2QBYB

Crystal structure of a heterodimer of cdc6/orc1 initiators bound to origin dna (from s. solfataricus)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
368
structure length
368
Chain Sequence
KNPKVFIDPLSVFKEIPFREDILRDAAIAIRYFVKNEVKFSNLFLGLTGTGKTFVSKYIFNEIEEVKKEDEEYKDVKQAYVNCREVGGTPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIRAIIYLDEVDTLVKRRGGDIVLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEYGLIKGTYDDEILSYIAAISAKEHGDARKAVNLLFRAAQLASGGGIIRKEHVDKAIVDYEQERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISELDMFGIVKIRIINRGRAGGVKKYALVEDKEKVLRALNETFEDSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Replication/dna
molecule keywords DNA (33-MER)
total genus 112
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09079 Cdc6_C CDC6, C terminal winged helix domain
B PF13401 AAA_22 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2qbyB01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2qbyB03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2qbyB02
4GYGA 4HLDA 4TLEA 1EFHA 1OXXK 1RZ3A 4WZAE 2FU4A 2WM9B 3GLGB 1SMTA 5AUOB 3AVOA 4RGRA 3ZJYA 3L0OA 3U3MA 1CEEA 2FFQA 2ZJ2A 2LCFA 4YC7A 1FC3A 4LC1A 3MRSA 4YG2F 1KY2A 2Q8KA 3CKLA 1TQIA 3D3QA 1R5BA 5FGMA 2UVQA 1ZD8A 4IVPA 3PEVA 4WZBE 2KJQA 3LA2A 4ZDJA 4URYR 1MRSA 2JLXA 4GI7A 3RDPA 1D5VA 3F8BA 3WGHA 3CNNA 2FX3A 1C1YA 2FV8A 3IHWA 3LW7A 4OOIA 2FNPA 3O6BB 1LFDB 2PZGA 3BXZA 5K5OA 3EWSA 5P21A 3T8TA 2O8FA 1YFHA 1FOEB 4POAA 5ILUA 1M7HA 3FMOB 4EAQA 1G3RA 1BBYA 3I32A 2DAOA 1Z08A 2Z5FA 5F6FA 4C0SA 2JLRA 5BQTA 1FBSA 1WQ1R 2QQ0A 1PP7U 2DI3A 4D25A 1W5SA 2ORWA 3KP3A 1DO0A 3AKYA 4E07A 4TV7A 1EGAA 5DCMB 3I5UA 3DZ8A 1J5YA 1ZARA 2ZCWA 3LAPA 2QU8A 3MWYW 2GXAA 4QC2A 5AJYA 2WPDA 1GRRA 1E94E 4OIQF 3V8LA 1LB1B 2FFAA 2HF9A 2ZYWX 3GZ5A 4JBAA 3UG6A 4E09A 1G4AE 1J9IA 1XSXA 2QG6A 4HLUA 4F4CA 2RGDA 3W8RA 4ZI2A 5LD2C 4URVR 4NQWA 2K86A 5JI3E 2EWNA 1D8JA 3GEHA 2JIZA 2N1BA 1GVJA 1RC8A 5GVSA 3GP8A 1BI0A 1SMYF 4L5BA 1TPZA 3B9PA 3ERED 2IA1A 4KT5C 3B60A 1KSFX 4IJMA 4MNUA 1XD2A 2HJGA 2XNDD 4QBIA 4DVGA 4DDVA 5TARA 1XGOA 2K5UA 3RWMB 2EFCB 3SJBA 2W24A 4BLOA 1MR3F 2E7XA 1L0OC 3LFUA 4DIDA 1KAOA 5JWOA 3SBDA 2F43B 4QBHA 3KZYA 5TJJA 2P5TB 2ZYUX 4PR0A 3T34A 1P5ZB 5A4JA 3R9XA 3VLFB 3R6SA 1KDOA 4CEJB 1UM8A 4US2R 3F8MA 4DT1A 3SQWA 4ESBA 3ADDA 2RKHA 4HZFA 2GXUA 3OZXA 2LF7A 2ZAMA 1JR3E 1J8MF 1WSUA 1EFRD 3FHTA 4ENJA 4LV6A 5L8VA 3AP1A 1FOKA 2YYZA 3AKEA 4TSFA 4ZYHA 3VX3A 1BI2A 4JVSB 3KETA 4D82A 2EFPA 2VRWA 3IBGA 5BPDA 2IRFG 5AR1A 3TAHA 4FWTA 4L15A 1ONVA 4CXFA 1EFRA 2BBOA 3W34A 2J7PA 3IIMA 1D9ZA 4QJ5A 5A2QK 1Z8FA 3LA6A 3EPKA 1YW7A 2V7QA 3QE0A 1STZA 4FMDB 2Y8EA 2V8OA 3DKPA 3JVVA 3VKHA 2MMGA 4IFEA 2XV4S 1GM5A 3V4FA 4AIIA 4KN7X 1AWCA 1U8RA 2LNBA 1KOFA 2GEVA 1AA9A 1NL3A 2R9VA 2IF0A 1TBXA 3EWAA 3UIEA 1TNDA 3NBZC 3KJIA 821PA 4QHSA 3KP2A 2FXAA 1JAHA 2YOFA 3B1WA 2WJIA 2JLVA 4P0TA 3BB3A 2DZNB 2QSYA 1Z91A 1GKYA 3BIFA 1SAXA 1XEFA 4JLVA 1WWXA 3EIQA 1GRQA 1MV5A 2ECKA 4Y0VA 4BUJA 1P92A 3E6CC 3FMPB 5HDKA 2M5WA 2W85A 1P2VA 1W0JD 2Q3FA 4HDOB 4KHZA 1NG9A 4NU0A 2CEAA 2VSFA 3THXA 4ZH4F 1DPFA 2IA5A 2IUTA 1E9DA 4UNSA 4ENMA 1Z0DA 4KUMA 1SZPA 1ZYRF 1CF7B 2BM0A 3QP6A 3BH7A 3K09C 4GOJA 2FSHA 2O52A 4PSAA 4DSOA 4X8MA 1X1SA 2BMFA 5HS8A 2O8BA 3K70B 2QP3A 2AWNA 3N2EA 4JKYA 4IOMA 2O0JA 3PCRB 3TDUC 1NN0A 4G01B 1LJ9A 4L18B 1FQKA 1FZQA 1MO3A 1Y0UA 1ZUNB 2J0UA 3W3AA 4BE7B 1T5LA 3U61B 5E8GA 5GJCA 4ESJA 3N4MA 1J75A 1FWZA 1E0SA 3C5HA 3CIOA 3NTUA 4IXNA 1HURA 3N2IA 4QHYA 1BIFA 4ZDWA 2ZRDA 1WCV1 3DHWC 1VCMA 2GXQA 4P96A 2R62A 2JA1A 4BFZA 2A3RA 2B0LA 4LOAA 1Z0FA 2ZI6A 4B34A 4A6XA 4HATA 4PXAA 1P6RA 3TR5A 1E2FA 1D8TA 3R0AA 2R6CA 2GVZC 3UMSA 1JR3D 2M45A 3ADCA 4JIMA 2ODNA 1K7AA 4E70A 1VTKA 4WX9A 1QDEA 3V7SA 4EM1A 3FKSD 3K0SA 2DVWB 2AL7A 2HTJA 2FBKA 3IRRA 1KK2A 1OXVA 2VSXA 3DMNA 3MMPA 1G3IA 1RRFA 2QAGA 2Z0MA 4Q18A 2DU9A 3DQVC 4URUR 1UCRA 3P9KA 4Y13A 5FPSA 1T9HA 1JPNA 4I1OA 5DGXA 4BGDA 2RGEA 4HQEA 1YW9A 1E1RD 3QKRA 2C98A 3OF5A 4JKIA 4ZIRA 4Q5SF 3LVQE 3ZS8A 2X0LA 4DLTA 2VP0A 5FL7A 2RMKA 4IDPA 2C77A 4NP6A 3TW4A 2RVCA 4B48A 3FMQA 1XXHE 1XWIA 4BAYA 1P4SA 2CHVA 1YE8A 1LS6A 4I99A 4BFXA 4HDUA 3TBKA 2A2ZA 2EV0A 3I58A 3FMRA 4R9UC 2D4HA 4B74A 1XF9A 2BMJA 1QZZA 2YPRA 5DD8A 3T5GA 5DN6D 4KYUA 4GYIA 4G7HF 3A4NA 1UBEA 1OKKA 2J5OA 4Q4LA 3A8TA 4F38A 1V3FA 2B6HA 3R4KA 3HU1A 2BJWA 1FLIA 2XAUA 1U6GA 2L0XA 4HAWA 3A4LA 1XD9A 3ZVNA 2ZRKA 1T3HA 3KQUA 4I4LA 2D1HA 2ODBA 4OIRF 3GLHA 1JNYA 3HR8A 1B6AA 4OHVA 5HTKA 2PCJA 1RPZA 3W8NA 3LXXA 2JAQA 2ZMEB 5BS6A 4EJWA 3PENA 2JDID 3K0CC 3F5FA 3IQXA 3AF2A 2OCAA 1QHSA 1SVIA 5CK4A 2O0HA 3WTWC 2OAP1 1AS3A 4D0GA 1J99A 1FFHA 1R6BX 1WRJA 4GXOA 1VYUA 3AF0A 4OI1A 2BKUA 3ZQJA 1KZGB 2IYWA 2BM1A 2V4ZA 3CBQA 4WXCA 4AYXA 1YIOA 1GKUB 3GFOA 2WJGA 3BFXA 5BN3A 1T98A 1CJMA 2IHYA 1JXOA 2R2AA 3ZMUA 1CTQA 1YVDA 2H57A 4UHTA 1RIOH 2IT1A 2LKCA 3CW2A 3QVVA 4MKFA 2IXEA 3QXCA 1W7PB 3AF1A 3TUIC 3RRZA 2CVFA 2J87A 5K8IA 3SBEA 4W9MC 4JQFA 4AYTA 1SD5A 2BEKA 1S1MA 1ODFA 2VHJA 2M8EA 3KKNA 3CNOA 2QQEA 4Y15A 2ZI9A 5KVRA 1ZVQA 3CUEF 4WOPA 4MTDA 3QXXA 2XHKA 1KK0A 4AC9A 3GFPA 2FBHA 1LNZA 5TB5A 4LLGF 1LVAA 4RD2A 2ORVA 1IRFA 4B33A 1ON1A 