3HGIA

Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
258
structure length
258
Chain Sequence
ERATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
total genus 69
structure length 258
sequence length 258
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hgiA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hgiA02
3I4VA 4ILTA 3HKPA 3PCFA 3LKTA 3PCKM 1YKMA 3PCDM 2BUXA 3HHXA 1YKNA 3PCJA 3MI5M 3T63A 3PCIA 1DLTA 2BUVA 2BURB 3MV4A 3T67M 3HJQA 3PCGM 1TMXA 2BUWB 4WHOB 2AZQA 2BUXB 3O32A 2BUQA 4WHQA 3LMXA 1EOBB 3N9TA 1YKKB 3PCCA 3PCLA 3PCMM 3PCCM 3PCLM 3PCHM 1YKPB 2BUYA 2BUQB 2BUMB 4WHQB 4WHOD 3O5UA 4WHRF 2XSRA 1YKOA 1EOCB 5TD3A 1YKLB 4WHPB 2BUMA 3MV4M 2XSUA 1DLQA 4WHPD 3PCBA 3MI1A 2BV0A 4WHSD 3HJSA 3PCAA 1YKLA 3PCHA 4WHRA 4ILVA 3HGIA 3PCJM 2BUZA 1EO2A 3MFLM 4WHOA 3HJ8A 4WHSB 3I51A 3HHYA 3TH1A 3PCBM 3PCKA 1EOBA 2BUYB 2BUZB 3PCFM 3MV6M 2BUVB 1YKNB 1YKPA 3PCEM 1YKOB 3LMXM 2XSVA 4WHSA 1EO9A 4WHPA 3I4YA 3MV6A 2BUWA 3PCGA 1EOAA 3PCNA 3MI5A 2BUTB 3MI1M 2BUUB 2PCDM 3LKTM 3LXVM 3PCDA 2BV0B 3PCAM 3MFLA 2BOYA 3PCIM 1EO9B 3PCMA 1YKKA 4WHRB 1S9AA 2BUTA 3PCNM 1YKMB 1DMHA 1EOAB 3T67A 3LXVA 1EO2B 2PCDA 2BUUA 1EOCA 3O6JA 3O6RA 3T63M 3PCEA 1DLMA 2BURA
chains in the Genus database with same CATH superfamily
3GRUA 4GC5A 1L2DA 4LGYA 2ERCA 3CF6E 2LHCA 1IBLM 2VIIA 1TH3A 3PCDM 4F2LA 3PCJA 4MGKE 3F92A 5JI2E 3MI5M 5IREB 3T63A 1DLTA 2BUVA 3SHFA 2LXEA 4OX9M 1HNZM 1YSYA 2VF7A 1PJTA 1NO1A 3ZQJA 4PT5A 3A98B 3SAUA 2Y0QA 1GABA 3GLHE 2D7EA 1VEKA 1WR1B 4FCTA 4GITA 2DZNB 3L26A 2BJVA 4LJ4A 4L78A 3DFZA 4LZJA 1TMXA 3SASA 5EXXA 1QYRA 1VDLA 1Z5CA 2JXNA 4X65M 1HT2E 5LMNM 2BUQA 1QDTA 4M9ZA 4B08A 3LMXA 3N9TA 1YKKB 3KP1E 3PFIA 2Z4RA 3AL0C 2ZM6M 3GRVA 3PCHM 1NHGC 1Q3CA 2J5YA 1XNRM 1XXHB 4I81A 1YKPB 4LG2A 2BUQB 1Z5BA 3Q8XA 2QBYA 4CIZA 2CV0A 2Y0TA 3MHVC 1R2YA 3L28A 4GHLA 3QWLA 1Z59A 3MV4M 3PXGA 4GEWA 4DV4M 1XXHA 1DO2A 3TWLA 2MROB 2XSZA 4JI7M 1OKSA 3J80S 3PNVA 4PDIA 4IBEA 4MGIE 3LVWA 1D0LA 4DBGB 2C9CA 2BV0A 1GKIA 2F5NA 1QDRA 3PCAA 4LJ5A 1QAOA 4NSOB 4AZFA 1GLNA 4TUWA 1YKLA 2UUBM 2JUJA 2G8LA 4ITQA 1G41A 1SG9A 4LF6M 2KW0A 2L7IA 1AIPC 4R71A 4AG5A 1TH4A 1X37A 2I7NA 3K2LA 4AKGA 3H4MA 3RGPA 1QZEA 4R7GA 5E26A 3J2PB 2CE7A 4FWGA 4GC9A 3HJ8A 3W0FA 1ZMVA 3UJNA 4DR6M 1IN4A 3HHYA 5F3WA 1OJLA 3I04M 3ZH9B 2DNAA 5DFLA 1OIPA 2ZTDA 3A42A 1IQPA 3DA1A 4OVZA 3K92A 4JN6A 2O5RA 1TR8A 1MX0A 4P16A 1EOBA 2C96A 1FNNA 2EA0A 1K3WA 2OQ4A 2DWLA 4X66M 3I01M 2ZBKB 5FLXS 2DVWB 3FYCA 1CUKA 2J7OA 3E46A 3PCEM 4L8RC 1OFIA 2DWZB 4K0KM 1E9SA 5H37D 1QQWA 1NV9A 4WHSA 4XK8F 4YHHM 1EO9A 4WHPA 3FYDA 1WJ7A 3UZUA 3B7QA 4PCZA 2DWNA 1FJGM 4RNAA 3MV6A 3FUXA 4LJAA 1XMQM 1EOAA 5FTNA 4JI2M 2JZ1A 1PGYA 4LCBA 4LF9M 1TTEA 1SXJD 3GQ5A 3TWMA 1NNJA 2BUUB 3LCVB 3LMMA 3U6CA 1TGUA 3SAVA 1NSFA 2BJWA 2X8AA 3KS8A 3HU3A 3QAUA 3SBJA 1GL7A 3SAWA 4DV1M 2BOYA 3PCIM 3W67A 1W5TA 3D8LA 5ITXE 1WXQA 2Y20A 3A46A 4DR1M 3H4JA 2DWMA 2LWXA 1OTRA 3FUUA 3LW5F 2NQ8C 4KLNA 3GPUA 1HNXM 1NJFA 5ITUA 3LXVA 3OTOM 4DR5M 2UUCM 3HHWA 2L6OA 1EOCA 4G3OA 4IBBA 5EP2A 2L4FA 3HU2A 2AHMA 1D2NA 3PCEA 2LNHC 1DLMA 2L09A 1N34M 3T63M 5KPZA 1ORYB 1IBMM 2BURA 1IY0A 2CRUA 3FTFA 4HL4A 4ANRA 2DZLA 4DV5M 4AG6A 2YQZA 1R5LA 2DHYA 1VEJA 4IBFA 2RRUA 2G5GX 3AV0A 3C9PA 4R3DA 4DV7M 3R9XB 4W5WA 1YKNA 3HX3A 4OW0A 2BURB 1J5EM 3E21A 4KT0F 1JR3A 3VFDA 1PJJA 3MV4A 3PNYA 3J7AS 3TWKA 3VLFB 3HHZA 2CEAA 1NJGA 4IIWA 3AOEC 1QAMA 2V1CA 3AFHA 4NOOB 3T15A 1XNQM 2UXCM 5IWAM 4G4NA 1A5TA 4WHOB 1HNWM 3CTWB 1NY5A 4IBJA 4QNMA 4GRIA 2FE8A 3LCUA 2K47A 1L2BA 2APLA 1LV7A 5BPVA 5ITXA 4MB7A 1OIZA 2V6ZM 2QPAA 3PCCA 1IM2A 4IBDA 3PCCM 2DKLA 1XHBA 2F5QA 1RU3A 1YLAA 4JV5M 3PVSA 4QHTA 1ZMUA 2CHQA 1F4IA 4XBOA 4LJ9A 1Z5AA 4D82A 3UGJA 2BWEA 2KZSA 2WSEF 3THGA 1YKOA 2I7PA 2JY5A 2OPFA 3T1YM 3C3DA 1GL6A 2FOIC 1EOCB 5TD3A 3KOXE 2EKFA 3FD9A 2ZAOA 1GJSA 2CHVA 1VDDA 1KFVA 1HJPA 3RFWA 5DYIA 3Q8GA 2DHRA 2QCUA 1WHCA 2XGNA 2KA6B 2MGWA 3AOEA 2LVOC 3FTCA 4KODA 3NBXX 4P17A 3A45A 4REZA 1UFZA 4G4RA 4LJ6A 3WHLA 4WP2A 2VDBB 1R2ZA 2CV1A 1EE8A 3SATA 1IXRC 5GKNA 3PCHA 3KVWA 4LFAM 4WHRA 2D7GA 1G3IA 4KO8A 4JI0M 1G59A 5DNYA 2Z8YM 3GRRA 4QOSA 2BWBA 4Y28F 4AW4A 1EIJA 4FVMA 2L2DA 3HY5A 1MJGM 1JR3E 4GIPA 1P3QQ 1QZMA 2R44A 4FW9A 3T38A 3U6DA 2BUZA 3ILKA 4IBIA 1C1KA 4WHOA 4WHSB 3U6PA 3I51A 1T43A 4NL4H 1T3TA 3TH1A 2H1RA 4RKUF 4A3VB 4XGIA 2XF3A 4WURA 