2QBYB

Crystal structure of a heterodimer of cdc6/orc1 initiators bound to origin dna (from s. solfataricus)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
368
structure length
368
Chain Sequence
KNPKVFIDPLSVFKEIPFREDILRDAAIAIRYFVKNEVKFSNLFLGLTGTGKTFVSKYIFNEIEEVKKEDEEYKDVKQAYVNCREVGGTPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIRAIIYLDEVDTLVKRRGGDIVLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEYGLIKGTYDDEILSYIAAISAKEHGDARKAVNLLFRAAQLASGGGIIRKEHVDKAIVDYEQERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISELDMFGIVKIRIINRGRAGGVKKYALVEDKEKVLRALNETFEDSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication/dna
molecule keywords DNA (33-MER)
publication title Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 112
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09079 Cdc6_C CDC6, C terminal winged helix domain
B PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2qbyB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qbyB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qbyB02
4PQRA 1N6HA 3SZTA 3WGHA 3ASYA 221PA 3EZ7A 4LLGF 3CZPA 3HP1A 4BZPA 5ERIA 3SOPA 1EWQA 5DYMA 2GVZC 1DPFA 1ZIOA 4Y0VA 3SBDA 5JEEA 1U3EM 3QPUA 1W48A 3CWQA 1FP6A 1KI6B 1XMJA 2OBMA 5AWFC 2MLGA 3H3UA 1XU4A 2VEDA 2ZRGA 2AK3A 5EE1A 4DT1A 1Y0UA 2ZRAA 2N46A 2CYYA 4HZIA 2D2FA 4A2PA 4FCVA 3K09C 1T5IA 1U0LA 3I4PA 2JLYA 4U88A 2RGNA 1WBDA 1KZ7B 2AD1A 1C9KA 3W90A 4P32A 4ASUA 1AN0A 3THOA 1SKQA 5SZHB 4CEIB 3WP1B 4ZI2A 1W7PB 3GJXC 4DXAA 2QMOA 2XRNA 4HEJA 3F3XA 4XSXF 1WWXA 3L09A 4UV9A 521PA 3K1NA 2BBSA 4O3MA 4QBHA 2M5WA 3K1MA 4LV6A 1XEWY 2OLKA 5JI3E 1N25A 4PXAA 1II0A 2FOKA 4HUQB 1YS6A 2GWRA 4B6FA 2QNRA 1JR3E 2RGCA 4OI4A 1GNRA 2FFBA 2Q0HA 5FBWB 3R8CA 1E94E 1U81A 3KE2A 4HZUB 3ABTA 1OSNA 1Z07A 4JMPA 2HYDA 2RGEA 1MABB 3F8BA 1ZYRF 1CIPA 4ZPXA 3WU1B 4F7ZA 1J99A 4YXWD 4XBFA 2W83A 1SVMA 4FCTA 2DFLA 2PFBA 2WJGA 1HXDA 2ISZA 2HWVA 4WZAE 5GVRA 4ABYA 3C14C 4K8OA 3ZIAD 4HATA 4Z1MA 4TZ6A 3PFIA 3CRRA 2WJVA 3PUZA 5AUQA 4PAMA 5DN6D 1C1YA 5J6XA 3M7GA 3VNUA 4NCKA 5EE9A 4RAZA 2OT3B 4DB4A 1KU2A 2MH2A 1KGDA 2WJIA 4UXJA 4XOIA 5CM9C 2IF2A 3BOSA 4NMMA 4HUTA 5LGUA 4RZUA 2PZGA 4B48A 3E5QA 2IA2A 3WU0A 1XTIA 2QY9A 1NLFA 4KJZA 3J81Z 2RN7A 1GNQA 2IXEA 2QI9C 2B0LA 4GPTA 2JLWA 1AQYA 1OR7A 2GZWA 1OFUX 2AD5A 2XTZA 3GMTA 1XB2A 2ZS7A 1CKEA 2RGGA 621PA 1GNPA 4C2UA 2G0NA 3OIUA 4Q9JA 4P96A 1NP6A 4Q4HB 1U2RA 3K0AB 5L3SB 2CCJA 3AJIB 3LY5A 3GLGB 2FGJA 1KY3A 2Q6TA 3EAQA 4LK0F 3VTKA 1SKYB 4KDPA 4DDWA 1Z08A 1YYVA 2XGXA 3JZMA 3CUQA 2AKAB 2F6RA 1T0JB 4A8JC 4D0GA 4PPFA 1RI7A 3F8NA 1FWZA 1ZLKA 2QPTA 4IJMA 3W6PA 1G17A 5JRJA 5SZKB 3I61A 5CVJA 1G18A 2DWOA 2LCFA 1IN5A 2ELHA 5KSOA 1IXCA 4MQ9F 1HSJA 3OE7A 2YC2C 5L3QB 1FT9A 3CPJB 4NL4H 2IWHA 2XJ4A 2X4HA 4WWCA 2V54A 4TN1A 1K8RA 3R60A 2A9KA 2IS4A 2VOOA 3MLEA 2ZNZA 4PGHA 5KHOC 3GJ4A 5KNCA 4EMSA 2DWPA 1LNWA 1II8A 1OHHD 1F2UA 2W58A 2XEXA 1JR6A 5TJJA 3BJOA 1A5TA 1ZIPA 2NRAC 4Z8YA 1G5PA 1TLHB 1UHWA 4JN6A 1M6NA 1ESNA 4QGFA 4FWHA 4RKEA 3H0KA 1OMIA 1QHXA 3BY6A 2MA3A 4D26A 4Q7KA 1GFIA 1J90A 2CE7A 4LK2A 4RGUA 5CVUA 2ZANA 1FPQA 1G19A 4AIKA 1N6LA 3RS4A 4M21A 4A8JB 4BLTA 3RS7A 2XAFA 2HKOA 1E2DA 2OFOA 3RABA 4R79A 1CR2A 1CULC 2AFHE 3FDIA 1PUIA 1CS4C 3WTSC 2VF8A 2C99A 4OMZA 1JB1A 3DL0A 3L0IB 4YMUA 3FZVA 4UQOA 3UMRA 2JIZA 1JI0A 2BWJA 2O03A 4UKDA 3AP3A 4DLVA 3FXRA 2D2WA 2VE8A 2EFGA 2GEUA 1IUYA 1W44A 2J5XA 1TEXA 4ILEA 4L9JA 2IRFG 5LB4A 2MH9A 2O8EA 1TQ4A 3J7AO 4O2LA 1U8RA 3ZD7A 2X0LA 4JVSB 4NYJR 5DI3A 1EK0A 4EUNA 2SHKA 4FMDB 3K0FA 1A2KC 4US1R 5TRDA 1N3BA 3L0SA 4PC3A 1NN3A 5J4LA 2EV0A 1MV5A 3LQQA 3I54A 3W8NA 1VPLA 4NBSA 2ZS8A 5E4FA 3HSEA 1TU3A 4A0FA 4JLBA 3M1IA 1P62B 3UWKA 1HW1A 1KDPA 2RHDA 1QNTA 1QZZA 2OSBA 2V6JA 4F93B 2WMOB 4OIPF 5AUOB 1SVIA 1BBYA 2YC4C 4KITB 1G5TA 2DQLA 1PP7U 2X77A 2A6EF 2JEOA 2B7BA 2OXCA 3EWAA 4DIDA 2PCLA 4MRSA 3VHLB 3C41J 3B1YA 4P31A 3RLFA 2YWGA 2VIIA 3REGA 1E6CA 4OI0A 5FTJA 1RIOH 1FOKA 1N6KA 4Q21A 4MEYF 3VX3A 1XGSA 4Z51A 4B3GA 1P2SA 1X8JA 1WDTA 2J87A 3EYIA 3QPWA 2R62A 4ZKEA 4RFSB 5E1WA 3ZDQA 3THXA 1SHKA 4EQ6B 4M1OA 4IOLA 4LJZF 1XEWX 4LWZA 2DZNB 2VN2A 4MKIA 1R7JA 1OYYA 4DLXA 2XTMA 2OCPA 2D45A 3A1TA 3BJIC 2H57A 4Q4ZF 3QKUA 3SFVA 4HLUA 3QU6A 4M1MA 4A92A 5HLHA 1NVVQ 3MFYA 3H2YA 2R3SA 3F8MA 3VX4A 1KQ0A 5E7MA 2EFNA 1F6BA 3DPUA 3TAHA 4A9AA 2OCYC 5D5XB 5LHGA 4V0NA 4FIDA 4D82A 2R6GA 2FBHA 2Z5UA 4LYAA 2WWXA 1SGWA 3SR0A 4C0BA 3R6SA 3QPHA 1OJLA 1EH7A 3KP5A 1R5BA 4IF4A 1VG8A 2BEJA 3MSXA 3CKLA 4KXFB 4BZXA 3CO7C 2ORIA 3VAAA 2EFPA 3A36A 1DVRA 3WODF 5FI1B 3SYNA 3E3VA 1AK2A 2RC4A 3K0LA 4I2OA 4UJ3A 5E8IA 3QPVA 4EIWA 1YZQA 4OL0A 4IVRA 3QP5A 1EFHA 1UBEA 4NCJA 3ZGXA 2FPMA 3EYYA 3KEQA 3GJ3A 3MGCA 4C3ZA 5EJEA 1ZINA 3W6KB 2G1JA 4ZV4A 5HKKD 2A3SA 3AGQA 3V7RA 1FOEB 1OXXK 2HTSA 1F60A 3IKVA 2RGBA 4Q1CA 1QVAA 1G6HA 2P67A 2IXFA 3E5XA 4MGYR 4UNQA 1GRRA 1TEVA 3PIRA 2V1DA 4DCNA 4OIQF 2F55A 5FPTA 3WRXC 3ADCA 1XTQA 3VU9B 1FX0A 2QBYB 5AIQA 3AF1A 3UWOA 3OHMA 4A6PA 4KNYA 4QG7A 3TGNA 2FA9A 1TPZA 4HB0A 4K46A 4YIIA 4GOXA 1Z7UA 3LAPA 2H16A 5H20A 4TYYA 3WHLA 5LD2C 4AD9A 2ETHA 1OYWA 1EFRA 3NH6A 2XROA 2GA2A 1U0JA 4PX9A 1JR3D 2OFWA 2M30A 3NTUA 