2AN9A 2QORA 2G7HA 2WMNB 3QG5A 4NMMA 2IS4A 5EP4A 4YONB 3HPRA 2OBMA 4G5SA 2L54A 3RS7A 5FH9A 1YZNA 1N6NA 3MG9A 1YW8A 2GVDC 3LRPA 5UKDA 4PPNA 4A6DA 1K6MA 4M21A 1XEXA 4ZKDA 5KUTA 4WBSA 2OZ6A 4B47A 3CRRA 4F7ZA 4P4UA 1DS6A 3REOA 2FG5A 5DYGA 2Q9AA 1AS2A 2ZROA 3AGQA 3VQTA 2ZRLA 3RSLA 1JXMA 4K81B 1QZXA 3SXYA 1S96A 1IN6A 1JHFA 1QPMA 4G6DA 1Z3IX 1US8B 4B71A 3JTHA 4EPYA 4EFLA 1XU4A 3L2CA 3QF4A 4CEHA 2FF7A 5DD4A 4AD8A 1O7FA 2STWA 3U2RA 1ONBA 4NZYA 3GO5A 1FP6A 3TLXA 3KW6A 1WXQA 1YR7A 2ZRBA 3P4YA 2YSRA 1RJ9A 4FCWA 1T6NA 4CW7A 2EFEB 2H27A 2QPAA 2GQQA 4AWXA 5IT5A 3I8XA 2ZRCA 1E9EA 4RCZA 2EFQA 1ZG5A 3B2EA 1J2JA 4UQOA 2FFHA 4NYIR 3T35A 3UWKA 2DZOB 1YRAA 4IHQA 1A7JA 2DWQA 4Z1MD 4LK1F 2ZSEA 4TL9A 3VU9B 1XXHA 4IW3B 1NBMA 1DAMA 2DB3A 4P55A 4Z2YA 3CO6C 1N5LA 1Z47A 3K9HA 3MJHA 3NXSA 3EXAA 2VEDA 4MITA 2OD5A 2R6AA 2YC4C 3M1EA 1R0ZA 1QZMA 1QQIA 1AKEA 2GCPA 3K09A 4HB3A 4B6EA 2A30A 2JRTA 3BOQA 5K8LA 2JJ2D 4OQLA 4HI0E 2OG2A 1IZ1A 2GA2A 4KN4X 1UDWA 2NRAC 2ZRAA 4Z8XA 2XOKA 3V8JA 3V8KA 4MUAA 4YIIA 4LG0A 4CEIB 4B3FX 3MWKA 4TTQA 4ZPXA 3KP4A 5ELXA 5A2QZ 4XWKA 4JYBA 1E2IA 3VODA 1JJVA 3UANA 4XVUA 3P4XA 2NNNA 3MCAA 2QT1A 1E32A 1G3UA 4NTZA 3ZZUA 2LKPA 4OMYA 2XKOA 3IBYA 5FPTA 1E1QD 4G9YA 4NCHA 2X2FA 1ZUHA 3QENA 5KU1A 1OHHD 4C0KA 1BKDR 3C4JA 2BV6A 3U44B 4TLAA 3F3XA 5J40A 3WHLA 3KKMA 2Q21A 4MQBA 2HQRA 3VOEA 1Q3TA 3KQLA 1IXRC 3E6MA 2V7QD 1KY3A 1U8AA 4BRUA 1XTSA 5LGUA 5FOSA 4KITB 2EQBA 4HBLA 4W5HA 3ZMDA 3WTTC 2WWHA 3KJHA 4PHGA 1F2TB 2VH5R 1KNXA 1W44A 3WP1B 3CM0A 4RY2A 5E1XA 1UBGA 3P32A 1G3TA 5HZHA 2ZPTX 4MQVA 3BJOA 3AVTA 1RYFA 1KJZA 3NEJA 5CDFE 1YZLA 2F3TA 2KJCA 1XB2A 1Z2CA 2P5SA 1FYKA 1F5NA 4DLVA 1S8FA 1OYWA 1W0JA 4NONA 2PJZA 4OYHA 2R3SA 3GJ3A 4C0HA 4DRZA 1FQJA 3R7WA 5HLHA 2A5FA 2DWPA 3E6DA 1REPC 2ZI3A 2ZU0C 5E7JA 4ABYA 4F4JA 2O03A 4C2TA 1FX0B 1YYVA 5E18F 1E69A 1KO7A 1TQ2A 4WXRA 4RAZA 4R1HA 1EX7A 4URXR 4TZ0A 3U60B 3HHHA 4H9GA 2K4BA 4RZ3A 5TDHA 1ESMA 3FYHA 1BI1A 3J80Z 1GITA 2XASA 2VODA 2F1JA 3BWDD 4Q4AA 2K27A 1QF9A 4JL8A 5TV2A 4BFTA 2QBYB 3K1MA 3JAMK 1KMHA 4ESHA 1LNWA 1F2UA 3NKVA 2WIAA 4Z51A 4UV8A 1JXSA 1HE1C 1MABB 1Q57A 2QAGC 3AQ4A 4JSTA 3RI4A 1E0KA 1P2UA 5FLXK 3LQRA 3ZZ0A 1FNNA 1SFEA 2DQRA 2C9CA 5FR1A 3T1VA 4QKQA 4GZMA 1XPRA 2FF4A 2P6RA 3DXJF 121PA 4RFSA 4QNRA 3T5XA 3KTAA 2FGJA 4DLSA 2RKOA 3U7HB 2P6UA 1JR3A 1DOAA 2HUPA 1D5CA 4MGIR 3WBJA 3GLIE 2F6RA 3V7RA 3MQ0A 1EK0A 3QVUA 1NRJB 4HAZA 2A68F 4U00A 1TEXA 2J46A 2J5PA 3FXUA 3NEYA 4HZIA 2QUZA 2ZRHA 1OT3A 4TWZA 3PUYA 4PAQA 5H20A 2VO1A 3BRWD 3DO6A 3GEEA 2WWYA 3DVLA 2E7WA 4IHSA 2ERYA 2V1UA 2NO9A 4BZXA 1FYMA 2OSBA 3B73A 5HS9A 1EWQA 5C4GB 2P0EA 2HLDD 4LJ9A 3CPEA 1Q1ZA 3I92A 3QXSA 2D7DA 4LFUA 2AR7A 2J1LA 4NCKA 4NCIA 1NIPA 1SVLA 4QBFA 1WDTA 4U0YA 4NE2A 4DLRA 1GIAA 4DEYA 3OOPA 3NH9A 2LWIA 4LYAA 2VOPA 1D9XA 4D81A 1YKSA 2UZKA 2QE7D 3HPQA 1YQTA 2IYSA 4AG6A 1M6NA 2Z99A 2GAOA 3VR4A 4FWHA 4LRSA 5JI6A 2RAPA 2DPDA 3THOA 2XZLA 3DPLC 4RGUA 1WMSA 1ZM7A 1SD6A 2PZEA 2QEQA 2REXB 4U7BA 3FHZA 1TEVA 6PAXA 2QE7A 3LX5A 1E2XA 1ESNA 2XJ9A 1JE8A 3HUGA 1NVWQ 5KNCA 4LJ6A 2W0SA 4UJ5A 3WU1B 1EH8A 5L3GA 1XTKA 2FA9A 221PA 2WICA 2GEUA 1P4WA 4EMSA 4IHTA 1Q1QA 3WYFA 3SN6A 1X1RA 1B23P 4IOLA 4FXPA 1Z6YA 1O7LA 4HAMA 1RNLA 1XD2B 2Q3HA 4PZZA 2DR3A 5CYPA 1CJTC 1L4YA 1ZM9A 4TTRA 2PMKA 1COWA 1GVNB 1PLKA 4RZXA 4XTCS 5LBIA 1W2HA 2ONJA 1AN0A 4CDGA 4AKEA 1VCNA 1G3WA 2VOOA 4XSGA 5HKKD 2G1KA 2WMOB 1Z1DA 3HDTA 4NH0A 5JSZB 2BJVA 1R1TA 2H16A 2LKDA 4A36A 3WTVC 4HDCA 1OLOA 2MMCA 4MRVA 2OAQ1 2P6NA 1G8GA 2RGCA 3SU8A 2XXAB 5CITA 1U99A 2M1BA 2J0QA 3AKDA 2D2EA 1GXPA 1FT9A 2EV6A 1GFIA 5C46F 1QHYA 5K8UA 4K46A 4OK5A 1P2TA 3QEOA 4MH0R 3IL2A 1KI6A 5KDLA 1DARA 1XDBA 4LK0F 3CR8A 3RLFA 2ZJBA 3L0IB 5CIWA 4BHCA 4JLJA 1W47A 1G7CA 1HTWA 3ETLA 2IT0A 5LEKA 2D62A 4HDQB 1WBDA 5FTKA 3NG1A 1XTQA 5DO9A 2G77B 2BCJQ 5F1RA 5KPJA 3ZMVA 2GETA 2F5FA 4TLBA 2XRNA 4KLNA 3DP7A 3IKTA 2OFOA 2FZLA 3TK1A 2EFHB 2JLUA 2IW3A 1JAIA 2VC1A 3P9CA 3JAMZ 3QBVA 3KQKA 4Q9IA 2GCOA 4YMSA 5H1YA 5KDOA 4L8GA 2NG1A 3ZD7A 2MD5A 1G5RA 1O87A 5G41A 2XAGA 5D3MA 1XD8A 3K0EA 4LYFA 3Q8XB 4OQXA 3Q9LA 4BLRA 3RJPA 3W6JB 1KNQA 3DEFA 5DSZA 1GOTA 4IVNA 1R5NA 1VG9B 1OIVA 2IL1A 3F8NA 3LLMA 3ZS9A 2PH1A 5E7MA 5EEGA 1W49A 1R00A 2OFXA 4Q4HA 4A82A 2ZSBA 2ZJ8A 3KFXA 3THXB 2IS2A 5DYIA 2LF8A 3LBIA 3QKSA 1AZTA 3LV8A 4QBGB 3P1JA 1P9NA 4XLNF 4DLWA 3QJYA 2OFWA 1HT2E 1KAGA 4Q7MB 5JR3A 2XSZD 3EC1A 1YS6A 3CF6R 2X2EA 4Q1CA 5KDDA 1HW5A 2CE7A 3KEQA 4HA8A 4HF1A 2A9KA 1JALA 1B4AA 5IT3A 1GL6A 2ANCA 2ZI4A 4M1MA 1ZH5A 2BYVE 3VTKA 3K1NA 4AD9A 1BOFA 2GRJA 2IXGA 3IHLA 2WV9A 4F91B 2ZFWA 1N25A 4PZYA 4QM6A 5KK1A 621PA 4QNMA 1S9HA 2BC9A 2QPTA 1P72A 1OSNA 2P7VB 3R9WA 5EP2A 2Y48A 2VT3A 4Z1MA 4OHXA 1KQ9A 3QKUA 4IJAA 3L82B 4BLPA 5CYOA 4A6PA 5K5QA 1W0KA 3PITA 4P4TA 4NCJA 3ZYCA 3KX2A 2UXXA 1T8UA 3IQWA 1KDRA 2RNJA 3DOEA 4B35A 3BP8A 4KFCA 4KDPA 4AY2A 4PO1A 5IK2A 3QY0A 1NIJA 3RC8A 3A1UA 1QHHB 2B8TA 3FWEA 1QHNA 1LB2A 4UVCA 1R8SA 1W0KD 2BCGY 5FBWB 5FPYA 2KB0A 3FPAA 1B0UA 4IRUB 5J8FA 1S29A 1G6HA 1ZD9A 4HLYA 4JL5A 4LRTA 1AGPA 1T0FA 1ZAOA 5TVKA 5IK2D 1WKMA 4X8OA 4ESVA 2ESNA 4YMVA 3F23A 4LBYA 3AVXA 4JL6A 4M1WA 3B02A 4OHWA 1LV7A 1SKQA 2ZAOA 2I1QA 