5E6JA 3GLFB 1MU5A 4CJ6A 2BUYB 4GMQA 1GVNA 2BUZB 3MV6M 3C58A 3SHGB 4NC6A 1Z6TA 3VDPA 4FWHA 1S3SA 3TE6A 4CHTB 1E32A 4Z8XA 3KOZE 1DGGA 2R65A 4ZPXA 5EXPA 1YKOB 3J27B 3JR4A 2UU9M 1K3XA 3SMPA 3GLFA 2KEBA 3I4YA 1TF0B 3TPZA 4RF1A 1R7RA 4EIWA 3MI1M 2LTUA 3HWSA 2YR0A 1N36M 3E4RA 3LKTM 2K0BX 1PRBA 2YFQA 3LXVM 1OFHA 2R6FA 3GLFE 3EIHA 4L16A 1IY2A 2DI0A 2DZOB 1HR0M 3MK6A 1J09A 3AJIB 1J7KA 1NV8A 2CFOA 5JI3E 1EO9B 3VK8A 4WHRB 1S9AA 2FH0A 3FTEA 3MJ5A 4CGYB 2QBYB 3AOGA 1DMHA 1EOAB 3PCNM 2VQFM 3T67A 3FRHA 3U6EA 2W82A 4B3TM 2PCDA 4MGYE 1XC8A 1IFYA 2JY7A 3GQ4A 3VKGA 2BUUA 1HQCA 2OO9A 3SYLA 3IECA 3NBIA 2LVAA 4F1IA 4YY3M 4LRSA 3K9PA 4JI1M 3KS4A 3T6PA 1QAQA 1L1ZA 3ZCBB 4AKHA 5DYGA 3HKPA 1VEGA 1IN6A 3U5ZA 3PCFA 3K1JA 1PM5A 2X4AA 1YKMA 4BBAA 2JNHA 2M60A 2BUXA 2KNZA 3HHXA 3FUVA 1OQYA 2QQ8A 4GKJM 3PCIA 4Z6YA 3K8ZA 1IBKM 2HL7A 1V34A 2JY6B 2QNJA 4WW0A 4BLCA 2KHHA 2F5PA 1QUSA 3SC3A 3GPPA 5EXSA 1KSFX 2RGOA 4S12A 2R45A 2WSCF 1VQ1A 2J7NA 4DUYM 3FUWA 1SXJE 3HJQA 3T1HM 3PCGM 1I94M 1WIVA 2BUWB 5KPTA 1WGNA 4G4OA 2C98A 3SFZA 2AZQA 2LBCA 4IJEA 3JAMS 2BUWA 3O32A 5ITYA 5ITQA 2KDLA 3B7NA 3B89A 2R46A 3VKHA 4PDGA 3GLIA 1EOBB 1ZAEA 3GQ3A 3U6MA 2DAMA 3PCLA 4I5SA 1TDHA 3PCMM 3PCLM 4G4QA 2QP9X 4B7FA 2CWBA 1AUAA 2FNAA 3GLGE 2HCBA 3NWLA 3TL4X 3JR5A 1OAOC 4MGHA 4X62M 1ZQ9A 1XWIA 4FD2A 2G3QA 4D81A 3GLIB 4DR2M 4WHRF 1Y8GA 3W0LB 4LF8M 1IN8A 1IXZA 3GLHB 1UM8A 3B74A 2L4EA 3KP0E 1JQJC 5ITRA 3B7ZA 1L2CA 4LGMA 1YKLB 4WHPB 2QENA 4LY6A 3UK6A 2KRUA 1I4WA 3U6OA 3L27A 4WHPD 1Q3BA 2QZ4A 2RKOA 3MI1A 3PCBA 2XSUA 4MM3B 3GO8A 4WHSD 2Z3XA 2ZANA 8CATA 4M0DA 3EIEA 4GKKM 5IZ7D 3U61A 2R62A 4M9SA 2DENA 3LVVA 3M7GA 5C1BA 1GJTA 2RGHA 3L2AA 3BXWA 4GH9A 2LH0A 2LVNC 3KDSE 1L1TA 4MGZE 2EKKA 3HGIA 3PCJM 2BNKA 4DV0M 3MFLM 1N77A 2UUAM 1MN3A 3B9PA 2K6BA 2P5TA 1GO5A 1DGHB 2XH9A 3U6SA 1W5SA 5ITTA 1SXJC 4AI6A 3SYKA 1G4AE 2M5ZA 3PCKA 3PCFM 1D0KA 4DV2M 2D7HA 3CF0A 4M9XA 1N78A 1YKNB 1YKPA 3LMXM 3QYBA 3C3EA 5A2QS 1NHWC 2XZUA 4LJ7A 3PCKM 3PCGA 2OOBA 1NNUC 1V92A 4QOZC 1VG5A 5FTMA 4NSRA 2CHGA 4RF0A 4B3MM 2BUTB 1PJQA 1YE9A 1BVSA 2JZ0A 1LTMA 4JI3M 1YUBA 3GP1A 3PCDA 2BV0B 4DV3M 3MFLA 4PD2A 3PCMA 2CP8A 2JA2A 3VDUA 3V76A 4M0WA 3DZDA 4DV6M 3PCNA 2BUTA 1YKMB 3R8FA 2XFSA 3KOWE 2JY8A 2C5RA 3D8BA 3UMMA 3SARA 2B3TA 1IN7A 3WHKA 4NXMM 2ZAMA 2Z4SA 3KXEC 1PJSA 1JR3D 3O6RA 5L8RF 2JWSA 1NY6A 2YNMD 3W68A 4DR3M 2F5OA 2C99A 4LFBM 3I4VA 1DGHA 4ILTA 2O01F 2HHHM 1QUTA 1QVRA 3BBZA 3LQRA 4JI8M 2MR9A 2KXEA 4IJFA 4D80A 3LKTA 4OVZB 1Q39A 4OU7A 4LF4M 3L29A 1G71A 2KNVA 5LMUM 1OAIA 2R18A 2UXBM 3KSJA 2UXDM 3VK7A 3GPYA 3M6AA 1V33A 2L7HA 2HKJA 3T67M 1DO0A 4DR4M 1DGBA 5KO3A 4HEOA 4B3SM 2HAKA 4LRTA 2XLJA 3U6QA 5EXTA 3U6LA 1D0MA 2BUXB 4II7A 4X64M 1PJIA 2MJ5B 4WHQA 4L15A 3M0EA 5EJCA 1SXJA 1Q02A 3FUTA 3IG8A 2XZFA 2DAEA 3RGSA 3J7BA 2BUYA 2HWJA 4JYAM 1TH2A 2BUMB 4WHQB 1NVMA 2EJSA 4FWDA 3ZC7B 4GHAA 4WHOD 3O5UA 4IBCA 4DR7M 2XSRA 1N32M 2A5YB 4LF5M 1SXJB 2LVPC 2F4VM 3U61B 2BUMA 3KFUG 4QHSA 1E9RA 4CISA 1XB2B 3QYEA 1DLQA 2Z7JA 1H6UA 3E9SA 2DAGA 2X49A 7CATA 2XFTA 3HJSA 2JP7A 4LFCM 1IXSA 4QNRA 5EP4A 3HU1A 5EP1A 2F5SA 4KHPM 1TDZA 4B7GA 2EUCA 3GLHA 2E5LM 3SMSA 1E94E 4MH0E 5FTLA 5KPRA 1L8QA 1KYIA 1DV0A 4ILVA 4AKIA 4AQYM 1C7YA 3TQSA 4B7HA 1QANA 5BR8M 2K9DA 1XXHE 3GRYA 1R6BX 2C9OA 1N75A 5FTKA 3U60A 1EO2A 3HZJA 2OOAA 4DUZM 2LVQD 4IBKA 1ZV1A 2FS1A 3RE8A 1IY1A 2Q2EB 2QSFX 4L4UA 4NXNM 3L25A 4IBGA 3PCBM 1R4GA 1K82A 3CF2A 2WZJA 2V1UA 5FTJA 1HQYE 2BUVB 3GPXA 2XSZD 3KSXA 3FTDA 2R4JA 3IHPA 2KZUA 1EFUB 2CUZA 3DOAA 3KOYE 3IG5A 3K9OA 2XSVA 2LHGA 2WSFF 4FCVA 2QHOB 2N35A 2DAKA 3GLGB 4I4LA 4UN2B 2DAIA 2Y21A 3CGWA 3KW6A 1G8PA 5EQTA 2CV2A 2MH8A 4JI4M 1HT1E 4FCWA 2R4EA 4BB9A 4G6ZA 4JI6M 3BOSA 5FSWA 4HLQA 3GLIE 4LF7M 3MI5A 3FE3A 3LQQA 4NRWA 2PCDM 4Q7JA 2GQFA 1IXSB 3J81S 1IN5A 4L6V6 4LJ8A 2FFJA 3GLGA 3PCAM 1T6OA 5EP3A 2KRKA 4JI5M 2KNAA 3FKEA 1YKKA 5KQ8A 1XMOM 2GNOA 4I8OA 2VQEM 2ZTCA 1DGFA 1ZMWA 2XEPA 2VF8A 1WGLA 2DXIA 4LZZA 3FRIA 4B3RM 5IT9S 1EO2B 3U60B 3AKZA 4NRVA 2R0IA 3U5ZB 1JB0F 3MMPA 3O6JA 2H5XA 5KQDA 2EO2A 2O25A 5C18A 4JXJA 1N33M
chains in the Genus database with same CATH topology