4TTRA 4WIAA 1NMZA 1VG0B 1MO3A 4XLPF 3LA7A 3T8RA 1NN5A 2VP9A 3IGFA 3RANA 3MCAA 1XGOA 3T1VA 1SULA 1K6OA 2OU2A 4CHUA 2FE4A 4ZYGA 1YZUA 5AJZA 5L8VA 2PT7A 1VYUA 1ZGJA 2WWFA 2GETA 3RS3A 1RC8A 3ZP5A 4ENMA 3A8TA 5JR3A 5JWRA 1ZAKA 4KN7X 4A2WA 2ZRBA 2M8EA 3OEED 1PUEE 5DDGA 3C3WA 4D0LB 1E3MA 2NIPA 1BC7C 3HJNA 2P7VB 2MC3A 4WOPA 4EPTA 1ETUA 3TVTA 3U4QA 1D8KA 1GHCA 4HF0A 4HZFA 2O8FB 1COWA 2FU5C 1KYZA 1KZGB 4HDCA 2VBZA 3Q8XB 1J5YA 1P9WA 2O5VA 1Z8FA 4MKGA 5LD2B 4BGDA 4PO1A 1ZD1A 2DB3A 3EETA 2GXSA 2QM8A 3W6OA 3T8TA 2OAP1 3FPAA 2JTVA 3C7JA 3RNLA 4OQMA 1XJQA 3KL4A 4C0LA 1GKIA 3C18A 2OE2A 4FCWA 4A5MA 1VCOA 2J41A 2QPAA 3CWZA 1HTWA 1ZM9A 4BRWA 5HCIA 5JEDA 2GWHA 3DDCA 1H65A 4QHYA 1S3JA 4NZYA 2IX3A 4GDFA 1ZRDA 2B7CA 2IYVA 1VHLA 5DISB 4NU0A 4BFYA 1D8TA 1IXSB 5HS7A 5JI2E 4I99A 3F0TA 4JT2A 3ZVNA 1YZGA 4DSTA 4X8OA 1KJWA 3HYTA 4ZO4A 1OE0A 2CL6X 1ZNWA 3WTZA 4POAA 3B13B 3D0SA 1XSXA 1KK3A 1TQ2A 4NYMQ 2A5DA 4A0YA 4MQBA 1DBSA 3FYHA 2VP2A 1QPMA 1NI3A 1Z91A 2YJTD 3U1DA 1VDZA 4DUGA 3NRVA 1FNMA 4Z54A 4CEHB 3LD9A 4NYIQ 1LDJA 3OOPA 1ZG3A 2KIUA 4HLDA 3GLIA 5AJVB 2IYQA 4B35A 1W1WA 4A2UA 1B9NA 3FGNA 4RD6A 1OKKD 3HSRA 1J9IA 1OXTA 1FP7A 2YV5A 5H6RA 1DAEA 1RFLA 4KYUA 4MRNA 5B57C 5FL7A 1FSEA 2CXXA 1ZNYA 2Q21A 2ODWA 4M6XA 3Q3JB 2J0UA 4R2IA 4PHTA 3V00A 2VHTA 1U8ZA 2R6DA 3OAAD 3P20A 4DVGA 2VBXA 3GEZA 3LA3A 3TSOA 4BRUA 1KO7A 1KA8A 4TYQA 2VP0A 1KKLA 4LV5B 2FGKA 1US8A 1FUKA 3VR6A 4U7DA 5E3HA 4R71A 1NRJB 2NAZA 1KDRA 4Q4JB 4HW0A 3NHAA 1K5GA 4DB2A 2P8TA 1E1QA 3I59B 3NDBB 3ULQB 5IRCD 3JZAA 1W5SA 4E03A 4G5SA 2CJWA 2OXRA 2FEZA 1LF5A 4G5QA 2QRZA 2UVQA 2COMA 1RRGA 1J7KA 5BQ5A 4X8MA 1L0OC 3AKDA 3R0JA 4JIMA 1NSFA 2ZCWA 3GO5A 1BH2A 4KA4A 2PI0A 4Q1FA 4UNPA 1Z0JA 2J45A 4L5BA 4WAUA 4C0QC 5HZHA 1XD8A 4M6YA 4QFMA 4F92B 3JSOA 5J47A 2HS5A 3H3ZA 2OCBA 4XVUA 2O8BA 4IRIA 4I1SA 4HX8A 1OLOA 1O57A 1Q1EA 4DEXA 5TXGA 3LRPA 1F5TA 3BFVA 4RGSA 5ICFA 2FFQA 1FBSA 4G1UC 4Q03A 1D6JA 1O7FA 3UMSA 1B23P 5CVVA 2OLJA 3QXHA 4QBIA 3U7FB 1XBTA 4DSOA 5ICCA 4EQQA 1U9IC 4EJVA 2C03A 1RJ9A 1Z1DA 1C4OA 1DOAA 1YZKA 2FSFA 5LRSA 2D4HA 1GG2A 3RSLA 3ELKA 2XOKD 1T98A 5AR1A 3E6CC 2WKPA 3E97A 4ZIRA 2GJSA 2I4IA 3MG9A 3X1XA 3HTUA 3RAPR 3KQNA 3VFDA 2JJ1D 5DIFA 1D2EA 2DFTA 2QORA 1JHHA 3BPVA 1SVOA 4JSTA 4EDHA 3X1YA 4TL9A 2PMUA 5CB6A 1P4AA 1ONVA 2F9MA 4GYGA 2IYLD 3K8YA 3AQ4A 4RD0A 4FW9A 3UATA 2ATVA 3LFUA 4PHHA 2ZE5A 1ZG1A 4LJAA 3REOA 4CRWB 4F4JA 4AURA 2V8OA 1P3JA 3GF2A 4TT3A 2Z4SA 3F8CA 1FQKA 1S2MA 1FZQA 1NBMA 4G8XA 4I0BA 2G1KA 5LGNA 4MDEA 5B64A 2D3WA 1G3QA 2V9VA 1EWRA 3BZ6A 2WV0A 2MMCA 1UPTA 4PPGA 5JHUA 2AKYA 2GA1A 3HRUA 2Z83A 5JZVA 2O8CA 4I1OA 2VHJA 2OHFA 2FEOA 4PC2A 2K5UA 3RYTC 3IQXA 4GOJA 1FUUA 1NHAA 5BYKA 3EQLF 2Q3FA 3NWJA 4Q1AA 2WSSD 3R9IA 5BN3A 2BBOA 4C2TA 1PLJA 4LCBA 2A6HF 4HB2A 1SXJA 3ROUA 3GFTA 4L5JA 2PMDA 4LBYA 1KMQA 5CITA 4YG2F 4FI3C 4HAZA 3TSZA 1T3LA 2ZSDA 1LW7A 2DWQA 3JW4A 4LYHA 1MGTA 1S1MA 4M2LA 1CR0A 1E2EA 2XITA 4CT5A 2FWRA 3TGPA 1P5ZB 4C0SA 5ILVA 3QBVA 3CRVA 3LX8A 3X2SA 4AIHA 2P5LC 4P5OA 4JK1X 4H1VA 3WNBA 4MGRA 2WIBA 3NBYC 1LS6A 4PZLA 3V7SA 4TZ0A 1IXZA 5D8LB 3ABUA 3BXZA 3QF7A 3TOAA 1E2GA 3B5JA 3MQ0A 4PDKA 1E2QA 1T38A 3OIVA 3WYFA 5L3VA 4JLPA 4HDUA 3MWKA 1DARA 1TTYA 2WTUA 2EFWA 1UM8A 4IXNA 1O87A 4YFKF 1E98A 2W2XA 2NO1A 2HT1A 4JLVA 3NG1A 4L16A 1IOZA 4ESHA 3DZ8A 4ASUD 1HKSA 3O2PE 1JAHA 4NHJA 1E2LA 2ZRKA 5KDOA 3UG6A 3I73A 3REFA 3I5XA 4R1HA 1OYIA 5IK2D 2NPFA 4L15A 4R9UC 3SU8A 1OB2A 2V6ZM 3EWSA 5DUKA 3FVQA 4AKGA 3K1PA 3Q9LA 5J4YA 2QAGC 1M7HA 3FMPB 1JBKA 4KN4X 4EGZA 3LVQE 1BIFA 2ZMEA 1FC3A 4GFDA 4M8NE 3X1WA 1OH6A 3IIMA 2ZVQX 1UBGA 1PUJA 5AK0A 3U9GA 1KNQA 1Z0IA 3MAJA 4D25A 1DELA 2GZHA 1G3TA 4ZZDA 3JSPA 3Q85A 3V8LA 4QJ5A 4X8LA 4BHCA 1N0VC 3BJAA 1PZNA 2CFXA 2VSOA 4YDHB 1VYTA 2BMDA 2Z4RA 1YJ5A 1ZUIA 4JQFA 2GDJA 2HXYA 4E70A 1TL7C 4B74A 3CRW1 4MYUA 3CB4A 4EFLA 2XAQA 5HS9A 5IT3A 2WWWA 3GEHA 4Z1MD 1AIPA 1G3YA 2NQ2C 1GSIA 1CTQA 1Z6XA 2GILA 3RKXA 5DUIA 3G5UA 3U61B 4TQUS 2FZLA 5C4GB 3PQJA 3SC3A 4RB2C 2A5GA 1GKYA 4DZZA 4DSUA 2JASA 2QMHA 1KAGA 1S9DA 1Z83A 1YR7A 4ESFA 4PTLA 3BIFA 2QAGB 1NF3A 2MBFA 1YIOA 3LFKA 4M4SA 2W2VA 1WB9A 3VFZA 1ZLJA 1AZSC 1T9HA 2C04A 4B33A 3QAHA 4L5IA 2J0SA 2J59A 1ZARA 1GAJA 3TUJC 4Q5SF 5TY0A 2M45A 5TB5A 4KFRA 3VLFB 3CJNA 2F5FA 4JBAA 3AF4A 2OAZA 2OCAA 4BFWA 2ZITA 3BPXA 2GZAA 3W5JA 1QG4A 3VNVA 4R98A 3FXUA 3KP2A 1YO5C 1V5WA 1NVXQ 4IXMA 3CTAA 1REPC 4Y17A 2W00A 4JLAA 1WRJA 5CK4A 3I4LA 2HLDD 1TMKA 1O7LA 5G3YA 1R0ZA 3GJ7A 4IOJA 1ODDA 2KBEA 2A07F 3OE7D 1XNJA 3F22A 3QEJA 4AYTA 5IF9A 4OHXA 1W2HA 2YNMA 2YOGA 3KP3A 5HE8A 1ULYA 3PEWA 2NO0A 3MD0A 3AKEA 1R22A 2GQQA 1GDDA 3IO5A 4RCYA 4DHEA 1JJVA 3GLIE 1X6VA 2F43B 2WWGA 4ENKA 2V4ZA 2XGJA 1I2DA 3K70D 2EV6A 4XSZF 1HW5A 1Z6TA 2RGVA 2ZO4A 2QU8A 1QHHB 4LHYA 4BYYA 3GEIA 1X37A 1VECA 1Z28A 4Q01A 3GLFA 3SS8A 4AYXA 5GVSA 3AVYA 3VOEA 3DP7A 3LA2A 4BWYA 1G6OA 4BZQA 1VG1A 3ZQ7A 2KSQA 2B8WA 4QL3A 4ZCIA 2J1LA 2KJBA 2H6BA 2P4WA 2P6SA 1WMSA 3F21A 2P3SA 4TLCA 2XSZD 4QNRA 2VSFA 4KSCA 3KDSE 3KX2A 4XIGS 4HYEA 2OBPA 1HYQA 1KY2A 2GEVA 2A69F 1MKYA 3K0SA 1ODFA 4M71A 4DLUA 4TSFA 3UPUA 2ZQ5A 1Z63A 2QWWA 2YWFA 1ESMA 4P4TA 1BMFD 1ZG5A 2XAJA 3HPQA 3IIJA 4LHXA 5FBLB 3RC8A 