2QBYB

Crystal structure of a heterodimer of cdc6/orc1 initiators bound to origin dna (from s. solfataricus)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
368
structure length
368
Chain Sequence
KNPKVFIDPLSVFKEIPFREDILRDAAIAIRYFVKNEVKFSNLFLGLTGTGKTFVSKYIFNEIEEVKKEDEEYKDVKQAYVNCREVGGTPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIRAIIYLDEVDTLVKRRGGDIVLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEYGLIKGTYDDEILSYIAAISAKEHGDARKAVNLLFRAAQLASGGGIIRKEHVDKAIVDYEQERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISELDMFGIVKIRIINRGRAGGVKKYALVEDKEKVLRALNETFEDSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (33-MER)
publication title Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Replication/dna
total genus 112
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09079 Cdc6_C CDC6, C terminal winged helix domain
B PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2qbyB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qbyB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qbyB02
5GADl 5HS8A 1H0MA 2EFDB 2ORIA 3LY5A 4OIPF 4ENKA 4KMFA 4C0HA 4DKXA 1GNPA 1SKYB 2VP6A 3DVLA 3HTUA 3CJNA 1GILA 2AD5A 3DPTA 3C8UA 4PO1A 2XOKD 5AJVB 4C4PA 2ZRLA 2J5XA 3D6TB 3K9LA 2DFLA 2GAAA 3AGQA 3KKPA 3BRWD 4I98B 2YOFA 1E2XA 4LOAA 1Q1QA 3AKYA 4XRFA 1GL6A 4GMDA 1V4RA 4TSFD 2WWGA 3B2EA 3WG9A 4AIHA 1TUIA 4N9HA 1UBGA 4EJSA 1TEXA 2AD1A 3RDPA 3QPUA 3K0LA 4PZJA 3WTTC 3W3AA 4BLQA 2FX3A 1KO8A 3ND8A 2IXFA 1ZAKA 1SXJD 1FLIA 2IJLA 2I1QA 5EXSA 1XD7A 2WTEA 2B7CA 4G5QA 5D3MA 4IDQA 3TNFA 1OXXK 1UEIA 2IS4A 3OESA 2X77A 5FL7D 2FPMA 3TO6A 4BHCA 2ZYVX 4GMXA 4NPHA 3ZD7A 2ZMEB 2RGBA 3GFPA 3ZVMA 1HV8A 4KIFA 1PP8F 3DPUA 4TLDA 2WJVA 2JJ2D 2WWYA 2SHKA 2ZRAA 3RS7A 4EJUA 3VR3A 2XNDA 4DDVA 1KJWA 2FGKA 4F92B 2HFHA 3MQ0A 3NTUA 2G1JA 2JJ8A 3QKSA 4UXNA 4D0GA 4A6EA 2KIMA 4BZXA 4QM7A 4BFTA 4D0NA 3IO3A 3U44B 4KLNA 2QZ8A 2R7DA 3RPUA 1BYUA 2HLDD 5DYIA 4MQ9F 4KIBA 1SKQA 4CGZA 2BMEA 1EFUA 4BLRA 1JEDA 2ZI3A 2C03A 3C16C 4ZDIA 2A5JA 3K1NA 4LYAA 2O8FA 3HOTA 3S2WA 3Q7QA 3V8JA 5KSOA 1SD7A 3IIMA 3DV8A 5E8IA 2CLSA 2IBMA 2JDIA 4KYUA 3C15C 5FFXA 3V4RA 1LV7A 4V0NA 2JATA 4EFLA 3GYHX 2QY9A 1EH8A 3L7WA 2GCPA 2J7PA 3DEFA 4KNYA 4XVRA 3ETLA 1KHTA 2IXGA 1OIVA 4M6YA 1UKZA 1WQ1R 1Z0AA 3N2IA 1DE0A 2QAJA 4QBGB 3VHLB 1P73A 3ZQJA 4BPBA 3B7GA 3IHWA 2F9MA 5D6EA 5B58C 3F5FA 3DQVC 5J4KA 3E97A 1DVRA 3BB1A 3PCRB 2RGEA 4B3DA 2Q3MA 5DYMA 4CT4B 1XGSA 3I8XA 3GXOA 5JLJA 2ANCA 2WPDA 4ZKEA 3UK6A 1ZINA 3S1AB 1OFHA 2H92A 1U0LA 2AN9A 1Q1ZA 3IL2A 3UKDA 4WA7A 2XXAB 3ML6A 4HV6A 2IHYA 3CZPA 1RRGA 4QBHA 2EYQA 1KY2A 4IHSA 3BJ6A 2ZAMA 1XMAA 1XXHE 1D2EA 2CCJA 2DWPA 1HA3A 4EVIA 4JKIA 4NKRA 5FL3A 3UMFA 4ARZB 3FHTA 2VBCA 2EWNA 3CO5A 4B71A 3CKLA 4DDWA 3THYB 2A61A 1NLZA 2ZJ5A 4AI6A 2F6RA 1E9DA 3QENA 5E1XA 3VHXA 4CDGA 1W0KD 4YMWA 2DO7A 4IDNA 2VBZA 3LBHA 2VH5R 1NG1A 1OLOA 4TWZA 2I1VB 4DUGA 3HRMA 4Q9HA 3ZMTA 3Q8XB 4NHOA 1P2TA 3EA0A 3KLOA 4LB5A 3O8DA 4QGAA 5EZ6B 5G3YA 1CRQA 2HXYA 1X8LA 3A4LA 1XMSA 2CHGA 2VPPA 3ZJYA 2BMFA 4P31A 5F64A 5LEJA 5BMZA 2PLYA 4GRAA 2A07F 3DMNA 4LK1F 3V7CA 3WTUC 2FPLA 4GOJA 3UWOA 1ZC3A 2UZKA 4ZYHA 3EWAA 4NYIQ 4YFXF 1MO5A 2H57A 3OIWA 3K1MA 1IY0A 1CEEA 2L01A 1S8NA 4CEIB 1P4SA 3W8NA 1R8SA 1COWA 2UZ3A 2FMXA 3NWJA 4HLCA 1OB5A 5B30A 1QVAA 3QEJA 2VOOA 2ECKA 4UXIA 5FOXA 3TVDA 1XD2B 4P3YA 1W36D 3DDCA 4C2UA 4FMDB 3I92A 2OAQ1 1OXTA 2Q9BA 4V02A 1GUAA 2JTVA 2RGCA 5C1BA 2JLUA 1MOZA 1Q21A 1W4BA 1O3QA 2FFQA 2MMGA 4L9WA 1VG0B 2MBFA 1CIPA 5JWHA 2AR7A 1DARA 1SFEA 4A5MA 1U5TA 5FD6A 3IQWA 3KE2A 2F2EA 1GL9B 4US0R 4V0LA 1XP8A 1BKDR 5M04A 2GF9A 3T1TA 5LHIA 3C41J 4RD6A 3ADDA 1GXQA 4PPQA 3M8EA 4R9UC 4WZ6A 4XVQA 1XMIA 3CM0A 3REFA 3IRQA 2E1CA 1KU3A 2B6HA 3MUFA 5DE3A 1NJGA 2HV8A 3TUIC 4DXAA 3PEWA 3K0AA 1UB9A 2BIFA 3ROUA 5LHGA 5FO5A 1DAKA 1G6OA 4PSKA 2NG1A 5FUVA 5L3RA 2EA4A 3J81K 1TQIA 2ORWA 2RGGA 3T5GA 3TUJC 3MWLA 2E9SA 5JECA 4WVFA 5FR2A 1N5KA 4LX0A 3OEHD 3FF5A 1HW5A 2A3SA 4N0BA 5AR1A 3MWJA 2OBNA 4HYEA 2VHQA 2L4AA 1KSJA 4BQSA 3FE2A 2V6JA 2ORVA 3KKQA 3VKGA 4AWXA 5K5RA 2OCAA 2VODA 2Z43A 3KDSE 4BAYA 3BPXA 3AF3A 4P4SA 2A69F 2GIVA 2L0XA 3RWMB 5EE5B 4P55A 2Z0MA 2O52A 1XFAA 4CXFA 1OV4A 5FGMA 3WNDA 1SVLA 5JWOA 2MA3A 1ZUNB 5EE0A 1RJ9B 2P6UA 3EYYA 5KO2A 2RCNA 1JXOA 4O6JA 4MNUA 3FKQA 1RFLA 1YZUA 1YS7A 2EFGA 1HTWA 4A6PA 1I1SA 4ZI2A 3U3KA 4ZV4A 4B47A 2RQPA 3HU3A 1ZGAA 1G1MA 1GG2A 1AGPA 2Z33A 1KGDA 1QHSA 2WWIA 3O47A 5JFGA 4HB3A 5KDLA 4A0XA 1XSXA 3LLUA 2OT3B 3BXZA 4LSGA 3BWGA 1XTKA 1G8HA 2CBZA 2IYZA 2O8BA 3FX3A 1NMYA 4L15A 1OMIA 2DWOA 2J9RA 4IPAA 2CL7X 2RGNA 2V54A 3C7KA 2P5TB 4C7OB 3N2EA 4GP6A 1N5IA 2BBYA 1S7AA 1IQPA 1C9KA 1UADA 1SVWA 3CR7A 3IIJA 2Q8KA 4MKGA 2QTFA 3KFVA 2IWHA 4ZIRB 1AOYA 1VG9B 1XPRA 1MGTA 3QF7A 3WTWC 2H16A 5JSZB 3F8MA 3PQJA 1IHUA 3ZYCA 4DC9A 5C4MA 1XDBA 2J0VA 4LPKA 2HYDA 4UJ3A 5H6RA 3TMKA 2QMOA 2OLKA 1AS3A 1G3YA 1ZCBA 3OAAD 4TL7A 1AM4D 3M1IA 3BOSA 1N6HA 2BEOA 3TSZA 5KSYA 2HYIC 1HKTA 3KQNA 4JBAA 2R3SA 4DRZA 3U4QB 3TUZC 1ZRDA 4HZUB 4D0PA 4IHTA 2XTNA 2REBA 2QWWA 2QUZA 2V6IA 3NQOA 3B1ZA 5CYOA 2BM1A 2CE7A 1OXUA 5EP2A 3F23A 4NB5A 2GVDC 3J81Z 2QP3A 2F3RA 3GJ3A 5B2ZA 3VAAA 5FOVA 2JIZA 