3HGIA

Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
258
structure length
258
Chain Sequence
ERATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 69
structure length 258
sequence length 258
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hgiA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hgiA02
1TMXA 2BUYB 4WHRA 2BUWA 3LKTA 3PCHA 3N9TA 4WHSA 3HGIA 3HJSA 1YKOB 4WHPA 1EOBA 2XSRA 3MI5A 2BUMB 3MI1M 3MFLM 4WHRF 3TH1A 1EOCB 2BUQA 1YKLA 3PCBM 1DLQA 3PCKM 3PCFA 3MV6A 3I4VA 2XSUA 1EO9B 3HJQA 3PCJA 1YKMB 1YKNB 3PCLA 3PCNA 1YKPB 4WHQA 3LMXM 2BURA 3T67A 3T63M 3PCDA 1DLMA 2BV0A 3HHYA 4WHRB 3PCGM 3MV4M 3PCAA 1YKKA 2BUWB 2PCDM 4WHSB 1DMHA 3LKTM 3PCHM 1EOBB 2BUXA 3PCIA 3HKPA 2BUTA 5TD3A 2BUZA 2BUQB 4WHSD 1YKLB 2BUVA 1YKOA 3MI5M 3PCEA 4WHPD 4WHOA 2AZQA 3PCFM 3MV6M 3PCCA 3LXVM 2BUUA 1EO2A 3PCMA 3O6JA 3PCJM 1DLTA 4WHQB 1EOAA 2BURB 4ILTA 1YKNA 2BV0B 3T63A 1YKPA 2BUYA 1YKKB 4WHPB 3T67M 3PCDM 3MI1A 3MFLA 3PCAM 2BUXB 3PCKA 3PCBA 3I51A 2BUMA 2BUTB 1EOCA 2BUZB 2BUVB 3PCIM 2XSVA 4ILVA 1EO9A 3HHXA 4WHOB 3PCEM 1YKMA 2BOYA 3LMXA 3O32A 3PCLM 3PCNM 1S9AA 3LXVA 2BUUB 1EO2B 3O5UA 3O6RA 3PCCM 3PCGA 3MV4A 1EOAB 4WHOD 3HJ8A 3I4YA 3PCMM 2PCDA
chains in the Genus database with same CATH superfamily
3JR5A 3FKEA 4HLQA 3ZQJA 4LF5M 4K0KM 4MGKE 4WHRA 1NHWC 4G4RA 3SAUA 4QHSA 4KT0F 4WHSA 1NSFA 2O01F 3HGIA 1IQPA 3L29A 3HJSA 3SBJA 1XMOM 2XF3A 1XHBA 4OW0A 1GABA 2LTUA 2JP7A 4AG5A 2BUMB 1IN6A 4PDGA 1G3IA 2EA0A 2CV2A 4GHAA 4IIWA 4KHPM 1F4IA 4RKUF 4W5WA 3TH1A 1QAMA 4L8RC 2ZBKB 2C9OA 3CF0A 1DLQA 1IN8A 4RNAA 3T6PA 1WR1B 3L2AA 1IBKM 3IG8A 4X66M 1EO9B 3MHVC 2DAIA 3Q8XA 4QHTA 4G6ZA 4HL4A 4L78A 3PXGA 3SFZA 1AIPC 3UGJA 4FVMA 3PCJA 3U6DA 2DZNB 2QSFX 3AOEC 2FNAA 1OKSA 4LFAM 4I81A 5ITQA 1IBLM 1YKPB 3CF2A 3TPZA 3GLFB 3LMXM 3VK7A 3T67A 3IG5A 2HCBA 4MGYE 2F5SA 3M7GA 3ZC7B 3T63M 2DZLA 4QNMA 3GLGB 2XSZA 1ZMVA 3FUXA 3KS8A 1SG9A 3KOZE 1XXHA 2BUWB 2DAGA 2DENA 2PCDM 2R45A 3F92A 4AW4A 5ITYA 4CJ6A 3J7BA 4LF9M 1IN4A 5H37D 4LZJA 4JI0M 3FD9A 4L15A 2Z4RA 3U6PA 2UXDM 3LKTM 3GPUA 1EOBB 3PCHM 2BUXA 2BWEA 3FTCA 4M0DA 4DV3M 3B89A 4LJ4A 2ZAMA 1L1ZA 2V1UA 1NHGC 3LVWA 2QCUA 1Z59A 1C7YA 2RGOA 3FUVA 2O5RA 3I01M 4IBEA 5EXTA 3MI5M 2DKLA 1D0LA 1VEKA 1Z5BA 1Q39A 3C3DA 2DAMA 4X65M 3L28A 3LVVA 1OIPA 2LVAA 1N75A 3PCFM 3ZCBB 2D7HA 2WSEF 1IBMM 2ZTDA 2CWBA 3K1JA 4LGYA 2RRUA 1XMQM 3LXVM 1NNJA 2HAKA 4X62M 3LW5F 1T43A 2EKKA 4OX9M 4R71A 3AOGA 3D8BA 3RFWA 3HZJA 4AKGA 3FUUA 4NC6A 1IXSA 1GLNA 2DNAA 2MH8A 4ILTA 2V6ZM 1YKNA 2LH0A 1YSYA 2JXNA 1P3QQ 3LCUA 5JI2E 4G4OA 2BV0B 5DYIA 3C58A 3T63A 2YR0A 2Y0QA 1XC8A 2R0IA 5KPZA 4IBIA 4G4QA 5IWAM 3KOXE 3MI1A 2OPFA 2EO2A 1G41A 2VDBB 3BXWA 4P17A 4LRTA 1YUBA 2I7PA 4TUWA 3PCKA 1MX0A 3I51A 2BUMA 2DI0A 2R4EA 5EJCA 2KZSA 3V76A 3K9PA 4REZA 3SC3A 1NNUC 4FWDA 3B7ZA 2BUVB 2JY6B 1QDTA 1JR3D 1HT2E 3LQRA 4DR7M 4GC9A 3VFDA 1E9RA 1G71A 2FS1A 2G3QA 1N32M 1HNZM 4GKKM 1EO9A 2D7EA 4JI6M 3HHXA 1L2BA 2FFJA 5EP1A 4LF8M 3O32A 4LRSA 1J09A 4AI6A 3LXVA 3AOEA 3SATA 3GLFA 3C9PA 1R7RA 3HU3A 4JI8M 2BJWA 1L2DA 3PCCM 4WHOD 4FW9A 3TWLA 3I4YA 1RU3A 2MROB 2QP9X 4F1IA 3GLGA 2C9CA 4Z6YA 1TMXA 1IY1A 3LQQA 3U5ZB 2W82A 2K6BA 2BUWA 3DA1A 5KPRA 1LTMA 3TWMA 2Z4SA 3U60B 1E94E 1SXJE 5FTJA 4ITQA 2OO9A 3LCVB 4DR4M 2Y0TA 4LJ8A 4JI3M 3TE6A 2CHVA 4WHPA 1EOBA 1PJTA 4DV4M 4IJFA 5E26A 4IBCA 3I04M 4LJ9A 3RE8A 3T1HM 3OTOM 3A42A 1GVNA 4FCWA 1E32A 4DV0M 4CISA 2CP8A 1R5LA 3DZDA 3GRUA 4IBBA 4YY3M 5ITRA 2DWNA 3R9XB 2YQZA 4CGYB 1IFYA 2QPAA 3PVSA 1E9SA 4GMQA 3I4VA 1Z6TA 2OOAA 3AJIB 3B9PA 3SHGB 3K9OA 5ITUA 1OJLA 5FSWA 2EJSA 4I4LA 2LBCA 5C1BA 5EP3A 1MU5A 4Q7JA 1YKNB 8CATA 3J2PB 2XZUA 2JY5A 4DBGB 3L25A 1EE8A 3DFZA 1V34A 3H4MA 4G4NA 3VK8A 1KFVA 2KA6B 4NOOB 3NBXX 2Y21A 4BB9A 3E4RA 2ZM6M 1L1TA 1DLMA 4L6V6 2BV0A 3W67A 3MV4M 3PCAA 1KYIA 1OAOC 4B3RM 2R46A 2M5ZA 2LHCA 3QWLA 1SXJC 1Q02A 3RGSA 1VQ1A 2Z8YM 1R6BX 3MJ5A 1ORYB 1OIZA 3PCDA 2C96A 4MGIE 1IY0A 2CRUA 3FRHA 1GJSA 3PCIA 3KXEC 5LMNM 3KSJA 2CHQA 4DV6M 1A5TA 1VEJA 2BUQB 3KP0E 3C3EA 4WHSD 1TR8A 3GQ4A 4B7GA 4LG2A 1YKOA 2BUVA 2ZAOA 2FH0A 1QAQA 2XLJA 3PCEA 3HY5A 3J27B 1TDZA 1J7KA 3A45A 2JNHA 4FWHA 1D0MA 3B74A 1Q3BA 2F4VM 3J80S 2AZQA 3U6CA 1VG5A 2L09A 2EUCA 2VQEM 2C98A 2J7OA 4CHTB 1N33M 1HNWM 3TL4X 3W0LB 3O6JA 1KSFX 3GPYA 2J5YA 4JI1M 1C1KA 1GO5A 4OU7A 3T15A 1XB2B 1N36M 2KRKA 5C18A 3HWSA 