4WXHA 1EGAA 1M74A 3P26A 5D5UB 1T5LA 1H0MA 3QBTA 4FMBB 4P0TA 1Y3AA 2FOLA 5SZJA 1SVWA 5AUPB 1CR4A 4BFSA 1AZTA 4HAYA 3GLHA 1BJAA 1T0HB 1HSTA 1T0FA 1TQMA 4S2EA 3TBKA 4JLKA 3DMNA 2ACJA 3EC1A 3N2IA 4DLRA 1G3WA 4RZ3A 1GP2A 5FFZA 2CQKA 5LEJA 1KI6A 2ZJBA 2WJJA 2IYZA 5HZKA 2CG4A 121PA 2F1HA 3ECOA 3QKSA 1O3RA 3TVDA 2IJLA 3QVUA 1I27A 2QP9X 1Q1ZA 3I92A 5FL3A 4OOIA 4M53A 1YHNA 2Q9AA 3QRFF 1E4VA 1GKUB 2P65A 1AOYA 3C1DA 4DLWA 2HEIA 4CEIA 4TV7A 4IHTA 1DPUA 3I71A 1G4DA 3PUYA 4EV0A 2P5KA 2G3YA 1MT0A 4BQSA 1G4UR 2NTYC 4JZKA 3MJHA 1PV4A 1R5GA 3KKNA 5CK5A 2HQRA 3MWMA 3RDPA 2VRWA 1OFIA 1XD2B 3NBZC 1X1RA 3P9KA 1KIMA 1NBME 4MRPA 4HBLA 3RYRA 4LB5A 1TF2A 1FLIA 1AWCA 1EXMA 4KU4A 3WTXC 1P75A 4N9HA 2ZREA 5L3CA 3BC1A 1GVJA 4LJ4A 2OQGA 2QL6A 3PUWA 4DWJA 2YSRA 1MABA 3N2EA 2BMJA 2WWYA 1D5CA 4GYIA 3PEUA 1ZUHA 3QXCA 1KKMA 4PC6A 4B47A 3W3ZB 1XN7A 4PCQA 1AA9A 1P2VA 3K0CA 4A4DA 1XDSA 4LC0A 1R6BX 4FMCB 4Q7MB 2ZRNA 2FMYA 4QWQA 4EGYA 3C8UA 4Q9LA 3G0HA 3EXAA 3UANA 2ZRIA 1OPCA 4JVLA 3L0OA 2JJ2A 5FR2A 2P6UA 1ZW6A 1SXJE 2EWVA 1P61B 1ZU4A 5FUYA 4KMUX 5EZ6B 3U3KA 2LNBA 3GJ0A 3ZZUA 5BXQC 4KIBA 3TR0A 3B85A 2C78A 3N4MA 3AVWA 3THYB 2ERXA 3CX7A 3FTQA 3KXIA 3NEYA 2CW0F 3H4MA 3EIQA 4LBZA 3WGGA 4L18B 4TMTA 2XV4S 4W7SA 1VHTA 2HF9A 1P6XA 4KUMA 2WHXA 1LEAA 2JCSA 2AL7A 1VTNC 2VF7A 1YVDA 3TW8B 4DRZA 3A4NA 5HDNA 4Q4HA 1G8GA 4IW3B 3K0AA 2ANBA 5FFXA 1KAOA 1XF9A 1LFDB 4U02A 3AF2A 1W7AA 5JRZA 1NVUQ 4IFEA 4GZMA 3NXSA 3SZRA 1NJFA 2OZEA 3NIBA 5L3BA 5DCFA 4AG6A 4DCTA 1V43A 1S6LA 2HZTA 4ON0A 4P9UA 4L9TA 1EFRD 1LJ9A 3MWYW 2QM7A 3TO6A 3QIAA 2HGCA 2IWRA 2ONJA 3EDPA 3K1JA 1W2GA 1R1TA 1T8UA 4P3YA 1XWIA 1XSVA 2AXLA 4DKXA 3U5ZB 4PFSA 1M7BA 4Q9IA 1E32A 1EESA 2RGNC 3CPHA 4DJTA 2EB7A 1UEJA 4M1YA 2EV5A 4CYDA 2K02A 2NS0A 5B58C 3EW9A 1Z6YA 2DBYA 2QRNA 4D4MA 4IVNA 4AWXB 1VIYA 2ORVA 1NNEA 1O3YA 1L8QA 1QO0D 2WAYA 4D2IA 2HOEA 3RWMB 1BYIA 3EUHA 1E79D 4B8XA 2YYZA 3B1ZA 5K8LA 2OZUA 3FMIA 3LVRE 5JWOA 4ENNA 4DDTA 2ZUBA 3R9XA 2F1IA 5FPYA 3R20A 4GI7A 3ZMDA 4O2RA 1Q44A 2PN6A 4EM1A 2FEMA 5E1XA 4A0XA 1MDMA 1GL9B 2A78A 2GCOA 4CO8A 1XDUA 4U7BA 1DAIA 3EARA 4BFTA 4JYBA 5JJLA 3M8EA 2ZE7A 3RI4A 2DAOA 2PJZA 3GFLA 3I64A 5HCNA 4DSNA 2CK3A 4QBGB 4DT1B 3O8RA 2NNYA 4Q9KA 3LXRA 1A82A 3M8FA 3B8HA 2UZIR 2RVCA 4YMVA 4LFUA 5FD5A 1XCPA 2XKPA 4XLNF 2ERYA 2XJ9A 1F2TA 1XTJA 3OEHA 1ZD9A 1DADA 2YPRA 2HCJB 1WA5A 3M6AA 2GZDA 2JAQA 1S1CA 3FE2A 4DLTA 5FPKA 1ZN2A 5DNYB 3TKYA 4KLNA 3GP8A 4M74A 2DCUA 2YX7A 4OU0A 2FSHA 1N6RA 4U0YA 2WOOA 3GX4X 4NKRA 2GBLA 5H8WA 4TYWA 2Q8KA 3U3OA 5GJCA 3ZJYA 2L3DA 4KODA 4F91B 3AVUA 4HLCA 4AI6A 2NOAA 1E9EA 4G0NA 4HX4A 3TQNA 2UZKA 4LZZA 4NCIA 2QEQA 1FYKA 1ONBA 1XDBA 1CRPA 4RVCA 5FBRB 2K4BA 4I7HA 3C5HA 2GVDC 1R4AA 2Z0MA 1V4RA 2WOJA 3B02A 1STZA 1P73A 4EM2A 2BM0A 4ACBA 4K2EA 3OIYA 4KFCA 3IIKA 3LW8A 3HYIA 2DK5A 1UBFA 3B60A 4FT8A 2Y75A 1I4TD 2NG1A 2ODEA 2ZFWA 4RB1A 3QENA 3KFVA 4KI0A 1BS1A 4E07A 3IRQA 5HR5A 4R7ZA 3J80K 5F3WB 3V8JA 4IRHA 3ZMVA 2WWHA 3K0EA 4URZR 4OIOF 2R6CA 5K5OA 4B3BA 1QHYA 4OQLA 3FB4A 5KSYA 3FMRA 4NQWA 1ZM3A 1FY7A 2UWMA 2ZUDA 4ESJA 3GLFE 4MYTA 1IJFA 5G3ZA 4A2QA 4RB0A 1I4DD 3T35A 1E1RA 1XEXB 4A82A 2FH5B 1MOZA 1YG2A 4LB6B 4Q9HA 1GRNA 4F4CA 5FOTA 1E2IA 1CXZA 3CUEF 1OKRA 3K70C 4IKEA 5DCMA 2BMFA 3U3MA 2QYOA 3EZFA 3WE3A 5TDHA 1IY2A 3LAJA 1L4UA 1M7GA 1Z6AA 4PC7A 3RRZA 2IEZA 2FXAA 4RB3C 3IKJA 1ZCBA 4MRVA 2PZEA 2FMXA 4PPNA 5DO9A 1CJKC 1A2BA 3B73A 1GWNA 4V0LA 3QXXA 4I4LA 1WQ2A 2FSWA 3TOBA 1L4YA 1UEIA 1IN4A 3LWNA 2ZM5A 2XXAB 1KJZA 4TTQA 1XCGB 1G3SA 4MGKR 5J4VA 2IS2A 2ZSAA 5FOVA 4W9MC 3NEJA 2AFIE 4OI2A 2FBKA 2NNNA 5J40A 4OIRF 3IEVA 1H8HA 3R9WA 4EJWA 1U2WA 4EJUA 1DE0A 1WKMA 1QHNA 1ZM2A 4M1WA 5FI0B 3UIEA 821PA 4A15A 1FP2A 2C9CA 3GW2A 3GLHE 4TWZA 2G9NA 5H1YA 2V1UA 1WI9A 4EJSA 1SD5A 1Z9CA 2LKCA 1F2UB 5CB8A 5E20A 3K70B 3WTYC 2QBYA 4IHSA 1D9ZA 1QVRA 4F38A 4A0ZA 1FMJA 1KK0A 4JL6A 4RAYA 4OQXA 5LGTA 1IQPA 2JDIA 2BEOA 3BGWA 1OXVA 2QUFA 1XRJA 3ADKA 4ARZB 4LLLA 4CW7A 2W25A 1EG7A 4XWOA 4C0HA 3T12A 3HDTA 2QT0A 5E8GA 1WQ1R 5CVIA 2F9LA 2RAPA 3DPLC 1M2OB 5DV5A 1W0JA 2WM9B 2ZU6A 2ZJ5A 3BS4A 1NBMD 1TADA 4TT3D 5EZ5A 5JI6A 3LLMA 4HB4A 5FBQB 2CLDX 1CU1A 3ZMZA 5CVRA 4OHZA 2ONKA 3F23A 2XNDA 3WE2A 2LKDA 2KE5A 2P6RA 4AC9A 4NB5A 2NO9A 4GO1A 3V4GA 2QG6A 3QJYA 4CICA 2QP4A 2I1QA 3IHLA 4N0EA 3DEUA 1T2KA 2GJAA 2Q3HA 3IBYA 1ZNXA 2WTEA 2EVWX 2FZ4A 2L01A 5EP3A 1F5NA 2OESA 3G82C 2A30A 3L43A 4NPHA 4D6PA 3T1TA 4FX4A 1OXUA 3ML6A 3K0FB 2QZ4A 3DZDA 1F48A 2BJVA 1Q1BA 4CF7A 1BI1A 1UKYA 2BBWA 2GRJA 2IA0A 2PEXA 1D5VA 4ZDKA 5JS8A 5JLJA 3RVBA 2FN4A 3MEXA 2FPLA 4LC1A 2EQBA 1GTVA 1KSJA 2QENA 4B75A 1IHUA 3W8RA 2GESA 2DPDA 4LHWA 3I5YA 5TMPA 3BRWD 5BN5A 2PJRA 2CE2X 3MMPA 4LLNA 1E69A 2GJKA 3VR4A 1MJAA 2L4MA 3EC2A 1QHIA 3U7HB 3RKYA 5EUMA 3EPHA 5K5RA 3TIFA 5DD4A 1UCRA 1Z6GA 2W84A 1FBUA 3BDDA 1T8TA 1PDNC 1BI2A 1TU4A 4BPBA 1F1ZA 1GM5A 3U60B 4LUCA 3THWA 2IC5A 2ZR0A 2CHQA 5LEKA 1JXMA 2G88A 2GXGA 3CNNA 1UBCA 3TKLA 2XKOA 4LHVA 1NIPA 1U94A 3THXB 1R0YA 4M73A 2VHUA 1YLFA 3ZZ0A 1S96A 4CZZA 1E99A 3MHVC 1EFTA 3ASZA 5D4SA 3L8ZA 2PH1A 1BYUA 1NN0A 4EJOA 1LB1B 1SKYE 1VIAA 1YR8A 2CVFA 3OF5A 1U8AA 4RJLA 5B30A 5LHIA 1SMYF 1KU3A 1XMKA 2H09A 1K7AA 2OBNA 