3GRUA 4GC5A 1L2DA 4LGYA 2ERCA 3CF6E 1IBLM 2VIIA 1TH3A 3PCDM 3PCJA 4MGKE 5JI2E 3MI5M 5IREB 3T63A 1DLTA 2BUVA 3SHFA 2LXEA 4OX9M 1HNZM 1YSYA 4PT5A 3A98B 3SAUA 2Y0QA 2D7EA 4FCTA 4GITA 2DZNB 3L26A 2BJVA 4LJ4A 4L78A 3DFZA 4LZJA 1TMXA 3SASA 5EXXA 1QYRA 4X65M 1Z5CA 1HT2E 5LMNM 2BUQA 4M9ZA 4B08A 3LMXA 3N9TA 1YKKB 3KP1E 3PFIA 2Z4RA 3AL0C 2ZM6M 3GRVA 3PCHM 1NHGC 1Q3CA 1XNRM 1XXHB 4I81A 1YKPB 4LG2A 2BUQB 1Z5BA 3Q8XA 2QBYA 2CV0A 2Y0TA 3MHVC 1R2YA 3L28A 4GHLA 3QWLA 1Z59A 3PXGA 4DV4M 1XXHA 1DO2A 3TWLA 2XSZA 4JI7M 4PDIA 3J80S 3PNVA 4IBEA 4MGIE 3LVWA 2C9CA 2BV0A 1GKIA 2F5NA 3PCAA 4LJ5A 1QAOA 4NSOB 4AZFA 1GLNA 4TUWA 1YKLA 2UUBM 2G8LA 4ITQA 1G41A 4LF6M 2KW0A 2L7IA 4AG5A 1TH4A 1X37A 2I7NA 3K2LA 4AKGA 3H4MA 3RGPA 4R7GA 5E26A 3J2PB 2CE7A 4FWGA 4GC9A 3HJ8A 3W0FA 4DR6M 3UJNA 1IN4A 3HHYA 5F3WA 1OJLA 3ZH9B 3A42A 1IQPA 3DA1A 4OVZA 3K92A 4JN6A 2O5RA 4P16A 1MX0A 1EOBA 2C96A 1FNNA 2EA0A 1K3WA 2OQ4A 2DWLA 4X66M 5FLXS 2ZBKB 2DVWB 3FYCA 2J7OA 3PCEM 4L8RC 1OFIA 2DWZB 4K0KM 1E9SA 5H37D 1QQWA 4WHSA 4YHHM 1EO9A 4WHPA 3FYDA 4PCZA 3UZUA 2DWNA 3MV6A 1FJGM 4RNAA 3FUXA 4LJAA 1XMQM 1EOAA 5FTNA 4JI2M 4LCBA 4LF9M 1NNJA 1SXJD 3GQ5A 3TWMA 2BUUB 3LMMA 3U6CA 1TGUA 3SAVA 1NSFA 2BJWA 2X8AA 3KS8A 3HU3A 3QAUA 3SBJA 1GL7A 3SAWA 4DV1M 2BOYA 3PCIM 1W5TA 3D8LA 5ITXE 1WXQA 2Y20A 3A46A 4DR1M 2DWMA 2LWXA 3FUUA 2NQ8C 4KLNA 3GPUA 1HNXM 1NJFA 5ITUA 3LXVA 3OTOM 4DR5M 2UUCM 3HHWA 2L6OA 1EOCA 4IBBA 5EP2A 3HU2A 2AHMA 1D2NA 3PCEA 2LNHC 1DLMA 2L09A 1N34M 3T63M 5KPZA 1ORYB 1IBMM 2BURA 1IY0A 3FTFA 4HL4A 4DV5M 4AG6A 2YQZA 4IBFA 3AV0A 2G5GX 1YKNA 4R3DA 4DV7M 3R9XB 4W5WA 4OW0A 2BURB 1J5EM 3VFDA 1JR3A 1PJJA 3MV4A 3PNYA 3J7AS 3TWKA 3VLFB 3HHZA 2CEAA 1NJGA 4IIWA 3AOEC 1QAMA 2V1CA 3AFHA 4NOOB 3T15A 1XNQM 2UXCM 5IWAM 4G4NA 4WHOB 1HNWM 3CTWB 1NY5A 4IBJA 4QNMA 4GRIA 2FE8A 2K47A 1L2BA 1LV7A 5BPVA 5ITXA 4MB7A 2V6ZM 2QPAA 3PCCA 1IM2A 4IBDA 3PCCM 1XHBA 2F5QA 4JV5M 3PVSA 4QHTA 2CHQA 4XBOA 4LJ9A 1Z5AA 4D82A 3UGJA 2KZSA 3THGA 1YKOA 2I7PA 2OPFA 3T1YM 1GL6A 2FOIC 1EOCB 5TD3A 3KOXE 3FD9A 2ZAOA 3MV4M 2CHVA 1VDDA 1KFVA 3RFWA 5DYIA 2XSUA 2DHRA 2QCUA 3AOEA 2XGNA 2KA6B 4KODA 3FTCA 3A45A 4REZA 4G4RA 4LJ6A 3WHLA 1R2ZA 2CV1A 1EE8A 3SATA 1IXRC 5GKNA 3PCHA 3KVWA 4LFAM 4WHRA 2D7GA 1G3IA 4KO8A 4JI0M 1G59A 5DNYA 3GRRA 4QOSA 4AW4A 4FVMA 4GIPA 1QZMA 4FW9A 3T38A 3U6DA 2BUZA 3ILKA 4IBIA 1C1KA 4WHOA 4WHSB 3U6PA 3I51A 4NL4H 1T3TA 3TH1A 2H1RA 4A3VB 4XGIA 2XF3A 4WURA 5E6JA 3GLFB 1MU5A 2BUYB 4GMQA 1GVNA 2BUZB 3MV6M 3C58A 3SHGB 1Z6TA 3VDPA 4FWHA 1S3SA 3TE6A 4CHTB 1E32A 4Z8XA 3KOZE 1DGGA 2R65A 4ZPXA 5EXPA 1YKOB 3J27B 3JR4A 2UU9M 1K3XA 3SMPA 3GLFA 2KEBA 3I4YA 3TPZA 4RF1A 1R7RA 4EIWA 3MI1M 3HWSA 1N36M 2YR0A 3E4RA 3LKTM 3LXVM 2YFQA 1OFHA 3EIHA 4L16A 1IY2A 1HR0M 2DZOB 3MK6A 1J09A 3AJIB 1J7KA 2CFOA 1EO9B 5JI3E 3VK8A 4WHRB 1S9AA 3FTEA 3MJ5A 4CGYB 2QBYB 3AOGA 1DMHA 1EOAB 3PCNM 2VQFM 3T67A 3U6EA 2W82A 4B3TM 2PCDA 4MGYE 1XC8A 2BUUA 3GQ4A 3VKGA 1HQCA 3SYLA 4YY3M 3NBIA 4LRSA 4JI1M 3KS4A 1QAQA 1L1ZA 3ZCBB 4AKHA 5DYGA 3HKPA 3PCFA 1IN6A 3U5ZA 3K1JA 1PM5A 2X4AA 1YKMA 4BBAA 2BUXA 2M60A 3PCKM 3HHXA 3FUVA 4GKJM 3PCIA 4Z6YA 3K8ZA 1IBKM 2HL7A 4WW0A 4BLCA 2F5PA 3GPPA 3SC3A 5EXSA 1KSFX 2RGOA 4S12A 2R45A 2J7NA 4DUYM 3FUWA 1SXJE 3HJQA 3T1HM 3PCGM 1I94M 2BUWB 5KPTA 4G4OA 2AZQA 2C98A 3SFZA 3O32A 4IJEA 3JAMS 5ITYA 5ITQA 2R46A 3VKHA 4PDGA 3GLIA 1EOBB 1ZAEA 3GQ3A 3U6MA 3PCLA 3PCMM 4I5SA 1TDHA 3PCLM 4G4QA 2QP9X 4B7FA 2FNAA 2HCBA 3NWLA 3TL4X 3JR5A 4MGHA 4X62M 1ZQ9A 1XWIA 4FD2A 4D81A 3GLIB 4DR2M 4WHRF 3W0LB 4LF8M 1IN8A 1IXZA 3GLHB 1UM8A 3KP0E 1JQJC 5ITRA 1L2CA 1YKLB 4LGMA 4WHPB 2QENA 4LY6A 3UK6A 2KRUA 1I4WA 3U6OA 3L27A 4WHPD 1Q3BA 2QZ4A 2RKOA 3MI1A 3PCBA 4MM3B 3GO8A 4WHSD 2Z3XA 2ZANA 8CATA 4M0DA 3EIEA 4GKKM 5IZ7D 3U61A 2R62A 4M9SA 3LVVA 3M7GA 5C1BA 2RGHA 3L2AA 4GH9A 2LH0A 3KDSE 1L1TA 4MGZE 3HGIA 3PCJM 2BNKA 4DV0M 3MFLM 1N77A 2UUAM 3B9PA 2P5TA 1DGHB 2XH9A 3U6SA 1W5SA 5ITTA 1SXJC 4AI6A 3SYKA 1G4AE 2M5ZA 3PCKA 3PCFM 4DV2M 2D7HA 3CF0A 4M9XA 1N78A 1YKNB 1YKPA 3LMXM 5A2QS 1NHWC 2XZUA 4LJ7A 3PCGA 1NNUC 4QOZC 5FTMA 4NSRA 2CHGA 4RF0A 4B3MM 2BUTB 1YE9A 4JI3M 3GP1A 1YUBA 3PCDA 2BV0B 4DV3M 3MFLA 4PD2A 3PCMA 2JA2A 3VDUA 4M0WA 3DZDA 4DV6M 2BUTA 1YKMB 3R8FA 2XFSA 3KOWE 2C5RA 3D8BA 3UMMA 3SARA 3WHKA 1IN7A 4NXMM 2ZAMA 2Z4SA 3KXEC 1JR3D 3O6RA 4DR3M 1NY6A 2YNMD 2F5OA 4LFBM 2C99A 3I4VA 1DGHA 4ILTA 2HHHM 1QVRA 3LQRA 4JI8M 4IJFA 2KXEA 4D80A 3LKTA 4OVZB 1Q39A 4OU7A 4LF4M 3L29A 5LMUM 2R18A 2UXBM 3KSJA 2UXDM 3VK7A 3GPYA 3M6AA 2L7HA 2HKJA 3T67M 1DO0A 4DR4M 1DGBA 5KO3A 4B3SM 4LRTA 3U6QA 2XLJA 