5ITXE 3HU2A 1W5SA 1OFIA 2L7HA 3UZUA 1BVSA 1CUKA 3U5ZA 1YKKB 4WHPB 1ZMWA 4D80A 3K92A 3U60A 2JZ0A 2CUZA 4DR1M 4AZFA 1MN3A 3WHKA 1R2ZA 1UFZA 4AKIA 2XSZD 3GO8A 4B3SM 2QZ4A 1J5EM 2XEPA 3AFHA 2UU9M 3RGPA 4II7A 1NVMA 4DV5M 3A98B 1PJIA 4NL4H 4JI5M 3GRRA 4QOSA 1WHCA 2G8LA 2Z7JA 4B3TM 4ILVA 4AG6A 4NXNM 1EFUB 3U6LA 2CHGA 2KNAA 1L2CA 5E6JA 3GRVA 4DV7M 1V92A 3LMXA 4R7GA 1S9AA 3U6QA 2X8AA 1VEGA 1G8PA 1T6OA 3M6AA 4RF1A 3O5UA 1ZV1A 3CTWB 2RGHA 4LF6M 1EOAB 2QENA 3CF6E 3NBIA 5GKNA 1V33A 4WW0A 3PCMM 2PCDA 1Q3CA 2H5XA 2BUYB 1NY6A 2VF8A 5EP4A 3LKTA 3PCHA 3GLHE 3N9TA 1T3TA 2KNVA 2R6FA 3SAVA 2J7NA 2DWLA 2Q2EB 1SXJA 3EIEA 4IJEA 2BJVA 1YKOB 1FJGM 2DWMA 2LHGA 4LF7M 3MI5A 3MFLM 4XBOA 3PNYA 2MJ5B 4P16A 3VKGA 4DR5M 3E21A 1WXQA 2JWSA 2QQ8A 2HHHM 1EOCB 1DGHB 3L27A 2BUQA 3ZH9B 1OAIA 3PCBM 3KSXA 1NO1A 3PCFA 2KW0A 2FOIC 5FTLA 2ZTCA 1QUTA 3HJQA 1K82A 1XNQM 4JI4M 3B7NA 4MGZE 1WJ7A 4AQYM 1HR0M 1YKMB 5A2QS 1QQWA 4B08A 1OFHA 4YHHM 1IN5A 1D2NA 2QHOB 2R18A 3J81S 1QZMA 2C5RA 1IXZA 2KNZA 4Y28F 4GHLA 1IY2A 1FNNA 4LFBM 2HKJA 4A3VB 3T1YM 1NY5A 2NQ8C 2QBYB 1ZAEA 3HHYA 4DUYM 4GKJM 4MGHA 5FTMA 3MMPA 3PCGM 3W0FA 1YKKA 1G59A 2UUBM 4DR6M 1TF0B 2L7IA 2LWXA 4PDIA 1JR3E 4LGMA 2XZFA 2UUAM 1HQYE 3SMSA 1DMHA 3GLIE 4LJAA 3THGA 1DGBA 2XGNA 4OVZB 2UXCM 2VIIA 2LVQD 3PFIA 3HX3A 2ERCA 4BBAA 1DGGA 1IM2A 3IECA 3H4JA 4QNRA 4XK8F 1VDDA 3JR4A 1YKLB 3SAWA 5EXPA 3U6OA 2ZANA 4JI7M 1GJTA 4WHPD 1QZEA 4PT5A 4IBKA 2DWZB 3SMPA 2VF7A 5FLXS 3UJNA 1XWIA 2JY7A 2CEAA 2WZJA 4DR2M 3PCCA 3KS4A 5DFLA 1QVRA 2XH9A 1IN7A 5FTNA 3L26A 3PCJM 4WHQB 4BLCA 1EOAA 4NRWA 4PCZA 4M9ZA 4HEOA 4RF0A 4X64M 2BURB 1PJSA 2R62A 4AKHA 3GP1A 2KZUA 3WHLA 4LZZA 3SYLA 2BUYA 1SXJB 4I5SA 4GH9A 3SARA 3T67M 3E9SA 2K9DA 5ITXA 4M0WA 3U61B 1WIVA 2WSFF 5BPVA 4GITA 1PJJA 3K2LA 5IT9S 5EXXA 2JZ1A 3AV0A 3M0EA 1GKIA 2R4JA 4GIPA 2DVWB 3GLIB 3FUWA 1H6UA 1WGNA 3U6EA 2Y20A 2YNMD 2DAEA 4JXJA 5BR8M 1D0KA 1EOCA 2BUTB 3GPXA 2KXEA 3BOSA 1DGHA 2HWJA 2BUZB 4GC5A 4M9SA 4MH0E 3KDSE 2F5PA 3VKHA 2LVPC 2XSVA 2L6OA 2XFSA 3E46A 4ZPXA 2Z3XA 3HHZA 2OQ4A 3MV6M 2APLA 2CFOA 4B7FA 1TH2A 4FCVA 4IBGA 2KRUA 4WP2A 5DYGA 4JYAM 2CV1A 1TH3A 4G3OA 2F5QA 1YKMA 3JAMS 3PCLM 4GEWA 2AHMA 5DNYA 3SHFA 3PCNM 4I8OA 1TTEA 4MB7A 1Z5AA 1EO2B 2BUUB 3AL0C 4Z8XA 4DUZM 1Y8GA 2K47A 4R3DA 3UK6A 3MV4A 2QNJA 1WGLA 1DO0A 2QBYA 2JA2A 2GQFA 1XNRM 3HHWA 4M9XA 5IREB 5JI3E 2I7NA 4GRIA 5KPTA 5KO3A 5KQDA 1TDHA 2GNOA 2LNHC 4D81A 1NJFA 3GQ5A 1YLAA 4NSOB 2VQFM 3KOWE 1L8QA 2OOBA 3GLHA 3QYBA 1G4AE 1ZMUA 4OVZA 1N34M 5EP2A 2JY8A 1QAOA 2A5YB 3ILKA 3T38A 2XSRA 4XGIA 3B7QA 3R8FA 3MI1M 2R65A 4WHRF 3AKZA 2FE8A 2LVOC 4DR3M 2E5LM 2WSCF 3QAUA 3EIHA 1YKLA 1OQYA 1GL6A 1JQJC 2X4AA 3PCKM 2BWBA 3MV6A 2EKFA 2XSUA 4MM3B 1DV0A 1W5TA 2G5GX 1HQCA 1NV8A 5L8RF 1GL7A 2MR9A 5EQTA 1QUSA 1DGFA 2LXEA 2P5TA 2O25A 3VLFB 1IXRC 3PCLA 3PCNA 4CIZA 1EIJA 2CE7A 4WHQA 3BBZA 3CGWA 3KP1E 4LCBA 4JI2M 2BURA 3GQ3A 3KVWA 2UXBM 1XXHE 4LJ5A 4IBFA 4NRVA 5F3WA 4WHRB 1PJQA 1JB0F 1PRBA 3U61A 3GPPA 1R4GA 2YFQA 3J7AS 1HJPA 3K8ZA 4D82A 5ITTA 1I94M 4WHSB 4DV2M 3VDUA 2R44A 2H1RA 4KLNA 3QYEA 1JR3A 1YE9A 2LVNC 4LJ7A 3SYKA 4ANRA 4B3MM 3FTEA 4WHOB 3GLIA 4JN6A 1K3XA 2L4FA 3U6SA 3HKPA 1TGUA 1X37A 3FYDA 3FRIA 4NSRA 3FTFA 2BUTA 2BUZA 5TD3A 4KO8A 4IBJA 1SXJD 5EXSA 1R2YA 2UUCM 2DHYA 1QYRA 3W68A 3A46A 2M60A 5KQ8A 4WHOA 2XFTA 2L2DA 4FCTA 2F5OA 2KDLA 4UN2B 4L16A 1HNXM 2BUUA 1EO2A 3PCMA 4IBDA 4PD2A 3KFUG 3Q8GA 1DLTA 1VDLA 2B3TA 2DHRA 1DO2A 2RKOA 4FD2A 4NXMM 1NJGA 4LY6A 1Z5CA 2KEBA 2D7GA 3GLHB 3PNVA 1YKPA 1UM8A 1OTRA 2DZOB 2DAKA 3FUTA 1XXHB 3GRYA 4FWGA 4KODA 5IZ7D 4LF4M 3PCDM 4DV1M 1AUAA 3FTDA 3NWLA 3MFLA 2N35A 3DOAA 3HU1A 3PCAM 1I4WA 4B7HA 3VDPA 2MGWA 2V1CA 4WURA 2BUXB 3PCBA 1ZQ9A 2BNKA 2L4EA 3SASA 2C99A 1N78A 1K3WA 3TQSA 4LFCM 1N77A 3PCIM 4L4UA 2F5NA 1NV9A 2K0BX 1PM5A 1TH4A 2HL7A 1LV7A 1MJGM 4LJ6A 5FTKA 3FYCA 3IHPA 3U6MA 3D8LA 3KW6A 5LMUM 1S3SA 2CV0A 4QOZC 3PCEM 2BOYA 2KHHA 1HT1E 1QDRA 2DXIA 2X49A 3GLFE 4S12A 3MK6A 4JV5M 2JUJA 3LMMA 3FE3A 3TWKA 7CATA 1PGYA 3KOYE 3O6RA 3GLGE 3PCGA 1IXSB 3HJ8A 4F2LA 4EIWA 3UMMA 1QANA
chains in the Genus database with same CATH topology