2HZTA 1JBKA 1RZ3A 4LYJA 4KVGA 2BJWA 4DLRA 5FTKA 2D74A 3I4PA 3DF8A 3R4KA 3OOPA 1P75A 2MLKA 2IHBA 3IDQA 3L0SA 4CVNA 3SXYA 2RH5A 4OK3A 4RB0A 5DNYB 2NS0A 2LF8A 3QJYA 4B3BA 1XB2A 4HQMA 1II8B 5HE8A 3QY0A 1TQ6A 3U9GA 4LPSA 4HF0A 3Q5FA 1NMZA 4I09A 2PMDA 2ERYA 5BWMA 2IP2A 3WGIA 3BB4A 3JZAA 4CHUA 2HWVA 4HB2A 4LC1A 4A2QA 4KVAA 4G3XA 1SXJC 3D8BA 2AFIE 1IN5A 1TF5A 2RC4A 3ZMZA 2VOPA 1YZTA 3GLHE 2EFOA 3F72A 4MRVA 1UFQA 1D2MA 1NY6A 2WOJA 2BKUA 1X37A 3HOSA 1ZRFA 2QAGA 2XNDD 2ZITA 1C4OA 2DU9A 2RGXA 4FCVA 2C95A 1I4LD 1ZD8A 2PJRA 1E2LA 2M45A 3TIFA 4V0MA 2IA1A 4HBLA 2RKOA 1U2WA 1DG1G 2WIBA 1Z8FA 3B82A 3LNCA 3X1WA 4F4JA 4Q7JB 1VG8A 4LB6B 2OA4A 2VP5A 3WGHA 2GA2A 3DP7A 2PBRA 3B1VA 1LVGA 5IHPA 3AVXA 1T8UA 4DZZA 2O8EA 4DCSA 2ZJBA 1P6XA 4FIDA 1GP2A 4OHZA 3JVVA 4LYFA 4FCWA 1DBSA 3KB2A 4RD2A 2JDID 3KX2A 2R6GA 2TMKA 3DMDA 5C4GB 1KZ7B 1AJEA 1S3SA 3T35A 1QZYA 1Z6TA 2CW0F 2XASA 1XD9A 4Y13A 1T3LA 1F6BA 5JJLA 3I32A 1JPJA 1N6OA 1I5ZA 5F1RA 1W2GA 2FF7A 2J7PD 3LX5A 4PC1A 3EZ7A 5LRRA 3E1SA 3GJXC 2EB7A 4HAYA 1Z5ZA 4HDOB 1T6SA 1BIAA 4N1AA 4A1FA 2QNRA 2XX3A 3U3RA 4QNMA 5HOOA 4HAMA 1W48A 1Z0FA 2D62A 3T1QA 3ZZTA 1XZQA 4DCTA 3VNVA 1KI6A 5J4LA 5HE9A 4HAVA 4XSGA 2QPTA 1KSFX 3BY6A 4RY2A 3A6PC 3EIEA 5JHUA 2AS5F 5KNDA 2F9LA 3ADCA 4HEJA 1WE2A 1SXJE 1J59A 4EFMA 3GLFA 1BN5A 4EGYA 2ZI6A 3BZ6A 2ZU6A 3F8BA 2WPDD 4A8JC 5EEHA 2G9NA 1FT9A 2OU2A 3FDIA 3BERA 1B9MA 3UPUA 4HA8A 4A12A 4JL6A 3FWEA 2VO1A 4JK1X 1DS6A 1EWRA 5D5XB 2F43A 3QPVA 4K81B 2V1UA 2MLGA 4NU0A 4U5XA 2EV0A 5CYPA 4AD8A 4TL6A 4XJXA 5EE3A 5FUYA 5HCIA 2ZJZA 4NCHA 1ZD9A 1EH7A 1FC3A 2I4IA 2IA5A 2LKCA 2FQ3A 4C0SA 4XH9B 1U8ZA 3BH7A 2DBBA 4LDJA 1FX0A 1G7TA 1T98A 3WU1B 4M4SA 5FOTA 4LJ8A 2OBLA 3KCCA 3EAQA 4A82A 3X2SA 4DBLC 4B43A 1W5TA 2DZOB 2ZI4A 2FEOA 4LBWA 4M1KA 1FTNA 4G8XA 3DOFA 3FKSA 3EZ2A 3IGFA 2OO7A 4DUGD 1XGNA 2H8KA 5L3QB 4PR0A 1NVVQ 1XEXA 2QE7A 4MITA 2JGNA 1L2TA 3GF2A 1DEKA 2H5EA 5A2QK 4ZH4F 4I81A 3H92A 2O0JA 1Q1HA 4M1OA 3NBYC 4U0VA 3EC1A 4LLLA 2HYGD 3X1DA 2FU5C 4KYIB 1X3SA 1KU2A 2FEMA 4B2IA 3O2PE 1CU1A 3CPHA 3AVUA 2XB2A 1NLFA 5CLSA 2W24A 1USSA 2ISYA 3K2ZA 4XTRA 2WSSA 4S35A 2Z83A 3NVAA 3I58A 1YYVA 5HLIA 1M1YE 4HAXA 4II7A 3UG7A 4TYYA 4QNRA 2EFQA 4TQUS 4W5JA 1COWD 1RW4A 2ELHA 3QEOA 4A2UA 3ZIAD 3VKWA 3W90A 1PUJA 1TW2A 1J8MF 2BYVE 1AKYA 3W6JB 1XJCA 4JLDA 4YG2F 2R8RA 3MHVC 1DG3A 1IBRA 1W36C 1Q20A 2V1DA 3TW4A 4HX8A 5L3SB 4GO1A 3B13B 3FOZA 5ICCA 5LEKA 1OH8A 2VQSA 4AYTA 1S29A 3K0CA 3AB3A 3SE0A 1IRGA 4Q21A 3FXRA 4GXOA 5EUQB 4CEHA 2JPCA 3VKHA 2A3RA 4Q9JA 1Q44A 1FOKA 5D3QA 8OHMA 3TRFA 5JHHB 4I0AA 2XJ4A 2V7QA 4Z1MA 2IK8A 2PT7A 5AK0A 2RKHA 4LBYA 1L0OC 3KKNA 2VIIA 2A5YB 2EFWA 2ZVQX 2EA2A 3A58B 2QEQA 3Q9LA 4HATA 1Z91A 1S2MA 5HPYB 4C0JA 1Z6YA 2B7BA 2OHFA 1Z1DA 5DDGA 1E9CA 3QF4A 2GJSA 2A5GA 4LHVA 2WAXA 3QVUA 3ZD6A 3VNUA 4JS0A 1TMKA 2ERXA 1Z6GA 2COMA 2Z6VA 3ERED 5JRZA 1F2UA 4RFSB 3JTGA 4LHZA 3TO9A 1ZUIA 1US8B 4O0MA 2A68F 1R22A 3SHWA 1M34E 1WSUA 5CITA 5FI1B 5JS7A 1F5TA 2YWFA 4OI1A 2W85A 4TL9A 5FL7A 2V6CA 3F22A 2R62A 1MRSA 5H8WA 4POAA 3NKVA 1MDMB 3EDPA 3EUHA 2BBOA 2VEDA 2BMJA 2OSBA 2K7LA 2ZUDA 5ICEA 3AP2A 5A2QZ 4HF1A 2PMHA 4AIKA 1D5CA 2R9VA 4I1UA 4LHYA 1Z6RA 4XOIA 2W0MA 1AN0A 1E2HA 4Q4JA 5C2JB 1ETUA 2VN2A 1JALA 1WKMA 2IUSA 5HS9A 2VTKA 1J2XA 3F8NA 4M21A 4DT1A 2GXAA 3EPLA 2GBLC 4DSUA 1ZU4A 3FXQA 4HAZA 2OZ6A 1U6GA 2DBYA 2IF2A 4ON9A 4QGFA 4EV0A 5FTJA 2CJWB 4I1SA 4CYDA 4NL4H 1FNNA 4M1MA 3LA3A 2E87A 3K09A 3RYRA 4PHGA 1STZA 3RNLA 1ZVQA 2WKPA 4PPNA 4A2PA 1D9ZA 4GP7A 5AJXA 4M9XA 1G3TA 1U94A 1QZZA 1W46A 1EFCA 2EFCB 4HLDA 3LVQE 4LHXA 5H68A 1KSGA 4FX0A 4OL0A 1KI4A 2JPBA 1A5TA 1N6PA 2ZRNA 4DIEA 1PP7U 4RZUA 121PA 2JJ1A 2P6NA 2ZM5A 2QT0A 4WF2A 3RANA 1R2QA 1P2SA 4PC6A 3E3VA 4CICA 2FNAA 4L16A 1EXMA 3KW6A 2B8WA 4G5RA 4BRWA 6Q21A 1P9NA 3FZVA 1BIBA 1KSHA 2YSRA 2OZUA 3PFIA 1KJYA 1TQ2A 2QRNA 4AYWA 2V1XA 1R5NA 2C04A 1OKRA 3SFZA 2HR3A 2HEOA 4WAUA 3P32A 5FUXA 3QIAA 1ZLKA 1E1RA 2DYKA 3QQ5A 3BPVA 4LV6A 3EARA 4OHVA 1AIPA 1Q22A 2BEJA 2JIZD 3QPTA 1E94E 1HEIA 1LF0A 3GD7A 1SAXA 3C7JA 4ZDKA 1IXSB 4LGMA 4RS8A 2NNNA 1TL7C 3IHLA 2GCNA 3X1XA 1MD0A 3PEYA 1MJAA 1Z6AA 1CJKC 4QOSA 3GWZA 4N9IA 4Q7LA 2FOKA 5BPDA 4G9YA 4P0TA 1EH6A 1D5VA 1E96A 5AUOB 4JLPA 4EJSC 2PX0A 4BFWA 2ZNZA 2YWGA 3EPJA 3QI2A 5BPIA 2GZAA 3ADBA 3MZYA 1E9SA 1PDNC 5KDOA 5AONA 3CWQA 2HCBA 1XN7A 2PT5A 4C9BA 3QKUA 3TR0A 1RNLA 1KO7A 2ZKZA 1T5IA 4P32A 2R65A 2LCFA 1KO1A 3ZGXA 4TMXA 3PUYA 1KMHB 2YX7A 2IT0A 3WTSC 3CLOA 3QE0A 4L8GA 2GJ9A 1EX7A 2W83A 3IBYA 2ZRBA 1IJFA 1DP7P 4ZYGA 1UHMA 4GOXA 3T06B 2JASA 3MG9A 3ND9A 2E7WA 4QLCU 3KUCA 2HCJB 1E6CA 4URZR 2QA5A 2KSQA 2NOAA 4WZBE 4U0WA 2P7VB 2YWHA 3PENA 2ZEJA 3E5QA 3VOEA 4R98A 3ZMUA 2O5VA 4TZ6A 3HR7A 3KZYA 2V79A 1PUEE 1KTVA 4U00A 1W7PA 2QTHA 1DPRA 4MQBA 3CRMA 4TLBA 3GJ6A 4I99A 1R1UA 3BJOA 2OCBA 1NBME 2A6HF 1WRJA 4EPWA 5J8CA 4U0YA 1E17A 2XTZA 4TQAA 2OFXA 3WP1B 1NF3A 2OXCA 1VYTA 4V0OA 1VTNC 2Y75A 4TTRA 4HX4A 2C77A 3R8FA 1H8HA 2FG5A 3CUQB 4ENNA 4TT3A 1XSVA 1BOAA 3L0IB 1V5WA 4KMUX 1D6JA 3QG1A 2F1IA 3QKRA 4AG5A 2ZPTX 4FMCB 1ZIPA 1BO6A 3ZQ6A 1G5PA 4I02A 1LEAA 1NMXA 5FTLA 5HLGA 4EPRA 3GLIA 4LZZA 2EFNA 4PHHA 1GKUB 2WJHA 3VLFB 5CIQA 5K8IA 4WXCA 1G3RA 