2NPIA 2RCNA 4AD8A 1MO4A 4CEHA 1A1VA 3BWDD 3ICQB 1Z2AA 5H68A 2ZIAA 1KI3A 1S8NA 1QGPA 1KI2A 2JGNA 2VYFA 5AUNB 5EQTA 1Z06A 2PEYA 1G3MA 1OPXA 3BK7A 1XXHA 1KDOA 2WJHA 2VT3A 1IBRA 5DHAA 1Q21A 1PJRA 1RKBA 3D31A 2VONA 1QHGA 4LRSA 3LBIA 3HRTA 1H8EA 2R7DA 1Q20A 3LBHA 2Z3YA 2RH5A 3ND8A 3P27A 1KI8A 5FTLA 4LOAA 3ZIAA 3U44A 2J9RA 1A04A 4Q18A 4GL2A 2GAUA 1JE8A 2OAQ1 3DVLA 4O5VA 3TDUC 4RS8A 4GGGA 1G1MA 3OESA 4MKFA 5D5VB 3AAFA 2OFXA 3H1TA 1T6SA 3AM1A 1Q57A 1X86B 4NDZA 1UDWA 5ANRB 4C30A 4QM6A 1NL3A 4GZLA 2HR3A 2AR7A 5F9HA 2FRHA 3I59A 1KK1A 2NMVA 3DHWC 2MSDB 5E18F 1FPMA 5L3DA 3AEZA 2J0VA 4TTPA 1GRQA 4C0AC 2QQ0A 5LPNA 3QSYA 3PQCA 2DPXA 2DY1A 1RRFA 4QGHA 5F98A 5HOOA 3H84A 4WVFA 3MCZA 3KEOA 3E6BA 2RGDA 4I0AA 1LVGA 1FX0B 5KDLA 1VKJA 2CCGA 4ZDJA 5HS8A 5BPIA 4GMXA 2BCJQ 4GMDA 4ZYDA 2EWWA 1LQ1A 2HUPA 4IDNA 2P6NA 1E0KA 2O61A 2IHYA 2C77A 3C16C 4HDQB 4RZ2A 5HTKA 1FZPB 1N0WA 1W0KA 3AGPA 1EH8A 4IOMA 4TL8A 1K79A 4QHTA 3EPJA 1R23A 3ZLJA 4LMYA 3RC3A 2DQRA 5JCPA 4HLXA 1OB5A 4BASA 1N5KA 3O8BA 1LTQA 2LWIA 4Q1BA 5A4JA 2VP4A 4B6EA 2ZJYA 3HTSB 3CRMA 1D9XA 3I8XA 2C95A 4XVRA 4JLJA 5JJKA 1T39A 1G7TA 3FKSA 2WMNB 3QF4B 1J75A 5HPYB 5K8TA 3SQWA 3HOTA 5CLQA 2PQ8A 3RDIA 4HQEA 2WSMA 1ZP6A 3SJAA 3AKCA 2X19A 4KVGA 5LB2A 2CCKA 4EFMA 4LRWA 2ZXUA 4U5XA 4IXAA 3J80Z 4G5RA 3U4QB 4FD2A 4D4LA 4FWGA 4OJKA 3SBEA 2STTA 1U90A 3AKYA 2R9VA 1YR9A 3WMFA 2ZRDA 4DCVA 4KFTA 2HYIC 3DF8A 4LGMA 4EVIA 1E2PA 2G9WA 1AS0A 1M34E 3SQNA 4G7HF 3GPLA 4LYFA 3Q7QA 2EA4A 2GXQA 3W3AA 1FYMA 4Q66C 1S9HA 2J7KA 3I1FA 3C7KA 3NDPA 2OBLA 3P32A 5E95A 3UMFA 2KJCA 3B2EA 1U9IA 1I2MA 3FMFA 4H1UA 2PBIA 2JLSA 4XVQA 2F7SA 1RRCA 4A36A 2XAHA 1FTSA 2R6AA 2PLRA 2F1RA 3O3KA 2ZSBA 4NP6A 2ZAOA 3DKWA 1E2NA 2VA8A 2YOFA 3P1JA 3TUIC 4GNKA 2HTJA 4A3VB 3LNCA 2BHRA 4B2IA 3QG1A 4TSFD 1P4SA 5M04A 3AH8A 5TVKA 5G41A 3R7WA 3UK6A 3HUGA 1TQIA 2GTPA 2NYXA 4GP6A 4HAXA 4OI1A 5GJBA 1EH6A 3L82B 1SFUA 3WHKA 4LRTA 1WF3A 3B9QA 4OBEA 4EPYA 5C2JB 3O47A 1N5LA 2YZ2A 4Y13A 5D6EA 4BH9A 3B1VA 4EKDA 3ZN1A 5TV2A 1E96A 3GLIB 4HX7A 1R5OA 1T3SA 2CVHA 3L9FA 2NO6A 3IUYA 3KKPA 2R65A 3F6OA 3O6BB 4BAYA 3V7CA 2CNWD 4OK3A 5FR1A 1K6MA 2FF7A 2ZVPX 1U5TA 4L9VA 1XP8A 1N2CE 2ZYVX 2A61A 4G3XA 4MRRA 2R6FA 4IVPA 2J0UB 5EE0A 3NC1C 3HSFA 3KJEA 2O6GE 1IRGA 3DPTA 3PR1A 3IL2A 1XMSA 4PQFA 2ZJ8A 3B1XA 4W5HA 1AJEA 5C1BA 1GVNB 4QKQA 4P33A 1NN1A 2IPQX 4HF1A 1US8B 3U6KA 3QNUA 3T1OA 2P6TA 3ZS8A 2VT2A 3N70A 3CLVA 5DLQC 3BWGA 1HKQA 4HAWA 2Y8EA 1SD4A 2Z5FA 4DC9A 4LJ6A 2WKQA 3HU1A 3KCCA 1UHMA 2CJWB 4NTZA 4WBSA 1U6GA 1CEEA 1QHSA 2AX4A 3LX5A 3Q5DA 3HWSA 2QQAA 3GEEA 4TQ9A 5GJVC 1BI3A 2QGZA 4Q4AA 1RW4A 4TL7A 2FFHA 3HYRA 4JLNA 1MR3F 4LPSA 4EFNA 4C7OA 5ILUA 1KOFA 1KNXA 3NBXX 3VKWA 2B6HA 5FOXA 4AVPA 3EPLA 5E17F 1MO5A 3B7GA 1M8PA 3Q5FA 4UNNA 4KLZA 3A1WA 2O8DA 4DLZA 1S29A 5FD6A 2EFHB 3CLOA 4LHZA 3BH6A 1W4CA 2C8VA 2PMHA 1R36A 3HHHA 4TLBA 2BOVA 3S2WA 1WSUA 1XFAA 1ZUNB 2MMGA 1J0RA 4DDUA 1NVMA 5FPHA 2V7QA 2HKXA 1LNZA 5HKKA 1SQ5A 2XZLA 2KRFA 5D4RA 2JJ2D 2DPUA 3A4MA 3SEAA 1QDEA 1WCV1 1OFHA 6Q21A 3CW2A 2CEAA 4WZ6A 1XTKA 5JSZA 1YTYA 2JSCA 2WPDA 1P2UA 1E2KA 4G5OA 3K9LA 4OQFA 2OV2A 2QAGA 1V3FA 3KP6A 2YHSA 2OQRA 5D3MB 2CHGA 5KPDA 2J7PA 3EIEA 2N42A 4GBMA 4JS0A 3LSTA 1F4KA 4UNOA 4UXHA 4AKEA 2V6CA 4BEJA 1N6PA 3O8CA 1TQ6A 1VTKA 3W5IA 5H70A 2DWZB 2BV6A 1DP7P 1UB9A 4RCZA 4PAQA 4B44A 1OFTA 4WXCA 2JLZA 1GZSA 3TW4A 3FWYA 4MTDA 4US0R 4CT4B 1Z0DA 1FMLA 1G21E 1WE2A 1KI9A 3LA6A 2V9PA 1XCBA 1JR3A 4IDQA 2QLZA 1L7VC 5HDGA 1YQTA 4I02A 2I3BA 4JSYA 1OXSC 1XZPA 1NVWQ 2O0JA 4B09A 2O8CB 3CUOA 4N1AA 1XB4A 1WXQA 3L0PA 1JNYA 2BMEA 4D0NA 3SJBA 4P55A 3E70C 3R8FA 2ZI3A 1TUEA 3OEEA 1MKMA 4P4SB 1JQLB 1MJ9A 3CM0A 2BBYA 1UDXA 4LG0A 1CGPA 1E9BA 4WXPA 3ZVRA 2YWEA 3V4RA 4FWDA 1XPOA 5L3EA 1G16A 2FG5A 3IWFA 4LX0A 1U78A 1NKTA 2I1VB 4M9XA 3KLNA 3GJ6A 4FWIB 4AIIA 2HT6A 2QSYA 1XXHE 1XEFA 1SHZA 2L0XA 3JVUA 4Q02A 1W4MA 3PITA 2RDPA 1R58A 2Q0OA 3GZ6A 3I62A 5DD8A 2IBMA 2PZFA 1ON2A 1KI1A 4ZCMA 4MH0R 2QPOA 4JJZA 3GLXA 1AGPA 5D3QA 1XPUA 3CF0A 2FU4A 5C18A 4OK6A 3KZYA 3KKOA 2E1NA 2V6IA 5KTYA 1DDNA 1BOFA 2BC9A 3R61A 3T0YA 1CF7B 1AGRA 3CONA 5JFGA 5BW8A 3GYHX 3UXMA 3KJHA 4MGZR 1DAHA 1KO5A 3OEHD 1ZAOA 3IPYA 2XB4A 4KIFA 3IHUA 3AF3A 1H9TA 1GL7A 3DOFA 4TL6A 1K78B 2AXNA 2JPBA 1XTSA 4A6DA 2IUUA 2VXZA 5BWMA 5IHPA 2DU9A 2CMKA 3AF0A 3KFXA 1XGMA 4I1UA 4UXNA 2D1VA 4LPKA 4JKIA 4CIDA 1QQIA 5CJ9A 4UUVA 1KSFX 2YVUA 4IHQA 4JL5A 4G6QA 1R8QA 3KP4A 2DR3A 5KUTA 2D7CA 1IY0A 1HQYE 4IRUB 3GQBA 2A3RA 2ZMEB 3FMSA 2OD5A 4LYJA 2VBWA 4FHTA 3U2QA 2ZRPA 3KP7A 4GRAA 4NYJQ 1U98A 2J3EA 1E9CA 1U8YA 5DGXA 3TQCA 1A4RA 3FF5A 2QE7A 3DKPA 4PO9A 1BKDR 3OAAA 3VB2A 2PEZA 3P9CA 3R4KA 4Q48A 2ZRHA 4UNSA 5ICEA 1KK2A 4HYYA 2REBA 3TH5A 2O3FA 4B73A 1F3OA 4BUJA 1P60A 2WKRA 2C96A 2X8AA 1TW2A 1TF5A 1DUXC 4YIFA 1DO2A 4OHYA 1GOTA 2QT1A 2JLVA 2W0MA 3HU3A 3B6EA 3S1AA 3RRYA 1ZRCA 1IN6A 2EYUA 3A1UA 2JIZD 5D5WB 4W5WA 1JHFA 1LDKB 3WG9A 1FW6A 2PCJA 4WZBE 2H27A 1LEBA 4B2LA 2IL1A 4KIGA 1KHTA 3IILA 3FOZA 5FGMA 3T1QA 3CO5A 4KCGA 5FB2A 1K5DA 1E9DA 2PT5A 1R1VA 1E0SA 4IDOA 5L3RA 1SAXA 1E1RD 1I6XA 4V0OA 2WC2A 4G9YA 4P9FA 5DH9A 4PSVA 1OH8A 3HR7A 2ESHA 2ZRJA 1ZGAA 2GJ9A 2PL3A 3NHBA 3NEUA 4MTEA 