3JR5A 3FKEA 4HLQA 4LF5M 4K0KM 4MGKE 4WHRA 1NHWC 4G4RA 3SAUA 4QHSA 4WHSA 1NSFA 3HGIA 1IQPA 3L29A 3HJSA 3SBJA 1XMOM 2XF3A 1XHBA 4OW0A 4AG5A 2BUMB 1IN6A 4PDGA 1G3IA 2EA0A 2CV2A 4GHAA 4IIWA 4KHPM 4W5WA 3TH1A 1QAMA 4L8RC 2ZBKB 2C9OA 3CF0A 1DLQA 1IN8A 4RNAA 3L2AA 1IBKM 3IG8A 4X66M 1EO9B 3MHVC 3Q8XA 3PXGA 4QHTA 4G6ZA 4HL4A 4L78A 3SFZA 2ZM6M 3PCJA 3UGJA 4FVMA 3U6DA 2DZNB 3AOEC 2FNAA 4LFAM 4I81A 5ITQA 1IBLM 1YKPB 3CF2A 3TPZA 3GLFB 3LMXM 3VK7A 3T67A 3IG5A 2HCBA 4MGYE 2F5SA 3M7GA 3ZC7B 3T63M 4QNMA 3GLGB 2XSZA 3FUXA 3KS8A 3KOZE 1XXHA 2BUWB 2PCDM 2R45A 4AW4A 5ITYA 3J7BA 4LF9M 1IN4A 5H37D 4LZJA 4JI0M 3FD9A 4L15A 2Z4RA 3U6PA 2UXDM 3LKTM 3GPUA 1EOBB 3PCHM 2BUXA 3FTCA 4M0DA 4DV3M 4LJ4A 2ZAMA 1L1ZA 2V1UA 1NHGC 3LVWA 2QCUA 1Z59A 2RGOA 3FUVA 2O5RA 4IBEA 5EXTA 3MI5M 1Z5BA 4X65M 1Q39A 3L28A 3LVVA 1N75A 3PCFM 3ZCBB 2D7HA 1IBMM 3K1JA 4LGYA 1XMQM 3LXVM 1NNJA 4X62M 4OX9M 3AOGA 3D8BA 3RFWA 4AKGA 3FUUA 1GLNA 4ILTA 2V6ZM 1YKNA 2LH0A 1YSYA 5JI2E 4G4OA 2BV0B 3T63A 5DYIA 3C58A 2YR0A 2Y0QA 1XC8A 5KPZA 4IBIA 4G4QA 5IWAM 3KOXE 3MI1A 2OPFA 2EO2A 1G41A 4LRTA 1YUBA 2I7PA 4TUWA 3PCKA 1MX0A 3I51A 2BUMA 2R4EA 5EJCA 2KZSA 4REZA 3SC3A 1NNUC 4FWDA 2BUVB 1JR3D 1HT2E 3LQRA 4DR7M 4GC9A 3VFDA 1E9RA 1N32M 1HNZM 4GKKM 1EO9A 2D7EA 4JI6M 3HHXA 1L2BA 2FFJA 5EP1A 4LF8M 3O32A 4LRSA 1J09A 4AI6A 3LXVA 3AOEA 3SATA 3GLFA 4JI8M 1R7RA 3HU3A 3PCCM 2BJWA 1L2DA 4WHOD 4FW9A 3TWLA 3I4YA 3GLGA 2QP9X 2C9CA 4Z6YA 1TMXA 1IY1A 3LQQA 3U5ZB 2W82A 2BUWA 3DA1A 5KPRA 3TWMA 2Z4SA 3U60B 1E94E 1SXJE 5FTJA 4ITQA 4DR4M 2Y0TA 4LJ8A 4JI3M 3TE6A 2CHVA 4WHPA 1EOBA 4DV4M 4IJFA 5E26A 4IBCA 4LJ9A 3RE8A 3T1HM 3OTOM 3A42A 1GVNA 4FCWA 1E32A 4DV0M 4CISA 3DZDA 4IBBA 3GRUA 4YY3M 5ITRA 2DWNA 3R9XB 2YQZA 4CGYB 2QPAA 3PVSA 1E9SA 4GMQA 3I4VA 1Z6TA 3B9PA 3AJIB 3SHGB 5ITUA 1OJLA 5FSWA 4I4LA 5C1BA 5EP3A 1MU5A 1YKNB 8CATA 3J2PB 2XZUA 3L25A 1EE8A 3DFZA 3H4MA 4G4NA 3VK8A 1KFVA 2KA6B 4NOOB 1L1TA 2Y21A 4BB9A 3E4RA 1DLMA 2BV0A 3PCDA 3MV4M 3PCAA 1KYIA 4B3RM 2R46A 2M5ZA 3QWLA 1SXJC 3RGSA 1R6BX 3MJ5A 1ORYB 2C96A 4MGIE 1IY0A 3PCIA 3KXEC 5LMNM 3KSJA 2CHQA 4DV6M 2BUQB 4WHSD 3KP0E 1YKOA 3GQ4A 4B7GA 4LG2A 2BUVA 2ZAOA 3PCEA 1QAQA 2XLJA 3J27B 1TDZA 1J7KA 3A45A 4FWHA 2AZQA 3MV6M 1Q3BA 2F4VM 3J80S 3U6CA 2L09A 2VQEM 2EUCA 2C98A 2J7OA 4CHTB 1N33M 1HNWM 3TL4X 3W0LB 3O6JA 1KSFX 3GPYA 4JI1M 1C1KA 4OU7A 3T15A 1N36M 2KRKA 5C18A 3HWSA 5ITXE 3HU2A 1W5SA 1OFIA 2L7HA 3UZUA 3U5ZA 1YKKB 4WHPB 4D80A 3K92A 3U60A 2CUZA 4DR1M 4AZFA 3WHKA 1R2ZA 4AKIA 2XSZD 3GO8A 4B3SM 2QZ4A 1J5EM 2XEPA 3AFHA 2UU9M 3RGPA 4II7A 1NVMA 4DV5M 3A98B 1PJIA 4NL4H 4JI5M 3GRRA 4QOSA 2G8LA 2Z7JA 4B3TM 4ILVA 4AG6A 4NXNM 3U6LA 2CHGA 1L2CA 5E6JA 3GRVA 4DV7M 3LMXA 4R7GA 1S9AA 3U6QA 2X8AA 1G8PA 3M6AA 4RF1A 3O5UA 3CTWB 2RGHA 4LF6M 1EOAB 2QENA 3CF6E 3NBIA 5GKNA 4WW0A 3PCMM 2PCDA 1Q3CA 2BUYB 1NY6A 5EP4A 3LKTA 3PCHA 3N9TA 1T3TA 3SAVA 2J7NA 2DWLA 2Q2EB 1SXJA 3EIEA 4IJEA 2BJVA 1YKOB 1FJGM 2DWMA 4LF7M 3MI5A 3MFLM 4XBOA 3PNYA 4P16A 3VKGA 4DR5M 1EOCB 1WXQA 2HHHM 2BUQA 1DGHB 3L27A 3PCBM 3ZH9B 3KSXA 3PCFA 2KW0A 2FOIC 5FTLA 3HJQA 1K82A 1XNQM 4JI4M 4MGZE 4AQYM 1HR0M 1YKMB 5A2QS 1QQWA 4B08A 1OFHA 4YHHM 1IN5A 1D2NA 2R18A 3J81S 1QZMA 2C5RA 1IXZA 4GHLA 1IY2A 1FNNA 4LFBM 2HKJA 4A3VB 3T1YM 1NY5A 2NQ8C 2QBYB 1ZAEA 3HHYA 4DUYM 4GKJM 4MGHA 5FTMA 3PCGM 3W0FA 1YKKA 1G59A 2UUBM 4DR6M 2L7IA 2LWXA 4PDIA 2XZFA 4LGMA 2UUAM 1HQYE 3SMSA 1DMHA 4LJAA 3THGA 1DGBA 2XGNA 4OVZB 2UXCM 2VIIA 3PFIA 2ERCA 4BBAA 1DGGA 1IM2A 4QNRA 1VDDA 3JR4A 1YKLB 3SAWA 5EXPA 3U6OA 2ZANA 4JI7M 4WHPD 4PT5A 4IBKA 2DWZB 3SMPA 5FLXS 3UJNA 1XWIA 2CEAA 4DR2M 3PCCA 3KS4A 1QVRA 2XH9A 1IN7A 5FTNA 3L26A 3PCJM 4WHQB 4BLCA 1EOAA 4NRWA 4PCZA 4M9ZA 4X64M 4RF0A 2BURB 2R62A 4AKHA 3GP1A 2KZUA 3WHLA 4LZZA 3SYLA 2BUYA 1SXJB 4I5SA 4GH9A 3SARA 3T67M 3E9SA 5ITXA 4M0WA 3U61B 1PJJA 5BPVA 4GITA 3K2LA 5IT9S 5EXXA 3AV0A 3M0EA 1GKIA 2R4JA 4GIPA 2DVWB 3GLIB 3FUWA 1H6UA 3U6EA 2Y20A 2YNMD 4JXJA 5BR8M 1EOCA 2BUTB 2BUZB 3GPXA 2KXEA 3BOSA 1DGHA 4GC5A 4M9SA 4MH0E 3KDSE 2F5PA 3VKHA 2XSVA 2L6OA 2XFSA 2Z3XA 4ZPXA 3HHZA 2OQ4A 2CFOA 4B7FA 1TH2A 4FCVA 4IBGA 2KRUA 5DYGA 4JYAM 4WHOB 2CV1A 1TH3A 2F5QA 1YKMA 3JAMS 3PCLM 5DNYA 2AHMA 3PCNM 3SHFA 4I8OA 4MB7A 1Z5AA 1EO2B 2BUUB 3AL0C 4Z8XA 4DUZM 4R3DA 2K47A 3UK6A 3MV4A 1DO0A 2QBYA 2JA2A 1XNRM 3HHWA 4M9XA 5IREB 5JI3E 2I7NA 4GRIA 5KPTA 5KO3A 5KQDA 1TDHA 4D81A 2LNHC 1NJFA 2VQFM 4NSOB 3KOWE 1L8QA 3GLHA 1G4AE 4OVZA 1N34M 5EP2A 1QAOA 2A5YB 3ILKA 3T38A 2XSRA 4XGIA 3R8FA 3MI1M 2R65A 4WHRF 3AKZA 2FE8A 2E5LM 4DR3M 3QAUA 3EIHA 1YKLA 1GL6A 1JQJC 2X4AA 3PCKM 3MV6A 