1NSFA 2ZANA 5LBIA 2GBLA 4QGHA 4AIIA 4HAUA 1NL3A 1DAIA 3QVVA 5AIQA 3DXJF 3A36A 4IDHA 2OFWA 3EPKA 5K8LA 4YDHB 3W6PA 4CEJB 1LNWA 1E0AA 1KU7A 5HZKA 2CHQA 3CRQA 1LVAA 3MAJA 3HHGA 1R5HA 4TLEA 4C30A 1KI7A 1N2CE 4RKEA 2ZBKA 1L4YA 2AWNA 2ZRJA 5J4YA 4B48A 1P2UA 2D45A 2A5FA 5L8VA 4HLQB 3O8RA 2Q3FA 3QPWA 5AUNB 5DCMB 5JRJA 1KAOA 1G8GA 2MSDB 1KAGA 3OEEA 2CXXA 1E2MA 2JLVA 3VR2A 4RB3C 4LHWA 3VR5A 3FKSD 1TTTA 4KFCA 5FPKA 5KSPA 2IEZA 1K7AA 2QE7D 3JSPA 4ITRC 3H86A 3A1VA 3CBQA 1U98A 3KQUA 1N0WA 1UFMA 3THXB 4BEJA 4JL8A 1U0HC 2NTYC 2FF4A 3DPLC 3AKDA 4K8OA 3THWA 2ZI9A 3SYKA 3V00A 1NY5A 4DNCA 1XXHB 5EZ5A 3L9FA 3LV8A 1F4KA 1QHGA 3IRRA 3AVTA 4TV7A 3CTAA 2P8TA 3CRVA 2P5VA 1P4WA 1FYKA 1AS0A 3BP8A 2WSSD 3K9NA 1OT3A 2G0TA 3AVVA 1KK0A 2ZETA 3WYGA 2IW3A 4S04A 4LJ5A 3P9KA 4LD5A 3PUVA 1U8RA 1Z63A 4GT1A 3FHOA 4A36A 2FBIA 1HW2A 5FH9A 4U7DA 3H1TA 4XD7A 2WJGA 2VT3A 3LLMA 1OPCA 2REXB 1ZD1A 1J99A 1GKYA 1RRCA 3I1FA 2B92A 4PPGA 2Z3YA 3I64A 4DWJA 2CL0X 1XTSA 1YJ5A 3BJIC 3C5CA 3KKMA 4JVSB 4LMYA 2VHUA 4HUQB 2EFPA 1GNQA 2OE2A 2VE9A 5IT9K 1D8JA 1E9BA 1PZNA 3FPAA 2Y8EA 3OIUA 4EQ6B 5BOXA 2QI9C 3QUSA 4A0YA 4KFRA 5GVRA 1F60A 2RAPA 2HJGA 4FMCF 3WY9A 5CJ2A 2O8CB 1U5TC 3I53A 3KP5A 2IYUA 3AP3A 5JR3A 3NH6A 3EETA 4MEYF 2FV8A 2V7QD 4Z1MD 2XVCA 3U2QA 2D2WA 4TZ0A 1K78B 1ODDA 3EXAA 1KQ0A 2PCJA 1KYWA 1JJVA 4LV8B 1G7CA 2ZR7A 2H7VA 2P2LA 3THOA 2PBIA 4LLGF 2QPOA 5CDFA 5L3GA 1R10A 1G16A 1AZTA 2N46A 2Q0HA 3DZDA 1G3SA 4UVBA 3H4MA 2WJYA 2OILA 4LBVA 4I7HA 1G4DA 2D2EA 1ZYRF 3QXJA 2ZNYA 2CE2X 2ZU0C 4ZO4A 3UATA 2NZ8A 2F1RA 3BFXA 3KZ1E 4RB1A 3F3XA 1LFDB 4Q9KA 4AKEA 1U0JA 4E03A 4Y0VA 2QN6A 4KJZA 1Z08A 4JLKA 5G40A 4QL3A 1P4AA 4UQOA 1NSTA 3U7HB 4UVAA 3LO5A 1HW1A 2WJIA 4L0YB 1M8PA 2VP9A 1JNYA 3KQLA 3I5UA 4G6DA 1UM8A 1FOEB 1R36A 1SD6A 3CPEA 2QMUA 1JQLB 4BFUA 4LJ4A 1FQKA 3RRYA 4B35A 4JLVA 1WDTA 2QT1A 2RV8A 2QG6A 4BYYA 3H3UA 1FYMA 2FH5B 5J6XA 2FGJA 2HJVA 3WGGA 3NH9A 4M2LA 3FHCB 2YPRA 5DN6A 5G53C 5A0FA 1IXZA 3RKYA 3IILA 3J81k 1FW6A 5LD2C 5LDDC 2QUFA 1GWNA 5B64A 4MGRA 1WBBA 3M0EA 2PJZA 2K27A 3QBTA 4H1UA 1E9EA 1KMQA 1DELA 1ZM4A 2VP2A 4DLXA 1T2KA 1XTIA 3U6BA 2CEAA 3R60A 2CK3A 2GXSA 3D31A 4D6PA 3KKOA 2FU4A 2V9VA 2K86A 2XKOA 5CVUA 1ZU5A 2FZ4A 3CZQA 4O3MA 4TYNA 1CLUA 1BM9A 5KOYA 2GF0A 3SJAA 1LF5A 2IYRA 5DIFA 2RGNC 5DD4A 1HBXG 5E18F 2P65A 1EWQA 1F9NA 5CK5A 4ZCIA 2XGJA 2YOGA 2W57A 4DVGA 4JN6A 3MGCA 4GZLA 4M1SA 4O2LA 4C0BA 3KQHA 4C2TA 2WWHA 1HURA 3U5ZB 1VYVA 2OESA 2QQ0A 1I4TD 2CSOA 4ZZDA 1VIAA 1CR2A 1QGPA 1CBUA 3Q9SA 5IT9Z 1CP2A 4EJOA 1BBYA 5HVQC 1QG2A 1X6VA 2JJ1D 2W58A 3HPQA 4HDCA 2NIPA 5DLQC 3UIEA 1UHWA 2EV5A 2YV5A 2G7UA 3GEIA 1JQJC 4FWGA 2HT1A 2H09A 4IOLA 4KIGA 2YVUA 2YWEA 3B1YA 4LY6A 3PUXA 6PAXA 3QXSA 4RFVA 3T61A 2GZHA 1W1WA 2IEYA 4EAQA 4KV9A 4L9JA 2ZE8A 2WAYA 1SVKA 2YOHA 3DO6A 4MRNA 1E1RD 1QHYA 2MC3A 1W4AA 2PX3A 2WMOB 2ZYUX 3AF2A 1YE8A 2PLFA 1TEVA 2O6GE 4DLWA 4EPVA 3E5XA 4BFXA 2PMUA 4NTZA 2C5LA 3IO5A 5DO9A 1XMKA 5ILSA 1W0JA 4B75A 2JLXA 4FMBB 4OIQF 3DHWC 2HUPA 5EE1A 2GXBA 1WBDA 2IS2A 3LWNA 4D4LA 2GEDA 4EKDA 4Z8XA 4K2EA 5HDKA 1T0HB 1YO5C 1G4UR 1XZPA 3LSTA 3NEYA 3IEVA 3HP1A 5JHGB 3R9IA 2E1RA 1OW3B 1W4MA 3N70A 3L2CA 2NO6A 3ZIAA 1FZPB 3B02A 1A4RA 4DSOA 5B57C 4D2IA 3PUWA 1LB1B 1K5DA 1O87A 2RDPA 2XAJA 1CR1A 1EFTA 3OIYA 2P3SA 1IN7A 4OK5A 1J9IA 4UHTA 4IOJA 2XSZA 4D82A 2PJPA 4Q9LA 4DLVA 3GPLA 4FWDA 2KJBA 5FD5A 3AKCA 3K70D 3LAWA 4QFMA 2OUKA 2CG4A 2GCOB 3HDTA 3CWZA 2QBYA 1Z0IA 2QAGC 4G1UC 2C8VA 4XSHA 1ZG3A 1YW9A 1ONBA 1E2GA 2J0UB 4MYCA 3NBZC 4B2PA 2QGNA 4RKFA 5EP1A 2MSCB 5EXTA 2W84A 5CIWA 4YMTA 2YC4C 1ZRHA 3VX3A 4BASA 1Q1EA 3EIHA 5DV5A 3EPHA 1Q3TA 3V7SA 3FMRA 1SVOA 3ZVLA 1W7PD 1T4GA 3LD9A 1P72A 3HTSB 1DADA 2PZGA 4DHEA 4C0QC 4DB2A 4MEXF 2ZS7A 1AZSC 1GL7A 2QQ9A 1MRNA 4H9GA 4DLZA 4FX4A 4KSCA 4X8OA 5AJYA 2LSOA 3LXXA 2ZSFA 3RS4A 3L0OA 3G5UA 1CXZA 3GLHB 1IAWA 2IYYA 5BYJA 1F2TB 4XWKA 5KUTA 5LHHA 2OAZA 1E79D 1G6HA 4TTQA 1P61B 5EQTA 2NO7A 1E2EA 4PC7A 1H8HD 1GHCA 1UKVY 1II9A 2L02A 3ASYA 4TT3D 4DLSA 3OE7A 3CRRA 4IOKA 3VTKA 1YRAA 3OF5A 2FSHA 3KP2A 3NIBA 3WHKA 1NIJA 3CB4A 4BGDA 2UXNA 3O6BB 3RABA 1QDEA 2YKGA 2RHMA 4B2LA 1WQ2A 3ZMDA 2FNPA 1MJ9A 3P20A 4A6DA 3AKEA 3BIFA 5J4HA 4LWZA 2GJKA 3IUYA 3DM9B 1T91A 3WTZA 2IUTA 1HSJA 4YC7A 3SQWA 1G17A 4RSGA 4WW0A 2BV3A 4B44A 1SVIA 1YVDA 2C2HA 3CO6C 3GO5A 1WA5A 2K5UA 3TO7A 2CCGA 4TMKA 4ASUA 3T12A 4OHYA 2QSZA 3E5HA 3C5HA 1KI1A 3PV0A 4JBWA 4CW7A 2ZMEA 1N6IA 1SFXA 2OAP1 1FNMA 1KK1A 2XKPA 1MABA 1MO6A 1R0XA 1S1CA 4RGSA 3BK7A 4LBZA 4A92A 2XGXA 2KBEA 4V0ME 1U9IC 1ZUHA 3BD9A 4YLGA 1H9GA 1K5GA 3B1WA 1AGRA 2ZRGA 3OEED 2FA5A 4EPYA 4RGXA 4JVMA 5DHFA 1BI0A 2ODBA 3CLVA 1ESMA 3U44A 3MJRA 1SXJB 2GWRA 3GJ8A 2W6IA 4FMDF 3SBDA 5EP3A 2K4JA 2EFHB 5LPNA 3BOQA 2AWOA 3F6OA 2O3FA 2Z4RA 1NIPA 2VBYA 1UDXA 1ELOA 1E2QA 2CNWA 3M9AA 2DCUA 3PG5A 4MGYR 5TXGA 5JEEA 1LEBA 1GDDA 1JPNA 2ZS8A 1HXDA 1SVMA 1NKTA 5DUKA 1U8AA 4RGUA 4OYHA 5ICGA 3ZPLA 1S4QA 1S9HA 2FFBA 3PXGA 3FMOB 4NCNA 3KJGA 4A0ZA 1ZJ6A 1SHZA 1VPLA 3N4MA 1FTSA 3ABUA 1KK2A 1OHHA 2FOLA 2GTPA 2PLRA 4IDPA 4Q4LA 2VXZA 4X8LA 2WOOA 3WE3A 3RJPA 4JYCA 4TL8A 4B73A 1USTA 2GAOA 3OIVA 1FUUA 4IXMA 4MRPA 5TB5A 1KI9A 2R6DA 1FWZA 3B85A 3FXUA 1KI2A 