3I54A 1NLZA 5EJEA 4LJYA 1KI8A 4G5GA 3AVQA 3SS8A 4YXWD 5JLJA 2KKOA 1CR2A 2GKSA 3TAUA 4CYDA 2CLDX 2VT2A 3EZFA 4G0NA 4P5OA 1N0WA 1TUEA 2CNWD 3MFKA 2WKQA 4HOBA 1WE2A 2OUKA 5FOWA 4DCTA 1IN5A 1UBCA 4LD5A 2TDXA 5FBVB 2C2HA 1X86B 5DNYB 2RGXA 4ITRC 2VE9A 2Q9CA 2ZE7A 2ZRGA 2OBLA 2ZI7A 1SVSA 1XN7A 3EARA 5JBQA 5JS7A 1UDXA 5DHAA 3I59A 1KSHA 1O3QA 2A61A 5EXPA 1EESA 1NVVQ 3B5JA 3QI2A 5LBQA 4OJKA 1BYUA 4IDQA 2CCKA 2IPQX 1U2RA 4P4SB 3IO5A 4EJUA 5GVRA 4C0QC 1ZNXA 1IY0A 2FFBA 3OIUA 1N6KA 4X8HA 2UXNA 4YQFA 5JS8A 4PHTA 3S1AB 2HQNA 3E6BA 5DIFA 3PQKA 4PAOA 4H0EA 4XIGS 1ODDA 4ZCIA 4FMBB 2D7CA 3ADBA 4LUCA 1BN5A 4QGGA 4QGHA 3KQHA 3KXKA 3DDCA 4BFVA 3F8FA 3R60A 3E97A 4B3GA 3ELKA 2O6GE 3TE6A 4K2EA 2DWZB 2IXFA 4MKHA 4C7OA 4HLXA 1XTRA 2YINC 2JJ8A 4TYNA 1ZUIA 5BMZA 4JBWA 1E98A 2ZS7A 5E1WA 1NLYA 2NOAA 1W2GA 5IT9Z 3H3UA 1UFMA 4RAYA 2PLYA 3QRFF 2AK2A 2ZU6A 4A5NA 1DAFA 3PIRA 2VQSA 2O8CA 4BZQA 5FO5A 2G88A 4DBLC 3RVBA 1W7PD 2ZRIA 1HE8B 2ZJ5A 5J5CA 2XAFA 2GZHA 2PFBA 4YDHB 2G0TA 3FMIA 3HOSA 3A1VA 4ZZDA 4Q5IA 2ATXA 5LHHA 4M1OA 2ETHA 2FSIA 4TZ6A 2PLFA 4A2WA 3FXRA 1K78A 2AK3A 1HSTA 2HEIA 1W7PA 1A82A 2WSSA 4EDHA 2EFWA 1EXMA 3KUCA 4U02A 5AJXA 4CHUA 1Z0AA 4KIFA 3BJAA 1QHGA 2ZBKA 2MSDB 4NYMR 1GG2A 3C3WA 2A5DA 3RAPR 2FOLA 3OEED 3LNCA 2R6FA 1SD4A 1IM2A 3FX3A 2CGPA 1IHUA 4G94A 1SVMA 3CRQA 3H0KA 1NY6A 3C8UA 4OL0A 5JWHA 5JHUA 3I1FA 2BIFA 1II8B 2GAUA 3AUYA 5DDGA 2GXBA 5HR5A 1K8RA 4MYTA 1VMAA 4LGWA 2XGJA 4ARZB 5AUPB 3ICEA 1XGMA 2Z9OA 5D8KB 1OKKD 1VG8A 2FPLA 5L3QA 2RV8A 2GJAA 1RRCA 2RGVA 4A12A 2IUUA 3ZDQA 1ZG3A 2KBFA 3WRYC 4HF2A 3FZVA 1VIAA 5EE3A 1XMJA 2HKXA 1E2JA 1M7BA 4ETSA 1H8ED 2G3YA 2MSCB 2H7VA 4RKFA 2ZM5A 3ZMZA 4JLMA 3SQXA 2VL7A 4PC7A 3RRYA 4GZLA 3WU0A 1DELA 2VE8A 5DCFA 1Q20A 4LPSA 4IDOA 1TMKA 2GHIA 2GESA 1W36B 3K9LA 4FD2A 4URWR 5AK0A 2P5LC 3KKPA 4LHYA 3ND8A 1OPCA 5LHIA 3VHXA 2XAQA 4M1KA 3I61A 5J47A 3M9AA 5D5XB 1I4TD 1R10A 4V0OA 3BJ6A 1Q12A 4A92A 1CRPA 4EQQA 1DAIA 4OQMA 4JSYA 4DLYA 2G9NA 2ZS9A 4DDUA 5HLGA 3NC1C 3A1WA 2JEOA 3WTYC 1AM4D 1JJ7A 3F6VA 2X19A 3FVQA 4BHBA 4EQ6A 2P67A 1T6SA 3VFZA 1U9IC 3X1YA 5TY0A 2C6YA 5TRDA 3SZPA 4LMYA 4IDNA 3BD9A 3CZQA 1U94A 1XJ0A 2WJYA 4EGYA 1AGRA 1G1MA 2OE2A 3ND9A 2ZRPA 2P6SA 3ZP5A 4M1YA 4NL4H 4V02A 3K70C 2QMEA 2OM2A 1HW1A 1NP6A 5GADl 1ZD1A 3W3ZB 2XUBA 3A4MA 3MHVC 5F64A 3BH0A 3BK7A 3SFZA 4RD1A 3QOPA 4OHZA 1SFUA 4IRHA 1OXTA 5DYMA 3LY5A 4EJSA 2V54A 1S2MA 1PUEE 3JSOA 1NKSA 2WSSD 3WYAA 2QMOA 1C4OA 1ZNYA 4IRIA 4D0PA 1AOYA 2REBA 1K5GA 2KE5A 3L0PA 4Q9JA 2ZETA 5J4VA 4L9NA 1R7RA 2L4MA 2WC2A 4P9UA 2O0KA 1N6OA 3FFBA 1TTYA 4LBWA 5G3YA 3B85A 3HYTA 2X8AA 2BBWA 3RC3A 3M8EA 4XWOA 3QPWA 4Q9KA 4G5QA 4CVNA 3DPTA 1PV4A 4UV9A 1KI7A 3K2ZA 2OO7A 5ED4A 5AUQA 2GF9A 4RVCA 3THYB 2JASA 2BMEA 3CRVA 4HQMA 2ZIAA 5DE3A 3RWOA 1DUXC 1CU1A 4UUVA 2ODEA 2RGBA 3O3KA 2RN7A 5L3SA 4EPXA 1OH5A 2LDUA 1KK3A 3C16C 4LWZA 4LLNA 3U44A 1P73A 4LY6A 3SI7A 4DHEA 2OT3B 2W83A 1C9KA 1B9MA 1ZIPA 3HSFA 4KA4A 2ZJZA 4XH9B 4Q19A 2DBYA 1V4RA 3DMDA 4AIHA 4KCGA 3ECHA 2QT0A 1E0AA 5F9FA 1KQ0A 2VLIA 2VSOA 3F22A 3F21A 3GD7A 4FWIB 3UXMA 1GHCA 2ZYTX 3AVUA 4N0BA 4PGGA 1X8JA 3MSXA 1WB9A 2JLQA 2WJHA 1S4QA 3ZH9B 3CO5A 5FBLB 1HY3A 1ZLKA 1XCBA 2DFTA 4Z54A 5C2JB 1PDNC 1UB9A 5D8LB 3KKOA 3U7EB 3EAQA 3K9TA 4LV8B 2V6ZM 1BMFA 1LF0A 2J59A 4PAMA 5FTJA 1JECA 1PUJA 2R6DA 2HGCA 3U7FB 1KA8A 1RRGA 2O8DA 4AYWA 3M6AA 3L8YA 5D5UB 4WK8F 3NEUA 3RS5A 4OMZA 1XNJA 2WTUA 4L5IA 1QG2A 4DCSA 3EETA 4D4KA 3IO3A 4RD4A 1J0RA 1II0A 1OJLA 1XMSA 4JLBA 4S35A 3PFIA 3J7AO 1A2KC 5DUKA 1CJUC 4I1UA 3GXOA 4K8OA 3RS0A 3ROUA 4PCQA 521PA 4B3XA 5LEJA 3IUYA 4DZZA 4L16A 1RVDA 5LD2B 1E9CA 1MKYA 4B3DA 2EFDB 4CGZA 3LXRA 1UEIA 5DI3B 3U3RA 3CX6A 3B13B 3H4MA 1VG0B 2DCUA 3KZZA 2FA5A 3OIWA 4KFSA 4RS8A 5FD5A 4FCVA 3T0YA 2QTVB 1J70A 2FMLA 2YHSA 4LX0A 1TNSA 3X1WA 3ABUA 5ICEA 4GPTA 1Z5ZA 1E2HA 2BEJA 3KTAB 1O3RA 1T3SA 3MZYA 4XRFA 2V6JA 2W6JA 3CB4A 4JS0A 1USSA 1XJCA 4MRRA 3EZ9A 1P4XA 1PLJA 1EH7A 2XAJA 2W25A 4W5JA 4XVQA 3K53A 1D2MA 5C1BA 4UNRA 2EB7A 4PTLA 1PJRA 4FHTA 1F1ZA 3B78A 3AKCA 3GJXC 4Q03A 2ESHA 2QTFA 3U7GA 5HKKA 2V6IA 2Q2EA 3QPVA 1W5TA 2IS6A 1DAEA 4GO1A 4HX8A 3MEXA 4PO9A 5JWRA 3OFND 4C30A 1XB4A 4DQ2A 1ZNZA 8OHMA 2QZ8A 1X8LA 2WIBA 2YV5A 4B32A 3GJ0A 2XZOA 4ERNA 3G82C 5CVJA 1TX4B 3F72A 4HW0A 1R5GA 2ZO4A 3K0FA 3EYIA 1YO5C 3PJRA 2W2XA 5CM9C 5JECA 2OCBA 5EUQB 4C3ZA 2FH5B 2HF8A 3BE4A 2E87A 4TMKA 4FMDF 1T38A 4QFMA 2X4HA 2ZSFA 4PFSA 2P2LA 4LJZF 2ZR7A 1G4DA 3B1VA 5FPHA 5KTYA 4TLCA 3LA3A 1IY2A 4DT1B 3BY6A 4I81A 3QSYA 3HYIA 1IXCA 2JDIA 3FXQA 1I2DA 2IF2A 1E3MA 1RRPA 4YFNF 4EV0A 4PSVA 1HKQA 4C2UA 3X1XA 1Z29A 1U3EM 4TN1A 4OI2A 2IYLD 3SZRA 5HCIA 2WSMA 3NDBB 2H94A 1SQ5A 2F1RA 2P5KA 2EA4A 1A2BA 1G7SA 2CMKA 2GJKA 1LDDA 1RYHA 4BNCA 1NJFA 3OV8A 2IYQA 3WNDA 4M9ZA 4LHZA 3P26A 2NO1A 4G5RA 5CJ2A 4HB2A 4UNOA 3NBYC 3SE0A 3CX8A 3AVVA 5FUYA 1R7JA 1HXDA 1DAGA 1IJFA 1MGTA 1Z0KA 1QBJA 2FE3A 4XBFA 2RCNA 3QNUA 1F3OA 4KU4A 4HX7A 3ZPLA 3SFVA 4QJ3A 2OILA 4O25A 2Q0HA 5D5VB 2Q6TA 4A0RA 3QPUA 1NVXQ 3WE2A 1SULA 2F1IA 4PANA 3TKYA 4DEXA 2BEOA 4P31A 3EASA 2GWHA 1I6XA 2IBMA 2QYOA 4Q7KA 2IWHA 4NHJA 4Q7JB 1XGNA 3TH5A 2ASEA 2AD1A 4FCTA 2VP9A 3WMFA 2IYTA 1Q1EA 2HLDA 2YU3A 