2QBYB

Crystal structure of a heterodimer of cdc6/orc1 initiators bound to origin dna (from s. solfataricus)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
368
structure length
368
Chain Sequence
KNPKVFIDPLSVFKEIPFREDILRDAAIAIRYFVKNEVKFSNLFLGLTGTGKTFVSKYIFNEIEEVKKEDEEYKDVKQAYVNCREVGGTPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIRAIIYLDEVDTLVKRRGGDIVLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEYGLIKGTYDDEILSYIAAISAKEHGDARKAVNLLFRAAQLASGGGIIRKEHVDKAIVDYEQERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISELDMFGIVKIRIINRGRAGGVKKYALVEDKEKVLRALNETFEDSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Replication/dna
molecule keywords DNA (33-MER)
total genus 112
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09079 Cdc6_C CDC6, C terminal winged helix domain
B PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2qbyB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qbyB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qbyB02
1B9NA 5FFXA 3RTRA 4DLXA 2CL0X 2EA2A 5DLQC 3E3VA 2IHBA 1LW7A 1XTQA 4Q7JB 5JEEA 5LB4A 3TVTA 4EJVA 4Q1CA 5ELXA 3B73A 4CDGA 3LX5A 2Z3YA 4HAXA 1BI3A 5DH9A 2FF7A 2OBPA 2HTSA 2QQBA 1T39A 3U3RA 1ZM4A 2R7DA 5J40A 4B6EA 3VOEA 1N0VC 1GOTA 2Q6TA 3GJ5A 1CF4A 2B0LA 1FWZA 1GZSA 1HEIA 1W36C 3WMFA 1T0HB 4MH0R 2UXXA 1NY5A 3R8FA 4TQ9A 1KMHA 5FPTA 2IVMA 4A6DA 3SHWA 3IILA 1LV7A 4CEJA 2XROA 1XEWX 4LJYA 3WTUC 3MWLA 1NY6A 2BMJA 4LRTA 3NVAA 1ODFA 1E98A 3HRMA 2O8CB 3FMRA 2C6YA 1JJVA 4DZZA 2OAQ1 1VG1A 4C0JA 4BEBA 2YINC 2EU8A 3NH6A 5ILVA 2QE7D 5FOTA 4C9BA 2ZYUX 3BE4A 3BK7A 4A5NA 3P32A 4KAXA 2G6BA 5IT5A 4C0AC 221PA 4M2LA 1HTWA 1RRGA 2OHFA 4TMKA 3SE0A 4BFYA 4Z51A 1YZGA 4IEIA 2OD5A 2V9VA 3U44B 1US8B 2BVNA 1EFTA 2NOAA 5BQTA 3HOTA 2XV4S 5BYKA 2RHDA 3QKSA 5FUVA 1TQMA 2VC0A 3C14C 2XOKA 4LJZF 3CPEA 3IEUA 4WZBE 2JSCA 5JVTA 1NN1A 4FMCB 1QHHB 2EYQA 5EJEA 1X8KA 1KSGA 1TQPA 4I98B 4LPSA 2VH5R 2NMVA 4F92B 1UM8A 3ZMSA 4EM2A 3U2RA 4EMSA 2VOPA 1ZUHA 4O5VA 3FXUA 3NQOA 1TF7A 2NG1A 2VP9A 3KJHA 2BIFA 4NE2A 4QHYA 4AYXA 4G9YA 1R8SA 1NRJB 3K0EA 4X8MA 5J6XA 4KFCA 2C77A 1L7VC 1JR3D 2ZJBA 3IO3A 3L0OA 1IXSB 3Q9VA 5D8KB 2ZRIA 1J90A 5EXSA 2YSRA 4UV9A 4DLZA 4BLOA 4KYWA 4M53A 1KU2A 2Q0OA 5LGUA 5LGNA 2RGDA 1YIOA 3GCGA 2FOKA 4FMBB 5DI9A 1TX4B 4M74A 2YWGA 1E96A 2HCJB 2DPDA 1TPZA 3VMFA 2P5SA 2IS1A 4GP7A 1QHIA 2QVOA 1FOKA 1BYIA 3DDCA 1Z63A 3SYKA 1RI7A 1B1BA 2OZ6A 1G8PA 1RE0A 2V6IA 2V9PA 2ZU6A 4LYFA 1S2MA 2M87A 3RI4A 3VHLB 3J80Z 4XVUA 5A5GA 1PUJA 3VAAA 4BLPA 1CR4A 2FG5A 2WC2A 3CO7C 2XSZA 5J4YA 1W4MA 3UKDA 3BWDD 1FLIA 1KIMA 3EYIA 1G7CA 1XPRA 2QQAA 1WCV1 1KK2A 1YHNA 3QAHA 4A0RA 4ESBA 2R6CA 4OQLA 4L9TA 1JAHA 3UG7A 4YMVA 3E6CC 1W4RA 3A6PC 2CEAA 4ZPXA 3IRRA 2AKAB 4B2LA 4EFMA 4P55A 4HF1A 2HQRA 121PA 2GEUA 4HAZA 1JR3E 2OBLA 4JLBA 3W9YA 1FX7A 4Y0VA 1TAGA 2C95A 1LEAA 1KYIA 4U88A 3SZTA 1KY2A 2GTPA 2HYDA 3B82A 3FVQA 4PPNA 4ZO4A 4DDVA 2R2AA 4A92A 5HE8A 5KK1A 5DDGA 4D80A 1KDTA 4RY2A 2R6GA 4DEXA 2ZRHA 3RKWA 1CU1A 3IPYA 4JBXA 4PXAA 4N0EA 4PPGA 5H8WA 2QTVB 1Z1DA 3CBQA 4MITA 2F1RA 4GXOA 2ORVA 3FOZA 2EWWA 3HYIA 1XCMA 2W6IA 4HUQB 4QC2A 4JLDA 1TQ2A 1XJ0A 2FH5B 1I2MA 3F3YA 5H6QA 4L15A 3CF6R 5HCNA 1IN8A 2O8BA 1V4RA 1RNLA 3DEUA 3KEQA 2GBLA 2VYFA 4XTRA 3DPTA 1PLJA 2DVWB 4YDSA 3S1AA 3LXXA 2XAQA 4BEJA 3JSPA 2CNWA 3CX6A 1FQKA 1OW3B 5LB2A 3RS2A 4BFVA 4JBYA 2HXYA 2VSXA 5L8VA 2OT3B 2XZOA 2ZUDA 3LFKA 2OZEA 4LBZA 4PAMA 2FSGA 3THOA 1O87A 1ZHFA 1ZD1A 1NLYA 2QAGB 5IK2A 4C30A 2Z99A 4PAQA 2XUBA 3REFA 4ZIRA 1SVKA 1HW5A 3CPJB 2ZU0C 1L4YA 2QPAA 5DN6D 2VHUA 1HYQA 2A5JA 4P4SB 2XKPA 4ZKEA 4BHBA 2HF8A 2IK8A 1Z6GA 2Q9BA 4JLVA 4JIMA 5L3RA 4Q4AA 3QEOA 4ILEA 3EA0A 2VBWA 4B3GA 2F1IA 1DVRA 4RFSA 4RGRA 3V00A 3GFIA 3BJOA 4LJ7A 3KKQA 2QMUA 3WTWC 1RVDA 2WSSA 5DI3B 2BMDA 1R5HA 2KKOA 5KNDA 4LYAA 1XD2A 5CJPA 5D5WB 5UKDA 4AIJA 2P6RA 2GJSA 4Q1AA 4UVBA 1DUXC 1QVRA 4Q01A 3R0JA 4QLCU 4KN4X 1OR7A 3EZ9A 3NTUA 3QPVA 4L9WA 2RGGA 1DO0A 5EEHA 5ILSA 1YTYA 2JLQA 5FOWA 2LSOA 4NCNA 3KZYA 1PJRA 1NN5A 4F7WA 1O7LA 4K2EA 1M6NA 2PQ8A 1CF7B 1E9CA 3AVUA 4GGGA 4G01B 5LEJA 1OXVA 3U5ZB 4EDHA 4IXMA 4AYTA 3DKPA 2OCPA 2JIZA 5FPSA 2WJGA 4C0KA 1UPTA 2XTZA 5CK5A 1Q22A 2Y48A 5BW8A 3WG9A 2GWRA 2QN6A 3HHHA 1WP9A 4D0LB 4JBAA 4MQVA 5KNBA 3F8MA 1HKQA 5L3QB 4H9GA 4Z54A 3GEHA 3M0EA 3BFXA 2UKDA 3VFDA 1J70A 1DG3A 2KI5A 4KBFA 4NP6A 1R23A 2FRHA 4HYEA 3M9AA 4M4SA 4MRRA 1U8YA 1XTJA 3MCAA 4JN6A 2W25A 4RB2C 1G3TA 2B8TA 3TGNA 2R9VA 2C99A 1K78B 3DOEA 3MAJA 3IKJA 2X77A 4Q7MB 4TSFD 4I7HA 1U99A 2EV6A 4NQWA 1HBXG 3NKVA 4TL9A 5C2JB 1LY1A 4M1OA 3P4XA 1XCBA 4P33A 4P31A 2FBKA 2Q9CA 4TL6A 4IDNA 3R6SA 2QSZA 2Q21A 2CG4A 1W0KD 2ZTSA 4PZZA 1ON2A 2XX3A 2CHQA 1LNWA 1AQYA 1TNTA 3U6KA 5AJVB 4LCBA 1SMYF 2WWXA 2DZNB 4PHTA 2WZQA 3T12A 2LKCA 1XEXA 2PT7A 5DYGA 3ZMDA 2ZI3A 2QENA 4AG5A 3RYRA 3BOQA 1QDEA 4QGHA 4TTPA 5CIQA 3TGPA 2HWVA 4B76A 2JLXA 3KP6A 3TNFA 2CCGA 4QJ4A 4CXFA 2D7CA 1VHLA 1P61B 2WSMA 4V0ME 2G9NA 3T06B 1UF9A 3F3XA 3AM1A 1V5WA 1I27A 1QZYA 4OI2A 4AKHA 4HF0A 2KJBA 1T8TA 4IDQA 4UHTA 4BLRA 2H5EA 1TW3A 2JT1A 1W36D 1Q1QA 2B7BA 1J75A 5AUQA 4FWDA 4RS8A 2QAJA 1GM5A 2V3CC 3WTYC 4I1SA 4IRGA 2H57A 3W5IA 3FF5A 