1YR6A 3SDZA 2RQPA 2M87A 2KJQA 5JHGB 1PLKA 4MUBA 4G7ZF 2IUSA 1FL9A 4A6EA 4CDGA 1XX6A 2M1BA 4UV8A 1Z29A 4W5JA 4B34A 3BH0A 3E6MA 1G20E 2JATA 4LBVA 2CGPA 2ZYTX 6PAXA 3Q5EA 2RMKA 3PEYA 1QRAA 4LDJA 5ILSA 1ZBDA 2QM3A 2QZ8A 4JBXA 5FUVA 3V9PA 3VR2A 3EPKA 4FWTA 3GWZA 3HHGA 5FTNA 4ZKDA 2XOKA 5FOSA 3CRQA 3CF2A 2VC0A 4M1TA 3BJ6A 4MGIR 1XMAA 3F5FA 4A6XA 4B3CA 4BFVA 4PR0A 3CR7A 1N0UA 3T5GA 2QUZA 1P6RA 2IT0A 3VR5A 4RY2A 5EEGA 2BKEA 5C46F 2BEKA 2ZRFA 3WY9A 1E0JA 3THYA 1RYFA 1H8HD 1NSTA 2DK8A 4LJ9A 4BNCA 3KJIA 3KUDA 4AKIA 4WF2A 1KMHB 1W7PA 2HJVA 2DYKA 3HPRA 2BJWA 2XUBA 5DSZA 3ZS9A 1G5RA 3NVAA 1DO0A 3QY0A 4BFZA 2IYXA 1HQCA 3JTHA 2GAAA 2Y0MA 1OF1A 2IW3A 2FNPA 2XX3A 1CRQA 2ZRCA 2ZR9A 3ZH9B 3GFPA 4HUQA 4IVQA 2JDID 2ISYA 1ZRFA 3TK1A 2IYRA 3GCGA 1YW8A 4NCNA 4HZUA 2QROA 4RD1A 3FFAA 1KDTA 3RHFA 5BOXA 1XMVA 1W0JD 4EPVA 1BN5A 5KPJA 1NY5A 3K09A 4TLAA 3MAAC 3U7EB 1Q1QA 4PO8A 4XD7A 5CYOA 3MWLA 2MSCB 3TO9A 2Z43A 2XNDD 2WSSA 3F8TA 3KTAB 1KTVA 3QEOA 4MEXF 3QUSA 4MYCA 1G6NA 1G8PA 4ETSA 4O25A 3MZYA 2FJUA 3FFBA 1BC8C 1KJYA 3P4YA 1MD0A 1T4GA 4HLQB 4E5UA 2V3CC 2EYQA 3G3ZA 4CEJB 4UVCA 2ZR7A 3QI2A 3M9AA 3LXXA 3SYLA 2P5VA 2J5OA 2KI5A 4MNUA 4FX0A 4L4UA 4CZ2A 3SJCA 3GLHB 5G53C 3BROA 2G7UA 2GCPA 3PVSA 1UJ2A 3AVOA 3FWEA 1AKYA 2FMLA 3VR3A 3L2OB 4NE2A 3WTVC 1XTRA 1T6NA 5L3SA 1LB2A 3GLGA 4A5NA 4Q00A 2OG2A 4D4JA 3QKSB 1JPJA 2H6CA 4KYWA 1G3RA 1IY1A 2H17A 1XCMA 2DW4A 3F3YA 2KB0A 3TNFA 1XZQA 2YR2A 1CJTC 4KT5C 1DEKA 1OW3B 1RRPA 3K0CC 2DLLA 4V0MA 4JLDA 3QP6A 2PLYA 2Q9BA 3TAUA 1LF0A 1PVOA 3VEPA 1JECA 2D2EA 3QQ5A 5CDFA 1CJVC 5L3QA 4OMYA 1XJ0A 4Y15A 2GXAA 5IK2A 5A5GA 2Z99A 2ZYUX 5L3FA 5KYKA 4YMWA 2O0YA 3QKRB 2FF4A 3X1DA 2CLCX 3CZQA 4WX9A 1ZVQA 2IW5A 2XAUA 2L4AA 4XTRA 3WBKA 4URVR 1NMXA 3D8BA 1VMAA 4ZI3A 3SNHA 5EEHA 3WTWC 2BBTA 2P5SA 3T61A 2ZXJA 2UXNA 1TBXA 5BPDA 5EP1A 1HH4A 4FMDF 4KV9A 1GITA 4YDSA 3W9YA 2Z9OA 3SYKA 1B1BA 2GXBA 2HYFA 5E7IA 4M0LA 3IRRA 1COWD 1O3TA 3ETLA 2V1XA 5KOYA 4A8JA 3MJRA 3BOQA 1YU9A 4DQ2A 2IS6A 1H8ED 1S0UA 3AVTA 2DI3A 1ANKA 2E1CA 1CR1A 2D62A 1S7AA 2ZPTX 3B1WA 2IYUA 2A5JA 4Q7LA 4BLSA 2W6IA 2W6JA 1DPRA 1DAMA 1JEEA 4GSYA 4JVMA 4L9WA 2PJPA 3QXSA 4MYHA 1YW9A 4YLGA 1HBXG 3I0TA 3U6BA 2QQEA 1ZH5A 2VTKA 5TARA 2ZBKA 2FFAA 4RGXA 4JBYA 2H8KA 1G291 1S3GA 1HV8A 1XEXA 2GA8A 1TNDA 2ORWA 5D8KB 2BCGY 2V79A 1P92A 5LDDC 3K9HA 2DFIA 4LD5A 2WWIA 2QGNA 3RPUA 4JJKA 1VCIA 1FSHA 1RYHA 4XWKA 1D2NA 3ZMTA 3EA0A 4HV5A 2YKGA 1DAKA 4AIJA 1EX6A 2L02A 3IQWA 2GHIA 3GFOA 5EE5B 2PG4A 1X8LA 1O3QA 3OZXA 3PUXA 1R7RA 2WJYA 5FBVB 5BQTA 3QPTA 1R00A 5K8UA 1W0KD 2H92A 4DUGD 1HUQA 3RS0A 4TLEA 3D6TB 3ADDA 4KMFA 3Q7PA 3BAFA 2XXAA 2HLDA 3WTUC 2ZNYA 1XSDA 1R2QA 3L8YA 1IW7F 2K4JA 1BI0A 3AP1A 2YX4A 4MKHA 3GXOA 1YFHA 5LBQA 4LK1F 1OIVA 1B59A 1W4AA 4FN5A 4CGZA 2VBCA 4TMZA 2NGRA 3BORA 5FL7D 4C0KA 1FFHA 4WW0A 3CUQC 5ICGA 1VCNA 1YE8A 2D74A 2DBBA 3KETA 2VHQA 3AVPA 3FKSD 2PX3A 4XTCS 1AS3A 1FBQA 1Z0FA 1BIAA 1G7RA 4KO8A 2ZJ2A 2ZI6A 4RFSA 5KNBA 3QXJA 3FHOA 4EQ6A 4KICA 2C5LA 2ZYWX 4M9QA 4OINF 1ZREA 1J8YF 2CBZA 5J5CA 2GBLC 4QLCU 1TX4B 3RS2A 3V4FA 4JYCA 1B0UA 2LF8A 4M1KA 3ZMSA 5CM8B 1E1QD 1JGSA 4Q5IA 1XMIA 4WA7A 4ARZA 2GCOB 1MDMB 3BB1A 5BS6A 3OFNA 2O52A 4KFUA 2MSEB 3GFMA 4UJ5A 4ERNA 1MJBA 3RRMA 5KNDA 2XSZA 2IYYA 2OM2A 2GXUA 1KO4A 2C9OA 4TMVA 1VYVA 3BB3A 3WTTC 4JBWA 3ZD6A 1E9AA 3ECCA 2CWEA 3GFIA 4PQYA 5DEQA 5HLGA 5DYIA 1YS7A 3CUQB 1E9FA 2H7VA 1KI4A 2C6YA 1F2TB 1R5NA 4D0PA 1BMFA 2DHRA 3K53A 4PZZA 5DI9A 4DBLC 4GT1A 1W4RA 3FHZA 5D6FA 5F9FA 1E0AA 3Q72A 5F64A 3VODA 3GUDA 3I53A 2J5PA 5LRRA 3PV0A 4IDPA 3TE6A 4II7A 2HFHA 4Q7JB 1Z5ZA 5EXPA 4DCUA 2IVMA 4TYPA 2TMKA 3WNCA 3A1SA 2VO1A 3PUVA 4ESVA 2ZUCA 2HXSA 2R2AA 4IEEA 3JAMK 3RYPA 2O0KA 3LAWA 3W6JB 3WYAA 1Z05A 3L2CA 2HDCA 2ZJZA 1II8B 5J4HA 1JAIA 3ND9A 2IUTA 3VU9A 4ON9A 4EAQA 2QA5A 4BLOA 1XCVA 1YZLA 4IDHA 5SZIA 2NZJA 2R44A 1Q3HA 2IYTA 3DOEA 4Z2YA 2G6BA 4LV8B 5JMTA 3BD9A 3IHWA 4B43A 1TQDA 3KUCA 2WVJA 1VG9B 4XRFA 1C0WA 1KI7A 1RPZA 1P72A 1WP9A 3NC0C 1GUAA 1JXSA 2VL7A 1GILA 4KAXA 2GF9A 5E7JA 2VSXA 4V02A 2Q2EA 4RKFA 1ELOA 4IJAA 2PBRA 4TMWA 1I1GA 5CIQA 2AS5F 4URWR 4U00A 3SXYA 2EFDB 1KQ9A 2LDUA 3KZ1E 2REXB 3SE0A 3FM5A 5CLSA 2WICA 3O8DA 1BM9A 1ON1A 2HDNB 2NO7A 2BKUA 4PHFA 4YONB 2F2EA 1HY3A 2GIVA 1MRSA 2O8EB 1KGSA 3H86A 4F7WA 1R8SA 1NMYA 1G64A 2F3RA 4ZCLA 1KU7A 4ZYHA 2ZJAA 3A4LA 1UKVY 5DI3B 1CJUC 3SN6A 3G73A 2N1BA 2PX0A 4BE7B 4M1SA 4EJSC 2AXPA 4D4KA 5DCMB 3N97A 5IT9K 1SXJD 2ZEJA 1KO1A 2BV3A 3A37A 4G5GA 1EV7A 3BB4A 3ZQ6A 5AONA 5JHHB 4WCGA 2O8FA 5CJ2A 1SVKA 1N6IA 1T91A 2DZOB 3W34A 1G7SA 2F5EA 1QF9A 4RD4A 4HLUC 5FUWA 3KQKA 1P9NA 2W0SA 2ZI9A 3R0AA 1QG2A 2GAOA 2QTFA 3WMEA 3TSWA 5KSZA 2LSOA 1NG9A 3RIRA 4BHPA 2C2HA 4OK5A 2MD5A 5J8FA 2A7QA 2Q9CA 2X1VA 2WZQA 5JCZA 1DG3A 4ZYEA 1YQAA 4HDOB 1P2FA 4LSGA 3PXGA 3HRMA 1G8FA 4LJ7A 1W36D 4QHSA 4B3DA 4B3FX 3JVVA 5EXTA 1FQJA 2V7QD 1SFXA 1ZHFA 2J46A 4Q4LA 3ZQJA 3KQUA 3J81k 1F9NA 3RWOA 2OUKA 1JQJC 1MZBA 3EIHA 2FE3A 2IF0A 4QBFA 5AJYA 2WPDD 2C98A 2RV8A 3IC7A 4G94A 4EJSB 3WXMA 1G4AE 3LLUA 3SZPA 4GITA 5L3GA 1OIXA 2BVNA 2A5YB 3E2IA 1UADA 3WGIA 4QJ4A 3GLGE 1LY1A 3LO5A 5EP2A 2J7PD 5F1RA 1Y63A 3BE4A 3NH9A 1M1YE 1NG1A 4HOBA 1ZD8A 3P4XA 