3HGIA

Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
258
structure length
258
Chain Sequence
ERATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
total genus 69
structure length 258
sequence length 258
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hgiA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hgiA02
3PCCM 4WHPA 1EOBA 3PCLA 3LMXM 3PCCA 3HGIA 1YKNA 3O5UA 3PCKM 3HJ8A 2PCDA 3PCKA 1EOCB 3O32A 1EO9B 1EO9A 3PCGM 4ILVA 3HKPA 3LKTA 3PCEA 4WHSB 2BUYA 3PCNM 4WHSA 3PCHM 1DLTA 3HJSA 1DLMA 2BUQA 3TH1A 4WHRB 3T67M 2BUUB 3PCDM 2BOYA 2BUUA 1EOAB 3LMXA 3PCAM 3I4VA 3T67A 3PCDA 1DLQA 3PCAA 3I51A 1YKKB 1EOCA 1EO2B 1YKKA 2BUZB 2BURB 3MFLM 1EO2A 2BURA 4WHRF 3PCBM 3PCMM 2XSVA 3MFLA 4WHOD 3O6RA 3PCGA 1S9AA 3PCBA 3T63M 3I4YA 1YKLB 1YKLA 1YKPB 3PCJM 3T63A 3PCNA 1YKPA 4WHPD 3PCJA 4WHRA 3PCHA 2XSRA 3PCFM 1YKMB 1EOAA 3HJQA 1YKMA 3PCFA 1DMHA 3MI1M 2BUVB 3LXVM 2BUVA 3MV4M 3MV6M 2BUTB 3MI1A 3HHYA 2BUZA 3MV4A 3MV6A 1EOBB 3MI5M 3PCMA 1YKNB 4WHSD 3MI5A 3O6JA 2PCDM 5TD3A 4WHQB 4WHQA 2AZQA 3N9TA 1YKOB 1YKOA 2BV0B 3PCIM 2BUXB 3LKTM 3PCEM 4WHOB 2BUWB 2BV0A 2BUXA 4WHOA 2BUWA 4ILTA 3PCIA 2BUYB 3HHXA 3LXVA 2BUTA 2BUMB 2XSUA 1TMXA 2BUQB 3PCLM 2BUMA 4WHPB
chains in the Genus database with same CATH superfamily
1IXZA 4FWHA 4DR2M 2YQZA 3CF2A 4NRVA 1OKSA 3GPPA 1IN8A 1FNNA 2UXCM 3PCCA 1IQPA 2OO9A 5KPRA 4AG5A 1V33A 1Z59A 3SHFA 3GLGB 3KSXA 3LQRA 5KPTA 1ZMWA 3HJ8A 3B89A 3W67A 5DYGA 3PCKA 2OQ4A 2XFSA 3U6EA 3NBIA 3KFUG 2QNJA 5E26A 3FD9A 2JWSA 4QHTA 4LCBA 3TE6A 3WHLA 4M0WA 2GQFA 2KEBA 4QNMA 4BBAA 4R3DA 1PGYA 4FCTA 3DZDA 4YHHM 1N34M 2D7HA 3Q8XA 3VLFB 2XF3A 2HHHM 2KZSA 4RKUF 3ZQJA 3L27A 1N32M 5BPVA 3PCEA 4IBKA 3HY5A 2UXBM 2BUYA 2R65A 3SMPA 3PCNM 1D0LA 2BWBA 2DAMA 3KDSE 1T43A 3GRVA 3MK6A 4LF8M 4GITA 3KS8A 3DOAA 4Z8XA 1TGUA 3GPXA 1N36M 2JY5A 3THGA 3PCDM 4KLNA 3CF6E 5ITYA 4B7FA 1DO2A 4FCVA 7CATA 5ITRA 1XMOM 1MU5A 1K82A 1R2YA 2FNAA 4NSOB 4EIWA 4OVZA 4X64M 4LF4M 2Y20A 4GIPA 1A5TA 1W5TA 3FE3A 2XFTA 3GRRA 1XMQM 2VIIA 1EOCA 1EO2B 1YKOA 3C3EA 2G5GX 3LMMA 3RGSA 3MFLM 1G3IA 1TDZA 1TR8A 3B7ZA 2D7EA 4XK8F 4DBGB 2BURA 1R5LA 3FUXA 1E94E 1VEKA 2CE7A 2DAKA 2MH8A 3U61A 4JI1M 2AHMA 1S9AA 2RGHA 1IFYA 3QWLA 2E5LM 1TF0B 2KRUA 3GLIB 1GL7A 1DV0A 1YKPB 2J7NA 3U5ZA 1P3QQ 1YE9A 1L2CA 3FYCA 1Q3CA 3PCHA 1V34A 4L16A 1OFIA 2XSRA 3E46A 1QAOA 1R4GA 3FTEA 1WHCA 2CFOA 5IT9S 3GPYA 2F4VM 1EOAA 1OJLA 1WR1B 3ZC7B 1YKMA 2KDLA 1ZAEA 5BR8M 3TWMA 3L28A 2ERCA 4BB9A 2BUVB 4UN2B 3VDPA 1E9RA 1DGFA 2L7IA 3SARA 2X8AA 3DA1A 2UUBM 3MV6M 2LNHC 2QBYA 5FTLA 3KVWA 1DGBA 3IG8A 3U6SA 2BUZA 3GRYA 1GJTA 2DENA 4I8OA 3MV4A 1HNXM 1QYRA 3K9PA 3U6DA 1IY2A 4NRWA 1EOBB 4RF0A 1XXHB 2I7PA 4II7A 4JI0M 3GLHA 3PCMA 1SXJC 3W68A 2LVQD 3TQSA 1YKNB 3J81S 4NXMM 3LW5F 4IBFA 4WHSD 2Z4SA 3EIEA 5TD3A 3W0FA 4FVMA 3B7QA 2C9OA 1IN5A 3AOEA 2FH0A 4WHQB 1Z5CA 3JAMS 2EUCA 5ITXE 1DGHB 2LH0A 4NSRA 3U6LA 3SHGB 3JR4A 1OAIA 1YKOB 4JI8M 1ORYB 1GKIA 3H4MA 2DAEA 3SFZA 4G4OA 4GHLA 3PCIM 4WHOB 1TH4A 4AI6A 2J5YA 1XNQM 2BV0A 1OIPA 2H1RA 2JY7A 2OPFA 2CV2A 3BOSA 4LJ9A 1K3XA 2KXEA 1YLAA 1IXSB 4MB7A 4KHPM 2BUMB 1PJJA 4MGZE 3KW6A 1SXJD 2YNMD 4MGHA 5EP2A 5LMNM 4DR1M 2BUQB 3PCLM 4WHPA 1QDTA 1SXJE 4JI7M 2ZAOA 1NY5A 4G3OA 3U6QA 3J7BA 4B3RM 3AJIB 3E9SA 4L15A 4CJ6A 1N77A 4L6V6 3GLGA 3FTDA 4IBGA 1NSFA 2JNHA 2UU9M 3FRIA 1L2BA 1Q39A 5C18A 1D0MA 3O32A 2V6ZM 3BXWA 1EO9B 4G4RA 5DYIA 2DHYA 3ZH9B 