHQA 2F2EA 1J59A 3E5UA 2G83A 3QKRA 1J0RA 4JJZA 4Q9IA 2D7CA 1E2QA 1UBFA 2ZXUA 1ZD9A 3K70B 2HQRA 3B9PA 4E70A 5EEGA 1OPXA 2H18A 2XJ4A 3X1ZA 4DEXA 2QBYB 4Z8YA 821PA 4DLVA 2MBFA 4QJ5A 4AIIA 4EUNA 4NYMQ 4RGUA 5DSZA 4HB2A 3KQUA 2GK6A 4HZIA 4K81B 2CFXA 2QT1A 3TE6A 2P5VA 1KI6A 1NP6A 3TW8B 3V00A 5L8VA 3BWDD 3VNUA 2HQNA 2H27A 2UXXA 4G7HF 4I2OA 1E2XA 2DFNA 4ABYA 4HA8A 2W24A 1F4KA 4BFYA 1KI8A 5HS7A 1VIAA 2YYZA 3K0LA 1TEXA 1PLJA 1U0HC 1G5TA 3PVSA 2JIZD 4TTPA 2OCYC 2VC0A 5E18F 1MD0A 3W6JB 4CDGA 3B1XA 3KXIA 3AKEA 2W83A 1RI7A 2JIZA 3HPQA 4GRAA 4PPGA 3MD0A 4BFZA 1C1YA 3WTYC 1BN5A 1TQIA 1U0LA 1ZD8A 3SNHA 4B3FX 3KLNA 3V7SA 1ZUHA 1P4SA 4DIDA 4XBFA 3U61B 2UVQA 2QMOA 3KZ1E 1YHNA 3E70C 5B64A 2FMLA 3P20A 3REGA 5FTMA 2Q0HA 3SFVA 3CIOA 5E8GA 4X8HA 4M0LA 5FPTA 4KLNA 1Z5ZA 3GX4X 4H9GA 2PZEA 3Q5FA 2TMKA 3JZAA 1IONA 4KYIB 2CL6X 4BECA 3FHZA 1WE2A 4Q9HA 5A2QK 5UKDA 4EFMA 4BGDA 1SXJC 4A6XA 1YFHA 4KCGA 1I27A 4G8XA 1Z07A 2P6NA 2C8VA 4G6QA 3Q9VA 2XAJA 2MH2A 4S35A 2IF0A 3PUWA 4NP6A 5D5VB 4M71A 2PBIA 3ZD6A 2XOKA 1YW9A 1U5TA 4Q01A 2GIVA 3ADKA 4MUAA 1JJ7A 3JVUA 1GVJA 1WWXA 1X8LA 4EJSA 3VKWA 4HX4A 4H0EA 3REOA 2F55A 2GXBA 2OZ6A 1X3UA 2FN4A 4DLXA 4A8JC 3C41J 3CUQB 1DEKA 1FBQA 3PCRB 2W00A 4P55A 1U0JA 1ODDA 3I71A 3VTKA 1YKSA 2OLKA 2IS6A 4WWCA 1JXSA 5KTYA 3T1OA 3B02A 2NTYC 3K0SA 1R6BX 2XB4A 4FWGA 2DFLA 4UXJA 2VSFA 4EPTA 2EA2A 4FD2A 4HOBA 2K5UA 2J45A 3GLGE 1F9NA 4PQRA 2J5OA 1FY7A 3W3AA 3HU1A 1H9TA 1E98A 1R5OA 2IT0A 2P3SA 2PEYA 4PX9A 2H7VA 4TT3A 3TUIC 2FSWA 1QHIA 4MUBA 2WJGA 1OB5A 4XVRA 2BEJA 3CR8A 1B6AA 5FO5A 1NN5A 1LF5A 1K5GA 1W46A 3T34A 4C4PA 5FH9A 2K7LA 5IK2D 4LJAA 2K86A 1OFUX 3ERED 3DPLC 4OHWA 1E2EA 5D6FA 2JLZA 5IK2A 3T06B 3R9XA 1IN8A 3GD7A 5FR2A 