2QBYB

Crystal structure of a heterodimer of cdc6/orc1 initiators bound to origin dna (from s. solfataricus)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
368
structure length
368
Chain Sequence
b'KNPKVFIDPLSVFKEIPFREDILRDAAIAIRYFVKNEVKFSNLFLGLTGTGKTFVSKYIFNEIEEVKKEDEEYKDVKQAYVNCREVGGTPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIRAIIYLDEVDTLVKRRGGDIVLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEYGLIKGTYDDEILSYIAAISAKEHGDARKAVNLLFRAAQLASGGGIIRKEHVDKAIVDYEQERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISELDMFGIVKIRIINRGRAGGVKKYALVEDKEKVLRALNETFEDSIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (33-MER)
publication title Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Replication/dna
total genus 112
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09079 Cdc6_C CDC6, C terminal winged helix domain
B PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2qbyB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qbyB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qbyB02
3WGGA 4L5IA 4DLTA 3NTUA 4B48A 1T6NA 5HCIA 2WPDA 4ZDJA 2AS5F 3WMGA 4ZO4A 4TTQA 4BE7B 4ZKDA 2P6SA 4HW0A 1NBMD 2RKHA 3DQVC 2OD5A 3CO6C 1N3BA 2ATVA 3W3AA 3NEJA 5CVRA 1HQCA 2GIVA 1AOYA 3QVVA 3QNUA 4HLCA 5FOUA 1CULC 4LDJA 3HU3A 1QHHB 3NDBB 5B58C 2QGNA 2Q0OA 3UKDA 1R4AA 1ZGJA 3RYPA 4D0PA 3KEOA 3BFVA 4JL5A 4YDSA 1HT1E 1KIMA 1VDZA 1GVJA 1IZ1A 1EESA 5E1WA 3WYGA 1EGAA 4XVRA 4M53A 5FUWA 2VBWA 5DI3A 5FLXZ 4MTEA 1RZ4A 2A6EF 5LPNA 2VE9A 3TR5A 1QZMA 2GF9A 3WNDA 3CF0A 3TKYA 4V0NA 1XCBA 1D9ZA 1ZAOA 4Y13A 2PG4A 1GNPA 4A12A 1DTSA 2ERYA 4NL4H 5KNCA 3PJRA 1GXPA 2XGXA 221PA 1ZMXA 1DELA 1N6RA 3KFXA 5EXPA 1REPC 1W0KA 2W0SA 3BRWD 4CYDA 2YV5A 4WZAE 1KI4A 4DLSA 1AGPA 5ICGA 2OLJA 4QGAA 3PITA 3UANA 4NKRA 3RKYA 1E0AA 1Z7UA 2QQAA 1NMZA 2W85A 4Q66C 3LAWA 3TJZA 5FUXA 4LJ5A 2A5DA 2LNBA 1TQ6A 4PC2A 1TTTA 1F6BA 3SZTA 2CK3A 3LFKA 2K4BA 3Q9VA 1CKEA 3BB4A 3EA0A 4E03A 5F9HA 1KYWA 2YJTD 1DEKA 1VYUA 1Z1DA 3F8FA 3MQ0A 5IRCD 3U3MA 1BI2A 4QGFA 1WB9A 3SHWA 3TDZC 1JXSA 3RPUA 3H2YA 1QF9A 1YHNA 1E0SA 2VP4A 2DVWB 2Z43A 3B13B 1P62B 1LVGA 2ONJA 2GCPA 1Q21A 3BFKA 3AF2A 3NHBA 1QNTA 3AJIB 4G7HF 3D0SA 4P3YA 3REGA 3WMEA 1RPZA 1E79A 2L3DA 1KO5A 1P9NA 1YU9A 1ZG1A 4B35A 5JSZA 3OOPA 4WK8F 1QHIA 2BBTA 4JJKA 2KIUA 2AHOA 4OBEA 4OK5A 4HUQA 2O8BA 1T91A 3CDHA 3J80K 3ZPLA 2VQSA 3CNOA 4LWZA 1H9TA 3BJ6A 3C7JA 2CYYA 1F48A 4PZZA 5FOXA 3E3VA 4FMDF 4DUGA 4IVPA 1FQJA 1LF0A 2AK2A 1NKTA 4HAXA 1IQPA 3OE7D 1E2LA 2VSOA 3W90A 3K70C 1R8SA 3C14C 3CPEA 3FWYA 1KTVA 1R5NA 2ZRHA 1DAEA 1EXMA 1D8JA 3Q5EA 1F2UB 4RD6A 3H3ZA 1LV7A 3R0JA 2QL6A 4X8OA 4AYTA 4ETSA 4BFYA 5L3DA 4BFZA 4QM6A 3O2PE 3BE4A 3KXKA 4PO8A 1BC7C 3L09A 1SXJC 3TDUC 1NVVR 1D6JA 5FFZA 1E69A 2FFHA 2OZEA 2HXYA 1CRQA 5KSPA 4LJ7A 5E95A 2R9VA 3U9GA 1XWIA 4TV7A 2P67A 2QN6A 3U7HB 4XOIA 3QU3A 4M74A 2DK5A 3CWZA 1ZYUA 2VC0A 2G7UA 2DR3A 2EA2A 4P55A 4E5UA 2WKRA 5B2ZA 3RC8A 3AVTA 1H65A 3W6PA 3HU1A 3VODA 3IBGA 3K0FA 2QAGA 3IHUA 4NHOA 1E6CA 2WMNB 4P0TA 1AZSC 1FUKA 1TU4A 3ZIAA 3OFNA 4H1VA 4IVQA 4DEXA 3W5JA 3KP6A 3EAQA 4KAXA 1JALA 2F3TA 2C9OA 4QNRA 4BYYA 5D5WB 1XCPA 5JWHA 3UWKA 1E0JA 1CGPA 1U0LA 3ND9A 2IYQA 4ACAA 4ZPXA 4WX9A 1ZNZA 3RS0A 1W1WA 4L16A 2UZKA 1Q0UA 1R2QA 2W84A 2WWWA 5LD2B 5P21A 2EB7A 2WJHA 4Q00A 1KMHB 4WBSA 2J0UB 3PUWA 2Z99A 3F8MA 1YYVA 1RI7A 3ISPA 2ZR0A 4JZKA 2IYSA 4CRWB 2X8AA 3U5ZB 4FHTA 2JJ1A 2ZRNA 4EUNA 3IL2A 2F5EA 1AGRA 1U2RA 3CB4A 3SEAA 4DB2A 2YX4A 1N6KA 1FTSA 2FFAA 2V1XA 4LK0F 5A4JA 2GEVA 4MKGA 2B21A 3QXHA 3NQOA 1FL9A 5ILVA 4MDEA 5DV5A 2O8DA 3JVUA 2G1JA 5DLQC 5J4HA 2BMDA 2PJZA 4G0NA 3JVVA 1Z2AA 1WQ2A 2YZ2A 1MOZA 4S04A 3ZQ7A 3BJOA 1XPOA 2FBKA 2NO1A 3RWOA 2BM0A 1ZRCA 3HRSA 5EZ5A 3V4FA 1VG1A 4JLAA 4BZXA 2W57A 4TMWA 4DSNA 2C6YA 2XJ9A 2F9LA 4M9ZA 3C3WA 1ZNWA 4IDPA 5BN3A 1NKSA 2NZ8A 2OESA 1XD7A 1NN0A 2OCAA 4ARZA 4YIIA 2PEYA 4FCWA 2B6HA 4D80A 4KDPA 2REBA 1QZYA 4TLBA 4E07A 1OSNA 3C15C 1T98A 3GJ4A 1T38A 1KNXA 4ERNA 5AUNB 4OI0A 2H94A 3GLXA 1GP2A 1OFHA 4FCVA 3KXLA 2BVNA 1XNJA 1ANKA 2FGJA 3RJPA 1H8ED 1WCV1 2NNNA 1RFLA 2CGPA 1RW4A 2RN7A 3DKPA 4G01B 4NONA 2ZSAA 4DCSA 1RNLA 4QWQA 3W6JB 5TMPA 2J7KA 4KBFA 2ORVA 4C0SA 3J81K 2QYOA 1MKYA 1RRFA 1E2GA 5G53C 3CPJB 2ZRCA 1XU4A 1FMLA 5G3ZA 3P1JA 1TNDA 4ESBA 5EE9A 3DFGA 2VTKA 1U6GA 2GXUA 1HH4A 2ZRIA 4ILEA 5F2EA 2A68F 2FSHA 2RV8A 1CJKC 2J5OA 2EFDB 4JKYA 4GP7A 1DUXC 3AGQA 4V0KA 1ZM2A 2GHIA 5EP2A 2UXNA 3IHWA 3HWSA 1W2GA 4QBFA 4TQ9A 2ZJZA 4BLSA 2RQPA 3LLUA 4IRUB 4V0ME 5GVRA 4HDUA 3FB4A 4C0KA 4AKIA 2F2EA 3WP0A 1LY1A 3WNBA 4A82A 4DDWA 3SJCA 1K8RA 1NIJA 2VF7A 5EE3A 1W36C 3IRRA 1E2IA 4HI0E 2A5JA 3DDCA 1DAIA 5L3FA 3GLGA 1ZH5A 1DG1G 2AWOA 3NVAA 3OIWA 4A0RA 1KKMA 2RGDA 2PI0A 2HKXA 3HHGA 4UNQA 4F4JA 2L4AA 2WV0A 1YZLA 1VPLA 2WSSA 4AD8A 4AIIA 5D6FA 1P4WA 2VP2A 1W4MA 1NSTA 1T6SA 3AP2A 3T1VA 1IAWA 1SMTA 3F72A 4GXOA 1FPMA 3KB1A 3RDPA 3TUZC 3RYTC 1N5KA 4OOIA 2WIAA 3CRRA 3QG1A 2JZYA 5DI3B 1R5OA 2FFBA 1J99A 1Z91A 4MRPA 5FR2A 2XTNA 5FBVB 3GLFA 4FWHA 4A0ZA 2V4ZA 2GAAA 5TVKA 3TSWA 2WWHA 4URWR 4WXCA 2HUPA 2PFBA 4D0NA 3Q5FA 4EQ6A 3J80Z 5FTMA 4IOKA 4YG2F 1WF3A 1FBUA 4FMCF 2QNRA 2XB2A 3BOQA 1IAQA 