2QBYB

Crystal structure of a heterodimer of cdc6/orc1 initiators bound to origin dna (from s. solfataricus)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
368
structure length
368
Chain Sequence
KNPKVFIDPLSVFKEIPFREDILRDAAIAIRYFVKNEVKFSNLFLGLTGTGKTFVSKYIFNEIEEVKKEDEEYKDVKQAYVNCREVGGTPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIRAIIYLDEVDTLVKRRGGDIVLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEYGLIKGTYDDEILSYIAAISAKEHGDARKAVNLLFRAAQLASGGGIIRKEHVDKAIVDYEQERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISELDMFGIVKIRIINRGRAGGVKKYALVEDKEKVLRALNETFEDSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Replication/dna
molecule keywords DNA (33-MER)
total genus 112
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09079 Cdc6_C CDC6, C terminal winged helix domain
B PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2qbyB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qbyB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qbyB02
5C18A 2QN6A 3JSPA 3KJGA 4CEHB 3FOZA 3WBKA 1J8YF 2FEMA 4QHSA 2LKPA 4YMVA 1QVAA 2CSOA 1ZC4A 2KBEA 3K1MA 1S3JA 2KI5A 4OIPF 2ONJA 1Z63A 3WTZA 2A61A 2P67A 2PBIA 2CCJA 4V0NA 2V4ZA 1JQLB 2ISYA 1JB1A 3VR6A 1G8HA 1KGSA 3BROA 1O3TA 4DLRA 1CTQA 1V43A 4Z51A 1J2JA 2IL1A 2A3RA 3S2WA 2WHXA 4IOMA 1E2LA 4OKSA 4LK0F 5JCZA 1R1VA 5D3QA 4KFUA 2FSIA 1R2QA 1DBSA 2F5DA 3LQQA 5L3SA 2B8WA 3LFKA 2VHQA 3B1YA 1P9RA 1EH7A 4JLJA 4B6FA 4BRWA 3PEWA 3O2PE 5FUXA 3LRPA 1AZTA 2VBYA 1UBGA 2FSFA 2KIMA 3BD9A 3CRRA 3FTQA 3ZQ6A 1XNJA 4DLYA 2R3SA 2VSOA 3THXB 2EWWA 2IUSA 3LW7A 4Q02A 1DE0A 4EM2A 1R5HA 4V0ME 1X6VA 3TDUC 5L3VA 4B48A 1Z0FA 2EFHB 1S8NA 4GOJA 3QQ5A 1J99A 1YR8A 2L0XA 1IN4A 2D2EA 5EEHA 3VR3A 1PUJA 1UADA 3KLNA 4R1HA 1YRBA 1ZGJA 3TSZA 3TUJC 5G3ZA 1X37A 1XCVA 2G7UA 1T0FA 3ZMDA 1J8MF 5JFGA 3GXOA 2OLJA 3ML6A 2ZJ5A 3K9NA 2HJVA 4LHWA 3VNUA 1Z6AA 3CO6C 4I0BA 1EFCA 2B8TA 2ZRGA 3A8TA 3LDAA 3T5DA 4F7WA 4EV0A 1N6RA 2PMDA 1ZAOA 4PQFA 1HQYE 4O5VA 3NH6A 2Q21A 1UBFA 1UEJA 1DARA 1VYVA 5LBQA 2ANCA 2RVCA 3SFVA 3M4YA 3DXJF 4IJAA 1XCMA 5A5GA 3PEYA 2IP2A 4HQEA 1MV5A 2F43B 1IOZA 2QAGB 4NCNA 3VQTA 1L4YA 3PCRB 4IEIA 4C0QC 1YW7A 1SVOA 2W6JA 3D6TB 2QP9X 3ZZUA 1N5LA 3SNHA 4YG2F 1PUIA 2IF0A 1T0HB 2FE3A 5FOSA 2XASA 1OKKD 2ZI3A 3NHAA 4M8NE 2EFEB 3KTAB 4CYMA 4CGZA 1V5WA 3P4XA 1XEWY 5D8LB 1R4AA 4FWGA 2A5JA 3IL2A 3CR7A 1TTYA 2DK5A 2F2EA 3K9LA 3PEUA 4DLZA 2NIPA 3D31A 3VKGA 3RS3A 2YWEA 4U0YA 4BFSA 2F1IA 2G0NA 4B44A 4KYWA 4B8XA 1IXSB 2HGCA 4MRSA 3T8RA 1S9DA 4OHXA 4P4TA 4WIAA 3UWOA 3KZYA 3M6AA 4BFVA 2MSDB 1XMAA 2QQEA 3ZDQA 4BEBA 2NAZA 5J4YA 2DY1A 5H68A 2ONKA 2CE2X 1NIPA 2YYZA 4QBIA 2F9LA 3MRSA 5KSOA 3VEPA 4U7BA 5FD6A 1OV4A 3LO5A 4IOLA 4B73A 4TL6A 3AM1A 2BEOA 1BKDR 5DIFA 3U44B 5FUYA 3I59A 1A4RA 3GVAA 4LBYA 5A0FA 4QFMA 2HQNA 2OFWA 1AZSC 3FM5A 1NBMA 3VR1A 1BOFA 2Q0OA 5K5RA 2G0TA 3AH8A 5CJPA 1ON1A 1D8JA 4EDHA 1E0SA 4B43A 3MZYA 1CR1A 3EPKA 4PZLA 4PQRA 5HCIA 1E69A 2V6JA 1TAGA 2MC3A 1MJ9A 3VB2A 1EV7A 3LW8A 2L54A 4FI3C 1O87A 1E1QD 5B30A 3KQLA 1R0XA 3B5JA 4HUQA 1ZNZA 2C2HA 4I1VA 4DLSA 1R00A 4LFUA 1G6HA 1MZBA 2OCAA 4JLBA 3TSWA 5CVIA 1E2MA 2DU9A 2F1JA 3K70C 2UWMA 3I5XA 4R7ZA 3REOA 1KKLA 4TTQA 5F9HA 4JLKA 3HSFA 2P65A 1AJEA 4AYTA 1SXJD 1XMVA 1RUOA 2QGNA 4TQ9A 1SVMA 2J7PD 1KYIA 1RFLA 1IJFA 4HBLA 5EE9A 3LA3A 2JJ2D 2MLKA 3DVLA 3Q5DA 3QKRA 4BLRA 4MYHA 4EFNA 4ZDJA 1XSDA 2HFHA 1P61B 5CM9C 3WTWC 2A07F 1EFRD 3OAAA 2ZAMA 1EFRA 1EX6A 1ZM2A 2OCPA 1G8YA 1I1SA 2J0UB 2L3DA 5FGMA 4FX4A 3WTVC 1Z0IA 5HLGA 5L3GA 4Z1MA 2O8DA 4LJ6A 1RJ9B 1BI2A 1EGAA 1C1KA 4Q9HA 1AKYA 2X0LA 1E9RA 1DOAA 3B8HA 2HS5A 1R10A 2BEJA 1KI6B 1BMFD 2H57A 2BGCA 1OKRA 2IXFA 2REOA 2FWRA 1ZD9A 1GKIA 5FL3A 1T3LA 1VG0B 3F72A 1FQJA 3W34A 3L0PA 2FA9A 4BECA 5K8IA 5LHGA 1GAJA 3MWYW 4Z8XA 3RRMA 3TQFA 3BE4A 5EE1A 3VMFA 4B3CA 2NMVA 1ZU4A 3EC1A 3OE7D 4DUGD 2P6RA 1R36A 4LJYA 3CH4B 3JAMK 3O8RA 2O8XA 1OSNA 3VKWA 4LB5A 4EFMA 1WWXA 3QP6A 1ZW6A 1YZUA 4NP6A 1A5TA 4D0PA 1JJVA 4ZDIA 3T12A 1IY2A 2ZXJA 5DLQC 3BJAA 3W6PA 3I54A 5ERIA 2VH5R 1EXMA 4A6EA 1JAHA 1QZZA 1YIOA 1G41A 5CLSA 1LS6A 1UBCA 5AR1A 3G3ZA 2YKGA 4F92B 3QI2A 1YZNA 4DCVA 4QBGB 2P5SA 3UXMA 2G3YA 3WXMA 2ACJA 421PA 2H09A 1Q20A 1IUYA 2WTUA 3PJRA 2EVWX 1E17A 4BPBA 3TK1A 3ZLJA 4AKGA 3UMFA 4C4PA 5ICFA 5DGXA 2ZUCA 4CZZA 2GAOA 1FPMA 3GJ7A 2REBA 1W48A 2XB4A 4KCGA 5DV5A 4MUBA 4U0VA 1T2KA 3QXHA 1Z6YA 4LGMA 1TF5A 3CNLA 2FJUA 2GTPA 1JR6A 2ERXA 2OD5A 1OT3A 3R9IA 4LRSA 1CR4A 3KJIA 5J8CA 2OBNA 1B9MA 2YOGA 1U78A 4GP7A 3M8EA 4M4SA 1OJLA 2CWEA 2VODA 3AF0A 5EE0A 3FMSA 2DI3A 1GL9B 2W6JD 2YC2C 4FD2A 3DQVC 1X3UA 2ORVA 2OT3B 4DIDA 1Z2CA 1UKVY 4PZZA 3QPHA 2WSMA 4ASUD 3GW2A 4V03A 3THYB 5BN4A 1P2TA 3FX3A 4UVBA 3KQUA 4Q5SF 3U44A 1TW2A 1OLOA 5BMZA 2WKRA 1TBXA 3SBDA 5DN6D 3CW2A 4HAWA 2ZE7A 2A5GA 3BOSA 1Z47A 1KQ8A 5DCFA 3BJIC 2RHMA 1QHXA 5LBIA 1M74A 4DCSA 3MCAA 1T5LA 2IYXA 3A1UA 2WOJA 4RB3C 4XOIA 1RYFA 1S9HA 1KQ0A 2ZO4A 3RS5A 2OZUA 2B0LA 3WGGA 3LAJA 3GFIA 3SOPA 4AKHA 2A7QA 4IDQA 1WQ2A 1CIPA 3FPAA 2VOOA 1BYIA 5JSZA 2JPCA 2WM9B 2YX4A 1O57A 3MFYA 4Q4LA 2Q9CA 2N42A 2AD5A 4K46A 4EM0B 3KKOA 4E5UA 1JXMA 4EIWA 2HQRA 1XTRA 2WJHA 1HXDA 3F8MA 5H6RA 3EZFA 