5H6QA 5D4RA 1QHHB 1WP9A 3VEPA 4BXUA 1HYQA 2IC5A 4XD7D 2KBFA 2DR3A 1OYYA 3VU9A 3O3KA 1RUNA 4PCQA 2QMEA 5ANRB 3GLFE 4A5NA 2XRNA 3BROA 5TJJA 1IAQA 4HI0E 4IFEA 3U3OA 3ZS8A 1IN8A 1R58A 5L3DA 1IXRC 3PVSA 4M74A 4OJKA 1PVOA 4UJ5A 1W4RA 2ATXA 2CLDX 1GNRA 1N5LA 1NG9A 4P5OA 4ETSA 3W6NA 4IXAA 1VCMA 3DFGA 1B23P 3S1AA 3P26A 2Z9OA 2MD5A 4Q1DA 4HLYA 3H0KA 4BFSA 3LA7A 2KE5A 3K0CC 2XEXA 3F8CA 1OSNA 2VSXA 3K1PA 2XXAA 2V6ZM 1WI9A 1XTJA 1G3IA 2F5EA 1U78A 4B76A 5FFZA 2CL6X 4GGGA 2HOEA 2I3BA 4ARZA 4RD4A 5F3WB 1GIAA 4BFZA 5DCFA 2F1JA 5CK4A 1ZMXA 1LS1A 4KI0A 4A8JB 1XCPA 3P4XA 2QL6A 4QC2A 5CB6A 3THYA 1M74A 4Z51A 1ZNZA 3CX8A 1ZH5A 1Z9CA 3FMIA 4AKIA 3P7NA 2DZNB 5CYVA 4I2OA 4IDOA 1CF7B 1W5SA 4E22A 4EM1A 3KTAB 4A0GA 3ICQB 3EQLF 4YMVA 3R61A 3NXSA 1R7RA 2HDNB 3AUYA 4GBMA 1E3MA 3ZP5A 3CUOA 1H8EA 3COAC 2O8DA 4IVNA 3GMTA 2FE4A 4RAZA 2P5SA 4MA4A 3QXHA 4PSVA 5BN4A 2ZAOA 1TUEA 621PA 1G64A 4S05A 3N97A 2ZRDA 5FUWA 1NVXQ 4CF7A 3OV8A 1UJ2A 4L5BA 4LRTA 4PHTA 1BOFA 1Z07A 4D4JA 2QM3A 2R2AA 2M1BA 1A82A 4MTDA 1IW7F 2V4ZA 3K69A 3FFAA 3KB1A 3GLGB 1MZBA 3Q5DA 4MGZR 5DN6D 2UXXA 821PA 1FBQA 2J45A 3K9HA 1NJFA 1PLJA 3BH0A 4CEIA 2VE8A 2JRTA 1U3EM 3B60A 3TSOA 2VF8A 3W34A 2QM7A 1JEEA 2VHTA 1X3UA 1WF3A 2G3YA 4ZKDA 3GJ4A 2HTJA 2F5DA 2P5LC 2CK3D 3WNCA 4QJ3A 1EFHA 1XD2A 2ZREA 2ZI7A 2FXAA 5E4FA 1CJTC 4NCIA 1M7BA 1DAFA 3SOPA 3KP7A 3NHAA 2J7KA 3K09C 4X8HA 3RS0A 4JLMA 4RZXA 1TQDA 4EJWA 4PHFA 1JHHA 3SS8A 4IVQA 5FPTA 4Q4HB 1U9IA 4G6QA 1HUQA 3BS4A 1HKSA 1KA8A 1N0UA 5HR5A 4Q4AB 1ZIOA 1V3FA 1XPOA 2BC9A 1IM2A 1W44A 2DK8A 4PQFA 4PZZA 4UNPA 2DWQA 2D4HA 1IZ1A 2EWVA 5DI3A 3SNHA 2DB3A 3O8BA 1G5TA 1KI8A 1W36B 2ZFWA 1G7RA 4G0NA 2A7QA 2H6BA 1T8TA 4G5SA 4M1YA 4L5JA 3WTYC 2FA9A 4M71A 3CH4B 3BDDA 3QNUA 4UKDA 4TMZA 2VP4A 2R6CA 2FZLA 3W3ZB 2BDTA 1JE8A 1GOTA 4A0FA 1CULC 2W2TA 2YJTD 3RLFA 1SVSA 1TAGA 3CR8A 4PGHA 2GDJA 4R79A 1OPXA 1UKYA 4ZYDA 2QSYA 5CLQA 5DSZA 3FMQA 1G3UA 4A6XA 3N5CA 5ERIA 4ESBA 1DAGA 2Z99A 3QOPA 1AQUA 3EZFA 1W0JD 2OXRA 5DEQA 2J0QA 3HPRA 5HKKA 1NNEA 4UV8A 4F7ZA 5JVTA 5D5WB 1XCVA 1S96A 1Q12A 2ZUCA 3CF0A 1YW7A 4IJMA 2ZRPA 3K53A 1HH4A 3B6EA 4OHXA 4LG0B 1RJ9A 4I0BA 3K0FB 3T34A 4YFNF 4HDQB 3GEEA 4G7OF 1EGAA 4PDKA 1A7JA 3RSLA 1RIOH 1KY3A 2O0HA 1E2IA 1E69A 1FL9A 1VECA 1YU9A 2P0EA 3CNNA 4CRWB 4WXPA 3TBKA 2DFIA 4OI4A 4B8XA 4IRIA 3EW9A 4GSYA 2ZRFA 2FJUA 1T39A 2WVJA 1GITA 4CT5A 4IHQA 2P6RA 2XSZD 4LRSA 2IA0A 3EC2A 4ILEA 4JJKA 1DPFA 1XB4A 5EEGA 3DKPA 3F21A 3SQXA 2ZROA 2HQNA 2XNSA 4ESHA 2WC2A 3K70C 1BJAA 1RE0A 4ESVA 3JVUA 3LAPA 2GETA 2MMCA 1O57A 3WHLA 1T0FA 3ICEA 3K9TA 1Q57A 1LDKB 3E6DA 2VSFA 4ZIRA 5IT3A 3P27A 5TDHA 5CVJA 3RC3A 4HDVA 3FM5A 1RI7A 3PQKA 2XAFA 4EGZA 1N3BA 2ASEA 1E2FA 2HXSA 5FBQB 5JSZA 1F1ZA 2PG4A 3J7AO 2NO1A 1JR6A 1JB1A 2EU8A 1R5OA 2B8TA 5GVSA 3GLGE 4CZZA 4UNNA 2ZYTX 2G9WA 1KDRA 4R2IA 3SZRA 4JBXA 3MSXA 3WBKA 3Q3JB 2ZJAA 3H2YA 5FTNA 3RRNA 5L3VA 1E1QA 2VA8A 4Q7MB 3RSOA 3M7GA 1S8FA 3G0HA 3K1JA 2CGPA 2Q21A 3FYHA 3W8RA 2QORA 1UKEA 4HZUA 3I54A 2WKQA 3FGNA 3LW8A 1SD4A 2J0SA 4RD1A 1IRFA 3OE7D 1ODFA 3OFNA 5LB4A 2IUUA 4E5UA 1KNQA 2D06A 4JT4A 4JZKA 4CYMA 2IT1A 1IJEA 1ZM2A 3FHZA 3AM1A 3UXMA 4L18B 1PV4A 3LWFA 4UVCA 1ZP6A 1QZXA 1NI3A 1X86B 4OHWA 5E1WA 3MRSA 3KZZA 5L3CA 3CRW1 1XCGB 3RHFA 4KO8A 1KQ9A 4WXDA 4B09A 2HS5A 2A5DA 2XZPA 1P9RA 2R6FA 4YFKF 2G83A 4Q4ZF 3CH5A 1YZGA 5LGTA 2ZRKA 3DZ8A 4WBSA 1II8A 4D26A 4P9FA 5G3ZA 1KO4A 2ACJA 4BE7B 2ETHA 2LDUA 1CS4C 1FP1D 1RYFA 5BN3A 1BIFA 1JXSA 2VHCA 4ASUD 2PN6A 2WWWA 2C9YA 1RRPA 1XDSA 1YS6A 4O5VA 1BI3A 4WK8F 1R1VA 1REPC 1G8PA 1X1RA 2WICA 4QRHA 3TSWA 1I2DA 1OYWA 1P62B 3AF4A 3ZZUA 4PO8A 4AC9A 2BCJQ 2H1LA 3TAHA 4YIIA 5HS7A 1LQ1A 1DUXC 2G0NA 2JLRA 1ZNXA 3Q72A 4IRGA 4YIFA 2H27A 4JIMA 3A8TA 3DM5A 1ZG5A 3PQCA 4EJSB 2ZJYA 2OV2A 1VG1A 4LC0A 3HJNA 4QHYA 3L43A 4HW0A 4V0KA 4ACAA 4AVPA 2WMNB 1KZGB 4NBSA 3F3YA 4A2WA 4B6FA 2O0YA 4MGIR 4M22A 2DTRA 2W6ID 3SJZA 1VCNA 4BWYA 1E2NA 5D3MB 2GJAA 4ZDWA 3A37A 4B3FX 3CF2A 1A04A 3JAMK 4EJVA 1R1TA 4OU0A 1G8YA 1GSIA 1O3YA 3BJAA 1QHIA 4DDTA 5ILUA 4LK2A 5FBRB 2CNWD 3AVYA 1G4AE 1FP7A 2QYOA 3MD0A 1LTQA 2IRFG 2W6JA 2ZRCA 3RI4A 4MHGA 1LDDA 4W7SA 4RFSA 2H94A 2V8OA 2AFHE 3QKSB 5SZIA 1P2VA 2KKOA 1XBTA 1XCBA 3A1TA 3K8YA 4URWR 2J41A 4QHTA 4OQLA 2Q6TA 4EDHA 1OHHD 1CF4A 4K46A 4I1VA 4M9QA 4KU4A 4Y15A 2WM9B 3C18A 1C1KA 1YZLA 3GLIE 2K4BA 1ZRCA 4OMZA 4AY2A 1ZM3A 3R6SA 1O7LA 3QRFF 2X1VA 5EXPA 1ZLJA 1TF7A 2O8FB 2HKXA 2QENA 4I1OA 3QP6A 1FSHA 2PEZA 5D8LB 5D5UB 4IXNA 4C3ZA 2AKYA 2Y48A 3RWOA 1G21E 4YONB 4M9ZA 1D8TA 3MEXA 4RCYA 4Q03A 2A2ZA 2KRKA 2CQKA 4NHJA 2RHDA 4KSBA 2EJRA 1T3SA 4TLAA 3RYPA 4UNQA 3IWZA 4I01A 5BQ5A 2D7DA 1VMAA 3I8SA 4CO8A 1QHXA 4IJAA 2NO9A 4DEYA 2BV6A 1CJMA 3LW7A 2EK5A 1CRPA 1ZN2A 4UNRA 5A5GA 4Q1EA 3KETA 1N6NA 2FBKA 2VF7A 3ZLJA 4TYQA 2AK2A 4NP6A 3SI7A 1E9FA 4XLNF 3CNOA 3VFDA 1B6AA 1J5YA 3NDPA 2BM0A 4Q66C 5FR1A 4D4MA 4L4UA 1N25A 4MTEA 1E0JA 1TQPA 2IYVA 4IOMA 3NRVA 3ZQ7A 3PITA 3BORA 4FWHA 2LKDA 4LJ9A 3HSFA 2VLIA 3SJBA 3D7MA 3SZTA 1UBCA 4BRUA 3IEUA 4WCGA 4IW3B 4ABYA 1HY3A 2FSGA 4EPXA 5JCZA 2ZJ8A 1F48A 5H20A 4G7ZF 2BBSA 1BH2A 1VHLA 5E1ZB 3GVAA 3RDIA 2O0KA 3REGA 2DPUA 2G88A 2PMKA 2WKRA 5FBVB 1H8ED 4DJTA 3WMGA 1XMVA 