3E5UA 1CF7A 3ADKA 2F7SA 3TVTA 4HZUB 3G0HA 4MGRA 1U78A 4HLUC 5AJVB 4F4IA 1HKSA 5EZ6B 2W6IA 3DKVA 3W5IA 4V0LA 3GLFE 4B2LA 3A58B 4B43A 1Z6AA 4QL3A 1UJ2A 1E2EA 1EG7A 2E9SA 4U5XA 1V5WA 4NYJQ 2YX7A 3NH6A 2RGNC 1OFHA 4S04A 4GP7A 2V55B 4URZR 4ZI3A 3GUDA 4HV6A 4KYWA 1XX6A 3WBKA 1FP1D 4B6FA 3C7KA 5BW8A 3UMFA 1JI0A 1SKYB 3G73A 3FMSA 4EFMA 3EA5A 4EPWA 4ACBA 1Z6XA 1KO4A 2ISYA 4DCNA 5A5GA 3WTSC 3HOTA 1ZRDA 1UKYA 1T8TA 3IDQA 1H8HA 2KIFA 5HE9A 3IKVA 5F98A 4LJAA 5G53C 3CDHA 1SVKA 5EP1A 5TXGA 1D8KA 1YZKA 2NZJA 4RKEA 3PQCA 1OF1A 1SVOA 2DBBA 3GFIA 2W2TA 4GNKA 3HRSA 3OE7D 1G8YA 4ENNA 4RB1A 1K6OA 1BYIA 4DSUA 2QQ9A 2HJVA 3KL4A 3EUHA 3QQ5A 4CZ2A 5GJWC 2RC4A 3RYTC 2JLSA 4JK1X 2YR2A 3I73A 1MO4A 3JZAA 3WTXC 3I72A 4OHYA 4UXIA 4DKXA 4A1FA 4OINF 2DHRA 4H1VA 4M4SA 1OE0A 2QRZA 4RZ2A 4XD7D 3LX8A 2A69F 3KDSE 3ZN1A 1RUOA 2PEYA 3B8HA 3QKRB 3DL0A 1ZBDA 5L3DA 3D31A 4PC3A 1OXSC 4TT3A 2P8TA 3NC0C 4UNPA 3SQNA 2OLJA 2A6EF 4EGZA 2WZQA 2BGCA 2PMHA 4HUTA 3TR0A 2DK8A 1T0JB 2IA2A 2CL7X 3IILA 3NHBA 2RHMA 2J0SA 1J59A 4LHWA 3W6PA 3M7GA 1R0YA 4Y0AA 4WIAA 1ZRFA 3GFMA 6Q21A 2XKPA 1UHMA 5B57C 3PG5A 2OHFA 3OEHD 2NYXA 2DTRA 1ZMXA 3C5CA 2Y0MA 3LSTA 3K69A 2G1JA 1KU2A 3FKSA 4RCYA 3REGA 1Z83A 1ULYA 3CUQA 4BFWA 4BLTA 4Q48A 1FZPB 2VBXA 3S2WA 4ACAA 3FE2A 3THWB 3U3JA 3TQFA 3HWSA 5ICGA 2ZE8A 1CP2A 2H6CA 1CR1A 5EUMA 2H17A 1E2DA 1EV7A 2NO6A 2FN4A 2F9MA 1CULC 1OHHA 3GF2A 3IPYA 1KKMA 4B2PA 4A0XA 1XMVA 3WY9A 4U0WA 1E2NA 1Q0UA 4OJQA 3UMRA 2PN6A 4KIGA 2OXCA 3L9FA 3AF3A 1G17A 4IOJA 4RD6A 5FL7D 4U0VA 4I2OA 3M8FA 2GAAA 4N0EA 1M2OB 3BZ6A 1FSHA 4D4MA 1E2PA 3GLIA 2CXXA 2FJUA 1XDSA 2IHBA 1OH8A 2E1RA 3IHUA 2GWRA 1E17A 3EX7C 3LVRE 1XBTA 4BFSA 4HDVA 3TUJC 5LLQA 2CO5A 3EZ6A 5ERIA 3OAAA 1ON2A 5LGNA 1UKEA 3O8BA 1HKTA 1TF2A 1CKEA 5ICCA 2ZVPX 3VHLB 1QG4A 2QQAA 1U8YA 2MSEB 2FU5C 4UNQA 4O0MA 3T06B 1HBXG 1R58A 2NGRA 1W7AA 3I71A 3GCGA 3SC3A 2ODWA 1XEWX 3T1QA 5KHOC 3EG5A 4M74A 4PZJA 1P62B 4KXFB 5L3BA 2RH5A 4IEEA 1Q22A 2PMUA 4ESFA 1GTVA 1SXJB 1IUYA 1XD7A 2HFHA 3KJGA 3LW8A 4MYHA 3UWOA 4LJ7A 2QY9A 3DF8A 4CO8A 1L7VC 2L01A 1BO6A 2W57A 4ZYGA 4M1SA 3J81Z 1BIAA 3RKWA 2UZIR 5HOOA 3SEAA 1S3JA 2CL0X 2W00A 3N5CA 4XD7A 4C0JA 3GFJA 1FPQA 3TDZC 2GK6A 3FWYA 4DDTA 1JQLB 4KIBA 3QBTA 4EM2A 5CDFA 2BMDA 3VX4A 4C7OB 3K70D 1MZBA 2COMA 1E96A 3RS4A 2MH9A 1OH7A 2CHQA 1TQ6A 2WJJA 2DPXA 4KAXA 2IUSA 1QZYA 4R2HA 2WBLC 1P4AA 4CYMA 1M34E 1XFAA 3H1TA 4DUGA 5J8CA 1H9GA 4PO8A 2GILA 4GITA 1BS1A 1XMIA 4TMVA 3K1PA 4QHTA 1A1VA 1NN5A 1K78B 2GZDA 2STTA 4L0YB 4I09A 1Z7UA 3AH8A 2Q3MA 3M1IA 2IEYA 3JVUA 1E9BA 2R65A 3JTGA 4DCVA 1CS4C 5JHHB 4MQ9F 5LGTA 1LW7A 2FPMA 3C14C 4MA4A 2B7BA 1KYZA 2VP6A 1MRNA 1BI3A 1R0XA 5JVTA 1G21E 2DFNA 5C18A 1XDUA 3GJ8A 1ETUA 2VP5A 1DG1G 2F5CA 1HEIA 2YWFA 1G18A 1T3LA 3LA7A 3GJ4A 4GP6A 4JLOA 1RKBA 1IQPA 2WWXA 4ASUD 1GUAA 3RPQA 1B59A 1UKVY 5K1YA 4QXAA 2HDCA 2V9VA 1CJVC 3GLFA 4L9TA 1GL9B 2MC3A 2IWRA 4HAVA 1NVMA 2A07F 5JEEA 2QENA 2IYXA 2XTNA 3WGGA 3G5UA 1Q1HA 3AEZA 3HYRA 3QP5A 2NO0A 2HTSA 4NCNA 5L3EA 2OXRA 1N6PA 5DHFA 1DEKA 1G4UR 2FSGA 1W48A 1ZW6A 1NKTA 2RGNA 3K0CA 3DKWA 3NBFA 3EPLA 3AVWA 1J8YF 4NBSA 4M73A 1SHKA 1ZGJA 4JVNA 4LG0B 4FT8A 3Q5EA 4CEIA 5ICFA 4I1SA 2DYKA 2ZRFA 2RGAA 4G3XA 1OV4A 2XEXA 4R8HA 2H1LA 5LHGA 2XSZA 5FUVA 3FF5A 1R0WA 3TMKA 2OZUA 3NRVA 2O61A 5E4FA 5FL3A 2V79A 5H6RA 3FTQA 4V0MA 2Z6VA 3U4QB 4UVBA 1SKYE 2ZS8A 1R36A 3RS2A 2DFKB 4FW9A 3IPXA 2XJ4A 3E5XA 3RYPA 2QN6A 1LEBA 2SHKA 3BJIC 3NVAA 1G3MA 3ISPA 1COWD 5EXXA 3BFKA 3KB1A 4GFDA 5CB6A 2PLRA 1XMKA 3CUOA 3RTRA 4TL7A 1F60A 4EIWA 1ZIOA 3IEUA 4QRHA 1TUIA 4LLLA 4US0R 2ZXJA 1FYLA 3OIVA 3TKLA 3E5HA 1OYIA 4OIPF 2WWIA 2JZYA 2ZR0A 2OCYC 3SYNA 5H6QA 4DUGD 4GGGA 2CCJA 2CLSA 3O8RA 1D2EA 2ZR9A 2L4AA 5E7IA 1I2MA 4I7HA 5ANRB 1O57A 4IVQA 3TSWA 3U9GA 4ZDIA 4LDJA 2ZNYA 3MJRA 3VR3A 3WTZA 1UF9A 3MUFA 2JPBA 4PHFA 1EFUA 3DFGA 2QTHA 3V00A 2ZSDA 4Q21A 4KFTA 2VC0A 4UXHA 4B3CA 1L2TA 4KSBA 3BPVA 4JLAA 3DZDA 2ZVQX 3KE2A 4TL6A 4Q66C 5FI1B 1QVRA 4A0YA 3KXIA 1C0WA 3R7WB 3W6OA 5LDDC 5IDVA 5JZVA 3T1TA 1S3SA 3U5ZB 2IP2A 2VP4A 3Q5DA 1NG1A 5CM8B 3TW8B 4YXWA 1R23A 2WOJA 5HE8A 2QGZA 2W6ID 2XTZA 3F8CA 3I64A 5HDNA 4XLPF 4JLNA 4TYQA 1IAWA 2PMDA 5AJWA 4TYYA 4B76A 5L3SB 2ZKZA 1OYYA 2KIMA 4AK9A 2QBYA 4DSNA 3B1ZA 4B44A 1DPRA 1OFIA 3RKXA 5E95A 4BASA 4BZPA 1VTNC 1ZLJA 2G7UA 3D5LA 2WPDD 5FB2A 3BORA 1QVAA 2FZ4A 1E2KA 1FBQA 1P75A 1XZQA 2O3FA 2Z3YA 4DDWA 3Q9SA 1XPOA 4QLCU 1U0LA 5FUXA 4PDKA 1UHWA 2HOEA 4EJOA 1M74A 1N5KA 4ZO4A 2AKYA 3F3YA 5LB2A 1RE0A 3DEUA 2FMXA 4XVRA 4CT5A 4FMCF 2A3SA 1CR0A 4MRNA 2MBFA 4GRAA 4JN6A 2IYUA 3OIYA 3X2SA 1E9RA 1IOZA 4LGMA 3C15C 3KQNA 2G9WA 2NO7A 5D4SA 2FMYA 1ZAKA 1YJ5A 2KBEA 2QMUA 4I01A 1GNPA 2XAHA 1KKLA 2VYFA 3GJ5A 1G20E 2HKOA 5IF9A 4TMTA 2P7CB 5DCMA 4LJ4A 5D6FA 2QL6A 2VF8A 4EUNA 4JMPA 2O8DB 4PHHA 3ML6A 1M7GA 1BOAA 2OESA 4LHVA 1UFQA 2A7QA 3D0SA 2F5EA 1R5OA 3CRMA 1KSJA 3VKWA 1TNTA 3MLEA 4C0LA 4L4UA 2HR3A 1P2SA 2H8KA 1I27A 4R71A 3WHKA 4P32A 3KEOA 3HR7A 2V6CA 5B30A 2NIPA 2IYZA 2R7DA 3TO6A 1LTQA 4TL8A 4DLXA 1NVVR 4EJTA 2YWEA 2C5LA 2YOHA 3F0TA 1XGSA 4LYHA 3X1DA 5HVQC 5H70A 5BN5A 3VB2A 4G7OF 1PVOA 4PSKA 3LD9A 4HAXA 2Z33A 2ZI5A 2HT6A 2VHCA 5FPKA 3ULQB 1U0JA 