3NBXX 3PCGM 2CUZA 2KNZA 2XGNA 2G3QA 2CP8A 2YR0A 3HKPA 4M0DA 5EXPA 1HJPA 4JI6M 3LKTA 4F1IA 2QZ4A 2Z7JA 4HLQA 4GMQA 3KS4A 4CHTB 3TPZA 2JXNA 4X62M 2MGWA 3HJSA 4KODA 2I7NA 4LZZA 1TH2A 3KSJA 1L1ZA 2FS1A 2Z8YM 3T67M 1T3TA 4LZJA 2Z4RA 2CWBA 4W5WA 3T38A 4LG2A 4JV5M 2O25A 3CGWA 1QZMA 4HEOA 3LMXA 2Q2EB 3PCDA 2FOIC 2R62A 2JUJA 2ZTCA 3PVSA 2XZUA 4JI2M 1HNWM 1DLQA 4LF6M 4LJ8A 2WSFF 3I51A 5FTNA 2CHVA 3DFZA 3HU1A 3QAUA 2CV1A 1YKKB 2DWLA 1EO2A 3KOYE 5DFLA 1JR3D 3AFHA 1BVSA 3QYEA 1DO0A 1ZV1A 5EXXA 3MFLA 3PCAM 2DKLA 3O6RA 1NNUC 3FUVA 1IM2A 1JR3E 4Y28F 4IBCA 3U6PA 4DV0M 1PRBA 2RGOA 1YKLB 1IXRC 2EKKA 2VF8A 3HHWA 3U60B 3GLFA 3GLIA 1NVMA 4NXNM 1YKPA 4YY3M 1J09A 4WHRA 2JY8A 2K0BX 4RF1A 3SC3A 3KOXE 3PCFM 1S3SA 4LJ4A 3RGPA 3WHKA 3HWSA 3HJQA 2CRUA 5KPZA 1NO1A 3R8FA 3K2LA 1FJGM 3LXVM 4LFBM 4AG6A 2BUVA 3PXGA 3GRUA 5ITUA 4MH0E 2R0IA 1HT1E 4FW9A 3M7GA 4CISA 3HHYA 1R2ZA 1HNZM 2BUTB 3K8ZA 1OIZA 2DWZB 4L4UA 4AW4A 3MV6A 3Q8GA 4CGYB 1N33M 1OTRA 2Y0QA 3KP1E 3L25A 1XXHA 4CIZA 1QAMA 4GHAA 2M60A 3O6JA 1IN6A 2R45A 1C1KA 3KOZE 2V1CA 5C1BA 2H5XA 3M6AA 4D80A 4WHQA 1D0KA 4MGIE 4LFAM 2UUAM 3N9TA 1DGHA 4KO8A 2XSZA 2FE8A 2QCUA 4IJFA 3EIHA 3VFDA 2QENA 2XEPA 3PFIA 4MGKE 4IJEA 3T6PA 1XNRM 4AKGA 3PCEM 1OFHA 2C9CA 4WHOA 2EA0A 3PCIA 2BUYB 3HHXA 4P17A 3ZCBB 4JI4M 4I4LA 3R9XB 4DR4M 1WXQA 3QYBA 1NNJA 2XSUA 2F5QA 3FKEA 3RE8A 1TMXA 2BUMA 4S12A 2L6OA 3FYDA 4QNRA 3PCLA 3BBZA 4OX9M 4XGIA 3V76A 2QHOB 3HGIA 1ZQ9A 4I81A 3L26A 2CHGA 3T1HM 3E21A 2KZUA 2BJVA 2MR9A 4DUZM 2F5SA 4JI3M 1GO5A 3A46A 1I4WA 3LVWA 2VQFM 4Z6YA 4IBJA 3FRHA 4LJAA 1AIPC 1SG9A 2XLJA 2CV0A 3SASA 3IHPA 4AKHA 2PCDA 1D2NA 3MMPA 2DAIA 3AOEC 2APLA 1EOCB 3LVVA 2C96A 1TH3A 1E9SA 5EP1A 1L2DA 1XHBA 1NV9A 1EO9A 4LJ5A 4LF7M 4TUWA 4KT0F 1KYIA 4B7GA 3HHZA 2L2DA 2N35A 1K3WA 3UJNA 1R6BX 4WHSB 2NQ8C 3TWLA 3CF0A 4QHSA 4DR3M 4AKIA 5FTJA 5IZ7D 4PCZA 2LWXA 3F92A 4M9SA 1VEJA 3PCHM 3U6MA 2OOBA 3UGJA 3TH1A 4MM3B 3VDUA 5JI3E 1Z6TA 4D81A 2KA6B 2BUUB 2DI0A 2C5RA 1DGGA 2VF7A 3GLHE 1GVNA 1RU3A 3IECA 3TL4X 1EOAB 2BOYA 1IN7A 3I4VA 4FWGA 4OU7A 1VDLA 3C3DA 1OAOC 1L8QA 4QOSA 3T15A 3HU3A 2ZAMA 2P5TA 2F5PA 1PJSA 2JP7A 5EXSA 4WW0A 1HT2E 2F5NA 4IBDA 3U6CA 4DUYM 1YKKA 2BUZB 2YFQA 2UUCM 4DV7M 1SXJB 5F3WA 2HAKA 2K9DA 3PCBM 3PCMM 4DV1M 2XSVA 4Q7JA 1GL6A 3GLHB 3KOWE 1KSFX 1MX0A 3T63M 1IY0A 2DZLA 3T1YM 3SAVA 1YSYA 1R7RA 1YKLA 3A45A 3PCJM 1LV7A 3PCNA 2F5OA 1GLNA 2L4FA 3U60A 3UMMA 3D8LA 2J7OA 2A5YB 3SATA 4WHPD 2ZTDA 1XB2B 2DWNA 2CHQA 4PDGA 2EKFA 3B74A 2MROB 3KXEC 2R46A 4WHPB 1WGLA 1TDHA 3FUUA 3PCFA 3PNVA 2QPAA 3K92A 3MI1M 4D82A 4B3TM 3LCVB 1NHGC 5EQTA 4F2LA 4B08A 4QOZC 3E4RA 4HL4A 4NOOB 4JXJA 1V92A 2HWJA 1IBMM 1QDRA 2QSFX 2Y0TA 3TWKA 2JA2A 1JQJC 2G8LA 2KW0A 2B3TA 2X4AA 4LY6A 5FSWA 4JYAM 2LBCA 2R44A 2WSCF 3MI5M 2L09A 3I01M 4DV6M 5ITQA 4ZPXA 1ZMVA 4LF5M 1C7YA 2LHGA 5FTKA 4ITQA 1G8PA 2WSEF 1QZEA 4DV5M 1Z5BA 4BLCA 1QVRA 4I5SA 4GC5A 2WZJA 3GQ5A 4IBIA 4GH9A 2AZQA 2JY6B 3AKZA 3J80S 2DWMA 4RNAA 1I94M 1IY1A 2JZ1A 2BWEA 1XC8A 2HCBA 3A42A 2BUXB 4DV4M 3LKTM 2BUWB 4G4NA 4AQYM 8CATA 3K1JA 2XZFA 2XH9A 3SYKA 4JI5M 3ILKA 3MJ5A 4PD2A 5ITTA 3IG5A 1J5EM 2X49A 2GNOA 1N78A 5EJCA 4FCWA 3PCCM 3LCUA 3HU2A 3HZJA 1EOBA 3C58A 2DAGA 4X66M 2L4EA 3LMXM 1E32A 1PJQA 2ZBKB 2C98A 1NHWC 1YKNA 3O5UA 3B9PA 3L29A 2LVNC 3PCKM 1T6OA 3VK7A 2ZM6M 3HX3A 2DVWB 3GLFE 2O5RA 4LRTA 2LVAA 3GLIE 3SBJA 1VQ1A 2HL7A 1LTMA 1Y8GA 1QANA 1HR0M 1PJTA 