5EXTA 3U6LA 2BUXB 4II7A 4X64M 1PJIA 4WHQA 4L15A 3M0EA 5EJCA 1SXJA 3FUTA 3IG8A 2XZFA 3RGSA 3J7BA 2BUYA 4JYAM 1TH2A 2BUMB 4WHQB 1NVMA 4FWDA 3ZC7B 4GHAA 4WHOD 3O5UA 4IBCA 4DR7M 2XSRA 1N32M 2A5YB 4LF5M 1SXJB 2F4VM 3U61B 2BUMA 3KFUG 4QHSA 1E9RA 4CISA 1DLQA 2Z7JA 1H6UA 3E9SA 2X49A 7CATA 2XFTA 3HJSA 4LFCM 4QNRA 5EP4A 5EP1A 3HU1A 2F5SA 4KHPM 1TDZA 4B7GA 2EUCA 3GLHA 2E5LM 3SMSA 1E94E 4MH0E 5FTLA 5KPRA 1L8QA 1KYIA 4ILVA 4AKIA 4AQYM 3TQSA 4B7HA 1QANA 5BR8M 1EO2A 3GRYA 1R6BX 2C9OA 1N75A 5FTKA 3U60A 4DUZM 4IBKA 3RE8A 1IY1A 2Q2EB 4L4UA 4NXNM 3L25A 4IBGA 3PCBM 1K82A 3CF2A 2V1UA 5FTJA 1HQYE 2BUVB 3GPXA 2XSZD 3KSXA 3FTDA 2R4JA 2KZUA 2CUZA 3DOAA 3KOYE 3IG5A 2XSVA 4FCVA 3GLGB 4I4LA 2Y21A 2BUWA 4JI4M 3KW6A 1G8PA 5EQTA 2CV2A 4JI6M 1HT1E 4FCWA 2R4EA 4BB9A 4G6ZA 4LF7M 3BOSA 5FSWA 4HLQA 3MI5A 3PCNA 3LQQA 4NRWA 2PCDM 1IXSB 3J81S 1IN5A 4LJ8A 2FFJA 3GLGA 3PCAM 5EP3A 2KRKA 4JI5M 3FKEA 1YKKA 5KQ8A 1XMOM 4I8OA 2VQEM 1DGFA 2XEPA 2DXIA 4LZZA 4B3RM 5IT9S 1EO2B 3U60B 3AKZA 4NRVA 3U5ZB 3O6JA 5KQDA 2EO2A 5C18A 4JXJA 1N33M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4V A;  4ILT A;  3HKP A;  3PCF A;  3LKT A;  3PCK M;  1YKM A;  3PCD M;  2BUX A;  3HHX A;  1YKN A;  3PCJ A;  3MI5 M;  3T63 A;  3PCI A;  1DLT A;  2BUV A;  2BUR B;  3MV4 A;  3T67 M;  3HJQ A;  3PCG M;  1TMX A;  2BUW B;  4WHO B;  2AZQ A;  2BUX B;  3O32 A;  2BUQ A;  4WHQ A;  3LMX A;  1EOB B;  3N9T A;  1YKK B;  3PCC A;  3PCL A;  3PCM M;  3PCC M;  3PCL M;  3PCH M;  1YKP B;  2BUY A;  2BUQ B;  2BUM B;  4WHQ B;  4WHO D;  3O5U A;  4WHR F;  2XSR A;  1YKO A;  1EOC B;  5TD3 A;  1YKL B;  4WHP B;  2BUM A;  3MV4 M;  2XSU A;  1DLQ A;  4WHP D;  3PCB A;  3MI1 A;  2BV0 A;  4WHS D;  3HJS A;  3PCA A;  1YKL A;  3PCH A;  4WHR A;  4ILV A;  3HGI A;  3PCJ M;  2BUZ A;  1EO2 A;  3MFL M;  4WHO A;  3HJ8 A;  4WHS B;  3I51 A;  3HHY A;  3TH1 A;  3PCB M;  3PCK A;  1EOB A;  2BUY B;  2BUZ B;  3PCF M;  3MV6 M;  2BUV B;  1YKN B;  1YKP A;  3PCE M;  1YKO B;  3LMX M;  2XSV A;  4WHS A;  1EO9 A;  4WHP A;  3I4Y A;  3MV6 A;  2BUW A;  3PCG A;  1EOA A;  3PCN A;  3MI5 A;  2BUT B;  3MI1 M;  2BUU B;  2PCD M;  3LKT M;  3LXV M;  3PCD A;  2BV0 B;  3PCA M;  3MFL A;  2BOY A;  3PCI M;  1EO9 B;  3PCM A;  1YKK A;  4WHR B;  1S9A A;  2BUT A;  3PCN M;  1YKM B;  1DMH A;  1EOA B;  3T67 A;  3LXV A;  1EO2 B;  2PCD A;  2BUU A;  1EOC A;  3O6J A;  3O6R A;  3T63 M;  3PCE A;  1DLM A;  2BUR A; 
#chains in the Genus database with same CATH topology
 3GRU A;  4GC5 A;  1L2D A;  4LGY A;  2ERC A;  3CF6 E;  2LHC A;  1IBL M;  2VII A;  1TH3 A;  3PCD M;  4F2L A;  3PCJ A;  4MGK E;  3F92 A;  5JI2 E;  3MI5 M;  5IRE B;  3T63 A;  1DLT A;  2BUV A;  3SHF A;  2LXE A;  4OX9 M;  1HNZ M;  1YSY A;  2VF7 A;  1PJT A;  1NO1 A;  3ZQJ A;  4PT5 A;  3A98 B;  3SAU A;  2Y0Q A;  1GAB A;  3GLH E;  2D7E A;  1VEK A;  1WR1 B;  4FCT A;  4GIT A;  2DZN B;  3L26 A;  2BJV A;  4LJ4 A;  4L78 A;  3DFZ A;  4LZJ A;  1TMX A;  3SAS A;  5EXX A;  1QYR A;  1VDL A;  1Z5C A;  2JXN A;  4X65 M;  1HT2 E;  5LMN M;  2BUQ A;  1QDT A;  4M9Z A;  4B08 A;  3LMX A;  3N9T A;  1YKK B;  3KP1 E;  3PFI A;  2Z4R A;  3AL0 C;  2ZM6 M;  3GRV A;  3PCH M;  1NHG C;  1Q3C A;  2J5Y A;  1XNR M;  1XXH B;  4I81 A;  1YKP B;  4LG2 A;  2BUQ B;  1Z5B A;  3Q8X A;  2QBY A;  4CIZ A;  2CV0 A;  2Y0T A;  3MHV C;  1R2Y A;  3L28 A;  4GHL A;  3QWL A;  1Z59 A;  3MV4 M;  3PXG A;  4GEW A;  4DV4 M;  1XXH A;  1DO2 A;  3TWL A;  2MRO B;  2XSZ A;  4JI7 M;  1OKS A;  3J80 S;  3PNV A;  4PDI A;  4IBE A;  4MGI E;  3LVW A;  1D0L A;  4DBG B;  2C9C A;  2BV0 A;  1GKI A;  2F5N A;  1QDR A;  3PCA A;  4LJ5 A;  1QAO A;  4NSO B;  4AZF A;  1GLN A;  4TUW A;  1YKL A;  2UUB M;  2JUJ A;  2G8L A;  4ITQ A;  1G41 A;  1SG9 A;  4LF6 M;  2KW0 A;  2L7I A;  1AIP C;  4R71 A;  4AG5 A;  1TH4 A;  1X37 A;  2I7N A;  3K2L A;  4AKG A;  3H4M A;  3RGP A;  1QZE A;  4R7G A;  5E26 A;  3J2P B;  2CE7 A;  4FWG A;  4GC9 A;  3HJ8 A;  3W0F A;  1ZMV A;  3UJN A;  4DR6 M;  1IN4 A;  3HHY A;  5F3W A;  1OJL A;  3I04 M;  3ZH9 B;  2DNA A;  5DFL A;  1OIP A;  2ZTD A;  3A42 A;  1IQP A;  3DA1 A;  4OVZ A;  3K92 A;  4JN6 A;  2O5R A;  1TR8 A;  1MX0 A;  4P16 A;  1EOB A;  2C96 A;  1FNN A;  2EA0 A;  1K3W A;  2OQ4 A;  2DWL A;  4X66 M;  3I01 M;  2ZBK B;  5FLX S;  2DVW B;  3FYC A;  1CUK A;  2J7O A;  3E46 A;  3PCE M;  4L8R C;  1OFI