4CRWB 3LAJA 4IXMA 3HSRA 4OK3A 5J4HA 3W6NA 3GMTA 1T2KA 1XCMA 1BM9A 1SVWA 4GMXA 5L3VA 1UADA 1KQ8A 3KFVA 3ICQB 2H6BA 1EWRA 3A37A 5HPYB 5H8WA 5LPNA 1MKMA 2QUFA 2XZPA 3SYKA 1W1WA 1Z6GA 3LWNA 1DPUA 4BWYA 2Z5UA 2OEPA 2XNSA 4PZLA 1YU9A 3GJ7A 3QU3A 4F7WA 2A5JA 2AXPA 4JBXA 1R1UA 1MDMB 2UWMA 3HHGA 4HLQB 3R9IA 1QBKC 2F9LA 3TOBA 2WWWA 4JVMA 2D1VA 2HV8A 4Q02A 2PZFA 4MRPA 3ZIAD 1ZG1A 3M4YA 1KI9A 4BECA 1MO5A 2ZRMA 1T5IA 4CZZA 1FMLA 1W4CA 1HQCA 3LBNA 4KBGA 1NF3A 3LO5A 1XCGB 1BH2A 1MOZA 3D7MA 1DAKA 1OIXA 3K0FB 3PUZA 1SD7A 1ZC4A 5EE0A 3CPHA 4A3VB 3ZIAA 4OU0A 3EC2A 4WZ6A 5FOVA 2AKAB 2O8EB 3SOPA 4JZKA 5EE9A 2VHQA 1TL7C 2QGNA 2XXAA 2DQLA 3Q7PA 5JJLA 1G3SA 2VHUA 2PEXA 2VBCA 4RB0A 5FD6A 4MTEA 3RIRA 3KUDA 1S0UA 5M04A 3P7NA 1N3BA 1ZM3A 5BXQC 4PPQA 2BV3A 2NZ8A 4I0BA 1X37A 2F2EA 2GJ9A 4O3MA 2YNMA 3P27A 2CHGA 1H65A 1HT1E 2O8BB 3CONA 1DG3A 2PBIA 5G3ZA 3AF4A 4UKDA 1E99A 1Y3AA 3H84A 4D6PA 4G7ZF 1FTSA 1HV8A 4Q1BA 2JPCA 1G64A 2MA3A 1I1GA 1VKJA 5KYKA 5DI9A 2AFHE 4IKEA 1R2QA 3A6PC 1Q3HA 2QRNA 4KVGA 3GW2A 1MJAA 2ZRNA 1S9DA 5JI2E 4MUBA 4BQSA 2XITA 4RB2C 2J7PD 1A04A 2QNRA 3DM9B 2PG4A 1T0HB 5D3MB 4M0LA 1XTJA 5G40A 3BAFA 3KFWX 2YZ2A 4R7ZA 4EVIA 1DAHA 4EFNA 2A5YB 1YR9A 3EDPA 1Q1BA 3CLVA 3Q85A 4ZCLA 1ZRHA 3EW9A 4TMZA 1TQ4A 4MYUA 1IXZA 3Q3JB 1OB2A 1W4BA 2KJBA 1TU4A 2CWEA 4QJ4A 1SXJE 1FUUA 3QKSB 4EPRA 3L8ZA 3RNLA 4V03A 4HZUA 2FGKA 1IAQA 4TTPA 1W46A 3ONWA 3H2YA 4MKGA 1IBRA 3LH5A 1YHNA 3SJAA 2C95A 1LDKB 1ZN2A 2DLLA 2WKRA 1VPLA 1PUIA 2AXLA 3CPJB 5K8TA 3PQJA 2P3SA 3VNUA 2IA0A 4JBYA 1CF4A 2C9OA 3MCZA 2GXSA 3T15A 4LI0A 1NSTA 5KNDA 3HSEA 1GRNA 4P33A 4NYJR 2KSQA 3ZN0A 3GJ6A 2KRKA 3FKQA 2CK3D 2QAGB 2CYYA 3MWJA 4B73A 5JMTA 5KSZA 2VPPA 1G16A 3PUWA 4LJ5A 1OB5A 4Q7LA 1FSEA 5B2ZA 5JCPA 1E4VA 3K1JA 2ZTSA 4NHOA 3H3ZA 2L02A 4PC1A 1RIFA 2ZJAA 4G5OA 2IYRA 1DO2A 2HCJB 4S05A 4A5MA 1QHHA 5D3QA 4D4JA 1KDTA 4P3YA 2A78A 2DT5A 1U5TC 4Q00A 4GDFA 3VNVA 2AS5F 4JVLA 2ZSAA 1KU3A 1XJQA 3GFTA 4RZUA 3KP6A 2VF7A 3TQCA 2ONKA 3PEYA 1JBKA 3DOFA 3IC7A 4HX4A 1JHHA 3O8CA 4Q9HA 1DDNA 1WF3A 3V4GA 2A5GA 3WNCA 3UPUA 1R5HA 4HV5A 4BFYA 2H92A 1VIYA 4ZYEA 4G1UC 5SZJA 4C9BA 4Q1FA 4AKGA 1FL9A 5E1ZB 2OCPA 1P3JA 1DTSA 2EYQA 4HUQB 2CQKA 4Q47A 2WHXA 2O8XA 2IYYA 4I1VA 3B82A 4O5VA 3U2QA 3GLHB 1E6CA 1NSFA 1YZTA 2AHOA 4PQFA 3RS3A 5FFMA 3WMEA 4A9AA 2GCNA 4KFRA 2ZMEA 2BVNA 3LLUA 5FI0B 4RJLA 4C0BA 1WRBA 1OH6A 3I59B 1A5TA 2IVMA 4DB4A 1P60A 1KI1A 3RRNA 3QOFA 5BPIA 3K0AB 1TAGA 2LSOA 1IJEA 1D6JA 1SHZA 3B6EA 3W9YA 5FFZA 2GDJA 3CWQA 1FY7A 4GT1A 5F3WB 1NBME 2CBZA 3FGNA 4P4SA 2XB2A 4FN5A 1N0VC 2HZTA 4QWQA 4R79A 2W6JD 1UBFA 1FP2A 5CB8A 3THWA 4M9XA 1YG2A 3L00A 4TYPA 4FWDA 3V7CA 4HSEA 4N9HA 5D6EA 1TLHB 4BPBA 1NN1A 3WE3A 5DN6A 1TQPA 4U88A 3MWMA 4HF0A 4BLQA 2JJ1A 4A8JA 4CT4B 4M9SA 1CR4A 3PEUA 1Z63A 3QXHA 3B1YA 5IHPA 2REOA 3AUXA 1ZCBA 5FBRB 2D2WA 3EIEA 2A6HF 1L3LA 2J7KA 2UZ3A 2RB4A 1P61B 2EJRA 3I4PA 4IFBA 3E1SA 4Q4JB 1S3GA 2GJSA 4X8LA 3TGPA 3DM5A 3MWLA 3JSPA 3CO7C 1PZNA 4LV5B 3BH6A 3UKDA 1Z6RA 1H8EA 1VHLA 3L43A 3NHAA 4DCUA 4M6YA 1E2LA 4E5UA 5JFGA 2J0VA 1OW3B 1G8HA 1G8PA 1D2NA 1CLUA 1I4DD 2BDTA 3GX4X 4YFKF 1BMFD 4EM0B 2JGNA 4RSGA 3BOSA 1VCOA 4QOSA 3AAFA 2J5XA 2ZUCA 2Q0OA 2WAYA 1XEXB 2YJTD 1NNEA 2QMHA 2RQPA 1ZYUA 3CUQC 1SXJC 5FBQB 3KCCA 2XNDA 1E2MA 4NYMQ 3ZQ7A 3TRFA 4BXUA 3A36A 3QU6A 2GJ8A 3OHMA 2CSOA 1XZPA 2UKDA 4CF7A 2R7FA 5J6XA 4FX0A 2CL6X 2FSWA 1XEWY 4TSFD 3P9IA 2R44A 3WGIA 1ZC3A 1US8A 2Y75A 1R8QA 3I4LA 1IF1A 2K02A 3OEHA 4L9SA 2KWIA 4NKRA 1BC8C 5L3QB 1IN8A 1Q44A 2P4WA 3COAC 5L3FA 5KSYA 3G3ZA 2GZWA 1XSVA 2VBZA 4M72A 1ZHFA 1S8NA 2EFNA 4AIJA 1ELOA 5BQ5A 3QIAA 5JJIA 4L5JA 4RGXA 3GZ6A 1E9FA 2XOKD 4WWCA 4JT4A 4N0DA 1N6RA 1IXSB 3T61A 4FIDA 1KO8A 3MZHA 5EXTA 5AIQA 1OFTA 4PQRA 2G83A 2ATVA 1KI2A 3KB2A 4AWXB 3KLOA 1XCPA 3VR5A 4NB5A 2ACJA 5L3CA 5CVRA 1FMJA 1GDDA 1LS1A 4V0NA 1AKYA 2IX3A 1G41A 3U1DA 1TW2A 2WKPA 1G7RA 5FTLA 4BFUA 1CIPA 1YRBA 2C8VA 1NMZA 2X77A 4IDHA 4E22A 4F93B 1YR6A 3W5JA 3GYHX 1RW4A 1SFXA 3MAAC 2GTPA 2IC5A 1W4AA 2QSZA 4PC2A 4DIEA 4ZKEA 2JCSA 4FI3C 4OBEA 2XVCA 4TLDA 1F4KA 2OU2A 3L09A 2EV5A 4XWAA 5F9HA 3OAAD 1ZRCA 3UG7A 4OK6A 1G5TA 1XRJA 2N46A 3AVPA 3HJNA 5EZ5A 2E1NA 4KVAA 5FOXA 4PGHA 3U3OA 3K0LA 2OBPA 2G0NA 2HYDA 3V9PA 4EQ6B 1FBUA 1IN4A 2MH2A 4WXDA 2ZUBA 2TMKA 5KNBA 5E8IA 4FMCB 3F8TA 2FEZA 3L7WA 4RFVA 2YWHA 2C96A 3D6TB 1GZSA 2J45A 3Q5FA 2WWGA 3GLHE 4KBFA 3GLFB 1H8HD 3SJZA 4Q4ZF 1FTNA 4A2PA 1G8FA 3MFYA 5HCNA 1E79D 2NTYC 1UKZA 2C04A 2CJWB 2PT5A 1ZNWA 2J3EA 2EWWA 3CZPA 2VTKA 4HAUA 1WBBA 1JQJC 2KRFA 2ZREA 1X3SA 1LF5A 2BKEA 2WAXA 1ZU4A 2VXZA 1I1SA 1FP7A 2OBNA 2QP4A 3FMFA 4YMUA 3I5XA 3ZLJA 2MLGA 1AQYA 1R22A 2JT1A 4L9JA 3Q7QA 1NBMD 3RRMA 1U5TA 2AD5A 1YZQA 1F48A 4U7DA 1GP2A 2D2FA 1GNRA 2IEZA 5J4YA 4YFXF 4I02A 1EX6A 3O47A 2CFXA 3GEZA 2PX0A 4N9IA 3CF2A 3BPXA 2EYUA 2V9PA 5DEQA 4MKIA 1XP8A 4LRWA 3T1OA 3KZ1E 1F2TA 2IJLA 3FDIA 1HQYE 4TT3D 3H86A 2WTEA 2ADUA 2R6GA 1NN3A 3R61A 4US1R 3MAJA 5LRSA 1ZJ6A 3GLGA 1WA5A 3HRMA 3E70C 1E2GA 3PV0A 5ILVA 1N5JA 3TJZA 2GEDA 4O6JA 5HDGA 2M30A 4OI4A 4PPFA 3AV0B 1VG1A 5ILSA 4AG5A 2FBIA 5CVVA 1F6BA 3EZ7A 1EFCA 1ZM4A 2ANBA 4GMDA 4GOKA 2HCBA 3CF0A 3H92A 4Y17A 3AM1A 1E1QA 4NPHA 4JLPA 