1TX4B 1GIAA 1WB9A 1TQIA 4G5QA 2HEIA 1X8LA 1LVAA 3BK7A 3QXSA 5IDVA 4Q9IA 2VSXA 2OCBA 3FMFA 3TQCA 4NZYA 3BPXA 3UKDA 1O3QA 3T15A 3V7CA 5EXSA 3D0SA 2GEUA 4JIMA 4G8XA 4KDPA 1Z2AA 2FMXA 3B1XA 3BFKA 4UJ5A 4DBLC 2E87A 1R0ZA 4P9UA 3ZS9A 1B23P 1S3SA 4HW0A 3KTAA 3AKDA 3K9TA 2C96A 4IVRA 5JBQA 3QOPA 3D3QA 3TW8B 5L3QA 2CHVA 3MFKA 3B78A 3RSOA 1GVJA 1WXQA 5TB5A 4LPKA 2AKAB 2AN9A 2QTFA 3HPRA 5ELXA 5DYMA 3RRNA 2VEDA 3PQKA 3H4MA 4QHYA 1KU9A 2CL6X 3LAPA 3IWZA 5CDFE 5JI2E 5CVJA 5B2ZA 1W4BA 5JWHA 4KFSA 1F4KA 4M21A 3C5CA 4LHVA 4M9QA 5E7JA 1G20E 3N70A 5JFRA 2V6CA 2ELHA 3P9KA 3F22A 5K1YA 5L3DA 1OFUX 4A82A 3ETLA 3I64A 2DFTA 3UMSA 4DDTA 3LWNA 2ZUDA 3FXUA 3DZDA 5KDLA 3SR0A 4XWOA 2J1LA 4WZ6A 4DZZA 3SXYA 5ICEA 1ONVA 3U60B 5FD5A 2QM7A 4BFUA 4BYYA 3JVVA 4OQLA 1GM5A 1QZYA 5AIPA 3IC7A 5DDGA 5DN6A 4EJSB 5F9FA 3DPTA 1T6SA 1AA9A 2BM0A 4YMUA 3CR8A 1KZ7B 4JLOA 4IFBA 2VP2A 2ZRJA 1RRCA 4L16A 5DYIA 2FZ4A 2CDNA 2PEZA 4KSBA 1Q1ZA 4LHZA 4IDPA 3H3UA 5EXTA 3GLIA 2DWPA 1ZG1A 4KIGA 1XJ0A 3LVRE 4TMZA 1UJ2A 5D5VB 5FOWA 1ZCAA 2EWVA 2REXB 5G3YA 5FLXK 3KW6A 2GBLC 3GD7A 2D1HA 3JAMZ 1WRBA 4IDNA 3DF8A 5FLXZ 3GJ4A 3OIUA 1DAGA 4HUTA 3AVUA 2QTVB 1S0UA 1D2EA 1NN5A 1EG7A 2P0EA 3KB1A 4FWDA 4RKFA 4KJZA 4BEJA 2XTMA 1E2NA 3ZVLA 4ERNA 3BAFA 2QY9A 3FKSA 5FOUA 4KODA 2EFWA 3GLGB 3RRYA 3GFTA 3NC1C 3SE0A 4FHTA 5FR1A 4MDEA 5LB2A 2WWWA 4B2IA 5E8GA 4YLGA 5KUTA 2PBRA 4ZO4A 5GADl 3GFMA 3CZPA 3X1DA 2WSSA 4KVAA 5FOXA 1G3YA 2PJRA 2XJ4A 1M1YE 5J6XA 2CK3D 4Q1EA 2NTYC 4PHFA 1F5NA 4PC3A 1E2FA 1P92A 2OLKA 2GRJA 4IKEA 1YG2A 2XGJA 1SD6A 1F9NA 1RYHA 2QA5A 1XFAA 1HYQA 3P9CA 1OXXK 1KKMA 1P4WA 2DYKA 3CRVA 4JYBA 4JLAA 5IT3A 5M04A 4EVIA 3DKWA 3ZVMA 3RS4A 2QGZA 2GWRA 5EP1A 1L3LA 1KZGB 3IIJA 4YMWA 1W7AA 1GKYA 4XD7A 4CW7A 2WJYA 2WTEA 5L3RA 2LDUA 2JLZA 1RPZA 1RW4A 1HY3A 2GAAA 3TGPA 2ZEJA 2O8CA 1Z07A 2IYUA 1Z6GA 5IK2A 1G5PA 5HS8A 3KKPA 3ASYA 2PEYA 3VR2A 1AOYA 2J41A 4RCYA 1ON2A 1OYIA 4FMCF 4HF0A 2C5LA 2IWHA 4AVPA 2VP5A 1P4SA 4P55A 1KU2A 3E70C 4A5NA 1E79A 4GL2A 2XZOA 1HT2E 1WI9A 5DUKA 4EJWA 2EFDB 2ZRDA 2LKDA 2R7FA 3ZPLA 3G5UA 1FSEA 3NXSA 4N9HA 5KHOC 1AS0A 3QKTA 3SJCA 1W0KA 5FI0B 5FTJA 1NHAA 1II8B 2RGGA 3K53A 1FOKA 2C8VA 2GILA 2JJ1A 4HEJA 4L9WA 3U7FB 2QT1A 5EUMA 2QEQA 3LLMA 2CFXA 2ZRNA 3EETA 1ZNYA 3CO5A 5EZ5A 2ODWA 2DPXA 1QHHA 4Q7KA 2YX7A 1T98A 2P6TA 2L4AA 3BRWD 3K0AA 4KXFB 2HF8A 4IOKA 2HDNB 4A0GA 1IM2A 1LS1A 3RTRA 3IPXA 4XH9B 1NIJA 1SMTA 2JGNA 4US2R 1MJAA 2VSFA 4Q47A 1KAOA 3SJBA 4BFXA 4ZYDA 4OI0A 3IILA 5LHHA 2RGEA 1CJUC 2XAHA 3H3ZA 2ZUBA 4JBYA 3GLGE 3AVWA 4PPGA 4KI0A 2ZS8A 2YV5A 1S3GA 1E1QA 4LGWA 1VCIA 2IW3A 3CLOA 3ECHA 4QC2A 4RKEA 4GITA 1OW3B 1HKQA 1SULA 1B6AA 3GEZA 3WYAA 1DAEA 1FW6A 2DB3A 1F1ZA 1KI9A 1YRAA 4IW3B 4PC1A 4FT8A 1WBDA 1UB9A 3W9YA 4UNSA 3C16C 1PLKA 4GYIA 3HRMA 2NPFA 5HS7A 1Q44A 2P6NA 4GXOA 5LRRA 1QG4A 1US8B 2QQ0A 5HPYB 2ODNA 3K1JA 3DMNA 1ZVQA 1GFIA 1KI3A 3I4PA 4GSYA 4P5OA 2JAQA 2WV0A 5L3CA 2XOKA 3ZIAD 4HAMA 2JLYA 2XRNA 1YQAA 1DTSA 5SZHB 1K78B 1VKJA 4V0OA 1LFDB 1YZQA 4UJ3A 1S8FA 2CVHA 2I1QA 5BQ5A 3B7GA 3BY6A 4LX0A 2EQBA 2I1VB 2ISZA 4MITA 2JPBA 3DOEA 2X19A 3T1QA 3ZYCA 1R0WA 3TSOA 2ZPTX 2Q3MA 2ZQ5A 4HI0E 3V7RA 2J59A 1Z9CA 1D5VA 1GDDA 1U9IA 4L9TA 2ZAOA 2Q8KA 4Y13A 1W7PA 2GA8A 2R6AA 2H6CA 3EUHA 4QGAA 4I7HA 3R7WB 4D4LA 2H18A 3HWSA 2EV5A 1EFHA 1XU4A 2NO9A 2RGNC 4NCJA 5BQTA 4QJ4A 4ZI3A 4RFVA 5HS9A 1E0KA 2PN6A 4FMDF 3VR5A 3EIQA 4C2TA 2N1BA 1NMZA 3OEHD 3QPUA 3F6OA 4JKIA 4QKQA 1XMIA 1RZ3A 3F0TA 4XWKA 2C6YA 1OPCA 5E1WA 5HOOA 4TT3D 1BOAA 1HSTA 2NG1A 5AJWA 2VL7A 1EFTA 1MO4A 2Z4SA 1JAIA 1CXZA 3HR8A 3CRMA 5E18F 1O3RA 1MH1A 3EWSA 3AVYA 2XZPA 3HRSA 3SQWA 2CGPA 3B9PA 5JCPA 3BDDA 3MWJA 4UVCA 4GGGA 1PV4A 5B58C 1WDTA 3LNCA 5G41A 1BH2A 2XNDA 2YHSA 2FEZA 3I5YA 2R6CA 3X1WA 1F2UB 4LY6A 1ZN2A 3GWZA 3HTSB 4L18B 1AGRA 1S2MA 2QSZA 2VQSA 4OU0A 1F3OA 5FPKA 2NOAA 4BFZA 2ZYWX 2IEZA 4OIRF 3THWA 3BPVA 4RGRA 3UATA 1XP8A 4Q01A 1ZYRF 3OFND 2H94A 3RYPA 3RS0A 4WF2A 4G5SA 2AKYA 2HYDA 3KKMA 4RVCA 1Y0UA 5BS6A 4EQ6B 2HYIC 4S35A 5CB6A 3R9XA 4M71A 4YXWA 2VHJA 2DZOB 3T1TA 3RWOA 1W1WA 2EV6A 1XEXA 3P32A 1W44A 2WIBA 1CJTC 1W5TA 4H1VA 4C30A 2DWQA 2I4IA 4TV7A 3PUXA 2RGAA 5KSPA 3GEIA 1DO0A 1LTQA 5FO5A 1OH5A 1EH6A 4DIEA 3X1ZA 4M1KA 5AWFC 2ZTSA 5BN3A 2P5TB 3V8KA 1NKTA 3KKNA 4GPTA 8OHMA 2NO7A 4F4IA 4Q4HA 5D6EA 5HTKA 4NYJQ 2C99A 3ND8A 1U94A 2JDID 3B02A 4G01B 1XEFA 2GWHA 3GFPA 4DC9A 4IRHA 4OIOF 4EGYA 2KJQA 4NTZA 5FUWA 3KZ1E 3QUSA 5F3WB 5ILUA 1BC8C 4I02A 1G18A 2GZWA 3CWQA 3DO6A 4BQAA 3LFUA 4Q5IA 1USSA 2R7DA 2GDJA 4DLVA 2RGCA 2FH5B 1VG1A 1HV8A 2K4JA 3MWKA 4BFTA 4PZYA 1X1RA 2KRFA 1IW7F 4I01A 4CDGA 1GNRA 2VLIA 3NEYA 2A3SA 3V00A 1LF5A 4MNUA 2EU8A 3F8TA 4JT4A 1WCV1 2FU4A 4RFSB 2ZITA 2OO7A 4ACAA 3O47A 2RNJA 1F5TA 2J9RA 1R5BA 4IEEA 4QBFA 2XXAA 4IHSA 2JZYA 3BXZA 4LYJA 1DAKA 1E2IA 1BI0A 5D5WB 1VMAA 2QMUA 1ZGAA 3L0IB 4G7OF 2FSWA 2E1RA 1KSGA 1KTVA 1WF3A 3I61A 3W90A 3C4JA 1UM8A 4NDZA 2BBWA 5CK4A 2GNOA 2WKPA 1W36B 4R79A 2KIUA 4HZUB 1IN6A 4TMKA 3TOAA 3JSOA 3GZ5A 3NG1A 4D82A 4P4SB 3T61A 4CRWB 4DJTA 3E97A 3C41J 4PHGA 1T8UA 3VTKA 1YKSA 4NE2A 4DEXA 4F4CA 1TADA 2WMOB 3V8LA 3IRRA 3M1IA 4MQ9F 1E9SA 3AF2A 4HLQB 1NVXQ 2D74A 3EC2A 4J0QA 4EJSC 