2Z0MA 4AG5A 3LA3A 2FOKA 1ODDA 1XZPA 4DLUA 2LKCA 4BLRA 1G5TA 2XOKD 1E4YA 4GOKA 3HUGA 2ZRAA 4LLLA 3T5XA 3D31A 4BRUA 1NVVQ 4HB4A 5CYOA 3T1QA 4ON0A 1FX7A 5JS8A 2IX3A 2VBZA 2DPUA 4HZIA 5JRJA 3U4QA 4Z8XA 2D74A 1MABA 3KP7A 2BEJA 2C8VA 1XF9A 4LBVA 3HRTA 4PC1A 5CITA 1BBYA 3LVQE 3O8CA 4A5NA 1V4RA 4L9TA 2LF7A 5FTLA 3R7WA 2AXLA 2OZ6A 1XEWX 4LGWA 1LS1A 1MO4A 2WWGA 2JTVA 4EPTA 2ZROA 3TIFA 4BUJA 2CLSA 1XDBA 4M8NE 1TU3A 1BC8C 3BH0A 4FIDA 3GZ6A 2A78A 2BMEA 2QQEA 5KU1A 4LB5A 1QO0D 2JPBA 5CYVA 1G20E 2HV8A 2KB0A 3TO7A 3VMFA 2ODBA 1E2DA 3FKQA 721PA 5J4YA 1HW2A 1ZRHA 3ZMVA 3PUZA 4IVRA 4A6EA 4W7SA 2O0HA 3KKMA 1STZA 2AFHE 4O2LA 2KRFA 5F9FA 1FOKA 1UBFA 2FEZA 3IPXA 2XHKA 1J0RA 1MD0A 2PX0A 1TBXA 5D4SA 2A61A 1E3MA 4FX0A 5CJ2A 3CBQA 4BHCA 3R6SA 3S2WA 1XGSA 3NBFA 2MSDB 3KETA 1NN3A 1M7HA 1NNEA 1HE1C 1S3SA 4NB5A 4OQXA 2HDCA 2E7XA 1KI9A 4ZDKA 3EYIA 4BFSA 2DHRA 4UNOA 1HW1A 1JHFA 2CCJA 2Y48A 1XMIA 4M1WA 3ZZUA 1NMXA 3K69A 1G8FA 3WRYC 4DB4A 1W48A 4OHWA 1BOAA 2GCNA 4G6QA 2VL7A 1BI0A 4E22A 5ERIA 3GLHE 2GILA 1W5SA 4RS8A 2QAGB 3TAUA 4Q1EA 4W9MC 3LXXA 1FYKA 2IT0A 2ZUCA 4D82A 3OIVA 1W46A 3P27A 4NDZA 4Q1CA 3UMRA 4B47A 2Z9OA 2P5VA 4JLPA 2VF8A 4P4UA 3GW2A 1DAKA 1L4YA 4L9VA 2C5LA 3FXQA 3ERED 4HEJA 1EV7A 4QC2A 2HF9A 1WXQA 2QPTA 4OK3A 3E5XA 4ZYDA 4RKFA 1QG2A 4DSUA 2L54A 1YZGA 4V02A 2ZS8A 4PZLA 5TDHA 3EXAA 1MJ9A 5DI9A 1EFCA 4QFMA 4Q1AA 3TVDA 1EFUA 4TL9A 4C2UA 2H57A 3I53A 3E97A 2HLDD 2VC1A 3J81Z 2X77A 3I5YA 3IEVA 4PC3A 3SFZA 3OZXA 2XSZD 1MJAA 4LJ4A 1GVNB 1KI3A 1GL7A 2UXXA 2V6JA 2WVJA 4FI3C 2NPIA 4K8OA 2FXAA 5K5OA 2O8DB 3D5LA 5FTJA 3M1IA 1JR6A 3C4JA 5FO5A 4A0XA 2JDID 5C18A 2R6GA 3I92A 3E6DA 4TYPA 5H8WA 2ZRLA 4HYYA 4ZIRA 2DBYA 2VBYA 1JXOA 1ZIPA 4EFLA 4N3NA 5UKDA 1BJAA 2G9WA 4FW9A 3GJ6A 4I1SA 4B6FA 3IILA 1S8NA 2ZREA 5JFGA 2FSIA 1G7RA 2OHFA 1OFUX 2ZRBA 4FWTA 1U78A 1ON1A 1FT9A 3KCCA 1JE8A 4IFEA 3FOZA 4ARZB 2SHKA 4LMYA 4A6DA 1S1CA 2CSOA 1OHHD 3OEEA 3FMIA 3KE2A 1LF5A 3UG6A 2CHQA 1J90A 4MA4A 4PDKA 5FI0B 2PL3A 3NBZC 3THOA 1IXZA 1P75A 2ZI3A 1Y0UA 1G3WA 1YRAA 5FR1A 2J7PA 3GFJA 1FYMA 1G3QA 2FFQA 1O3SA 2KIMA 3B02A 1XBTA 3DVLA 2Z4SA 4QG7A 2ESHA 2OQGA 1U0HC 1T8TA 1XMJA 1G3YA 2H17A 2ZS7A 2GZWA 1YQAA 5DYMA 2ZJYA 4KLZA 4RFSA 5EE0A 3PEWA 2RC4A 3ASZA 3K9HA 3P9KA 5JVTA 4PO9A 1DAHA 3BGWA 4I02A 2YC4C 3U6KA 2J3EA 1FP1D 2BE5F 4NH0A 1MO5A 4UNRA 4NE2A 3VR1A 1IJFA 4PFSA 2JIZA 3PR1A 4Q03A 2QP3A 5HZKA 3AVWA 1X37A 4Y15A 3A1SA 3X1DA 1R22A 4URUR 2XZLA 2D1HA 2VSFA 3CONA 4PSVA 3DMDA 2AN9A 4Q48A 3MFKA 2GXQA 3GEIA 2FE3A 1W0JA 2XKOA 4LHYA 2XZOA 1OT3A 3AVQA 3QBVA 4BEJA 4JLOA 4DJTA 3QKUA 2VA8A 2ANCA 1W4RA 2J0QA 1EFTA 3SU8A 4HATA 1QVAA 2HEOA 1VMAA 4X8MA 4PHHA 3ICEA 3GLGB 4KSCA 3VAAA 1N0UA 1BS1A 2ZTSA 2FSFA 4CF7A 4Z54A 3HRUA 5BYKA 4K46A 4PPNA 4CEHA 2PJPA 5EE5B 4A3VB 1R58A 2Q3FA 5JJLA 5L3QA 1D8KA 3ROUA 2PMDA 4N0DA 1ZD9A 2BYVE 2Y75A 1DVRA 2WM9B 1G7CA 2W0MA 2WAYA 2XNDA 1G16A 1YZTA 3LH5A 2O8BB 2ZUDA 3LNCA 2HYIC 3MFYA 4KU4A 2WMOB 4YXWA 3QRFF 3VX4A 3A8TA 3CH4B 3I8SA 3OAAA 4UHTA 4EQ6B 1P4XA 1CF7A 2V9PA 1HKQA 1FX0B 4B6EA 3LA7A 5EJEA 121PA 5H20A 3WODF 3PV0A 3ZMZA 1XTJA 1N5LA 3L7WA 2Q0HA 3EETA 5HCNA 3M1EA 3ZVNA 3SZPA 1EFRA 3AKCA 4L9WA 4BPBA 3GLHA 2EFWA 1NP6A 2J87A 4A8JA 2W6JA 1SXJE 3IRQA 1K6OA 2HS5A 5E18F 3U4QB 1J70A 2ZPTX 2JLSA 2YOHA 3I0TA 4A0HA 2O61A 1XSDA 3D3QA 1DPRA 2KBEA 2HGCA 3TOAA 2WPDD 4AI6A 5D5XB 1VKJA 1ZM3A 5TV2A 1XTSA 3GQBA 2JRTA 5CB8A 1S1MA 2BEKA 1CR0A 4GOXA 3R7WB 2DWPA 2ZVPX 1Z2CA 4DLYA 1AJEA 4HLQB 3NEYA 1E2MA 1UDXA 3MGCA 3B85A 2CWEA 1OLOA 1E2JA 4LHVA 2AX4A 5BQ5A 3TW4A 2QU8A 3UXMA 2G7HA 3TUIC 3F0TA 1CRPA 5E1XA 2M87A 1IONA 1DBSA 1GNQA 3IEUA 4BZPA 2ZJ8A 2IXGA 2O3FA 4Q4JB 5KPJA 5L3EA 2JLXA 4JVNA 3U7GA 3BOSA 5E7IA 1Q57A 4G5SA 3G82C 1JR3A 1KNQA 3QPVA 3KQHA 3SQWA 4AWXB 3RKWA 2OILA 4R2HA 4RZ2A 4DNCA 5C4GB 2R8RA 4MH0R 3ADCA 4TSFA 4DWJA 4TWZA 4CW7A 3LDAA 3GEEA 3LO5A 1I27A 4JYBA 2HCBA 2HXSA 2WJGA 4TLDA 3K9GA 3F3XA 1XTQA 5JHGB 1M6NA 4U7BA 2ZITA 4Q21A 4Y17A 3ECOA 5K8UA 2QBYA 1N0WA 4GPTA 4WWCA 3K9NA 4DXAA 4F7ZA 2D06A 1N6NA 2ZETA 4ASUA 2KI5A 2G3YA 4HDQB 1X86B 4UXNA 1C0WA 3BS4A 4CEIB 3ADKA 3U44A 2HT6A 1W0KD 5LRSA 1S9DA 2JEOA 2P6NA 3EIEA 4FWIB 3TOBA 1KJYA 2A9KA 3PUVA 3CNNA 4RD0A 2J9RA 3N2EA 2CDNA 5E8GA 2R6DA 4TT3A 3ZGXA 4DLVA 1G4DA 1PLJA 4EV0A 4RZUA 3DKVA 4DLRA 1OFTA 4JBWA 3A4LA 2A2ZA 4HLUA 1FTNA 1QGPA 3DKWA 3PEUA 3U60B 1W7PA 2CK3D 3OV8A 5JHUA 3B5JA 3VTKA 5JZVA 2A6HF 1BI3A 4K81B 5L8VA 4I01A 3THXA 2PLRA 3ZP5A 5KUTA 1HE8B 2IW5A 2W58A 4GFDA 3SJZA 3EQLF 5HDGA 3E6CC 2KIFA 4HX7A 4L9SA 2K27A 4LC0A 3QUSA 4LYFA 3VR3A 1U9IA 3WTUC 1QQIA 2ZI6A 4LLGF 2XUBA 2BMFA 1I1GA 2F7SA 2XAFA 1KQ0A 1XZQA 3H1TA 3E5HA 1VIAA 5J5CA 2D7CA 1YVDA 1MO3A 1BN5A 3CLOA 4NYJR 1E79D 4QBIA 3PG5A 4RD1A 2O8XA 5L3SA 2IWRA 1YRBA 4IOLA 1CBUA 2CXXA 3LBNA 5CVUA 1X3SA 1IN8A 1I6XA 2DU9A 4KMUX 4U0WA 2RGBA 1U8ZA 4EGYA 1MH1A 2IUUA 3ZVMA 1UKYA 2H6BA 4DUGD 4Z51A 1F1ZA 2B8WA 4UV8A 2PH1A 5JI6A 1RJ9A 4LB6B 3I1FA 4A2QA 3FHTA 2D45A 3FE2A 3OF5A 1UHWA 5CM9C 2DZOB 2ZRGA 3RWMB 2ZYUX 2H16A 1P4AA 1G3TA 4JL8A 2GA1A 2STWA 2BKUA 4ZIRB 3GYHX 1YZKA 2ZYTX 4UJ3A 2EFEB 4OU0A 4MGZR 2MC3A 3HJNA 4F91B 3BWGA 4RB3C 1VHLA 1TEVA 3ZN0A 4W5JA 3RDIA 3Q5DA 1ZG5A 4TYWA 