2XSUA 4MM3B 1W5TA 2G5GX 1HQCA 1GL7A 5EQTA 2LXEA 1DGFA 2P5TA 3VLFB 1IXRC 3PCLA 3PCNA 2CE7A 4WHQA 3KP1E 4LCBA 4JI2M 2BURA 3GQ3A 3KVWA 2UXBM 4LJ5A 4IBFA 4NRVA 5F3WA 4WHRB 3U61A 3GPPA 2YFQA 3J7AS 3K8ZA 5ITTA 4D82A 1I94M 4WHSB 4DV2M 3VDUA 2H1RA 4KLNA 4B3MM 1JR3A 1YE9A 4LJ7A 3SYKA 3FTEA 3GLIA 4JN6A 1K3XA 3U6SA 3HKPA 1TGUA 1X37A 3FYDA 4NSRA 3FTFA 2BUTA 2BUZA 5TD3A 4KO8A 4IBJA 1SXJD 5EXSA 1R2YA 2UUCM 1QYRA 3A46A 2M60A 5KQ8A 4WHOA 2XFTA 4FCTA 2F5OA 4L16A 1HNXM 2BUUA 1EO2A 3PCMA 4IBDA 4PD2A 3KFUG 1DLTA 2DHRA 1DO2A 2RKOA 4FD2A 4NXMM 1NJGA 4LY6A 1Z5CA 2KEBA 2D7GA 3GLHB 3PNVA 1YKPA 1UM8A 2DZOB 3FUTA 3GRYA 4KODA 1XXHB 4FWGA 3GQ5A 4LF4M 5IZ7D 3PCDM 4DV1M 3FTDA 3NWLA 3MFLA 3DOAA 3HU1A 3PCAM 1I4WA 4B7HA 3VDPA 2V1CA 4WURA 2BUXB 3PCBA 1ZQ9A 2BNKA 3SASA 2C99A 1N78A 1K3WA 3TQSA 4LFCM 1N77A 3PCIM 4L4UA 2F5NA 1PM5A 1TH4A 2HL7A 1LV7A 4LJ6A 5FTKA 3FYCA 3U6MA 3D8LA 3KW6A 5LMUM 1S3SA 2CV0A 4QOZC 3PCEM 2BOYA 1HT1E 2DXIA 2X49A 4S12A 3MK6A 4JV5M 3LMMA 3TWKA 7CATA 3KOYE 3O6RA 3PCGA 1IXSB 3HJ8A 4EIWA 3UMMA 1QANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TMX A;  2BUY B;  4WHR A;  2BUW A;  3LKT A;  3PCH A;  3N9T A;  4WHS A;  3HGI A;  3HJS A;  1YKO B;  4WHP A;  1EOB A;  2XSR A;  3MI5 A;  2BUM B;  3MI1 M;  3MFL M;  4WHR F;  3TH1 A;  1EOC B;  2BUQ A;  1YKL A;  3PCB M;  1DLQ A;  3PCK M;  3PCF A;  3MV6 A;  3I4V A;  2XSU A;  1EO9 B;  3HJQ A;  3PCJ A;  1YKM B;  1YKN B;  3PCL A;  3PCN A;  1YKP B;  4WHQ A;  3LMX M;  2BUR A;  3T67 A;  3T63 M;  3PCD A;  1DLM A;  2BV0 A;  3HHY A;  4WHR B;  3PCG M;  3MV4 M;  3PCA A;  1YKK A;  2BUW B;  2PCD M;  4WHS B;  1DMH A;  3LKT M;  3PCH M;  1EOB B;  2BUX A;  3PCI A;  3HKP A;  2BUT A;  5TD3 A;  2BUZ A;  2BUQ B;  4WHS D;  1YKL B;  2BUV A;  1YKO A;  3MI5 M;  3PCE A;  4WHP D;  4WHO A;  2AZQ A;  3PCF M;  3MV6 M;  3PCC A;  3LXV M;  2BUU A;  1EO2 A;  3PCM A;  3O6J A;  3PCJ M;  1DLT A;  4WHQ B;  1EOA A;  2BUR B;  4ILT A;  1YKN A;  2BV0 B;  3T63 A;  1YKP A;  2BUY A;  1YKK B;  4WHP B;  3T67 M;  3PCD M;  3MI1 A;  3MFL A;  3PCA M;  2BUX B;  3PCK A;  3PCB A;  3I51 A;  2BUM A;  2BUT B;  1EOC A;  2BUZ B;  2BUV B;  3PCI M;  2XSV A;  4ILV A;  1EO9 A;  3HHX A;  4WHO B;  3PCE M;  1YKM A;  2BOY A;  3LMX A;  3O32 A;  3PCL M;  3PCN M;  1S9A A;  3LXV A;  2BUU B;  1EO2 B;  3O5U A;  3O6R A;  3PCC M;  3PCG A;  3MV4 A;  1EOA B;  4WHO D;  3HJ8 A;  3I4Y A;  3PCM M;  2PCD A; 
#chains in the Genus database with same CATH topology
 3JR5 A;  3FKE A;  4HLQ A;  3ZQJ A;  4LF5 M;  4K0K M;  4MGK E;  4WHR A;  1NHW C;  4G4R A;  3SAU A;  4QHS A;  4KT0 F;  4WHS A;  1NSF A;  2O01 F;  3HGI A;  1IQP A;  3L29 A;  3HJS A;  3SBJ A;  1XMO M;  2XF3 A;  1XHB A;  4OW0 A;  1GAB A;  2LTU A;  2JP7 A;  4AG5 A;  2BUM B;  1IN6 A;  4PDG A;  1G3I A;  2EA0 A;  2CV2 A;  4GHA A;  4IIW A;  4KHP M;  1F4I A;  4RKU F;  4W5W A;  3TH1 A;  1QAM A;  4L8R C;  2ZBK B;  2C9O A;  3CF0 A;  1DLQ A;  1IN8 A;  4RNA A;  3T6P A;  1WR1 B;  3L2A A;  1IBK M;  3IG8 A;  4X66 M;  1EO9 B;  3MHV C;  2DAI A;  3Q8X A;  4QHT A;  4G6Z A;  4HL4 A;  4L78 A;  3PXG A;  3SFZ A;  1AIP C;  3UGJ A;  4FVM A;  3PCJ A;  3U6D A;  2DZN B;  2QSF X;  3AOE C;  2FNA A;  1OKS A;  4LFA M;  4I81 A;  5ITQ A;  1IBL M;  1YKP B;  3CF2 A;  3TPZ A;  3GLF B;  3LMX M;  3VK7 A;  3T67 A;  3IG5 A;  2HCB A;  4MGY E;  2F5S A;  3M7G A;  3ZC7 B;  3T63 M;  2DZL A;  4QNM A;  3GLG B;  2XSZ A;  1ZMV A;  3FUX A;  3KS8 A;  1SG9 A;  3KOZ E;  1XXH A;  2BUW B;  2DAG A;  2DEN A;  2PCD M;  2R45 A;  3F92 A;  4AW4 A;  5ITY A;  4CJ6 A;  3J7B A;  4LF9 M;  1IN4 A;  5H37 D;  4LZJ A;  4JI0 M;  3FD9 A;  4L15 A;  2Z4R A;  3U6P A;  2UXD M;  3LKT M;  3GPU A;  1EOB B;  3PCH M;  2BUX A;  2BWE A;  3FTC A;  4M0D A;  4DV3 M;  3B89 A;  4LJ4 A;  2ZAM A;  1L1Z A;  2V1U A;  1NHG C;  3LVW A;  2QCU A;  1Z59 A;  1C7Y A;  2RGO A;  3FUV A;  2O5R A;  3I01 M;  4IBE A;  5EXT A;  3MI5 M;  2DKL A;  1D0L A;  1VEK A;  1Z5B A;  1Q39 A;  3C3D A;  2DAM A;  4X65 M;  3L28 A;  3LVV A;  1OIP A;  2LVA A;  1N75 A;  3PCF M;  3ZCB B;  2D7H A;  2WSE F;  1IBM M;  2ZTD A;  2CWB A;  3K1J A;  4LGY A;  2RRU A;  1XMQ M;  3LXV M;  1NNJ A;  2HAK A;  4X62 M;  3LW5 F;  1T43 A;  2EKK A;  4OX9 M;  4R71 A;  3AOG A;  3D8B A;  3RFW A;  3HZJ A;  4AKG A;  3FUU A;  4NC6 A;  1IXS A;  1GLN A;  2DNA A;  2MH8 A;  4ILT A;  2V6Z