4PPQA 1R23A 3R60A 1BI2A 3QF7A 2LWIA 3B1ZA 3PEUA 1AJEA 4F38A 1FPMA 4MH0R 2IYRA 3I5XA 1SKYE 3AB3A 4XIGS 4LRSA 2WOOA 1T9HA 4GZLA 5CVRA 3IRQA 5E95A 1W44A 2X8AA 1KKMA 2IBMA 3MG9A 4ZCIA 1OKRA 3T0YA 2W0SA 4QLCU 4OBEA 2KIFA 4OL0A 3HWSA 2ZR0A 3REFA 1FSHA 1M7BA 1KZGB 2ZSAA 3OFND 5KSPA 5BPIA 3NC0C 3MEXA 3HOSA 3ICEA 3M9AA 3GLIE 2J0UB 2YWGA 2KSQA 2W25A 2VP4A 3IBYA 3HTSB 2G9WA 3OFNA 4NYIR 4LJ6A 1CRQA 2OQRA 3T12A 4KO8A 3BFXA 4JYBA 1SVMA 3PR1A 1HQCA 1ONBA 1F60A 2HKOA 1SAXA 1R5BA 3B13B 4LV6A 4PPFA 1U8AA 4Z8XA 4PXAA 2JLXA 4Q1DA 3EX7C 3HHHA 2G9NA 2UZIR 1SVLA 3H1TA 4CEIB 4MGZR 2P5KA 4BZQA 4G7ZF 2YOGA 3R0AA 4C9BA 5DV5A 1Z6YA 4WA7A 1S7OA 2FMYA 4EM2A 4S04A 4NCNA 5C4GB 5AJVB 2XSZD 4QC2A 3SZRA 4WBSA 5ED4A 3R4KA 3SBEA 2O61A 1P73A 4K46A 4OJQA 5K8LA 3LW7A 2OCPA 4MYUA 3IQXA 1J99A 2F1HA 2Q9BA 1HBXG 4EQQA 2PT7A 621PA 4PZLA 3UG6A 3AUXA 3AGQA 3F8NA 3K09A 4N1AA 1P9RA 1GRRA 3HHGA 3RS7A 4OKSA 3LVRE 2GKSA 3WGIA 3GVAA 2EWNA 1IOZA 3AF0A 3B60A 4MEXF 4QRHA 5HCNA 4ZI3A 5FR1A 2DO7A 4GDFA 1VYTA 4A0HA 1KU7A 1IZ1A 1RNLA 3U2RA 4URYR 1D6JA 1FTNA 2XB2A 3GW2A 2HZTA 3HYTA 3J80Z 4DCNA 2LDUA 1IJEA 2OV2A 3CM0A 3P7NA 3VKHA 5JHGB 2JT1A 1ZGJA 5KHOC 1VTNC 5L3SA 2F43A 3E6MA 4IOKA 3BERA 2CCGA 4TLBA 5B58C 1N6IA 2YOFA 1H65A 5F98A 2KRFA 1D3YA 2WICA 4RKEA 2RVCA 5JEDA 5ILVA 3IC7A 3FYHA 4HBLA 1CGPA 3N5CA 3IIKA 2IYSA 1NVUQ 4JSYA 2R3SA 1CJKC 1LNWA 2BBWA 3F72A 4R71A 3TDUC 4LRTA 5J4HA 1W36B 5AIPA 3JSPA 4IHSA 3BGWA 2QTHA 2Q6TA 3VHLB 4E07A 2P7VB 3AP1A 1I1SA 1Z6XA 2JDID 4M72A 4P4TA 2BC9A 3LVQE 5DCMA 4IFBA 3DL0A 2CHGA 1W4BA 1ZU5A 2JDIA 1U99A 4PO9A 2PCJA 4C0SA 3DEUA 1TADA 3I73A 5DIFA 4MRVA 2VT3A 4AYTA 2IYTA 3SJAA 2NGRA 1LDDA 5FFMA 2DW4A 2NPIA 3IO3A 3X1XA 1WF3A 1MABA 2EFHB 