1DAGA 2QE7A 3REFA 2FSWA 1G3MA 3TSZA 3GJ5A 1XXHE 3NBXX 2DLLA 2OBNA 2QP4A 4YMVA 3EPKA 2PBIA 3IIKA 1J59A 4EFNA 1BMFA 1JBKA 1G4AE 1FFHA 1XCMA 1U3EM 1G21E 1P9WA 3W6NA 1S2MA 3D6TB 1E9CA 1OPXA 1UKVY 3ZIAD 1ZNYA 3FHOA 3MUFA 3ZH9B 1KGDA 3OFND 4P32A 4B32A 4FX4A 3KLOA 1V5WA 1YG2A 1HSTA 3U1DA 2V6IA 3L8ZA 5L3CA 3IO3A 5J8FA 1R0WA 2IXFA 2ANBA 2QM3A 1VG9B 4HAMA 3VR6A 5FUVA 5E4FA 2YWHA 1O87A 1QHNA 2V6ZM 1XSVA 2IRFG 2F5CA 5CVVA 2XAGA 3ZMDA 1W4BA 1KQ9A 2JGNA 4BLTA 5KNDA 2E1RA 3V7SA 1E1RA 1KK2A 1WRJA 3V8KA 2ODWA 5IT5A 2RGEA 4TMZA 5G3YA 2YKGA 3S1AA 4HYEA 4FT8A 1BOFA 3B1WA 5JI2E 2JJ1D 4DCVA 4HAYA 1TL7C 2QMOA 3M8EA 3BXZA 1CEEA 1VCIA 5J47A 2H6CA 4HLXA 1W49A 1X8KA 3WGIA 4TLEA 3CTAA 5AUOB 5DN6A 2NNYA 1T2KA 4BQAA 1DAMA 2ZSBA 3K0EA 4D6PA 2J0SA 3LW7A 5F6FA 4Z1MA 4HF1A 3WY9A 6PAXA 1E2KA 1SQ5A 1U94A 5CLSA 1CIPA 3P9IA 3SHFA 2P5SA 4HBLA 2D62A 1R7RA 1AZTA 5CYPA 1NY6A 1S29A 4DIEA 3REOA 2HDNB 2IA5A 3I32A 5ED4A 3T61A 1U2WA 1ODFA 3U7FB 3EUHA 3FKSA 2AWNA 4JL6A 4MYTA 1E2EA 3RSOA 3ULQB 4LUCA 3I8XA 5EXSA 2NS0A 4CEHB 4R98A 1WWXA 2NIPA 5L3QB 4CZ2A 2PCJA 1KSGA 2ZUBA 5JS7A 1V3FA 2OZUA 4AD9A 5LLQA 821PA 3GEHA 5LEKA 4QM7A 1E9SA 2ZYWX 1P6XA 3WU1B 3CO5A 3THWB 1ZLJA 3CR8A 3KP2A 4LBZA 1XB4A 4LJ8A 2H7VA 2PLFA 4NBSA 4BGDA 1KJZA 1XX6A 3U61B 2CHVA 3Q9SA 2PMKA 3F22A 4XSGA 3V00A 1CF7B 4TTPA 4IEIA 1R7JA 2F9MA 2YHSA 2FG5A 4YMWA 2YOFA 3DEUA 2O8EA 2ZI4A 4URXR 4LJ6A 3KKOA 2RB4A 3QP6A 5FTNA 1ONVA 2DW4A 3PQJA 3HTSB 4JBXA 1WRBA 5B57C 1PUEE 4BHPA 1NIPA 1E99A 1KO1A 4KIBA 1P9RA 1RRGA 4G1UC 4PANA 4A8JB 1LB2A 2EYUA 4BASA 4DKXA 2RCNA 3G3ZA 4RAYA 2CEAA 1VECA 3BD9A 3CX7A 1LEAA 2ORIA 1FPQA 4TMKA 3LD9A 1D9XA 5D3QA 5HPYB 1JECA 1MRSA 2C9CA 2EU8A 3SJBA 2CJWA 1G7TA 1EFHA 1WQ1R 3QF4A 4KFRA 5CDFA 5L3GA 2AKYA 4KO8A 2AXNA 1AA9A 4KT5C 3L0IB 1MO6A 3V9PA 5DDGA 3K09A 5TRDA 1ZG3A 1X1SA 1LTQA 4PC6A 4M1MA 2RHDA 1Z47A 2CVHA 4M1KA 1HA3A 1NN5A 3R9WA 2QT1A 1FUUA 4F7WA 4P5OA 2OXRA 4LSGA 2QG6A 3CX8A 1XTIA 2JASA 3KL4A 2WWXA 2ZS9A 4NYJQ 4XWAA 2K4JA 3VR4A 4A2PA 4GGGA 1XEFA 2WSSD 3BH6A 2O0YA 1Z08A 5F1RA 3HHHA 3P9CA 1ZUHA 2Q9BA 4LJAA 2PQ8A 2OFOA 2IEYA 1K6MA 4QHSA 1OKRA 2ZRPA 5CJPA 1JPNA 2MSCB 3VQTA 3GLIE 2VHCA 2WICA 5J4VA 5KO2A 3K1NA 4HV6A 1W47A 4FD2A 2P7CB 3CM0A 1JB1A 4E70A 2AK3A 3LRPA 4GSYA 1R0ZA 2QP9X 1D5CA 1FBSA 5D5VB 4B33A 1VG8A 2GAUA 2YWFA 2QBYB 3C8UA 1G6HA 4TMVA 2XNSA 2F43A 3QPTA 5LD2C 4DLXA 1UM8A 1XN7A 1CU1A 4EM0B 4GITA 4B2IA 3LX8A 2QT0A 1GFIA 1P72A 2VBXA 3QKRA 3TKLA 4PZYA 2IPQX 3U44B 4LRSA 3WGHA 4HUTA 1GDDA 4WA7A 3NHAA 4RZ3A 1XXHA 1COWA 2WV9A 4CEJA 3EZ9A 1KU7A 3EYYA 2BBWA 1HBXG 3ZS9A 4PAQA 3M8FA 1KK3A 2DYKA 4XD7A 4XIGS 3BB1A 4C3ZA 2VHJA 2ZMEA 3NKVA 2EJRA 1JEDA 2GJKA 4G9YA 3TNFA 5EXTA 2HTSA 1LEBA 1UEJA 1Z6AA 3K0CC 3RVBA 1B4AA 4PTLA 3RS7A 3IKTA 2DWZB 4G7OF 4YLGA 3NIBA 1W7PB 2LDUA 2D4HA 2BWJA 2DFTA 1UBEA 3BFXA 4HAUA 2ZNYA 3SE0A 2J0VA 2PJRA 3THXB 1D8TA 1TQ4A 1ESNA 2EWVA 3FYHA 3I5XA 4PGGA 4QJ5A 4JLBA 5FPYA 1ZU5A 1IOZA 4GP6A 4Q9HA 1E1QA 1NMYA 4AY2A 1AQUA 1KSFX 1H8HA 1J9IA 3AGPA 5TJJA 3B1VA 3QAHA 4UVBA 2FMXA 2YOGA 3WYFA 5KDLA 4ZKEA 2P4WA 2QQ0A 3EPJA 4RB2C 3A6PC 3W3ZB 3X2SA 3KZYA 4ENMA 2FU4A 4LJ9A 3R60A 1ZAKA 3CR7A 4MRSA 4O25A 2EK5A 1KDPA 2KJCA 2O8CB 1LNWA 3VKHA 2YU3A 5AIPA 2WSMA 4HA8A 1GHCA 3SYNA 4OIRF 3DXJF 2OFXA 4RFVA 3BDDA 3HTUA 3L0OA 4MGYR 1Z9CA 2Z5FA 4S35A 4EJUA 3R9IA 1RJ9B 2EV5A 2QMEA 1VIYA 3JTHA 3WTSC 1IY0A 3D8BA 2E1CA 1ZIOA 3AQ4A 1I4DD 2RVCA 2GK6A 5BPDA 4GYIA 2ISYA 4P4SA 1Z6RA 4LG0A 3HRMA 2VHTA 4JLNA 4BLQA 4TL8A 2G88A 5JWOA 3GFPA 1O3TA 5GJCA 1U5TA 3JW4A 4EDHA 3R0AA 4M9SA 1SVLA 1VCNA 3HYTA 3PENA 1SFEA 1Q22A 3SS8A 3FF5A 1CJTC 4MTDA 4CIDA 2QTHA 3SDZA 4XTCS 2BOVA 3UK6A 4JYCA 1FNMA 4QXAA 3TBKA 3HPRA 2OU2A 2ZI5A 2G0NA 3GJ7A 2ZIAA 2R6CA 1LVAA 3N5CA 4XSXF 2D2FA 4II7A 4LBYA 4OJQA 1OXVA 2CL6X 3MWJA 5TB5A 4MRVA 1L2TA 4QKQA 1B59A 2L4MA 1O7FA 2AKAB 3BY6A 4YFKF 3R8FA 2YWGA 3I61A 3GPLA 4DT1A 2GBLA 2VHUA 2H27A 2MH2A 4P9FA 2HQRA 3T15A 4QHTA 3EX7C 1BIAA 1TNTA 3SFVA 3KJHA 2BJWA 5FGMA 2OBMA 3N2IA 4LPSA 2QUZA 1E9RA 1G3IA 1GL9B 4JLJA 2RGVA 3RRNA 2F55A 8OHMA 3DV8A 5LBQA 1YIOA 1SKYB 2XB4A 4KN7X 1X6VA 5JMTA 1XP8A 4PQFA 2ERXA 1KO8A 4YC7A 4IXAA 5IT9K 2ZYVX 2RDPA 1OYIA 3GLFE 2VSXA 3EZFA 5CJ9A 5JBQA 1H0MA 1W2HA 1AM4D 4U0YA 2CHGA 1XMSA 1XD2A 4IHSA 3WTYC 3FHCB 4W5WA 2IBMA 3ZZ0A 4M6YA 1PZNA 3GF2A 2EFNA 2RAPA 2O0KA 1B9MA 1IRFA 4S05A 1T3HA 1XTKA 1TTYA 2C99A 2V1DA 4MHGA 3QKSA 1F2TA 4DQ2A 2JJ2A 3LX5A 4M0LA 4AC9A 4GYGA 1KU3A 4C30A 1R5GA 2R62A 1YR9A 2FF7A 4TLAA 2JLVA 1SD5A 4URVR 1DO0A 4IJMA 2DAOA 2QQBA 3AVXA 4B3XA 3HP1A 2GEUA 4BFTA 4MRNA 2FPLA 2G1KA 4QBGB 2K86A 1VYTA 5IDVA 3T5DA 3QXCA 1B6AA 1G8PA 2QQ9A 3OEED 2NAZA 2PT7A 1XRJA 4JSYA 1KK0A 3MJRA 2ZBKA 2YVUA 2OQRA 4MKHA 3FDIA 4OMZA 4EJSA 5TXGA 1AS0A 5IF9A 2WJIA 2LF8A 2J7PD 1I4TD 2GVZC 2YX7A 1T8UA 4HAVA 4B44A 2A3SA 4MQ9F 4KIFA 4QLCU 4OMYA 5JJKA 2WOOA 1E2PA 2O8EB 5HVQC 3CRMA 4PPGA 2E7WA 1G9XA 1FNNA 2XXAA 2J5PA 1I4LD 1Q12A 1CR4A 4PC7A 4I4LA 1OXSC 2IF2A 4A6PA 3W34A 2XGJA 3EZ2A 2PT5A 1G6NA 4YDHB 2XAJA 1G64A 4B09A 4EVIA 5HLHA 3KKNA 4PHTA 1KAGA 1J75A 1O7LA 3GWZA 2YYZA 3TO9A 1I5ZA 2Q9CA 5IK2A 2ATXA 4RAZA 3C16C 1XD9A 3P20A 2R7DA 4ZCMA 3QF4B 4KA4A 2CE2X 3PEVA 3QJYA 3M0EA 