M;  1YKN A;  2LH0 A;  1YSY A;  2JXN A;  1P3Q Q;  3LCU A;  5JI2 E;  4G4O A;  2BV0 B;  5DYI A;  3C58 A;  3T63 A;  2YR0 A;  2Y0Q A;  1XC8 A;  2R0I A;  5KPZ A;  4IBI A;  4G4Q A;  5IWA M;  3KOX E;  3MI1 A;  2OPF A;  2EO2 A;  1G41 A;  2VDB B;  3BXW A;  4P17 A;  4LRT A;  1YUB A;  2I7P A;  4TUW A;  3PCK A;  1MX0 A;  3I51 A;  2BUM A;  2DI0 A;  2R4E A;  5EJC A;  2KZS A;  3V76 A;  3K9P A;  4REZ A;  3SC3 A;  1NNU C;  4FWD A;  3B7Z A;  2BUV B;  2JY6 B;  1QDT A;  1JR3 D;  1HT2 E;  3LQR A;  4DR7 M;  4GC9 A;  3VFD A;  1E9R A;  1G71 A;  2FS1 A;  2G3Q A;  1N32 M;  1HNZ M;  4GKK M;  1EO9 A;  2D7E A;  4JI6 M;  3HHX A;  1L2B A;  2FFJ A;  5EP1 A;  4LF8 M;  3O32 A;  4LRS A;  1J09 A;  4AI6 A;  3LXV A;  3AOE A;  3SAT A;  3GLF A;  3C9P A;  1R7R A;  3HU3 A;  4JI8 M;  2BJW A;  1L2D A;  3PCC M;  4WHO D;  4FW9 A;  3TWL A;  3I4Y A;  1RU3 A;  2MRO B;  2QP9 X;  4F1I A;  3GLG A;  2C9C A;  4Z6Y A;  1TMX A;  1IY1 A;  3LQQ A;  3U5Z B;  2W82 A;  2K6B A;  2BUW A;  3DA1 A;  5KPR A;  1LTM A;  3TWM A;  2Z4S A;  3U60 B;  1E94 E;  1SXJ E;  5FTJ A;  4ITQ A;  2OO9 A;  3LCV B;  4DR4 M;  2Y0T A;  4LJ8 A;  4JI3 M;  3TE6 A;  2CHV A;  4WHP A;  1EOB A;  1PJT A;  4DV4 M;  4IJF A;  5E26 A;  4IBC A;  3I04 M;  4LJ9 A;  3RE8 A;  3T1H M;  3OTO M;  3A42 A;  1GVN A;  4FCW A;  1E32 A;  4DV0 M;  4CIS A;  2CP8 A;  1R5L A;  3DZD A;  3GRU A;  4IBB A;  4YY3 M;  5ITR A;  2DWN A;  3R9X B;  2YQZ A;  4CGY B;  1IFY A;  2QPA A;  3PVS A;  1E9S A;  4GMQ A;  3I4V A;  1Z6T A;  2OOA A;  3AJI B;  3B9P A;  3SHG B;  3K9O A;  5ITU A;  1OJL A;  5FSW A;  2EJS A;  4I4L A;  2LBC A;  5C1B A;  5EP3 A;  1MU5 A;  4Q7J A;  1YKN B;  8CAT A;  3J2P B;  2XZU A;  2JY5 A;  4DBG B;  3L25 A;  1EE8 A;  3DFZ A;  1V34 A;  3H4M A;  4G4N A;  3VK8 A;  1KFV A;  2KA6 B;  4NOO B;  3NBX X;  2Y21 A;  4BB9 A;  3E4R A;  2ZM6 M;  1L1T A;  1DLM A;  4L6V 6;  2BV0 A;  3W67 A;  3MV4 M;  3PCA A;  1KYI A;  1OAO C;  4B3R M;  2R46 A;  2M5Z A;  2LHC A;  3QWL A;  1SXJ C;  1Q02 A;  3RGS A;  1VQ1 A;  2Z8Y M;  1R6B X;  3MJ5 A;  1ORY B;  1OIZ A;  3PCD A;  2C96 A;  4MGI E;  1IY0 A;  2CRU A;  3FRH A;  1GJS A;  3PCI A;  3KXE C;  5LMN M;  3KSJ A;  2CHQ A;  4DV6 M;  1A5T A;  1VEJ A;  2BUQ B;  3KP0 E;  3C3E A;  4WHS D;  1TR8 A;  3GQ4 A;  4B7G A;  4LG2 A;  1YKO A;  2BUV A;  2ZAO A;  2FH0 A;  1QAQ A;  2XLJ A;  3PCE A;  3HY5 A;  3J27 B;  1TDZ A;  1J7K A;  3A45 A;  2JNH A;  4FWH A;  1D0M A;  3B74 A;  1Q3B A;  2F4V M;  3J80 S;  2AZQ A;  3U6C A;  1VG5 A;  2L09 A;  2EUC A;  2VQE M;  2C98 A;  2J7O A;  4CHT B;  1N33 M;  1HNW M;  3TL4 X;  3W0L B;  3O6J A;  1KSF X;  3GPY A;  2J5Y A;  4JI1 M;  1C1K A;  1GO5 A;  4OU7 A;  3T15 A;  1XB2 B;  1N36 M;  2KRK A;  5C18 A;  3HWS A;  5ITX E;  3HU2 A;  1W5S A;  1OFI A;  2L7H A;  3UZU A;  1BVS A;  1CUK A;  3U5Z A;  1YKK B;  4WHP B;  1ZMW A;  4D80 A;  3K92 A;  3U60 A;  2JZ0 A;  2CUZ A;  4DR1 M;  4AZF A;  1MN3 A;  3WHK A;  1R2Z A;  1UFZ A;  4AKI A;  2XSZ D;  3GO8 A;  4B3S M;  2QZ4 A;  1J5E M;  2XEP A;  3AFH A;  2UU9 M;  3RGP A;  4II7 A;  1NVM A;  4DV5 M;  3A98 B;  1PJI A;  4NL4 H;  4JI5 M;  3GRR A;  4QOS A;  1WHC A;  2G8L A;  2Z7J A;  4B3T M;  4ILV A;  4AG6 A;  4NXN M;  1EFU B;  3U6L A;  2CHG A;  2KNA A;  1L2C A;  5E6J A;  3GRV A;  4DV7 M;  1V92 A;  3LMX A;  4R7G A;  1S9A A;  3U6Q A;  2X8A A;  1VEG A;  1G8P A;  1T6O A;  3M6A A;  4RF1 A;  3O5U A;  1ZV1 A;  3CTW B;  2RGH A;  4LF6 M;  1EOA B;  2QEN A;  3CF6 E;  3NBI A;  5GKN A;  1V33 A;  4WW0 A;  3PCM M;  2PCD A;  1Q3C A;  2H5X A;  2BUY B;  1NY6 A;  2VF8 A;  5EP4 A;  3LKT A;  3PCH A;  3GLH E;  3N9T A;  1T3T A;  2KNV A;  2R6F A;  3SAV A;  2J7N A;  2DWL A;  2Q2E B;  1SXJ A;  3EIE A;  4IJE A;  2BJV A;  1YKO B;  1FJG M;  2DWM A;  2LHG A;  4LF7 M;  3MI5 A;  3MFL M;  4XBO A;  3PNY A;  2MJ5 B;  4P16 A;  3VKG A;  4DR5 M;  3E21 A;  1WXQ A;  2JWS A;  2QQ8 A;  2HHH M;  1EOC B;  1DGH B;  3L27 A;  2BUQ A;  3ZH9 B;  1OAI A;  3PCB M;  3KSX A;  1NO1 A;  3PCF A;  2KW0 A;  2FOI C;  5FTL A;  2ZTC A;  1QUT A;  3HJQ A;  1K82 A;  1XNQ M;  4JI4 M;  3B7N A;  4MGZ E;  1WJ7 A;  4AQY M;  1HR0 M;  1YKM B;  5A2Q S;  1QQW A;  4B08 A;  1OFH A;  4YHH M;  1IN5 A;  1D2N A;  2QHO B;  2R18 A;  3J81 S;  1QZM A;  2C5R A;  1IXZ A;  2KNZ A;  4Y28 F;  4GHL A;  1IY2 A;  1FNN A;  4LFB M;  2HKJ A;  4A3V B;  3T1Y M;  1NY5 