2L54A 3I53A 2PZFA 1A1VA 3RS4A 3KXLA 4DB2A 3NBXX 2EFQA 4NKRA 2F43A 1IW7F 1KSHA 4PO9A 3REOA 3HYRA 3TMKA 3FHOA 1E0KA 4TV7A 4DEYA 3ZQJA 3O8RA 2R6DA 2QQEA 5IHPA 1VG9B 3T15A 3KL4A 3RC8A 1SFEA 3LH5A 3T8TA 5EXXA 3THXA 3ML6A 4S05A 1T2KA 3UXMA 3BOSA 2HUPA 2ZYVX 4RSGA 3G73A 2ACJA 4ENJA 4Q5SF 2ZXJA 1W49A 4LJ8A 2VODA 5SZHB 1FX0B 4HUTA 4Q1DA 2JLZA 4TZ0A 5JFGA 2NAZA 1L2TA 2MMGA 3KUDA 3RYPA 4WCGA 2P7VB 3P9CA 1KHTA 4KNYA 1TQ6A 2IYTA 4IPAA 4MEYF 5L3DA 1ZM9A 4GZMA 3X1YA 5JWRA 4BRWA 4OI1A 3GLGA 2ELHA 2EW1A 3AVQA 1G41A 1T5IA 1LF0A 1YZLA 3CNOA 3FX3A 3GD7A 2VC1A 2CLSA 2EB7A 1D2EA 4K46A 3WMEA 4CT5A 3IQXA 1JNYA 1N6NA 2J3EA 3VTKA 5IK2D 1I1SA 1J8YF 3BJIC 4FWIB 5ANRB 4EQ6A 1QG4A 4B3CA 3AB3A 3PQCA 3KQLA 4KU4A 1YU9A 4Q21A 1YG2A 2XASA 1J59A 1QQIA 4PX9A 3H3ZA 1PLLA 1Z0FA 1JEDA 2P7CB 4OI0A 3E70C 2GZAA 1ZINA 3GFMA 4URYR 4YDHB 1KJYA 1XSDA 1OYIA 2XB4A 1FP2A 1U9IC 5GJWC 3EW9A 4PC7A 2YX4A 3TQFA 4KFSA 3ETLA 5D5VB 1S7OA 1S3GA 3QEJA 1WBDA 2FDCA 3WNDA 1N0WA 2RGAA 3MWKA 5DCMB 1G21E 2HEOA 3GW2A 2XIGA 2OESA 2X2FA 2DYKA 2ZREA 3I1FA 4NYMQ 4ZKDA 2QROA 2AK3A 3LRPA 4GMXA 3QQ5A 1TMKA 3LW8A 2IP2A 4QGGA 2YVUA 1GNPA 1R7RA 2ZNZA 2FOLA 1H9TA 3Q7QA 2OCYC 1K8RA 2Y75A 1WXQA 4FMCF 1NVVQ 1Z22A 2XAFA 3TOAA 1GP2A 4JKIA 5BQ5A 1VKJA 4BASA 2K02A 1W0JD 3MWYW 4B35A 2WHXA 4MEXF 2P5TB 2PH1A 3IKTA 2PLRA 4PFSA 1E1RD 2WWHA 4A2QA 1RZ3A 2VA8A 1J2JA 2DPUA 2N42A 2BBSA 1ZH5A 1GL7A 5CLLA 5JHHB 4I09A 1FTSA 2FMLA 4CGZA 5F9HA 5JFRA 4MQBA 2GAAA 2M45A 3UMSA 4MGKR 3I54A 3MEXA 1KI2A 1H8EA 4P3YA 1EWRA 2QAGA 3U61B 3LWNA 4DSOA 3GLGE 3QPTA 3F22A 1PUEE 6Q21A 2QAGC 2Q8KA 5LHIA 2XB2A 3U4QB 1EK0A 3HRTA 5FL7D 4ZYDA 1J99A 1ZRFA 1R2QA 1T8UA 4P4SA 4I02A 3TE6A 1BYUA 3AP2A 4FWTA 2CHGA 1E0JA 4HV6A 1D9ZA 5HLGA 4ARZA 2WJIA 1KA8A 5E17F 4KMUX 4R79A 2IT0A 2ISZA 1E69A 2F7SA 2I1QA 3CR8A 4U5XA 4BFXA 3AAFA 1YO5C 3KEOA 3K0AB 2V7QA 5ICCA 4WK8F 1UEJA 1Z9CA 4KSCA 4FX0A 4HAMA 1ZW6A 2V1UA 2VQSA 3Q72A 4LV6A 3I58A 2BEJA 2YKGA 4OQMA 3QU6A 4DIEA 1E3MA 1GRQA 4NB5A 1W44A 3KLOA 1MO3A 2Q3FA 2V1XA 3TO7A 4HZUA 2AD1A 3MMPA 2ZRAA 1U8RA 3NXSA 3KQKA 3DO6A 4EJSA 3WP1B 3W6JB 2ZYWX 2GJ9A 1LFDB 2X8AA 1P2FA 1FMJA 1ZNZA 4I1VA 4QHTA 2QRNA 2WIBA 4RD6A 3EETA 1BI1A 1KKLA 4BFUA 2KRFA 3GLIE 2ZNYA 2ZRFA 2HT6A 5D4RA 1HW1A 1JR6A 2F55A 2PEXA 4OIPF 5H70A 3PITA 2EJRA 1XMJA 4I99A 5HR5A 2J5PA 5HDKA 1B6AA 2LF7A 1MO4A 2SHKA 3CUQA 1NVWQ 1P72A 2WSSD 2KIFA 2PX3A 3FM3A 2QE7A 3AGPA 3IHLA 4PO8A 5KNCA 5C1BA 2QORA 1L4UA 1P3JA 4M6YA 1CJUC 3KDSE 1H9GA 1G7TA 2R44A 4DJTA 3RS5A 2XGXA 3GLXA 2OU2A 2BC9A 2QBYA 2J0UA 1D5VA 4MGIR 5DIFA 1YR9A 3S1AB 2ZSFA 2FEZA 1RYFA 1X86B 4LBVA 1OH7A 3WTZA 3QENA 4A36A 2IUSA 2Z5FA 5DN6A 4W5WA 1ZRHA 4OOIA 1QHGA 1VDZA 2V6CA 1DDNA 2QZ4A 4XLPF 3KCCA 2M30A 1R10A 2F9MA 2A3SA 2VRWA 3KXKA 3Q5FA 1LVGA 4AK9A 1HQYE 3W34A 3THWA 3K0SA 1KNQA 1N5LA 1G3SA 4L0YB 4A6XA 4BLQA 4EPWA 3TR0A 4E5UA 5AJZA 2FX3A 2QYOA 4HLUC 3FDIA 4M1MA 1P9WA 1W48A 3AVPA 3AVVA 4LFUA 4ON0A 1OXTA 3GZ6A 1VYUA 3EUHA 2AN9A 1IHUA 3F8TA 3T34A 1F2TA 3IC7A 3VR4A 4LX0A 4B33A 2PZGA 3GQBA 2P5VA 1GDDA 4Q9IA 2PMHA 4Q9KA 1IOZA 1G3IA 3PUVA 3O3KA 2FFAA 1U78A 1DAIA 2EFWA 3QPHA 4LLNA 2BOVA 4GI7A 4M1SA 1FBQA 4F7ZA 1SVIA 4OHVA 5G41A 4DNCA 3LD9A 2R62A 5EXPA 3RSLA 4RCYA 1JECA 2BEKA 4TMTA 1L0OC 3GZ5A 1KI3A 1FTNA 2JJ1D 2OXRA 1E2LA 4G5GA 2OXCA 2VHCA 5SZKB 4JKYA 4MYCA 4QBFA 4CYMA 1R4AA 3R20A 1P5ZB 1U2RA 2QP4A 2H8KA 3VR6A 3A1VA 4IF4A 2VP6A 2BJVA 5FFZA 3IQWA 3MLEA 4DLVA 2DTRA 1G19A 3D7MA 4G7ZF 3RLFA 2OEPA 2DHRA 3JAMZ 1XEWY 3GLFE 5CYOA 2JJ2D 2REXB 4IHSA 3WE2A 4XSHA 5JHUA 1KDPA 1I5ZA 1KOFA 4HX7A 2GETA 2XTNA 2KSQA 1KU3A 2ECKA 3VR3A 4IRUB 3W5JA 4JBWA 1E32A 3MZYA 2ZPTX 1XMSA 2ZS8A 4LUCA 4DRZA 4URWR 2ETHA 3SYNA 4II7A 4ZDIA 5KSOA 4P9FA 4BXUA 1JXSA 1AS2A 4NMMA 5BYJA 4BWYA 2JLUA 2HT1A 1IONA 1K78A 3TSOA 2IA0A 1M7HA 4N1AA 4W5HA 2PMKA 4ESFA 2IYSA 4JS0A 3VR2A 4RZ2A 4W7SA 1S9DA 2OUKA 4N9IA 1W4AA 4DBLC 1Z5ZA 2PI0A 4AIKA 3HR8A 2IJLA 4QOSA 2DBBA 2RC4A 3AH8A 2VHTA 4NL4H 4IOKA 1AJEA 3GLFA 1E0AA 4ZYHA 1GIAA 1NMZA 2GAOA 1P4AA 2FNPA 1M74A 1ZRDA 4PHGA 4LDJA 5FOUA 1C1KA 2BBYA 5LBIA 2IEZA 4H1VA 1EFHA 1COWD 3C1DA 1WF3A 1ZU4A 2GCOB 1A2KC 1Z07A 2DBYA 4S04A 1ODDA 2VIIA 2VT2A 5E20A 1P6XA 3N2EA 1XSXA 3QXHA 2WTEA 4ZCIA 1XN7A 1JB1A 1AWCA 3MWJA 1UHMA 4LRWA 2ZUCA 2FV8A 3HSFA 2VXZA 3C4JA 3KX2A 5CB6A 1RKBA 2NPIA 1XB2A 2AS5F 3BS4A 5JCPA 2QI9C 4BFSA 1HE1C 2VP0A 1OIXA 4GBMA 2ZE6A 2CLDX 1XPOA 3Q3JB 1QHNA 4OINF 4M9SA 2R7FA 1ZYRF 3MQ0A 4IKEA 3QKTA 1DEKA 3OAAA 2DU9A 4KV9A 2AX4A 3JVUA 1Z8FA 1VCIA 2GILA 4Q4HB 1XTSA 3GJ0A 3OHMA 5JI2E 2NS0A 5L3SA 4US2R 1Z6TA 1R5NA 1E9AA 2HOEA 3P7NA 4AYWA 3VKGA 4S35A 1BIFA 4FCVA 4Q48A 1F5NA 1P2TA 2OCAA 4G5OA 5K1YA 1E2QA 2NPFA 4DCSA 1E79A 5LLQA 1G6HA 5FPKA 2WWFA 1AM4D 1K6OA 3A36A 2GXUA 3DMDA 3KJIA 4GPTA 1ULYA 3EAQA 3L0IB 4H1UA 5EXTA 4ZV4A 3TKYA 1W46A 2ZI9A 1XB4A 4Z8YA 3ADCA 2QEQA 2BKUA 3L43A 3CPHA 3P4YA 3WP0A 1Z91A 2IC5A 2Z4SA 4ASUD 2J87A 2ZM5A 4R71A 4DHEA 4Q19A 4EPTA 4UXIA 2QL6A 3AVTA 4YFXF 1U6GA 3ULQB 1XEFA 4D4LA 2Z5UA 3ZMVA 3CX7A 3TAHA 2FN4A 2IS2A 1TTTA 4HB4A 3EIHA 4JL5A 2HDCA 3MJRA 1WRBA 1EX6A 2ZIAA 3TOBA 4V0MA 1R58A 1OH5A 2CVHA 4PGHA 1CBUA 4Q66C 3A1SA 3AVWA 3LVQE 4UXHA 1Q3TA 3M6AA 1U5TB 2Q2EA 