4KBFA 3FMOB 4ACAA 2H94A 3NBFA 2RKHA 3AVQA 4YMTA 4Q47A 1X1SA 2FX3A 1UKEA 3VR1A 4V0ME 4F4IA 5CJPA 3ZYCA 2DFNA 1P4XA 3A58B 5AJXA 4YXWA 5J4KA 4MDFA 2XB2A 1SMTA 1UF9A 3BERA 2HYGD 1SFEA 3E5UA 4HAMA 4PPQA 2FA5A 5CDFE 2TDXA 1UFQA 4NCHA 1QBKC 4YC7A 1IRFA 4Q19A 2W85A 2W24A 3B9PA 3JTGA 3QKTA 4K81B 3U3RA 3QF4A 4XH9B 4UNRA 3ICEA 4LJ5A 3GD7A 4PZJA 4JVNA 4PHGA 1UKZA 4TYNA 5DN6A 3MRSA 1W47A 1B9MA 5JBQA 1G8HA 1HT2E 1IM2A 4N9IA 1HW2A 2F3TA 2QP3A 5JS7A 2EJRA 4PGGA 4Q4JA 1E79A 1X8KA 3CR8A 4WXRA 4HDVA 4EJTA 1ZCAA 4J0QA 3SHWA 3I3SR 3TR5A 2E7XA 1OT3A 3KKQA 3MFKA 1E2MA 2VLIA 1EX7A 1G3IA 2OILA 2ZS9A 4URYR 2BM1A 1KO8A 5FLXK 4EPXA 1FX7A 4B3XA 4MHGA 1IF1A 1OIWA 1RIFA 1ZM4A 3FXQA 1SD6A 1ZM7A 1IAWA 4OQNA 3GVAA 2G7HA 3LH5A 2RNJA 1E4YA 5BN4A 1W49A 5FOWA 4RSGA 1CF4A 1WRBA 1LDDA 4DLSA 4I09A 3I32A 4OKSA 2JT1A 2DVWB 3QOFA 2IS1A 4DEYA 4L0ZB 1GXQA 2VOPA 1HE1C 1Z22A 4M22A 3ONWA 1MO6A 2ZAMA 421PA 1AQUA 1DAFA 2J0QA 4E09A 4BHBA 3LQRA 2F5CA 2QQBA 1TQPA 2KWIA 1FNNA 4KBGA 4C4PA 3THWB 1DG1G 2CL0X 1SVLA 2A5FA 2H1LA 2JA1A 1GXPA 3BBPA 4MITA 4HV6A 4ESBA 1CLUA 4V03A 5DE3A 4ASNA 5KU1A 1D8JA 2QTVB 1G7CA 4XSHA 4URXR 2E87A 3HRSA 3IWZA 5J8CA 2ESNA 4YFNF 2RHMA 3CPEA 4FXPA 4OYHA 4IOKA 5KO2A 3PQKA 1B4AA 1OH7A 3I5UA 2UZ3A 3B78A 721PA 1OH5A 4YFXF 1OHHA 2VHCA 4JLOA 4PSKA 3BP8A 2BGCA 2BYVE 2B8TA 2BIFA 2FSIA 3F8FA 2IK8A 3SQXA 1ZC3A 4BFUA 3TRFA 1X3UA 3IBGA 3CX6A 2KIFA 2ZROA 3ADBA 1BIBA 2XVCA 3TDZC 4Z8XA 1NLZA 2RB4A 1XXHB 3IDQA 2VC1A 5JVTA 3FX3A 1II9A 4PAOA 4QGAA 4QRHA 4TMKA 4HB3A 3RTRA 1LVAA 4S05A 4PANA 4BECA 5FTMA 2KKOA 4LJYA 5EE3A 4DCSA 2QE7D 3U44B 1IZ1A 5H6QA 4BLRA 2CSOA 3K69A 1S3SA 1C1KA 3AUYA 3RRNA 3WP0A 2K27A 3HOSA 1YZNA 2KBFA 3ZZTA 2GNOA 5FO5A 2IT1A 1UAAA 4IRGA 4S35A 1TNTA 4JT4A 4RGRA 2CLSA 2JJ8A 4X8HA 4UXIA 1ZMXA 5KK1A 2ZETA 2QSZA 3U2RA 2HEOA 3VKGA 1N5IA 2VP5A 4FINA 4CYMA 1FP1D 3KFWX 1R0XA 2FSGA 1RZ3A 2O8XA 2H5EA 3IO3A 4GP7A 3IEUA 3OIWA 4CVNA 3B82A 2ASEA 3CH4B 4LBWA 2H18A 4LI0A 4AY2A 3D7MA 3BFKA 3PENA 2AHOA 3M0EA 4A0HA 5E1ZB 1E2HA 2JLQA 2RGAA 2UKDA 4IPAA 2QN6A 2JLRA 4G01B 2IA1A 4RFVA 3TMKA 1JJ7A 2FDCA 4A12A 2YU3A 4MA4A 4L0YB 1YKSA 2QVOA 3KZZA 3AUXA 1TTTA 3VKHA 2ZI4A 5G40A 1NY6A 4QNMA 1D2MA 1R1UA 1Q0UA 3P9IA 4H9GA 3T34A 4BFXA 2XIGA 3JAMZ 2G0TA 2GJ8A 2ZSEA 2ZSFA 2CL7X 1QBJA 2QMEA 4I01A 4BXUA 4AKHA 2EFCB 5HDKA 1Z0AA 2EA2A 4TMXA 5IDVA 4XWAA 3WBJA 1EFUA 4Q1EA 3UG7A 3EZ2A 3WRYC 4BLPA 2ZE6A 1HKTA 5A2QK 2P5TB 4HI0E 4ZZLA 1XGNA 2WBLC 4KHZA 4DIEA 5DHFA 4BEBA 3IKTA 2VPPA 1J2XA 2IP2A 1ZNZA 3K9GA 3T06B 2NZ8A 4LY6A 4HF2A 4QJ3A 1Q22A 2QQ9A 3MUFA 1IAQA 2O0HA 5D3MA 2A2ZA 3QOPA 4MUAA 3WMGA 1W7PD 2A68F 3RPQA 1Z0KA 1XJCA 5LHHA 4R8HA 2OO7A 4QXAA 3FHTA 5F6FA 5CYVA 1ZYUA 3A1VA 3CNOA 3GJ5A 5LLQA 1USTA 4HA8A 2IYSA 2WAXA 5AJWA 3SHFA 2IA5A 4M9SA 1JXOA 1I1SA 4B76A 2HF8A 1VCMA 3IPXA 1T3HA 1I5ZA 1IXRC 3CBQA 2Q3MA 5JJIA 3TLXA 1KYWA 2K86A 2Y48A 2PLFA 4OJQA 3LW7A 1RNLA 5BYJA 5IT9Z 3K9TA 4DDVA 5FH9A 2EW1A 4RD2A 3SJZA 2ZKZA 8OHMA 1U5TC 2O8BB 2FNAA 3AVXA 2D1HA 4UHTA 1W4BA 3VQTA 3TJZA 2IEYA 4BQAA 4C9BA 4XD7D 4P4SA 5GJWC 3FM3A 2OA4A 4L9NA 3CX8A 2F5DA 2EWNA 4A1FA 4AK9A 1Q3TA 4GXOA 1O3SA 3T15A 1I4LD 2Z33A 1J59A 1Z2CA 2X2EA 5K8IA 3KXKA 4WXDA 2VODA 1RJ9B 5DYGA 1SD7A 3R7WB 1G41A 3AV0B 3D5LA 3M1EA 4ZIRB 2BDTA 1NKSA 1NVVR 3RS5A 5EUQB 3PJRA 1CP2A 3PEVA 1S7OA 3KB1A 5LBIA 1JPNA 2XNSA 5EXSA 2DT5A 1G9XA 3C4JA 4KVAA 4CXFA 1NIJA 1XD9A 3LBNA 1YRBA 2GCNA 4LJ8A 5K1YA 1SXJC 2HQNA 4XSGA 3KW6A 2MLKA 2LF7A 2OZ6A 2G77B 4YQFA 2K7LA 3ECHA 3DFGA 4RZXA 3I8SA 2CDNA 4KSBA 2B21A 3SFZA 3KQLA 2D06A 4JKYA 2ZTSA 3E1SA 1U5TB 3WNDA 1CF7A 1UFMA 2JLXA 4QC2A 5JWHA 2XAGA 1G3UA 1ZU5A 2XZPA 4Y0AA 1AS2A 1EFCA 4OHWA 2FBIA 4GCVA 1YRAA 1NJGA 2YINC 1NLYA 2P2LA 4S04A 2RKOA 3DMDA 1N5JA 1W36C 4QOSA 2ADUA 1XD7A 4BLQA 1D3YA 1KU9A 4D81A 1USSA 2REOA 3M4YA 1K78A 4JLMA 4TLDA 3LDAA 4N0DA 2EK5A 3RJPA 3RKWA 3V8KA 3ZMUA 2GK7A 1YW7A 2ANCA 1PP8F 2OEPA 5P21A 3F72A 2L54A 5HVQC 3CO6C 1J70A 4GOKA 3LWFA 1P9RA 1AKEA 1GL6A 1SXJB 2ODNA 2F43A 3D3QA 4Q4AB 4QM7A 2EU8A 2JLUA 3L00A 2XZOA 4U0WA 1IN8A 4C7OB 1RUOA 1W46A 1TW3A 1Z6RA 1QHHA 2BE5F 2X2FA 3KKMA 4A0RA 4C0JA 1U99A 1HEIA 1HA3A 5ED4A 1MH1A 2O8DB 3ZVMA 5UKDA 3DKVA 3Q9VA 1AM4D 2IXGA 4TQAA 1DTSA 5FLXZ 3AP2A 1L2TA 2ZRMA 5A0FA 2FPKA 2P0EA 1KSGA 1G8YA 3COAC 1W36B 4I1VA 3NKVA 2QAJA 1A7JA 4EM0B 3E5HA 2VH5R 1YZTA 2CK3D 3C5CA 4ENJA 1LV7A 4OHVA 4P4UA 3CIOA 2D7DA 1P7CA 5FUXA 5KSPA 2W6ID 2W6JD 3F6VA 2FV8A 5GADl 1W5TA 4N0BA 3T1BA 2ECKA 3T5DA 4L9SA 3J81K 5FTKA 2JPCA 2AWOA 4RD3A 4LGWA 5K5QA 5JSZB 3DXJF 3I72A 3ZPLA 1MRNA 2DO7A 2AN9A 1DS6A 1BO6A 2E7WA 4UVAA 1JEDA 2VQSA 2ZI7A 3LV8A 1Q12A 4NH0A 2F1JA 3EZ9A 4B32A 4EPWA 3GFJA 5AIPA 4ZDIA 4HQMA 5KVRA 3ISPA 4URUR 2RGXA 2Z6VA 4ITRC 2ZI5A 4AYWA 5IT5A 4HAUA 3I58A 1J2JA 2G83A 2XTNA 4MQVA 1HT1E 2PMKA 1OKKA 4L8GA 3EX7C 1BOAA 2XASA 3HU2A 4JL8A 4R2HA 3P7NA 1E2JA 1QZXA 4HAVA 5HE9A 2CHVA 1KQ8A 4B71A 2JZYA 3CNLA 3DQVC 1IONA 3U7GA 3EG5A 5CYPA 2EFOA 3GZ5A 2P7CB 4WK8F 3CDHA 1P4WA 1LS1A 5EXXA 1N6NA 1U0HC 2EFEB 2ATXA 3BH7A 3X1ZA 3SI7A 1FYLA 3L7WA 4FMCF 4NYMR 4LG0B 1E2FA 4IFBA 2ZJOA 1KMHA 1RVDA 2QMUA 3EASA 4NONA 3KQHA 1PLLA 4HSEA 1TF7A 1RE0A 3C15C 2E1RA 3DM5A 3EA5A 3K9NA 4NYIR 4XJXA 4YMSA 