4KYIB 1J75A 5P21A 3A1WA 3UWKA 1R1UA 2OU2A 3QF4B 3ZD7A 1QRAA 1W4AA 2IA0A 5DISB 4PHHA 4P96A 3IEVA 4JJKA 5IHPA 4M74A 3NIBA 1Z06A 1LB2A 1BN5A 2O03A 4U5XA 1Z0AA 5HLHA 5JWOA 3TNFA 4NCIA 4EMSA 4RZ3A 4Q4JA 3DEUA 5LGNA 4OINF 3WNDA 4AK9A 3BP8A 3FMQA 3L7WA 1DUXC 4QM7A 4PFSA 4LLGF 2PLFA 1J59A 1KSHA 3GLGA 2C9YA 2DR3A 2CEAA 3LH5A 4LSGA 3SFZA 2ZSDA 4G5RA 2IYWA 1GP2A 3VAAA 3KETA 4C0HA 5B64A 4NB5A 3QKSA 4C7OA 1E1RA 3L2OB 2V79A 2KIFA 4RSGA 2QMHA 4G7ZF 3ADDA 4P0TA 3KP6A 1PLJA 5KDOA 3U7HB 4MHGA 3H92A 2LF8A 1KNQA 4LJ9A 1LF0A 2CXXA 1MRSA 4TYPA 4LCBA 1E2HA 1HT1E 1L4UA 3IQXA 3P4YA 4BLQA 4YFKF 4E07A 1MO5A 3FM3A 1T9HA 2IUUA 3QPVA 3B73A 2GIVA 3AP3A 4PZJA 4N0BA 3WODF 1P9NA 1QF9A 3FKQA 1FZPB 2Y0MA 3KEOA 2FMYA 2OQRA 3IKTA 2AXPA 4Y15A 2WICA 4P33A 4CZ2A 1HW2A 2FE4A 4Q1DA 4DXAA 4HDCA 3EW9A 1CJVC 2FX3A 2MSEB 1VG9B 2YZ2A 1Z91A 4URYR 3K70B 2P6UA 2CLSA 4DQ2A 5CYVA 3VFZA 3THOA 4DSTA 4AKIA 4R2HA 4GI7A 5D3MB 2H1LA 1OFTA 4ZYGA 1QZXA 3C7KA 5DI9A 5FL7D 821PA 2WJJA 1EK0A 3CUEF 1XMJA 2QUFA 2A2ZA 4KIFA 1Q1HA 4LMYA 3GUDA 2X4HA 1F6BA 2MBFA 1LNZA 1TUEA 2ZSFA 4BFYA 1XB2A 4HZUA 3CF6R 3IEUA 1USTA 2QBYA 1FMLA 3F3YA 1E3MA 1G9XA 1D3YA 2OQGA 1G1MA 4WBSA 4A8JB 2PZEA 1GWNA 4HB0A 1R7RA 2WVJA 2R65A 1KMHA 4HB4A 4M22A 3EIHA 5BPDA 5H20A 3QXCA 2QRZA 4HAUA 5H6QA 3QSYA 2QP4A 4LBZA 1PJRA 4Q1FA 2G9WA 4ZCMA 2FPKA 2JT1A 3IPYA 1S1CA 2J87A 4ZDWA 3AGQA 1SKQA 3DZ8A 1G3SA 4NYMQ 4XTCS 1IONA 5J40A 3D5LA 4PC6A 5TVKA 4LG0B 3RC3A 1NVWQ 3AVPA 4O2RA 4UXJA 1X8KA 4FMCB 1SVSA 2ZE5A 2OE2A 5CITA 1TQDA 1XTKA 2EFQA 5HKKD 3CONA 2GETA 2ZRHA 2HT1A 1IF1A 3E6BA 1ESNA 1NN1A 2QTHA 3NH9A 4PPQA 3O8CA 2RAPA 1ZD1A 3AP2A 2MSCB 3AP1A 4UNPA 4W5WA 4W5JA 3BORA 4ESBA 3SYKA 3K09A 2IJLA 1S7AA 2XX3A 2NRAC 4L9VA 1JE8A 1K5DA 4NHOA 4NYIR 1Q0UA 3WMFA 3QBVA 4M53A 1ZRDA 5FFXA 4X8LA 4A92A 3I0TA 3LX5A 4RZXA 2OSBA 4MKIA 1VTKA 5TDHA 3T1OA 2WWYA 1R8QA 2BE5F 2FSGA 2NO0A 3IIMA 2VP0A 1J9IA 2KJCA 1TMKA 3BERA 5DSZA 5JSZB 3CF0A 4KV9A 2D7DA 3MQ0A 1I2MA 1KHTA 3CNOA 2VBCA 1C1YA 1I6XA 3BWDD 1YW8A 4RD4A 1E0AA 2XHKA 4AG6A 2Q0HA 2JRTA 3R6SA 4A0ZA 2VHTA 4JLDA 4NPHA 3DL0A 4JYCA 2OV2A 4Q19A 4BLSA 4Q7JB 5C2JB 2IS1A 5AONA 5J4VA 1R0YA 5BOXA 1NP6A 3HOTA 2D4HA 2VF8A 4DDUA 3K0SA 3WMGA 4A8JA 2W25A 2W6ID 1XJQA 3HYIA 4R2IA 3IHWA 1QQIA 1SZPA 2QG6A 2DBYA 2QE7D 2ZE6A 3OE7A 3ONWA 3F8NA 5D8KB 1HBXG 2AK3A 4HAVA 4P4UA 5KPJA 1IN7A 4LZZA 4A6PA 4PGGA 4PCQA 4LYHA 4XIGS 1F2UA 2IK8A 1LB1B 4G3XA 3FE2A 4BLPA 1TQPA 4NHJA 1QHIA 1UKEA 1Z05A 1YZGA 2A30A 3L9FA 3TO9A 1IXCA 3SI7A 2QL6A 1Z29A 2AHOA 1U2WA 2UZKA 2XZLA 4DWJA 3RKXA 2BM1A 3QIAA 3LWFA 1L2TA 1TNSA 4S2EA 3I4LA 3HU2A 2D45A 4Q48A 3GFLA 1VPLA 2FSHA 5FOTA 2COMA 3SHFA 2X2FA 4HDVA 1QBJA 3PITA 2IWRA 2E7XA 3EAQA 3VHXA 2B6HA 1XD8A 4QWQA 3X2SA 3NBXX 1C9KA 1IAQA 4PDKA 2D3WA 1TLHB 2JLSA 4LYFA 2BMDA 2J0SA 3X1XA 3SZRA 4KFTA 5L3SB 5LEKA 3CIOA 4QGFA 2AXNA 1KI2A 5HDKA 2E1NA 1HE1C 1CLUA 2VO1A 2D06A 3JVUA 2XSZD 1Q1QA 4WVFA 4D0NA 4HYYA 4CXFA 2JATA 2MH9A 2VOPA 4C0SA 3AVXA 3I1FA 4DSNA 2L02A 4WX9A 1OFIA 1MD0A 1CGPA 3CKLA 3KJEA 4DLUA 2W85A 2RCNA 4R98A 3FMIA 3FZVA 4HLUC 5JS8A 2DLLA 2Z9OA 3FVQA 1F48A 2IHBA 2L01A 3WBJA 2WWGA 4KT5C 3RDPA 3ZZ0A 4DLTA 2YNMA 2HEOA 1ZHFA 4GRAA 4K8OA 3VX3A 4EUNA 1I27A 2VYFA 3O8DA 4TLAA 5TARA 3MG9A 1ZREA 3ICQB 4BAYA 3GP8A 2P3SA 4Q66C 3KFVA 4P32A 3ADBA 2EV0A 3ZMSA 3HU3A 2Y48A 3VLFB 2ESNA 4Q1BA 2O8DB 3I92A 2EJRA 4Q4AA 4JQFA 4A5MA 4MH0R 4TLBA 5FTMA 5F1RA 1ZP6A 1R23A 3NBYC 2IRFG 2A6EF 1P62B 2FPMA 4N9IA 1P60A 2AWNA 3IQWA 2YOFA 3ZD6A 3PG5A 5E17F 3QKRB 4N0DA 1MOZA 1CU1A 2FF4A 2R62A 1IJEA 1FMJA 2O0HA 4JLVA 5CJ2A 1D9XA 1SMYF 2GK7A 2VC1A 4PPNA 3B6EA 4EPWA 2XAFA 4P4SA 3SC3A 1TU3A 5FPTA 1Z0KA 2JSCA 2GBLA 3CPJB 1FYKA 3ZIAA 1E2KA 4G7HF 1JXSA 4S05A 1G21E 2BHRA 4IXNA 3OV8A 4JMPA 1K8RA 2XKOA 3PXGA 1MR3F 4OI4A 4PPFA 1IZ1A 4LB6B 1COWA 1P2VA 2CJWB 4Q21A 5FL7A 1TEVA 1FUUA 5TMPA 4W9MC 3QBTA 3I72A 4BE7B 1SVIA 1ZUNB 3FMRA 2WWIA 1Q3HA 2Z83A 1RRFA 221PA 3PEVA 2WWFA 4Q00A 1QHHB 3M0EA 1UDXA 4RFSA 1NSTA 4DEYA 2V9VA 1CR2A 1R5NA 4F7ZA 2Z3YA 3Q9LA 1BMFA 2FRHA 3AKCA 4UXIA 3W8NA 5A4JA 2H7VA 1GRNA 1SD5A 3T1BA 4IDOA 3A1VA 4BZXA 1A04A 3WMEA 2H27A 3EX7C 2UXXA 3ZVNA 3I59B 3R0JA 2GJ9A 1XTSA 2PJPA 3PVSA 1XD2A 2ECKA 4CYDA 2XUBA 1R8SA 5AK0A 3DOFA 2KKOA 1CRQA 1MO6A 5ICGA 3M7GA 2GCNA 3LQRA 3BIFA 2FBKA 3RS2A 4LUCA 2ZI9A 2LWIA 2PMHA 4L0YB 5CVUA 1G8FA 1MKMA 5BYJA 1OH6A 1KY2A 4IVQA 4B34A 5LD2B 1U8RA 2ATXA 3A4MA 1E9DA 4YDSA 4UVAA 3FHCB 2ZRKA 5CVRA 2O6GE 1OH7A 2HT6A 3SZPA 4KLZA 3I8SA 4MQBA 2QWWA 1REPC 2IF2A 5DEQA 1T91A 3PFIA 2PZFA 2QP3A 2YVUA 4DT1A 1YZKA 1N6PA 4OYHA 4AIJA 1E4YA 3AVTA 1U2RA 3H1TA 1W0KD 4FW9A 4ZKDA 1HEIA 4B3XA 1P9WA 1W46A 3K0FB 2WJIA 2ZR9A 3NDPA 5KYKA 4S04A 3H0KA 1F2TA 1H8ED 4BQSA 3SQNA 2ZM5A 2GHIA 1BS1A 2F43A 2QAGA 3KXKA 5IF9A 3E5XA 4P9FA 5AIQA 4TMVA 1KA8A 1FBUA 1HUQA 2AL7A 2WIAA 2ZNZA 3NEJA 2QENA 2FXAA 3R8CA 4Y17A 5TV2A 2NS0A 1ZG5A 1H8HD 4RGXA 1W2HA 4LV5B 1NG1A 1NL3A 3GLFE 5KO2A 4MEXF 1BO6A 4DCUA 4URZR 1DPRA 4ARZA 3QXXA 1AQYA 2ETHA 1S4QA 3BH7A 5LEJA 3WE2A 4FWTA 5ILVA 1ZC3A 2FFAA 4AIIA 1E96A 2CHQA 2ZMEA 2M8EA 3ELKA 2KBFA 4KITB 3FF5A 1FL9A 1KMQA 1E99A 4M9ZA 1RKBA 2GF0A 3VU9B 2PCLA 3VX4A 1QHSA 3THXA 1L8QA 3L00A 2BBTA 