1MR3F 2GZWA 4R1HA 3ZN0A 1FQJA 2Q0OA 2X19A 3P1JA 1E79A 1QVRA 1I2MA 1N0VC 1XDUA 1J8YF 2CO5A 4BUJA 1ZARA 3U7EB 4FT8A 5EUMA 4PQRA 2J1LA 3JAMZ 1WB9A 4XWOA 2WTUA 4A0HA 2C78A 3T5XA 2IYTA 3ZS9A 5BN5A 4WZAE 2W2VA 1U90A 5FPYA 2JSCA 4HOBA 3VR6A 1F3OA 3R7WA 1ZM9A 2PEYA 5K5QA 4B74A 1LJ9A 3ONWA 2XUBA 1X8JA 1KI3A 1GVJA 4Q5SF 3TKYA 1VCIA 1VCOA 1DTSA 4RAYA 4URVR 1H65A 4Z8YA 2VT2A 1GM5A 1UEJA 2NPFA 3R9WA 2ZQ5A 4ESJA 5EP4A 3KLNA 1T6NA 2GJ8A 3LQQA 3CX6A 3I61A 3LBIA 1E9RA 2ANBA 3NBFA 2ZJOA 2Z5UA 1M7GA 5LGNA 2PI0A 5H70A 5L3SA 4PQYA 3RAPR 3RS2A 2ATVA 2GHIA 4BZPA 5JI3E 4P96A 3I59A 4QG7A 1E2KA 2XAGA 2GEVA 3F6VA 1EK0A 1KK3A 3P9IA 2J59A 3L8ZA 4OQXA 4FWTA 1IN4A 2JEOA 5DD8A 3W5JA 5JI2E 3U6KA 5CDFE 4E70A 4QBFA 5J4VA 2IYWA 1XMJA 4KN7X 3B1XA 4LYHA 1FYLA 4QGGA 4A4DA 2IYXA 3EX7C 2NQ2C 2E7XA 1I27A 2X2FA 3C1DA 2DW4A 5LGUA 4FCTA 4RD0A 4UXHA 1Z28A 2HT6A 3U7FB 4OMYA 4P4UA 2AX4A 1J2JA 2ODNA 4JKYA 1SMYF 1MV5A 1B59A 4NYJR 5JS8A 1U5TB 2DQRA 1TX4B 3ZDQA 3I71A 1ZNWA 3U1DA 1AK2A 2JCSA 3T1OA 3WRXC 2M5WA 1B4AA 3GLXA 5CVVA 5KHOC 2CFXA 2KIUA 2PZFA 3SQNA 1AS2A 4L9VA 3FM3A 1GXPA 3FMPB 4FN5A 2M30A 5HKKD 5F9HA 2XJ9A 5SZJA 2FFAA 1LNZA 4D81A 1D2NA 1V43A 2PL3A 4ON0A 3K0AB 5JJIA 1ZGJA 2Z5FA 5GJWC 4LI0A 4NH0A 1R5GA 1G7SA 4IFBA 5SZHB 3ZZ0A 1BMFA 2EVWX 1MDMA 4Z54A 3WODF 3LA2A 5FPSA 4KFTA 1CJUC 3M8FA 2PQ8A 1Y0UA 2BWJA 4A3VB 2BBWA 4ZCLA 3SFVA 5F2EA 421PA 1WMSA 1A1VA 4L5IA 3EZ9A 4AWXB 3U3JA 4B32A 3A4NA 4P4SB 1JR3A 1DOAA 4B33A 1KOFA 5E20A 1E2DA 4GCVA 3VODA 1J75A 1NBMA 4RZ3A 3W5IA 1SULA 3V8KA 1N6RA 5ILVA 1AA9A 1E99A 1P5ZB 2KB0A 2Q9AA 1IN6A 1NVWQ 2QP4A 3MJHA 2ZE6A 1YIOA 4DB4A 5BW8A 5KTYA 2FSIA 4KLZA 3U61B 1QQIA 2F7SA 4DLUA 2BJVA 2CJWA 3FVQA 4MDFA 4HLUA 2BE5F 5HZHA 4BQAA 4WWCA 5LLQA 4BH9A 1CJVC 2OFOA 2OM2A 3NBXX 2V55B 1O3TA 5KNBA 5LD2B 1E9AA 1XNJA 5P21A 2C99A 3ISPA 1ONVA 5CVRA 5ED4A 1A2KC 2ZO4A 4H1VA 2H18A 4OQFA 4B3CA 1X1SA 5LB2A 2ESNA 1LY1A 4OKSA 4US1R 4F4IA 1D3YA 1II0A 5ICFA 4R2HA 5K8UA 3GFJA 1BYIA 5FBWB 1P9WA 1SMTA 2Z4SA 3RRZA 1LDJA 1EESA 1ZYUA 3GJ7A 4PXAA 4KDPA 2K02A 1HT1E 2O8BB 3QP5A 4A0RA 4IRHA 4U7BA 4BECA 1OB2A 1E1QD 2MSEB 2WZQA 721PA 2Y0MA 4LJZF 1TQ4A 1MABB 3SU8A 4M72A 2ZR0A 4MUBA 3WNBA 3KEOA 2QLZA 2QROA 1R5BA 1Z29A 3PUZA 4MKIA 5UKDA 5KU1A 4YXWA 3OFND 1J0RA 3AQ4A 4Q19A 3HRSA 1GRRA 2VSOA 1XU4A 4LJAA 4GPTA 3MWMA 4UXJA 2WJJA 4M1WA 3CW2A 3HYRA 4F7WA 1R0ZA 2JLZA 2N1BA 1SHKA 2DPXA 2DFNA 5LBQA 4Q02A 2N42A 1YQAA 3HSRA 1C0WA 2IYLD 1XTQA 2PEXA 1OF1A 5D8KB 5JCPA 3BGWA 2XHKA 2OCYC 5E3HA 3P4YA 4Q48A 1TNSA 4UUVA 4DCUA 3QPHA 4M73A 1K79A 1MO4A 3RPQA 1VDZA 1NVVR 3LFUA 5EXXA 3EIQA 4LUCA 1OH7A 4WX9A 1YTYA 1G291 2UZIR 2GK7A 4P4TA 1UPTA 3L2OB 1GAJA 5D5VB 1YKSA 1Y63A 4NE2A 1G8FA 2ZVPX 1XEWX 1M2OB 2NAZA 3MFKA 2GQQA 4ENMA 5E17F 1QRAA 2VC0A 4DEXA 1KMHA 3TKLA 3SYLA 1TNTA 5DI9A 3HR8A 5IK2A 3UMSA 4XSZF 1IY2A 1VIYA 3D5LA 3VU9B 5BYKA 1H9TA 1RVDA 3A1SA 1HT2E 1TU3A 4HX7A 1G3WA 2HKOA 4ASNA 2A9KA 1L3LA 4KFSA 4PX9A 3VR4A 1YG2A 4UNSA 4KYWA 1RUOA 1OIXA 4YQFA 4E09A 1DO0A 1W7AA 1GVNB 3SN6A 3LRPA 1CTQA 1ZM7A 2QAGB 3ELKA 3KP4A 3B73A 1R8QA 2W6JD 1ON2A 1ZHFA 1MO3A 4QXAA 2P6SA 4U02A 4NYMR 1OH6A 1SFUA 1A2BA 2KI5A 4H0EA 2ONKA 1SKYE 4MDEA 1GRQA 3AAFA 2ZSAA 4ENJA 3E6CC 2XAUA 4HUTA 3CUQA 3F0TA 2L4MA 4Z2YA 2CHVA 3OHMA 2J5OA 3KJEA 2LKPA 4EFNA 2CDNA 4TMTA 1W2HA 3KQKA 5GJBA 2O8EB 1NKSA 5GJCA 2DHRA 4URUR 1E4VA 3W6OA 4QKQA 2PFBA 4G5OA 3GFIA 3D0SA 1T3HA 2GKSA 2ODEA 1TLHB 1P6RA 4EQQA 3LFKA 4GI7A 4OINF 5FPHA 1B0UA 2OG2A 4QJ5A 4OIOF 3T5DA 1RPZA 2YYZA 4EM2A 4P9UA 1U2RA 221PA 4JSYA 2KRFA 3TDZC 5IF9A 2O8DB 3MFYA 2OD5A 1T0JB 2VHJA 3ASZA 3FTQA 2ZSBA 4NMMA 2IVMA 1W4CA 5LRSA 1YZQA 3VB2A 4CEJA 2BGCA 2FBHA 1FP6A 1RRFA 2FPKA 2PCLA 3IBGA 4PPFA 4PZLA 4MUAA 5IDVA 1S0UA 4Y17A 2BVNA 2C96A 4BHBA 5DYGA 3E6BA 4HV5A 3HYTA 3I72A 3SEAA 4HLXA 1ZAOA 2O8XA 2NRAC 1KI6B 2D7CA 1P60A 1VYUA 3NEUA 1R6BX 1NHAA 1XX6A 2W2XA 1FBSA 2JAQA 5CM8B 1IONA 2QM8A 2XB4A 5CJPA 5J40A 3QU3A 1GFIA 2UKDA 3MCAA 4MYUA 2XZOA 2ZCWA 1DO2A 1K6MA 4ZI3A 4KITB 5DCMA 1SQ5A 2ONJA 2HQRA 4W5HA 1QO0D 3GLFB 1O3SA 2RGAA 1OXSC 4Y0AA 2ODWA 4L9TA 3WU0A 2V9PA 1SZPA 2NNYA 4J0QA 2AXLA 2ZJ2A 2GNOA 2GK6A 2GZDA 2HF9A 4KCGA 2IWRA 2F55A 3HUGA 4ZZLA 4FHTA 5FI0B 1R23A 1OKKA 2ZRHA 4U88A 1FY7A 2F43B 3B8HA 2BEKA 4D25A 3THXA 2G1KA 1XCMA 4TYWA 1QG4A 1NRJB 4BFYA 4E07A 3CNLA 3WP0A 5SZKB 4AK9A 1EG7A 1PJRA 2IW5A 3WXMA 4B3GA 2VONA 4C0LA 5JJKA 1FX0B 4FI3C 5DI3B 5TARA 5KK1A 1B9NA 1XXHA 3T8TA 1Q3HA 3CPJB 1S6LA 3MWYW 5DGXA 4YDSA 3QKTA 3QU6A 4RD3A 4JLBA 1TNDA 3PEVA 4AKHA 2FMYA 4YMSA 2NGRA 4JSTA 1OYIA 1RZ4A 2YHSA 4Q1AA 2FSWA 1XWIA 2WV9A 5JI6A 1XEXB 4XIGS 1NN5A 4MYTA 3A4MA 3V7RA 2CMKA 5F9FA 2BOVA 3EWSA 3T15A 4R71A 4GYIA 3M6AA 3HSEA 2YZ2A 1NN3A 2HYFA 2ZR9A 1ESNA 5AUPB 2C9CA 3UANA 3WE2A 3AVPA 1S9DA 4G5GA 3GEHA 1ZW6A 5DHAA 2OQGA 4LV5B 2H17A 1IY1A 1D8KA 4GYGA 1XGMA 4HUQA 4EQ6A 2BKEA 4TYPA 5AUQA 4B34A 3TJZA 4FW9A 4O25A 4AURA 4C0AC 5BXQC 2QP9X 4Q9IA 2F3TA 2D3WA 1PUIA 1JI0A 1Z22A 2JLSA 2OEPA 4WXHA 2ZE7A 1U99A 3E5UA 2FE3A 4NQWA 1UBEA 2LF7A 3DKVA 4NCKA 4WOPA 2O8CA 2JZYA 1EFRA 1P4XA 1UCRA 3GUDA 1DAMA 1K78A 2A78A 2ISZA 1Z0DA 2C98A 1J7KA 3IHUA 4KN4X 2D2FA 4JVLA 4DDUA 3CONA 4LK0F 4MRRA 5ELXA 3ULQB 1ZG1A 