4JBYA 4UUVA 5JMTA 1H0MA 1SFUA 2UXNA 2D2WA 4P0TA 3I53A 1DAEA 3GFLA 4A0FA 1T38A 1G5PA 3ZZTA 1I2MA 2YWEA 1D5VA 4ACBA 3MAAC 4ZCLA 5J4LA 1IN5A 1E9FA 2JLQA 3GLXA 3DEFA 4IFEA 5DD8A 1CIPA 2ZXJA 4UVAA 5BOXA 2EFDB 2F1RA 2W2VA 3OEHD 3NHAA 4AVPA 1E6CA 3GLGA 1EXMA 4II7A 2L0XA 2ZUBA 4KI0A 4RZ2A 3OEHA 5DEQA 4D0PA 1GHCA 2ZM5A 2KKOA 3GJ4A 2B7CA 3RYPA 2AWOA 2HXYA 2G7HA 2HOEA 5DD4A 1IN7A 4P4SA 4DJTA 1GM5A 2O8FA 2WMOB 2ZRGA 2BEKA 2H09A 5JVTA 2NO6A 2QPOA 6Q21A 2BBTA 5BN3A 4L4UA 2FXAA 1YZKA 3K0FB 1D2EA 1NN3A 1GFIA 3KFXA 5KPJA 4JL5A 3IO5A 3GLHB 1JR3E 4GITA 5L3EA 4JSTA 1NY6A 2GAUA 1IN4A 4NL4H 3VHXA 4DVGA 3IWZA 2QUZA 2EYUA 4Y0AA 5H68A 1YU9A 1ONVA 2P6SA 5BN4A 1BIFA 2COMA 2FZ4A 1PP8F 3BXZA 1T5LA 2DK8A 2YHSA 3BH6A 3VR6A 5K8UA 1R4AA 1XD7A 1YJ5A 2G1JA 5KUTA 2P6RA 2HF9A 1NMXA 2E9SA 3TH5A 3QU6A 3QE0A 4ENMA 1MRSA 5JEEA 1R1UA 4PC3A 1ZG3A 4IOLA 5GJBA 2X77A 2Y0MA 3VX4A 3DM5A 2CNWA 5HPYB 4BE7B 3H86A 4AI6A 4QHYA 3RS4A 1XD9A 3PJRA 3L0SA 2A6HF 5EXXA 3C7JA 3PENA 5DE3A 2PJZA 1HSTA 1T0FA 4Q19A 2LKCA 3CRQA 3OOPA 4HI0E 3U6KA 1SFXA 1T8TA 2BM1A 4A2QA 1UB9A 3DPUA 3K9GA 4LI0A 1Q3HA 4D4LA 3PEYA 3I59A 4I09A 1JAHA 3OIUA 4MRPA 5HZKA 4HLQB 1FNNA 1T3HA 2XAUA 1N0VC 1T98A 4ASNA 1G8GA 2D1VA 1TF7A 3T35A 4UXNA 4LV8B 2VXZA 5F2EA 4A82A 5GVSA 3GZ5A 3V7RA 2CW0F
chains in the Genus database with same CATH superfamily
4I2VA 3RM3A 4CVNA 5IP6A 2J7OA 3AHCA 1XCBA 1F2VA 4IBDA 3IUSA 1T1EA 2VE8A 1N1DA 4E4YA 3ZQIA 2XGXA 3DVLA 3WGZA 3GTJJ 4QEKA 1EK2A 4KWIA 2FZWA 1IBRA 4R5HA 2JVGA 4Q05A 3G3ZA 3RPEA 3U5ZB 4A3BJ 1M34B 5JH7A 1N6LA 1MQAA 1QNTA 1E0KA 2HGSA 3REQA 5E20A 3QOYA 1NM5A 3U9SA 3ZV6A 2WTUA 2E7WA 3DBLB 2ABWA 2F9MA 1IV8A 3FCYA 1ISPA 1ZZEA 4RL6A 3A45A 3ZLTA 1D2AA 2W4IA 2KMUA 