1NV8A 4ILVA 3GPUA 5KQ8A 1H6UA 3VKGA 3M0EA 1NJGA 1PJIA 4GKJM 4DV2M 4GEWA 2DZNB 2UXDM 3NWLA 4IIWA 4WHSA 1L1TA 3GLFB 1NY6A 1IXSA 2V1UA 4L8RC 1QUSA 1DLTA 1EFUB 1DLMA 2BUQA 5ITXA 4WHRB 2LHCA 5E6JA 1GABA 5H37D 3K9OA 4NC6A 4B3SM 1GJSA 2KNVA 1XWIA 2BNKA 2EJSA 3FUWA 5EP4A 4B7HA 1XXHE 2BUUA 1YUBA 4NL4H 1PM5A 1KFVA 2DNAA 4LGYA 4PDIA 4OVZB 2R6FA 2PCDM 3C9PA 4R71A 3B7NA 3D8BA 4GC9A 5FTMA 5DNYA 3U6OA 3PCAA 3SYLA 3UZUA 2R18A 4ANRA 5JI2E 5KQDA 4M9XA 2DZOB 4IBBA 4LJ7A 4M9ZA 1TTEA 4GRIA 2XSZD 4G6ZA 1G59A 1IBLM 2BURB 2KHHA 4PT5A 4WHRF 1UFZA 3GQ3A 3J27B 1SXJA 3U61B 3FUTA 4WHOD 3PCGA 1Q3BA 5A2QS 4A3VB 3PCBA 3FTCA 3I4YA 3VKHA 1QUTA 2LVPC 1HQYE 3UK6A 1F4IA 3U5ZB 1QQWA 2QP9X 1EIJA 3T63A 2VDBB 3GP1A 4REZA 2Z3XA 2K47A 3PCJA 3J7AS 1MJGM 2Y21A 4FD2A 2L7HA 5EXTA 3SMSA 4AZFA 2VQEM 2M5ZA 2HKJA 1J7KA 5IWAM 4XBOA 2KRKA 1YKMB 1N75A 2KNAA 1HQCA 4LGMA 4WURA 1DMHA 4JN6A 4MGYE 3PNYA 2FFJA 3KP0E 4LJ6A 2EO2A 2LTUA 5FLXS 2QBYB 4DR6M 3MV4M 1ZMUA 3MI1A 3AV0A 2C99A 4B3MM 3A98B 3VK8A 1G4AE 2K6BA 4X65M 2O01F 1VEGA 1WIVA 5IREB 3SAWA 2CEAA 1G41A 1JB0F 1Z5AA 1CUKA 3L2AA 4G4QA 1NJFA 1UM8A 4IBEA 1QAQA 3JR5A 3MHVC 4WP2A 4K0KM 1IBKM 1X37A 3MI5A 3T67A 1Q02A 4GKKM 3GQ4A 5L8RF 1VG5A 5LMUM 5KO3A 2LXEA 4LRSA 4R7GA 3GO8A 4DV3M 3AL0C 1OQYA 4DR7M 2MJ5B 3I04M 1G71A 2OOAA 1W5SA 2R4JA 2D7GA 4P16A 4LF9M 2QQ8A 3OTOM 1MN3A 3H4JA 4LFCM 1AUAA 2BJWA 3LQQA 3W0LB 1EE8A 1JR3A 2BV0B 2DXIA 3GLGE 3RFWA 2BUXA 2DHRA 4OW0A 5GKNA 4DR5M 3SAUA 2BUWA 4ILTA 4L78A 3AOGA 2R4EA 5EP3A 3LXVA 2JZ0A 2RRUA 2BUTA 3CTWB 1IN4A 3J2PB 1VDDA 1WGNA 4FWDA 2W82A 2RKOA 1WJ7A 2LVOC 3FTFA 2ZANA
chains in the Genus database with same CATH topology
1IXZA 4FWHA 4DR2M 2YQZA 3CF2A 4NRVA 3GPPA 1IN8A 1FNNA 2UXCM 3PCCA 1IQPA 5KPRA 4AG5A 1Z59A 3SHFA 3GLGB 3KSXA 3LQRA 5KPTA 3HJ8A 5DYGA 3PCKA 2OQ4A 2XFSA 3U6EA 3NBIA 3KFUG 5E26A 3FD9A 3TE6A 4QHTA 4LCBA 3WHLA 1PJJA 4M0WA 2KEBA 4QNMA 4BBAA 4YHHM 4R3DA 1N34M 4FCTA 3DZDA 2D7HA 3Q8XA 3VLFB 2XF3A 2HHHM 2KZSA 3PCEA 3L27A 1N32M 5BPVA 4IBKA 2UXBM 2BUYA 2R65A 3SMPA 3PCNM 3KDSE 3MK6A 3GRVA 4LF8M 4GITA 3KS8A 3DOAA 4Z8XA 1TGUA 3GPXA 1N36M 3THGA 3PCDM 4KLNA 3CF6E 5ITYA 4B7FA 1DO2A 4FCVA 7CATA 5ITRA 1XMOM 1MU5A 1K82A 1R2YA 2FNAA 4NSOB 4EIWA 4OVZA 4X64M 4LF4M 2Y20A 4GIPA 1W5TA 3GRRA 1XMQM 2XFTA 2VIIA 1EOCA 1EO2B 2G5GX 3LMMA 3RGSA 3MFLM 1G3IA 1TDZA 2D7EA 2BURA 3FUXA 1E94E 2CE7A 3U61A 4JI1M 1S9AA 2AHMA 2RGHA 3QWLA 2E5LM 2KRUA 3GLIB 1GL7A 1YKPB 2J7NA 3U5ZA 1YE9A 1L2CA 3FYCA 1Q3CA 3PCHA 4L16A 1OFIA 2XSRA 1QAOA 3FTEA 2CFOA 5IT9S 3GPYA 2F4VM 1EOAA 1OJLA 3ZC7B 1YKMA 1ZAEA 5BR8M 3TWMA 3L28A 2ERCA 4BB9A 2BUVB 3VDPA 1E9RA 1DGFA 2L7IA 3SARA 2X8AA 3DA1A 2UUBM 3MV6M 2LNHC 2QBYA 5FTLA 3KVWA 1DGBA 3IG8A 3U6SA 2BUZA 3GRYA 4I8OA 3MV4A 1HNXM 1QYRA 3U6DA 1IY2A 4NRWA 1EOBB 4RF0A 1XXHB 2I7PA 4II7A 4JI0M 3GLHA 3PCMA 1SXJC 3TQSA 1YKNB 4WHSD 3J81S 4NXMM 4IBFA 2Z4SA 3EIEA 5TD3A 3W0FA 4FVMA 2C9OA 1IN5A 3AOEA 4WHQB 1Z5CA 3JAMS 2EUCA 5ITXE 1DGHB 2LH0A 4NSRA 3U6LA 3SHGB 3JR4A 1YKOB 4JI8M 3H4MA 1ORYB 1GKIA 3SFZA 4GHLA 4G4OA 3PCIM 4WHOB 1TH4A 4AI6A 1XNQM 2BV0A 2H1RA 2OPFA 2CV2A 3BOSA 4LJ9A 1K3XA 2KXEA 1IXSB 4MB7A 4KHPM 2BUMB 4MGZE 3KW6A 2YNMD 1SXJD 4MGHA 5EP2A 5LMNM 4DR1M 2BUQB 3PCLM 4WHPA 1SXJE 4JI7M 2ZAOA 1NY5A 3U6QA 3J7BA 4B3RM 3AJIB 3E9SA 4L15A 1N77A 3GLGA 3FTDA 4IBGA 1NSFA 2UU9M 1L2BA 1Q39A 5C18A 3O32A 2V6ZM 1EO9B 4G4RA 5DYIA 3ZH9B 3PCGM 2CUZA 2XGNA 4M0DA 