4M1YA 3HHHA 2CK3A 3M9AA 3QU3A 1KGDA 3WGHA 2JJ8A 3CX8A 2K7LA 4B35A 2O5VA 1GRRA 2IEYA 3FMPB 3COAC 1QVRA 3IRQA 3GX4X 4BLOA 3GLIB 4L15A 4IHTA 4U7DA 2HXSA 3IIKA 1VHLA 2FPLA 4RD3A 3KP5A 3V7SA 2VE8A 1TUIA 2WC2A 1XTJA 2DCUA 2ZROA 3UIEA 5KDDA 4A15A 3FKSD 4WA7A 3K69A 4N1AA 3EPHA 2ZANA 5KK1A 4IFEA 1WMSA 2OM2A 5FBVB 2IYSA 3R7WA 4I1OA 1HW1A 5IT9Z 4RD0A 3U6KA 3RC8A 2ZMEB 5A2QZ 1UBEA 5H1YA 3UK6A 3BJOA 1OE0A 2FQ3A 3LY5A 5SZJA 5KTYA 1U90A 1I4TD 4OI2A 4B74A 2CYYA 1YZLA 1S29A 1GTVA 2EYQA 1KAGA 2O0YA 1P2UA 4RGSA 1VIYA 2B7BA 2YINC 3IDQA 3K9HA 3A37A 1IY0A 4CEHA 2H17A 1XD7A 3E5UA 4TMXA 1I4LD 2MA3A 2G9NA 5DD4A 3ICEA 1ZM7A 2EA2A 4JSTA 1K78A 2V7QA 1DO2A 4DB4A 3GJ6A 4FIDA 3CLVA 1JGSA 3GLFB 3CPHA 1QO0D 2LF7A 4HLYA 1OHHD 1Z7UA 2FG5A 4AC9A 1TL7C 3TAUA 2IS4A 1C4OA 1JJ7A 2JEOA 1FBSA 5KSZA 4A2PA 4FCTA 2QSYA 3K0FA 3EQLF 1C0WA 4TYYA 1GNQA 4ENJA 3B1ZA 4W5HA 2AXLA 1KYWA 1S7OA 3QAHA 2R6GA 5DO9A 4NCHA 1N25A 1KJWA 4NL4H 4RZUA 4DT1B 4FXPA 1G3MA 3RKWA 3NEUA 3ECCA 1LQ1A 1G8GA 3KKQA 1QGPA 2QM8A 1NLZA 4B76A 4O3MA 4E09A 1BJAA 3QF7A 4U02A 2TDXA 3KXLA 5L3FA 4PHTA 4D6PA 1SAXA 2IXEA 2X1VA 3OOPA 2ANBA 2AR7A 1ZIPA 4GOKA 4HV6A 2MD5A 2PT7A 1M34E 2GVDC 3A1TA 1ODDA 1XDBA 1H8HA 2CCGA 2LKCA 3AGPA 4YC7A 3L82B 2DZNB 2JIZA 1P5ZB 1GL7A 4G1UC 4JN6A 1TF2A 4WZBE 4RB1A 4LHXA 5CB8A 3TUZC 3R8FA 2DQRA 2M30A 4LG0A 2ZSBA 1XDSA 2YWFA 4O6JA 1FUKA 4YIIA 4OK3A 4EJOA 1RC8A 2BJWA 1II8A 2GESA 4UHTA 4NCKA 2IA5A 3GEHA 4IPAA 1YO5C 1D8TA 2VHCA 4B2PA 5HLIA 2CJWA 5IT5A 5KPDA 2G1KA 3O3KA 2K27A 1TQMA 3CH5A 5GJVC 2JLWA 1OF1A 3FB4A 1U99A 4HDOB 4TT3A 1T0JB 2CE7A 5CLLA 5AUQA 3RWMB 4IRIA 3PUYA 4BZQA 5AJYA 2YJTD 3N4MA 3KEQA 3MJRA 3QENA 1Z28A 2XEXA 2BYVE 4OQMA 2GEVA 2XROA 2ZS9A 4MUAA 2DT5A 3TKYA 3EASA 1SD7A 4C0JA 4GNKA 5GJBA 1CP2A 1G7CA 1U81A 5GJCA 2FDCA 5B57C 1ZU5A 4AWXB 1R5OA 1XGSA 2W57A 4LD5A 3KXIA 4OQNA 4F93B 1UAAA 4PO1A 2F5CA 2W84A 1MABA 1PLLA 1TQ4A 2BCJQ 4P31A 3C3WA 1YVDA 1YS6A 3T5XA 4Q4AB 2VT3A 5BW8A 2EFOA 1NVVR 1VIAA 2OBPA 5KNBA 2QRNA 1KDOA 5EJEA 1M2OB 4MRNA 2J5XA 3BB1A 3OHMA 4Z8YA 3KUCA 5KVRA 4LBVA 2JLRA 3DKVA 3IO3A 2OAP1 3TIFA 4L4UA 3TKLA 3WNCA 4Z54A 3CJNA 2HYGD 621PA 3ZQ7A 5EXPA 1G7RA 4HQMA 4UXNA 1OXSC 1QG2A 2GCOA 2J46A 2OBLA 2OBMA 2ZREA 4GT1A 3E6DA 4Q18A 4LOAA 4Q9JA 1I4DD 2Y8EA 1R7JA 3L2CA 4FMBB 2ZI7A 4O2LA 4AI6A 1JR3A 1VCNA 2BCGY 2QU8A 4JL8A 2IS2A 4ASNA 2BMEA 1KQ9A 5DD8A 3TO7A 2Q9AA 4NYMR 4HAYA 2FEOA 2GXSA 2DPDA 2DHRA 2DO7A 5FBWB 5SZKB 3LSTA 2H16A 3TAHA 5HCNA 3G82C 4GDFA 2B92A 2DFNA 4ZYHA 4PAOA 3U2QA 3NWJA 2F3RA 4PO8A 3SJZA 5KSYA 1YJ5A 3R0AA 1W0JD 2VRWA 2AX4A 3LX8A 4B47A 4UXHA 2Z4RA 5BWMA 4CICA 3A4LA 3CUQA 5DHFA 2P6SA 3HSEA 2RHDA 2W0MA 1U5TB 5DYGA 1E2XA 3L8ZA 4I99A 4TTPA 3GFOA 4JS0A 3Q7PA 1XMKA 5ILSA 1E9BA 1N6NA 2PL3A 4GZLA 2QAJA 4LJ7A 1G3UA 4RS8A 2DW4A 2OA4A 1FX7A 1T39A 5LGTA 1AK2A 3TUIC 4UV8A 2NNYA 2RGBA 4CEIA 1KIMA 4IRUB 4EJSA 2C95A 2BKUA 4LJAA 2HTSA 1Q21A 1TQ2A 4DLWA 2FBHA 2WZQA 4LI0A 4ESFA 1UPTA 1LDKB 2P5LC 4AG5A 3QE0A 1KO5A 2GEDA 4FMDB 4V02A 2ZRAA 2ZR0A 4HLUA 2UVQA 4DDWA 1WBBA 1ZUHA 3OESA 3IBYA 1OFHA 2MMCA 2BWJA 2H92A 2IC5A 1XTIA 2M1BA 1G3QA 2F9MA 1NVMA 2YPRA 3U5ZB 3QEJA 2OXCA 4MA4A 5DCMB 2CO5A 1D5CA 1ZJ6A 3AQ4A 3H84A 2IHYA 1AIPA 2J7PA 3CDHA 3ADKA 2O52A 3AUYA 1JALA 4RD1A 2CMKA 5JVTA 1AGPA 1T3HA 2EK5A 5JR3A 3QNUA 4MQVA 5IK2D 2A6HF 4RCZA 1OPXA 1DAIA 4CEJB 2WAYA 4LWZA 2NNNA 3IHUA 2QLZA 4Y0VA 2F5FA 2K86A 2HLDA 1FBQA 4A2WA 1S6LA 4L9NA 4A3VB 2Z6VA 4JBXA 1XZQA 2R44A 1O7FA 1J70A 3ZJYA 1DG3A 5EUQB 5KNCA 3K0CA 1G6OA 4D25A 4B32A 2K4BA 3RABA 1DPUA 3LBHA 1GITA 3IWFA 4Q1AA 3RHFA 2RGDA 1M8PA 1RNLA 3TBKA 2JA1A 4JVMA 4AIKA 1SXJA 2ZNYA 4CO8A 3LBNA 4YMSA 2XKPA 3BBPA 2ZSEA 1E2DA 2DFLA 1IXRC 4AIHA 5KU1A 4M1OA 1DP7P 3A6PC 5BN5A 2IYVA 3MEXA 4NU0A 2F7SA 3RRZA 5E3HA 3G0HA 1SXJB 2O61A 1XTQA 1XGOA 1IHUA 2FU5C 4MKFA 4MYTA 2EFGA 1GXQA 1W7PD 1XGMA 3I3SR 3JW4A 1U8ZA 4N3NA 5EQTA 1XB4A 3OF5A 1W0JA 4A6DA 4FWIB 2MLGA 3SHWA 3F3XA 5E8IA 2QUZA 2DFIA 4ZZLA 4KHZA 2ZKZA 2CBZA 1CULC 2NPIA 2FA5A 3NQOA 3LVQE 4KLNA 1E2QA 4M1MA 4QXAA 2WV9A 1U6GA 2WPDA 2BJVA 2Q6TA 4TTRA 4HB3A 5C1BA 4IXAA 4TL8A 4EPXA 3B9QA 2P7CB 1EWRA 1D2MA 1Q1BA 2NQ2C 4RD6A 1SFEA 2QROA 2QPOA 3GF2A 5L3EA 4LJ8A 4GO1A 1KI1A 2DFKB 5E20A 1RE0A 2HWVA 2P8TA 1QHYA 1ZM3A 2FFBA 5JI3E 2DAOA 4H0EA 3FWYA 4PR0A 4ASUA 2TMKA 1XPOA 2OEPA 2V3CC 1SD4A 2BDTA 4FCWA 1L0OC 1AQUA 4EPYA 1NKSA 4YMTA 2VP4A 2J3EA 2PT5A 3U4QB 4CT4B 2ZJOA 4PTLA 1U0LA 2OCYC 1J0RA 1YR6A 3J81Z 1G3IA 2AWOA 2VA8A 3KE2A 5LHIA 3J81K 3RPUA 4G6QA 4C2UA 1KYZA 1QDEA 1T5IA 1CEEA 2RDPA 5F64A 1VHTA 1H9TA 1XN7A 2WWHA 4OHWA 2IYRA 1IN5A 2J0VA 3D7MA 1G4DA 5JECA 1MKYA 1I5ZA 1E2PA 3L0OA 4CF7A 3PUWA 2RMKA 2D2WA 4MTEA 2YOHA 3ABTA 1KU7A 1XSXA 4E03A 4QL3A 4CEIB 1A2BA 2BV3A 4ZCLA 5FBRB 4XRFA 1E98A 1UDWA 4A6XA 4D2IA 3V4RA 3BH6A 1OR7A 3HPQA 1J2XA 3CUQC 2W24A 3MJHA 1MT0A 2Z0MA 1TNDA 2CW0F 2N46A 3ULQB 4A2UA 4BZPA 1GOTA 3BB3A 1JHHA 5GVRA 4G9YA 4V0KA 3TH5A 4YONB 4TL9A 5JI6A 2V1DA 2ZSAA 3WE3A 3MUFA 1MJBA 3EG5A 1DPFA 2M5WA 2W2VA 1A1VA 2BMJA 5LLQA 2BEKA 2LNBA 2QQBA 2ERYA 4MRPA 3M8FA 4EFLA 2QMOA 4YXWD 1W7PB 4IRGA 4RB2C 4K81B 3W6KB 3TRFA 5TJJA 5J4KA 2RV8A 5TY0A 1A2KC 3QKSB 2ZRPA 3B2EA 3MLEA 4DDVA 3TMKA 1E94E 