A;  2DWZ B;  4K0K M;  1E9S A;  5H37 D;  1QQW A;  1NV9 A;  4WHS A;  4XK8 F;  4YHH M;  1EO9 A;  4WHP A;  3FYD A;  1WJ7 A;  3UZU A;  3B7Q A;  4PCZ A;  2DWN A;  1FJG M;  4RNA A;  3MV6 A;  3FUX A;  4LJA A;  1XMQ M;  1EOA A;  5FTN A;  4JI2 M;  2JZ1 A;  1PGY A;  4LCB A;  4LF9 M;  1TTE A;  1SXJ D;  3GQ5 A;  3TWM A;  1NNJ A;  2BUU B;  3LCV B;  3LMM A;  3U6C A;  1TGU A;  3SAV A;  1NSF A;  2BJW A;  2X8A A;  3KS8 A;  3HU3 A;  3QAU A;  3SBJ A;  1GL7 A;  3SAW A;  4DV1 M;  2BOY A;  3PCI M;  3W67 A;  1W5T A;  3D8L A;  5ITX E;  1WXQ A;  2Y20 A;  3A46 A;  4DR1 M;  3H4J A;  2DWM A;  2LWX A;  1OTR A;  3FUU A;  3LW5 F;  2NQ8 C;  4KLN A;  3GPU A;  1HNX M;  1NJF A;  5ITU A;  3LXV A;  3OTO M;  4DR5 M;  2UUC M;  3HHW A;  2L6O A;  1EOC A;  4G3O A;  4IBB A;  5EP2 A;  2L4F A;  3HU2 A;  2AHM A;  1D2N A;  3PCE A;  2LNH C;  1DLM A;  2L09 A;  1N34 M;  3T63 M;  5KPZ A;  1ORY B;  1IBM M;  2BUR A;  1IY0 A;  2CRU A;  3FTF A;  4HL4 A;  4ANR A;  2DZL A;  4DV5 M;  4AG6 A;  2YQZ A;  1R5L A;  2DHY A;  1VEJ A;  4IBF A;  2RRU A;  2G5G X;  3AV0 A;  3C9P A;  4R3D A;  4DV7 M;  3R9X B;  4W5W A;  1YKN A;  3HX3 A;  4OW0 A;  2BUR B;  1J5E M;  3E21 A;  4KT0 F;  1JR3 A;  3VFD A;  1PJJ A;  3MV4 A;  3PNY A;  3J7A S;  3TWK A;  3VLF B;  3HHZ A;  2CEA A;  1NJG A;  4IIW A;  3AOE C;  1QAM A;  2V1C A;  3AFH A;  4NOO B;  3T15 A;  1XNQ M;  2UXC M;  5IWA M;  4G4N A;  1A5T A;  4WHO B;  1HNW M;  3CTW B;  1NY5 A;  4IBJ A;  4QNM A;  4GRI A;  2FE8 A;  3LCU A;  2K47 A;  1L2B A;  2APL A;  1LV7 A;  5BPV A;  5ITX A;  4MB7 A;  1OIZ A;  2V6Z M;  2QPA A;  3PCC A;  1IM2 A;  4IBD A;  3PCC M;  2DKL A;  1XHB A;  2F5Q A;  1RU3 A;  1YLA A;  4JV5 M;  3PVS A;  4QHT A;  1ZMU A;  2CHQ A;  1F4I A;  4XBO A;  4LJ9 A;  1Z5A A;  4D82 A;  3UGJ A;  2BWE A;  2KZS A;  2WSE F;  3THG A;  1YKO A;  2I7P A;  2JY5 A;  2OPF A;  3T1Y M;  3C3D A;  1GL6 A;  2FOI C;  1EOC B;  5TD3 A;  3KOX E;  2EKF A;  3FD9 A;  2ZAO A;  1GJS A;  2CHV A;  1VDD A;  1KFV A;  1HJP A;  3RFW A;  5DYI A;  3Q8G A;  2DHR A;  2QCU A;  1WHC A;  2XGN A;  2KA6 B;  2MGW A;  3AOE A;  2LVO C;  3FTC A;  4KOD A;  3NBX X;  4P17 A;  3A45 A;  4REZ A;  1UFZ A;  4G4R A;  4LJ6 A;  3WHL A;  4WP2 A;  2VDB B;  1R2Z A;  2CV1 A;  1EE8 A;  3SAT A;  1IXR C;  5GKN A;  3PCH A;  3KVW A;  4LFA M;  4WHR A;  2D7G A;  1G3I A;  4KO8 A;  4JI0 M;  1G59 A;  5DNY A;  2Z8Y M;  3GRR A;  4QOS A;  2BWB A;  4Y28 F;  4AW4 A;  1EIJ A;  4FVM A;  2L2D A;  3HY5 A;  1MJG M;  1JR3 E;  4GIP A;  1P3Q Q;  1QZM A;  2R44 A;  4FW9 A;  3T38 A;  3U6D A;  2BUZ A;  3ILK A;  4IBI A;  1C1K A;  4WHO A;  4WHS B;  3U6P A;  3I51 A;  1T43 A;  4NL4 H;  1T3T A;  3TH1 A;  2H1R A;  4RKU F;  4A3V B;  4XGI A;  2XF3 A;  4WUR A;  5E6J A;  3GLF B;  1MU5 A;  4CJ6 A;  2BUY B;  4GMQ A;  1GVN A;  2BUZ B;  3MV6 M;  3C58 A;  3SHG B;  4NC6 A;  1Z6T A;  3VDP A;  4FWH A;  1S3S A;  3TE6 A;  4CHT B;  1E32 A;  4Z8X A;  3KOZ E;  1DGG A;  2R65 A;  4ZPX A;  5EXP A;  1YKO B;  3J27 B;  3JR4 A;  2UU9 M;  1K3X A;  3SMP A;  3GLF A;  2KEB A;  3I4Y A;  1TF0 B;  3TPZ A;  4RF1 A;  1R7R A;  4EIW A;  3MI1 M;  2LTU A;  3HWS A;  2YR0 A;  1N36 M;  3E4R A;  3LKT M;  2K0B X;  1PRB A;  2YFQ A;  3LXV M;  1OFH A;  2R6F A;  3GLF E;  3EIH A;  4L16 A;  1IY2 A;  2DI0 A;  2DZO B;  1HR0 M;  3MK6 A;  1J09 A;  3AJI B;  1J7K A;  1NV8 A;  2CFO A;  5JI3 E;  1EO9 B;  3VK8 A;  4WHR B;  1S9A A;  2FH0 A;  3FTE A;  3MJ5 A;  4CGY B;  2QBY B;  3AOG A;  1DMH A;  1EOA B;  3PCN M;  2VQF M;  3T67 A;  3FRH A;  3U6E A;  2W82 A;  4B3T M;  2PCD A;  4MGY E;  1XC8 A;  1IFY A;  2JY7 A;  3GQ4 A;  3VKG A;  2BUU A;  1HQC A;  2OO9 A;  3SYL A;  3IEC A;  3NBI A;  2LVA A;  4F1I A;  4YY3 M;  4LRS A;  3K9P A;  4JI1 M;  3KS4 A;  3T6P A;  1QAQ A;  1L1Z A;  3ZCB B;  4AKH A;  5DYG A;  3HKP A;  1VEG A;  1IN6 A;  3U5Z A;  3PCF A;  3K1J A;  1PM5 A;  2X4A A;  1YKM A;  4BBA A;  2JNH A;  2M60 A;  2BUX A;  2KNZ A;  3HHX A;  3FUV A;  1OQY A;  2QQ8 A;  4GKJ M;  3PCI A;  4Z6Y A;  3K8Z A;  1IBK M;  2HL7 A;  1V34 A;  2JY6 B;  2QNJ A;  4WW0 A;  4BLC A;  2KHH A;  2F5P A;  1QUS A;  3SC3 A;  3GPP A;  5EXS A;  1KSF X;  2RGO A;  4S12 A;  2R45 A;  2WSC F;  1VQ1 A;  2J7N A;  4DUY M;  3FUW A;  1SXJ E;  3HJQ A;  3T1H M;  3PCG M;  1I94 M;  1WIV A;  2BUW B;  5KPT A;  1WGN A;  4G4O A;  2C98 A;  3SFZ A;  2AZQ A;  2LBC A;  4IJE