2YR0A 3HKPA 5EXPA 4JI6M 3LKTA 2QZ4A 2Z7JA 4HLQA 4GMQA 3KS4A 4CHTB 3TPZA 4X62M 3HJSA 4KODA 2I7NA 4LZZA 1TH2A 3KSJA 1L1ZA 3T67M 1T3TA 4LZJA 2Z4RA 4W5WA 4JV5M 3T38A 4LG2A 3LMXA 1QZMA 2Q2EB 3PCDA 2FOIC 2R62A 3PVSA 1DLQA 4JI2M 1HNWM 4LF6M 4LJ8A 3I51A 5FTNA 2CHVA 3DFZA 3HU1A 3QAUA 2CV1A 1YKKB 2DWLA 1EO2A 3KOYE 1JR3D 3AFHA 1DO0A 5EXXA 3MFLA 3O6RA 1NNUC 3FUVA 1IM2A 4IBCA 3U6PA 4DV0M 2RGOA 1YKLB 1IXRC 3HHWA 3U60B 3GLFA 3GLIA 1NVMA 4NXNM 1YKPA 4YY3M 1J09A 4WHRA 4RF1A 3SC3A 3KOXE 3PCFM 1S3SA 4LJ4A 3RGPA 3WHKA 3HWSA 3HJQA 3R8FA 5KPZA 3K2LA 1FJGM 3LXVM 4LFBM 4AG6A 2BUVA 3PXGA 3GRUA 5ITUA 4MH0E 2BUTB 1HT1E 4FW9A 3M7GA 4CISA 3HHYA 1R2ZA 1HNZM 3K8ZA 2DWZB 4L4UA 4AW4A 3MV6A 4CGYB 1N33M 2Y0QA 3KP1E 3L25A 1XXHA 1QAMA 4GHAA 2M60A 3O6JA 1IN6A 2R45A 1C1KA 3KOZE 2V1CA 5C1BA 3M6AA 4D80A 4WHQA 4MGIE 4LFAM 2UUAM 3N9TA 1DGHA 4KO8A 2XSZA 2FE8A 2QCUA 4IJFA 3EIHA 3VFDA 2QENA 2XEPA 3PFIA 4MGKE 4IJEA 1XNRM 4AKGA 1YKOA 3PCEM 1OFHA 2C9CA 4WHOA 2EA0A 3PCIA 2BUYB 3HHXA 3ZCBB 4JI4M 4I4LA 3R9XB 4DR4M 1WXQA 1NNJA 2XSUA 2F5QA 3FKEA 3RE8A 1TMXA 2BUMA 4S12A 2L6OA 3FYDA 4QNRA 3PCLA 4OX9M 4XGIA 3T1HM 3HGIA 1ZQ9A 4I81A 3L26A 2CHGA 2KZUA 2BJVA 4DUZM 2F5SA 4JI3M 3A46A 1I4WA 3LVWA 2VQFM 4Z6YA 4IBJA 4LJAA 4AKHA 2PCDA 2XLJA 2CV0A 3SASA 1D2NA 3AOEC 1EOCB 3LVVA 2C96A 1TH3A 1E9SA 5EP1A 1L2DA 1XHBA 1EO9A 4LJ5A 4LF7M 4TUWA 1KYIA 4B7GA 3HHZA 1K3WA 3UJNA 1R6BX 4WHSB 2NQ8C 3TWLA 3CF0A 4QHSA 4DR3M 4AKIA 5FTJA 5IZ7D 4PCZA 2LWXA 4M9SA 3PCHM 3U6MA 3UGJA 3TH1A 4MM3B 3VDUA 5JI3E 1Z6TA 4D81A 2KA6B 2BUUB 2C5RA 1DGGA 3TL4X 1GVNA 2BOYA 1EOAB 3PCAM 1IN7A 3I4VA 4FWGA 4OU7A 4QOSA 3T15A 3T67A 1L8QA 3HU3A 2ZAMA 2P5TA 2F5PA 5EXSA 4WW0A 1HT2E 2F5NA 4IBDA 3U6CA 4DUYM 1YKKA 2BUZB 2YFQA 2UUCM 4DV7M 1SXJB 5F3WA 3PCBM 3PCMM 4DV1M 2XSVA 1GL6A 3GLHB 3KOWE 1KSFX 1MX0A 3T63M 1IY0A 3T1YM 3SAVA 1YSYA 1R7RA 1YKLA 3A45A 3PCJM 1LV7A 3PCNA 2F5OA 1GLNA 3U60A 3UMMA 3D8LA 2J7OA 2A5YB 3SATA 4WHPD 2DWNA 2CHQA 4PDGA 3KXEC 2R46A 4WHPB 1TDHA 3FUUA 3PCFA 3PNVA 2QPAA 3K92A 3MI1M 4D82A 4B3TM 1NHGC 5EQTA 4B08A 4QOZC 3E4RA 4HL4A 4NOOB 4JXJA 1IBMM 2Y0TA 3TWKA 2JA2A 1JQJC 2G8LA 2KW0A 2X4AA 4LY6A 5FSWA 4JYAM 3MI5M 2L09A 4DV6M 5ITQA 4ZPXA 4LF5M 4ITQA 5FTKA 1G8PA 4DV5M 1Z5BA 4BLCA 1QVRA 4I5SA 4GC5A 3GQ5A 4IBIA 4GH9A 2AZQA 3AKZA 3J80S 2DWMA 4RNAA 1I94M 1IY1A 1XC8A 2HCBA 3A42A 2BUXB 4DV4M 3LKTM 2BUWB 4G4NA 4AQYM 8CATA 3K1JA 2XZFA 2XH9A 3SYKA 4JI5M 3ILKA 3MJ5A 4PD2A 5ITTA 3IG5A 1J5EM 2X49A 1N78A 5EJCA 4FCWA 3PCCM 3HU2A 1EOBA 3C58A 4X66M 3LMXM 1E32A 2ZBKB 2C98A 1NHWC 1YKNA 3O5UA 3B9PA 3L29A 3PCKM 3VK7A 2ZM6M 2DVWB 2O5RA 4LRTA 3SBJA 2HL7A 1QANA 1HR0M 4ILVA 3GPUA 5KQ8A 1H6UA 3VKGA 3M0EA 1NJGA 1PJIA 4GKJM 4DV2M 2UXDM 2DZNB 3NWLA 4IIWA 4WHSA 1L1TA 3GLFB 1NY6A 2V1UA 4L8RC 1DLTA 1DLMA 2BUQA 5ITXA 4WHRB 5E6JA 5H37D 4B3SM 1XWIA 2BNKA 3FUWA 4B7HA 5EP4A 2BUUA 1YUBA 4NL4H 1PM5A 1KFVA 4LGYA 4PDIA 4OVZB 4GC9A 3D8BA 5FTMA 5DNYA 3U6OA 3PCAA 3SYLA 3UZUA 2R18A 5JI2E 5KQDA 4M9XA 2DZOB 4IBBA 4LJ7A 4M9ZA 1IBLM 4GRIA 2XSZD 4G6ZA 1G59A 2BURB 4PT5A 4WHRF 3U61B 3GQ3A 3J27B 1SXJA 3FUTA 4WHOD 3PCGA 1Q3BA 5A2QS 4A3VB 3PCBA 3FTCA 3I4YA 3VKHA 1HQYE 3UK6A 3U5ZB 1QQWA 2QP9X 3T63A 3GP1A 4REZA 2Z3XA 2K47A 3PCJA 3J7AS 2Y21A 4FD2A 2L7HA 5EXTA 3SMSA 4AZFA 2VQEM 2M5ZA 2HKJA 1J7KA 5IWAM 4XBOA 2KRKA 1YKMB 1N75A 1HQCA 4LGMA 4WURA 1DMHA 4JN6A 4MGYE 3PNYA 2FFJA 3KP0E 4LJ6A 2EO2A 5FLXS 2QBYB 4DR6M 3MV4M 3MI1A 