4TN1A 5FPKA 1YZNA 3MLEA 4CT4B 4UVCA 1W0JD 4Q02A 5AUQA 1Z22A 3KFVA 2GXSA 2L02A 3LQRA 2DI3A 1U8RA 1QBJA 2P5TB 2IA1A 4AIJA 4ESJA 2WWFA 2X2EA 3L0SA 3K9TA 1T3SA 4OI1A 3NWJA 4DLWA 3I62A 1YKSA 4KYUA 1EWQA 1TLHB 2XV4S 1IBRA 1OKKA 2Y0MA 3H0KA 1ZW6A 4D4LA 2JJ8A 2DFIA 3PVSA 1N0VC 2JAQA 3DZDA 1IW7F 3HOTA 2X0LA 1ZN2A 2BKEA 4OI4A 3TE6A 2Z33A 5KK1A 2B7BA 3HOSA 2QAGC 4CHUA 3RYRA 1Z0FA 4P31A 4NCNA 4UXHA 4YFNF 2P65A 2IHYA 4M4SA 4POAA 4X8HA 1KI6A 4B73A 2IS6A 2BEOA 5JSZB 2V79A 2OBLA 2XNDD 1P2VA 2XXAB 1F4KA 2DQRA 1ELOA 2FU5C 2QRZA 1KO7A 4IDOA 4RD4A 4HUQB 3K1MA 3RNLA 2F43B 2G9NA 3TQCA 1N6IA 2O0JA 4JKIA 4YXWD 5JRZA 3OAAD 3LSTA 1P6RA 3B73A 4ZZLA 3T8RA 1MV5A 2XAUA 4HQEA 2M5WA 3QKRB 3VU9A 1NSFA 3LVRE 5K5RA 3GJXC 2VP5A 1EFRD 3ABTA 4KNYA 3ONWA 1K5DA 4FCTA 3ZJYA 3BJIC 1XGOA 5B64A 1A82A 2GJ9A 1XPRA 3KZZA 2W6JD 4D2IA 5JWRA 2JLZA 3EG5A 1LQ1A 3R8CA 4UNPA 1ESMA 1UEIA 2A5YB 4A92A 3PEYA 2REXB 2HJGA 5FD6A 2V6CA 1P61B 3L82B 4MGIR 5FI1B 2L0XA 3NC0C 3TGPA 2O8FA 3F5FA 4AIHA 1R0YA 2RGXA 1A2KC 4BWYA 4NU0A 3LWFA 4N0EA 2NG1A 1TQ2A 5F98A 2ESNA 4TLCA 3RS3A 3D7MA 2GWRA 1BO6A 1D5VA 4I09A 1BYUA 2V8OA 3GD7A 3DPUA 1YR6A 1FSEA 4HX4A 3VEPA 1FSHA 1A5TA 4EMSA 2F1JA 2ORWA 3MWLA 2VBCA 1JAIA 3K0FB 3IHLA 4PPQA 5L3VA 3GXOA 3AEZA 1PV4A 4B3GA 1ZM7A 4OHYA 1SVKA 3VKGA 2DQLA 4AYWA 2P0EA 2BBYA 2M45A 2V1UA 2IVMA 2K7LA 4UVAA 1TMKA 2OE2A 4Q7LA 1JR3D 5IT3A 1WP9A 3LLMA 4I99A 5AJZA 1OH5A 1FWZA 3CUQA 3DPTA 4ABYA 1S8FA 4L5BA 5EP3A 2CNWA 4TSFD 1ZNXA 2PZGA 4ENNA 621PA 1IN6A 3F21A 3KXIA 4WVFA 3M9AA 2GJSA 2GRJA 3KKQA 2I4IA 3DEFA 2RKOA 4U88A 5HS9A 5IT9Z 3EW9A 4IFBA 1N6PA 4M22A 1OF1A 1BIFA 1GRRA 5FPSA 4ASUD 1Q1EA 4DC9A 4LYJA 1U5TB 2XAHA 1HKSA 1P2SA 4V0MA 4XTRA 2EV0A 2OFWA 4BRWA 1ZC4A 4RB0A 2OM2A 5GVSA 4I98B 2MMCA 3EZ7A 2O6GE 3SBEA 1II0A 2OCYC 3A1UA 3EZ6A 1OJLA 4TT3D 3EDPA 2WWIA 2WJYA 3U3KA 1VTKA 1E9BA 1H8EA 1HUQA 4EFMA 5AK0A 1T39A 5JLJA 3BAFA 1E9AA 4M1SA 4B3FX 1R5HA 1U0JA 2CCKA 1NLZA 4NQWA 1WDTA 1W7PD 1V43A 3U6BA 4Z8YA 4PSKA 1QRAA 4DT1B 1FP6A 2UWMA 3JZAA 1G7SA 1S6LA 3AVVA 3CPHA 5A0FA 2J1LA 5HE8A 4UKDA 4LX0A 1Q44A 1Z8FA 5DGXA 5AJVB 4RB1A 4ESHA 2CCGA 2NPFA 4M21A 4E09A 2ZRFA 3L43A 3EC2A 2FBIA 1G1MA 4G5OA 1HY3A 3BWDD 4R2IA 3BJAA 1J7KA 3MWKA 3DOEA 3HSEA 2N1BA 2UKDA 2QWWA 1M8PA 1TPZA 1UBGA 4IDHA 1RUOA 4JLVA 2M8EA 1WE2A 4ENKA 5BMZA 2QEQA 3CW2A 4XJXA 3RRZA 2CL7X 5TY0A 1OIWA 5KYKA 4ZH4F 1HEIA 1XD2B 1MDMA 1YJ5A 2I1VB 1KGSA 3P26A 4OQNA 4KFCA 1EH6A 4LYHA 1YW9A 4LY6A 4MNUA 4O6JA 2ACJA 4O3MA 5F64A 3SZRA 1UBCA 1XDUA 3ZYCA 3CF2A 4CYMA 4FMDB 5GJBA 3QQ5A 4AG6A 1C1YA 3QKSB 1F2TB 2Q6TA 1ZLKA 4TL6A 4N9HA 3A1TA 3SYLA 1O3RA 3EA5A 3SQNA 1KU2A 2DPDA 2VE8A 3Q8XB 4BXUA 5BYJA 4A4DA 1PP8F 4WCGA 1CR2A 5H1YA 4PHFA 4MEYF 3T1TA 2DTRA 5C2JB 5DUIA 5F3WB 4M72A 2P5LC 2VP6A 1E98A 3DHWC 3KJEA 4R79A 2K5UA 2RGNC 3CRQA 4KFUA 1NG1A 2IL1A 3RS2A 1ZJ6A 2UZ3A 5FUYA 2PLYA 4R8HA 5AUPB 2QE7D 4BZQA 1DOAA 1W5TA 4TYNA 4IRGA 3ZMUA 4RD2A 3PXGA 1NY5A 2IF0A 1BMFD 4OHVA 1GKIA 1H9GA 1HURA 4G94A 1Q1QA 2X2FA 1XPUA 3LA6A 3T5GA 4KBGA 2CE7A 1JEEA 4A1FA 2W24A 4HDVA 3A36A 4KYWA 3VB2A 3AKEA 3AVOA 4M1TA 3K8YA 3U3RA 2XOKA 4OIQF 4TQAA 3HYIA 4CZZA 1S3JA 5DYIA 1L0OC 1UB9A 3Q9LA 2OBPA 4LJZF 5HKKA 3EASA 4BNCA 2GWHA 1Q1BA 1GOTA 5D8LB 3GLFB 3WRXC 3C5HA 2LKPA 4Q5IA 3LBHA 2P8TA 2B92A 3FM5A 3FWEA 3Q72A 1E1RD 2P6RA 2Q21A 5BN5A 4XLPF 3IWZA 1N6LA 2V54A 1S96A 1T0HB 2YINC 3DMNA 4GRAA 4JJZA 4C0JA 1K79A 2WIBA 2ZAOA 2VOPA 4R1HA 2NO0A 3W9YA 2RHMA 2BDTA 1R1TA 1TAGA 1TF7A 3TLXA 2J5XA 2ZE5A 4B34A 5DN6D 4TZ0A 2OAZA 5E8IA 2OA4A 4BH9A 1O3YA 1SKQA 4Z1MD 3CH5A 3WXMA 1E94E 4HAWA 3AF4A 4JT2A 1XJQA 4I1VA 5ICFA 1NVUQ 2BBOA 2A5FA 1R36A 5JR3A 2GCOA 1MABB 2ODEA 5FOVA 4KFTA 3LA2A 2BV6A 4I81A 4IRIA 4UUVA 1WI9A 4OQLA 5ELXA 1AS3A 5DO9A 5AR1A 1F3OA 4LD5A 3FKSD 4B2PA 4QHYA 1J2JA 4H9GA 3LBIA 2EFOA 2P7VB 3QVUA 2DFKB 3HPQA 3PUYA 3B78A 5EZ6B 1GXQA 2B8TA 5DD8A 2EW1A 1IUYA 1ZREA 2STTA 3UMFA 4OQMA 2IS4A 1FLIA 3V8JA 3MD0A 3LXRA 2HQNA 3WBJA 3KW6A 4F4CA 2QM7A 4G5QA 2NQ2C 4JBYA 4BQSA 3BK7A 4HZUA 3K0SA 4UJ5A 3X1ZA 1E2NA 2ZM5A 1XB2A 4N0BA 2NGRA 1P4SA 3WHKA 3PCRB 4F4IA 2ETHA 3MZHA 5FOWA 3SOPA 5DYGA 4QNMA 1K7AA 2EYQA 3VU9B 2OSBA 5LGNA 1DPFA 3QPWA 1E4VA 2QSZA 2QA5A 3IBYA 1E0KA 3I3SR 3RABA 3KQKA 1R5BA 3QF7A 1DARA 3FMFA 3CX6A 1XGMA 3HU2A 1KYIA 3V7RA 4LC1A 1SHZA 3OEHA 2LWIA 3ZMTA 5J8CA 2A7QA 4V0LA 2RGGA 4XBFA 521PA 1E32A 4L9NA 3F23A 1UADA 4DCTA 4DCNA 4QJ3A 5KSZA 3BROA 3KUCA 3SN6A 4JQFA 1RKBA 3ZS8A 5FBWB 4RJLA 4MEXF 1KY3A 2AD1A 2EFQA 2ODNA 3U7EB 4TYYA 1G3UA 4NYIR 5FFXA 1CXZA 1B0UA 1TNSA 3M6AA 4ZZDA 3C5CA 2DY1A 2QZ8A 2H5EA 3DZ8A 3WE2A 4NCKA 3E6BA 2HEIA 3RHFA 1XMKA 1J5YA 2GA2A 3BP8A 2F1HA 1KI2A 4GI7A 2IS1A 3H4MA 1M7BA 4HDOB 2KBFA 5JEDA 4KODA 1WBBA 3CUQB 5BW8A 1OH8A 3AH8A 2ZSEA 2VN2A 2V7QA 4I1OA 4EIWA 1M2OB 3LWNA 1GM5A 2DFLA 4US2R 2DBBA 3RC3A 4C0LA 2QZ4A 1SAXA 1U81A 5HDNA 4LFUA 4G8XA 3AUYA 3TMKA 5KDOA 1ON2A 2YR2A 3UIEA 2R44A 3ZVLA 1UFMA 2A69F 1NLFA 2WKQA 1DAFA 4A0FA 1TX4B 1KI1A 3THYA 1Z63A 3DF8A 4DVGA 3WTWC 4GZLA 1OIVA 3I59A 4D4JA 4YQFA 1Z0DA 1OHHA 2FWRA 4FMCB 4IXNA 2IYLD 4AURA 5EQTA 1COWD 4Q4LA 1P2UA 4ZI2A 4YMUA 4HB0A 1S7AA 2NO9A 3SYKA 2ZR9A 3AF0A 3QENA 4Q18A 2XROA 4NPHA 4XD7D 3F3YA 3NDPA 4XSHA 