3ZH9B 2OC9A 4UHFA 4HDSA 1JPJA 5B2FA 4CE6A 5D1NA 4JVSB 2PS3A 3P4UA 4JLBA 1OREA 4X63A 4RK4A 1OIWA 1T2CA 3SC2B 3HJRA 2Z57A 4OCZA 1XSXA 3NT2A 4P38A 2H4ZA 2OOKA 3WXMA 4EKNB 4GS5A 5IUKC 1JIUA 1GPNA 5LLSA 1LA2A 4LZWA 2C82A 5JXWA 3OE4A 4M6WB 3GWZA 3STXA 4UHHA 4IHVA 1K3WA 2Y0PA 4O4LB 4EEZA 1DJLA 2N9UA 1OYYA 2GPYA 1Z88A 3WL4A 4IO0A 3PEVA 1T5TA 4Y6RA 1VZ0A 1HT3A 4LF5B 4R83A 3NAGA 2VBYA 3VPDA 2DT7B 3PQEA 1N6HA 4LF7B 4Y9UA 5CBKA 3B3JA 3IP7A 1D09A 1MBEA 1VJGA 2RD2A 4CZZA 4UREA 3V9AA 3HRKA 3H4JA 5KAMA 4K6FA 2E36A 1R2QA 3KZVA 2F62A 1EX7A 2Q2WA 4GEGA 1NJGA 1XZJA 3H05A 2JD1A 5C34B 1VJ1A 4WTOA 3H1EA 2ELHA 2V3WA 3T5MA 3I6ZA 1DS6A 1C7RA 4MWBA 5FOXA 1K7XB 3SMVA 3EPJA 1O89A 4EO7A 4BUZA 3PL1A 1OIZA 2J3HA 1PK8A 4PGGA 4L0ZB 4WN9B 3H3JA 2P2YA 3SZLA 4R54A 4XGNA 3PFHA 4J1TC 1P2BA 4MQEB 1JGSA 1XXLA 2JD2A 3ACDA 4KU4A 5KJ1A 1U3TA 5BWNA 4I4TA 4BNFA 4DW8A 3OTOB 3IB3A 4QFMA 4C89A 1E6MA 2VK4A 2G8LA 2DM6A 4AS3A 3AIIA 3LVWA 3LWDA 2QN1A 1XCJA 1YRNB 3KQHA 2HLNA 1EAYA 4M8NE 2H2WA 1GPH1 1VMKA 3TW6A 4B4OA 4WURA 5C1OA 2BZ1A 2XMSA 1OBHA 3ANSA 3IQWA 1KGDA 2BGLA 3MSCA 3H5RA 1E3PA 3MN1A 3U19A 3RFVA 3E58A 3PT9A 4R3DA 4HQ6A 3HR7A 5KQGA 2XQJA 1E6KA 2V6BA 1A27A 3K6SB 2IA1A 1D1AA 4ZQCB 2DR3A 3RJZA 3K8OE 3C3KA 1E3WB 3FVTA 5JSYA 1JHFA 2F5VA 1R5GA 4JN6B 3I56I 1QH8B 5CH5A 3IAM2 2R79A 4AW9A 1P81A 4BV8A 3K6JA 5HF6A 3A26A 3BG3A 5JSFA 2WRZA 4N7MA 4NFSA 4W5RA 5F08A 3GJ0A 2WV7A 1Z5OA 4J43A 3L1HA 5SZJA 3BMQB 3DKRA 3D5QA 5D00A 3MGKA 3V42A 4O3MA 4PNHA 4PYLA 3VO1A 1SBTA 3QPCA 1OROA 1W5BA 1Z25A 5IDQA 4B6RA 1EG7A 3OTWA 3QV1A 3WGNA 4FXOA 2VJ4A 5ABPA 3J7AY 2H2FA 2OD5A 4X3CA 4BMOB 3CIFA 1QYIA 3ONNA 3QSYA 3ZE2B 2CLHB 3UGTA 4CL0A 4J03A 4OQMA 3OE7D 1WTCA 1D2HA 4PXYA 5I45A 