3AV0A 2C99A 4B3MM 3A98B 3VK8A 1G4AE 4X65M 5IREB 3SAWA 2CEAA 1G41A 1Z5AA 3L2AA 4G4QA 1NJFA 1UM8A 4IBEA 1QAQA 3JR5A 3MHVC 4K0KM 1IBKM 1X37A 3MI5A 4GKKM 3GQ4A 2XZUA 5LMUM 2PCDM 5KO3A 2LXEA 4LRSA 4R7GA 3GO8A 4DV3M 3AL0C 4DR7M 2R4JA 4P16A 1W5SA 4LF9M 2D7GA 3OTOM 4LFCM 2BJWA 3LQQA 3W0LB 1EE8A 1JR3A 2BV0B 2DXIA 3RFWA 2BUXA 2DHRA 4OW0A 5GKNA 4DR5M 3SAUA 2BUWA 4ILTA 4L78A 3AOGA 2R4EA 5EP3A 3LXVA 2BUTA 3CTWB 1IN4A 3J2PB 1VDDA 4FWDA 2W82A 2RKOA 3FTFA 2ZANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PCC M;  4WHP A;  1EOB A;  3PCL A;  3LMX M;  3PCC A;  3HGI A;  1YKN A;  3O5U A;  3PCK M;  3HJ8 A;  2PCD A;  3PCK A;  1EOC B;  3O32 A;  1EO9 B;  1EO9 A;  3PCG M;  4ILV A;  3HKP A;  3LKT A;  3PCE A;  4WHS B;  2BUY A;  3PCN M;  4WHS A;  3PCH M;  1DLT A;  3HJS A;  1DLM A;  2BUQ A;  3TH1 A;  4WHR B;  3T67 M;  2BUU B;  3PCD M;  2BOY A;  2BUU A;  1EOA B;  3LMX A;  3PCA M;  3I4V A;  3T67 A;  3PCD A;  1DLQ A;  3PCA A;  3I51 A;  1YKK B;  1EOC A;  1EO2 B;  1YKK A;  2BUZ B;  2BUR B;  3MFL M;  1EO2 A;  2BUR A;  4WHR F;  3PCB M;  3PCM M;  2XSV A;  3MFL A;  4WHO D;  3O6R A;  3PCG A;  1S9A A;  3PCB A;  3T63 M;  3I4Y A;  1YKL B;  1YKL A;  1YKP B;  3PCJ M;  3T63 A;  3PCN A;  1YKP A;  4WHP D;  3PCJ A;  4WHR A;  3PCH A;  2XSR A;  3PCF M;  1YKM B;  1EOA A;  3HJQ A;  1YKM A;  3PCF A;  1DMH A;  3MI1 M;  2BUV B;  3LXV M;  2BUV A;  3MV4 M;  3MV6 M;  2BUT B;  3MI1 A;  3HHY A;  2BUZ A;  3MV4 A;  3MV6 A;  1EOB B;  3MI5 M;  3PCM A;  1YKN B;  4WHS D;  3MI5 A;  3O6J A;  2PCD M;  5TD3 A;  4WHQ B;  4WHQ A;  2AZQ A;  3N9T A;  1YKO B;  1YKO A;  2BV0 B;  3PCI M;  2BUX B;  3LKT M;  3PCE M;  4WHO B;  2BUW B;  2BV0 A;  2BUX A;  4WHO A;  2BUW A;  4ILT A;  3PCI A;  2BUY B;  3HHX A;  3LXV A;  2BUT A;  2BUM B;  2XSU A;  1TMX A;  2BUQ B;  3PCL M;  2BUM A;  4WHP B; 
#chains in the Genus database with same CATH topology
 1IXZ A;  4FWH A;  4DR2 M;  2YQZ A;  3CF2 A;  4NRV A;  1OKS A;  3GPP A;  1IN8 A;  1FNN A;  2UXC M;  3PCC A;  1IQP A;  2OO9 A;  5KPR A;  4AG5 A;  1V33 A;  1Z59 A;  3SHF A;  3GLG B;  3KSX A;  3LQR A;  5KPT A;  1ZMW A;  3HJ8 A;  3B89 A;  3W67 A;  5DYG A;  3PCK A;  2OQ4 A;  2XFS A;  3U6E A;  3NBI A;  3KFU G;  2QNJ A;  5E26 A;  3FD9 A;  2JWS A;  4QHT A;  4LCB A;  3TE6 A;  3WHL A;  4M0W A;  2GQF A;  2KEB A;  4QNM A;  4BBA A;  4R3D A;  1PGY A;  4FCT A;  3DZD A;  4YHH M;  1N34 M;  2D7H A;  3Q8X A;  3VLF B;  2XF3 A;  2HHH M;  2KZS A;  4RKU F;  3ZQJ A;  3L27 A;  1N32 M;  5BPV A;  3PCE A;  4IBK A;  3HY5 A;  2UXB M;  2BUY A;  2R65 A;  3SMP A;  3PCN M;  1D0L A;  2BWB A;  2DAM A;  3KDS E;  1T43 A;  3GRV A;  3MK6 A;  4LF8 M;  4GIT A;  3KS8 A;  3DOA A;  4Z8X A;  1TGU A;  3GPX A;  1N36 M;  2JY5 A;  3THG A;  3PCD M;  4KLN A;  3CF6 E;  5ITY A;  4B7F A;  1DO2 A;  4FCV A;  7CAT A;  5ITR A;  1XMO M;  1MU5 A;  1K82 A;  1R2Y A;  2FNA A;  4NSO B;  4EIW A;  4OVZ A;  4X64 M;  4LF4 M;  2Y20 A;  4GIP A;  1A5T A;  1W5T A;  3FE3 A;  2XFT A;  3GRR A;  1XMQ M;  2VII A;  1EOC A;  1EO2 B;  1YKO A;  3C3E A;  2G5G X;  3LMM A;  3RGS A;  3MFL M;  1G3I A;  1TDZ A;  1TR8 A;  3B7Z A;  2D7E A;  4XK8 F;  4DBG B;  2BUR A;  1R5L A;  3FUX A;  1E94 E;  1VEK A;  2CE7 A;  2DAK A;  2MH8 A;  3U61 A;  4JI1 M;  2AHM A;  1S9A A;  2RGH A;  1IFY A;  3QWL A;  2E5L M;  1TF0 B;  2KRU A;  3GLI B;  1GL7 A;  1DV0 A;  1YKP B;  2J7N A;  3U5Z A;  1P3Q Q;  