1RYHA 1ZU5A 2ZVQX 3I3SR 3UWOA 1S9HA 4KHZA 4C3ZA 2O61A 4LHVA 2QMHA 4BH9A 5JMTA 4HQEA 4OQNA 4CICA 3ADDA 1XNJA 3FM5A 3DEFA 3CRQA 2W2VA 3E6MA 4WXRA 1R1TA 2JATA 3FTQA 3EIQA 3NIBA 1GSIA 1P60A 3HIFA 4L5JA 2FEMA 3IIKA 2PCJA 1NBMD 4B34A 3I61A 1XTKA 3VQTA 3WU0A 4UVCA 4CEIB 2ESNA 4KITB 1Q0UA 2X2EA 4O2RA 2A07F 1G64A 2JGNA 4GMDA 1YW8A 2WOJA 4D0PA 5ICGA 2ZRMA 3EWAA 4G7HF 2J1LA 3KB1A 4CYDA 3L9FA 3CUOA 1KO8A 4P96A 1VYVA 1N0UA 3K9TA 3LO5A 4QG7A 5CVVA 4AVPA 1K6MA 5GJVC 1W2GA 1F5TA 1G17A 4WA7A 3RAPR 2VBYA 3B02A 4B75A 4TLAA 1BJAA 4OHZA 3VHXA 1VTKA 2NNYA 2RDPA 3TSZA 4R98A 2CW0F 4KLZA 2J5XA 1XFAA 2NO0A 2HKXA 3IHWA 2VE8A 4EJSC 1FUUA 1M7GA 3SFZA 5DCFA 3D31A 1ZLKA 2QMOA 2EFHB 3CX8A 3REGA 1XMAA 3UATA 4D4MA 2D74A 4KODA 2RAPA 2J7PD 3R7WB 3RANA 3RRZA 5CDFE 2H6CA 3B1WA 1Z6XA 2N1BA 3TUZC 2J0UB 4IJMA 1ZM7A 2W0MA 5AK0A 3NG1A 1B9MA 3B13B 1OXUA 1KO5A 3DL0A 4TMZA 1SVWA 1KZ7B 3DF8A 5LRSA 3CJNA 4BNCA 1KMHB 2GZWA 3HDTA 2O6GE 4NYJR 4DCVA 5HVQC 1E1RA 5E8IA 2OLJA 4EAQA 3LQQA 3THWB 2FBHA 1E4VA 1W4CA 2B7CA 3MUFA 3HR7A 3QF4B 1TBXA 4WX9A 1QG2A 1FSHA 1R6BX 1P73A 3ELKA 2AWNA 1DARA 1YZUA 3LAJA 3ND8A 5FH9A 2LKPA 5DO9A 4BFWA 4KICA 2RMKA 2K5UA 3C5HA 2EFPA 4Q00A 521PA 1YRBA 4LHXA 2H18A 5FBLB 5FUWA 1OYYA 1W4BA 3FMOB 1MKMA 1DADA 5HLHA 3TAUA 1FYMA 1M1YE 5LBQA 3J81K 2FFHA 2HJGA 3BB1A 3OIVA 1SXJA 1LF5A 1P92A 1OFTA 2P4WA 2QP3A 3G82C 5CDFA 4F4JA 1QZZA 3TQCA 3E5QA 3K0AA 2D2FA 3U3OA 3T5DA 3QF7A 1ETUA 5KPJA 5CB8A 5JR3A 4TZ6A 2O8FA 4HB2A 3WGGA 5D6FA 4CZZA 1E9FA 5FI0B 5DD8A 5J47A 3B7GA 1I4DD 3AF0A 2AKYA 4HZUB 1GAJA 1P7CA 2Q0HA 2YR2A 1Z3IX 3TJZA 3ZDQA 4MNUA 5CM9C 4XVQA 3BIFA 1IUYA 1TUIA 4DQ2A 3U60B 2BYVE 3RC3A 4XSZF 1ZVQA 4CEHB 5EP4A 1Z0DA 421PA 1XBTA 2CYYA 5E18F 2V54A 2ZRBA 3E5UA 3WXMA 1W7AA 2BV6A 1N6LA 2E87A 3KKMA 1H8HA 4N3NA 5BPIA 3MHVC 3KZZA 1XRJA 1ZRCA 3BDDA 4HATA 4DT1A 2IXGA 1GL6A 2VSFA 5ICEA 1MV5A 3WMGA 4FMDF 1CR0A 4DVGA 1OJLA 2JDID 4B09A 4B8XA 4JZKA 3ECHA 1Z6YA 2FMXA 1Q12A 2X4HA 2F5EA 3WBKA 1FP6A 1GRRA 1US8A 2ERYA 3CH5A 2NNNA 1ZUNB 1ZC4A 3IUYA 5C18A 5DE3A 2GVZC 3HYTA 3LLMA 4G1UC 1ZLJA 2WWYA 4RD2A 2V55B 2ZE7A 2CXXA 2ZJ2A 3IL2A 5K8UA 1MH1A 3JVVA 2OZUA 3I5XA 4NCJA 4D82A 1YS7A 2AD5A 5JRZA 2IA1A 1E9BA 3EIEA 1OH8A 1DPUA 1ZN2A 3PEUA 4D26A 1AN0A 2BBWA 3HRUA 4D4JA 2I3BA 1W5TA 3PVSA 3LA3A 2EFGA 3AF4A 3CRW1 2WPDD 4HLDA 4PO1A 3CZPA 2XZLA 4TT3A 1GG2A 4Q4LA 4TSFA 2DPXA 4JSTA 3GO5A 3HSRA 5B64A 2REOA 3GMTA 4Q7KA 4X8LA 1ZC3A 4LD5A 3RS0A 5KHOC 4G6QA 1N6OA 4KVAA 1JALA 2WIAA 4DUGA 1ZD9A 2WV0A 2FU5C 1EH7A 1HW2A 2QY9A 3OE7A 5H68A 1TF2A 2QT0A 2W00A 5FUYA 4L18B 4A82A 2J0SA 3K70B 4BHPA 2ZRGA 1KSFX 3VEPA 1JJ7A 4M71A 1UBFA 1ZCBA 3SBEA 2O8BB 4ACBA 2DR3A 3P27A 4MUBA 1SZPA 3U7FB 1I1GA 5F64A 2YV5A 4LHZA 3IBGA 1KI7A 2P6UA 3HHGA 2HDNB 2PBRA 2DFTA 3K0CC 4PPQA 1TW2A 2VLIA 5TXGA 3UK6A 1EFCA 2J59A 2XKOA 1O3YA 1ZP6A 4YMUA 1E9EA 2OQRA 1U2WA 5JJLA 4NCHA 3ECOA 1MOZA 4LWZA 3LAWA 1Z83A 1N6PA 1EG7A 2FFBA 3LW7A 1KAOA 1P75A 3G0HA 3DP7A 3SBDA 3ZIAD 3CR7A 1LB1B 4Z8XA 1DPFA 2DFKB 3LDAA 4KIGA 2ORWA 2PG4A 3HPQA 3TUIC 1J0RA 2DAOA 3T8RA 2A68F 5L3FA 4U0YA 4TLEA 4L16A 1T3SA 3LBIA 1HQCA 2P2LA 2EVWX 1SFUA 4HB3A 4F93B 3ZD6A 2HXSA 2FQ3A 2FJUA 2PJZA 3QKSB 1T5LA 4LV5B 4NTZA 2QU8A 3R9WA 5DGXA 2MD5A 1RIFA 1A5TA 3V7SA 1GHCA 1P9RA 3F6VA 4RAYA 3NWJA 2IXEA 2J46A 3TKLA 4IVNA 4M9ZA 4JVMA 4CF7A 1BS1A 2FSFA 1GKUB 2PLFA 1G4UR 3BRWD 3N4MA 3FGNA 1O3RA 3W8RA 3RIRA 3I71A 4OMYA 2XOKD 1VCOA 4GOXA 2FXAA 4XOIA 2W57A 3F72A 2NO9A 1M2OB 2AHOA 3FKSD 4A0GA 3IKVA 3QNUA 4IDPA 1CEEA 4GZLA 1HSTA 4UVAA 1SVLA 1XGMA 2F3TA 1GVJA 1NLZA 4BAYA 1G3WA 5LEKA 4JYCA 1R1VA 3CTAA 1UBGA 4TYPA 2RGBA 4YMTA 1DG1G 4EKDA 2UXNA 1OHHD 3PFIA 3MAAC 4ESVA 3T1TA 2RVCA 1HSJA 1NI3A 5ERIA 2C04A 3AV0B 5JWHA 2XHKA 1IY0A 2Z4RA 4MKHA 4W5JA 2HYIC 2O03A 4EM1A 3OEEA 3ABUA 3L7WA 3QP6A 4QRHA 4HLQB 2XRNA 5FL7A 2CE2X 1Y3AA 3T35A 2R6AA 4GOJA 2IPQX 3ICEA 3OOPA 4A0XA 2J9RA 3KETA 1UDXA 5DI3A 3ONWA 3P9IA 2Y8EA 1C1YA 3ZYCA 3KJGA 1IRFA 1BBYA 2GXAA 1QGPA 3LY5A 4DLRA 1N3BA 3FYHA 2KBEA 4QJ5A 1H8ED 1LS6A 5FTKA 5TDHA 5JBQA 4OL0A 1OPCA 2FF4A 2G0TA 1WMSA 1CXZA 3KXIA 3MCZA 4FHTA 2C9OA 1FP1D 1HXDA 1XGOA 1SHKA 1YJ5A 3KJEA 4TLBA 4EFNA 5FTJA 1CF7A 4OHWA 3PUYA 5F9FA 1NVUQ 2BEOA 2ZEJA 3GEIA 3CWQA 2ZRPA 5D3MB 1OIWA 3I59A 3CRVA 1P6RA 4WVFA 4EJOA 1Z0JA 5TARA 1GKYA 4PZLA 2CGPA 1BH2A 2IWHA 1WWXA 4QHSA 4A5MA 4MGZR 4UXJA 2F2EA 1D2MA 5FB2A 1OFUX 2LNBA 1U81A 1G3UA 1XMIA 3IGFA 4UNPA 4AC9A 4DCNA 2W6JD 4G6DA 5G53C 3WHKA 5L3QA 5C46F 4KIBA 4YFNF 4A15A 1AK2A 1GUAA 1OE0A 1TU3A 3QSYA 2DCUA 3A37A 3ROUA 2VF8A 1BKDR 2A2ZA 2ATVA 3J7AO 2YOFA 3HJNA 3R9IA 2DK8A 2J45A 1U8ZA 5J8CA 1WI9A 1FYKA 2DT5A 2RCNA 1QZMA 4ZYGA 2RV8A 1E2EA 3NHAA 4MKFA 1CJKC 5F6FA 1NN3A 2VTKA 1BN5A 4MUAA 1BMFA 2K86A 2XAHA 3C16C 1OPXA 8OHMA 3EDPA 1V43A 1U9IA 1YS6A 2VO1A 3FFBA 2ZYTX 4GYIA 3L8YA 4TTRA 3CF0A 1N6HA 1NG9A 2R65A 1RUNA 4ACAA 3W6OA 3VR1A 3BORA 2MLGA 5HOOA 1S7AA 4I2OA 3TO6A 3QRFF 3K1NA 2OFOA 4DLUA 2YWHA 5GADl 1WE2A 1FBSA 3KP4A 5FOXA 5AUPB 1RZ4A 2UZKA 1O3SA 5FTMA 4IJAA 2CJWB 3DPLC 5TV2A 3TSWA 3H1TA 3SR0A 3H4MA 5DEQA 4XLNF 5JS7A 2GEVA 2G7HA 2M1BA 4IVQA 2BJWA 4PQRA 3JAMK 4A2WA 1E9DA 1UJ2A 3SQNA 2O8FB 1BI2A 4B71A 2E1NA 5LD2B 3TVDA 