A;  3JAM S;  2BUW A;  3O32 A;  5ITY A;  5ITQ A;  2KDL A;  3B7N A;  3B89 A;  2R46 A;  3VKH A;  4PDG A;  3GLI A;  1EOB B;  1ZAE A;  3GQ3 A;  3U6M A;  2DAM A;  3PCL A;  4I5S A;  1TDH A;  3PCM M;  3PCL M;  4G4Q A;  2QP9 X;  4B7F A;  2CWB A;  1AUA A;  2FNA A;  3GLG E;  2HCB A;  3NWL A;  3TL4 X;  3JR5 A;  1OAO C;  4MGH A;  4X62 M;  1ZQ9 A;  1XWI A;  4FD2 A;  2G3Q A;  4D81 A;  3GLI B;  4DR2 M;  4WHR F;  1Y8G A;  3W0L B;  4LF8 M;  1IN8 A;  1IXZ A;  3GLH B;  1UM8 A;  3B74 A;  2L4E A;  3KP0 E;  1JQJ C;  5ITR A;  3B7Z A;  1L2C A;  4LGM A;  1YKL B;  4WHP B;  2QEN A;  4LY6 A;  3UK6 A;  2KRU A;  1I4W A;  3U6O A;  3L27 A;  4WHP D;  1Q3B A;  2QZ4 A;  2RKO A;  3MI1 A;  3PCB A;  2XSU A;  4MM3 B;  3GO8 A;  4WHS D;  2Z3X A;  2ZAN A;  8CAT A;  4M0D A;  3EIE A;  4GKK M;  5IZ7 D;  3U61 A;  2R62 A;  4M9S A;  2DEN A;  3LVV A;  3M7G A;  5C1B A;  1GJT A;  2RGH A;  3L2A A;  3BXW A;  4GH9 A;  2LH0 A;  2LVN C;  3KDS E;  1L1T A;  4MGZ E;  2EKK A;  3HGI A;  3PCJ M;  2BNK A;  4DV0 M;  3MFL M;  1N77 A;  2UUA M;  1MN3 A;  3B9P A;  2K6B A;  2P5T A;  1GO5 A;  1DGH B;  2XH9 A;  3U6S A;  1W5S A;  5ITT A;  1SXJ C;  4AI6 A;  3SYK A;  1G4A E;  2M5Z A;  3PCK A;  3PCF M;  1D0K A;  4DV2 M;  2D7H A;  3CF0 A;  4M9X A;  1N78 A;  1YKN B;  1YKP A;  3LMX M;  3QYB A;  3C3E A;  5A2Q S;  1NHW C;  2XZU A;  4LJ7 A;  3PCK M;  3PCG A;  2OOB A;  1NNU C;  1V92 A;  4QOZ C;  1VG5 A;  5FTM A;  4NSR A;  2CHG A;  4RF0 A;  4B3M M;  2BUT B;  1PJQ A;  1YE9 A;  1BVS A;  2JZ0 A;  1LTM A;  4JI3 M;  1YUB A;  3GP1 A;  3PCD A;  2BV0 B;  4DV3 M;  3MFL A;  4PD2 A;  3PCM A;  2CP8 A;  2JA2 A;  3VDU A;  3V76 A;  4M0W A;  3DZD A;  4DV6 M;  3PCN A;  2BUT A;  1YKM B;  3R8F A;  2XFS A;  3KOW E;  2JY8 A;  2C5R A;  3D8B A;  3UMM A;  3SAR A;  2B3T A;  1IN7 A;  3WHK A;  4NXM M;  2ZAM A;  2Z4S A;  3KXE C;  1PJS A;  1JR3 D;  3O6R A;  5L8R F;  2JWS A;  1NY6 A;  2YNM D;  3W68 A;  4DR3 M;  2F5O A;  2C99 A;  4LFB M;  3I4V A;  1DGH A;  4ILT A;  2O01 F;  2HHH M;  1QUT A;  1QVR A;  3BBZ A;  3LQR A;  4JI8 M;  2MR9 A;  2KXE A;  4IJF A;  4D80 A;  3LKT A;  4OVZ B;  1Q39 A;  4OU7 A;  4LF4 M;  3L29 A;  1G71 A;  2KNV A;  5LMU M;  1OAI A;  2R18 A;  2UXB M;  3KSJ A;  2UXD M;  3VK7 A;  3GPY A;  3M6A A;  1V33 A;  2L7H A;  2HKJ A;  3T67 M;  1DO0 A;  4DR4 M;  1DGB A;  5KO3 A;  4HEO A;  4B3S M;  2HAK A;  4LRT A;  2XLJ A;  3U6Q A;  5EXT A;  3U6L A;  1D0M A;  2BUX B;  4II7 A;  4X64 M;  1PJI A;  2MJ5 B;  4WHQ A;  4L15 A;  3M0E A;  5EJC A;  1SXJ A;  1Q02 A;  3FUT A;  3IG8 A;  2XZF A;  2DAE A;  3RGS A;  3J7B A;  2BUY A;  2HWJ A;  4JYA M;  1TH2 A;  2BUM B;  4WHQ B;  1NVM A;  2EJS A;  4FWD A;  3ZC7 B;  4GHA A;  4WHO D;  3O5U A;  4IBC A;  4DR7 M;  2XSR A;  1N32 M;  2A5Y B;  4LF5 M;  1SXJ B;  2LVP C;  2F4V M;  3U61 B;  2BUM A;  3KFU G;  4QHS A;  1E9R A;  4CIS A;  1XB2 B;  3QYE A;  1DLQ A;  2Z7J A;  1H6U A;  3E9S A;  2DAG A;  2X49 A;  7CAT A;  2XFT A;  3HJS A;  2JP7 A;  4LFC M;  1IXS A;  4QNR A;  5EP4 A;  3HU1 A;  5EP1 A;  2F5S A;  4KHP M;  1TDZ A;  4B7G A;  2EUC A;  3GLH A;  2E5L M;  3SMS A;  1E94 E;  4MH0 E;  5FTL A;  5KPR A;  1L8Q A;  1KYI A;  1DV0 A;  4ILV A;  4AKI A;  4AQY M;  1C7Y A;  3TQS A;  4B7H A;  1QAN A;  5BR8 M;  2K9D A;  1XXH E;  3GRY A;  1R6B X;  2C9O A;  1N75 A;  5FTK A;  3U60 A;  1EO2 A;  3HZJ A;  2OOA A;  4DUZ M;  2LVQ D;  4IBK A;  1ZV1 A;  2FS1 A;  3RE8 A;  1IY1 A;  2Q2E B;  2QSF X;  4L4U A;  4NXN M;  3L25 A;  4IBG A;  3PCB M;  1R4G A;  1K82 A;  3CF2 A;  2WZJ A;  2V1U A;  5FTJ A;  1HQY E;  2BUV B;  3GPX A;  2XSZ D;  3KSX A;  3FTD A;  2R4J A;  3IHP A;  2KZU A;  1EFU B;  2CUZ A;  3DOA A;  3KOY E;  3IG5 A;  3K9O A;  2XSV A;  2LHG A;  2WSF F;  4FCV A;  2QHO B;  2N35 A;  2DAK A;  3GLG B;  4I4L A;  4UN2 B;  2DAI A;  2Y21 A;  3CGW A;  3KW6 A;  1G8P A;  5EQT A;  2CV2 A;  2MH8 A;  4JI4 M;  1HT1 E;  4FCW A;  2R4E A;  4BB9 A;  4G6Z A;  4JI6 M;  3BOS A;  5FSW A;  4HLQ A;  3GLI E;  4LF7 M;  3MI5 A;  3FE3 A;  3LQQ A;  4NRW A;  2PCD M;  4Q7J A;  2GQF A;  1IXS B;  3J81 S;  1IN5 A;  4L6V 6;  4LJ8 A;  2FFJ A;  3GLG A;  3PCA M;  1T6O A;  5EP3 A;  2KRK A;  4JI5 M;  2KNA A;  3FKE A;  1YKK A;  5KQ8 A;  1XMO M;  2GNO A;  4I8O A;  2VQE M;  2ZTC A;  1DGF A;  1ZMW A;  2XEP A;  2VF8 A;  1WGL A;  2DXI A;  4LZZ A;  3FRI A;  4B3R M;  5IT9 S;  1EO2 B;  3U60 B;  3AKZ A;  4NRV A;  2R0I A;  3U5Z B;  1JB0 F;  3MMP A;  3O6J A;  2H5X A;  5KQD A;  2EO2 A;  2O25 A;  5C18 A;  4JXJ A;  1N33 M; 