5JRJA 2F5DA 1J2XA 1QO0D 2DK5A 3ABTA 1KK1A 2HXYA 4D0NA 2ZQ5A 1W36D 1ZINA 1Z07A 2C9YA 3BB4A 4F92B 4Q4AB 2O8FB 2ISZA 2J41A 4DJTA 2OQGA 1TTTA 1P9WA 1H0MA 1E9AA 3KLNA 1ZU5A 4DLZA 2QVOA 4WF2A 3WRXC 1ZM2A 5BYKA 1NMXA 2FNAA 4EKDA 4OQNA 1K5DA 5JJKA 1XMAA 3VAAA 1Z2AA 1JB1A 2I3BA 3RHFA 5EE5B 1G6NA 2P6TA 1N6IA 4WAUA 1OIWA 2HT1A 2D3WA 2QM7A 4O2RA 4GCVA 4D2IA 3TSZA 4KMUX 3TO7A 1E0JA 3LWFA 1JEDA 2X1VA 4ENKA 5IRCD 3U6KA 1U90A 4LPKA 4N3NA 4H1UA 1BC7C 1T4GA 1HH4A 2F3RA 1KJWA 1KJYA 3SNHA 2JLZA 1JPJA 2WWFA 1USTA 1TF5A 4WVFA 1P2FA 3GWZA 3QPTA 1IONA 1VHTA 3ZZTA 4OQFA 3UATA 3C7JA 3FM3A 3EZ2A 3J81k 1V43A 1FW6A 2CK3A 4TQ9A 1KI3A 2GZAA 2V1XA 5JEDA 5DI3A 2C99A 2JTVA 2OZEA 1E2QA 2FOKA 3IRQA 3ZQ6A 3UK6A 1F5TA 4IXAA 2GA1A 4AIKA 3ZVMA 2F43A 1QHXA 2ZJOA 1QNTA 4M9QA 1I5ZA 1B1BA 1MJ9A 2YX4A 1XCVA 3HTSB 2EWVA 4FINA 2PJRA 2QM3A 1JGSA 1X8KA 2CLCX 4LB6B 4AKIA 2ZANA 4CEJA 5EEHA 2DWOA 3PR1A 3PUXA 2FEMA 1HUQA 3J80K 3R20A 1NLFA 2QP9X 5B64A 1YTYA 5CVIA 1J7KA 3A1SA 4MGKR 1UAAA 4AURA 4JJKA 4WA7A 2F55A 3IGFA 1YZGA 3HRUA 4G6QA 2PEZA 3TIFA 4FX4A 3CWZA 4BRWA 4R2IA 4A15A 1XPUA 4UXNA 3RDIA 3CNLA 3FHOA 5JFRA 5D5WB 1S1CA 4ZCMA 5J4LA 2QROA 4JLDA 1WP9A 2VHTA 4XSXF 2QPOA 1GWNA 1BJAA 2DW4A 2IYVA 3ECCA 4DXAA 2FE4A 4TQUS 3NWJA 1Q21A 3GVAA 1HA3A 3ZVRA 3ECOA 2P65A 2EVWX 2QM8A 4KLZA 4BEBA 4PX9A 4ON0A 1FPMA 1NVUQ 4JLKA 3T12A 3HIFA 2J9RA 4KO8A 5KOYA 3QAHA 3SHFA 4L0ZB 5AWFC 3PVSA 4A0FA 4M71A 2I1VB 5CJPA 3ZGXA 3SDZA 1RFLA 3SZTA 2BHRA 4W7SA 4D26A 2XTMA 3AB3A 5DISB 2YKGA 2CW0F 4A4DA 2XIGA 1MD0A 1M8PA 4WXPA 1KGDA 2OAZA 1Z22A 2GNOA 5CLLA 1E1RA 4EPTA 1AIPA 4IEIA 1U98A 3TVDA 1KU7A 1MH1A 3IIKA 3LBHA 4LC0A 4NDZA 3TSOA 3OFNA 5JSZA 3RKYA 4ASUA 3MD0A 4B8XA 4ZV4A 3WNBA 1PLLA 2C78A 2JJ1D 3K9NA 5BYJA 4A0HA 3RPUA 1KMQA 2B8WA 3ASYA 5K5RA 4G8XA 2ELHA 2EA2A 4IF4A 5CYVA 1Z6TA 5CVUA 3BROA 1PP8F 2ZJYA 1MDMA 4C0AC 3IEVA 3VKGA 1I4LD 4KMFA 2M87A 4HB4A 1SGWA 2YOGA 4WXHA 4YIFA 4M1TA 4LB5A 2BE5F 2K7LA 3E2IA 2GA8A 3KKQA 2J0UB 1O3SA 4GSYA 1KI6B 3SR0A 5EXSA 4MHGA 1GILA 3R8CA 4LHXA 3SYLA 3N70A 5KSOA 2O0YA 1TQMA 3M0EA 4J0QA 4L9WA 3TUZC 3L2OB 3VEPA 2FQ3A 1FNMA 1KI4A 1VYTA 4EPVA 2Z83A 1Y63A 4OKSA 3E3VA 4Q9LA 2H5EA 4B3BA 1K79A 2B7CA 3BBPA 4ILEA 2KI5A 1CXZA 2ZUDA 5BN4A 2O8EA 1U2WA 2EU8A 4NYIQ 1KU9A 2V1DA 3TQNA 2Z43A 4LBZA 4Q1DA 3WXMA 2PI0A 3D8BA 1AK2A 3A1TA 3IWZA 2AXNA 5KSPA 3U6BA 3AP2A 3AGPA 1F9NA 2W84A 2FRHA 1E4YA 3N97A 2GCOB 1MJBA 4EJVA 1LQ1A 2NPIA 2BBSA 2W58A 4PQYA 4XSHA 3X1ZA 1AQUA 2QQBA 3KP5A 3LAWA 1QRAA 4KYIB 4W5WA 3FM5A 4IRGA 4YDSA 3JW4A 3WP0A 3TGNA 2JJ2A 4IOKA 3VR2A 3HRTA 2HYGD 2JLWA 4WW0A 1N6HA 4Q4HB 1YZUA 1G291 3C1DA 3C41J 2VBYA 4QGFA 2V3CC 1ZGAA 2EFOA 2NNYA 4OIOF 1DE0A 5KO2A 4II7A 4M2LA 4KFUA 2XX3A 4ZDKA 2D45A 3W90A 5C4MA 2VA8A 3B1XA 1JR6A 5FTNA 2VBWA 5FLXZ 2ZEJA 1TQDA 3BB1A 721PA 4LCBA 4UVAA 2KIUA 1G3QA 4TQAA 2RDPA 2GBLC 4YLGA 3TNFA 5CIQA 4XOIA 1P9RA 1G5PA 5AUNB 4M53A 4B2IA 1Z05A 5LB4A 2QLZA 3CH5A 4IVRA 5SZKB 4BQAA 3T5DA 1M1YE 2DY1A 1ZREA 3VFDA 3TOAA 2DFIA 4KICA 1YLFA 4LYJA 2B92A 4HLCA 3FFAA 2QA5A 1BIBA 2C03A 2D74A 1CJKC 5EE1A 3WODF 2ZXUA 1LEAA 4ZZLA 1CRQA 1OXUA 3O2PE 3QUSA 3BC1A 1OFUX 1W4MA 1T39A 3VR6A 1YQAA 3U3KA 5EQTA 2BBYA 1U0HC 2MLKA 5H68A 3AVYA 2HXSA 2NS0A 4MGYR 1B9NA 5DH9A 2JIZD 2VIIA 4KJZA 3KXLA 1S7AA 5AJZA 5IT9K 1NJGA 3WYGA 4MRSA 3EPHA 1AJEA 3CH4B 1CGPA 4MYCA 1GKIA 2ZITA 5AONA 1Z0IA 2YC2C 4M22A 3OE7A 1G19A 3CUQB 1MO6A 1VYVA 1U8ZA 5HZKA 1EH6A 3Q72A 4S2EA 2NAZA 3IIJA 1E79A 5CK5A 3J81K 1QGPA 2NQ2C 3VR1A 2JSCA 2R8RA 1KO1A 5TMPA 4LBVA 3EQLF 1KDPA 4KI0A 4AKHA 2QZ4A 3W6KB 3REFA 1GNQA 1N5IA 3PUVA 3R8FA 4YMWA 2F1HA 4V0KA 3SHWA 3SJCA 3Q9VA 3WG9A 1Z9CA 1H9TA 1P6XA 5L3RA 2ZE5A 1U9IA 5BWMA 1T91A 3RABA 3KP7A 3JZMA 2PL3A 2BOVA 1W36C 5HLIA 3I8SA 3RYRA 1OR7A 2K4JA 2HYIC 2XROA 1G6OA 1G3YA 2WJVA 3BFVA 4EJSC 1L8QA 1OKRA 4KODA 3GLIB 4DNCA 5EP3A 4ZIRB 3NBXX 1TW3A 4MEYF 2VONA 4KNYA 1GL7A 1KO5A 1UEJA 3TO9A 1VECA 3IKJA 3WMGA 4LZZA 4ON9A 1W4RA 3S1AA 4HUQA 2AFIE 2GK7A 3NDPA 4KV9A 3OEEA 3LFKA 2PJPA 1II9A 4MDEA 1TADA 2RGGA 3GLXA 4YMTA 1RUNA 5CJ9A 3I62A 1IW7F 5LRRA 3FHCB 5B58C 5J4KA 1OPXA 1R1VA 1WQ2A 1O3TA 4V0ME 4HEJA 4B09A 3K0AA 3PXGA 4M8NE 3QF7A 2WOOA 4O2LA 5BOXA 4CICA 2ZRJA 4RD3A 5A0FA 2EFGA 2O8CB 2PBRA 4BHPA 1SXJA 1N0UA 2ZNZA 4A0GA 4DLUA 5E3HA 2JLYA 3HTUA 1G7TA 4FWGA 1NHAA 3F6OA 3GEIA 3HU3A 1NY5A 4TMWA 4MDFA 2EK5A 4L9VA 4QM7A 3FOZA 2GIVA 2L3DA 3QKTA 4PC6A 5FUWA 1L4UA 4WCGA 4RB3C 4MGZR 4QGAA 2PQ8A 1U81A 4XTRA 4A8JB 4DSTA 3I53A 2NPFA 3QF4B 4CEHB 2ZE6A 1Z0JA 3E5QA 1GSIA 2I4IA 4JJZA 4DC9A 2FDCA 2HDNB 3GFLA 3BWGA 3AJIB 2Z4RA 3GLGE 3T8RA 1S7OA 4JT2A 2XB4A 4Q4JA 3GQBA 4E03A 2IS1A 1RJ9B 3CX7A 4HYEA 3CR7A 1Z06A 1DVRA 3QEJA 1II8A 1FX7A 1LVGA 2IW5A 1J90A 2QI9C 2CVHA 3BERA 1CBUA 4AI6A 5DUIA 2Z4SA 3B7GA 3NIBA 5GJVC 2VN2A 3RSOA 4ARZA 4B75A 4C4PA 4BH9A 2FWRA 4CIDA 2YVUA 1A4RA 3KJEA 1S6LA 1XXHB 1KGSA 1AZSC 2JATA 3ZMTA 3BDDA 4N1AA 2HYFA 3VU9A 4XSZF 4ZYDA 1NMYA 1RZ4A 3O8DA 2CE2X 1GXQA 1DP7P 4GOXA 3MGCA 2HWVA 2W2VA 1XSDA 5JHGB 3L0SA 2DO7A 5FTMA 1XTIA 2H18A 4Q01A 4UJ3A 5DV5A 1IN7A 4ASNA 2NMVA 3ZMSA 3DPUA 1AS0A 3ZVLA 3WTUC 1NI3A 1HW2A 3I3SR 3ZD6A 2EW1A 2FEOA 1Z28A 3CRW1 3GPLA 4D80A 4HYYA 4A8JC 2WVJA 