3T7EA 2QU7A 2M6LA 2OXCA 1NG6A 3H0KA 2PSEA 1BU5A 4JLJA 4HLYA 3DLPX 4R1LA 3PFYA 3UAXA 1N2HA 3R7BA 4O2BF 3PGVA 5EJ7A 3OBIA 1F51E 2Q3HA 2FN7A 2OQGA 2QM8A 5KREA 3UUWA 3BGOS 2RKHA 4A3VB 2LXNA 2ONKA 4BFUA 4B8ZA 2O7SA 1LCIA 4BX9A 2OJED 3P5SA 2BCGY 1HT1E 3G7NA 4PD2A 2CMGA 1OR8A 1OWPA 2ESRA 2G07A 4YAWA 4EYKA 1I51A 5HTKA 1ENYA 2N42A 1KJ9A 3NUQA 2AEEA 2MR6A 1C9EA 1Y7LA 4KR6A 2OESA 3DZGA 2PWZA 2Q2QA 1ZYUA 3CONA 4XQ0A 2IEYA 2VBCA 5ALSA 3H4VA 4FUQA 1SOAA 4KXLA 1RWMA 3GJRA 4XOUA 3FHCB 3JSOA 3UPTA 2XGGA 3T1YB 2GEDA 4NU8X 3CFYA 5DT2A 5D6OA 2DFEA 2I7VA 1R4ZA 1ZITA 3V3KA 1HLPA 3KR0A 4NQWB 5FYQA 4W9MC 2P35A 1MDMA 3NCHA 4XGIA 1V9LA 4QOGA 4EFDA 2EUCA 4BE4A 4ESBA 4P1ZA 2XGNA 3V32A 3R9IA 3UXEA 4W8GA 4G5OA 1F5NA 3UCFA 3LA8A 3HI4A 1I7PA 2DHQA 3PQ5A 1MIOA 4LZPA 1W4ZA 2ZUFA 3X1MA 3KVYA 2M6SA 5I7FA 4WK6A 3B6CA 1PVOA 3ZN0A 3FMSA 2OO7A 3VDNB 3EQLF 2Q45A 4DR1M 1ODJA 3VPAA 4S1OA 2UZAA 1K78A 2X85A 5HLHA 3D4NA 3M4JA 2FW1A 2ST1A 5GAGJ 1M2HA 4JASB 2HI3A 4ZIRA 1X42A 2GXQA 3FNGA 4FNOA 5HUQA 1VZ2A 1OCTC 3DE3X 3ONQA 3WYGA 3X3HA 4ZXPA 3FX3A 4XVUA 4UE2A 1N5IA 2VBXA 1SMYF 1W59A 3OZWA 1KBQA 4N48A 1I0LA 4MRMB 3AVVA 1XPJA 3NZEA 2NXCA 3BZUA 2FKNA 3HXTA 3O8NA 4U2EA 2BFNA 1P7CA 3VDMA 3BN3A 1EX6A 5IARA 2HU8A 1ZHOA 3S8EA 3AFIA 2IV3A 2M45A 2GAAA 3B51X 3IX7A 3HOXJ 3VPRA 3ZWPA 2WWRA 2X1LA 4I5FA 3M6VA 4AMZA 2PL1A 3UZUA 3WKAA 4A6PA 5EMLA 2AMYA 4YCBA 1WPQA 1CRPA 3EDMA 3VM6A 4Q3AA 2GFHA 2H08A 2CE2X 5TMPA 3MBKA 2CK3A 5IULC 5LBQA 2NRAC 4DT1A 4UOQA 4FYIA 5LXTB 2HHLA 3L6RA 3KELA 1U0NA 1C5KA 1P0MA 1N8NA 2Q50A 4M2LA 2Y48A 2ZRLA 4LJ5A 4I7HA 3RYFB 2WHPA 3CN7A 3FFTA 1WZUA 3TE7A 1FFEA 2VHZA 2XPUA 3D6AA 5CM8B 2ZSFA 3HP4A 3H9BA 2WB2A 4R0MA 1MRZA 3GJZA 2ZYVX 2P9BA 5IHPA 3ITNA 