4KBFA 5EE5B 2ZJ8A 4DVGA 4YDHB 2YR2A 1GZSA 3RJPA 3U1DA 4XSGA 4MKHA 2JJ2A 3U7GA 5CYOA 2GVZC 3AF4A 3U3OA 3GJ0A 1TNTA 1N6KA 3V9PA 4A0FA 3CUQB 4D4MA 4TQUS 1YW9A 3IO5A 2ZVQX 1BBYA 1FLIA 3U61B 4OMZA 4Z1MD 3H2YA 1S96A 5CVVA 4ACBA 3B1WA 4KU4A 4CIDA 1P2FA 2GXUA 1RJ9A 2IYTA 5C46F 4BNCA 3EWAA 4A8JC 1Z8FA 3JTGA 4KIBA 1ZM4A 5UKDA 1NMXA 4URVR 1US8A 3U2RA 4ZKEA 3P7NA 4D26A 2QMEA 1GG2A 4JKYA 3I53A 1ZH5A 1CF7A 1NRJB 3FGNA 2G88A 4HLCA 4Q9LA 5TXGA 4US1R 3C14C 4B09A 5JRZA 1E32A 1XZPA 1P4XA 1STZA 2JIZD 2R6DA 1JECA 4JLNA 5DI3A 4HF2A 3ZQJA 2O8EA 4M9SA 2BBYA 1E2GA 5FOVA 2WSSD 1KJYA 1O3YA 2ZRCA 2V55B 3Q8XB 3DM5A 4WK8F 1KOFA 2GXQA 2R9VA 3QEOA 3GJ8A 1D6JA 1DAFA 3NRVA 2NO1A 3DKPA 5AJVB 4YFNF 5H70A 3REFA 4ZIRA 3DP7A 4OK5A 2XAGA 1W36D 4UUVA 3QG5A 1PDNC 4DHEA 4IF4A 1CJMA 3KB2A 4JL5A 4CT5A 2HZTA 4YIFA 2EW1A 1ESMA 4LJ5A 2CNWD 3K8YA 3MSXA 4LHYA 1VG8A 4HDUA 3K70D 4BWYA 1Z6TA 3B60A 2XXAB 5E95A 5F6FA 2GKSA 2W58A 3LA2A 2OZEA 5FTKA 4ZCIA 4EKDA 2IA1A 4HV5A 2HF9A 5EZ6B 3T35A 3Q5FA 2AK2A 3RYTC 5JMTA 2HCJB 1W5SA 1K6MA 4I98B 1R22A 1XDUA 4EJTA 3AF3A 2JLVA 2A5FA 3WHLA 3GLXA 3MWMA 1UHWA 3WG9A 1GRQA 4M73A 3HHGA 4OQFA 5E7IA 3T5GA 1N5IA 1SGWA 2VF7A 5G40A 2PG4A 4BLTA 1UEIA 2YWHA 3WU0A 2H5EA 3ZN1A 2K02A 2XVCA 1P6XA 4HATA 3TE6A 2A69F 5HVQC 1ZD8A 1EESA 3KZZA 1VTNC 5DH9A 4AD8A 4OOIA 4ZZDA 1E9FA 2OAQ1 4B6EA 1KK0A 4UNRA 2KWIA 4F91B 1BM9A 3TO6A 3I73A 3EIEA 3JTHA 1JHFA 1U3EM 6Q21A 4QNRA 1HW5A 3EYYA 2O8CB 4PSAA 2BC9A 2LCFA 1FP7A 3MZHA 1CF4A 1M6NA 1OKKA 2C77A 2P2LA 1CR0A 2VTKA 3P20A 3EA0A 3IKJA 2JLXA 2HOEA 2KSQA 3F21A 3BB4A 2W83A 3GCGA 4AY2A 3DEFA 3BJ6A 1B1BA 2Z5FA 2CVFA 4KMFA 3N5CA 3M1EA 1OIXA 4A1FA 5GVSA 1K79A 5J4LA 4XVQA 4TLCA 4GCVA 1II0A 4NH0A 1XBTA 1CKEA 2CLCX 4FWHA 3KQNA 4IHQA 1H9GA 3N97A 1NI3A 4NQWA 3T1VA 3GLFA 3V4FA 1EH8A 1KNXA 4PQYA 3LXRA 5K8UA 1XD9A 2ADUA 3N2EA 4PSVA 2IYLD 5AJZA 5ANRB 1NMYA 1OH8A 2A68F 2ZYVX 4XVRA 5FBLB 1XXHA 4C0KA 2A5DA 3SJAA 3VR4A 3R4KA 1FP2A 1OIVA 3AF1A 4N0EA 2CHGA 3IBGA 1J7KA 3TDZC 2ZRLA 1HKTA 1KY3A 1YU9A 4NYIQ 1TTTA 1QZMA 2VE9A 3O8BA 4TLEA 5FPYA 3E1SA 3REGA 4OHZA 1NY5A 4UNOA 3RPQA 1DVRA 2RGVA 4MTDA 1JEDA 4QBHA 4UKDA 1QHGA 2W2XA 4KFRA 1MDMB 3VNVA 1B4AA 1Q3TA 2WKQA 4B2LA 1XEWX 4JBWA 4BASA 4JLMA 3WTYC 4ABYA 1UKZA 721PA 3SYNA 4WAUA 3U3JA 2ZIAA 4ZH4F 4PAQA 2CLDX 3P9IA 4LK1F 4RB0A 2K5UA 2PH1A 1GILA 2HCBA 2O3FA 1XGNA 2SHKA 2XNDD 2C98A 3GLHA 4LRTA 4Q03A 2A78A 4FN5A 5JLJA 2QVOA 1JEEA 5D6FA 1NLFA 2F6RA 1PP7U 1LV7A 2C9OA 2IW5A 1FX0B 3CZQA 2PJZA 4TLDA 5IRCD 4G5GA 1ZRCA 4LPSA 1ZRHA 3KUDA 1GL6A 2ORIA 4HOBA 1E79D 1VCMA 3Q3JB 1NVVQ 1JXOA 1ZIOA 5DNYB 1Q57A 2QZ8A 2ZVPX 4KN7X 2AFIE 4OHVA 4Z2YA 2B7CA 1E2EA 1E9CA 2BIFA 4B3BA 2JTVA 4BRUA 3GPLA 3UPUA 3GQBA 5EP3A 1G7SA 3FYHA 4LK2A 4WOPA 1RI7A 3AVOA 5CJ9A 5FFZA 1NBMD 1YR9A 5EP4A 1KO4A 4M6XA 5FUVA 3OEHA 4KMUX 1UCRA 4JK1X 4MRVA 4GYGA 3GEEA 2QORA 1FNMA 2UKDA 1EWQA 1AWCA 3KP3A 3GLHB 3ADCA 3AKYA 4OK6A 4GZMA 3C18A 2ZI4A 3ND9A 3SEAA 3W8RA 1P4AA 1DADA 2ZJYA 5C4MA 2ZJZA 1FY7A 3C8UA 5JEDA 1ZNWA 2MMGA 2UZ3A 4YQFA 2J45A 3AAFA 3GJ5A 4QG7A 4XVUA 4PANA 1V4RA 2F3TA 3OEEA 5FTNA 1RIOH 1N6OA 3QVUA 1WRJA 3HRUA 2STTA 3FHTA 4NONA 4ZPXA 4LJZF 3F8BA 2OHFA 2ZU0C 4IVPA 1SHKA 4A0RA 4G0NA 4IVNA 3A58B 3OIWA 1Q12A 2D62A 3LA6A 1ZRFA 4HLXA 3DHWC 3IKVA 1D2NA 4BHPA 4HLDA 2GZDA 5J8FA 3K1PA 4UV9A 2XOKD 2VIIA 1XXHB 3DMDA 4M9XA 2V7QD 2AS5F 3QRFF 1W2GA 3C1DA 2Z5UA 3U9GA 2YSRA 2DPUA 1VCOA 2IYQA 2ZRFA 3AVQA 4HDQB 3EPLA 1HQCA 5HDNA 2PLYA 1ZCBA 1BIFA 4XJXA 2RGXA 2PMKA 1ZG3A 2G77B 2V6IA 3R61A 3KCCA 2IBMA 1U8AA 2V9PA 4EM1A 2J5OA 1NVUQ 2ASEA 2WPDD 1ZARA 4U88A 2GJAA 3LBIA 3UANA 5JHGB 1XD2B 3PUZA 1DELA 4PC7A 4XLNF 5HKKA 4KN4X 1P6RA 2QPAA 1X86B 4LDJA 4U00A 1JR3D 3HJNA 4C3ZA 1Z5ZA 5EXXA 5FBQB 1P75A 2RC4A 1ZMXA 3F23A 3S1AA 3WRYC 1AN0A 1TW3A 4UNQA 4TYQA 5KOYA 4G6DA 1V3FA 4M1TA 3TOBA 3K0LA 4QM6A 2M87A 3WYFA 3C5HA 2BBSA 1G17A 1AKEA 4LLLA 3FHZA 1FC3A 2O0KA 2Q9BA 4F38A 5AUOB 3EZ9A 2XNSA 4I09A 5CYPA 3L0SA 2FOKA 4KFCA 1LW7A 2PCJA 1U9IC 2QI9C 4WXCA 3CRW1 3RDIA 5EEGA 2CCKA 4QJ3A 3OEED 1OXUA 3AV0B 5J4HA 4DSOA 2IA2A 3THYA 2EFNA 1T4GA 4IOJA 3DPUA 2F5EA 1KI7A 3PV0A 3FFAA 4A0XA 5E7MA 5IT9K 2EA4A 4A0YA 4DNCA 2OESA 3WTXC 4NKRA 2ZXUA 2VN2A 2UXNA 3KX2A 1DAHA 2ZETA 5JEEA 4CHUA 1P2SA 4PX9A 5JJKA 1BYUA 4D0GA 2IPQX 1LEAA 1KSFX 4LLNA 4GBMA 4M0LA 4A4DA 3EYIA 5F2EA 5D5UB 5JZVA 2W00A 4R9UC 2F1HA 5KNDA 2LSOA 1OIWA 3MAJA 4A9AA 2RKHA 3KQKA 3IUYA 2NGRA 3DV8A 4HA8A 1UFQA 2XJ9A 3MHVC 3VODA 2D2FA 4XSZF 4ENKA 1GSIA 2F55A 1XJCA 4LBWA 4GFDA 4L0ZB 3HR7A 2A5YB 5LPNA 2XTZA 2ODBA 4RZ2A 1BIAA 5DI3B 3OFNA 2O8EB 4Q7MB 4EJUA 1ZLKA 5JS7A 1E9AA 2OFXA 1RRPA 1KJZA 2ZU6A 3F8FA 2Q3HA 3FMOB 2CL0X 1KO7A 2C04A 4NMMA 4FCVA 2EB7A 1WA5A 1FSHA 2KB0A 2RH5A 4HZIA 3I62A 4KVGA 3E6CC 3HRTA 4LV6A 2JCSA 1XPUA 3HOSA 2D1VA 3MWLA 1F60A 3PQJA 3ZN0A 2FN4A 1II9A 1IAWA 4XWAA 2EWNA 5CM8B 3F5FA 1ZUIA 2QZ4A 4L9JA 1N2CE 3QKUA 4RD2A 3WP1B 1Z0JA 1NF3A 5BXQC 1QPMA 1CRPA 1KI8A 2HKOA 1AS3A 2V1XA 5FR2A 3A1SA 3HUGA 4D80A 2GQQA 1N6LA 4AKEA 4WXRA 3CRQA 2P5KA 3T8TA 4I2OA 2J7KA 2W2TA 2QPTA 2P7VB 3PQCA 2BBOA 2FBIA 1YE8A 4GP6A 5AJXA 4LYAA 5JJIA 3ZMUA 4EGZA 1P72A 1IRGA 2J0UA 4D0LB 4BHCA 1SQ5A 1Z08A 3QPWA 3BGWA 3P26A 