A;  2NQ8 C;  2QBY B;  1ZAE A;  3HHY A;  4DUY M;  4GKJ M;  4MGH A;  5FTM A;  3MMP A;  3PCG M;  3W0F A;  1YKK A;  1G59 A;  2UUB M;  4DR6 M;  1TF0 B;  2L7I A;  2LWX A;  4PDI A;  1JR3 E;  4LGM A;  2XZF A;  2UUA M;  1HQY E;  3SMS A;  1DMH A;  3GLI E;  4LJA A;  3THG A;  1DGB A;  2XGN A;  4OVZ B;  2UXC M;  2VII A;  2LVQ D;  3PFI A;  3HX3 A;  2ERC A;  4BBA A;  1DGG A;  1IM2 A;  3IEC A;  3H4J A;  4QNR A;  4XK8 F;  1VDD A;  3JR4 A;  1YKL B;  3SAW A;  5EXP A;  3U6O A;  2ZAN A;  4JI7 M;  1GJT A;  4WHP D;  1QZE A;  4PT5 A;  4IBK A;  2DWZ B;  3SMP A;  2VF7 A;  5FLX S;  3UJN A;  1XWI A;  2JY7 A;  2CEA A;  2WZJ A;  4DR2 M;  3PCC A;  3KS4 A;  5DFL A;  1QVR A;  2XH9 A;  1IN7 A;  5FTN A;  3L26 A;  3PCJ M;  4WHQ B;  4BLC A;  1EOA A;  4NRW A;  4PCZ A;  4M9Z A;  4HEO A;  4RF0 A;  4X64 M;  2BUR B;  1PJS A;  2R62 A;  4AKH A;  3GP1 A;  2KZU A;  3WHL A;  4LZZ A;  3SYL A;  2BUY A;  1SXJ B;  4I5S A;  4GH9 A;  3SAR A;  3T67 M;  3E9S A;  2K9D A;  5ITX A;  4M0W A;  3U61 B;  1WIV A;  2WSF F;  5BPV A;  4GIT A;  1PJJ A;  3K2L A;  5IT9 S;  5EXX A;  2JZ1 A;  3AV0 A;  3M0E A;  1GKI A;  2R4J A;  4GIP A;  2DVW B;  3GLI B;  3FUW A;  1H6U A;  1WGN A;  3U6E A;  2Y20 A;  2YNM D;  2DAE A;  4JXJ A;  5BR8 M;  1D0K A;  1EOC A;  2BUT B;  3GPX A;  2KXE A;  3BOS A;  1DGH A;  2HWJ A;  2BUZ B;  4GC5 A;  4M9S A;  4MH0 E;  3KDS E;  2F5P A;  3VKH A;  2LVP C;  2XSV A;  2L6O A;  2XFS A;  3E46 A;  4ZPX A;  2Z3X A;  3HHZ A;  2OQ4 A;  3MV6 M;  2APL A;  2CFO A;  4B7F A;  1TH2 A;  4FCV A;  4IBG A;  2KRU A;  4WP2 A;  5DYG A;  4JYA M;  2CV1 A;  1TH3 A;  4G3O A;  2F5Q A;  1YKM A;  3JAM S;  3PCL M;  4GEW A;  2AHM A;  5DNY A;  3SHF A;  3PCN M;  4I8O A;  1TTE A;  4MB7 A;  1Z5A A;  1EO2 B;  2BUU B;  3AL0 C;  4Z8X A;  4DUZ M;  1Y8G A;  2K47 A;  4R3D A;  3UK6 A;  3MV4 A;  2QNJ A;  1WGL A;  1DO0 A;  2QBY A;  2JA2 A;  2GQF A;  1XNR M;  3HHW A;  4M9X A;  5IRE B;  5JI3 E;  2I7N A;  4GRI A;  5KPT A;  5KO3 A;  5KQD A;  1TDH A;  2GNO A;  2LNH C;  4D81 A;  1NJF A;  3GQ5 A;  1YLA A;  4NSO B;  2VQF M;  3KOW E;  1L8Q A;  2OOB A;  3GLH A;  3QYB A;  1G4A E;  1ZMU A;  4OVZ A;  1N34 M;  5EP2 A;  2JY8 A;  1QAO A;  2A5Y B;  3ILK A;  3T38 A;  2XSR A;  4XGI A;  3B7Q A;  3R8F A;  3MI1 M;  2R65 A;  4WHR F;  3AKZ A;  2FE8 A;  2LVO C;  4DR3 M;  2E5L M;  2WSC F;  3QAU A;  3EIH A;  1YKL A;  1OQY A;  1GL6 A;  1JQJ C;  2X4A A;  3PCK M;  2BWB A;  3MV6 A;  2EKF A;  2XSU A;  4MM3 B;  1DV0 A;  1W5T A;  2G5G X;  1HQC A;  1NV8 A;  5L8R F;  1GL7 A;  2MR9 A;  5EQT A;  1QUS A;  1DGF A;  2LXE A;  2P5T A;  2O25 A;  3VLF B;  1IXR C;  3PCL A;  3PCN A;  4CIZ A;  1EIJ A;  2CE7 A;  4WHQ A;  3BBZ A;  3CGW A;  3KP1 E;  4LCB A;  4JI2 M;  2BUR A;  3GQ3 A;  3KVW A;  2UXB M;  1XXH E;  4LJ5 A;  4IBF A;  4NRV A;  5F3W A;  4WHR B;  1PJQ A;  1JB0 F;  1PRB A;  3U61 A;  3GPP A;  1R4G A;  2YFQ A;  3J7A S;  1HJP A;  3K8Z A;  4D82 A;  5ITT A;  1I94 M;  4WHS B;  4DV2 M;  3VDU A;  2R44 A;  2H1R A;  4KLN A;  3QYE A;  1JR3 A;  1YE9 A;  2LVN C;  4LJ7 A;  3SYK A;  4ANR A;  4B3M M;  3FTE A;  4WHO B;  3GLI A;  4JN6 A;  1K3X A;  2L4F A;  3U6S A;  3HKP A;  1TGU A;  1X37 A;  3FYD A;  3FRI A;  4NSR A;  3FTF A;  2BUT A;  2BUZ A;  5TD3 A;  4KO8 A;  4IBJ A;  1SXJ D;  5EXS A;  1R2Y A;  2UUC M;  2DHY A;  1QYR A;  3W68 A;  3A46 A;  2M60 A;  5KQ8 A;  4WHO A;  2XFT A;  2L2D A;  4FCT A;  2F5O A;  2KDL A;  4UN2 B;  4L16 A;  1HNX M;  2BUU A;  1EO2 A;  3PCM A;  4IBD A;  4PD2 A;  3KFU G;  3Q8G A;  1DLT A;  1VDL A;  2B3T A;  2DHR A;  1DO2 A;  2RKO A;  4FD2 A;  4NXM M;  1NJG A;  4LY6 A;  1Z5C A;  2KEB A;  2D7G A;  3GLH B;  3PNV A;  1YKP A;  1UM8 A;  1OTR A;  2DZO B;  2DAK A;  3FUT A;  1XXH B;  3GRY A;  4FWG A;  4KOD A;  5IZ7 D;  4LF4 M;  3PCD M;  4DV1 M;  1AUA A;  3FTD A;  3NWL A;  3MFL A;  2N35 A;  3DOA A;  3HU1 A;  3PCA M;  1I4W A;  4B7H A;  3VDP A;  2MGW A;  2V1C A;  4WUR A;  2BUX B;  3PCB A;  1ZQ9 A;  2BNK A;  2L4E A;  3SAS A;  2C99 A;  1N78 A;  1K3W A;  3TQS A;  4LFC M;  1N77 A;  3PCI M;  4L4U A;  2F5N A;  1NV9 A;  2K0B X;  1PM5 A;  1TH4 A;  2HL7 A;  1LV7 A;  1MJG M;  4LJ6 A;  5FTK A;  3FYC A;  3IHP A;  3U6M A;  3D8L A;  3KW6 A;  5LMU M;  1S3S A;  2CV0 A;  4QOZ C;  3PCE M;  2BOY A;  2KHH A;  1HT1 E;  1QDR A;  2DXI A;  2X49 A;  3GLF E;  4S12 A;  3MK6 A;  4JV5 M;  2JUJ A;  3LMM A;  3FE3 A;  3TWK A;  7CAT A;  1PGY A;  3KOY E;  3O6R A;  3GLG E;  3PCG A;  1IXS B;  3HJ8 A;  4F2L A;  4EIW A;  3UMM A;  1QAN A; 