4FFBB 2RFLA 4Z3OA 5ESWA 2ATEA 1S29A 1GQQA 3FETA 1KMMA 1EVKA 3PBKA 2QT9A 4Q4AA 3EGVA 3L79A 4KFUA 1SD6A 2DYKA 5B57C 4XRFA 1ECFA 2BJVA 1J07A 4DTCA 3I72A 2VKQA 2OK7A 4CUZA 4WK4B 2B3TA 2LH0A 1Z59A 2FKAA 3S1LA 1Z2CA 4G4RA 1JUSA 3AV0A 2XC7A 3AL3A 1A9XA 2C00A 4WPGA 1OJ7A 1TC2A 1L2BA 3I58A 2FPSA 1ZLXA 1XE3A 2WYVA 1NYLA 2XBLA 3AJIB 5CCBA 2ZIZA 4MZDA 4Q3LA 3ZE8A 4YHHB 2AQKA 4UTVA 1DMSA 3BILA 4OXRA 4Q34A 3O2PE 5JFOA 5EFOA 2NXNA 3BR5A 1JIQA 2CGPA 4HDOB 3O8QA 2J0VA 4UEKA 4UNQA 3EFOA 3RTBA 2V6CA 1F9EA 1VPDA 1JDVA 3H5AA 5EJ5A 4M46A 1N7JA 2QUJA 4DBVO 2CNLA 3HA7A 1PT6A 1N7HA 1XL0A 2YWHA 5IFKA 2HTSA 1UPTA 2B37A 2I7CA 2I8AA 4EB8A 1QVTA 3DTNA 3BQZA 4AF7A 4OKIA 3QMMA 5CPFA 4OOIA 4K26A 4MGKE 2RIPA 1UDWA 4EUEA 5FWXA 1B6TA 3F1LA 1YB5A 1AMNA 2WYHA 3M49A 4EY5A 1GLNA 3UXMA 1EESA 4ZGGA 3BXHA 3VNAA 1OXUA 1J42A 3TWMA 1Z22A 1WI3A 1XZBA 5I8ZA 2FFAA 2K9NA 1AA7A 1KVQA 2RH5A 3U44B 9MHTA 2ZAGA 2L2OA 2VHCA 5K8JB 2QTMA 3B8EA 4LRWA 3W8EA 5E1DA 1VE1A 1JI0A 1H2XA 4B7AA 1A5TA 1MBJA 2OU2A 3Q1KA 2BMAA 4JP8A 1IY0A 3ICPA 4ZV9A 1O94D 5LHHA 4XTCS 5LGTA 2YTZA 1T3ZA 3LBFA 4HPQA 2JZCA 5JNTA 1LV7A 1ISGA 4F56A 1T5HX 3E35A 1Q5PA 5EGOB 3IIEA 5IT5A 5ALEA 1L0BA 2QKLB 3KSMA 2ZMEC 3DXZA 1E3HA 1GNQA 2OV6A 3P9SA 4J2OA 3RC7A 4AN4A 4QTZA 1HE8B 2XZOA 3V4PB 4BVJA 2QG4A 2XTNA 4EGYA 3RKWA 4M22A 1P9LA 4ZVTA 1L7MA 1Q0LA 3GHYA 4FYVA 2TECE 4TWZA 3FCXA 5K6TA 4DWVA 2UKDA 2O8EA 4Q3BA 3E18A 3WMGA 2HYDA 2GDZA 4L9WA 4OAOA 1GA4A 2IXTA 4IVQA 2RNGA 5B3SH 3NFRA 1LPBB 5LA6B 3BL6A 4KXUA 2A9QA 3BBPA 1VB3A 3FOWA 4RTJA 1HEIA 2D62A 2OGZA 3Q3EA 2WP0A 1MV8A 4G0PA 1T4GA 3GEGA 3MK31 1B73A 5E4FA 3JR9A 4BDTA 2OD7A 2ID8A 2O5RA 1TL7C 3KJXA 4JQSA 3CLRC 4YDRA 3DOIA 4LVCA 3P32A 1O6CA 1WTAA 2ZWVA 