3GMTA 4C9BA 3EPHA 3RPQA 2GZAA 3HR7A 4JSTA 2NYXA 5FBQB 1AIPA 1Z0AA 2AFIE 3WTTC 1CTQA 3QPHA 2C04A 5ANRB 3KP3A 5EUQB 4XVQA 5H68A 3QP5A 3AAFA 3T06B 1UPTA 2GJ8A 3MZYA 1SZPA 1CF4A 2IYWA 4JVSB 1A1VA 3MWMA 5LBIA 2F1IA 3WU0A 1KMHA 2QAJA 4BEBA 1E1QD 1H8HD 1VG0B 5AJXA 2W2VA 1MZBA 2IYYA 5LEJA 4A2WA 4GMXA 1XJCA 4U7DA 3KB2A 5C4MA 4GBMA 1ETUA 2FA5A 4MGKR 2BHRA 1LDDA 4G3XA 3NBYC 2JA1A 4EJWA 3Q7PA 2XJ4A 1MGTA 4KVGA 4S2EA 4JBAA 3W6KB 2RGAA 2G83A 2FMYA 4B3CA 2PX3A 1F5TA 4HV5A 2E87A 5D3MA 3EIQA 2ZR7A 2JLYA 3KTAA 2B7CA 2I1QA 2MLKA 4HZFA 4I2OA 1MDMB 4RFSB 1SXJA 2BV3A 3MEXA 5DH9A 3FZVA 3JAMK 2WHXA 2QLZA 3AB3A 1A04A 3OIUA 4KCGA 2C95A 5LHHA 2O8FB 3AKDA 3NXSA 2F5DA 5D5UB 2FEOA 5EXXA 4LV8B 2W6IA 3MAJA 1GTVA 4TL7A 4DIDA 2VT2A 1PJRA 3CF6R 3HSRA 1ULYA 4HF0A 4IKEA 4P4TA 3COAC 2PZFA 4ACBA 3KP5A 1T9HA 2Z5UA 1FQKA 2QPOA 3EWAA 3IDQA 4WW0A 4A8JC 1LS6A 2ELHA 2ZE7A 3CRW1 3T1BA 1RVDA 2R65A 4Q47A 1GZSA 2VEDA 3TK1A 4OKSA 2ZO4A 5J40A 2GK7A 3EWSA 4GT1A 2IJLA 1UDWA 2FH5B 4KSBA 4C0BA 3MRSA 2EQBA 2XTMA 4PSAA 3QEOA 1OFIA 4L8GA 4TTRA 3NH6A 2WC2A 1CLUA 2OV2A 5SZKB 5BQTA 1Z6GA 2XVCA 4MDFA 2X4HA 3I73A 3AVUA 4JVLA 4LK1F 2ZEJA 5AONA 1G291 2X1VA 4LCBA 2DT5A 1Z06A 3GFIA 3QU6A 3W6OA 1Z6YA 3JSOA 4HLYA 4M2LA 2O52A 4QJ4A 1M34E 3I64A 1D2EA 4NYMR 1JXMA 3R9XA 2VRWA 3ZDQA 1G8GA 2B0LA 5DD4A 3L2CA 1WKMA 2JSCA 5AIQA 1EWRA 1G5RA 3E2IA 3WMFA 1FC3A 4BAYA 2BCGY 1PLKA 2DO7A 1TF2A 1USSA 1HKTA 3FMPB 5BWMA 1I1SA 4D25A 1SD4A 2C98A 2OXCA 2IYTA 3NRVA 4HQMA 1GWNA 3AF1A 3MMPA 4Q01A 1JAHA 4D4MA 4BHBA 2FQ3A 1LFDB 3WBKA 2CLDX 3BZ6A 3DM5A 3ADBA 2P5KA 3GLHB 2GXGA 5D4RA 1F60A 4LHWA 1HXDA 4LHZA 3UPUA 2FV8A 3WG9A 1GIAA 1G18A 4U0VA 1YZQA 1T0JB 2PN6A 2JJ2D 2GCOB 3AV0B 2XTZA 4MUBA 1VCOA 2ZRDA 2E9SA 1II8A 1OB5A 3X1WA 1OV4A 1JJVA 1IXCA 4NYIQ 2OLKA 4WXDA 4HB3A 4M1OA 3IUYA 4KUMA 3U3JA 2FMLA 4ZV4A 1NBME 3FPAA 3IKJA 3V8LA 2KE5A 2OUKA 2TDXA 2WJJA 3EIHA 4HOBA 3JTGA 1Z0IA 1FP2A 2IHBA 2Z4RA 4HLUC 1E2QA 4IF4A 2N46A 1KU9A 1SHKA 1FW6A 3A1WA 4HX8A 5JEEA 2CG4A 2FZLA 4I1UA 4C7OA 4DSTA 2FZ4A 3B1ZA 4OI2A 3EC1A 2F6RA 1XDSA 4TZ6A 4HZUB 1OXTA 3QI2A 2PCLA 2LKDA 4Q4HA 4BECA 4EAQA 2Z6VA 2D3WA 3K53A 1U9IC 3CKLA 4F93B 4MRRA 1QHGA 4ENJA 5CB6A 3IQXA 2RMKA 5FL7A 3BH7A 4Q9KA 4U5XA 3TSOA 4L5JA 2ZFWA 3MJHA 2MBFA 1ZUNB 1DE0A 4AYXA 3QSYA 3VNUA 1P2FA 1R10A 3R4KA 3VFZA 2X19A 4LLNA 5FTKA 3FHZA 3F6VA 3IKVA 1S9HA 3FFAA 4PQYA 1C4OA 2PMHA 4G7ZF 3QY0A 4I0BA 2HCJB 4XWOA 1JQJC 2KSQA 5IK2D 5ILSA 4RZXA 4LRTA 3H3UA 3AP3A 1FYLA 5GJVC 4XSZF 4D81A 3RRMA 2WOJA 4IHQA 2VT3A 1Q1ZA 5SZIA 1M1YE 1C9KA 1QHXA 1RC8A 2FDCA 1R6BX 1MJBA 1YFHA 3H86A 2HF8A 3QOFA 4TMTA 5CLLA 3CUEF 5ICCA 1CJUC 1YQTA 3B1XA 2ZCWA 1TUIA 1TQDA 2GVDC 5JJIA 1OKKD 4IHTA 1ZINA 1YS7A 3BB3A 3GLGE 3TAHA 1Z28A 2HOEA 2XAQA 3LAPA 1U98A 2C77A 5LB4A 1EH7A 5HS7A 1Q20A 4GO1A 3UMSA 1LJ9A 3O6BB 4TMXA 1UAAA 2QMHA 4B3BA 1L4UA 2Z3YA 1P7CA 2ZSFA 4HAZA 3ZVRA 5KSYA 2A5GA 1CP2A 4A0YA 1WA5A 2QORA 1L7VC 3B9PA 3KDSE 1LB1B 3KJGA 3TH5A 5L3SB 2Q8KA 1KHTA 5EP4A 2WTUA 3U3OA 1WMSA 2H92A 2D7DA 2A3RA 2FBHA 4EM1A 1PP7U 4JN6A 1RE0A 1SVMA 2KRKA 2C78A 3GFLA 1KSJA 4IEEA 1OPCA 3K2ZA 5EUMA 3SQXA 3O47A 4EQQA 2FPMA 4RSGA 4L0YB 1XMVA 2AR7A 1R1VA 3HR8A 3FGNA 5FOSA 3THYB 4DCUA 1KZGB 2DPXA 3VR5A 3H92A 3I59B 5HOOA 3JAMZ 1O57A 4GOJA 4NP6A 1K5GA 1FZPB 4OHXA 2QMUA 2BBSA 3E6MA 3V4RA 2BM1A 2O03A 3GZ5A 3QPUA 2EWNA 3J81k 5E3HA 5HE9A 4A0GA 1E17A 2GJAA 4M6XA 1ZYRF 3LV8A 4IOJA 5KHOC 1OMIA 3ND8A 3DM9B 1NG9A 2ONKA 4LI0A 4R71A 1TW3A 4KN4X 3GCGA 1QVRA 3SNHA 3SC3A 1YTYA 2GXBA 3B7GA 1G6OA 3PQKA 3ECHA 4ZYGA 2NTYC 4KIGA 3IWFA 5HDKA 1XFAA 2Q3MA 2ZRMA 1VYVA 1IJEA 2A07F 5HLGA 4RCYA 4IRHA 3C1DA 4NYMQ 4B76A 1FZQA 1N6OA 1T3LA 3QBTA 3GUDA 2W25A 1EG7A 1I2MA 3K70B 2FF4A 5BPIA 4R9UC 3SBDA 3HDTA 2XZPA 5AJWA 4KLNA 4HF2A 3W8NA 3ZLJA 5H6QA 5D3MB 2HTJA 4NHJA 1JJ7A 1TUEA 5KVRA 2OAQ1 3BIFA 3KTAB 4LYAA 4NZYA 1BIBA 4PO1A 5IHPA 2KJBA 2BJVA 2CNWD 3B8HA 4YMSA 1SXJB 3C18A 2UVQA 5AJYA 1IXSB 5JI3E 1IN5A 3QXJA 3LQQA 3RANA 2WTEA 4IDQA 2IT1A 2PBRA 2ZU0C 1F9NA 3ZQ6A 5BOXA 2ZSDA 4ZCLA 4CVNA 3OESA 5SZJA 1PUIA 2MMGA 1X1RA 4RCZA 3S1AB 1XGNA 2COMA 1U8AA 4UNNA 4F38A 5C46F 1NBMA 4JIMA 4EKDA 4PCQA 2ZJAA 1ZC3A 4F92B 1NRJB 1BI1A 5K8LA 2Z83A 1IN4A 3JZMA 1SFUA 3KEQA 3T35A 1UHMA 1DS6A 4X8LA 2IK8A 1AKEA 4A5MA 5E17F 3M4YA 1NVWQ 3GFOA 1E9DA 4URYR 5A2QK 3PQCA 4IXMA 1LNZA 1Z6TA 1F5NA 1GRNA 1T5LA 1X8LA 3QEJA 1S3GA 5EP1A 2VP9A 4PQRA 5CIQA 5FPHA 1FY7A 4YONB 2G0TA 1KQ8A 2DZNB 2BGCA 4WXHA 1D2MA 3L00A 3K09C 3UG7A 3WYAA 5JHHB 3IGFA 4A15A 3GLIA 3L9FA 1XD8A 2HKOA 2WKPA 3KKPA 4UNSA 1TQPA 4Z2YA 2IYZA 2LCFA 3BPXA 3UATA 1TQIA 1YLFA 4B43A 1X8JA 3T1OA 1NN1A 1N6HA 3AM1A 3VOEA 1QZZA 2RNJA 3MWYW 3GJ8A 3T12A 2J46A 4CGZA 2W2TA 1J8MF 2Q9AA 5FFMA 3KQLA 1KK1A 3FMQA 2C2HA 1QG4A 4Q7KA 1NHAA 3VR2A 1VHTA 2WAXA 2EFPA 2F5FA 3EARA 2H1LA 6Q21A 3B82A 1X3UA 4LGMA 4WOPA 1KO4A 4JLMA 4PZJA 1L3LA 2CQKA 3KFWX 2XEXA 3AVPA 3FVQA 4URZR 4P96A 3ZD6A 2JATA 1E9FA 2P6UA 1CJMA 1SGWA 1ZD1A 4IW3B 4G6DA 3I58A 1R8QA 3NH9A 2Q2EA 5DISB 4FWGA 2HYFA 4RGXA 4CICA 3FMRA 1AK2A 2CLCX 4LV6A 2KWIA 5K5QA 4UQOA 1OYWA 2HZTA 5LB2A 3RSLA 2JIZD 3MCZA 2M30A 2GDJA 4LV5B 2R6FA 4BFVA 2BC9A 1II8B 2DWQA 2L01A 1QBKC 2CJWB 2FNPA 1QHYA 5FBLB 