4AVPA 1EFTA 3RANA 3BGWA 2QAJA 3QG1A 2ZYVX 5F2EA 2PX3A 3I5YA 5GJBA 1QHIA 3QXJA 2D06A 5JRZA 3B9QA 4P9FA 1X6VA 1YR8A 4TYWA 2E1CA 5KPDA 4BLSA 5HS7A 3EA0A 4DB2A 3NQOA 2W0MA 3K8YA 1ZP6A 2H09A 2O5VA 1VDZA 4BEJA 2OLKA 3QPHA 2AX4A 5FOTA 5JCZA 4OI0A 3DV8A 1N6LA 2OA4A 1KZ7B 1TU3A 1HSJA 4HB0A 2ERXA 2VP2A 1GAJA 2BBTA 1G9XA 3ASZA 4GBMA 4LK2A 1FUKA 1TF7A 2RHDA 3CJNA 3R0JA 4A2QA 1SXJD 4UXJA 1LDJA 1OMIA 4I98B 4PPGA 421PA 2WV0A 3PEWA 5FOUA 2CNWA 2B21A 2OV2A 4DWJA 1ANKA 5E20A 2Q9BA 4A6EA 4Q1EA 4QG7A 3U4QA 1RI7A 3LQQA 2PT7A 4EJSB 1LY1A 4Q1AA 1DADA 3AP3A 2HEOA 4Z8YA 3VMFA 4IPAA 5AIPA 2XGXA 2GBLA 1R4AA 3FB4A 5SZHB 3C18A 2QWWA 3EPJA 5D4RA 3EYYA 2GXGA 1KSGA 2FPKA 1KYWA 3LDAA 1FX0A 2FSFA 1N2CE 4I0AA 4MEXF 1P7CA 2HS5A 1KIMA 3K9GA 3P20A 1DBSA 1HYQA 1IRGA 4RD0A 2AWOA 4D0LB 4LSGA 2YWGA 3THYA 2GF0A 5FR2A 1D3YA 5SZIA 1JEEA 4D4LA 4TMXA 1ZCAA 2CJWA 3HP1A 4R98A 3HU2A 1KMHB 4LJ8A 3CLOA 3CTAA 5FFXA 1F2UB 1KTVA 3I0TA 2DPUA 1MT0A 4RGSA 4JYCA 3EIHA 1MABA 1YS7A 2N42A 4KSCA 5CLQA 3IWFA 4UNNA 2CG4A 5CLSA 5E17F 2P5VA 2G6BA 1WI9A 1U5TB 2OQRA 3T1BA 4A0ZA 4BYYA 1KHTA 4A2UA 2BWJA 4XJXA 4GL2A 2PCLA 2CCGA 3V4RA 1E9SA 1O3YA 1VCIA 1C1KA 1UPTA 2CDNA 3BS4A 4RFSB 2IK8A 3OESA 4HAYA 5DLQC 1IY1A 2ORIA 2DFLA 4M6XA 1KYIA 1X3UA
chains in the Genus database with same CATH superfamily
5CAEB 3PC6A 3QFHA 3I2IA 1SMTA 4O5AA 4A3SA 3ZCOA 1GV5A 1PFYA 1DWUA 3WDLA 3C8HA 3D0KA 4HH3C 1JT6A 2K3FA 4YCJA 2FHSA 1HEYA 1EP1B 5E3OA 3O6BB 1KZ9A 2H48A 4KZKA 2Z5FA 2JLRA 3QMVA 1OC2A 4NEHB 2WPDA 2WLTA 1XSXA 4F4CA 1DZ3A 1Z25A 4QO8A 4URVR 4RSRA 4N18A 4UBJA 5JI3E 3S16J 2PGXA 1V0JA 1WD7A 3B9PA 2IA1A 4Y8VA 2HJGA 5D86A 4DVGA 3GFBA 3H1CA 1EGHA 1ZK2A 4PFKA 4B87A 3TLGB 4YHHM 4PVCA 1NQAO 4LF8M 5BUZA 3ADDA 1PJBA 2FQ4A 3AP1A 4NSRA 5I5GA 5E6UB 4ME6A 3PT5A 2Y8EA 1E7MA 4I55A 2D7HA 3NBZC 3AR8A 1GTRA 4PAWA 2G7ZA 1ATZA 4FYVA 2AH5A 3E6CC 3FMPB 5F76A 4FKMA 4GOJA 4Q34A 5HKBA 1F6WA 3HKBB 4II2A 5BY2A 3U61B 5E8GA 4XOPA 4IWNA 4WPGA 2OXTA 4Y33A 2GXQA 4C4AA 4HYQA 5DTMA 4X7BA 2QJTA 3ADCA 4H31A 2L09A 1K7AA 4E70A 4WX9A 3F5SA 4LRTB 5CT6A 3CQ9A 1XDWA 1NXPA 4F3QA 1UCRA 2FB9A 3OJWA 2PU5A 3VPGA 2WSYB 4JKIA 2X0LA 1NVBA 4IDPA 2A0XA 1UMBA 5J2UF 1YDEA 1XWIA 2CHVA 4LMRA 2J5OA 1E4OA 1A2OA 4Y9TA 1XNQB 1LEHA 5JRDS 3HRIA 4HMPA 3OZEA 3V1UA 2D0DA 2EHDA 2CJPA 1NG6A 1N0HA 3W0FA 3K0CC 5I4BA 4MVJE 4F3YA 4BCCA 1SVIA 1M2OA 5KTTA 2OQVA 2BKUA 4TTJA 3C6YA 5K4GA 1CJMA 2P2SA 4BXOB 1M8JA 2X6RA 3D3KA 1HNZM 2ZWIA 3Q6NA 2OCCH 4KN6A 1ZXXA 3KKNA 4RDIA 3W9SA 4ENPA 3N8DA 1MVNA 2WMNB 4IUYA 5CVCA 1BL0A 2VXOA 1OASA 4WOKA 1VJGA 4M21A 3ZI4A 4WBSA 4B4KA 3SX4A 1S2OA 2CDRA 1V8PA 4FYPA 1MN3A 3RSLA 1RKTA 1HE2A 1US8B 1NW9B 3JTHA 4EPYA 1H6UA 1ONBA 3ZTWA 3Q2OA 4R16A 4N6OA 1Z2PX 1Z15A 8ABPA 1T6NA 3OT5A 4ZZ1A 3OYGA 4XJVA 3HYSA 4UQOA 2XF7A 2V6GA 2AVNA 1U2PA 4TL9A 3EGIA 2W4QA 3LC7O 3EXAA 3PDHA 2V65A 5KWJA 1NBOA 1T1SA 5CIYA 3LC0A 2JRTA 5DGHA 4U2EA 1WPGA 3B53X 1D8AA 5AVTA 1DCTA 2JJ7A 4ZPXA 2EZLA 2Y27A 4CCOA 1QYXA 3DAOA 1E1QD 4G9YA 2FPWA 2X48A 2E3JA 3H2SA 2AT1A 3IAM1 4E32A 1JHRA 3E0XA 4YNBA 4GOOD 3L6CA 1LZKA 4HBLA 2OTCA 3OPYI 2XDQA 1RYFA 4O63O 3U9LA 3LUKA 4EZIA 1REPC 1S3IA 4YMLA 5EPOA 4TZ0A 4AKSA 3U60B 3WWZA 1IQUA 3LSPA 1QF9A 2DYSH 2Z58A 1LNWA 3NKVA 1XQWA 2QAGC 3LQRA 1FNNA 1GJRA 2ZJFA 4GZMA 1R16A 3S15J 121PA 3T5XA 5BNTA 1DWPA 2BWBA 1PFQA 5T67A 3GCMA 3OIFA 5EJ5A 2O2JA 1JPVA 4HQKA 4CYCB 3FTDA 1QWOA 4M3DA 4BZXA 4V24A 5AW0A 4EG5A 4NCKA 3UQZA 5IXSA 4EMTA 1FYVA 1PO7A 4KAFA 2AE1A 3IBCA 4OL9A 4D81A 2ZT6A 4LRSA 2CFIA 1E6LA 3DPLC 3T1YB 4IUCS 3BMXA 4H7JA 4A3BJ 2ZWAA 4LJ6A 1SKBA 221PA 1J24A 3T5BA 4HAMA 1W5BA 1PJIA 2IDJA 4A2CA 1JZSA 4X65B 1GTL1 5JSZB 2JZNA 2G1KA 5B3JA 3D1LA 3LPCA 4MRVA 2QX8A 4W99A 3AKDA 4AZWA 1NU6A 5C46F 2V7GA 5D8DA 3TEFA 1AZWA 3PFCA 4GUDA 3IL2A 2R1TB 4MWEA 4CLOB 5FTKA 3F9RA 4ZVNA 2WD8A 1AOXA 1BH6A 3Q3SA 3L7LA 4HL4A 4XOTA 1O87A 1UAGA 5D3MA 1XD8A 4FHFA 4AMYA 1PBTA 4YUWA 1BWSA 3ZS9A 1T0BA 3THXB 2IS2A 1AZTA 4DLWA 3ZE9A 1YS6A 2B2NA 3FVRA 3J7YJ 2COEA 2BYVE 3KC2A 1C0KA 5TT1A 5AK4A 1CFZA 3GGSA 5CYOA 1XKTA 1MHTA 3IT0A 1A8UA 1ZI6A 3Q1KA 5CPFA 1QHHB 4WI1A 3QUBA 3ER8A 2GHQA 4M1EA 1V8OA 3GDGA 1KY4A 1ZX1A 1KS2A 4YMVA 2HCFA 3QWHA 2Y31A 2ZAOA 2QMZA 4YUVA 3SS8A 1FFDA 1TUEA 4G0VA 3BBLA 3BGOS 4I46A 3L6OO 4KO4S 1X0VA 5JS7A 2O19A 4CCMA 4MHOA 1N6KA 3UHAA 5DHPA 5CEEA 2HQ5A 3JVEA 1ZN8A 3TJRA 4K2EA 3P4UA 4UB8C 3IXQA 2BH9A 4RAYA 3TLJA 1G5IA 3IP3A 3PD0A 2PWPA 1ZW1A 4AL4A 1PEYA 1UXHA 3PQ6A 1HFJA 1XAIA 2DSTA 2HLNA 1UFOA 1HSTA 5KSZA 2EFWA 1R71A 2GN4A 3CRQA 4LDRA 4JDPA 3AUYA 1I33A 3K8OE 2ONCA 3L0BA 4NAVA 1SU8A 2WTAA 2BISA 1XGMA 1VYHA 4CKWA 2IXSA 4IBCA 3MJEA 2P6OA 1PFKA 3KR9A 4FGJA 1TMKA 1HDOA 2V7PA 3E8SA 2HMSA 5M3MJ 3DZFA 3RJMA 3R7AA 1JNXX 1RZRA 1WBJB 1S02A 3WTYC 3VFZA 1FE8A 1LDMA 2RJOA 4HRAA 2BGLA 1SC9A 3RJ5A 3K70C 2OAGA 1HW1A 1NP6A 4OHZA 3LS2A 5DYMA 2A94A 3WYAA 4GMQA 2W43A 2DUJA 1XAGA 4S24A 2O0KA 2BBWA 3M8EA 1V6CA 1JHVA 5TNXA 5ED4A 1IOWA 1GG5A 3S93A 1DUXC 2DFFA 3C16C 1EQ2A 1P73A 1D6NA 4WV3A 5INTA 2ZK7A 3G1WA 4X0EA 2ZJZA 4XH9B 2CMDA 5KMGB 1Y81A 1VI6A 2RNGA 4B08A 2PTHA 2VSOA 3QTBA 2WJHA 3AF5A 4FHDA 3D8SA 3KU4A 3K4JA 4K2HA 5CFQA 1R2ZA 5JAOA 2R6DA 4ALMA 1DKRA 4LFCB 4EB3A 