#chains in the Genus database with same CATH homology
 3GRU A;  4GC5 A;  1L2D A;  4LGY A;  2ERC A;  3CF6 E;  1IBL M;  2VII A;  1TH3 A;  3PCD M;  3PCJ A;  4MGK E;  5JI2 E;  3MI5 M;  5IRE B;  3T63 A;  1DLT A;  2BUV A;  3SHF A;  2LXE A;  4OX9 M;  1HNZ M;  1YSY A;  4PT5 A;  3A98 B;  3SAU A;  2Y0Q A;  2D7E A;  4FCT A;  4GIT A;  2DZN B;  3L26 A;  2BJV A;  4LJ4 A;  4L78 A;  3DFZ A;  4LZJ A;  1TMX A;  3SAS A;  5EXX A;  1QYR A;  4X65 M;  1Z5C A;  1HT2 E;  5LMN M;  2BUQ A;  4M9Z A;  4B08 A;  3LMX A;  3N9T A;  1YKK B;  3KP1 E;  3PFI A;  2Z4R A;  3AL0 C;  2ZM6 M;  3GRV A;  3PCH M;  1NHG C;  1Q3C A;  1XNR M;  1XXH B;  4I81 A;  1YKP B;  4LG2 A;  2BUQ B;  1Z5B A;  3Q8X A;  2QBY A;  2CV0 A;  2Y0T A;  3MHV C;  1R2Y A;  3L28 A;  4GHL A;  3QWL A;  1Z59 A;  3PXG A;  4DV4 M;  1XXH A;  1DO2 A;  3TWL A;  2XSZ A;  4JI7 M;  4PDI A;  3J80 S;  3PNV A;  4IBE A;  4MGI E;  3LVW A;  2C9C A;  2BV0 A;  1GKI A;  2F5N A;  3PCA A;  4LJ5 A;  1QAO A;  4NSO B;  4AZF A;  1GLN A;  4TUW A;  1YKL A;  2UUB M;  2G8L A;  4ITQ A;  1G41 A;  4LF6 M;  2KW0 A;  2L7I A;  4AG5 A;  1TH4 A;  1X37 A;  2I7N A;  3K2L A;  4AKG A;  3H4M A;  3RGP A;  4R7G A;  5E26 A;  3J2P B;  2CE7 A;  4FWG A;  4GC9 A;  3HJ8 A;  3W0F A;  4DR6 M;  3UJN A;  1IN4 A;  3HHY A;  5F3W A;  1OJL A;  3ZH9 B;  3A42 A;  1IQP A;  3DA1 A;  4OVZ A;  3K92 A;  4JN6 A;  2O5R A;  4P16 A;  1MX0 A;  1EOB A;  2C96 A;  1FNN A;  2EA0 A;  1K3W A;  2OQ4 A;  2DWL A;  4X66 M;  5FLX S;  2ZBK B;  2DVW B;  3FYC A;  2J7O A;  3PCE M;  4L8R C;  1OFI A;  2DWZ B;  4K0K M;  1E9S A;  5H37 D;  1QQW A;  4WHS A;  4YHH M;  1EO9 A;  4WHP A;  3FYD A;  4PCZ A;  3UZU A;  2DWN A;  3MV6 A;  1FJG M;  4RNA A;  3FUX A;  4LJA A;  1XMQ M;  1EOA A;  5FTN A;  4JI2 M;  4LCB A;  4LF9 M;  1NNJ A;  1SXJ D;  3GQ5 A;  3TWM A;  2BUU B;  3LMM A;  3U6C A;  1TGU A;  3SAV A;  1NSF A;  2BJW A;  2X8A A;  3KS8 A;  3HU3 A;  3QAU A;  3SBJ A;  1GL7 A;  3SAW A;  4DV1 M;  2BOY A;  3PCI M;  1W5T A;  3D8L A;  5ITX E;  1WXQ A;  2Y20 A;  3A46 A;  4DR1 M;  2DWM A;  2LWX A;  3FUU A;  2NQ8 C;  4KLN A;  3GPU A;  1HNX M;  1NJF A;  5ITU A;  3LXV A;  3OTO M;  4DR5 M;  2UUC M;  3HHW A;  2L6O A;  1EOC A;  4IBB A;  5EP2 A;  3HU2 A;  2AHM A;  1D2N A;  3PCE A;  2LNH C;  1DLM A;  2L09 A;  1N34 M;  3T63 M;  5KPZ A;  1ORY B;  1IBM M;  2BUR A;  1IY0 A;  3FTF A;  4HL4 A;  4DV5 M;  4AG6 A;  2YQZ A;  4IBF A;  3AV0 A;  2G5G X;  1YKN A;  4R3D A;  4DV7 M;  3R9X B;  4W5W A;  4OW0 A;  2BUR B;  1J5E M;  3VFD A;  1JR3 A;  1PJJ A;  3MV4 A;  3PNY A;  3J7A S;  3TWK A;  3VLF B;  3HHZ A;  2CEA A;  1NJG A;  4IIW A;  3AOE C;  1QAM A;  2V1C A;  3AFH A;  4NOO B;  3T15 A;  1XNQ M;  2UXC M;  5IWA M;  4G4N A;  4WHO B;  1HNW M;  3CTW B;  1NY5 A;  4IBJ A;  4QNM A;  4GRI A;  2FE8 A;  2K47 A;  1L2B A;  1LV7 A;  5BPV A;  5ITX A;  4MB7 A;  2V6Z M;  2QPA A;  3PCC A;  1IM2 A;  4IBD A;  3PCC M;  1XHB A;  2F5Q A;  4JV5 M;  3PVS A;  4QHT A;  2CHQ A;  4XBO A;  4LJ9 A;  1Z5A A;  4D82 A;  3UGJ A;  2KZS A;  3THG A;  1YKO A;  2I7P A;  2OPF A;  3T1Y M;  1GL6 A;  2FOI C;  1EOC B;  5TD3 A;  3KOX E;  3FD9 A;  2ZAO A;  3MV4 M;  2CHV A;  1VDD A;  1KFV A;  3RFW A;  5DYI A;  2XSU A;  2DHR A;  2QCU A;  3AOE A;  2XGN A;  2KA6 B;  4KOD A;  3FTC A;  3A45 A;  4REZ A;  4G4R A;  4LJ6 A;  3WHL A;  1R2Z A;  2CV1 A;  1EE8 A;  3SAT A;  1IXR C;  5GKN A;  3PCH A;  3KVW A;  4LFA M;  4WHR A;  2D7G A;  1G3I A;  4KO8 A;  4JI0 M;  1G59 A;  5DNY A;  3GRR A;  4QOS A;  4AW4 A;  4FVM A;  4GIP A;  1QZM A;  4FW9 A;  3T38 A;  3U6D A;  2BUZ A;  3ILK A;  4IBI A;  1C1K A;  4WHO A;  4WHS B;  3U6P A;  3I51 A;  4NL4 H;  1T3T A;  3TH1 A;  2H1R A;  4A3V B;  4XGI A;  2XF3 A;  4WUR A;  5E6J A;  3GLF B;  1MU5 A;  2BUY B;  4GMQ A;  1GVN A;  2BUZ B;  3MV6 M;  3C58 A;  3SHG B;  1Z6T A;  3VDP A;  4FWH A;  1S3S A;  3TE6 A;  4CHT B;  1E32 A;  4Z8X A;  3KOZ E;  1DGG A;  2R65 A;  4ZPX A;  5EXP A;  1YKO B;  3J27 B;  3JR4 A;  2UU9 M;  1K3X A;  3SMP A;  3GLF A;  2KEB A;  3I4Y A;  3TPZ A;  4RF1 A;  1R7R A;  4EIW A;  3MI1 M;  3HWS A;  1N36 M;  2YR0 A;  3E4R A;  3LKT M;  3LXV M;  2YFQ A;  1OFH A;  3EIH A;  4L16 A;  1IY2 A;  1HR0 M;  2DZO B;  3MK6 A;  