3L2OB 1N6KA 4P5OA 3GPLA 4EPRA 4MA4A 3ZIAA 2CQKA 2QTHA 3ZS9A 1A2BA 1MJAA 1XZPA 1X8LA 1TUEA 2P0EA 5AR1A 4LJAA 1X1SA 4LGMA 4E09A 1PP8F 3IBYA 2E7WA 2J0VA 2EFNA 4RZUA 3WTXC 3CW2A 3WRXC 1UEIA 3KFXA 4NCIA 5CYVA 3K8YA 3UMRA 1HURA 1J7KA 2FGJA 4MRVA 2WWIA 1QHHA 4MYHA 2R3SA 3FMQA 4C7OA 3QF4A 2XAGA 1XX6A 4EV0A 4CO8A 5A2QK 2AWOA 3TH5A 1UFMA 4ENKA 2FA5A 5HDGA 4JK1X 1KTVA 4QWQA 3FKQA 4EJWA 4RB1A 2WWGA 2P6TA 2ZSDA 1QZXA 4DLSA 2CL6X 1BMFD 4HAWA 4NPHA 5ICFA 5HPYB 4EPXA 3CUEF 4TQUS 2ZVPX 2LWIA 1KZGB 4NDZA 3JTHA 2F1JA 2XXAB 3AQ4A 3W8NA 1JHHA 3SFVA 1ONBA 4GDFA 3OF5A 2A7QA 2ODBA 3LBNA 5BMZA 1QRAA 1ZG5A 2V6ZM 1DBSA 3PR1A 1KJZA 2ZSBA 5BOXA 2CDNA 3T1BA 4Q9LA 3N2IA 1IN4A 4M72A 2PEYA 3QE0A 4YLGA 4BZXA 5JHGB 1ANKA 1TEVA 4Q9HA 2FFQA 1Y63A 2GRJA 3DVLA 3C8UA 1USSA 3Q9LA 5EE5B 5TY0A 3TR5A 4RB3C 2QQ9A 2HZTA 3ABTA 1Q3HA 2BMFA 4KLNA 2FWRA 3O47A 3ZVRA 5LD2C 1R5BA 3L0PA 1TU4A 3CO6C 3I5UA 2D7DA 3ADBA 3PEVA 3CRRA 2F1HA 3B1ZA 2C98A 1ZG1A 4B2PA 4LJ5A 4DSTA 4V0KA 3QPWA 1FQJA 2O8DA 2D2EA 3U6BA 2IXFA 2VF7A 2YWEA 3B2EA 3W6NA 5ED4A 1G16A 4NZYA 2TMKA 4IXAA 3FZVA 5DCMA 4DC9A 4DKXA 1IN5A 3BZ6A 2OO7A 5F98A 1II8A 2QMEA 1SD7A 4EGZA 3CNNA 3T1QA 1JQJC 1ZM3A 2G3YA 2AXLA 2JDIA 3IPXA 3FE2A 1B59A 4KXFB 5CITA 3VX3A 5HS9A 1GITA 3IDQA 2ORIA 4TLDA 1DS6A 5HCIA 3SN6A 3TW8B 5JECA 1FL9A 4QFMA 5EZ6B 3Q5EA 3KQUA 1SAXA 1P2UA 1ZMXA 2FE3A 2OFXA 4R8HA 2D45A 4L5BA 2O0JA 2DWPA 3FHCB 4URZR 1X1RA 3LFUA 3C3WA 4OBEA 2OQGA 1KMQA 1YW9A 4WXHA 2Z33A 1E2PA 1TF5A 3TBKA 4QBGB 2ZITA 1VECA 2L3DA 4OKSA 3THXB 1XGNA 1SMTA 5GJBA 4MRNA 4XWOA 2VBCA 4PC2A 2ZR7A 4ZH4F 4CZ2A 4X8HA 2ZRDA 3EZ6A 5ILUA 2ZJZA 4FWHA 3KP2A 3W3AA 4UJ5A 1QHSA 1W1WA 1X6VA 5L3CA 4B47A 4KVGA 1YFHA 3EA5A 1BOAA 1XZQA 5FBQB 2JLRA 1VIYA 4LK1F 2AK2A 2ZRKA 1FFHA 4M1YA 1LDJA 1E2GA 4O3MA 3ND9A 4RKEA 3U1DA 1C9KA 3KE2A 2KJQA 3FMFA 3LQRA 3E6BA 2A3RA 1PUIA 2HLDA 2FU4A 4V02A 4IOMA 5KPDA 1KO1A 2WMNB 4I4LA 1N5KA 3PUXA 3A4LA 2IX3A 5IRCD 5FL3A 3SJCA 3ZPLA 5HS7A 4Q9JA 1WB9A 2P6NA 1MDMA 2QZ8A 3MJHA 2BM0A 2QPOA 3BD9A 5BS6A 1KYWA 1R5GA 2D2WA 1PLKA 3DZ8A 1II0A 4U00A 4U7DA 1P4SA 3SS8A 3X2SA 4EPYA 1Z2AA 3OIYA 1RFLA 2EWVA 2DFNA 3KP5A 2A6HF 1GL9B 2B21A 3V4GA 3QG5A 1Q57A 4Q1EA 1ZGAA 1UADA 5BWMA 3ADKA 1SVOA 2J5OA 4JJKA 2IRFG 1SD5A 1NKTA 2MSCB 3GEZA 3FWEA 4RGSA 2ZRCA 4A6PA 1I6XA 1HKSA 2D1VA 2WAYA 2C8VA 4ITRC 1R7JA 4E22A 1DAHA 1G5RA 2C78A 4BLSA 1DAFA 2F6RA 1Q20A 1RJ9A 3NDPA 1VIAA 1ZIPA 3OESA 2IUTA 4M8NE 4OI4A 5HZKA 3AUXA 3W6KB 3SXYA 3GFLA 2D06A 2VHJA 5TVKA 4LHWA 2VP2A 1DAEA 3JW4A 3GLHB 1K5DA 2VL7A 1FPMA 4D6PA 4AWXA 4CRWB 5EUQB 3VKWA 4YIIA 5KSYA 1IY1A 2EFOA 3F23A 4LJ4A 4KSBA 2GXQA 5TB5A 5H6RA 1IJFA 4M22A 2BM1A 3C15C 3ZLJA 5L3EA 1Z28A 1S8NA 2E1RA 2MH9A 3DFGA 2GF9A 4HZFA 2ZRLA 3M1IA 4U7BA 1Q21A 5DYIA 1U98A 4XH9B 5D3MA 2STTA 3UIEA 4DLYA 1AIPA 3OFNA 4V0NA 1MJBA 3LA7A 2RGCA 1YKSA 1YZTA 5GVRA 2A5FA 1W5SA 1RRFA 5BN3A 4B74A 3F0TA 1E9RA 3RHFA 4GP6A 5AUNB 2TDXA 3OV8A 2V7QD 2X19A 3A1TA 1FY7A 1ESMA 2EYUA 5E7MA 3SOPA 4FW9A 2V79A 3DQVC 1AZSC 1NIJA 3D5LA 1F3OA 2FNAA 4RGUA 1G1MA 4FCTA 1YZQA 3FB4A 2PEZA 4MYUA 5BN5A 1EGAA 2BBTA 1IY2A 2CJWA 2JJ2A 3NHBA 1WBBA 4NU0A 3A4NA 4JLJA 1U90A 4ASNA 5B2ZA 4HX8A 1S3SA 4TMXA 3LVRE 4LJ6A 4OQFA 1K79A 2L02A 1D8TA 1FPQA 4MYTA 4TYNA 2GJKA 2FSWA 2P8TA 5DV5A 3RABA 3ZGXA 2NTYC 3QU3A 3BH7A 2A61A 3GLHE 2VT3A 2IWRA 4JQFA 3JTGA 2BKEA 3B6EA 4G5SA 4IXNA 2DWQA 621PA 4YG2F 2XITA 2ZROA 1UKVY 4FINA 4P32A 4EJSB 5KSZA 2WICA 1Z05A 2ASEA 1P62B 4EUNA 3GYHX 2Z43A 2GA2A 3NDBB 2ZS7A 1MD0A 3UPUA 5E4FA 2JA1A 1A82A 4CEJB 2DFIA 1E1QD 4FN5A 5JCZA 1DP7P 1W0JA 2FPMA 5IF9A 2XGJA 3D0SA 3L82B 5JSZB 2QGZA 2IHYA 2M5WA 3KUCA 5HKKA 4LI0A 1W36B 4Q4JB 2CL7X 2JCSA 1F9NA 4LG0A 3LXRA 3GUDA 2CK3A 4LBYA 3P9KA 3GXOA 1ZYUA 4DUGD 1G5PA 2XJ9A 3U44A 2ZI5A 3ERED 1YR7A 3K0FA 3SZPA 4PAOA 1S3JA 3UANA 4C0QC 2Z6VA 1WRJA 2RN7A 3UG6A 1DO2A 2NYXA 4HLYA 2B6HA 2BWJA 4PC3A 4XRFA 4A8JA 3B1VA 3EARA 4C2UA 1U94A 2FPKA 4EM0B 1Q1HA 1FW6A 4KO8A 3HU1A 3ZMZA 2I1VB 3GJ3A 4C0SA 2F5CA 2YOHA 1F48A 1ZIOA 3TLXA 4LK2A 1E4YA 5K5RA 1KK0A 2QGNA 4HZIA 4JSYA 3VU9A 4N9HA 5FGMA 2ZKZA 1Z6AA 1NJGA 3RS3A 1VTNC 4CVNA 4E07A 1JHFA 3ZMTA 1GFIA 1HH4A 5B30A 3RYTC 2O0KA 5HKKD 1X37A 1FT9A 3LA2A 3FHZA 2KWIA 3NBZC 4YXWD 4AKGA 4HDUA 3GFPA 3K9GA 1ZNWA 4BE7B 5C4MA 4HF2A 4KDPA 1G8GA 1MT0A 2OAP1 2MH2A 2EFEB 2G88A 4HDCA 3F8CA 1G7SA 4AG6A 2EFDB 2O8DB 2BHRA 3V8JA 1ZNXA 1R00A 4C0HA 1CKEA 3SC3A 1N6IA 2JEOA 1MO6A 3BFVA 5BXQC 2VP5A 2J7PA 2XJ4A 4LK0F 2OG2A 2YC2C 4QBHA 2DQRA 2IBMA 3ZN1A 4S2EA 4EVIA 2GWHA 4F4CA 3CONA 2PMUA 4Y0AA 4YONB 3T1OA 4Q4HA 3W6PA 1QBJA 3WYAA 4B2IA 4CIDA 2JJ8A 1T0FA 1E2HA 2GESA 3ZD7A 2C9CA 3T5GA 3EYYA 4M1TA 1P9NA 3ZZUA 4HDQB 3TRFA 1O7FA 3G3ZA 1JAIA 5D5XB 2WKQA 1XDUA 3EXAA 2ZANA 3BWGA 3WGHA 3NH9A 4MHGA 4UNRA 5K5OA 1CULC 2O0HA 3X1WA 3EPLA 3SQXA 2YJTD 2XVCA 4BUJA 4V0OA 3GFJA 3IHUA 2IW5A 1E2JA 3B78A 3BGWA 5IT9K 4MDEA 4TQAA 4U0WA 1ON1A 4L0ZB 3TDZC 4G5QA 5E1WA 2ESHA 1XDSA 4L9NA 1DAMA 3BB4A 1SKYB 2XZPA 5HDNA 2FZ4A 1R8QA 3F8FA 4URUR 1Y0UA 1YYVA 4LY6A 3QI2A 5C4GB 2XNSA 2PJRA 3FXQA 2E7XA 3VNUA 4LLGF 3P26A 1T98A 5KU1A 3KP3A 1QF9A 2H92A 3VFZA 2HTJA 3OEHA 3FMPB 4RZ3A 1S29A 3OFND 1FSEA 4ZZLA 4E70A 3FMIA 2O3FA 3BJ6A 