2OZEA 3L00A 2O61A 1JAHA 3AUXA 4NDZA 1OFTA 1FBUA 3MLEA 4PAMA 1FMJA 4IVPA 3TGNA 2XROA 2WSMA 1KO5A 1DDNA 3GX4X 1TBXA 1FZQA 3Q85A 5FOUA 3L8YA 3VR1A 3C14C 3MCZA 4DCVA 3EYIA 4OI0A 4CEHB 3F8TA 1JAIA 3GFTA 4PAOA 4F93B 1XSDA 1G6NA 1TPZA 1Y3AA 2GA1A 3BBPA 4HB0A 4OOIA 4FXPA 1FFHA 4Q18A 1HKQA 4EIWA 2GVZC 5J5CA 1M7HA 3T8RA 1AQYA 4KBFA 3AH8A 2GXQA 2VL7A 4JYBA 3HYIA 3KUDA 4LGWA 4DQ2A 1QF9A 2IX3A 2BHRA 1Z0KA 2A30A 1S1MA 1BMFD 3LAJA 1G3QA 3QF4B 3QSYA 3AP1A 4ERNA 3QBVA 4EMSA 4EM0B 1KDPA 1QPMA 2WHXA 1WWXA 1JR3D 3KFXA 1F2UB 2PH1A 3TE6A 1X8KA 1NBMD 5TV2A 3ADKA 4WXRA 1KDTA 4QWQA 4JLNA 3RYTC 4JJZA 1OJLA 1Q0UA 1XTRA 1HSTA 1I6XA 1NN0A 2QVOA 2GILA 3NG1A 5DH9A 5E7JA 4F38A 4JVNA 3H84A 1DPUA 3F8FA 1XD8A 2JLQA 4XTCS 4AG6A 1KU9A 1K8RA 5JMTA 1JECA 3LXRA 4M9SA 3E70C 3L0PA 2G7HA 2DFTA 5KSZA 1XEFA 2CVHA 2ZI5A 1YR7A 5G41A 3RRMA 1XPUA 3CIOA 2J87A 2CYYA 4RZ2A 4TLCA 3EA5A 4US2R 4HAWA 4JLJA 4Q4JB 1N5JA 3RS5A 3NHBA 2FRHA 5J47A 2D1HA 3O8CA 1FPMA 2FN4A 4DT1B 1NN1A 3D3QA 2EFEB 4QM6A 4MGKR 4N3NA 1TW3A 4TTPA 5CJ9A 1O7FA 3BFKA 2FEZA 3MAAC 4NYJQ 2ESHA 2ZS9A 3KXKA 3T1VA 1KYIA 5D4SA 3PEUA 4IVRA 3IIKA 3R8CA 3SHFA 1UDWA 2VBWA 1GZSA 1UBFA 4GDFA 4NZYA 3NC0C 4HB4A 2ZYWX 2OBPA 1IOZA 1OE0A 4JLOA 3IPXA 1L4UA 1YFHA 3KP6A 1O3RA 3WRYC 4YXWD 1XEWY 3W6KB 1JHFA 1U8YA 4PGGA 2BBTA 5C18A 5HDGA 1HQYE 2G77B 1CKEA 2C6YA 1G5RA 2F1HA 5JZVA 4PANA 3FWYA 2KIFA 1KKMA 2QRZA 2RMKA 1XGOA 1OR7A 4M53A 4F4CA 3EG5A 4RB2C 4OIRF 1K6OA 2UWMA 2KWIA 4FINA 4MRSA 5TVKA 4RCZA 4B3XA 2DVWB 1BC7C 2MH2A 1E0KA 521PA 2GXUA 2AK3A 3UMRA 1KNXA 2YX4A 2RVCA 2GA8A 3LBNA 3IKTA 2VP0A 3QAHA 4KBGA 4X8MA 1CR0A 3I62A 2DPDA 1VTKA 2GWHA 2GRJA 1OFIA 2RGDA 3GFOA 4HZFA 3TDUC 1HE1C 1ANKA 4M0LA 3I5YA 4LJYA 4M8NE 1IUYA 2YC2C 2NZJA 3TR5A 4ACBA 3QG5A 2IYQA 3EASA 3GEZA 3HHHA 2P6TA 5FLXK 2WV0A 3NEJA 5AJWA 4KODA 4GZMA 1IF1A 2QPAA 4DLTA 5FBLB 5TY0A 4GFDA 2FDCA 2GCOA 1FP2A 3RTRA 1Z83A 1UAAA 4LJ6A 1YLFA 4RGRA 1E2PA 4QJ4A 5IK2D 1P2FA 2J0UA 4PFSA 4RVCA 1TU4A 4O2RA 2XAQA 3AVOA 1MJBA 1D9XA 2IL1A 1XF9A 2QU8A 1S3GA 3I4LA 3KXIA 4IRUB 3CDHA 3WTVC 1YRBA 3TQNA 2ZXJA 5L3EA 1G19A 1Z3IX 3DOEA 1G20E 2KJQA 4M6XA 2WWFA 4URYR 2AL7A 1EV7A 1OFUX 4KXFB 4PTLA 3K70B 2ZIAA 2ADUA 2X0LA 4BNCA 2B21A 2ZRIA 4UV9A 3IQXA 3U60B 3R0AA 2GAUA 3WBJA 3JZMA 2V3CC 3GLHA 1E4YA 2R7FA 2AKAB 1F2TA 3JSOA 1UF9A 4D80A 2DFKB 1Z06A 4IKEA 2NPIA 3LVRE 1BC8C 3V9PA 2M87A 4EUNA 1E0SA 3ECCA 3VQTA 4BLOA 3TAUA 5JWRA 4ZYEA 5FFMA 1G18A 2YU3A 3PIRA 4HYYA 1W7PB 1JGSA 2HDCA 1EX6A 3TVTA 4TMVA 3X1YA 5CVIA 3ZN1A 1OH5A 3HRUA 1DAEA 3FMFA 1W47A 3RVBA 5KVRA 3T0YA 1CR4A 2ZTSA 4OJQA 2Q9CA 3WYFA 4BLPA 5CB8A 5C46F 1RC8A 2JLWA 3SDZA 3AF0A 1WCV1 1Z7UA 2RB4A 3SC3A 1ZNYA 1NVUQ 1T5LA 3K0EA 3AVQA 4TQ9A 2F5CA 2DI3A 3WMEA 3MWKA 3LDAA 4YMUA 5IT5A 3QKRB 4ZPXA 1W49A 4Q1FA 1L8QA 2IXEA 2X8AA 2P4WA 2XOKA 1R0YA 3R9XA 1FSEA 1ZCAA 3AF1A 5H1YA 4C7OA 1ZBDA 2XTMA 5E95A 3PR1A 3GLIB 4GOKA 2UVQA 1C1YA 3R7WB 3OZXA 3TK1A 2IPQX 3SBEA 2VC1A 4BHPA 3TGPA 2Q3HA 3TQFA 2QMHA 1MH1A 4TSFA 3REOA 2X4HA 1AWCA 3A1WA 3KXLA 4MYHA 5AJZA 4URXR 2D1VA 1CGPA 2AXNA 2YNMA 4MKFA 3LH5A 3H3ZA 5HCNA 5FLXZ 3VX4A 4M1TA 4KAXA 2L54A 4AKGA 3U2RA 4HF2A 2XZLA 1SXJA 3IC7A 4ESFA 1OKKD 1KJZA 2VBXA 4KFUA 3RIRA 1HE8B 4G7HF 1P7CA 2AHOA 3HRTA 3Q9VA 1KDOA 3WTXC 2REOA 3I59B 4JBYA 5HLHA 4NYMQ 3A1UA 1T9HA 3G82C 5E7MA 4FD2A 4KICA 1G41A 2GEUA 1VKJA 2JJ2A 2ZSEA 1LB2A 4BLSA 2OBMA 2EW1A 3JTHA 3R0JA 3U4QA 5JEDA 4JLAA 1NP6A 1G9XA 5E7IA 4MKHA 3HU2A 3U3MA 4LRWA 1KKLA 2LWIA 1TTYA 5D6FA 4LLNA 2W0SA 3K0SA 2KJCA 2HLDA 2XITA 1FX7A 5JFRA 5K1YA 3LX8A 3PJRA 4LJ7A 4MQVA 3EZ6A 4MH0R 5IRCD 3ZVNA 3KL4A 5A4JA 2DQLA 2FMLA 1ON1A 1QNTA 3FB4A 3GFLA 5HTKA 2NMVA 2G6BA 4PSAA 2PZEA 3GJ0A 1QHHA 5FOWA 1VHTA 3LQRA 3THWB 1YHNA 2R6AA 2EWWA 5L3BA 2J46A 4TMWA 2J3EA 5TRDA 4CZ2A 2XAHA 1YQTA 3BE4A 4DSNA 3E2IA 4PO9A 3W9YA 3JW4A 3UG6A 5TMPA 4P33A 1MKMA 1GRNA 2P67A 1KIMA 3ZMVA 3ECOA 2HGCA 3M1EA 1TF2A 3FFBA 5CM9C 3GP8A 3AEZA 5F98A 1P3JA 3WMFA 4RJLA 3Q5EA 1Z6XA 2CCKA 1YR8A 1EFRD 1IXCA 3CX7A 1FMLA 4NYIR 3RS3A 2H6CA 3KFWX 5KDDA 1BI1A 2JA1A 3BAFA 3E6MA 2CVFA 4BZQA 4NCJA 4A15A 5F6FA 2IYSA 2FFHA 1YW8A 2EYUA 5AIPA 3QOFA 3TOBA 3B9PA 3ZH9B 4A8JA 4PAQA 1B1BA 2GXGA 2P5KA 1J70A 1YR6A 3KP3A 1QHNA 3UWKA 2DY1A 2LNBA 3I73A 3G3ZA 4XBFA 1G3MA 4B6EA 4LCBA 1S7OA 3DKWA 1CF7A 1KQ8A 4HSEA 4W9MC 4GL2A 3KTAA 2BCGY 3AVWA 2J5PA 1WXQA 2B0LA 3TW8B 2STWA 2HF8A 2QTVB 2ZE5A 2IA2A 1OIWA 4W5WA 4XVUA 1N6LA 1PLLA 5JBQA 3HWSA 4AYXA 3GQBA 3IPYA 1I1GA 1Z2CA 4Q1BA 1RIFA 3G73A 1WRBA 1LW7A 4GNKA 3ZMSA 4JQFA 4R7ZA 1N6KA 1Z2AA 2BMDA 5EJEA 4D0LB 1RKBA 2DK5A 1W0KA 5KNCA 2DLLA 2F5FA 4PC2A 3NDBB 3GLGA 4UNOA 1GTVA 3CUEF 4R8HA 1Z0JA 2E1NA 4V03A 3VFZA 2CWEA 1Z47A 5BS6A 3GW2A 1GKIA 2RGVA 3IKVA 3SR0A 1F5NA 4AIJA 1NLYA 3GZ5A 1T38A 3M4YA 2P7CB 1Q1BA 1AKEA 1TQMA 2TDXA 3ECHA 3IWFA 4ZCMA 4FWIB 4OI2A 1NVMA 4A9AA 5KYKA 4HLUC 2XV4S 3BC1A 2OCPA 2X2EA 3Q7PA 4D4KA 3I5XA 1FPQA 4Q4HA 4XSXF 4CIDA 2FSFA 4Q4AA 2MH9A 3P9CA 4QBIA 1U81A 3V4FA 5CLLA 4Q7KA 1KYZA 4ZDJA 2QQBA 3C4JA 3ABTA 4LFUA 3DL0A 3RC8A 3TOAA 3BH6A 5DUIA 5K5OA 4EJTA 4BLTA 2L3DA 1XRJA 1Z05A 1ULYA 2W00A 5L3QA 2OQRA 2GESA 3AV0B 1R7JA 3ZVRA 3MMPA 2WBLC 4WIAA 1E98A 4Q1CA 3SYNA 3WYAA 4HZIA 3SJCA 