4BFUA 2W2XA 1OXUA 4US1R 2CMKA 1KSHA 3GEZA 2HYGD 3I71A 1JQLB 2J41A 3T0YA 1OXXK 4NCHA 4US0R 4LZZA 5HTKA 2XRNA 5HLIA 3CUOA 3FTQA 5EE1A 4O0MA 1GAJA 5CLQA 3F8NA 5E20A 3WE3A 2IA2A 4YMTA 1RIFA 5LDDC 4C7OB 1I2DA 4EM2A 5L3BA 3QXSA 1FX0A 4LJYA 5E7JA 2KJQA 1M7GA 3QG5A 4Q4HB 3F8CA 1G19A 5CK5A 2JCSA 2ZI9A 1S4QA 4WIAA 2DWOA 4IJAA 1AS2A 2YPRA 1IHUA 3OE7A 5K8IA 2FSGA 4LK2A 4M1YA 4WAUA 1NVXQ 1O3QA 1Y3AA 1YE8A 2BMJA 2QI9C 2QM8A 1N5IA 4TYQA 2ZE8A 5HKKD 1J8YF 5KOYA 1EX7A 5CM8B 2F3RA 2NZJA 2NRAC 2RGNA 4RGUA 1GKYA 4DLZA 3FXUA 4Q4AA 3QE0A 1K78A 4AKEA 2GESA 4N1AA 1W36B 2DB3A 3UWOA 1OW3B 2QGZA 3WP1B 2FPKA 2QRNA 2ZJ5A 2GNOA 2VODA 3B9QA 1LW7A 2OT3B 2OCPA 3B6EA 5B30A 1XXHB 4NTZA 4CEJB 4EJVA 3O8DA 4PAOA 2ZMEB 3LW8A 4M9QA 1U5TC 5M04A 1ZHFA 2NOAA 3SR0A 2CBZA 4Q4JA 5AWFC 3N70A 1KI7A 1LDJA 4ITRC 1GNRA 2HJVA 3QIAA 4Q7MB 3GP8A 1D3YA 1DDNA 2FEMA 1ZRFA 2YSRA 2GTPA 3IO5A 1AKYA 4HSEA 3CLVA 4C0HA 4AWXA 5JCPA 2CL0X 1FBQA 5BS6A 1Z6XA 3BERA 2IYXA 2MLGA 1BYIA 4FWDA 1XCVA 3BPVA 1JHHA 3K9LA 2FA9A 1Z07A 3KX2A 1OH7A 4JVMA 4A36A 2P6TA 1KAOA 3RI4A 3ZD7A 4DDUA 4PPFA 4IOMA 1NVMA 2J45A 4DSOA 3IIJA 2EFGA 2GA8A 2GBLC 1FOEB 3CNLA 3CZQA 4LHXA 1ZGAA 2GZDA 1XEXA 4B2LA 3VNVA 4JMPA 4CEIA 4DHEA 4JS0A 4BLPA 1Q1HA 2CFXA 1NL3A 1KDOA 2E1NA 2R7FA 2XIGA 4ZYEA 4Q9LA 4ZCIA 2FN4A 5BXQC 3SXYA 1ZRDA 4KMFA 1SVIA 1SMYF 4O5VA 1TF5A 3P32A 4NCIA 5FL3A 5K8TA 4FXPA 3RS4A 1MKMA 1MRNA 4LOAA 5LGTA 1NF3A 1A2BA 2GEDA 1XEWY 2G6BA 2JLRA 2TMKA 3ASYA 3ETLA 4QGGA 1KKLA 2ZAMA 4XRFA 2ADUA 1U8YA 1RIOH 2IP2A 1GKUB 1ZM9A 3A4NA 4KITB 2P2LA 1W4CA 3DPLC 3G5UA 4P4SB 4G5GA 4LG0B 2GAOA 2JLWA 4AKGA 1CS4C 1HT2E 1S7OA 1SD6A 1Q3TA 1CJVC 4D4KA 4NCJA 1UKZA 5KPDA 2JLUA 2QTFA 1N25A 5DCFA 1KI8A 4JLKA 4OL0A 4L9JA 1G4UR 1UJ2A 3OEHD 3PFIA 5JFRA 5ICEA 1G3SA 2VOOA 1WSUA 4MQVA 4A2UA 2D2EA 3TQNA 2V55B 3CZPA 3GFTA 3QXXA 4KICA 2IUSA 1W44A 2GXAA 3PIRA 3KP4A 1N2CE 2OEPA 3FX3A 3ELKA 4CO8A 5A2QZ 3A1VA 4PHGA 2W00A 5H70A 1UF9A 2IUTA 1UCRA 1RRPA 4RVCA 3O8RA 1OB2A 2ZQ5A 3MG9A 2Q3HA 2ZE6A 3E1SA 3H84A 5LGUA 3IPYA 1ZM4A 4KJZA 2H09A 2JT1A 4M9XA 3AUXA 2ZXJA 5FH9A 2HT1A 1USTA 4Q4ZF 3K0AA 4Q5SF 1E96A 1UKEA 4WXRA 4OYHA 2OCBA 1JR3E 2ASEA 1D2NA 2XX3A 1YS6A 2ZJBA 3VFDA 2VPPA 4GZMA 2ZRJA 3W8RA 5DCMA 2V7QD 4TQUS 5G40A 4EJSC 2ZANA 3MCAA 4GNKA 1S0UA 1XCGB 1VTNC 2BCJQ 3DL0A 4I7HA 3ZMSA 3GVAA 2CVFA 2ZXUA 1R0XA 2ZKZA 4OJKA 1SD7A 3FFBA 2P3SA 1HTWA 4B71A 3QOPA 2IYVA 4V03A 4EPVA 5DUKA 3CIOA 1ZVQA 4Q1FA 4DDVA 3F6OA 4RKEA 4ASNA 4XLNF 4WF2A 1LDKB 2PZEA 4KHZA 2AD5A 3ECCA 1T4GA 2VYFA 2NMVA 1SULA 3B2EA 4EPRA 2VIIA 1IN7A 2FE4A 4IPAA 1US8A 1VCMA 1YR7A 5DEQA 3I5UA 2QROA 3CWQA 4UXJA 1SVSA 1JNYA 1RUNA 2WBLC 5C1BA 3GX4X 1ZCBA 1HQYE 4BFWA 4JK1X 3F8TA 3VHLB 4A9AA 3V4GA 4J0QA 1SFXA 3FM3A 2BIFA 5D8KB 1JPJA 2YNMA 5G41A 3GLIB 2HR3A 1KJWA 4EPYA 1A7JA 5KDDA 3K1PA 4G5RA 2D2WA 1E2HA 5BN4A 1KDTA 1GITA 2WJVA 2OG2A 5DHAA 1RRCA 2IS2A 2OO7A 3IIMA 4EJOA 4KYIB 4DBLC 2VHQA 1GSIA 5CIWA 2QTVB 4FINA 4EJSB 3K70D 4RGRA 2IXEA 2NO6A 5LRRA 3ZN1A 2HFHA 2YWEA 3MSXA 4U00A 3J7AO 1PDNC 3RIRA 1J2XA 4IVNA 2IW3A 2W83A 4CXFA 2C96A 1YW7A 4KI0A 4CDGA 3ADDA 4GCVA 5J4LA 3T8TA 1SXJD 1GRQA 3RS5A 4C0QC 2FRHA 2CW0F 3N4MA 1IRGA 2R6AA 3ABUA 4K2EA 5FPTA 4D0GA 3TGNA 1IM2A 5CVJA 1G17A 1E9EA 3Q7QA 1ZD8A 4PR0A 3NEUA 2W6ID 4FN5A 4JLDA 1R23A 4Q7JB 4BFXA 3A37A 3K1JA 3OIYA 5ILUA 1P3JA 2GZHA 3WTVC 2DK8A 4M71A 2F1RA 4IDNA 5KSOA 1U90A 4EGZA 3EPLA 2XASA 3KQNA 1WBDA 4B3DA 1HW5A 1MR3F 3B1YA 4LRWA 1P92A 1KOFA 1QHHA 3L2OB 3THWA 5EEGA 3FMSA 1AWCA 1TEXA 5DE3A 1EK0A 1G3RA 4XVUA 3AF3A 2GKSA 4V0OA 1G8YA 2Y8EA 2J59A 2IYRA 3CRVA 4A6XA 2HYDA 5CK4A 4Q1DA 4UXIA 2EFHB 3CO7C 3MAAC 3E5UA 1QPMA 4OIPF 1AN0A 1T5IA 3P7NA 2RH5A 3LFUA 4PX9A 4YFXF 3TUJC 1B23P 2CO5A 4M73A 4AVPA 1FP7A 3AKYA 3KLNA 1TADA 1U99A 1YZUA 1Z5ZA 4RGSA 2O5VA 3GFMA 4H0EA 3BORA 1YW8A 4AIKA 2ISZA 3E70C 3U2QA 4CT5A 5HR5A 2QVOA 4AK9A 1E2XA 1KI6B 5GADl 5HZHA 5D6EA 1GILA 3CUQC 1SKYE 2FX3A 4B75A 5E1ZB 1KY2A 2ZU6A 3F8BA 1Z0KA 3TW8B 3WTZA 1NLYA 1EH8A 4OINF 4Q4AB 1K78B 1Y63A 4W5HA 4KVAA 2UZIR 1BM9A 2MA3A 1G41A 4UV9A 3SJAA 4DDTA 1DO2A 5LHGA 1P60A 2IC5A 3GJ0A 1R1UA 1RYHA 4GMDA 1NJFA 4MQBA 2VLIA 2M1BA 1R00A 5J4KA 2VO1A 3A58B 1Z83A 3IC7A 1IF1A 1T0FA 2H18A 4Y0VA 3B60A 3N97A 1DP7P 3T34A 3ML6A 5FB2A 4EPWA 1ZP6A 4MKIA 5DNYB 5CVIA 3P4XA 4H1UA 4KV9A 1KYZA 1ZCAA 4U02A 4WXPA 5KNBA 4MUAA 1PVOA 2ZJ2A 3ICQB 4R7ZA 4OK6A 3X1XA 5FLXK 4D0LB 2I3BA 2EA4A 1FMJA 4XH9B 3WHLA 2V9VA 2N42A 2V3CC 1ZARA 4P33A 3TQFA 1Z0JA 2FOLA 4JT4A 3ZZTA 4D26A 1SVWA 1Z05A 2JPCA 3CJNA 2R2AA 2HLDA 5SZHB 4ZYHA 4BLOA 1XEXB 4EPXA 1RZ3A 1L8QA 4Q9JA 2XSZA 1Z29A 1JI0A 3NG1A 3AP1A 4DZZA 1A4RA 4ZDWA 4PGHA 1W4AA 2YC2C 3HYRA 4FMBB 2DFNA 1AQYA 3I4PA 3VLFB 2QUFA 2IYUA 2ZNZA 2PEXA 3HSFA 2WZQA 5FL7D 1QHSA 1Z3IX 1E2FA 2C9YA 3RLFA 5JCZA 2NO7A 3AVYA 1ZBDA 2JDIA 5GJWC 1F2UA 4C2TA 1ZUIA 2MH9A 4P9UA 4NMMA 2GQQA 2D1VA 2HWVA 5FBRB 3DOFA 1KA8A 1RYFA 1GUAA 5DIFA 1W36D 5H6RA 1IY2A 3LAJA 4XWKA 2OAP1 1PUJA 3KQUA 1PLLA 3C7KA 1QZXA 1YO5C 4L15A 4HDCA 3Q85A 4L18B 2C03A 4ON9A 1OE0A 3TVTA 1B9NA 4N9IA 3TO6A 2A30A 3RTRA 1UFQA 5CDFE 2FNAA 5FOTA 5J6XA 4Q9IA 3OHMA 5DSZA 1G8HA 3IQWA 2REOA 4MITA 4OQFA 5E7MA 2ZI7A 3JSPA 1M74A 3V7CA 1N5JA 3A4MA 