2GF0A 5BMZA 1XD2A 5B2ZA 2R8RA 4B2PA 1HE8B 3NQOA 3Q9SA 1E17A 3FMQA 1S4QA 3E6DA 4G6DA 1SZPA 2HV8A 2WIAA 3HR8A 4US2R 5JECA 2STWA 2VBYA 2IYWA 3KJGA 3UKDA 4D80A 1ZRHA 2ZRLA 4QGGA 4U0VA 1N6OA 3OFND 4PC1A 2QTHA 3RSOA 3TQFA 3VHXA 5C4MA 1KYIA 1H9GA 4H0EA 1DAGA 4EPRA 5ELXA 4O6JA 4UVBA 3K2ZA 1TNSA 1E2XA 2W2TA 3KLOA 1JALA 4M72A 4O0MA 1ZJ6A 3KB2A 4M9ZA 1Q1HA 3KTAA 4AG5A 4Q1DA 5EP4A 3EZ6A 4E22A 1RUNA 2HCBA 2JRTA 1QZYA 1R5HA 1R10A 5F2EA 3DO6A 2ZE8A 3AVVA 4PZYA 2AWNA 1FTNA 2KRKA 3ZVLA 4CEJA 1QZMA 2DFKB 3FHCB 3TUZC 2JJ1A 3QVVA 1CBUA 2E9SA 2IHBA 1SVSA 1E9SA 4HLYA 2V55B 3CF6R 3DEFA 3QE0A 3T5XA 4G7OF 4I81A 5A2QZ 3QU3A 4KFSA 2UXXA 3U3JA 2FQ3A 2W57A 4A0GA 1IN7A 1WBBA 1TAGA 2CNWA 2LKPA 2AK2A 2GK6A 3DM9B 3HIFA 2XHKA 1Z47A 4DNCA 2YOHA 3N5CA 5CIWA 3GJ8A 2ZU0C 4ZDWA 1OV4A 3GLFB 2GEDA 3KXLA 5FOUA 3WYGA 5KDDA 3CH5A 1R0WA 3AB3A 4IEIA 3DV8A 5FFMA 3MWJA 4I98B 5JFRA 1TUIA 3BFXA 3TO7A 3FKQA 4PSAA 2CO5A 3ERED 2C9YA 2VE9A 4DLYA 2EFQA 2R7FA 1CJMA 1L3LA 5CLLA 3VMFA 5HLIA 3H92A 2WV9A 1B6AA 1RZ4A 4N3NA 2DTRA 3PCRB 3A6PC 3QG5A 1Z3IX 5FPSA 3W6NA 1X3SA 1XPRA 2B92A 4KYIB 2ODBA 4NHOA 3S1AB 1S8FA 2GKSA 3QKRA 1GIAA 1IJEA 1ZC4A 1HURA 4V0KA 3MZHA 1E9RA 4ZH4F 3OV8A 3PG5A 4AWXA 1KSHA 1J8MF 2KIMA 2HJGA 3ZN0A 2VP6A 2YWHA 1P2TA
chains in the Genus database with same CATH superfamily
2CYCA 2WFLA 2PS3A 1DUVG 3CZPA 3KUKA 5ERIA 4KAAA 1ZIOA 1U3EM 3B52X 5GMOA 2FK8A 2ZBFA 2V4UA 2BFCB 4PQEA 3ESYA 3QNMA 3RU7A 5CFOA 3PXAA 3KRTA 5SZHB 4ZO9A 5JG7A 4DXAA 4C6SA 4KNVA 2UZAA 3DDOA 3DVSX 2CD9A 3C1UA 3VPXA 4H7JA 2Q0HA 3ELBA 3DLBA 1UPXA 2DAGA 2OCEA 3IT0A 3UUFA 4IS3A 1E89A 1HXDA 2HWVA 2VI6A 4A8HA 2VDLB 1C3XA 3QLEA 4UB6C 3QP9A 4XOPA 1LUAA 4DB4A 4RTSA 5AKZA 2QY9A 3GTGJ 1NLFA 5F3RA 1WI3A 4KJZA 3J81Z 4GPTA 4PZCA 1JG1A 1TT5A 5CB4B 4BXFA 3KSDO 5IJWA 4QQRA 3EAQA 5JMPA 2GASA 2AZ4A 4CU2A 4YP6A 5CVJA 4I5EA 4MQ9F 1HSJA 2YC2C 4NL4H 3FIJA 3FNRA 3N8IA 2PMCA 1W9HA 3QMPA 1YCGA 4QDOA 4PGHA 5KHOC 1ECFA 3KUUA 1CEXA 4MCAA 4DWVA 4QGFA 2K85A 3WDSA 3TO5A 4F4DA 1J90A 2J9XB 3DXXA 2Z98A 1PYOA 3LSMA 4FS3A 4AIKA 1BAPA 4DC0A 5KAMA 1YJAA 2HN9A 3RYHA 3UMRA 1YDHA 3V8VA 5LQRA 1A0OA 3KSBC 2QTCA 3PNTA 4E1VA 1WMEA 3K1TA 1NN3A 3GLKA 4KO1S 4XYBA 4WFIA 5D3KA 5CD9A 4XQ9A 4H60A 4PSDA 2PRSA 1WHCA 3TYXA 1PP7U 2X77A 4OSOA 5BUCA 3C41J 2GLTA 1VSTA 3FN4A 3RLFA 3RYCB 3WA6A 1X8JA 3GRPA 5E1WA 4IDEA 3P9RA 1HSZA 3I1JA 1NASA 3FNHA 3VX4A 3KS9A 3TAHA 5I9SA 3A3PA 1IZ7A 4IF4A 1F43A 4K6GA 3SYNA 5E8IA 2ONCA 1QIKA 2RGRA 3QP5A 4O4IF 1ZINA 3W6KB 4JJ6A 2FMFA 3C98A 1F60A 2Q45A 3FPSA 4BO1A 1UKCA 3AV3A 3WRXC 2L4EA 4KIUA 3SIRA 4UVIA 1T8WA 1LBSA 4DR3M 4I5FA 1EWTA 2HAEA 1YNOA 1OFCX 3LY9A 2XROA 3UCXA 4DAOA 4B2YA 3PNLA 4CHUA 2OU2A 1C9DB 3ER8A 2VR1A 4D0LB 3OEED 2PFKA 5JVGF 3R3ZA 4AWAA 2PPLA 4WZZA 1IUPA 1P9WA 4MKGA 1EFAA 2DB3A 3EETA 2QM8A 3DOCA 2QGFA 3NBAA 3GCMA 4EFDA 1M72A 4RAGA 3HO6A 4A5MA 1K3TA 3L6RA 1ZMRA 1RLUA 2R4UA 3DZGA 4BFYA 1MMGA 4MRMA 4DSTA 4POAA 4TZKA 2RC5A 4UDYX 1RBQA 4UW9A 4DV0M 3NVDA 4AU7A 5H3HA 3NRVA 4OMFG 2VTBA 3RREA 4A2UA 5B57C 3L2AA 1Z3CA 3ABSB 4W5NA 2Y99A 2VP0A 1O54A 3VR6A 2RCYA 1UQTA 4JI7B 3ULQB 3EEFA 4E03A 2NXCA 2QRZA 4RH0A 3HDYA 3N87A 2Q1XA 3PHBE 1GQ2A 4JFAA 4K6OA 3H3ZA 1O6CA 4PNZA 1RR7A 5C81A 4HQFA 3QXHA 2XSDC 1XZCA 3OYCA 3AR2A 5THQA 3E97A 2N3ZA 3JYNA 3X1XA 4AUEA 5U4QA 1WDMA 2JJ1D 1JHHA 3I4NJ 4B4OA 1TXGA 1QM5A 1FDVA 1ONVA 4GYGA 2BEUB 1ES9A 3SLGA 4CLOA 4XDZA 3ZG6A 4CG1A 2H7CA 3AG2H 1BGXT 3PF9A 3HRUA 2F3SA 2XT9A 5KO3A 1B00A 5CFZA 5AVRA 1K66A 2P3LA 2Q3FA 2V6BA 2QRKA 5AFSA 1ISPA 4LBYA 2PE5A 4NXMM 2ZSDA 3GEPA 2ECCA 1GZ6A 1A9ZA 4AMBA 5AI6A 4TZ0A 3PS9A 1O94D 4Z0HO 2NU7B 1ZRMA 3PPWA 2QTBA 4D5FA 3S1SA 5FEMA 4U7FA 3P5BA 3E9DA 2R7KA 5MF6A 4EUSA 2VKHA 1FOWA 1PD1A 1JFFB 2DLCX 1WCMJ 2DY0A 4PZEA 3IV6A 4LSMA 1EWKA 4RXMA 4I4TF 4GFDA 1PDOA 2BFFA 3IIMA 4HEA2 1UBGA 2JCBA 2XB9A 2D5LA 3KZVA 3AM3A 1L9XA 3KS4A 1P2DA 4JQFA 2GDJA 1Z7BA 3AUFA 3GEHA 4WGGA 1N75A 4QARA 2JHCA 1Q5PA 1B8IA 1W9MA 1NF3A 4R4JA 1M6YA 1PL7A 3RKSA 2IPXA 4UEWA 3JTMA 1ZWLA 2HBZA 3EZLA 2QJRA 3P19A 5CMLA 1QGYA 3TZEA 4D9NA 4ERXA 5K8JB 3JQGA 1P5FA 2ZSHA 2MW8A 4PXSA 4YAEA 3I9MA 2VUHB 1JHDA 4Q01A 4C7MA 3IAM2 1DKRA 3NBUA 2AR9A 5AH0A 2B36A 1XF1A 4FCCA 4CCWA 4MV5A 2DZLA 3KYJB 3QEKA 1XNQM 4DLUA 2IEDA 4P4TA 1ESMA 4YPOA 3AHIA 3IIJA 2JK3A 1RWXA 5CBPB 3GT7A 3OSUA 3FRJA 1Y3AA 2OO9A 3L2WA 2GS9A 2AXQA 1WEKA 1T0FA 5E79C 1PJLA 1KI6A 5FFZA 5LEJA 1JTFA 5HZKA 1WZIA 1SUSA 4B0PA 1UC4B 3CNQS 4AY5A 4M3EA 1Q1ZA 1MEEA 4KE9A 3VH1A 3KOYE 5K6AC 3GARA 2A9VA 1RWQA 4TV7A 1TM3E 5MN5A 1BMTA 1T2UA 1GPLA 1TK9A 1U8CB 3DDZX 1OFIA 1XD2B 2FQWA 5G0WA 1ZGWA 1NBME 3HBFA 3BUSA 2AI1A 3ZLVA 4WL0A 5D2CA 1P2VA 3M9LA 3QPAA 1BG6A 3DU5A 5FR2A 1PV1A 2RI1A 3ONFA 1T0IA 4KZKA 3R76A 1I1HA 3N4MA 2ZC2A 3PT5A 5HDNA 4U02A 1EEHA 1N7HA 2A5WA 4BKOA 2BFEB 1YQXA 2QM7A 4B85A 2HGCA 1MMDA 4I1IA 3IP3A 1C0LA 1Z6YA 4AWXB 1O3YA 4J16A 2IXAA 3LF2A 2H4YA 3H2IA 4G84A 1LX6A 4GI7A 5KEIA 4BFTA 2ZE7A 3I9NA 2DJ5A 1QNFA 5FKJA 4DT1B 4LFUA 4HFJA 1EJ6A 3K5IA 1DTWB 1N2XA 2DCUA 2PQMA 4OU0A 4BL0B 4P5EA 3W9BA 5AESA 4AI6A 4FQ5A 4XUEA 5FBRB 2O2CA 4XCVA 2AOTB 3ILSA 5J58A 1RCTE 1MQAA 4ALLA 2ODEA 3DXFA 3FOWA 3Q98A 3FSJX 2R8ZA 4HS9A 1CUJA 2O1WA 1NP3A 4P6VF 