1YE9 A;  1L2C A;  3FYC A;  1Q3C A;  3PCH A;  1V34 A;  4L16 A;  1OFI A;  2XSR A;  3E46 A;  1QAO A;  1R4G A;  3FTE A;  1WHC A;  2CFO A;  5IT9 S;  3GPY A;  2F4V M;  1EOA A;  1OJL A;  1WR1 B;  3ZC7 B;  1YKM A;  2KDL A;  1ZAE A;  5BR8 M;  3TWM A;  3L28 A;  2ERC A;  4BB9 A;  2BUV B;  4UN2 B;  3VDP A;  1E9R A;  1DGF A;  2L7I A;  3SAR A;  2X8A A;  3DA1 A;  2UUB M;  3MV6 M;  2LNH C;  2QBY A;  5FTL A;  3KVW A;  1DGB A;  3IG8 A;  3U6S A;  2BUZ A;  3GRY A;  1GJT A;  2DEN A;  4I8O A;  3MV4 A;  1HNX M;  1QYR A;  3K9P A;  3U6D A;  1IY2 A;  4NRW A;  1EOB B;  4RF0 A;  1XXH B;  2I7P A;  4II7 A;  4JI0 M;  3GLH A;  3PCM A;  1SXJ C;  3W68 A;  2LVQ D;  3TQS A;  1YKN B;  3J81 S;  4NXM M;  3LW5 F;  4IBF A;  4WHS D;  2Z4S A;  3EIE A;  5TD3 A;  3W0F A;  4FVM A;  3B7Q A;  2C9O A;  1IN5 A;  3AOE A;  2FH0 A;  4WHQ B;  1Z5C A;  3JAM S;  2EUC A;  5ITX E;  1DGH B;  2LH0 A;  4NSR A;  3U6L A;  3SHG B;  3JR4 A;  1OAI A;  1YKO B;  4JI8 M;  1ORY B;  1GKI A;  3H4M A;  2DAE A;  3SFZ A;  4G4O A;  4GHL A;  3PCI M;  4WHO B;  1TH4 A;  4AI6 A;  2J5Y A;  1XNQ M;  2BV0 A;  1OIP A;  2H1R A;  2JY7 A;  2OPF A;  2CV2 A;  3BOS A;  4LJ9 A;  1K3X A;  2KXE A;  1YLA A;  1IXS B;  4MB7 A;  4KHP M;  2BUM B;  1PJJ A;  4MGZ E;  3KW6 A;  1SXJ D;  2YNM D;  4MGH A;  5EP2 A;  5LMN M;  4DR1 M;  2BUQ B;  3PCL M;  4WHP A;  1QDT A;  1SXJ E;  4JI7 M;  2ZAO A;  1NY5 A;  4G3O A;  3U6Q A;  3J7B A;  4B3R M;  3AJI B;  3E9S A;  4L15 A;  4CJ6 A;  1N77 A;  4L6V 6;  3GLG A;  3FTD A;  4IBG A;  1NSF A;  2JNH A;  2UU9 M;  3FRI A;  1L2B A;  1Q39 A;  5C18 A;  1D0M A;  3O32 A;  2V6Z M;  3BXW A;  1EO9 B;  4G4R A;  5DYI A;  2DHY A;  3ZH9 B;  3NBX X;  3PCG M;  2CUZ A;  2KNZ A;  2XGN A;  2G3Q A;  2CP8 A;  2YR0 A;  3HKP A;  4M0D A;  5EXP A;  1HJP A;  4JI6 M;  3LKT A;  4F1I A;  2QZ4 A;  2Z7J A;  4HLQ A;  4GMQ A;  3KS4 A;  4CHT B;  3TPZ A;  2JXN A;  4X62 M;  2MGW A;  3HJS A;  4KOD A;  2I7N A;  4LZZ A;  1TH2 A;  3KSJ A;  1L1Z A;  2FS1 A;  2Z8Y M;  3T67 M;  1T3T A;  4LZJ A;  2Z4R A;  2CWB A;  4W5W A;  3T38 A;  4LG2 A;  4JV5 M;  2O25 A;  3CGW A;  1QZM A;  4HEO A;  3LMX A;  2Q2E B;  3PCD A;  2FOI C;  2R62 A;  2JUJ A;  2ZTC A;  3PVS A;  2XZU A;  4JI2 M;  1HNW M;  1DLQ A;  4LF6 M;  4LJ8 A;  2WSF F;  3I51 A;  5FTN A;  2CHV A;  3DFZ A;  3HU1 A;  3QAU A;  2CV1 A;  1YKK B;  2DWL A;  1EO2 A;  3KOY E;  5DFL A;  1JR3 D;  3AFH A;  1BVS A;  3QYE A;  1DO0 A;  1ZV1 A;  5EXX A;  3MFL A;  3PCA M;  2DKL A;  3O6R A;  1NNU C;  3FUV A;  1IM2 A;  1JR3 E;  4Y28 F;  4IBC A;  3U6P A;  4DV0 M;  1PRB A;  2RGO A;  1YKL B;  1IXR C;  2EKK A;  2VF8 A;  3HHW A;  3U60 B;  3GLF A;  3GLI A;  1NVM A;  4NXN M;  1YKP A;  4YY3 M;  1J09 A;  4WHR A;  2JY8 A;  2K0B X;  4RF1 A;  3SC3 A;  3KOX E;  3PCF M;  1S3S A;  4LJ4 A;  3RGP A;  3WHK A;  3HWS A;  3HJQ A;  2CRU A;  5KPZ A;  1NO1 A;  3R8F A;  3K2L A;  1FJG M;  3LXV M;  4LFB M;  4AG6 A;  2BUV A;  3PXG A;  3GRU A;  5ITU A;  4MH0 E;  2R0I A;  1HT1 E;  4FW9 A;  3M7G A;  4CIS A;  3HHY A;  1R2Z A;  1HNZ M;  2BUT B;  3K8Z A;  1OIZ A;  2DWZ B;  4L4U A;  4AW4 A;  3MV6 A;  3Q8G A;  4CGY B;  1N33 M;  1OTR A;  2Y0Q A;  3KP1 E;  3L25 A;  1XXH A;  4CIZ A;  1QAM A;  4GHA A;  2M60 A;  3O6J A;  1IN6 A;  2R45 A;  1C1K A;  3KOZ E;  2V1C A;  5C1B A;  2H5X A;  3M6A A;  4D80 A;  4WHQ A;  1D0K A;  4MGI E;  4LFA M;  2UUA M;  3N9T A;  1DGH A;  4KO8 A;  2XSZ A;  