4HB2A 4HLDA 4LPKA 1W7AA 2GF0A 2G77B 4OHZA 2O8CA 3PUXA 4QRHA 3K0LA 3C41J 3K0AB 5FD5A 4I0AA 3WTXC 4OIOF 1BKDR 1CR1A 1YR8A 3O3KA 2DCUA 2QENA 3HIFA 3G73A 2AL7A 1DADA 3RKXA 1EX6A 1GG2A 2AXPA 1QDEA 3DO6A 4MYUA 5HS8A 2GETA 2J0UA 4Y0AA 4L0ZB 1TW2A 3SI7A 1P5ZB 3I72A 4ZI3A 5DCMB 3GJ3A 4ESFA 4MGRA 3L8YA 4Q1BA 1HV8A 2QY9A 1SVOA 3VHXA 3VX3A 4GDFA 1DG3A 1OIXA 1JGSA 4B74A 1KDRA 1Q3HA 2VP0A 4MYHA 1B1BA 2VH5R 1BH2A 4QL3A 3RAPR 4KXFB 3R61A 1KZ7B 2RGCA 1OH6A 2K02A 1XTRA 3L0PA 4Q19A 5JECA 1OYYA 3Q3JB 3K0CA 5A5GA 4L4UA 2EVWX 1IXRC 2VONA 2XKPA 3LY5A 4YIFA 2ECKA 3NC1C 4KFSA 3G0HA 3M7GA 4MKFA 1NJGA 1P73A 1G5PA 2ZVQX 4GL2A 1OR7A 3TRFA 2IA0A 3RRYA 4RY2A 1TQMA 4QOSA 1HSJA 1US8B 4QGHA 2MSEB 2IWHA 3DP7A 4PAMA 3TR0A 2ZRKA 2PMUA 3BBPA 4PXAA 2EFCB 5K1YA 5DHFA 421PA 5TARA 2LSOA 4AKHA 2H8KA 4C0AC 4C4PA 2WWYA 3X1YA 2IEZA 2R3SA 1C1KA 2QPAA 2QSYA 3KZ1E 4QBHA 4ESVA 1XMAA 3ZQJA 3I54A 4WZBE 4O2RA 3I4LA 4B8XA 1KMQA 4LBWA 3P4YA 3KUDA 4RD3A 3BC1A 3MHVC 3FXRA 3FMOB 3VKWA 5L3RA 2JLQA 3U2RA 1MT0A 2MD5A 2VXZA 2KKOA 3QKTA 1HYQA 4WZ6A 1P2TA 1XSXA 3R20A 1DPUA 4DRZA 3W5IA 2EV6A 5KTYA 4DEYA 1IY1A 5LHIA 5EEHA 1ZU4A 4ZDIA 3O8BA 2ZJOA 3E5QA 2EWWA 3GO5A 2PEZA 2FJUA 1XJ0A 1GL6A 2XITA 4MYCA 1II9A 1ONBA 2FGKA 3WNCA 3KJIA 4EJTA 1NI3A
chains in the Genus database with same CATH superfamily
3AC0A 3SZGA 3WGGA 4ER6A 5AJTA 1KFKB 4W1UA 1HBJA 3GJZA 2YHBA 1N3BA 3LUDA 4BKXA 2OWEA 2H59A 2QI9F 1NA5A 5KBYA 5K0ZA 3UKDA 1SWVA 1PN3A 5IEJA 4FT2A 1YZVA 1VDZA 1GPUA 1ESEA 1UZAA 4F1WA 2FF5A 2VBWA 1OISA 2JK1A 5LPNA 3I76A 3DMPA 4JP8A 5BP7A 3H8WA 3JD2A 3ZU4A 5TF0A 4DILA 3O9MA 3F6CA 5F21A 3QXGA 4DOZA 1KI4A 1WUYA 2XVZA 4G24A 2X3UA 4DLSA 4O4LA 1T35A 1NMZA 1B1AA 2AFIA 1FMWA 1WLYA 2ICAA 3P96A 3DZIA 5IRCD 4XSVA 2QTZA 3U3MA 3TDZC 1IK4A 1YHNA 1YIAA 5BNWA 2DVWB 3JRIA 4BC0A 1YZFA 3KTOA 3LUFA 3HKDB 2BGRA 1VA5A 1F48A 1KDYA 3WGTA 1QTNA 3LG2A 1R8SA 5A9TA 1ZD2P 3EE6A 1R5NA 3MGAA 3DHEA 4BFZA 2FD5A 2Q5IA 2MR6A 3EGXB 2LLKA 1E69A 2OZEA 1FLDA 4WPGA 3BG5A 3CWZA 5AM5A 3AVTA 3TBHA 5AJHA 3IHUA 1WPGA 2HSJA 1V3VA 4IVQA 3KP6A 2F3TA 1ZNZA 3RS0A 2AW3A 1S72I 2RHRA 1A6QA 2JFBA 1T2FA 1UINA 2JZOA 2CW7A 3U5ZB 1UIRA 4OXXA 2MR5A 5DIZA 2QLJA 5A4JA 4AW9A 2AF3C 1OI3A 4D4GA 1FOXA 4TKMA 4HNVA 2YZ2A 5CBKA 4FS8A 1VQNI 1N8SA 4ZT4A 3WHBA 3HRSA 2WF5A 4TMWA 5B6PA 1LH0A 5FA6A 3F6BX 3NHPA 4IDPA 3DU5A 3EMKA 2OCAA 4ZAZA 1DXYA 3W9BA 4LDAA 4TLBA 4E07A 4PK4A 1OSNA 1T98A 1QWSA 3DE0X 4OHRA 2H94A 1XNJA 3MTJA 3S1QJ 2QYOA 4D7AA 4KIJA 4HPWA 2UYCA 4JQZA 4YMHA 5ILOA 1UQRA 2AOTA 1U04A 4JKYA 1U2GA 4UC0A 1ZM2A 2UXNA 3HWSA 2K40A 4QT0A 1EF4A 1HGXA 3SF0A 4F0JA 2JGDB 4RS3A 2X76A 2VDBB 3ZV4A 3FXKA 4OX9Y 2ZB4A 1Z5VA 3CUKA 1VPLA 4C29A 2WUVA 5H9WA 3I12A 4QO7A 3CRRA 3KWLA 2GEFA 4CGYB 4KVFA 4YALA 4DN6A 3LDUA 1IAQA 1FNSA 1R16A 4BRUA 3T5XA 3DU6A 2JIPA 1VA4A 3K4CA 4GMQA 3F3SA 2BNKA 1AGNA 4B8YA 3KP7A 2Y1DA 3RUFA 2AG1A 3UT5A 3R09A 4L9TA 4EPTA 2XADA 1PZGA 3RADC 2P4EA 3F92A 5E1MA 1RJFA 1TU3A 1M8KA 4OSOA 5CYVA 2C7BA 3FKQA 5TQ0B 3VO1A 4A6EA 2G70A 3PZRA 1E66A 1WP4A 4OEHA 1Z17A 3W2VA 5D4SA 4FX0A 2XFSA 5CLGA 2BLNA 3LSYA 3RFFA 3KETA 5IT4A 5EPEA 2HK8A 4OQXA 2G4LA 2JAPA 1NZFA 1XMIA 3PQ5A 1W48A 4NC7A 4XK8F 4CHGA 1W5SA 4ILKA 4NDZA 3K5WA 1DV2A 4DQVA 2QIOA 2LBCA 2KS6A 3AOEC 4MA5A 4HG2A 3F4LA 4G89A 5HJ2A 4CMEA 2RI6A 3TVDA 2WUFA 4TL9A 4YJFB 1CG6A 3SFZA 4EYKA 3A3YA 2JI9A 5CU7A 2IHZA 3W77A 2VBYA 4ND3A 1ZIPA 4H08A 4FW9A 4M8IA 1AXRA 4XI9A 4ARZB 4R1NA 2C58A 4PDKA 4F06A 4M54A 1Y0UA 3RVRA 3ZDBA 4FE4A 1O9HA 3DDSA 3WLPA 5EUBA 3ASZA 3Q40A 4RF5A 1UZMA 5JAOA 4I02A 2JPDA 1RR6A 2KMUA 2ZSJA 1CB0A 1BDBA 1TWFJ 3MF4A 1YCHA 4KQIA 1A5JA 4JI2B 4E7SA 4LHYA 2X9QA 3QKUA 4RO0A 4ABZA 4H6PA 3B7ZA 2PBZA 3ICEA 1ERDA 3HRUA 4M7PA 3DV0B 3GTPJ 4J0EA 5B1IA 2WM9B 2W0MA 2XNDA 3JYPA 2D7JA 4J01A 3NIFB 5TGTA 3ZMZA 5AHWA 3SVTA 1JEQA 1K8ZB 1LDGA 3COZA 3RUDA 2GSDA 1SZJG 5F0FA 3IODA 4YP7A 2G7HA 4CPDA 1GNQA 2O3FA 5KPJA 4JVNA 5LUBA 1CIJA 1ZMOA 2CVOA 1XRSB 1MEOA 3RKWA 2HA6A 2VB6A 1K66A 3IE0A 4JU9A 4TWZA 1DJLA 4YWHA 2HXSA 3A6KA 1PS0A 5JHGB 3N2LA 1S7CA 4U7BA 1ZUNA 3HCFA 4Q3AA 1T1IA 2Q3JA 4FDMA 1N6NA 2ZQZA 3BS4A 3WISA 5BVGB 5JTTA 2JEOA 3N2EA 3UHAA 4H4KC 1X7DA 3RVSA 3PE3A 3BXWA 3D1NI 3DEAA 3PFGA 1W7PA 4K81B 5JZSA 1NDUA 1OXKB 3TL4X 3AR4A 4Q34A 4FCYA 1MBZA 1LLQA 1MH1A 4HVLA 4LTNA 5IFLA 1F1ZA 4UD6A 3M9LA 1MF7A 2Z95A 1GQRA 5TQ2B 3OF5A 2Y3IA 2VDUE 2H16A 1O6FA 3GRAA 1DV1A 2X6OA 1OLXB 4DM3A 4E7ZA 3C58A 4Y0NA 4ENSA 2L5QA 3WHCA 2OAEA 4YJ2F 1TAUA 1WV0A 4HXFB 4W8HA 2D7EA 1IDYA 3BHJA 2XQKA 1Z38A 4C4SA 4ND8A 5ITVA 2CZCA 3EUEA 1WJBA 1JWAB 4KPUB 3JREA 5J47A 3TLMA 4HLXA 2V6EA 4OLBA 1RXEA 1SCDA 2C2MA 3Q0TA 3WY9A 3ZJ5A 1NI4B 4MVJA 5K0FA 2IGKA 4C14A 5J2TA 5HKAA 5ED4A 3FKSA 3NHZA 1XLWA 5TPWA 4BWGA 2AQEA 4BE4A 821PA 3CO5A 4QPPA 3CQ9A 3TINA 2PLFA 4XOTA 4CL2A 1OFCX 1SXIA 3DEUA 4P98A 3MJCA 3DUWA 2RB4A 4YJ3A 2P8JA 5IT9A 3WZLA 4M7WA 1KO1A 4KIBA 1LB2A 4GEWA 3E3LA 4K3VA 2ORIA 4QOIA 1XK6A 2XTJA 3P19A 5ECGC 5HK9A 5TRDA 3VH1A 2AOXA 4HNSA 1VL0A 5ARBA 2NSJA 3GMIA 3R8XA 4AMGA 3BH6A 4ZVPA 1G8XA 3UJ8A 3LF2A 5JCOA 2DEUA 1WDLA 5KO2A 4GSYA 1H2XA 1OZAA 4JJ7A 4JI2M 2F43A 2P9BA 4AP5A 3EZYA 5AVUA 3KYBA 3TGLA 4PSWA 1F6DA 1STOA 5EPOA 2DT7B 2B25A 4XIGS 