1YHZA 1U7PA 3PTAA 5JYDA 4AF8A 4OAQA 2NV6A 1PUIA 3UEOA 1XMPA 4ZD6A 3MUFA 3L7BA 4IIVA 4RZUA 3T3IA 3E6CC 4BRWA 3G2IA 2O0HA 3TNFA 1FIAA 4JBHA 3VJMA 3N86A 2CO5A 4M98A 5DN6D 1FTTA 4KT5C 1WXXA 3ZJ5A 3M82A 2HRBA 2F6RA 1SPBS 2A3SA 4DABA 4TSFA 4K1XA 4LOKA 1PFUA 2JATA 3EZ7A 1OTHA 1PR3A 1T95A 1M8PA 1O3RA 1IY9A 1SD1A 1AKHA 1NHWC 2IYZA 3X2SA 4NHOA 1OLUB 1Q1BA 2A0KA 5JG7A 2O14A 1VGQA 1O77A 2Q9AA 4YIRX 4C4OA 2G36A 4W9NC 3SPXA 4KIGA 4V0QA 4G36A 1LJLA 2HV8A 2IHYA 3WYEA 4UZEA 3M34A 5JZVA 2W82A 4DR7B 3H84A 3NEYA 3PI7A 2NT3A 3HG7A 1QMGA 4KPYA 4RMHA 4LG0A 4W63A 3FPLA 4CH7A 3QOWA 5AVRA 2X0EA 3JQ7B 4CM3A 4EPVA 2JAUA 1YTYA 3GZNB 3E6DA 4XQEA 2WAAA 3A1TA 5D87A 2ZREA 4MI3A 1AKUA 4ND8A 4WCFA 3DDUA 3WL8A 4OQ4A 4MHGA 4D4GA 1GUZA 2CL5A 1MU5A 5LMUM 3WKEA 2VKHA 5IBPA 1ZR2A 1ENZA 2OCEA 4R8RA 2LRDA 2G06A 1N8SA 3KJEA 1LQ2A 2DHYA 2WIAA 2J5YA 4OVKA 4RVSA 3W2EA 4BVFA 4FWDA 1LC3A 4YV2A 4J90A 3ZWWA 4E7KA 4I08A 4K9LA 3GEBA 3SI7A 2ZM6B 2YX4A 1GLVA 4DN6A 5DK4A 5E4YA 1UC9A 4YAFA 2O1XA 1RR7A 1OLSA 1UPXA 3RJ9A 1C0IA 1KONA 5ICCA 4EGFA 4D0SA 3OURA 3JWIA 4AYBA 4F2HA 3Q9NA 1IQ0A 1XA4A 1BJZA 4I99C 4QULA 5DW0A 2X6RA 4KOAA 1G64A 3D3KA 2EV5A 2NUAA 4JT4A 5BUCA 2DFHA 4KN5A 1RE0A 1KZ6A 4PO8A 4LRTB 1Z6RA 1JTXA 1V8FA 2Q3EA 2Q7DA 3CC2I 2G5GX 1RYHA 5H2FC 2I91A 4URXR 4DBRA 2OZLB 4XB2A 3QFFA 4MW5A 4RM3A 1BSVA 1RAHA 1ZMXA 3F92A 1G4AE 3BT7A 4QXPA 1HZJA 2Z8YA 2IXGA 3W6OA 2DWZB 4O1IA 2BIFA 1TZ2A 3V4SA 1EFDN 3I4NJ 3ASUA 4N5HX 4JR1A 2A4MA 1JEDA 4FT2A 4M0DA 1QZYA 3DQQA 2ZITA 1LLCA 4XLLA 4L85A 3N2YA 4LKRA 5BN1A 1PAUA 4PJJA 4UU7A 5LEKA 4CTJA 4V0SA 1PDNC 3LW8A 3T9FA 5JCXA 5J3LA 2BHNA 1JHRA 1L2DA 3BGDA 5IC6A 2JB9A 4ND2A 1JQDA 1GQSA 3I59B 1XV5A 2Q7XA 5CT6A 2FXVA 4TOIA 3SS8A 