5HR5A 2HJGA 1U0HC 4HX7A 3RVBA 2GA2A 1O7LA 1FWZA 1FX0A 1KDTA 1JBKA 1KK2A 1TEXA 1VYUA 2PLRA 3CWZA 1XSVA 2IS6A 3VHLB 4QJ5A 1OXVA 4KYUA 1Z22A 4DB2A 3BOQA 2DQLA 4URWR 3RSLA 4KUMA 2G1JA 4EPVA 1GXPA 1OMIA 3B1VA 4URUR 1XX6A 2PI0A 1Z83A 1E2JA 4JL6A 1BC7C 3TR0A 2L4MA 3DFGA 3HTUA 1FTSA 3NVAA 1EX7A 1SHZA 3NKVA 1FNNA 3GYHX 1DG1G 1J90A 2ZS7A 3GFJA 4DUGA 5L3QB 2IX3A 2FNPA 3GMTA 1G3WA 2X2EA 4V0MA 1XMSA 3Q9VA 1LEBA 2PEXA 1ONBA 4JLPA 4TYWA 4I1UA 2IT1A 4WCGA 4JVNA 2G83A 1FFHA 1KK3A 1D8KA 4GOXA 5FTLA 1G4AE 2BV6A 2QT0A 5EE3A 1ETUA 4UNNA 5FPSA 1I1GA 2DBBA 2CQKA 3F6VA 4ZDKA 3UG7A 4ESHA 4HB2A 1W36C 1G7TA 2EFPA 3R60A 2C78A 3CUOA 3AVVA 3G73A 1SVKA 3W6OA 3WHKA 1KO8A 2HLDD 4JT2A 1UFMA 2CL7X 1FZQA 3I8XA 1IXZA 1ZYUA 4OQXA 4Q9KA 1X8JA 1P3JA 1SVLA 1NJGA 3VOEA 1W47A 2DWOA 5AUPB 1HTWA 4TN1A 1LVGA 3SS8A 4C0AC 4KO8A 4M1WA 1HKSA 1SXJE 1T3SA 1VDZA 2FGJA 3EARA 3J81k 5FFMA 3B85A 4XSXF 1WSUA 3K9GA 3KJHA 3CNNA 5LB4A 1LY1A 3ASZA 1WP9A 4U0WA 4EQQA 1LJ9A 1MGTA 3E5QA 2GF9A 2WWXA 2VBXA 3AEZA 3P27A 3Q85A 3T06B 3U3MA 5AUNB 4NBSA 2ODEA 4WW0A 1KMHB 3BS4A 2DK8A 3CX6A 1N6IA 2QBYB 1FYMA 4LJ4A 2O8BB 1SFXA 3GLHE 5E1XA 4ON9A 3KL4A 3WYGA 3CTAA 4I0AA 4W7SA 4A2QA 2O8FA 3C15C 1TPZA 2WMNB 4MGRA 2QQAA 2PX0A 3LLUA 3PR1A 2KRKA 3SYLA 4MGKR 4MGIR 3W3ZB 5D3MA 3A4NA 5BYKA 4PGHA 4IXMA 2QNRA 1FP1D 4R71A 4LC1A 3ZZTA 2ZJ2A 3D8BA 1W4CA 2PQ8A 4WWCA 1COWD 4L9SA 4OI1A 2VONA 2W6IA 2WAXA 4LRWA 2V6ZM 3EZ2A 3ABUA 4TZ6A 1FPQA 2VBZA 4ZIRB 2C9CA 3EA5A 3W6JB 4GMDA 3TVTA 5DCMA 4OHYA 3AUXA 4X8MA 2KJBA 3BFVA 2GZHA 5TRDA 4O0MA 4L5IA 1YYVA 3W3AA 2QM3A 1B0UA 2ZFWA 1SFUA 3SDZA 4XTRA 5FH9A 1CJKC 1G19A 2KE5A 3O6BB 5CIQA 2V54A 1R58A 2PFBA 1NNEA 3KP4A 3I58A 3QG1A 5SZIA 2OILA 1G291 4OJKA 2OFOA 4EJVA 1T38A 3UG6A 4EPTA 5C4GB 5EP2A 4WXHA 4DRZA 1DAMA 2DTRA 2GZAA 3NC0C 1K5GA 4M2LA 1WE2A 1JQJC 3PUVA 4TSFA 3SQXA 1CS4C 3WP0A 3U7EB 4TSFD 5HZHA 1OB2A 2YC4C 1M7GA 4Q7LA 2ZJBA 1NN0A 3N2IA 1YQTA 2VPPA 4Q4JB 2Z33A 1G8PA 1KI6A 1G4UR 2RQPA 1B59A 5D4SA 3TR5A 2DVWB 4TWZA 1TF7A 5CK5A 2H6BA 1W49A 2WOOA 2IXGA 3KP2A 1Q1EA 3J7AO 4QOSA 4C7OB 4KICA 1YLFA 2IVMA 3E3VA 5JHUA 2A9KA 3EZ7A 4PAMA 2M45A 2R2AA 5DE3A 3ZP5A 1X3SA 3QU6A 5JWRA 3ZGXA 2HXYA 5CDFA 3WTSC 4XSHA 3Q5EA 3BWGA 2GCOB 1DDNA 2JJ1D 4ETSA 3ZMZA 1LDJA 4K2EA 3HP1A 1YTYA 3SU8A 4C0BA 2HV8A 1H8EA 5JJLA 2I3BA 2Z99A 4FX0A 3NTUA 3EZ6A 3RKYA 2ZRBA 5FI1B 1DEKA 2GA1A 1E4VA 3R20A 3RNLA 1QNTA 3TVDA 4DCNA 2GAUA 2GJSA 2PX3A 4JVLA 1HE8B 4MKGA 1OXTA 3PENA 4HUQB 3E6MA 3ZS8A 4MDFA 4B71A 3A36A 5ICCA 1Z0DA 4D81A 2GCPA 2H8KA 1XCBA 3ZMTA 3HSRA 2OZ6A 4AWXA 4OIQF 4QNMA 4URXR 3CO7C 3ECOA 2AD1A 2ZRMA 1J5YA 5BPIA 4R8HA 1YZTA 3LV8A 4B75A 5E4FA 2O8FB 3KFWX 3U4QA 3TQNA 4YFXF 1FOEB 1MO3A 4XLPF 1NSFA 3RS7A 2O8BA 4A0HA 1HURA 3ERED 3TJZA 1D9ZA 2ATVA 2XIGA 3GO5A 2EFCB 1IRFA 2JLUA 1X1SA 3QF4A 2GXAA 1W4MA 1N5KA 1XXHE 3WTUC 3NBFA 5LDDC 1KDPA 1G16A 4MGZR 1B9NA 2V8OA 3TGNA 1MRNA 1NLYA 1JNYA 2OUKA 2NYXA 4G94A 2Q2EA 4HZFA 4X8HA 3NDBB 2XTNA 1KI4A 3L8YA 1G3TA 2PZGA 3QVVA 1PVOA 2HR3A 4PXAA 4EAQA 3CPEA 3I32A 2VT2A 1NN3A 1GUAA 4Y0AA 3LAWA 4CVNA 2Y75A 1OYWA 4TYNA 2JASA 3KP7A 1RZ4A 3LD9A 5K8TA 2J5PA 3MCZA 3SBEA 1XEXB 3K09C 3K1NA 3WTTC 2FNAA 4M72A 1OYYA 2NO6A 1GNPA 3BH0A 2QAGC 2HYFA 3F8CA 1HSJA 4EQ6A 1A82A 2C03A 3CB4A 4XBFA 1R1TA 2ZJAA 4AYWA 2FV8A 2XGXA 1Q22A 2NZJA 4KNYA 3MD0A 4QLCU 4Q4HB 3CX7A 4HX4A 2J0QA 1U5TC 1ZBDA 3OIYA 5D5XB 4BXUA 3MGCA 4H9GA 3W5IA 4PSKA 3FHOA 3X1YA 1BI1A 3RI4A 1G64A 4TMTA 2F1RA 2ZI5A 5J5CA 2ZBKA 3U3RA 1XCGB 3U6BA 2GXBA 3MAAC 3RYRA 2VP6A 3QPTA 5FPHA 4C0LA 1NJFA 1W4RA 3ISPA 2VP9A 2XB2A 3L43A 2JLQA 4CEJA 4QGHA 4O25A 1XRJA 3GZ6A 2RGNA 4IDHA 1NY6A 3VFDA 2IYZA 2B21A 3AB3A 3I5UA 5F98A 2IYYA 3CBQA 2RKOA 1YS7A 4HF1A 1EFUA 121PA 1KO1A 2GJ8A 4ILEA 4L5BA 3RLFA 3WY9A 1CBUA 4RY2A 4DLXA 2HKXA 5K5QA 1XPRA 1L7VC 1N0UA 5K8LA 3THWB 4HX8A 1E9EA 3WU1B 2CNWA 5HDGA 2EYUA 4ITRC 4B3GA 4B33A 2R8RA 1XF9A 3HYTA 2HTJA 2FGKA 4OJQA 4QGGA 5LD2C 3AKEA 1QBKC 3Q7QA 2CG4A 2XAJA 1UHMA 4E70A 1P73A 2ZE8A 3JZAA 3K0CC 4OL0A 3FXQA 4JJZA 2ZI6A 2BMFA 2OAZA 1ULYA 4BFWA 3I71A 2BKEA 3HU1A 2ZCWA 5HE9A 1U8YA 2OXRA 3B82A 6PAXA 4HAXA 1N3BA 1YFHA 1TU4A 4TMWA 1AS2A 3GJ3A 1NG9A 4RAYA 1JI0A 1ELOA 1N0WA 2OG2A 2R6FA 4ESJA 1S1MA 1M7BA 2Z43A 4AURA 2GXGA 3LA7A 1FQKA 1H65A 3HIFA 2FOLA 1FP6A 2ZYUX 1XWIA 2XAQA 2ESHA 1U5TA 2FF7A 4MYCA 3P1JA 5K5OA 4V0LA 1GHCA 3FFBA 4AYXA 2VHUA 1K7AA 3Q9SA 1LNWA 1DS6A 1SXJC 1JPJA 2XSZA 4JVSB 4RGUA 3WGIA 3KFXA 4A36A 3VU9A 5JHHB 5ED4A 3K0EA 3QXJA 1PP8F 1MDMA 1Y3AA 4E22A 1YHNA 4WXDA 4MYUA 4IJMA 1N0VC 4WXPA 1BIBA 2HUPA 4OBEA 2FMLA 2GK6A 4MEYF 4WZAE 1E1RD 1KDRA 3WRXC 2E7WA 4ON0A 4I4LA 1ZINA 3TLXA 3ZVRA 4ENMA 2YU3A 3ZH9B 3QP5A 4HYEA 2WJVA 4BH9A 3Q72A 4M1SA 3T34A 4ARZB 1AM4D 1WQ1R 1P7CA 1GVNB 2QE7A 4GMXA 521PA 4BGDA 2P4WA 3KLOA 4AD9A 4D4KA 3C7JA 1T6NA 3CF2A 1H0MA 2UZIR 3E2IA 3DPLC 4PO9A 3W5JA 2ZR7A 1JPNA 3HYRA 4D4JA 1RVDA 3J80K 3EXAA 2QQ9A 1NBME 2IT0A 2RB4A 3J80Z 3OZXA 4NYJR 4QHTA 1F2TB 5J47A 2Q3FA 4ESVA 3HDTA 1YR7A 2P5VA 3ZMVA 3OIVA 1FTNA 4I81A 1MABB 4XD7D 1FT9A 1OHHA 1R5GA 4RAZA 4TZ0A 3KQHA 1KK1A 1ZAKA 4ENNA 3B13B 1IY1A 5LGUA 2D7CA 5GJWC 3V8JA 4B3DA 3L09A 4JBAA 4TQAA 3BZ6A 4L5JA 1QHNA 2FFHA 3FXRA 2ZRIA 