#chains in the Genus database with same CATH homology
 3JR5 A;  3FKE A;  4HLQ A;  4LF5 M;  4K0K M;  4MGK E;  4WHR A;  1NHW C;  4G4R A;  3SAU A;  4QHS A;  4WHS A;  1NSF A;  3HGI A;  1IQP A;  3L29 A;  3HJS A;  3SBJ A;  1XMO M;  2XF3 A;  1XHB A;  4OW0 A;  4AG5 A;  2BUM B;  1IN6 A;  4PDG A;  1G3I A;  2EA0 A;  2CV2 A;  4GHA A;  4IIW A;  4KHP M;  4W5W A;  3TH1 A;  1QAM A;  4L8R C;  2ZBK B;  2C9O A;  3CF0 A;  1DLQ A;  1IN8 A;  4RNA A;  3L2A A;  1IBK M;  3IG8 A;  4X66 M;  1EO9 B;  3MHV C;  3Q8X A;  3PXG A;  4QHT A;  4G6Z A;  4HL4 A;  4L78 A;  3SFZ A;  2ZM6 M;  3PCJ A;  3UGJ A;  4FVM A;  3U6D A;  2DZN B;  3AOE C;  2FNA A;  4LFA M;  4I81 A;  5ITQ A;  1IBL M;  1YKP B;  3CF2 A;  3TPZ A;  3GLF B;  3LMX M;  3VK7 A;  3T67 A;  3IG5 A;  2HCB A;  4MGY E;  2F5S A;  3M7G A;  3ZC7 B;  3T63 M;  4QNM A;  3GLG B;  2XSZ A;  3FUX A;  3KS8 A;  3KOZ E;  1XXH A;  2BUW B;  2PCD M;  2R45 A;  4AW4 A;  5ITY A;  3J7B A;  4LF9 M;  1IN4 A;  5H37 D;  4LZJ A;  4JI0 M;  3FD9 A;  4L15 A;  2Z4R A;  3U6P A;  2UXD M;  3LKT M;  3GPU A;  1EOB B;  3PCH M;  2BUX A;  3FTC A;  4M0D A;  4DV3 M;  4LJ4 A;  2ZAM A;  1L1Z A;  2V1U A;  1NHG C;  3LVW A;  2QCU A;  1Z59 A;  2RGO A;  3FUV A;  2O5R A;  4IBE A;  5EXT A;  3MI5 M;  1Z5B A;  4X65 M;  1Q39 A;  3L28 A;  3LVV A;  1N75 A;  3PCF M;  3ZCB B;  2D7H A;  1IBM M;  3K1J A;  4LGY A;  1XMQ M;  3LXV M;  1NNJ A;  4X62 M;  4OX9 M;  3AOG A;  3D8B A;  3RFW A;  4AKG A;  3FUU A;  1GLN A;  4ILT A;  2V6Z M;  1YKN A;  2LH0 A;  1YSY A;  5JI2 E;  4G4O A;  2BV0 B;  3T63 A;  5DYI A;  3C58 A;  2YR0 A;  2Y0Q A;  1XC8 A;  5KPZ A;  4IBI A;  4G4Q A;  5IWA M;  3KOX E;  3MI1 A;  2OPF A;  2EO2 A;  1G41 A;  4LRT A;  1YUB A;  2I7P A;  4TUW A;  3PCK A;  1MX0 A;  3I51 A;  2BUM A;  2R4E A;  5EJC A;  2KZS A;  4REZ A;  3SC3 A;  1NNU C;  4FWD A;  2BUV B;  1JR3 D;  1HT2 E;  3LQR A;  4DR7 M;  4GC9 A;  3VFD A;  1E9R A;  1N32 M;  1HNZ M;  4GKK M;  1EO9 A;  2D7E A;  4JI6 M;  3HHX A;  1L2B A;  2FFJ A;  5EP1 A;  4LF8 M;  3O32 A;  4LRS A;  1J09 A;  4AI6 A;  3LXV A;  3AOE A;  3SAT A;  3GLF A;  4JI8 M;  1R7R A;  3HU3 A;  3PCC M;  2BJW A;  1L2D A;  4WHO D;  4FW9 A;  3TWL A;  3I4Y A;  3GLG A;  2QP9 X;  2C9C A;  4Z6Y A;  1TMX A;  1IY1 A;  3LQQ A;  3U5Z B;  2W82 A;  2BUW A;  3DA1 A;  5KPR A;  3TWM A;  2Z4S A;  3U60 B;  1E94 E;  1SXJ E;  5FTJ A;  4ITQ A;  4DR4 M;  2Y0T A;  4LJ8 A;  4JI3 M;  3TE6 A;  2CHV A;  4WHP A;  1EOB A;  4DV4 M;  4IJF A;  5E26 A;  4IBC A;  4LJ9 A;  3RE8 A;  3T1H M;  3OTO M;  3A42 A;  1GVN A;  4FCW A;  1E32 A;  4DV0 M;  4CIS A;  3DZD A;  4IBB A;  3GRU A;  4YY3 M;  5ITR A;  2DWN A;  3R9X B;  2YQZ A;  4CGY B;  2QPA A;  3PVS A;  1E9S A;  4GMQ A;  3I4V A;  1Z6T A;  3B9P A;  3AJI B;  3SHG B;  5ITU A;  1OJL A;  5FSW A;  4I4L A;  5C1B A;  5EP3 A;  1MU5 A;  1YKN B;  8CAT A;  3J2P B;  2XZU A;  3L25 A;  1EE8 A;  3DFZ A;  3H4M A;  4G4N A;  3VK8 A;  1KFV A;  2KA6 B;  4NOO B;  1L1T A;  2Y21 A;  4BB9 A;  3E4R A;  1DLM A;  2BV0 A;  3PCD A;  3MV4 M;  3PCA A;  1KYI A;  4B3R M;  2R46 A;  2M5Z A;  3QWL A;  1SXJ C;  3RGS A;  1R6B X;  3MJ5 A;  1ORY B;  2C96 A;  4MGI E;  1IY0 A;  3PCI A;  3KXE C;  5LMN M;  3KSJ A;  2CHQ A;  4DV6 M;  2BUQ B;  4WHS D;  3KP0 E;  1YKO A;  3GQ4 A;  4B7G A;  4LG2 A;  2BUV A;  2ZAO A;  3PCE A;  1QAQ A;  2XLJ A;  3J27 B;  1TDZ A;  1J7K A;  3A45 A;  4FWH A;  2AZQ A;  3MV6 M;  1Q3B A;  2F4V M;  3J80 S;  3U6C A;  2L09 A;  2VQE M;  2EUC A;  2C98 A;  2J7O A;  4CHT B;  1N33 M;  1HNW M;  3TL4 X;  3W0L B;  3O6J A;  1KSF X;  3GPY A;  4JI1 M;  1C1K A;  4OU7 A;  3T15 A;  1N36 M;  2KRK A;  5C18 A;  3HWS A;  5ITX E;  3HU2 A;  1W5S A;  1OFI A;  2L7H A;  3UZU A;  3U5Z A;  1YKK B;  4WHP B;  4D80 A;  3K92 A;  3U60 A;  2CUZ A;  4DR1 M;  4AZF A;  3WHK A;  1R2Z A;  4AKI A;  2XSZ D;  3GO8 A;  4B3S M;  2QZ4 A;  1J5E M;  2XEP A;  3AFH A;  2UU9 M;  3RGP A;  4II7 A;  1NVM A;  4DV5 M;  3A98 B;  1PJI A;  4NL4 H;  4JI5 M;  3GRR A;  4QOS A;  2G8L A;  2Z7J A;  4B3T M;  4ILV A;  4AG6 A;  4NXN M;  3U6L A;  2CHG A;  1L2C A;  5E6J A;  3GRV A;  4DV7 M;  3LMX A;  4R7G A;  1S9A A;  3U6Q A;  2X8A A;  1G8P A;  3M6A A;  4RF1 A;  3O5U A;  3CTW B;  2RGH A;  