1J09 A;  3AJI B;  1J7K A;  2CFO A;  1EO9 B;  5JI3 E;  3VK8 A;  4WHR B;  1S9A A;  3FTE A;  3MJ5 A;  4CGY B;  2QBY B;  3AOG A;  1DMH A;  1EOA B;  3PCN M;  2VQF M;  3T67 A;  3U6E A;  2W82 A;  4B3T M;  2PCD A;  4MGY E;  1XC8 A;  2BUU A;  3GQ4 A;  3VKG A;  1HQC A;  3SYL A;  4YY3 M;  3NBI A;  4LRS A;  4JI1 M;  3KS4 A;  1QAQ A;  1L1Z A;  3ZCB B;  4AKH A;  5DYG A;  3HKP A;  3PCF A;  1IN6 A;  3U5Z A;  3K1J A;  1PM5 A;  2X4A A;  1YKM A;  4BBA A;  2BUX A;  2M60 A;  3PCK M;  3HHX A;  3FUV A;  4GKJ M;  3PCI A;  4Z6Y A;  3K8Z A;  1IBK M;  2HL7 A;  4WW0 A;  4BLC A;  2F5P A;  3GPP A;  3SC3 A;  5EXS A;  1KSF X;  2RGO A;  4S12 A;  2R45 A;  2J7N A;  4DUY M;  3FUW A;  1SXJ E;  3HJQ A;  3T1H M;  3PCG M;  1I94 M;  2BUW B;  5KPT A;  4G4O A;  2AZQ A;  2C98 A;  3SFZ A;  3O32 A;  4IJE A;  3JAM S;  5ITY A;  5ITQ A;  2R46 A;  3VKH A;  4PDG A;  3GLI A;  1EOB B;  1ZAE A;  3GQ3 A;  3U6M A;  3PCL A;  3PCM M;  4I5S A;  1TDH A;  3PCL M;  4G4Q A;  2QP9 X;  4B7F A;  2FNA A;  2HCB A;  3NWL A;  3TL4 X;  3JR5 A;  4MGH A;  4X62 M;  1ZQ9 A;  1XWI A;  4FD2 A;  4D81 A;  3GLI B;  4DR2 M;  4WHR F;  3W0L B;  4LF8 M;  1IN8 A;  1IXZ A;  3GLH B;  1UM8 A;  3KP0 E;  1JQJ C;  5ITR A;  1L2C A;  1YKL B;  4LGM A;  4WHP B;  2QEN A;  4LY6 A;  3UK6 A;  2KRU A;  1I4W A;  3U6O A;  3L27 A;  4WHP D;  1Q3B A;  2QZ4 A;  2RKO A;  3MI1 A;  3PCB A;  4MM3 B;  3GO8 A;  4WHS D;  2Z3X A;  2ZAN A;  8CAT A;  4M0D A;  3EIE A;  4GKK M;  5IZ7 D;  3U61 A;  2R62 A;  4M9S A;  3LVV A;  3M7G A;  5C1B A;  2RGH A;  3L2A A;  4GH9 A;  2LH0 A;  3KDS E;  1L1T A;  4MGZ E;  3HGI A;  3PCJ M;  2BNK A;  4DV0 M;  3MFL M;  1N77 A;  2UUA M;  3B9P A;  2P5T A;  1DGH B;  2XH9 A;  3U6S A;  1W5S A;  5ITT A;  1SXJ C;  4AI6 A;  3SYK A;  1G4A E;  2M5Z A;  3PCK A;  3PCF M;  4DV2 M;  2D7H A;  3CF0 A;  4M9X A;  1N78 A;  1YKN B;  1YKP A;  3LMX M;  5A2Q S;  1NHW C;  2XZU A;  4LJ7 A;  3PCG A;  1NNU C;  4QOZ C;  5FTM A;  4NSR A;  2CHG A;  4RF0 A;  4B3M M;  2BUT B;  1YE9 A;  4JI3 M;  3GP1 A;  1YUB A;  3PCD A;  2BV0 B;  4DV3 M;  3MFL A;  4PD2 A;  3PCM A;  2JA2 A;  3VDU A;  4M0W A;  3DZD A;  4DV6 M;  2BUT A;  1YKM B;  3R8F A;  2XFS A;  3KOW E;  2C5R A;  3D8B A;  3UMM A;  3SAR A;  3WHK A;  1IN7 A;  4NXM M;  2ZAM A;  2Z4S A;  3KXE C;  1JR3 D;  3O6R A;  4DR3 M;  1NY6 A;  2YNM D;  2F5O A;  4LFB M;  2C99 A;  3I4V A;  1DGH A;  4ILT A;  2HHH M;  1QVR A;  3LQR A;  4JI8 M;  4IJF A;  2KXE A;  4D80 A;  3LKT A;  4OVZ B;  1Q39 A;  4OU7 A;  4LF4 M;  3L29 A;  5LMU M;  2R18 A;  2UXB M;  3KSJ A;  2UXD M;  3VK7 A;  3GPY A;  3M6A A;  2L7H A;  2HKJ A;  3T67 M;  1DO0 A;  4DR4 M;  1DGB A;  5KO3 A;  4B3S M;  4LRT A;  3U6Q A;  2XLJ A;  5EXT A;  3U6L A;  2BUX B;  4II7 A;  4X64 M;  1PJI A;  4WHQ A;  4L15 A;  3M0E A;  5EJC A;  1SXJ A;  3FUT A;  3IG8 A;  2XZF A;  3RGS A;  3J7B A;  2BUY A;  4JYA M;  1TH2 A;  2BUM B;  4WHQ B;  1NVM A;  4FWD A;  3ZC7 B;  4GHA A;  4WHO D;  3O5U A;  4IBC A;  4DR7 M;  2XSR A;  1N32 M;  2A5Y B;  4LF5 M;  1SXJ B;  2F4V M;  3U61 B;  2BUM A;  3KFU G;  4QHS A;  1E9R A;  4CIS A;  1DLQ A;  2Z7J A;  1H6U A;  3E9S A;  2X49 A;  7CAT A;  2XFT A;  3HJS A;  4LFC M;  4QNR A;  5EP4 A;  5EP1 A;  3HU1 A;  2F5S A;  4KHP M;  1TDZ A;  4B7G A;  2EUC A;  3GLH A;  2E5L M;  3SMS A;  1E94 E;  4MH0 E;  5FTL A;  5KPR A;  1L8Q A;  1KYI A;  4ILV A;  4AKI A;  4AQY M;  3TQS A;  4B7H A;  1QAN A;  5BR8 M;  1EO2 A;  3GRY A;  1R6B X;  2C9O A;  1N75 A;  5FTK A;  3U60 A;  4DUZ M;  4IBK A;  3RE8 A;  1IY1 A;  2Q2E B;  4L4U A;  4NXN M;  3L25 A;  4IBG A;  3PCB M;  1K82 A;  3CF2 A;  2V1U A;  5FTJ A;  1HQY E;  2BUV B;  3GPX A;  2XSZ D;  3KSX A;  3FTD A;  2R4J A;  2KZU A;  2CUZ A;  3DOA A;  3KOY E;  3IG5 A;  2XSV A;  4FCV A;  3GLG B;  4I4L A;  2Y21 A;  2BUW A;  4JI4 M;  3KW6 A;  1G8P A;  5EQT A;  2CV2 A;  4JI6 M;  1HT1 E;  4FCW A;  2R4E A;  4BB9 A;  4G6Z A;  4LF7 M;  3BOS A;  5FSW A;  4HLQ A;  3MI5 A;  3PCN A;  3LQQ A;  4NRW A;  2PCD M;  1IXS B;  3J81 S;  1IN5 A;  4LJ8 A;  2FFJ A;  3GLG A;  3PCA M;  5EP3 A;  2KRK A;  4JI5 M;  3FKE A;  1YKK A;  5KQ8 A;  1XMO M;  4I8O A;  2VQE M;  1DGF A;  2XEP A;  2DXI A;  4LZZ A;  4B3R M;  5IT9 S;  1EO2 B;  3U60 B;  3AKZ A;  4NRV A;  3U5Z B;  3O6J A;  5KQD A;  2EO2 A;  5C18 A;  4JXJ A;  1N33 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...