1GKUB 2O0JA 2WJGA 5DHAA 4ZYEA 1M7HA 1XCPA 2E9SA 3QOFA 4PC2A 4BUJA 5HZKA 5H8WA 1VECA 3KDSE 3BC1A 3MMPA 1PZNA 2XV4S 1UF9A 4B3FX 2BVNA 5DUIA 2PMUA 4TL7A 4KSCA 5G53C 3RANA 2DWZB 1G5TA 5CIWA 3GLIE 3RAPR 2X8AA 3K0AB 1ANKA 4OMYA 3FDIA 4C9BA 1HA3A 1A7JA 4P3YA 3VKHA 4RJLA 1PUEE 4Q1CA 1KSJA 3E5HA 4DSUA 3S1AB 1G3RA 5E1ZB 3ROUA 1U0JA 1UKYA 1HH4A 4A12A 3QY0A 4G5OA 3NBZC 1SKYB 4L8GA 2MH2A 2WBLC 2BOVA 5A2QK 1RIFA 2RN7A 3AJIB 1G5RA 2ZYTX 2V1UA 4POAA 1N5JA 2GJKA 4KA4A 4UQOA 5FB2A 3NHBA 2FZLA 1ZLJA 2VC0A 2AFHE 2XAUA 3V4GA 3IHLA 3TW4A 1Z6XA 1RUNA 1G6NA 1JR3E 3FWEA 1Z3IX 3CM0A 4MRRA 3W6NA 5JRJA 4H1UA 1BI3A 2IUTA 1T8TA 3T0YA 4HSEA 1U98A 3DDCA 4LC0A 4ZV4A 2STWA 2QYOA 3JZMA 1SVWA 4MGYR 1IQPA 1KU3A 3GJXC 2VXZA 4X8OA 4DKXA 1Z1DA 3R9WA 3BFXA 4F4JA 4LV8B 2FFQA 3RIRA 1Y63A 4JZKA 5LRSA 5L8VA 4Q4ZF 4II7A 1OB5A 2X77A 1TQ6A 3H86A 3U3KA 1E0JA 3K2ZA 1CF7B 3EPJA 5L3BA 2W0SA 4DCTA 3UMRA 1K6OA 4BHBA 4I1SA 3EDPA 1RRGA 3SN6A 2NZ8A 3IGFA 2VBWA 1E6CA 1IN8A 2E1CA 1N6HA 4KBGA 1WKMA 1ZM9A 2ORWA 3SZTA 1FYLA 1VYTA 3QJYA 4ZI2A 3PIRA 2HDCA 1O3SA 3DM9B 1I2DA 5CLQA 5D4RA 4US0R 2JDIA 1LDDA 3WNBA 1ODFA 2G6BA 3OAAD 2XITA 1IBRA 1SKYE 4JSYA 4KAXA 1Z6RA 4EPRA 1R6BX 2YWGA 5HE8A 4FINA 4M6YA 1ZNXA 4HAZA 4QRHA 3LXXA 2G7HA
chains in the Genus database with same CATH superfamily
4LXQA 3IMKA 4G8BA 2FEMA 1Q6YA 3NYRA 3EXFA 2V4JC 1KAEA 3GQBB 4L2IB 5KNDH 2JFGA 2IL1A 2B2XA 2EC5A 4LK0F 4IIUA 4WNIA 5EY5B 2F5DA 5L3SA 2R18A 5IFLA 2VHQA 4DYDA 3P97A 2QRMA 1U0GA 1PS0A 3E1KA 4I76A 5TGDA 1N2GA 1WVMA 1T8YA 3TDUC 3RS8A 1Z0FA 1YOVA 5HEKA 1GYPA 1MVNA 3T3GA 4DA7A 1XCVA 2VPQA 1OAKA 4EV0A 1A35A 2PMDA 3ROZA 1ZAOA 2FMIA 1XCMA 3PCRB 4P82A 1N5LA 1E2BA 4LYYA 2K9LA 4QPZA 2A5JA 4ZVUA 5SICE 1Z4KA 3CEPB 4JU8A 3ZCXA 3LZ6A 4PONA 1NP7A 2PRKA 4U7BA 4RENA 1LBTA 2PGXA 2R48A 1EF4A 1FDSA 1D8JA 1JF8A 2IZ7A 3K6RA 4EHLA 2IHKA 4IH1A 3U6MA 3B5JA 4IOAF 1ZGHA 3ISJA 3TXYA 1U0RA 3JTEA 3R0IA 5HJEA 1SXJD 5CXSA 2R8BA 3GCZA 3H5WA 1GJSA 1RP7A 2Y1XA 1ZM2A 1EX6A 2R7UA 2J0UB 3VSLA 1MTOA 3JATA 1VQNI 1RJ9B 2EHDA 2KYRA 1AQLA 4C07A 4WBNF 3TTUA 1GKIA 2FA9A 3LXUX 5LHGA 1LFAA 2CDBA 4AZFA 4WK0B 4YTEA 4PCVA 1JVSA 2B9SA 1YZUA 2R92J 3L7IA 2A4KA 1J39A 4J16A 1VZ3A 2G3YA 2PV0A 3KUXA 2RHCA 4QJBA 2NU9A 2OSVA 3QXHA 1Z6YA 2WJZB 1ETKA 1E6LA 1I3OA 4EB6A 7AT1A 4R81A 1CR4A 1AUQA 4TXJA 5EJ8A 3FMSA 3AUKA 3D5TA 2FR0A 1QMGA 4L7QA 3J81A 1TW2A 4HMQA 4HAWA 4P1ZA 4M54A 4RFLA 2KS6A 3D6JA 3OM9A 2GPSA 3A1UA 5EJ5A 3WGGA 4N3CA 3BXOA 3QK7A 2VJAA 4FHDA 1XR3A 1XTRA 3EZFA 3OZGA 1QHHD 3RC1A 5C31A 4ZC3A 3VU1A 4PG8A 2VSXA 2AG1A 3AHCA 3T15A 4UJ5A 2YQ4A 3LOCA 4HW0A 3AR7A 4K7JA 2C96A 1F0YA 5CW1A 4AF6A 4BMPB 3IG8A 3OE4A 1G20E 3N70A 2JFNA 5L3DA 3VZQA 4D9NA 3I64A 2H0RA 2QTMA 3SXYA 4E30A 3NIWA 5DN6A 3PHBE 3HL2A 1N2XA 1H2RS 4IHKA 3F4LA 3WNQA 5EXTA 4PK4A 5FOWA 5SY4A 1UJ2A 3RGWS 1UPUA 1B73A 3DF8A 2A9PA 1T5DX 1J9GA 3SX2A 4BEJA 2B1IA 2XTMA 3NT5A 4UPEA 3VR5H 3W2EA 1TDHA 5E8GA 4NY1A 1EUZA 2CK3D 5LQSA 2OLKA 1YG2A 4DR2M 4C3UA 4OHPA 1VOTA 2AHRA 3IIJA 3G1WA 4BV3A 9LDTA 2WJYA 4OHRA 4LXXA 2C7QA 1XMOB 1CCWA 1X42A 3L7KA 2HGSA 4H0NA 3JTMA 5FI0B 3IBSA 3W1EA 3RCOA 3DAHA 2ZTHA 3K0AA 5LZ7A 2HDNB 1ONSA 2RHRA 2VJOA 1ZOPA 3V4SA 1UJCA 4BMSA 1BEUB 1VCIA 3HKDB 2D5VA 3C8HA 1GA4A 1QGUA 2O2SA 4DGQA 1FW6A 3S14J 5TLSA 5DHTA 3VU8A 5HJ7A 4WKCA 1SANA 3HGQA 4C22A 1IG7A 3ZKAA 2LR0A 4X1IA 3S68A 4FILA 1PL0A 3FRHA 2CVHA 3B7GA 4XM3A 2BY0A 3EULA 3FKSA 1HFJA 3C3CA 2LDBA 2EV5A 1YIAA 2ZAYA 1XMIA 2DLDA 3GRAA 2KDZA 2B9VA 2I54A 5DV9A 4ZO6A 1E0EA 3C1OA 5F52A 1ORRA 2GRAA 3DS8A 3QQPA 1Z6QA 3M9XA 4XYGA 3NHMA 3THWA 3BPVA 4Y1RA 1CY4A 4Q01A 3RKQA 3BEOA 4G5SA 1ACJA 5CB4A 3P32A 3MOIA 1VBNA 2G1PA 2J33A 4PRKA 3PIOF 3GLRA 3EGEA 2JDID 4J9UE 5K0LA 3FX2A 3KZ1E 1BC8C 5FJIA 3FTNA 3FBGA 2HPVA 4PNZA 1VG1A 3R41A 1BN6A 2OZLB 3LVVA 3NEYA 1LF5A 4P4NA 3K9WA 2OF7A 5G0VA 4F46A 4NDZA 1ZEJA 5J9FA 5F51A 1XOIA 1WIWA 1T1GA 4WFKA 4BNTA 4F2LA 4MQ9F 4EJSC 1RMYA 3NYIA 4FUQA 1QRAA 4NBKA 4LA4A 1BQEA 4IZ6A 4U5XA 2R7RA 1EP2B 3N8KA 4B4CA 4YCLA 1OCRH 3S6JA 4YP9A 3NDJA 2P3OA 5FOQA 3CJTA 1T36B 4O4IA 1HT1E 3FM3A 2BEUA 3E7PA 2BE7A 5KVAA 2ORYA 2OQRA 1GADO 4YV2A 1J4AA 4L8LA 4FONA 3BAZA 4NATA 3EW9A 3K70B 1NHWA 2GPBA 4GX1A 3VFZA 4O59O 4AKIA 1EE9A 1T34A 1M1ZA 1Z5UA 5D6NA 4Y0NA 2P0WA 1PGJA 2Q29A 4EHFA 1GWNA 4M22A 2EAUA 2VOEA 1IZ0A 4QDTA 3LDFA 3AZOA 3ROFA 1NPDA 2P3LA 4IH4A 2MJ5B 3AGQA 4DDMA 4YRJA 4D96A 5CITA 1V34A 2RK6A 1E3EA 3ONNA 2P9CA 4UVGA 4XGNA 3NT4A 2MHCA 1K5DA 4J16C 3B6IA 1TPYA 4MGYE 3MTQA 3V80A 2BE5F 4R68A 2VP0A 1TMKA 5FSWA 4ND7A 1QGED 4JU9A 1NR7A 1NTCA 1H42A 4A0ZA 3UV6A 4H7DA 3ZC3A 2PD4A 2D1YA 3WADA 3PTAA 3AR8A 1JAXA 4XIGS 1F2UA 1NXTA 2XMBA 4NFHA 5EOVA 1T43A 3HVUA 3TMYA 1NI5A 1YB1A 4Q48A 1HOTA 3SHFA 3E1GA 3WV4A 3VHXA 2IOYA 2D3WA 2JLSA 2WF6A 4EG6A 1Y9JA 4DM4A 3JVUA 2JATA 4DLUA 5HS4A 3UPTA 2WWGA 4EUNA 2ECQA 2DLNA 3OU7A 3KLBA 4Q66C 5EHZA 3VLFB 4N3BA 2O48X 1Q0ZA 3CESA 2LVBA 4X84A 3L06A 1ST3A 4H60A 1CU1A 4KXNA 1MW8X 2VC1A 3R3WA 1V1MA 3GA0A 3DF9A 3PWKA 3I6IA 1P5HA 1LDGA 1P2VA 1DXHA 1FUUA 1TEVA 3BWYA 2YHUA 3ZY2A 3PEVA 1TWFJ 1CR2A 4F7ZA 2PO5A 3W8NA 2H7VA 1SD5A 3T1BA 2BW3B 1KXZA 1CRLA 2ECKA 2KKOA 3LQRA 5FKLA 1B8NA 4LUCA 4CMEC 1U8CB 2JGIA 