2FE8 A;  2QCU A;  4IJF A;  3EIH A;  3VFD A;  2QEN A;  2XEP A;  3PFI A;  4MGK E;  4IJE A;  3T6P A;  1XNR M;  4AKG A;  3PCE M;  1OFH A;  2C9C A;  4WHO A;  2EA0 A;  3PCI A;  2BUY B;  3HHX A;  4P17 A;  3ZCB B;  4JI4 M;  4I4L A;  3R9X B;  4DR4 M;  1WXQ A;  3QYB A;  1NNJ A;  2XSU A;  2F5Q A;  3FKE A;  3RE8 A;  1TMX A;  2BUM A;  4S12 A;  2L6O A;  3FYD A;  4QNR A;  3PCL A;  3BBZ A;  4OX9 M;  4XGI A;  3V76 A;  2QHO B;  3HGI A;  1ZQ9 A;  4I81 A;  3L26 A;  2CHG A;  3T1H M;  3E21 A;  2KZU A;  2BJV A;  2MR9 A;  4DUZ M;  2F5S A;  4JI3 M;  1GO5 A;  3A46 A;  1I4W A;  3LVW A;  2VQF M;  4Z6Y A;  4IBJ A;  3FRH A;  4LJA A;  1AIP C;  1SG9 A;  2XLJ A;  2CV0 A;  3SAS A;  3IHP A;  4AKH A;  2PCD A;  1D2N A;  3MMP A;  2DAI A;  3AOE C;  2APL A;  1EOC B;  3LVV A;  2C96 A;  1TH3 A;  1E9S A;  5EP1 A;  1L2D A;  1XHB A;  1NV9 A;  1EO9 A;  4LJ5 A;  4LF7 M;  4TUW A;  4KT0 F;  1KYI A;  4B7G A;  3HHZ A;  2L2D A;  2N35 A;  1K3W A;  3UJN A;  1R6B X;  4WHS B;  2NQ8 C;  3TWL A;  3CF0 A;  4QHS A;  4DR3 M;  4AKI A;  5FTJ A;  5IZ7 D;  4PCZ A;  2LWX A;  3F92 A;  4M9S A;  1VEJ A;  3PCH M;  3U6M A;  2OOB A;  3UGJ A;  3TH1 A;  4MM3 B;  3VDU A;  5JI3 E;  1Z6T A;  4D81 A;  2KA6 B;  2BUU B;  2DI0 A;  2C5R A;  1DGG A;  2VF7 A;  3GLH E;  1GVN A;  1RU3 A;  3IEC A;  3TL4 X;  1EOA B;  2BOY A;  1IN7 A;  3I4V A;  4FWG A;  4OU7 A;  1VDL A;  3C3D A;  1OAO C;  1L8Q A;  4QOS A;  3T15 A;  3HU3 A;  2ZAM A;  2P5T A;  2F5P A;  1PJS A;  2JP7 A;  5EXS A;  4WW0 A;  1HT2 E;  2F5N A;  4IBD A;  3U6C A;  4DUY M;  1YKK A;  2BUZ B;  2YFQ A;  2UUC M;  4DV7 M;  1SXJ B;  5F3W A;  2HAK A;  2K9D A;  3PCB M;  3PCM M;  4DV1 M;  2XSV A;  4Q7J A;  1GL6 A;  3GLH B;  3KOW E;  1KSF X;  1MX0 A;  3T63 M;  1IY0 A;  2DZL A;  3T1Y M;  3SAV A;  1YSY A;  1R7R A;  1YKL A;  3A45 A;  3PCJ M;  1LV7 A;  3PCN A;  2F5O A;  1GLN A;  2L4F A;  3U60 A;  3UMM A;  3D8L A;  2J7O A;  2A5Y B;  3SAT A;  4WHP D;  2ZTD A;  1XB2 B;  2DWN A;  2CHQ A;  4PDG A;  2EKF A;  3B74 A;  2MRO B;  3KXE C;  2R46 A;  4WHP B;  1WGL A;  1TDH A;  3FUU A;  3PCF A;  3PNV A;  2QPA A;  3K92 A;  3MI1 M;  4D82 A;  4B3T M;  3LCV B;  1NHG C;  5EQT A;  4F2L A;  4B08 A;  4QOZ C;  3E4R A;  4HL4 A;  4NOO B;  4JXJ A;  1V92 A;  2HWJ A;  1IBM M;  1QDR A;  2QSF X;  2Y0T A;  3TWK A;  2JA2 A;  1JQJ C;  2G8L A;  2KW0 A;  2B3T A;  2X4A A;  4LY6 A;  5FSW A;  4JYA M;  2LBC A;  2R44 A;  2WSC F;  3MI5 M;  2L09 A;  3I01 M;  4DV6 M;  5ITQ A;  4ZPX A;  1ZMV A;  4LF5 M;  1C7Y A;  2LHG A;  5FTK A;  4ITQ A;  1G8P A;  2WSE F;  1QZE A;  4DV5 M;  1Z5B A;  4BLC A;  1QVR A;  4I5S A;  4GC5 A;  2WZJ A;  3GQ5 A;  4IBI A;  4GH9 A;  2AZQ A;  2JY6 B;  3AKZ A;  3J80 S;  2DWM A;  4RNA A;  1I94 M;  1IY1 A;  2JZ1 A;  2BWE A;  1XC8 A;  2HCB A;  3A42 A;  2BUX B;  4DV4 M;  3LKT M;  2BUW B;  4G4N A;  4AQY M;  8CAT A;  3K1J A;  2XZF A;  2XH9 A;  3SYK A;  4JI5 M;  3ILK A;  3MJ5 A;  4PD2 A;  5ITT A;  3IG5 A;  1J5E M;  2X49 A;  2GNO A;  1N78 A;  5EJC A;  4FCW A;  3PCC M;  3LCU A;  3HU2 A;  3HZJ A;  1EOB A;  3C58 A;  2DAG A;  4X66 M;  2L4E A;  3LMX M;  1E32 A;  1PJQ A;  2ZBK B;  2C98 A;  1NHW C;  1YKN A;  3O5U A;  3B9P A;  3L29 A;  2LVN C;  3PCK M;  1T6O A;  3VK7 A;  2ZM6 M;  3HX3 A;  2DVW B;  3GLF E;  2O5R A;  4LRT A;  2LVA A;  3GLI E;  3SBJ A;  1VQ1 A;  2HL7 A;  1LTM A;  1Y8G A;  1QAN A;  1HR0 M;  1PJT A;  1NV8 A;  4ILV A;  3GPU A;  