3TCNA 2ZMEA 4YP5A 1K27A 3TNFA 1Y6FA 1Z6AA 2FK7A 3IKTA 1GQYA 4CISA 3K4NA 1D8TA 1L7AA 4YX9A 4PGGA 4JLBA 4AY2A 3OOEA 4BB5A 3WV5A 2BFWA 3ZIDA 4ZOLF 1VSQA 3AB7A 1KP3A 1XE3A 1V9SA 1RAIA 3VKHA 2O8CB 1EJ2A 3TP3A 4GXRA 4Z4IA 5I8PA 2I4MA 2ISYA 4ETIA 1BCRB 4ENVA 3M4XA 1GYPA 4MTDA 1ZMTA 4ZZ3A 1FJHA 1S5LC 5IOYA 4UTZA 2AKAB 3TTXA 3KYJB 2GASA 1H1LA 4BDTA 1QVZA 1JLRA 2RGVA 4TTIA 2ZWAA 1FJLA 5BUZA 4IHYA 3BGSA 3I6MA 4CG2A 1NXQA 1KO8A 3U37A 2BEWA 4EENA 1GPWB 4L6CA 4U0YA 1WU8A 4JB3A 3HG7A 4CV2A 3GF2A 4PXSA 2O0KA 3OPXA 3FUUA 2QTTA 2VPZA 3BMOA 3HL4A 3KVWA 4F5DA 2ODTX 1DO0A 1JHAA 2COEA 1EYZA 5E4TA 3HP1A 4NNJA 4ZP1A 1RC9A 4ANJA 4K9NA 4CLXA 2Q3DA 1YRHA 2QQ9A 3UAOA 5CNMA 3BDVA 4MKHA 4MUEA 2IZ0A 1AS0A 1ZI6A 4HAVA 2EZTA 1E2PA 3CRMA 4PPGA 4CF3A 4I4LA 1HZZC 5JASA 2EZUA 3FFWA 2Q9CA 4LZNA 5IK2A 4RAZA 4C7MA 4RJKA 4G1CA 3RZDJ 3E2MA 2IE0A 3M0EA 2G71A 1RWMA 5B4UA 4EELA 1IBRA 1IWBB 2FRVA 2WSIA 4GC5A 3JQBC 4NCNA 4JP5A 3LKVA 5H4HA 5FKNA 2QVZX 5JSZB 2H4JA 4BX8A 2Z1NA 1QRDA 4M6WA 4PZDA 2IH2A 1I4EB 4ISBA 1V16A 3BJIC 3VSEA 4H7EA 4Y2JA 5C4XJ 3ZDFA 2EO2A 2C94A 2M6RA 1BGWA 1ESZA 3VEPA 1C3OA 1XDGA 3N0XA 3KDPA 5IU6A 4LA4A 1TMKA 2PSSA 1YT5A 1D0XA 3WYNA 1A7UA 1JQBA 2B1IA 3JCUC 2DULA 4TSFD 4YUZA 2AFVA 1LPAB 4MLCA 2RKOA 4L72A 5FPSA 4LXTA 2BRUA 2OM2A 2YIJA 4JP3A 5C8YA 2HWWA 2Y2VA 5DRYA 4A0SA 4DV7B 4TT3D 2WJYA 4B3FX 3PI6A 2P6PA 3GVHA 3U6BA 2VKQA 4DT1B 2UWMA 2M32A 2OCEA 1G7SA 4REQA 1VLHA 2HCFA 2VHZA 2N1BA 2UKDA 3S27A 3A0BC 4EFLA 2QEQA 3HY5A 3DL7A 2SICE 5TY0A 2BN4A 2VN8A 4XN3A 1YI2I 4KUEA 1YW9A 4OO3A 4IMJB 3DAFA 4NNPA 3QKSB 3QOEA 4TL6A 2FZKA 5E3NA 3OX4A 1CR2A 2CUEA 4FX5A 5F3WB 2P5LC 5L6MB 1SXPA 2XCOA 2O1SA 1YOBA 1DDGA 1Q1QA 4NOJA 2R66A 3FNEA 2BMAA 2BFFB 4DCMA 4GH9A 1VLVA 2VZLA 2YXPX 1C1XA 2YINC 3NETA 2YWJA 3ET5A 3JAMA 4PTYA 3OZGA 1PBTA 4OBWA 1CQZA 1JGGA 1UOPA 3AV0A 2GCOA 3IUNA 1ZGWA 4LYDA 2W4IA 3S3MA 1ESDA 3NAGA 5AR1A 3HEFA 1MAAA 4JR0A 3IV5A 5DBEX 1GXQA 4NSOB 4ZV9A 5F4BA 3UMFA 1CEYA 1ZREA 1FLIA 2OCCH 1LCIA 1MB0A 3CXRA 4MR7A 4KMMA 2ETHA 5IASA 4CTMA 2A5LA 3H3VK 3WRWA 1DARA 5F4ZA 4Q3BA 2DWUA 1V3TA 1WB6A 4M88A 3V7RA 4XPZA 2QUAA 1SHZA 1NMEA 1XHEA 1UADA 3TLGB 5JQWA 3Q8WA 5ARCA 4MEXF 1YDHA 2WUGA 4IICA 2PYDA 4B84A 1VQ8I 2H5EA 2HJHA 1K75A 5C3UA 4A3EJ 3RC3A 2QZ4A 1XALA 1U81A 5DHTA 1Q1GA 2WTAA 4NEQA 1KI1A 3RT1A 1VGQA 4YQFA 1OHHA 2FWRA 3G2NA 4ZI2A 2H4WA 1UG0A 3OZSA 5FNVB 2D6FA 3GMTA 2RBEA 4MCHA 3GAAA 3HZJA 3CVXA 3LL7A 3N7UA 2EF1A 3K16A 4H59A 1KMHA 4DBRA 3G1LA 1N2ZA 2J3KA 1P1IA 1XWFA 1WPXA 4R8RA 2G83A 4B3CA 1AF4A 2BELA 4L8YA 5AHXA 4HZFA 1GGFA 2J31A 4JJIA 5DBOA 2PGDA 2I03A 2WE8A 2FEOA 4PG7A 4TL7A 4EITA 4IHJA 1ULYA 4P4TA 1F7UA 4CKEB 4EB0A 5EWJA 3BSYA 2ZAIA 3T1BA 4D8YA 5TMBA 2D59A 2MTBA 2XWJI 3G71I 2AN1A 3PFBA 4PSAA 5LMNB 1GNVA 3ANLA 4EY7A 3UJCA 1RXUA 1G59A 2PXHA 1SZDA 4LZAA 4BX0A 1A69A 4BAYA 4LF9B 4DV7M 3C6XA 4QUAA 2GK4A 3NRVA 4Q01A 5ECDA 1N57A 2FQ3A 1XZJA 3ZGKA 1UDBA 1MC8A 1DBIA 2R8ZA 4MUBA 2PN6A 2EKQA 1VCOA 2C3OA 2QEXI 4OLHA 5LP6F 3V8LA 2KE5A 2TDXA 5A2QA 2I7VA 4OMUA 5JT1A 4DZTA 4MFEA 2Q4EA 2PS9A 2OECA 2LKDA 3OE4A 4I50A 1U2ZA 3JPYA 4RPKA 3M3YJ 3W2TA 3MJHA 3SAUA 4BKOA 1EVIA 1R10A 3R4KA 2I67A 4Q3DA 2KSQA 4LOJA 1J97A 5M34A 4FZJA 3LL4A 2CNBA 3BCSA 2XR1A 1DKPA 1TAHA 2X13A 3KIPA 3I04A 2X1DA 3UMSA 5BORA 4IDGA 4EOGA 2QMHA 5AI9A 2Q8NA 2H92A 3GPXA 3RT9A 2X2PA 4IJFA 1UOOA 2CV2A 4RE5A 1E17A 1OMIA 2X40A 5TT1A 3GCGA 4LF5B 3OD1A 3C48A 2GXBA 4UEQA 2DKLA 2YUSA 5F12A 3IWFA 1FIPA 1N7HA 3KYCA 1F2VA 2QVGA 3OZIA 1OLSA 4KWEA 5ALQA 1CY1A 3RGPA 2I22A 4BVFA 1WCIA 3QE9Y 2OAQ1 4QBKA 3G9QA 3H1GA 1AK9A 4MPDA 3FSEA 2E1OA 3FDJA 5SZJA 1T8WA 1ZIDA 4F38A 1XLTC 2ZJAA 4F92B 1HLGA 3FTDA 4RLSA 2Y93A 1AKEA 5ITWA 2O6HA 1W1UA 4RPJA 2C7VA 3PQCA 4J4BA 1Z6TA 3PT5A 1KR2A 4UTNA 3L9FA 2GEKA 5FKOA 3KKPA 5HILA 3H4IA 2QTVA 4BU2A 1RKVA 4B7GA 1L3LA 3AVPA 1E4OA 5MFZA 3WKBA 1RFGE 4NJEA 4IW3B 4G6DA 2QN2A 3H35A 4G1BA 3RM3A 3FMRA 2KWIA 1AV7A 4LV5B 3K6SB 3HOUJ 3OYMA 1LLDA 3L1PA 1KSHA 3KR1A 4LTMA 4NCHA 5EMNA 2X8WA 3TIXB 5EE1A 1PSDA 4AU7A 2V45A 3KSJA 3F9KA 4LJYA 4EGJA 2W98A 3UYLA 2YPRA 3EQ8A 2JD2A 2QI9C 4D9NA 4R2LA 1CY4A 4A69C 4AKEA 3RV4A 1AURA 4RBOA 3CLQA 5LMNM 3B6EA 4KQCA 4CEJB 3OFKA 3QPDA 1E3PA 1U5TC 2NOAA 4EY3A 4MB2A 1W76A 5CYFA 3IELA 4R4JA 4R1TA 2XB6A 4YJDA 4LF9M 4YN3A 4RTRA 4IOMA 3IUSA 3CNLA 5DLDA 5DX8A 1KDOA 3S3OA 5FL3A 4CKCA 4TVSA 4JFRA 1HNNA 2IQ5A 2LG4A 4UM7A 4KR7A 4BN5A 3B6CA 4MGKE 4JLKA 4OL0A 1GZ7A 1L7BA 3CZPA 2AUTA 5KC9A 2YWDA 1QOQB 2VKEA 3ESWB 2W00A 4S0XA 7GPBA 1MSFC 3DMYA 3JX9A 2ZXJA 1TJNA 2FX5A 3FPKA 2ASEA 1D2NA 3LT2A 3VFDA 5G40A 5LUAA 1L3BA 4ND1A 4RPGA 3ZVKA 2B35A 3UJPA 2ZKZA 4OJKA 4B71A 3HGIA 3QOPA 3CIOA 1LDKB 5CIYA 4EKNB 2XVYA 1VCMA 4CTNA 3KPJA 4CM1A 3CX4A 7CATA 2VJYA 4CM4A 4TXMA 1HQYE 1ZQ3P 4RTLA 4QECA 3BE5A 4BAUA 1QAOA 3B1JA 5D87A 3ZX5A 4EJOA 1NM5A 3USCS 3HR4A 4IZIA 4KQ6A 3M89A 2Y0QA 2IW3A 1VJDA 3EZLA 1V8PA 3RF6A 2AXQA 2FRHA 5JIBA 4LF5M 1I3MA 1ZD4A 4AUXA 4RHCA 5MN4A 1RYBA 4P3KA 3ACCA 1FFCA 1WBDA 3NZEA 1IBMB 3MYYA 4OHPA 3NPAA 3B2QA 4P81A 2ISZA 3AZOA 4YEDA 1H4SA 1K1EA 3U6SA 2IXTA 4PXYA 1R6RA 4KVAA 2UZIR 4DDTA 1DO2A 2ME0A 3QHQA 2UXBB 1R00A 3QPBA 1F8YA 1I6MA 1IZYA 5T4BA 3FYCA 1KP9A 2LTUA 4OXQA