2XAUA 5KVRA 4KFUA 3DV8A 2XEXA 4JVSB 1REPC 4G5RA 2HR3A 2FSIA 4A2UA 1NF3A 1KSJA 1SKQA 5CVIA 3A1UA 3HP1A 4A6EA 3K0CA 4JL6A 4QXAA 4A2PA 4BECA 5E7IA 2Z9OA 2J0QA 1FUKA 4QJ3A 1CLUA 4A0FA 3PEYA 2KE5A 4UQOA 4WBSA 1JXMA 4JLPA 5F2EA 2P5KA 1WKMA 3QKUA 5FPYA 1LTQA 3F8BA 2FPLA 3B1YA 4BZPA 5LPNA 4HW0A 3SHFA 1OLOA 2QQ0A 4M21A 1IN6A 4ZDKA 1R0WA 1E2XA 3KB2A 2QM3A 2BGCA 1IXRC 2GZDA 3D3QA 4IVPA 2QUFA 1G8FA 1KK1A 3NEUA 1JXOA 4M1WA 5EE9A 2JASA 4JT4A 1F6BA 1S1CA 4EJUA 5BPDA 3C18A 1JI0A 1OHHA 2WJHA 2RQPA 3ZVNA 4WZAE 5HS8A 4GL2A 5L3SB 1WSUA 4XSGA 2W0SA 2QM7A 1KI1A 1XD2B 3K9LA 3GLHA 4AWXB 1J5YA 2YNMA 4EQQA 2JIZD 4LYHA 4HDVA 2HLDD 1ZAKA 3MSXA 1CR2A 5M04A 1PDNC 4LV8B 5FTLA 3E1SA 1HA3A 4IDOA 5JWOA 4Y13A 2DQLA 4OU0A 3F21A 3KTAB 1W7PA 3LLUA 3BP8A 4QBIA 1NNEA 4KMFA 4LHYA 4KIFA 3FPAA 4URXR 2OBMA 2CLCX 3PXGA 2MBFA 3BH6A 2HCBA 1OB2A 3WYGA 4H0EA 3LX8A 1TQ4A 4MTDA 1FC3A 4FIDA 4NBSA 2DW4A 1XXHB 3EPJA 1EH8A 4POAA 2DK5A 3T61A 4GNKA 1RJ9B 2KIUA 4KFTA 4Q02A 2D4HA 1KGDA 4GT1A 4Q4JA 1VCMA 1Q1EA 1TQIA 3DMNA 4LYJA 1MABB 4CHUA 3THYB 3AKYA 5DISB 3V8LA 1KQ8A 2IYRA 2JLVA 1PVOA 2O8EB 1TL7C 4PC1A 3RNLA 3RKXA 3LNCA 2G0NA 2IYYA 1KI8A 2VPPA 5CVUA 3H0KA 3PIRA 4KYUA 5FFMA 5FLXZ 3B9QA 2X0LA 4UNSA 1YQAA 2F5DA 2VSOA 1EFRA 4R7ZA 3MD0A 4BRUA 3JZAA 3NC0C 4UJ3A 5P21A 4MTEA 3I73A 2UZIR 4NONA 2GJ8A 2FEOA 1AKEA 4L9SA 1MDMB 5E3HA 4Y17A 1YR8A 4LBWA 1OH6A 1Q44A 1AGRA 3WRYC 4MQ9F 3QG1A 5DUIA 3K69A 1HV8A 3G5UA 2ZRNA 4EIWA 4JL8A 3RSOA 1J9IA 2ZJOA 2CSOA 2IYWA 1LS1A 2QLZA 1OKKD 4X8OA 1JPJA 3AJIB 2GK7A 2WKPA 1QPMA 1HT1E 4B43A 1CJVC 4DIDA 3GJ8A 2D62A 3CB4A 2DZOB 3ZH9B 3Q9SA 3X1XA 4ENMA 3ECCA 3N70A 4HAYA 3V9PA 4UKDA 4DSUA 5JSZA 1KYZA 3D8BA 3SI7A 3WE3A 1CJMA 5JI6A 5H1YA 5F3WB 2O8XA 3RKYA 4A4DA 3B5JA 3J80K 2HYGD 3GVAA 1BIBA 1GVNB 1XDBA 2OILA 3KP7A 1NHAA 4JVLA 4IEEA 4UNQA 3O6BB 1DAGA 2ZJ8A 3PUZA 3BBPA 2K7LA 2O52A 2ZS9A 3AP3A 5KYKA 5LHGA 1M8PA 3K09A 1CGPA 4LC0A 1II9A 1R0YA 3MFKA 2P5LC 3GJ7A 3R8CA 3E2IA 2KIMA 1KO7A 1IXZA 4OIQF 1G20E 3ZZTA 2W2TA 3MGCA 1CIPA 2L4MA 2WV9A 2G1KA 3K9HA 3E97A 4MKIA 1YLFA 2K4JA 3AGQA 4PHFA 1GILA 3RRNA 3U3KA 1VG8A 3AVXA 4RFVA 5AONA 5EEGA 1AQUA 1HE8B 4IFBA 3GF2A 1E2MA 4TYQA 1KU7A 3WHLA 1Q1BA 1QBKC 4TLCA 1B4AA 2A9KA 3H3UA 1J8MF 1SVSA 4Q03A 4ESHA 3GJXC 4Z1MA 2G83A 3K53A 4WZ6A 5K8LA 3GLFB 2KB0A 2QPTA 4YC7A 5DHFA 3IRQA 3T0YA 4LGWA 4A8JC 3RDIA 3K1JA 4I01A 4HAUA 2JZYA 3CUQC 4G94A 5HTKA 3HU3A 4L9VA 2D1HA 1H8HD 4KN7X 2RGVA 3Q8XB 4B3FX 721PA 1IM2A 4LB6B 2K4BA 4RD3A 2CBZA 4D0GA 4EJTA 2Q3HA 4MKGA 3EG5A 3C7JA 5EUMA 4C0LA 5EZ5A 2GXSA 2L01A 1Z0AA 4EQ6B 5G3YA 2HKOA 4HA8A 1EX7A 2IF0A 3PG5A 1KQ9A 1MJ9A 4G0NA 4OYHA 1F60A 2P65A 2MSDB 3R4KA 1D2NA 4GSYA 2RGNA 3AKCA 3CDHA 4LB5A 3QPUA 4AY2A 4DCTA 3IEVA 1ZGJA 2JPCA 1MKYA 1BO6A 2AXNA 3B60A 5FI1B 2HGCA 1OIVA 3KFVA 5EE0A 2C9YA 2GBLC 4V0LA 3F8NA 3AUYA 5FR2A 3A1WA 1FMLA 3U3MA 4IRHA 3WTVC 4DDWA 4WW0A 1XF9A 2L0XA 5EP3A 2B92A 4A9AA 2H16A 2ZJAA 1E1QA 1I4TD 3U3JA 2CO5A 5GVSA 3HTSB 2EV5A 5FTNA 4LG0B 2FZLA 2LKDA 4ENNA 2NGRA 4HI0E 4BFTA 1XWIA 1CRPA 1N6RA 1YQTA 3H2YA 2W2XA 5AUOB 2FMYA 4BZQA 1HT2E 2Y0MA 2CHVA 4KA4A 3MRSA 2IS6A 2O5VA 2DLLA 2VHQA 1G291 4PANA 3HTUA 5FR1A 3HWSA 4AURA 1E6CA 2BDTA 4PPFA 4A8JB 1T3LA 3C41J 1Z0IA 4YFKF 1K7AA 1NMXA 3I4PA 5AJWA 4G7OF 1CTQA 5JI3E 3CNLA 2B8WA 5J4LA 2H27A 5EE3A 4LMYA 1FNMA 1G8HA 5H20A 3CRMA 3P20A 3U7GA 3BPVA 1HUQA 5EP1A 2W83A 3GJ4A 4AIIA 1W7PB 3EZ2A 1G6NA 1IQPA 2RNJA 1IRGA 3N5CA 4Q7LA 5CLSA 4JLMA 3K0LA 3ISPA 2K27A 1U5TA 1W0KA 1GKIA 2R6FA 2W6ID 5CJ2A 4M0LA 2HQNA 1KI4A 4DB4A 4FI3C 3QP5A 1GWNA 2GKSA 2IA2A 2IYUA 3B1XA 3I32A 5KUTA 1KDOA 5DNYB 1VG0B 3CKLA 4QNMA 4E03A 1UDWA 2ANBA 2GCPA 1JEEA 3DKVA 4GRAA 2JLYA 2YX7A 1SD4A 2J41A 4LJ9A 3TDUC 1L3LA 2OAZA 2FE4A 2P3SA 2W6JA 2MC3A 4TMVA 3U4QA 3VX4A 3W90A 1ELOA 4DCUA 3QXJA 4NCKA 2C03A 1V3FA 2CMKA 1G7RA 4LPKA 3HUGA 3H84A 3ZMUA 2JLWA 1R0XA 2IF2A 3P1JA 1O3TA 1ZREA 2O0YA 1ZJ6A 2AFHE 3CH4B 3PQKA 4IVRA 2WM9B 3RWMB 3KZ1E 4AI6A 4NHOA 4Q4AB 3ZVLA 5FD5A 2RGNC 2WTUA 5J4VA 1QO0D 4EGYA 2HFHA 3V7RA 1SD6A 1L8QA 3SYLA 1EXMA 3QKRB 4XIGS 1CR1A 4EFLA 2IYVA 4DWJA 3WODF 5HZHA 2A69F 1YZKA 3AVYA 2RKOA 1FP7A 3RPUA 1U8AA 1F1ZA 2AFIE 3EASA 2G7UA 5EP2A 3A58B 2J7KA 4HQMA 4B3BA 3R60A 4QKQA 1E2FA 1RUOA 3QBVA 3U7EB 2AXPA 1VYTA 2ZE8A 3COAC 2ZCWA 1Z47A 1TTYA 3I59B 1BC8C 3UMFA 2IS4A 1TNDA 3OEED 3RRMA 2ODNA 5DSZA 2W85A 1TADA 2RHMA 4B44A 4QM7A 4F91B 3JZMA 1CS4C 3SJBA 3MWMA 5CM8B 5FO5A 3FKSA 4JYBA 1RC8A 4RAZA 2OM2A 4ZIRB 4OMZA 4YIFA 2EA4A 5AWFC 1WDTA 1YRAA 2ADUA 1FOEB 3KKOA 4PQYA 4D4KA 1SQ5A 1BI0A 3TK1A 4BFZA 4HB0A 4C7OB 3HOSA 2QBYB 1YW7A 3KKPA 3K9NA 5DUKA 3NBFA 3W3ZB 4ERNA 1SXJC 1SXJE 1F4KA 4IRIA 1JQLB 4V03A 5E95A 5D8LB 2CVFA 2W24A 1NKSA 2F5FA 4RVCA 1KI6A 3OZXA 2WWWA 4Z1MD 4UNNA 1I4LD 2COMA 3VODA 4A1FA 1BOFA 1XD9A 3D6TB 3EC2A 4I1OA 4MGYR 2NQ2C 3OAAD 1LQ1A 3Q7PA 3JSOA 4PZYA 2PX0A 2ZAOA 5HE9A 1UB9A 2VN2A 1USTA 4BQAA 1CRQA 3ZS8A 4WXDA 1GNQA 2PFBA 4I0BA 4UNOA 2ATXA 1FZPB 2X1VA 2P6SA 2H17A 3M4YA 1NBME 4XD7A 5J5CA 1XXHE 4CEHA 5E8GA 4R9UC 3ASYA 2QNRA 4TWZA 4IOJA 4M6XA 2XNDD 1E2NA 2IA5A 5CIWA 4AKEA 4RD0A 4HX4A 3K70C 4PC6A 4HLCA 1NMYA 2PL3A 3K1MA 4PZJA 5AIQA 3AF3A 2A5YB 4ZDJA 1AOYA 2I4IA 1TLHB 