2QRVB 5I3ZA 1E6LA 2C4KA 1JLRA 2FH5B 5FWYA 1CXZA 2QD5A 2JCGA 2L0KA 5G2OA 1A6QA 2IEZA 3FCCA 3VDPA 2H08A 1PRYA 3PD1A 4OVKA 3HVKA 4UMFA 1WQ2A 4WLOA 5FOVA 1S6YA 4DGSA 1A1SA 1RRJA 4M83A 1B1AA 2AZTA 3P0EA 1ZGGA 3KD3A 4GUDA 4JB3A 3RFTA 4JIMA 4JMLA 4C0QC 2DPYA 3ZU3A 3OYFA 2ONKA 2QG6A 3V4GA 3LG2A 1CY1A 4KH1A 2I1QA 3COYA 2G7ZA 2BTQA 4RA6B 2DUJA 3TOSA 1RAFA 1U0RA 2QZ4A 3DZDA 2JKVA 2BJVA 2I6SA 2QZSA 3A7DA 5JS8A 3AG1H 2CXOA 2AUMA 2QF7A 1ZOLA 5HS4A 1F1ZA 2IC5A 3HBLA 3GGGA 4RLSA 2F4IA 4LHVA 2BFAA 3JR3A 2VHUA 3L3BA 1K7AA 5J1UA 3NONA 3FRHA 2UV1A 2ZTDA 1S8NA 1NJ6A 4XKBA 4MQEA 2A9RA 4OAPA 4WFQA 2XUGA 2Z3YA 4AX8A 5C0OE 3UY4A 3C7AA 4MKFA 5BNTA 2UXDB 1KK1A 4TSRA 1M8KA 5E18F 3PHHA 1IY8A 3TQHA 1D7OA 4BJ1A 1VJCA 2GAIA 1CY2A 3E6BA 4GMXA 4DUPA 2VP3A 4O4LF 1LQ1A 3C16C 3U9LA 3HEFA 1W0KA 2DUUA 5AOAA 3K7AJ 2GM3A 3EPJA 2FX2A 4CKWB 3LUCA 4PEVA 1WHTA 2X5KO 2ZJYA 1V2GA 4EHNA 1LK0A 1MA3A 4QYWA 2VATA 2PQ8A 2YQZA 2X19A 5A7FA 1UJ5A 5JH7B 4IX7A 4H17A 5KU7A 3KWLA 4X6XA 2AFVA 4KUEA 4KFTA 1TWGJ 2HSEA 3SQNA 1NE7A 4V0QA 3ENNA 5EN4A 3DBLA 4IHYA 5E95A 1RKVA 4IQ8A 2DEUA 3IP9A 5DF1A 1EFVB 4AF8A 4Y6SA 4ZQHA 1L6IA 1R8XA 3UAYA 1U3FA 3CURA 4XLFA 4YH1A 3DA8A 2GTPA 4HAXA 4XKVA 1E1DA 3VUEA 4QXMA 3DONA 3I8OA 1WP4A 4XWTA 1K6MA 3QELA 4E2FA 1OILA 4BP1A 4BNFA 3W4KA 3TVYA 1GVNB 1NN1A 1US8B 4HVAA 4HAWA 1EBUA 3A01B 4Z4QA 4B3MM 2WKQA 3K6RA 3KCCA 2NUTB 1BCSB 3KKZA 3HWSA 4Q4AA 2FQ1A 1N9GB 5E0OA 4D7NA 5E17F 2IPNA 4NCAA 2XQKA 1A35A 1M8PA 5FUMA 1I3KA 4AUXA 4OHBA 3ED1A 1I1QB 3I2KA 2V7QA 4EJ2A 5EMJA 3WAGA 1JMVA 1SUFA 1E1CA 5KPDA 3KP6A 4UNOA 4YDRA 1N5MA 1N6PA 3O8CA 1SBNE 4MTCA 2NVWA 4I02A 1NYLA 2O0JA 2OUIA 3CE6A 3FNFA 1RACA 1C1DA 2ZI3A 2AC4A 1U31A 5AW8A 4ENQA 2KNZA 3UTDA 1V2HE 4M9XA 3GJ6A 3HJFA 1ACLA 2QSYA 2FUKA 1JKIA 1AK9A 1ZJYA 1IWPB 2B1IA 3AFNA 5D3QA 2ZB8A 2AYYA 3LHSA 3DAGA 3KXEC 1DEAA 4L8LA 4LSWA 2HRQA 1C81A 2AXNA 4X5OA 2FUEA 1ZH4A 1YUMA 5IHPA 4EYOA 4BV3A 4EJFA 3KT6A 1KSFX 4GIPA 2WZCA 4BJ5C 4BBZA 1Z77A 4GR5A 3URMA 4B73A 1BW9A 5DYYA 5BNFA 3I5AA 1CUWA 3NR2A 4JX8A 1IN6A 3A1UA 2JIZD 3I9JA 1DMRA 3DF7A 5FGMA 2ZUEA 3FNGA 1RYYA 5AVSA 2J6BA 4CTKA 1R64A 2KJQA 3PQ7A 5JHGB 4F5YA 2B2NA 4CDGA 3OIDA 3ND5A 5KPTA 4D6XA 1HR0M 2QIPA 3HHGA 1TO6A 2GNPA 4A6XA 2G8LA 4PU0A 3THYA 1IVYA 4ME6A 3KJIA 4AKIA 3BR0A 3VSCA 2NUPB 3MMXA 3NVAA 3OLQA 1HQCA 2DPMA 3CCFA 2FNPA 4HUQA 3RIMA 1EFLA 3L8HA 3EPPA 4PFKA 5EJ9A 2O5EA 1NJ5A 5ALNA 1H88C 3HJEA 4HDNB 1MNQA 1NQAO 2HKIA 3Q0TA 1T9BA 4AS2A 4DV7M 3PC8C 1S01A 5C8XA 5G53C 2GCPA 3PVSA 3RF7A 2XZFA 4NBQA 3DAYA 4PX5A 1GU1A 3HV2A 3AFIA 4INOA 4OIFA 1GCUA 2RGWA 5L3QA 3SKVA 3RVMA 3PHJA 1JS1X 3LPDA 1EYZA 3GO4A 1B1BA 1VFCA 1UFRA 3IRRA 1X58A 3WOHA 4DR3B 1S0UA 1ANKA 3B1WA 3AERA 4JVMA 2C5EA 2B3DA 4WEOA 2VTKA 3JRDA 4R5MA 3ASUA 2YVAA 2K9LA 2DFIA 4OFBA 1MZPA 1QVWA 1DAKA 1OGJA 1HMYA 3ORRA 5CUQA 3B6CA 3NW9A 2HA2A 4RPKA 1BI0A 4E7OA 4BEVA 4EB6B 3BK1A 1R6XA 4LF6M 2ZI6A 3QXJA 2C5LA 3I39X 3U37A 3O4GA 1JIJA 3S8EA 3NAZA 3SYMA 5KNDA 4DV0B 5KWEA 1O96A 2HK7A 3T5AA 2HCTA 2D7GA 1W4RA 3K9WA 5CW1A 4IDPA 2Q5OA 3E9NA 3ZD8A 4TYPA 3R6DA 3BIJA 1VI2A 1YIJI 5DLEA 2PSEA 2RJNA 3CN9A 4S1WA 2M2IA 4MM3B 3KZNA 4LV8B 4P34A 5FULA 4INZA 2PBRA 2KDLA 4U00A 1Y34E 5DEOA 3SE0A 4RTPA 1N2SA 1U9NA 3IV7A 3BFJA 3CISA 5LFAA 3U0BA 2BFDB 4MAMA 4PWYA 5AP9A 4X71A 4QHSA 2CLHB 2ME6A 3RZDJ 1ZHFA 4B83A 3UK1A 1IC6A 2IXTA 3WU2C 4EJSB 1ONOA 5C7YA 3F5DA 3IBTA 3H3VK 1NU8A 2ZYDA 2H7YA 4JV5M 1XQ9A 4YMTA 2FX3A 4ONEA 4V0ME 3IMKA 1P4XA 2RDMA 3S4YA 1FYXA 2XUDA 4PZJA 4DIBA 1Z5VA 2XNJA 4V38A 4I0WB 4Q4JA 4RCVA 4J7CA 1GEGA 3I3SR 4KXLA 1WQ4A 5ALXA 2DHYA 5JAMA 2BM1A 3JYHA 4MHGA 1I13A 4HWPA 2Z3ZA 1PRBA 5ALZA 1ZKGA 4TKMA 2FKNA 3VNBA 2POQX 2V9ZA 3I32A 4OKSA 1X7DA 4ZFNA 421PA 1AQUA 5HX7A 1QP8A 1YA4A 2JA1A 1SUCA 1NQ5A 1QO9A 4RM3A 2FWBA 3LSYA 4J00A 4IKFA 2NYUA 1G4HA 3KOXE 4N5DA 3IBGA 1Y6FA 3ZHZA 5CLFA 1D1TA 1T2FA 2JJ8A 1ORIA 1ZMXA 2ZWMA 1THZA 3WIBA 3ZE8A 2IW1A 3IO3A 5CLGA 2H29A 2RFLA 1XRPA 2W2PA 4MA4A 4TVBA 4EM6A 4X41A 3WFIA 1Q0UA 2W2KA 5D00A 3NP9A 2UUZA 4LHSA 3C6XA 2P5TB 1Q3CA 4JBHA 2O0HA 1XNQB 2JFNA 3QVJA 3PR2B 1O9GA 4TS9A 3A6LA 3AY6A 2LH9A 3GBGA 1OZHA 2CB9A 1VMIA 5AJWA 5K3DA 1JXOA 5FJJA 1RQXA 2I3DA 2CUJA 4OJQA 4R8LA 1RNLA 4TXJA 4QELA 5TR9A 1W4BA 4XD7D 4P4SA 3PWZA 4A1FA 2P3QA 1IDYA 3H2HA 4IR7A 1XZDA 4TTSA 2M6LA 2UVPB 2XNSA 3FAZA 4IJ6A 5HUQA 2HQNA 1W30A 2B35A 3L8GA 1WB5A 1TIBA 2QRPA 1A98A 4RZXA 4IX9A 3B7NA 2ZTSA 3X43A 3WICA 1AS2A 2E0IA 3VZSA 4GCVA 2BHLA 3TQTA 1R4NA 2MINA 4X7MA 2CV0A 5BPFA 2PYIA 2DLDA 2L54A 1J70A 3D3QA 4X9XA 1XK7A 3KT8A 4K9MA 1Z6RA 3KG2A 1X7YB 4K9SA 1XTUA 3UK0A 5FLXZ 2G4LA 2X6YA 2BR5A 4BE1A 3QEBZ 3QJGA 2JPCA 1QIDA 3M6IA 3MJTA 5HQTA 1AIPC 3TZQA 2F1JA 4UHJA 2ASVA 3OY9A 4HAUA 3EX7C 2PMKA 4NS4A 2XASA 4R2HA 2K87A 4RL6A 4D8WA 4B71A 5LLTA 4YUWA 3LOPA 2JCYA 5EXXA 3PWSA 1Z4KA 3C6BA 5D85A 1TC3C 2PG3A 3S81A 5AKGA 1SZPA 1L6RA 1X87A 3HR8A 2VBYA 1C7IA 1AKHB 4HDMA 2QTHA 3EY4A 3JXEA 1QRTA 3K2ZA 5FNZA 3CRNA 2WIKA 4Q1DA 1BA5A 2FG7C 4FEYA 5F2EA 4LG2A 2ZE8A 2E5ZA 5FSWA 3C5VA 1CBUA 5B7GA 1WDWB 3NNNA 3ENQA 4I81A 2ZAGA 2N9UA 4G25A 1NQUA 2AK2A 3KIOA 4DNCA 5AVWA 4TUYB 4DSZA 3ZQLA 2ID8A 5A71A 3AB3A 1VI5A 3MWJA 4OA8A 4DFDA 3W6NA 2VJAA 4KYIB