2VDKB 4WK8F 1S7CA 1L1RA 2EEPA 1QG2A 3EETA 1II0A 1OJLA 6LDHA 4ZVKA 4PCQA 1T8YA 5IDQA 3E7XA 4B3DA 2FSPA 3LXRA 3RLIA 2H5XA 5ITUA 2DTXA 4RS8A 4NC9A 2ZCJA 4GPTA 4JS0A 1XMQB 3GIWA 1P4XA 1EH7A 1GRVA 2JVIA 3K53A 3HZOA 2R7MA 3JSAA 5JC1A 3B78A 1RADA 4NUBA 2LCQA 1Z9BA 4CYCA 1DAEA 2EJSA 2X8LA 2YUIA 3EFEA 3UBTA 4JUBA 4EHDA 4OQYA 1B8UA 2GMWA 2WIBA 1UOQA 1O54A 2ZO4A 1IBKB 5LMCA 1HC7A 4F8YA 1CEYA 2FYTA 1XYYA 2L18A 3T95A 1F6DA 1DQUA 3BY6A 1RJDA 3QLUA 4ERXA 3FXQA 4J7UA 2IF2A 3Q7RA 4QXMA 4TN1A 4G4SP 2CMKA 4UU1A 4PLCA 1T8WA 4E46A 3BK1A 4PSUA 2RCNA 3TECE 4B1RA 1N3LA 2H2GA 3VRHA 3FSRA 3L2UA 3DBLB 2F7SA 4G12A 4C4TA 1MMSA 1KC3A 2ZJRF 3HJFA 4QL3A 1UJ2A 2X14A 1OFHA 4S04A 4URZR 3B3QA 1E3QA 1UOPA 3GZ4A 2ZRQA 5HIKA 3FJYA 2XCOA 3HN2A 1KQGA 4ZALA 3QIVA 3ZWOA 2CMFA 1YZKA 4MQLA 4CLDA 3JD0A 4GKJB 2OKCA 1RI3A 2G0EA 2HVSA 3R40A 3HOUJ 3M4OJ 3PNQA 1RQXA 5FOUA 2WILA 4PC3A 2Z5LA 3SQNA 3DYVA 3FPEA 1ZMWA 3TR0A 3IJ5A 2FUCA 5EKSA 2ADOA 4B7CA 2CU7A 5DX8A 1IVNA 4KOAA 1M2WA 1MJGA 4V1CB 4IQGA 5A2QA 4OUDA 2ZE8A 2QQGA 5EUMA 1K2VN 1OHHA 3GF2A 2QN2A 4A6XA 4G1MB 2V98A 2GAAA 2WJ3A 1ODLA 2FJUA 2FE8A 3TWLA 3PM1A 4XRSA 3PJEA 1UMQA 5LLQA 5D5QA 4NFHA 1YS9A 4OLHA 3D59A 2CXTA 3E53A 1Q74A 4HEA2 5T6MA 1L6IA 4AO8A 1GTVA 2GM5A 1E2BA 4M1SA 3OM9A 4BRSA 1PR3A 2I87A 1SIBE 4P6VF 3GX1A 3EXG2 4XUGB 3MOSA 2AZDA 4RE6A 4PO8A 5L6LB 4GITA 1BMTA 1K78B 1L0BA 3AH8A 1OC4A 1A36A 4UTRA 1O94C 5I8ZA 1ZAEA 1QDUA 4X1YA 4AKTA 1JHYA 4YUAA 3LA7A 4B2YA 4RWZA 4YJDA 1EBFA 3ABLH 3L05A 2XB5A 4F2LA 3CKKA 3DVSX 1O8BA 2QQ5A 3IOEA 4JVNA 1NF2A 3DJFA 1NONA 3SYTA 3RVKA 3SYMA 3DA8A 1FJGB 3ISPA 4UHJA 3UT5A 1Z6PA 4EIWA 4QRHA 4IDGA 4AMGA 3TSCA 1J0BA 3O8RA 5I4IA 5D87A 2X0RA 4FFOA 5B2EA 3MWEA 1RCTE 1NOIA 4YXWA 2WOJA 2WWVD 3F8CA 4GPBA 2C2XA 2ZTHA 1IAWA 1V9LA 2EP8A 4TYYA 2ZKZA 5E95A 2WPDD 3D5LA 5EJ8A 2FZ4A 2X9DA 1XZQA 1RYMA 5H7XA 3ESCA 2IE0A 1SUPA 3CJRA 4MLCA 5E8RA 1Y37A 4H3KB 4PZ9A 5IAGA 3LY8A 5IF9A 4TMTA 4HFMA 1RPNA 1MNEA 5A3JA 2OESA 2ZUVA 1RYZA 2Q07A 5JPCA 4GRIA 2BTOA 2HR3A 3ZRGA 1FRQA 4J9VA 2VTBB 1KEKA 4EJTA 3X1DA 3KR1A 2DT8A 2I10A 5EGNA 3KZXA 2YZKA 1OWLA 3HSRA 1LLQA 1PZHA 2FPIB 2VJYA 3A0BC 3DO5A 4LNHA 1KFCB 3FHLA 2OEPA 1ULZA 2JCYA 1HDRA 1ODTC 2NN3C 1Z21A 4HFNA 1DXHA 2H2DA 4DBQA 3EC2A 1GT6A 1R8XA 1TI7A 2DQLA 3K0KA 1XALA 5JJLA 2QVZX 5M7EA 3KUDA 3M1CA 2NZ8A 1A7KA 1TJNA 2PUTA 3GVCA 1M72A 3ZJ4A 2JPCA 2V7EA 1QZEA 1BE6A 3I0MA 2QZSA 5F7OA 3NYWA 3TCXB 3HL4A 3C7DB 4D96A 5L7YA 1P1KA 1SQSA 3ZCXA 3QOEA 4W8GA 1CNMA 4QJ4A 3L49A 3ONNA 4EELA 4EPRA 2P81A 5B4UA 3L0ZA 1IBRA 2JLBA 3SJAA 4IYJA 3W5AA 2C95A 1ZN2A 1VQ4I 3R5SA 1NSTA 5FBKA 4LG3A 5JMTA 3ABRB 4B73A 1JEQA 2ZIVB 2J32A 1ZWKA 2H7CA 3E5NA 1RIFA 4KYTA 4AY4A 3WU2C 3NWBA 1JE0A 1BE8A 3SK0A 4XPZA 2C4KA 1XJQA 2ZULA 3TQCA 4FE4A 2QA4I 4QBKA 5DMXA 1V11B 2B3TA 1YJ9I 4YP0A 4RELA 2WHXA 3THRA 3GLHB 1NSFA 1V45E 1PT8A 1QPZA 1RJWA 2O8KA 1Y1KE 1NW6A 2GDZA 5HP4A 4RGQA 2PUEA 3RE8A 4P4SA 2LVAA 1TLHB 4EGFA 1H05A 3JARB 3QM1A 4M9SA 2VPXA 1P2DA 1QGED 4X8LA 2RHOA 1TT7A 3NARA 3F7MA 4LV5B 1G8KA 2JHPA 5I7EA 1SIOA 4NE7A 2B5OA 2PA3A 5F1KA 3BOSA 4QOSA 2F5NA 5BO5A 4TSKA 2H06A 1V5IA 2CL6X 1XEWY 4YO8A 3CVJA 3JWIA 3W5SA 1AHPA 1ELOA 4QGSA 4CG3A 1EWYA 1TZ2A 4BDYA 3NUGA 4FDVA 5DM6F 2R66A 1P0IA 4C4OA 4KUGA 1AKYA 4GQAA 1LCIA 2HU5A 3GYHX 3BF7A 1RHKA 3INGA 4PC2A 4ZKEA 3DHYA 5JANA 1G5TA 4B4OA 2LD5A 2MH2A 2GPTA 2YWHA 5KREA 3WO1A 4QTYA 3Q7IA 1Y7HA 4GSKA 2JGDA 3L26A 1ZU4A 1TYAE 3I5XA 1AQYA 5F2OA 3LY7A 4KXWA 1SFRA 4U7DA 2D2FA 3NHZA 5AW1A 3BPXA 3L6BA 5K45A 3L84A 4IHJF 3JQBC 1U5CA 1ZQ9A 4I8IA 1TWAJ 3AM1A 3N2LA 3DEEA 4F9EA 4J6EA 1GA1A 1C3XA 1E1MA 5JH7A 2H4XA 4MB7A 3OZFA 3RROA 4PF1A 3OMLA 5EE5B 2JIMA 5EJ7A 1E0JA 1U90A 3WHIA 4C1BA 3NTXA 2VJNA 1YDHA 2ETVA 4EHHA 1HYHA 3FYUB 4C2BA 5CXSA 1DRWA 2C99A 3JYOA 3U1TA 3ZQ6A 1NNUC 3G8YA 1XCVA 4CCNA 4CI9A 2C20A 3CG4A 2RH4A 3PR1A 1JZQA 3R20A 2AF3C 2JMWA 4EITA 5AW2A 3RDIA 5J4LA 2QROA 3VJMA 3EDMA 2IYVA 3AI3A 4E0BA 1EVEA 3PGJA 4ON0A 1OU0A 3PVSA 4YRRA 2AEFA 2WFMA 1WXIA 3F5MA 1S2IA 4E94A 1U98A 3LBHA 3NHMA 4LC0A 3RKYA 3VSEA 3CHYA 4BJ6C 2B8WA 4F1IA 3FUWA 3V5NA 2YOGA 3PX7A 2VKTA 3E35A 3G9ZA 3C9PA 3BJZA 2O0YA 4RS4A 3OBIA 2L9NA 5I7UA 3RBZA 2EQRA 2CNLA 4J8PA 2O8EA 4J2TA 3E18A 2NPIA 5JVGF 4YUYA 1I39A 2HFJA 3IUNA 4IOKA 1OBVA 3RKSA 2DQSA 4GX0A 4OFWA 3SJMA 3C41J 4WRRA 1ACLA 1S5PA 2D45A 4Q3AA 5ARBA 3GROA 1EGQA 4PJJA 5FLXZ 4NMHA 3E9CA 1ZREA 3NDRA 4RC9A 1Y33E 3FFAA 2X51A 4ZZLA 1NQ5A 3TDKA 3MZ8A 2PV0A 3VR6H 4MR8B 2HXSA 3RSFA 3UWPA 3JRCA 1UIMA 4O8CA 3NWEA 3SKVA 2ZWPA 2R18A 1ZJ5A 3D5TA 3JVIA 3PRHA 3Q9VA 3KV1A 1RJEA 3TL2A 4OA8A 3T9CA 1XRLA 2IHUA 4LVNA 1G3YA 4KODA 3PSAA 4RKRA 1VECA 1IFXA 1W9MA 2PJPA 5FRMA 3ETNA 2WP8J 3PXGA 3CEMA 2WOOA 5BOXA 4ZJPA 5COAA 1I3CA 3REQB 2G9RA 4KQMA 2EK5A 3FOZA 1L5RA 2J9XB 1E6EA 3I8OA 1D2AA 1RC1A 3EFBA 3GLGE 1LI7A 3CX7A 3B52X 4YACA 1LTMA 3E48A 4C4PA 1RWQA 3D2CA 2FUKA 3ZMTA 3T4PA 3GGPA 3PVCA 4K0KB 2JFOA 3DDHA 4RESA 1DP7P 3ONVA 3MGCA 1WZNA 3E03A 4EZEA 4IJ5A 1R1DA 4U6SA 3KR2A 3WTUC 1F8YA 2CUEA 3GPLA 2XCIA 2P4QA 3RANA 1L5VA 2ZYVX 3QITA 3CU5A 3SASA 2AFHB 4DB2A 1J2TA 2WG0A 2H09A 2FRDA 4ZV9A 1Z35A 2EDAA 3M6FA 4LK2A 3CMMA 5FDFA 2WZBA 3FPCA 2CKMA 3BD6A 1A76A 2PLWA 5TPWB