4R2IA 2IL1A 3MG9A 5G3ZA 2YOGA 1QHXA 1XPUA 1U3EM 2ZR9A 3DM5A 3FWYA 5E1XA 3OE7D 4IW3B 2A6EF 3BROA 2GZHA 2P67A 1XD7A 1S1MA 3DOFA 1FBUA 1XCVA 3L2CA 4UXNA 1AS3A 3B85A 4US1R 1Q1ZA 3V7CA 4ZI3A 4B32A 3TO9A 5DHAA 2C96A 2H94A 4OHXA 3X1ZA 2JTVA 1QHYA 2F9LA 3I62A 4YQFA 1IAWA 1IF1A 1XXHA 1G3MA 1QVAA 4IHQA 1P2SA 5A2QZ 1DE0A 4PHHA 4Z2YA 1A4RA 3WNBA 3AP1A 3B9PA 1GNRA 2QTFA 4KI0A 1RW4A 1GRNA 1II8B 1WA5A 1FNNA 1MABA 4U0VA 3EC1A 4WXPA 2Q9AA 3B8HA 4HYYA 1STZA 5D3QA 3WNCA 4LSGA 1NVVR 2A30A 5F1RA 4A3VB 3RDPA 2MSEB 3I4LA 3PJRA 1NG1A 2H09A 2OE2A 2UVQA 4OHYA 1EFRD 4OK5A 1NSFA 4TT3D 2D3WA 2WAXA 4OIRF 3HU2A 3AEZA 1OV4A 3NBYC 3BXZA 3NEJA 3WU1B 4NYMR 4DDTA 4AD9A 2VP4A 3WGIA 5KSPA 3DXJF 1E17A 4PCQA 2WOOA 4FCWA 2ZR0A 3CIOA 1EH6A 1D5CA 1VCNA 2A5DA 1SGWA 2NO6A 4J0QA 1PV4A 5SZIA 3ZQ6A 1YZNA 1JPNA 1UAAA 4WIAA 4ZI2A 2ZXUA 3LBHA 4GO1A 4OK6A 4BYYA 2ZI7A 3FFAA 2EWNA 5E7JA 2GDJA 3KLNA 4MRSA 2LDUA 2GCOA 3DM9B 2A78A 1SKYE 4D2IA 3S2WA 4XBFA 1W7PD 2OLKA 3EPKA 2XSZD 4O6JA 3GFOA 1N25A 3VB2A 3IIJA 4KBGA 4F38A 3FMSA 1OYWA 1KDRA 2G1JA 4D0NA 1I2DA 4QM6A 1AGPA 3ZJYA 3K70D 2ZSAA 1RIOH 2JLSA 4PDKA 5CVJA 4RJLA 5DYMA 3E5HA 1N5IA 3RS7A 4PR0A 3I64A 1TNSA 1XCGB 2WJJA 2IW3A 4YMWA 3VR5A 1RPZA 1A04A 3QOPA 3BERA 3O8CA 2OCBA 3GX4X 3BB3A 2GAUA 2QUZA 5LDDC 4DLTA 3WTSC 4OIOF 2GA1A 1S8FA 3CUQB 4US0R 1SULA 4B73A 2HEIA 1G4DA 1OF1A 1Z6RA 3KKNA 4KCGA 1MZBA 3QVUA 2ODWA 4FWGA 3WY9A 2ZI6A 2E9SA 4TMWA 3F6OA 1SHZA 2RKHA 3KFWX 3I8SA 1G6OA 1VMAA 4OK3A 3BPXA 2DWOA 1XCPA 1SXJD 2GIVA 4U02A 2C5LA 4Y15A 2BCGY 1NJFA 3M8FA 1T91A 2V8OA 2HYFA 2WKRA 3L0SA 3O8DA 3Q85A 2GHIA 4QGFA 1G3YA 4HOBA 3GWZA 3F5FA 2PJPA 3DPUA 5FOSA 5FBVB 1XMVA 2PMDA 3QBTA 2AR7A 1UBCA 2CNWD 2CK3D 3CZQA 1E2KA 3OEHD 3PV0A 1QNTA 3PEWA 1NVMA 1DAKA 2IEYA 3SQWA 3WBJA 3M7GA 3GJ6A 5FD6A 1T38A 1Z08A 2QA5A 1NVXQ 3QXSA 1G8YA 2YWFA 1XJCA 4Q4ZF 2WMOB 2G9WA 4M73A 3L8ZA 1F2TB 5SZJA 3DZDA 4FX4A 2H6BA 2OBNA 4ARZB 2VE9A 1F2UA 5FBWB 1DELA 5EE1A 4JLNA 4ABYA 3EWSA 4NHJA 3AKDA 3I72A 5B58C 4Q1BA 5K5QA 4XVRA 3LA6A 1ESNA 2QM8A 4XTCS 4EPVA 4L9JA 2KRKA 4ESJA 1YR6A 3C7KA 3EZ7A 4UV8A 1KKMA 5D5UB 1JGSA 3RVBA 5JRJA 3SEAA 5KTYA 1CP2A 1NBMA 4MDFA 1OSNA 4L8GA 1G3RA 4PQFA 5GJCA 2VEDA 3OIUA 1LDDA 4XJXA 1H0MA 2GJAA 2H7VA 2PCLA 1C0WA 4TL8A 1U5TC 2GXGA 4B3XA 3CLOA 1LB2A 5LHHA 3L09A 1IBRA 5IDVA 3X1DA 3ZVMA 1T9HA 2ZMEB 2EQBA 4L5IA 3T5XA 3WYFA 3KW6A 5HLIA 3U9GA 4XWAA 2QP9X 1SFXA 4NH0A 1GXQA 2IYXA 4A0ZA 1CJTC 2PBIA 5KOYA 2Z0MA 4FXPA 4LRSA 1Z06A 2WJVA 2GVDC 4GOKA 4FD2A 1XTRA 1X3UA 2ONJA 4NYIQ 2YC4C 1WQ2A 2V4ZA 4DDUA 3HSEA 1Z29A 1U0JA 1MGTA 3LWFA 3SU8A 3MFYA 1DPRA 4QL3A 1X3SA 2V1DA 1OFHA 1ZARA 3MZHA 1KGSA 2UWMA 5TRDA 2LCFA 1UCRA 1Z2CA 1ZNYA 2ZETA 1P4XA 3M8EA 2CE7A 1N2CE 1EESA 1JR3A 5L3GA 3THYA 3O2PE 5B57C 3SDZA 1KNXA 2ERXA 4LZZA 2ZAMA 1R0ZA 1HKTA 3AVOA 2ZE5A 4JT2A 4LOAA 4N0DA 1PP7U 2NRAC 2UZ3A 3NC1C 821PA 3KQHA 1GXPA 5IT3A 5G40A 5E1ZB 4A12A 1P4WA 3ICQB 4KUMA 1OMIA 3R0AA 5LGTA 1G5TA 4K81B 1KI9A 3I0TA 4TN1A 1SXJB 2VOOA 2CWEA 1UKEA 4WOPA 3KQNA 1NP6A 1UFQA 5K8IA 2O8CA 4UUVA 4D25A 4JLAA 1NSTA 2WVJA 3PCRB 1TEXA 1FYLA 4MGRA 2NIPA 2VBXA 3QVVA 4GFDA 4KYIB 1D8JA 2A5GA 2ANCA 1S0UA 3QKRA 2GXBA 1EFUA 2OV2A 1UKYA 3VU9B 3FHTA 3ZP5A 1SVMA 2L4AA 1JE8A 2GQQA 2H1LA 4ZCMA 4XWKA 1E79D 2IYLD 2V6JA 3WTTC 1EWQA 4A0YA 4IOLA 1TQDA 2N46A 3V4RA 2E1CA 1K5GA 4HAVA 3J81k 1T4GA 1S6LA 1ZUIA 4Q18A 2RGXA 4RD1A 2NZ8A 2YHSA 1EV7A 3AKEA 3PUWA 1BC7C 5CLQA 2CCKA 2GEDA 2QT1A 4QGAA 4BPBA 5CVRA 1E9SA 2HF9A 4O2LA 5FBRB 3IIMA 1ZD8A 5LRRA 3QXCA 3BH0A 3QXXA 3UWKA 2YYZA 1N5JA 4DT1B 5D4SA 5JJKA 2LF8A 4LC1A 4IHTA 4PGGA 4MRPA 3LV8A 3BJAA 2RH5A 4HBLA 4NYIR 4O0MA 2DY1A 3EPHA 2HS5A 3EZFA 4GYGA 3SJAA 3TW4A 3K0FB 4HEJA 4RZXA 1KQ0A 4ZZDA 1COWA 2OA4A 4XSXF 1P2VA 1M34E 4HLUA 4IDHA 3U7HB 2ONKA 4AKIA 4CT4B 4WXCA 4TTQA 1S96A 4ZCLA 1DOAA 3GEEA 2R8RA 2EK5A 3GLIA 1KAGA 1KJWA 1M7BA 3RJPA 2XXAA 2F3RA 1IN7A 4I0AA 1KI6B 4M9XA 3AF2A 4RGXA 1X8JA 2KJCA 3CLVA 1MR3F 2BCJQ 1OKRA 3PENA 4IFEA 2JRTA 3IWFA 3SNHA 4ZYEA 1AS0A 5FUXA 1C4OA 3A8TA 3IWZA 2BV3A 4JMPA 1IJEA 4OQXA 3PQJA 1XMKA 5L3VA 1OKKA 3K1PA 5J4HA 1W47A 4RCZA 4B6FA 2NZJA 3ASZA 2FBIA 2JAQA 4I81A 3DHWC 2WPDA 1JBKA 2BE5F 4PSVA 2XAJA 3VNVA 2M8EA 1BIAA 5FOVA 5J4KA 3LSTA 2PZEA 2WJYA 2ISYA 2IYZA 3SZRA 1UKZA 1D3YA 1D6JA 1VHTA 4FMDB 3HPRA 3TIFA 4ETSA 4BQSA 1YVDA 1NIPA 3QJYA 3I92A 4HDOB 2W84A 3R9XA 4R2HA 1O3QA 2NO1A 3I5YA 5CJ9A 1XP8A 2QWWA 1G4AE 2EFCB 1LEBA 2MMCA 3GP8A 5TMPA 3BAFA 4RKFA 1KY3A 4JVNA 3U2QA 2REBA 2BBOA 2ZRJA 5KDDA 4HSEA 4ASUA 2PT5A 1A7JA 1R36A 4ZDWA 2Q3MA 1B0UA 1HY3A 3CF2A 1R1UA 3IO5A 1XJQA 5J8FA 1NLFA 3QOFA 2ZSEA 2W58A 1T6NA 5L3BA 4I1UA 4BGDA 1D9XA 1LJ9A 1LVAA 1R5OA 1KK3A 4A0HA 3ZZ0A 1VPLA 1MRSA 4JLKA 1H65A 5AJYA 5AIPA 3CO5A 4Q1FA 2CFXA 4AD8A 2NO7A 2YU3A 4YMSA 2STWA 3SJZA 4YXWA 3A4MA 6PAXA 3AF1A 2DWZB 5JEDA 2YZ2A 3TQNA 3VKHA 4JLOA 2QG6A 2XTMA 1RRCA 4BHCA 1LDKB 1AKYA 1OB5A 4C0BA 4AIHA 1OFIA 1KU9A 1LNZA 4WAUA 4KFRA 4P4TA 1O57A 4LLLA 3FXRA 1G3QA 2DI3A 4N0BA 1XU4A 4F4IA 4C2TA 4Q47A 1U0HC 2XNDA 3V4FA 3H92A 2DO7A 2KBFA 2QSYA 3BFKA 1ZAOA 1MRNA 2DFLA 4HLXA 2IYQA 4HUQA 1UHWA 2GA8A 1BM9A 3KTAA 5AJXA 2IT1A 4XD7D 4K8OA 4DSNA 3E5XA 5JZVA 1ZM2A 2PLYA 4PSKA 5EQTA 