3PU6A 5LD2B 3SZPA 5E3OA 4DT1A 4M8SA 2X51A 3OZTA 3IODA 4B3RM 4NJMA 3GJQA 2ACKA 1X7DA 4X1YB 2GHIA 2QAGA 2I6FA 3E5XA 1ZY2A 1YR2A 4HWPA 1UXHA 4DYQA 1ULUA 3L5KA 4RGXA 2I65A 4M76B 1VLLA 2DOFA 5LEJA 1VJCA 3VV2A 4AIIA 4D9FA 1EFAA 2YHBA 3ELKA 5HF8A 1BL0A 4CA0A 2LTAA 3THXA 3OMWA 2BBTA 3A0RB 3QU3A 3BE5A 1YFZA 1ZOOA 4U7DA 5IJWA 1VHLA 4I14A 3RW9A 4QUEA 2ZANA 4GMQA 3U60A 5A2QZ 5H1YA 4GMFA 2JHGA 2PLNA 4OHOA 4B74A 4XK8F 1WXIA 1HT0A 2PR2A 3A37A 4DV4M 3S81A 3OSFA 4JUAA 3CPHA 2AN5A 3CLRD 4ENJA 4NMWA 1X7ZA 2OHIA 4FGZA 4IJ5A 2ZR8A 3B5EA 2H7CA 1DCFA 3OLZA 2DLCX 1RXUA 5J2UB 4ZJZA 1DHRA 3AEUB 3G1UA 5EJ2A 3SMPA 5GAGJ 2X9NA 1OGYA 3GZJA 3TUZC 1XTPA 2WZBA 3KPJA 3D0QA 5DNDA 4OATA 2FI1A 1YJCA 5IT5A 1NW4A 3CH5A 4HDOB 1T0JB 5AUQA 4IRIA 3SFIA 1TZJA 3GFRA 1OBOA 2X49A 1KONA 3ZGNA 5BP7A 2E89A 1I1QB 3DA8A 1U81A 3IXLA 2JS7A 1TUGA 2HOAA 3KXIA 2RD2A 3D7LA 5B1EA 5BW8A 5KNBA 4LZWA 1I9GA 3TIFA 1QTQA 2RE8A 3A11A 4UEJA 1QG2A 1ZA2A 2OBLA 3I37X 4C0KA 4Q18A 2JEZA 2Y8EA 5AK4A 4O2LA 1QS0A 3RG2A 5DD8A 2FEOA 5DYYA 1HQDA 1IPHA 4MMYB 2LG4A 3NWJA 4RESA 2AX4A 4MQEB 2YFHA 3CUQA 4ID3A 3NDIA 4CF3A 1RTKA 5GZ3A 1BC5A 2JA8J 1C0LA 2GEDA 2UVQA 4IRMA 2IC5A 3FWZA 4U6NA 4I2VA 2O52A 2JBHA 3PBKA 3FOCA 2CWBA 3TW8A 1KC3A 1GFZA 3HBJA 1DG3A 3K0CA 1PNOA 3NHJA 2FN9A 2XWJI 2RGDA 2RAUA 2JY7A 1NWCA 2ZSEA 2JZ0A 2Z7JA 2ENWA 1OLUB 1A36A 4QOFA 3RRJA 1O08A 3OFVA 4HHEA 2HM7A 4GEKA 2PMZN 1Q1BA 4M0DA 1BU8A 1CY0A 3BTVA 3B7PA 2WZJA 4FCWA 1BJZA 4FM9A 4WV3A 3U4QB 4MVJG 5BORA 3NPAA 3KE2A 3L1HA 1QDEA 4O2AA 3TXXA 2WWHA 1G4DA 4Z7NB 3HYLA 1UJNA 3KOYA 4XWGA 2O7OA 1OC2A 4P3PA 3WTBA 3TLBA 5GVRA 5CEEA 2ZSAA 4TSRA 3G7SA 3B7WA 5HFJA 3SC2A 3ZWMA 5TJJA 1A2KC 5LNK6 4KBFA 2O5CA 1GZSA 1QR2A 2O54A 4FDAA 4D4MA 3HU5A 4OMZA 4YY3M 2E4VA 3TPFA 3DE4X 2K5CA 1ZH5A 4CGYB 3R8XA 1N2JA 1E7SA 4CUGA 1E32A 2P78A 4HF2A 2FPIA 3C85A 2WSSD 4IJUA 2Z8ZA 3DM5A 4JV5M 1BVSA 2BGNA 2VCEA 1MGPA 2M6KA 2R93J 5AM4A 1RD4A 5B55A 1H6UA 1TDJA 1VJ1A 1K7YA 2DBRA 4WQMA 2PQ2A 3P9NA 4FOOA 3EYYA 2C77A 5AVYA 4EJ6A 1NW9B 4CG0A 2CVFA 3VOBA 1SCBA 1SFOJ 2H5XA 1U3WA 5FBZA 4ME6A 1H9GA 1UKCA 1T9DA 5GAJA 4QDZA 4BJ5A 3AONB 4E7IA 2ZRLA 1SC1A 2XYRA 4OHZA 4NOOB 2PX2A 5EZGA 4UCWA 4DMRA 4RB0A 3A6LA 5F77A 3B89A 4KO2S 5I51A 1GL6A 5JSYA 1E79D 1P7PA 2IU6A 8MHTA 2CVQA 1MMFB 1ZIOA 2ME6A 1F17A 3RSZA 5L53A 5M3MJ 2ZUSA 3ADCA 2C97A 2P2DA 1WJBA 4X1IB 1I5EA 3QVUA 1TYDE 2VWHA 2XNHA 1ZRFA 3IKVA 4ZI7F 4GBJA 5EYPA 5ESWA 4ZJYA 1NMQA 3BRSA 3LCMA 4HDQB 3LY7A 3EPLA 1IN1A 1ZCBA 3QVMA 4TZTA 4DR1M 2VQFM 4H31A 1WUJS 2BYTA 1ZOLA 4U88A 4ZZ3A 3E5MA 4U00A 1SUPA 4HN9A 3L4SO 5FBQB 1P75A 5CVCA 3TL2A 3OZAA 2YMPA 4XOUA 4C4XA 4M1TA 4ZVRA 3WYFA 1AKEA 4CIWA 4ARCA 3CRW1 5J4HA 2OGTA 1H85A 1Z67A 4QECA 3H2ZA 4A0YA 2YU9J 4M60A 2ZXUA 1MDBA 5FLXA 2VUSA 3A0UA 3OQ1A 4AW4A 3OYGA 1L2CA 4CUKA 1GZUA 2I71A 1FTGA 1U9ZA 3VZPA 3HVRA 5JS7A 1WZCA 3MS2A 4I7EA 3PXUA 2Q3HA 1AKRA 4YH1A 2HNHA 5TQ2A 4RWZA 1QBGA 3HEBA 4GDMA 4LISA 3MWLA 4WY5A 5MHTA 1II9A 1IAWA 3M6XA 5KAIC 4X62M 2KW5A 3I09A 3O8QB 1QPMA 3SIPA 2WB2A 5JDIA 1DGQA 3RO7A 4QT0A 3RREA 5CJ2A 2J7KA 4S24A 4LRXA 3RUEA 3NW9A 4RF1A 3PGVA 3SQDA 4YJGB 4URWR 2HHAA 1E1DA 1MCZA 1PVDA 1BC7C 4D41A 4Y30A 4DUGA 2ZS7A 5LZ5A 1GTG1 3DEKA 1NF9A 3E9RA 2IPNA 5FTLA 3A3YA 1R16A 2A5LA 5JDIC 2Z1NA 1VP9A 4MW2A 3OIOA 5ARDA 2C78A 1KO8A 4Q9KA 1KP2A 5K6AC 2PMCA 4LRYA 2C9BA 1LY1A 4AM8A 1UELB 4F12A 3E5QA 3IHPA 4NBSA 5TEVA 3JS5A 4AYBA 1KMHB 4N7BA 4DCCA 3LYAA 1TZKA 3TRHA 1TYCA 4FYMA 1M2VA 4PJ0C 2PVPA 4DNPA 5F04A 4R71A 3HXQA 3LIPA 4BB0A 2HRZA 2WAXA 4PBTA 1FPQA 4ZIRB 3EA5A 2HIHA 5GP9A 2HSEA 5LMNM 5FBHA 4OAPA 5TMDA 4YDRA 4YB8A 5CIQA 4QWWA 4RNAA 1A4IA 1G291 2FWNA 3BHMA 4WCFA 4ZOAA 4W1RA 3J81S 3PUVA 3NOXA 4TSFD 4BQRA 4YRAA 4K6OA 1HMPA 1JTVA 1XXLA 4CR7A 1Z21A 2QVGA 3T7JA 2H1RA 3IT2A 1U0SY 2DWMA 1IQ0A 5EIFA 5JZMA 2LVQD 3I4FA 1Z7WA 3BWGA 4ZOCA 3PE6A 3I45A 2QV0A 2NT4A 1F3LA 1F6WA 3BHIA 2L0KA 2X8WA 4P1WA 5AW9A 2AD1A 1FOEB 1W88B 1N32B 2JIBA 1D9ZA 3ZE0B 1N5KA 5KYUB 2G9QA 5M5WJ 5ADHA 1UOEA 1L5RA 1YJ8A 2V8OA 4OH1A 4KMMA 1R37A 2O3UA 5BR8M 1JTYA 2HFKA 4CVNA 5B66C 5IKPA 3KP7A 2QUAA 4JQSA 5L7WA 3K1NA 1SPBS 3ONDA 4G0VA 2JBWA 3ANYB 1XQ6A 3MD0A 4TUYB 3HEFA 1G64A 5CCXA 1IDOA 1XCGB 1FDUA 3RU3A 3RYRA 2UUPA 1ODIA 1PBTA 2ONCA 4HQ6A 1W4RA 5ITSA 5E2IA 1OTXA 4WCFC 2ZT7A 2F67A 4RY2A 4RV4A 4UPDA 4B3GA 5LD2C 4XJTA 3GUHA 1G8KA 3MWFA 4BFWA 2L7FP 3QU9A 4YT8A 3IDZA 1YHQI 3CVVA 1FDOA 2WYIA 2XIJA 1O1YA 4J9VA 1ZX1A 2K2WA 3HCFA 2CEKA 3IQIX 2G5TA 4YFVA 6REQA 1BDHA 1J5EB 5TPWA 1K7AA 1LNWA 2DFPA 2GPTA 3EGIA 3FHNA 3QLJA 4IJMA 1DBQA 3RQIA 3ZH9B 4MO9A 3TDMA 1WFXA 3AWIA 3J80K 4DJAA 3Q7IA 3FBTA 3J80Z 4QHTA 2XMZA 2P9TA 2Q7OE 4C0XA 1AHPA 3EFEA 4XWYA 1X3ZB 1U28A 4AZVA 1SCKA 5EZYF 4X00A 3M6IA 2D7CA 4PS0A 1ZFNA 3OMYA 2EH3A 4AF8A 2WJGA 4A3IJ 3BCRA 4L7VA 2YTZA 1IBMM 2YV3A 4U3JA 5JXGA 1J21A 4L8GA 2WBLC 1G5RA 2LBFA 4XLHA 3PE3A 2YX1A 2WU4A 4GYKA 3R3ZA 1DKQA 1LUAA 3OTIA 1PWXA 2OCIA 4DKXA 3D2LA 1SY7A 1F2VA 3VBEA 3IMFA 3WE7A 3U3KA 1K6OA 3G23A 4MTCA 3ZGVA 4QQ8A 3LDGA 1SHLA 3KUKA 2TYSB 3HV0A 2QSHX 2OHJA 2BFDA 3K5HA 4OAZA 5M5XJ 3SX4A 2PBIA 3ENKA 2ISYA 1N36B 3HJTA 1V43A 3DBRB 2A3RA 3U6OA 2XYPA 3R76A 3RSGA 3H2JA 1BN7A 1IAVA 3GUCA 1SCJA