4RVCA 2FMKA 3NEAA 4ZZ2A 5NLLA 4JJKA 4TL7A 1NVDA 2AOTB 4RFVA 3OLWA 5G3ZA 4IBOA 2REXB 1U8BA 3N5KA 3QYAA 3Q2KA 3RDPA 1Y4ZA 1U31A 1L1RA 3LLMA 1T24A 2C5RA 1E2QA 4QATA 3KQUA 4K81B 2VOEA 2H6EA 5C32A 5ALIA 3RTCA 3QVKA 4MDHA 4I19A 4LJLA 1MOPA 1UP7A 2EW8A 3AKEA 3EZLA 1BN5A 2O6HA 3SNHA 4W1UA 1XZAA 3W78A 1ZVJA 2A67A 3LUFA 4XASA 1MEJA 2CT8A 1DIAA 4DKXA 3G02A 3DWFA 3JZAA 5HDQA 4DIUA 4MWGA 1Z07A 2P2GA 4FLMA 2BY1A 3K8ZA 1U5TA 1WWXA 3P5JA 4HX4A 3N87A 2BDUA 3PNOA 2I71A 2NVOA 2Q1SA 3UGQA 2DFLA 4LGVA 4C7JA 3WIDA 3HJAA 5MF6A 2F8MA 1KZ9A 4NJEA 2NVUA 3S2YA 2LR0A 5HFJA 3FPGA 3S7TA 2IE0A 2JRLA 5CX1A 2B7EA 2FUEA 4MH0R 4XIGS 4P4LA 3DU5A 5TPZD 3T6PA 3RU3A 3FBGA 2FQWA 2GHTA 3ZCRA 5H80A 1SAXA 4G8CA 1E1CB 2GM5A 3IP9A 4KL8S 3H1TA 3F3KA 2CZQA 2P69A 1WDKA 4K46A 3SS7X 1HBXG 4DW6A 3WGIA 1TM4E 3AF0A 2R6JA 1OUMA 4YQEA 4GDFA 2AFHB 4UMVA 2XB2A 3LHKA 3IKLA 3OMXA 2CCGA 1IWOA 1K0UA 2KRFA 1D3YA 2NX2A 4ZOCA 3QX8A 3IC7A 1N32B 1CGPA 4Q9NA 1VL1A 1PWZA 2BTOA 4R71A 4ALNA 3CCSI 5JAHA 1DBQA 3AP1A 5G4KA 2M34A 4MVXA 3DD5A 1TADA 3I73A 4MRVA 1NULA 5FFMA 4AFNA 1XROA 1SBYA 3ABKH 4R3UC 4P0TA 1B1AA 2D2IA 4A0FA 2A88A 3G8DA 2HQBA 4UUQA 1XWWA 1CIPA 5BOXA 3HMQA 4OVZB 1WVRA 4M3EA 4FX2A 2ZRGA 4D5GA 2I6XA 2JFXA 2BBTA 1PNOA 2WJ6A 4AIRA 3RG2A 1N4DA 3UMMA 4GITA 4GI2A 3RE8A 5H68A 4C2MJ 5DBFA 4A2CA 3LSHA 2QUHA 1R4AA 1XD7A 3MTJA 1YJ5A 3CJRB 2P6RA 5K6RA 1R1UA 1D4ZA 4GHAA 1BGWA 1SG6A 4Y4RA 3H13A 1OILA 4KMMA 4HBZA 3W4KA 5AHOA 1N0VC 1G8GA 1NUAA 2CW0F 3FNIA 3VVLA 3GAMA 4CLXA 1NIJA 3C7DB 1J2RA 4CR6A 2YNMD 1WZ2A 1KAHA 1QK3A 1QVWA 2ZBQA 1H1LB 3ZE7A 2RG7A 1GTG1 5G53C 1Z0ZA 4LDQA 1WX1A 3SDZA 1XGMA 3L7YA 1JFFB 5IDYA 4Q3EA 1V25A 4AM3A 3JAWB 5LWQA 1RUOA 5K20A 5B1HA 3AEXA 4RZXA 3AFHA 2QX8A