2NYXA 2IS1A 3BFVA 4PC3A 4HQEA 5L3FA 1R0WA 3BB3A 3BWDD 4NONA 4DLYA 3I0TA 4IF4A 4KT5C 3J80K 4KHZA 4DCNA 3FMSA 3GZ6A 4DIDA 4OBEA 2VYFA 4S2EA 4IEIA 4PZYA 2EV6A 5KPDA 1JJ7A 4Q47A 1I4DD 4JT2A 4LG0A 1SGWA 2M8EA 1QBJA 3GCGA 1JR3E 2AXPA 3K0FA 3OEHA 2EQBA 4GITA 1S3JA 5HDNA 3K9GA 2ZSDA 4XWAA 5EE9A 3VMFA 1R00A 2IF0A 3R20A 4C0KA 4OK6A 5FOSA 2DAOA 3C3WA 1BI2A 2ZRMA 3TH5A 4KA4A 4AD9A 1ZC4A 3GFMA 4G94A 2YR2A 2WWXA 2Q2EA 3DEUA 1YR9A 1PLKA 2WIAA 5K8TA 3AGPA 4BEBA 3QXCA 3HIFA 1XJQA 5AWFC 4OQMA 4QHSA 1M6NA 1BS1A 1L7VC 4DSTA 3SZPA 3KJHA 3TQCA 3KJIA 3B5JA 1RYHA 1XJ0A 3IKJA 4N0DA 2JLYA 1P92A 3HU1A 3AJIB 2DT5A 1MT0A 2ZXUA 3CF6R 5DISB 4HDUA 3LA6A 3QXXA 1ZREA 1R4AA 4KUMA 2QZ4A 2STTA 4Q01A 4Q5IA 1E2JA 3V8LA 4L9SA 2VRWA 3TLXA 3V4GA 5BQTA 5KPJA 2RNJA 2QBYB 2QGZA 5FTMA 4JL5A 4TN1A 2NO0A 4L9NA 3RKXA 4L0ZB 2QQAA 2QQEA 3I3SR 4G01B 3X1ZA 2A6EF 2HTSA 3L09A 1US8A 1QZMA 1OXVA 3MZHA 4I4LA 5GJVC 4EPTA 3KEQA 3RKWA 2DWZB 3L82B 4Q00A 4BFVA 2CLCX 1YZNA 2RN7A 3U7GA 1MKYA 1LS6A 3CUQC 2YINC 2JT1A 5J8FA 3GJ5A 2R44A 3OAAA 4N0EA 1SD5A 2O03A 1J90A 1TADA 3B9QA 3B78A 2XIGA 3NC1C 3T1BA 2OLJA 1YZKA 4JMPA 2IS6A 1FUKA 2ZUBA 1HQCA 5FB2A 4IEEA 1JXMA 1DAHA 1KGSA 1E32A 5E8GA 2C9OA 2W25A 2FWRA 3CO7C 3J80Z 2HEIA 1QBKC 4F91B 4XLPF 4OQNA
chains in the Genus database with same CATH superfamily
3IJ5A 1UPFA 4H1WA 3G1OA 3FK7A 3DE5X 3D4BA 1CVIA 1WUJS 3BRWD 4I98B 3N58A 3EUFA 4XRFA 1A6QA 1LDNA 3X2EA 3MBOA 2P40A 2BTEA 1SXJD 3TNFA 2WTEA 4TS4A 3ZD7A 3Q10A 2WJVA 2JJ2D 1CZNA 3GRCA 5EIBC 5BVGB 3NJ8A 4UXNA 3G1UA 4BFTA 2UUAM 2K85A 1Y3FE 5DYIA 1G8XA 4DMMA 4TLMB 2I8AA 2WJ6A 1IBKM 2C03A 4YJ2F 2CLSA 4G41A 2HRRA 3FPBA 2R4EA 4PSUA 5FFXA 3QUTA 1FDUA 3OYJA 4QYIA 4EI8A 3GYHX 3FCYA 4IJWA 4CV2A 1TC3C 2B78A 1GO5A 1XG5A 3PDWA 4YLEA 3Q3SA 1DE0A 3VHLB 2BFDA 4KR9A 2OD7A 4E3ZA 2B1QA 4OXYA 3I8XA 4D5CA 4QU0A 4KR3A 1RRGA 4BY1J 1PG5A 1VMEA 5EWMA 4RJTA 1FXSA 1KEEA 3K1AB 3LBHA 2VH5R 1YIDA 3GXBA 4JB2A 3BMOB 3BZBA 1OI7A 5FLEX 3A4LA 5F3RA 5DM1A 1ADFA 4N03A 3K1MA 4R3WA 3R5TA 4DV0B 2ECKA 2R5WA 3WK8A 1JPVA 4GPEA 4MQ4A 4RPLA 3PQDA 4CIBA 1MUUA 4L9WA 1GL9B 1XP8A 2GF9A 1Z5OA 1XMIA 4CIDA 2B6HA 1X80A 3PEWA 3R0QA 5FUVA 4AJOA 3KVNA 4TV8A 3I34X 3OEHD 4N0BA 2C54A 3LFTA 4IH9A 4EYQA 2OCAA 1TM3E 1KFEB 1AB5A 1ZJJA 3OU2A 4UEOA 3KAQA 3EFHA 3ASUA 4F2WA 1YS7A 4WNIA 4FYYA 5ED0A 3OZDA 4A0XA 2JAXA 2Y1DA 3V4OA 3GX1A 4D4HA 4CSWA 4DC9A 2YZGA 2QLMA 1HL3A 5HUQA 4V3BA 2B99A 2ETXA 3TSZA 4UASA 1ZR4A 2VTDA 2O1EA 3W8FA 4M60A 5EIOA 1YHQI 3WLTA 4H16A 2JIZA 4KVGA 4EVRA 1YL6A 1H8AC 5IVDA 3I4PA 4M0KA 3SXYA 4LF7B 4OK3A 1TM5E 4I4TB 4B0OA 4LPSA 2YNMC 1TRKA 4HX9A 3WGIA 2HWVA 1WXGA 3D8BA 1GVNA 1M66A 3PNPA 4OKNA 1X37A 1DKQA 1TD1A 4BX0A 1ZL2A 4MCJA 4RQTA 3TIFA 3MS2A 1HZZC 5F35A 1DG1G 3LNCA 4Q7JB 1YIAA 3K6KA 5IHPA 4D97A 4O4IA 2I10A 4KXLA 4B8ZA 2O3SA 1F2VA 3MNFA 2HCRA 4MUGA 3OO0A 4A1FA 3ZY4A 2HVQA 2VJMB 2NVUB 3ADCA 1YUMA 2ZI6A 3F8BA 2OU2A 1M34B 4A12A 4JL6A 4J76A 3TOSA 3NANA 4TL6A 5HCIA 1R0BA 4XH9B 2DBBA 1V7QA 2ZYIA 3WLMA 2BOLA 3ZHXA 2EZHA 2H5EA 4ZT4A 4NV0A 5KNDH 2MSKA 5K6AA 2LV8A 2FEMA 4JXZA 2XE8A 4J9VA 4H0NA 3K2ZA 2B4AA 4QOZC 2JEZA 3NNDA 4X54A 3TDKA 1PUJA 4S1TA 5CW2A 5IT9A 1C8VB 4YRZA 1W36C 4LYEA 4JJ8A 2ZWAA 1JRLA 1CPYA 4GWGA 3VKHA 3F92A 1Q44A 2VAMA 5JHHB 2RKHA 2FRXA 5BNWA 3A9TA 1CUBA 2A5YB 2FHSA 2L09A 1T3GA 1Z6YA 2B5WA 3QVUA 4ND3A 5M2QA 4QPOA 4UUBA 2VHEA 4CIZA 2HDDA 2F4NA 3MCUA 3NKVA 5C53B 1DGRM 2R9VA 3EMBA 3LY7A 1PG2A 4WXEA 4NHEA 2E35A 3KNZA 3OKPA 3KZNA 2HLNA 2DBYA 2E87A 1N78A 5JJCA 3WL6A 2Z5LA 4WHMA 2QMQA 2OB1A 1RYEA 3E3VA 4BRWA 4F86A 3PFIA 1J56A 1RADA 3GPBA 2WQ7A 2HR3A 2DYKA 3NNNA 4IXDA 3V1NA 2TMYA 1K0UA 3GD7A 1GSOA 2UUAB 3EW7A 5C5CA 1IBKB 2M5ZA 5AUOB 3D3JA 4KWHA 2KDLA 2EA0A 5AONA 3OCJA 4DDMA 2XF5A 2GAFA 3U60A 4L8GA 3PIOF 3MG9A 5CGZA 5MN4A 4EELA 5DTQA 2WW8A 4TKVA 5J2UB 3WP1B 2RARA 1VYTA 3JWEA 4DAOA 1XGKA 1XSVA 4KMUX 2M4KA 4BNNA 2JGDB 3ZHOA 1PBTA 2C4WA 4Q39A 2M60A 1NMXA 3O8NA 2QCUA 5HLGA 4EPRA 4LZZA 1JBQA 4XJVA 1QDRA 5CVTA 1NSFA 2H4ZA 4EKYA 3DMHA 4R68A 4AN0A 2LXNA 1M5TA 2AWNA 2YVKA 2Q3FA 5DCMB 3V42A 1KAOA 2MSDB 1YNOA 4HPXB 3QHPA 1W25A 5AW6A 1NMSA 1V8FA 2IEZA 1D3AA 1U0HC 4E33A 3THWA 4QELA 4TV7A 1H2HA 1YDEA 1QVZA 1AS0A 2F00A 1KK0A 4U7DA 4XD7A 2NSLA 4G81A 1GNQA 3QE3A 3TEFA 2QN9A 5AVRA 1ZMWA 2DHEA 4L2IA 4TKUA 3U9TA 3O8HA 3TL2A 1LC0A 3NYIA 4LV8B 1UBLS 1L1RA 3BDVA 3H4MA 1A4XA 3ZEIA 1ZYRF 4AKEA 2QN6A 5FUMA 1OBVA 1LDGA 3IPLA 3GO8A 3NGMA 4E94A 1IDZA 3O2SB 3NWBA 1SD6A 3CUYA 3HX3A 2RV8A 5B36A 5J6XA 3KRTA 4KN8A 1FW6A 3F97A 1C7EA 5LDDC 3ZLBA 3UW3A 4C4ZA 3QBTA 1IU9A 3R60A 3D31A 2ZYAA 2QRVA 1SQSA 3MGGA 3P9QA 1EVEA 5DD4A 4H18A 3WU2C 4JX5A 4ZCIA 3FSGD 1XOIA 2YWXA 4ER3A 4M3DA 2YFHA 2HT1A 4HQNA 4L07A 1LVUA 1BS2A 2YYYA 1XFDA 1O8CA 5CB4B 2WAMA 4G65A 2ABWA 3BXGA 1P3DA 1TLFA 3ORQA 1SXHA 2EKPA 1NBHA 1DNPA 4J3FA 3JVDA 1A4RA 2IPAB 3VYWA 1WX1A 2J31A 2XAJA 4RY0A 3A2KA 4HDSA 4GI1A 2XQVA 1TDHA 3C43A 5DNAA 5E0KB 4G1UC 4DYQA 2V6GA 1FXWA 1E3OC 4YMTA 1RXSA 1Q50A 1MU5A 4YIRX 2DUMA 1PD0A 2QQ9A 4KSCA 4CMKA 4H2DA 4WFQA 1UKVY 2VRBA 3BG3A 2GARA 5GY7A 2EDAA 1SQGA 4HHEA 5HFNA 2HXGA 1EXVA 3B52X 4ZYWA 4TMKA 4ASUA 5C5DA 3E0QA 4IZ6A 4ENWA 2DAPA 3BK7A 4P58A 3WV5A 3B1WA 5DHFA 