4LF6 M;  1EOA B;  2QEN A;  3CF6 E;  3NBI A;  5GKN A;  4WW0 A;  3PCM M;  2PCD A;  1Q3C A;  2BUY B;  1NY6 A;  5EP4 A;  3LKT A;  3PCH A;  3N9T A;  1T3T A;  3SAV A;  2J7N A;  2DWL A;  2Q2E B;  1SXJ A;  3EIE A;  4IJE A;  2BJV A;  1YKO B;  1FJG M;  2DWM A;  4LF7 M;  3MI5 A;  3MFL M;  4XBO A;  3PNY A;  4P16 A;  3VKG A;  4DR5 M;  1EOC B;  1WXQ A;  2HHH M;  2BUQ A;  1DGH B;  3L27 A;  3PCB M;  3ZH9 B;  3KSX A;  3PCF A;  2KW0 A;  2FOI C;  5FTL A;  3HJQ A;  1K82 A;  1XNQ M;  4JI4 M;  4MGZ E;  4AQY M;  1HR0 M;  1YKM B;  5A2Q S;  1QQW A;  4B08 A;  1OFH A;  4YHH M;  1IN5 A;  1D2N A;  2R18 A;  3J81 S;  1QZM A;  2C5R A;  1IXZ A;  4GHL A;  1IY2 A;  1FNN A;  4LFB M;  2HKJ A;  4A3V B;  3T1Y M;  1NY5 A;  2NQ8 C;  2QBY B;  1ZAE A;  3HHY A;  4DUY M;  4GKJ M;  4MGH A;  5FTM A;  3PCG M;  3W0F A;  1YKK A;  1G59 A;  2UUB M;  4DR6 M;  2L7I A;  2LWX A;  4PDI A;  2XZF A;  4LGM A;  2UUA M;  1HQY E;  3SMS A;  1DMH A;  4LJA A;  3THG A;  1DGB A;  2XGN A;  4OVZ B;  2UXC M;  2VII A;  3PFI A;  2ERC A;  4BBA A;  1DGG A;  1IM2 A;  4QNR A;  1VDD A;  3JR4 A;  1YKL B;  3SAW A;  5EXP A;  3U6O A;  2ZAN A;  4JI7 M;  4WHP D;  4PT5 A;  4IBK A;  2DWZ B;  3SMP A;  5FLX S;  3UJN A;  1XWI A;  2CEA A;  4DR2 M;  3PCC A;  3KS4 A;  1QVR A;  2XH9 A;  1IN7 A;  5FTN A;  3L26 A;  3PCJ M;  4WHQ B;  4BLC A;  1EOA A;  4NRW A;  4PCZ A;  4M9Z A;  4X64 M;  4RF0 A;  2BUR B;  2R62 A;  4AKH A;  3GP1 A;  2KZU A;  3WHL A;  4LZZ A;  3SYL A;  2BUY A;  1SXJ B;  4I5S A;  4GH9 A;  3SAR A;  3T67 M;  3E9S A;  5ITX A;  4M0W A;  3U61 B;  1PJJ A;  5BPV A;  4GIT A;  3K2L A;  5IT9 S;  5EXX A;  3AV0 A;  3M0E A;  1GKI A;  2R4J A;  4GIP A;  2DVW B;  3GLI B;  3FUW A;  1H6U A;  3U6E A;  2Y20 A;  2YNM D;  4JXJ A;  5BR8 M;  1EOC A;  2BUT B;  2BUZ B;  3GPX A;  2KXE A;  3BOS A;  1DGH A;  4GC5 A;  4M9S A;  4MH0 E;  3KDS E;  2F5P A;  3VKH A;  2XSV A;  2L6O A;  2XFS A;  2Z3X A;  4ZPX A;  3HHZ A;  2OQ4 A;  2CFO A;  4B7F A;  1TH2 A;  4FCV A;  4IBG A;  2KRU A;  5DYG A;  4JYA M;  4WHO B;  2CV1 A;  1TH3 A;  2F5Q A;  1YKM A;  3JAM S;  3PCL M;  5DNY A;  2AHM A;  3PCN M;  3SHF A;  4I8O A;  4MB7 A;  1Z5A A;  1EO2 B;  2BUU B;  3AL0 C;  4Z8X A;  4DUZ M;  4R3D A;  2K47 A;  3UK6 A;  3MV4 A;  1DO0 A;  2QBY A;  2JA2 A;  1XNR M;  3HHW A;  4M9X A;  5IRE B;  5JI3 E;  2I7N A;  4GRI A;  5KPT A;  5KO3 A;  5KQD A;  1TDH A;  4D81 A;  2LNH C;  1NJF A;  2VQF M;  4NSO B;  3KOW E;  1L8Q A;  3GLH A;  1G4A E;  4OVZ A;  1N34 M;  5EP2 A;  1QAO A;  2A5Y B;  3ILK A;  3T38 A;  2XSR A;  4XGI A;  3R8F A;  3MI1 M;  2R65 A;  4WHR F;  3AKZ A;  2FE8 A;  2E5L M;  4DR3 M;  3QAU A;  3EIH A;  1YKL A;  1GL6 A;  1JQJ C;  2X4A A;  3PCK M;  3MV6 A;  2XSU A;  4MM3 B;  1W5T A;  2G5G X;  1HQC A;  1GL7 A;  5EQT A;  2LXE A;  1DGF A;  2P5T A;  3VLF B;  1IXR C;  3PCL A;  3PCN A;  2CE7 A;  4WHQ A;  3KP1 E;  4LCB A;  4JI2 M;  2BUR A;  3GQ3 A;  3KVW A;  2UXB M;  4LJ5 A;  4IBF A;  4NRV A;  5F3W A;  4WHR B;  3U61 A;  3GPP A;  2YFQ A;  3J7A S;  3K8Z A;  5ITT A;  4D82 A;  1I94 M;  4WHS B;  4DV2 M;  3VDU A;  2H1R A;  4KLN A;  4B3M M;  1JR3 A;  1YE9 A;  4LJ7 A;  3SYK A;  3FTE A;  3GLI A;  4JN6 A;  1K3X A;  3U6S A;  3HKP A;  1TGU A;  1X37 A;  3FYD A;  4NSR A;  3FTF A;  2BUT A;  2BUZ A;  5TD3 A;  4KO8 A;  4IBJ A;  1SXJ D;  5EXS A;  1R2Y A;  2UUC M;  1QYR A;  3A46 A;  2M60 A;  5KQ8 A;  4WHO A;  2XFT A;  4FCT A;  2F5O A;  4L16 A;  1HNX M;  2BUU A;  1EO2 A;  3PCM A;  4IBD A;  4PD2 A;  3KFU G;  1DLT A;  2DHR A;  1DO2 A;  2RKO A;  4FD2 A;  4NXM M;  1NJG A;  4LY6 A;  1Z5C A;  2KEB A;  2D7G A;  3GLH B;  3PNV A;  1YKP A;  1UM8 A;  2DZO B;  3FUT A;  3GRY A;  4KOD A;  1XXH B;  4FWG A;  3GQ5 A;  4LF4 M;  5IZ7 D;  3PCD M;  4DV1 M;  3FTD A;  3NWL A;  3MFL A;  3DOA A;  3HU1 A;  3PCA M;  1I4W A;  4B7H A;  3VDP A;  2V1C A;  4WUR A;  2BUX B;  3PCB A;  1ZQ9 A;  2BNK A;  3SAS A;  2C99 A;  1N78 A;  1K3W A;  3TQS A;  4LFC M;  1N77 A;  3PCI M;  4L4U A;  2F5N A;  1PM5 A;  1TH4 A;  2HL7 A;  1LV7 A;  4LJ6 A;  5FTK A;  3FYC A;  3U6M A;  3D8L A;  3KW6 A;  5LMU M;  1S3S A;  2CV0 A;  4QOZ C;  3PCE M;  2BOY A;  1HT1 E;  2DXI A;  2X49 A;  4S12 A;  3MK6 A;  4JV5 M;  3LMM A;  3TWK A;  7CAT A;  3KOY E;  3O6R A;  3PCG A;  1IXS B;  3HJ8 A;  4EIW A;  3UMM A;  1QAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...