4NYJQ 2WBLC 1Z7UA 5KDOA 4BLTA 3T1VA 1PZNA 1ZBDA 2FGKA 4FT8A 1ZCAA 3NEYA 4WF2A 3OIWA 1T3HA 1AZTA 1NN0A 1XD8A 2BMEA 2RGEA 4URVR 2ZUBA 2GF0A 1U0LA 1E0SA 1OT3A 5D6EA 1GTVA 2ZQ5A 3QIAA 3ZQ7A 4DXAA 4CEIA 3Q5DA 4TYWA 4O25A 1WQ1R 2FA9A 4GITA 1XEXB 1AA9A 4RD4A 3EQLF 4M9QA 1OXSC 2ODEA 4B48A 2EV0A 3QY0A 4KT5C 1W2HA 1Z0KA 5FPHA 3DKWA 1F2UB 4G8XA 1T0JB 3CM0A 4JJZA 1E2IA 2ZMEA 5JLJA 4M1KA 4P9UA 4TYYA 5BN4A 5IT9Z 4RFSB 3EX7C 4GCVA 2HV8A 1OXXK 1E2DA 3BC1A 4D81A 2MA3A 3O8BA 1T6SA 3E6DA 3RPQA 1B23P 4OJQA 1E94E 2ZI4A 3N97A 4OJKA 4L4UA 2IUUA 5K8TA 5DD4A 1S4QA 2G77B 1XTIA 1FZQA 4TL7A 5JS8A 3HRSA 3R7WA 1IXCA 1RRPA 4P4UA 5KDLA 3V8KA 5CYPA 4DLWA 2JPBA 2ZO4A 2VONA 2ZJYA 3RWOA 2PN6A 2GNOA 2ZJ5A 4R1HA 2F43B 1XGSA 2AL7A 2HJVA 5A0FA 4W9MC 3R61A 1G18A 3LAPA 4WWCA 2GK6A 3M1EA 5KO2A 1ONVA 2FSHA 2JJ1A 4B3DA 1DTSA 1MO5A 1KO4A 3GFTA 3QUSA 4KJZA 3BY6A 1IAQA 1YE8A 3C5CA 4PTLA 3RRYA 4Q5IA 3H86A 3TUJC 4CW7A 2DB3A 1D8KA 2O8EA 1R22A 1G9XA 1E99A 5TJJA 1ZG3A 2MLKA 1XSVA 3NRVA 2ZBKA 5FLXK 1UBEA 2QRZA 3K09C 5CK4A 1FX0A 5JJIA 4QNRA 2OSBA 2Z83A 4C4PA 2OFWA 4PSAA 4P0TA 1NL3A 1J2XA 2VBZA 3VLFB 4RB0A 3K2ZA 2RB4A 5A4JA 3ZN0A 2GCNA 2CCJA 2ZFWA 2C2HA 3GLIB 3J81Z 4ON9A 3CWZA 3I8XA 1IZ1A 4G3XA 3L00A 4HV5A 3GLGB 2YPRA
chains in the Genus database with same CATH superfamily
2JFWA 2KZGA 4EY6A 4BE0A 1MX0A 2VK1A 3B73A 4CDGA 4K1XA 1EUCB 5KTKA 2C2GA 4TQ9A 3IILA 4CEJA 1Y8RA 1E5LA 4OYYA 4HN9A 4BEBA 3U1VA 4Y6PA 1KTIA 4JK3A 4UM7A 5F7JA 2BVNA 3ORYA 2O3UA 3QKSA 2JSCA 5JVTA 4IV5A 3NIDB 3WK4A 3BCBA 5J63A 4O5VA 4GL2A 4IIJB 3JAKA 5CRIA 1QVUA 2P41A 4D9FA 4GFBA 1MQAA 5C1IA 3PNTA 3OFJA 3T1YB 3S8EA 4NABA 2IS1A 4PFPA 3EDRA 1SRQA 1B1BA 3GGSA 2VSYA 4XVUA 1L7OA 1TUBB 1CR4A 3GJRA 3CO7C 1FXWA 4M8SA 4WWHA 4ZC3A 1XPRA 1S89A 3AXSA 5G2OA 4F21A 3A6PC 4B2LA 4OQPA 2R1UA 1V71A 2QYHA 5GM1A 1TAGA 3FVQA 3B82A 2QU7A 4ZYAA 3EWNA 1KDTA 3RJTA 3RKWA 4PXAA 4RVOA 3L2UA 1QCDA 1PU2A 4N6NA 1N2ZA 4JLDA 1XJ0A 4MWOA 4PLFA 3TQCA 3U6SA 4JBYA 2V8BA 3N05A 1JIKA 1ZD1A 4PAQA 3A1DA 2Q9BA 4P54A 3QEOA 2E71A 2QMUA 3L93A 2AFRA 5DM2A 3OTIA 5IASA 3CCFA 1NN5A 1KMCA 2AHMA 1S3IA 3AJ8A 2NS7A 1H3NA 3KYDB 4UBOA 2A7XA 5AW3A 3D59A 4PEVA 1QFYA 1EDZA 5CK5A 1ETWA 3CMCO 2QN6A 4JBAA 5AKYA 3F8MA 4MO2A 4PFQA 2H65A 1WSDA 4FGUA 1PZMA 3G2MA 3ONDA 3HM5A 4EJMA 1HBXG 3NKVA 5C2JB 1EUCA 3MAGA 2YW9A 4AYBA 5LBUA 5ALHA 3HWWA 1WB6A 1QUSA 3HCNA 3KIPA 4HH1A 3DVAB 2YIVX 1T1GA 2QR5A 2M32A 1ZGWA 4HN2A 2B7BA 2OO3A 1GM5A 2V3CC 1E62A 3DLPX 1FYWA 2FZKA 4BMSA 1TGVA 2ZBEA 2ZGVA 3HPHA 2WFMA 3KL4A 3LH5A 3JAKB 4PFOA 1PM5A 4M36A 3RREA 1JEYA 3PC8C 1JFRA 4Z0PA 4KNYA 1DAPA 3DA1A 1E7QA 1G41A 3SM9A 3CNOA 3U3XA 2KHHA 1IHPA 3WTCA 1C3JA 5ESDA 5EWLA 4FEYA 1STOA 3CG0A 4Y2JA 3KVOA 3QYAA 4MP6A 4P2BA 3UAYA 4WOKA 3D5RC 2XIGA 3GW2A 2Y1LA 2AK3A 4LXHA 3LW8A 2IP2A 3VU8A 5NULA 1XZNA 2KISA 4I08A 4X7BA 3FSEA 2PLRA 3IKTA 3H8SA 4DMRA 3GARA 2HQOA 2FMLA 1PR1A 4WDRA 3GTMJ 4YJ3B 4B9EA 2O2EA 2RH4A 6Q21A 3U4QB 3S44A 5IKEA 3C97A 3EH2A 2CHGA 3AJRA 4QG3A 3TQQA 4JLUA 2XYHA 2V7QA 1B8IB 4EF4A 4R1NA 3C2GA 4HZUA 1TCCA 1I1QB 3RGSA 1FUEA 2QRNA 3EETA 2JVJA 1K7CA 2KRFA 2ZIUB 5JXHA 1FDSA 3H19A 3IQEA 1NPDA 5AHKA 2XZUA 3KSUA 1QFMA 5A4FS 4CHTB 1B6AA 4I19A 3EEFA 2EZ9A 1LDBA 4HLNA 3W2EA 2KXEA 3PB3A 1RYFA 1O9GA 2F9MA 4NBNA 4ZHQF 1U5BA 5ES3A 4WI1A 3A28A 1N9KA 2QYOA 1W48A 4ON0A 4QRDA 2PZGA 2I7PA 2PMHA 3PUVA 2LD5A 3E7XA 1MX5A 2Y1EA 1SVIA 3ITDA 2BW0A 4JJIA 4HV4A 1FQOA 2JJ1D 3INTA 4Y7NJ 2LFBA 3R20A 2Q4RA 3EQ9A 4BMDA 5LP6F 4RTRA 2C3YA 4G7ZF 5C8ZA 1UMDA 3JAMZ 5BMOA 4UEOA 1CC1S 3OX2A 2NZ2A 1R64A 4LUCA 4V3BA 4ZO7A 5KSOA 2P9FA 3J27B 3G49A 3G71I 3VBCA 5GINE 4CMIA 1YO6A 3L92A 3ONNA 4R6WA 1DBVO 3RADC 4ZYHA 1P4RA 1XCOA 2PGAA 4L8WB 4NULA 4H1VA 1EFHA 1Z07A 3ZWPA 1QC5B 2VUSA 3P4UA 3OWHA 2LY9A 3I6QA 2QVCA 4Y8VA 3I05A 4B7HA 3WVNA 4GPZA 2UYCA 1E2UA 3MXOA 2ODPA 2QSHX 2QNJA 1XTSA 3I9LA 4US2R 1Z6TA 1I13A 2VAVA 5JXIA 2C58A 3GAZA 4H1UA 1GV1A 4B4VA 2QNIA 1B6RA 4M38A 2X23A 3WP0A 3QSGA 1BHO1 4R71A 3DYIA 1K6JA 4GZ6A 4L3WA 3FOEC 4N5DA 3AVTA 1FFEA 3N59A 3NHSA 3COYA 5C8VA 3NGXA 4K3VA 1PK9A 3A6LA 1OH5A 5F0CA 3EN0A 5FT9A 1BXKA 3KC2A 4LW8A 2HL7A 3ZZNA 1HNXB 4DFDA 3UHAA 2DH6A 2H8RA 1GSIA 1NBMD 3L77A 4XZ3A 3Q8KA 2D0OB 2X2EA 4I5DA 3PTLA 5DW3A 4Q7QA 2AI2A 3KB1A 1UJ8A 4BJ6C 1UOQA 2FQ1A 2OL4A 1YFLA 2NNYA 4QFBA 2PAFA 4A3FJ 1M7GA 2ZBVA 3D31A 4LGYA 4BE4A 2B69A 4MB6A 2ZB9A 2YYAA 2BZSA 5JNUA 4DMMA 3KALA 3ND8A 5EUCA 2Q0XA 1B2RA 5BWOA 1MSEC 3F96A 2FFHA 2IRWA 5B4UA 3SEFA 3LO8A 1ACJA 3PJFA 1NVBA 3PRJA 3U3OA 2O8FA 5DRYA 5IT0A 3B7GA 2YR2A 1O97C 2ZUVA 5FLYA 3U60B 1VBFA 3BRWA 4RM2A 4HATA 2L19A 3ZJUA 1FB5A 1Q0RA 5AXAA 3TPCA 5KKCA 2OV6A 4RD2A 5GV8A 2W7TA 1WPXA 5JRZA 3TECE 2Z2ZA 4D26A 3PVSA 1E3JA 4MQEB 3GO5A 2ID3A 1V1MA 3KXPA 4FNMA 1IBCA 2ZK7A 4U7TB 2WV0A 3VJLA 4A82A 1CP3A 5JXGA 2RC6A 2VTBA 3H9QA 3RK1A 1M75A 3K0CC 5KS2A 1EFCA 4DBQA 4YMUA 1E9EA 1HYGA 1KZ4A 5KIAA 1ENHA 1N6PA 4CV2A 2I8CA 3GFSA 3LKZA 4DSZA 4V2FA 4PNPA 4ZREA 4G4NA 3ZD6A 2FQ3A 1RIFA 2Q5CA 5DK4A 1G4UR 3D6AA 3I71A 4OMYA 3T5BA 3IKVA 8GPBA 1EUQA 1U0TA 4G5YA 5H82A 3A01B 2RVCA 1EQUA 1A3CA 1NO1A 2X4IA 5AM5A 3OEEA 3ONQA 4W1RA 3OOPA 5DI3A 3FR7A 3KJGA 1QGPA 4GKAA 1V5FA 4UQLA 5A2QA 3MZ0A 