1C0IA 2PUHA 2EFHB 3W5BA 2Z4RA 3UXYA 1GDDA 2JIPA 2Y1XA 4X8LA 4BU2A 5FUBA 3UAXA 3DBHA 2LBPA 1FLNA 1OAIA 5TJJA 5T4FA 1PVOA 1D0LA 4LK3A 1NHWA 2WE8A 3H0KA 1W87A 4LVCA 3OYKA 4D8YA 5HIKA 4JBHA 4JGIA 2OG1A 1YWGO 4NJMA 2BZGA 2PKCA 3GLTA 2Q3LA 1PYDA 3BBZA 4EI7A 3I39X 4A0GA 4K9QA 4V38A 3OQIB 1CEQA 5FUWA 4JIGA 1YX5A 3W3CA 4DQDA 3KB1A 3ASVA 1NJFA 4R16A 1U02A 1Q0SA 4KC0A 2CHUA 4XYLA 5JPDA 2P5LC 3Q2OA 1TF0B 4KQXA 3ESAA 3KP7A 5DWQA 1JHHA 1TT0A 2GBPA 4G6QA 1IAVA 3NXKA 4UNPA 3SHVA 4C03A 1U80A 1WABA 2CUNA 4NJOA 3DTIA 1QPGA 3BDDA 4N4OB 4TMZA 3LWBA 2QSYA 1KBZA 4QXPA 1G3UA 3HPRA 5D5WB 4R2MA 2K6GA 4I0BA 1O77A 5DNEA 5ALTA 4FKBA 3NX4A 1T15A 3EGDA 4WXPA 3BZKA 2QN1A 1TH3A 1I94M 4ILEA 3WK4A 5EXDA 3DOCA 4K0KM 3HYSA 4FLMA 3SEZA 1GLVA 4G4GA 1VFCA 2PG4A 1W4LA 1GVDA 3BYZA 1R5OA 2Y0EA 4BDTA 3GLGE 4X3PA 3DXYA 4UNNA 3SZRA 2J5QA 2XZFA 5FTNA 3SE7A 2VI5A 3PGMA 1TXGA 4MYRA 1ORTA 1KNQA 2P1ZA 4KQ9A 4BKMA 3LWFA 1QZXA 4F6RB 1TZ2A 1E3TA 3ETGA 2OY0A 5JDIA 4D26A 4ZOQI 1YAJA 1KO4A 3JTEA 4F1IA 3X44A 1P8AA 2W4QA 3QY9A 4N5LA 1XDSA 2WG1A 1Y56A 3O90A 3LT1A 2YW2A 4CETA 1JSZA 4YIFA 1ENZA 3DM5A 1XZMA 5I4KA 3E7DA 4M22A 3SJZA 3KYCB 2D5BA 1VOTA 3KVOA 4MHGA 3QKSB 4N01A 3KPJA 3N8DA 1SH7A 1SN7A 4KU4A 4Y15A 1DBIA 1W0UA 4RKUF 4BV3A 1BKYA 1ZISA 2RQQA 4YYEA 3VAZA 4H35A 2WB1A 4XB6B 5G4KB 4G1MB 1XQWA 3R74A 4NP6A 4RF0A 2MHCA 4LDRA 4BVBA 2NNWB 4GMGA 3U17A 3RRBA 1WJDA 3SJBA 4D7NA 3HSFA 3COWA 2HYJA 3QEMA 1T4CB 3IEUA 5CURA 4AQ7A 5H20A 1ZAYA 2BBSA 1VHLA 3E5RA 1AOXA 5FNVB 2X19A 3PWKA 1QVRA 2V5VA 2WUDA 3FAZA 4EG1A 1QZ3A 2RFLA 3A32A 4Y9TA 1H93A 1F3OA 1UXIA 1GM5A 4MIKA 1B93A 5EP4A 3ND6A 1AKHB 4KVZA 5HDBB 1PEKE 3VYTB 3CX3A 1Q0TA 3P19A 1EK0A 1KK3A 4FWTA 5AM1A 2EW8A 5J4VA 4AECA 3B1XA 5LMNM 4HSRA 1GRVA 1I27A 2HT6A 4Q3AA 3BG5A 4JKYA 1SMYF 4L8WB 2VUTA 3ZDQA 3DEYX 5J47A 2PZFA 5F9HA 4UFNA 4HRAA 5ALJA 4BMOB 1LNZA 1FNSA 3Q3HA 4BXOB 3PX3A 2Z5FA 4IFBA 3ZZ0A 2M1XA 4KFTA 5T57A 4X20B 4WPGA 1WMSA 1JU3A 1DOAA 3TM4A 4BVEA 2LBFA 4I6EA 3DFFA 3GRRA 3V8KA 1YKFA 5FWAA 2FSIA 2F7SA 5BSRA 1VQ1A 4CM8A 4BQAA 5EDNA 3MXTA 3IUSA 5LD2B 2H18A 5JXHA 3OBBA 1XRMA 4LXXA 3JARB 1II0A 5ICFA 3RUDA 4L02A 1UMBA 4NXMM 4X95A 4U7BA 4GQBA 3ZJ4A 4BECA 1XQ6A 1VDMA 1IWBB 3N0XA 1L4NA 3HRSA 3ZJTA 4UTPA 2JLZA 4A1OA 3OWHA 3BREA 5LBQA 3PF8A 1C0WA 4GKJM 4PYIA 3BGWA 3HUEA 1U5BA 3QPHA 4ZAXA 1XCLA 4AZ0A 1ID8A 4IICA 3UM9A 1O96A 5H4HA 5LQJA 4L4RA 2J5BA 5E17F 1QRAA 4GEGA 4P4GA 2QRKA 4ML3A 5FFNA 1YZYA 5EMMA 2LLKA 5DZSA 4FDMA 5A1TA 2QX7A 2L4FA 1DRJA 1RUOA 2WB1N 3UJHA 4EGJA 3ELKA 4C6TB 4XKWA 3DMYA 4U02A 1NKVA 2CDNA 1X39A 2J6BA 3GFIA 4P4LA 4DQKA 1B0UA 2OG2A 1FSGA 3BHJA 3QMVA 3UAGA 4UREA 3VR4H 4YALA 1M72A 3IBGA 3IAHA 3I72A 2X6WA 4ZMBA 5ALEA 1KI6B 2D7CA 2VATA 3F3MA 1IONA 2UKDA 3HOYJ 1W8IA 1Z45A 3ONQA 3LOQA 1SZPA 2KHMA 1P2BA 1UJ6A 2OK8A 1F5SA 1EG7A 4MWSA 3PVCA 2O2GA 4AKHA 3AEUB 1CP3A 3FRJA 1UR5A 4F1KA 3EJ6A 1XWIA 4XIGS 4BCBA 1RAFA 1Z4QA 5GONF 2PLWA 4R71A 2E18A 2QTWB 3VDMA 1B00A 1OWPA 5DXJA 4C0AC 5CD1A 2F3TA 4QARA 4L8VA 3VGJA 1DWPA 5M5BA 2D2FA 2OECA 2HO5A 1I94B 4YRVA 5FOUA 3VR1A 1PRBA 4CEHB 4K0KB 1UEXC 3GFTA 4XYBA 1FP4A 1G6NA 2GA1A 1E3WB 2W4IA 3U56A 1ZWLA 4BZZA 2W8ZA 3AZOA 4NX2A 3PD0A 4I9UA 4CU5A 2D0PB 2GZSA 1WWXA 4LF5M 4MVJG 2PH1A 3A01A 2IZ0A 3NG1A 2D1TA 1PCXA 4JVNA 1XPXA 1MV8A 1YD7A 2I1WA 2G7HA 1TK3A 1YR7A 5EZYF 4TWJA 4RXTA 1R2ZA 4AO8A 1ZZEA 1ETWA 1QG6A 1QGUB 4H7EA 4YS6A 4EP1A 2VJAA 4LOIA 4GDFA 3GDOA 1UBOS 2EKZA 4JEIA 1H2EA 2GZ1A 4PANA 2KIFA 2OHOA 3IUPA 4MDFA 2EZIA 4KBGA 4X8MA 1IV8A 1VP3A 3ZC7B 4ZMSA 2V8BA 3LP6A 3I5YA 1PWYE 3TR5A 1QGAA 3RKSA 4UOEA 3NEJA 5FLXK 4ENQA 4MVCA 1B8NA 4RPCA 2B35A 1DUSA 2R7VA 3QU5A 1ZN7A 4UE3S 2QU8A 3ND5A 4HDNB 3CINA 4DR7B 1Y34E 2ZIAA 3Q3GE 3HG9A 3TWOA 4O3FA 3QVGA 4DLKA 4MQFB 2BTOA 5KQPA 3TQQA 2SKEA 3GH1A 2LR8A 3BQNB 2R6ZA 1VQ4I 4MV6A 2Z5GA 1XZHA 1POXA 3AVQA 1N9ZA 1T5DX 2QVXX 3I37X 2EKFA 3QKRB 5F4ZA 4ZPXA 1W49A 2QJFA 1DL5A 3L92A 3R7WB 5D7NA 3FWNA 2IGMA 4GBED 4FPXA 1H4QA 4V1CI 2L9VA 4KFUA 4JC8A 4W1QA 3EXHB 4J29A 4MVWA 2E4UA 4JLAA 1Y1KE 5LC1A 2KJCA 2B3DA 5LMNB 4NFSA 2PUGA 4EG3A 5IP6A 1AMOA 1XKXA 5HTKA 3GJ0A 3DLCA 4Q9DA 4Y2VA 4FHCA 1DC4A 5TMPA 4LNUA 3SF8A 3WMFA 4B17A 1EFRD 4WZAB 4FGWA 1TP4A 4BZQA 2X0FA 2ID6A 5IM4A 3RT9A 1BGVA 3K5HA 1Q2UA 1CF7A 1NW6A 3O74A 1IVSA 4N6GA 1UBMS 2YS7A 3HBMA 4NXMB 1U2SA 2JFNA 1A9ZA 5IWCA 3NS7A 4BVHA 1L1ZA 2HHLA 2AO9A 3ECHA 2LNDA 5JPCA 4OI2A 4HLUC 1WH7A 3HRHA 3NGXA 4GKJB 5GP9A 2H2DA 4JYAM 3WGTA 1QOQB 4G4QA 2PM8A 4RDIA 4LXTA 5L3QA 4OYYA 3MFQA 3SKVA 3J80K 2H52A 4U2FA 3OL4A 3VYVA 3GFFA 4PX5A 1I3MA 2ZSDA 4RVHA 3I9V6 4E2FA 5F04A 2DAOA 2ZRMA 4XYGA 3A6ZA 2Q2EA 3DEUA 3IP5A 1Z82A 3AGPA 3E5MA 3TZQA 4DFDA 3TWKA 3LWDA 3RVPA 5CHEA 1DCTA 2ZBPA 3DV0B 4C78A 3VAYA 5G0VA 2E2WA 4EY6A 3X2FA 3V8LA 3X1MA 1NRXA 2IBDA 2XDVA 2H65A 4R4JA 2JT1A 3NYRA 1SD5A 4AN4A 1XTVA 1FJHA 1HQCA 1OILA 1FQOA 3TZCA 3ESYA 1G2IA 3A06A 3MZ0A 3LKZA 3CJNA 2XOKD 3HJAA 4BQRA 4LOAA 2WMDA 2QEXI 3R7BA 3BTCA 4ROTA 3HB7A 4NVRA 2AQHA 4BLQA 5EXSA 4JJ4A 1TDZA 4UM9B 2ZMEB 1EB8A 5DVZA 4KIFA 1U3FA 2G1JA 2JJ8A 1QRDA 1SWVA 1R1DA 2R7DA 1MMSA 1UC9A 1V4NA 3GBGA 4G24A 2E5NA 3TQIA 1NUUA 5H02A 4ZDIA 4LYAA 4FTHA 1SD7A 3IIMA 4IIJF 2I55A 3DT9A 1TIKA