3GCMA 1OPCA 2G0TA 2G1AA 1XGOA 2OGWA 2VPZA 1E61A 1XDZA 2PT6A 2DPMA 3SSAA 3HR4A 1RZRA 4OTZA 4CIYA 1ETHA 1TU3A 3ROUA 4ZQCB 1M5RA 5FJIA 2B0JA 3ICCA 5DRTA 3TLGA 2RV8A 5CDTA 5F6FA 2B9SA 1JE0A 4CL2A 1XTUA 1U9IA 1XLWA 3QBEA 3DUFB 5LMNM 1T1JA 2I3AA 5HOOA 4N03A 2J0EA 2AKEA 1E7RA 1RZ4A 1JJ8C 2CJWB 2W6MA 4AC0A 3JSXA 4S0XA 3L4JA 3CSDA 4EPRA 4UTVA 1U1FA 1U2GC 5BPVA 2KEBA 2FW1A 3NHLA 2QIOA 3VC7A 3ZBTA 3KYDA 3AYZB 3WTBA 4C1NA 2OA0A 3VU0A 2B1IA 3N2GB 1U3FA 1XL0A 4MQFA 2P6TA 1ERDA 4ITQA 1DAOA 3AERB 4I50A 1QAOA 1PT8A 3I9KA 5CDYA 3EPRA 1DBSA 1UK7A 4BX3A 4FT2A 1LW6E 4ZAGA 2QA4I 1MB0A 3L7JA 1R5BA 1ZOOA 2L9NA 4B46A 3TQHA 4R9RA 4UARA 2B61A 3LDHA 1EHCA 2YMLA 3RD5A 1IN5A 4J4TA 4URFA 4EGZA 5LSAA 3FF1A 1S3FA 2ORIA 2BT4A 1T56A 3Q5EA 3K0KA 3ET4A 4EBFA 3LFUA 4D8XA 2RHHA 4GG1A 3HVUA 1Y8AA 5SY9A 3TOZA 2VBCA 2ZR7A 4LWPA 4PN3A 1XZQA 4MUGA 3TRIA 1X2EA 2R751 3HMQA 2KJQA 4AJLA 4E6KG 2JI4A 1N7JA 1VJ5A 4BWVA 3WL8A 5B3SH 3FPLA 3JQ9A 3ZWBA 1II0A 2F5SA 3EVAA 1GL9B 3AILA 1Q57A 2J5OA 2LMDA 3HV2A 2QCUA 3OMWA 5JVDB 1OGIA 1VIAA 3OESA 3B2NA 3AUXA 2VHJA 1OIZA 1ZRSA 5IPAA 1A9SA 2GXQA 4R81A 1XL1A 5DMHA 5AKXA 2EKDA 3UNXA 4V0NA 2MHCA 1YZTA 3FWZA 1RRFA 3BXGA 2ORED 3RHFA 4GP6A 2E85A 2GRAA 1DXOA 5BN5A 4UVGA 5CLIA 3MJCA 5JPDA 5JNVA 2CJWA 4LMRA 1Y6IA 3U62A 3HL0A 1XG1A 3T7CA 1OOEA 1I1NA 2VT3A 4JQFA 3AOGA 4QULA 3FRHA 5T3UA 4EJ2A 1T08B 1IZ8A 2QRVA 4RTLA 3UVEA 2VPYA 1W0JA 2WE7A 3E8SA 3IP6A 2AMVA 2CL7X 3P9KA 1X7DA 1E6MA 1V1RA 3B6CA 2Z6VA 1MBEA 1SM4A 3CW8X 3RGGA 4G1CA 1PBNA 3ASVA 2DWMA 1KAMA 2OHIA 4IMRA 1X7XB 2F64A 3G2HA 2JY5A 1M8GA 4BE7B 2OAP1 3J7TA 4AG6A 2G88A 2GEFA 3L9XA 1N6IA 3DV0B 2PX4A 3ZN1A 3KEYA 1KH1A 3GXBA 2LW7A 1L3BA 1X4OA 1O7FA 2X1LA 2BISA 4B6JA 3ZHUA 4YDRA 3EPLA 4L4SA 4ZYTA 2R84A 3TM4A 1LQ2A 4BKOA 5ITSA 1LTMA 3F8FA 4R8RA 3MJFA 3WLNA 4MWDA 2YV4A 4QYMA 4KFUA 3AL0C 5TSDA 3JREA 4WZAA 4LF4B 2NLOA 4A6EA 3GA0A 2LD4A 1O6ZA 4A26A 4G8DA 3QGMA 4S1PA 2YHUA 3B1YA 3V7FA 4UBMA 3USZA 1P7PA 5HIJA 5FXMA 1AUAA 5K3DA 3E9SA 2VUUA 2W0SA 4HNTA 1NSYA 3EYWA 1J2TA 4N9QA 4RIHA 1OXKB 3LLUA 1YRQA 2OBMA 5BW6B 1TAQA 4POAA 3NNDA 4F96A 3KB8A 1VCMA 3BKXA 3THYB 5DISB 1BNCA 1TL7C 2QRMA 4BN4A 3OCZA 4NZMA 2XKBA 3GA7A 4IF6A 4CQMD 2D1QA 3NRJA 2VQFB 4IXWA 3AJIB 1HF0A 1DXYA 1XLUA 3SFTA 1CJMA 1QUTA 1XDBA 3PKJA 2OM6A 2GCGA 2DTEA 1D5WA 5KYKA 5HXAA 2ZS9A 3LDUA 3MGCA 4G0WA 4PHFA 3U3KA 3ICVA 4TMFA 4D9HA 4HEA6 4F85A 4K9OA 1FLVA 3K6KA 3HWX1 4PNEA 1ORHA 4HAUA 4AUKA 1LPBB 4RD3A 1MV8A 3A2MA 1TMGE 3W5CA 5FPPA 2J08A 3WFJA 1F60A 1U8TA 3PA8A 2CFSA 1XCLA 2VI5A 4GYKA 2AXNA 4YJHA 5E4JA 5LA6B 3WTVC 2FZLA 4BVHA 4EVQA 1N6RA 2EKQA 4B7UA 2CHVA 3C58A 2IS6A 3FWNA 2PLAA 1W5EA 1OU4A 1VRCA 2ATIA 3COSA 5CD1A 1IK4A 3GJ4A 1JQBA 4Q3NA 4X6LA 5CVDA 2W6ID 1GKIA 2I2CA 1PSWA 4FI3C 1ZHOA 2IYUA 1CUZA 3I32A 4PX2A 3FNEA 4UATA 2P3SA 3PC3A 2MC3A 4B85A 2JNHA 2V9CA 2CMKA 4Y6LA 3TW0A 2QV0A 3LBFA 4XXHA 3Q2OA 4LFAM 2HA3A 5HZHA 5LU9A 2RKOA 5K3FA 1PT6A 3D6FA 2OCLA 2OOBA 1ID1A 4GX0A 4C01A 2ZE8A 4XWWA 4TV8A 4D56A 3YASA 2DUUA 2IEKA 1TNDA 3F6PA 1T8IA 2GBYA 5EWMA 4XKCA 4BS9A 3DT8A 3ZCBB 1WJBA 1T9CA 3QRWA 1LLCA 1SXJE 4PPYA 2AOUB 2W93A 3ZHTA 4UNNA 3DVSX 4NHEA 4HC4A 1BOFA 2NQ2C 3OAAD 3PXDA 1LVUA 4FMDB 3KZMA 2M2IA 2Y77A 5E8GA 1S7EA 5CIWA 1TLLA 4F1IA 2DFVA 1YI2I 4E4TA 1KJJA 1QNLA 3WA7A 4F4DA 4M54A 4AZSA 1JQDA 3AUFA 3A9UA 1FYXA 3I04A 2C96A 5CT9A 2ZTMA 1QR2A 5ALDA 1VIMA 3P0FA 3B9PA 4R5MA 2JS7A 2A30A 3RDPA 4RXUA 2A9RA 3NW9A 5KVVA 3GJSA 2VP4A 2OCIA 3QVKA 4XIFA 3UXHA 5AD1A 4OK6A 3O03A 1ZD4A 2A78A 4UUBA 1UC4B 3EPKA 1WB4A 2FRXA 1NV9A 1F0YA 3T4PA 1VI0A 3MGBA 4ID9A 2ZRQA 3U9TA 3WQHA 1UZLA 1PL6A 2WHEA 4A7PA 5GGXA 1D0XA 5EGOA 1PJIA 1MZBA 3R3UA 2ZI6A 4D8UA 5IH3A 4U02A 3SXJA 4Y15A 2BCGY 1NJ2A 3Q85A 3PJDA 2PMDA 4YRBA 4ZK2A 3OEHD 2V7BA 4QFCA 3WKEA 1FNBA 1NVXQ 1S2OA 1CUFA 2G9WA 4M3FA 5IZ7D 4BJHB 1J2RA 5HCUA 1H2RS 1JGGA 1WKVA 3OWOA 3E23A 3R5XA 3PFBA 4Y9DA 1P44A 3WYBA 2I76A 1M33A 4XWAA 2QP9X 1SFXA 1GNVA 3IEIA 5BV1A 4X3PA 5HVNA 1XTRA 4XJSA 2A35A 1Y3FE 3LWFA 3E8MA 2XXBA 1EVIA 3GTKJ 1UCRA 1Z2CA 2ZETA 3R41A 1N2CE 5L3GA 3PUFA 2VS1A 4CR6A 5ALGA 1WJAA 3VH2A 1PP7U 1GG9A 1PNTA 3P94A 3HKZN 2KLBA 1E18A 3L7BA 2Q3BA 1OZGA 3ABKH 3ECSA 2VBXA 3QKRA 3FHTA 1VE6A 5DV9A 5EHNA 1J1IA 2VPWA 4DR7M 1JU4A 3DPIA 1E9SA 1K8XB 4DMLA 3INYA 4F86A 1N5JA 4IM7A 4LC1A 1L7AA 4WNIA 4HBLA 4KN5A 1YB5A 3HNOA 1R8YA 4FFMA 1KQ0A 1S96A 2JGAA 1KI6B 3ZE9A 2WFAA 1YK1A 1Y0NA 4IFEA 2JRTA 3AR2A 4ZYEA 2AB0A 5AVRA 4OQXA 3FPHA 2Q1TA 4RCZA 3JQQA 2YV3A 1Y5MA 3S1RJ 2JZCA 1H2BA 1F7VA 5HHTA 4ETSA 2XRFA 2DPHA 1TJ4A 5CDSA 2QGUA 4K9LA 1AOXA 3HJAA 1NBEA 5AW4A 5FA5A 2IEIA 4ZDWA 1A7JA 4Q05A 3WGZA 1U5CA 3H7AA 4I5FA 4DUYB 2DZLA 2CU7A 4BO9A 2VUTA 3AF1A 1ZDMA 2UVDA 2Y68A 5KYUB 4MGIE 4X5OA 4AIHA 3I4VA 1G20A 3AFGA 4GYYA 1V55H 3SHOA 2FPIA 1LUJB 1ISGA 4HLXA 3ZU5A 2HWUA 3MOIA 1P1JA 5ALQA 3RVNA 2JFOA 2VXOA 1GU7A 3BZKA 2ZQ5A 4TYWA 5H7XA 4K9KA 1XZCA 3BA6A 1FJHA 2EV0A 2XVZA 3KKKA 3EVNA 5JLJA 3OSGA 4M1KA 4TYYA 2QN8A 1OXXK 4OQEA 4RH1A 3OPYA 3RPQA 4XFKA 3J81A 4OX9M 2V97A 4R8KA 3JASB 2GH1A 1XGSA 2C5AA 3CNHA 4B4UA 3UMVA 3H17A 1PNQA 3IUBA 4KXXA 3BMOA 1N3YA 3E22B 4R2LA 2WAFA 2VRCA 2CF5A 5C5DA 5D5QA 2GCNA 1YR3A 2E55A 2MG4A 2NG1A