5KQ8 A;  1H6U A;  3VKG A;  3M0E A;  1NJG A;  1PJI A;  4GKJ M;  4DV2 M;  4GEW A;  2DZN B;  2UXD M;  3NWL A;  4IIW A;  4WHS A;  1L1T A;  3GLF B;  1NY6 A;  1IXS A;  2V1U A;  4L8R C;  1QUS A;  1DLT A;  1EFU B;  1DLM A;  2BUQ A;  5ITX A;  4WHR B;  2LHC A;  5E6J A;  1GAB A;  5H37 D;  3K9O A;  4NC6 A;  4B3S M;  1GJS A;  2KNV A;  1XWI A;  2BNK A;  2EJS A;  3FUW A;  5EP4 A;  4B7H A;  1XXH E;  2BUU A;  1YUB A;  4NL4 H;  1PM5 A;  1KFV A;  2DNA A;  4LGY A;  4PDI A;  4OVZ B;  2R6F A;  2PCD M;  3C9P A;  4R71 A;  3B7N A;  3D8B A;  4GC9 A;  5FTM A;  5DNY A;  3U6O A;  3PCA A;  3SYL A;  3UZU A;  2R18 A;  4ANR A;  5JI2 E;  5KQD A;  4M9X A;  2DZO B;  4IBB A;  4LJ7 A;  4M9Z A;  1TTE A;  4GRI A;  2XSZ D;  4G6Z A;  1G59 A;  1IBL M;  2BUR B;  2KHH A;  4PT5 A;  4WHR F;  1UFZ A;  3GQ3 A;  3J27 B;  1SXJ A;  3U61 B;  3FUT A;  4WHO D;  3PCG A;  1Q3B A;  5A2Q S;  4A3V B;  3PCB A;  3FTC A;  3I4Y A;  3VKH A;  1QUT A;  2LVP C;  1HQY E;  3UK6 A;  1F4I A;  3U5Z B;  1QQW A;  2QP9 X;  1EIJ A;  3T63 A;  2VDB B;  3GP1 A;  4REZ A;  2Z3X A;  2K47 A;  3PCJ A;  3J7A S;  1MJG M;  2Y21 A;  4FD2 A;  2L7H A;  5EXT A;  3SMS A;  4AZF A;  2VQE M;  2M5Z A;  2HKJ A;  1J7K A;  5IWA M;  4XBO A;  2KRK A;  1YKM B;  1N75 A;  2KNA A;  1HQC A;  4LGM A;  4WUR A;  1DMH A;  4JN6 A;  4MGY E;  3PNY A;  2FFJ A;  3KP0 E;  4LJ6 A;  2EO2 A;  2LTU A;  5FLX S;  2QBY B;  4DR6 M;  3MV4 M;  1ZMU A;  3MI1 A;  3AV0 A;  2C99 A;  4B3M M;  3A98 B;  3VK8 A;  1G4A E;  2K6B A;  4X65 M;  2O01 F;  1VEG A;  1WIV A;  5IRE B;  3SAW A;  2CEA A;  1G41 A;  1JB0 F;  1Z5A A;  1CUK A;  3L2A A;  4G4Q A;  1NJF A;  1UM8 A;  4IBE A;  1QAQ A;  3JR5 A;  3MHV C;  4WP2 A;  4K0K M;  1IBK M;  1X37 A;  3MI5 A;  3T67 A;  1Q02 A;  4GKK M;  3GQ4 A;  5L8R F;  1VG5 A;  5LMU M;  5KO3 A;  2LXE A;  4LRS A;  4R7G A;  3GO8 A;  4DV3 M;  3AL0 C;  1OQY A;  4DR7 M;  2MJ5 B;  3I04 M;  1G71 A;  2OOA A;  1W5S A;  2R4J A;  2D7G A;  4P16 A;  4LF9 M;  2QQ8 A;  3OTO M;  1MN3 A;  3H4J A;  4LFC M;  1AUA A;  2BJW A;  3LQQ A;  3W0L B;  1EE8 A;  1JR3 A;  2BV0 B;  2DXI A;  3GLG E;  3RFW A;  2BUX A;  2DHR A;  4OW0 A;  5GKN A;  4DR5 M;  3SAU A;  2BUW A;  4ILT A;  4L78 A;  3AOG A;  2R4E A;  5EP3 A;  3LXV A;  2JZ0 A;  2RRU A;  2BUT A;  3CTW B;  1IN4 A;  3J2P B;  1VDD A;  1WGN A;  4FWD A;  2W82 A;  2RKO A;  1WJ7 A;  2LVO C;  3FTF A;  2ZAN A; 
#chains in the Genus database with same CATH homology
 1IXZ A;  4FWH A;  4DR2 M;  2YQZ A;  3CF2 A;  4NRV A;  3GPP A;  1IN8 A;  1FNN A;  2UXC M;  3PCC A;  1IQP A;  5KPR A;  4AG5 A;  1Z59 A;  3SHF A;  3GLG B;  3KSX A;  3LQR A;  5KPT A;  3HJ8 A;  5DYG A;  3PCK A;  2OQ4 A;  2XFS A;  3U6E A;  3NBI A;  3KFU G;  5E26 A;  3FD9 A;  3TE6 A;  4QHT A;  4LCB A;  3WHL A;  1PJJ A;  4M0W A;  2KEB A;  4QNM A;  4BBA A;  4YHH M;  4R3D A;  1N34 M;  4FCT A;  3DZD A;  2D7H A;  3Q8X A;  3VLF B;  2XF3 A;  2HHH M;  2KZS A;  3PCE A;  3L27 A;  1N32 M;  5BPV A;  4IBK A;  2UXB M;  2BUY A;  2R65 A;  3SMP A;  3PCN M;  3KDS E;  3MK6 A;  3GRV A;  4LF8 M;  4GIT A;  3KS8 A;  3DOA A;  4Z8X A;  1TGU A;  3GPX A;  1N36 M;  3THG A;  3PCD M;  4KLN A;  3CF6 E;  5ITY A;  4B7F A;  1DO2 A;  4FCV A;  7CAT A;  5ITR A;  1XMO M;  1MU5 A;  1K82 A;  1R2Y A;  2FNA A;  4NSO B;  4EIW A;  4OVZ A;  4X64 M;  4LF4 M;  2Y20 A;  4GIP A;  1W5T A;  3GRR A;  1XMQ M;  2XFT A;  2VII A;  1EOC A;  1EO2 B;  2G5G X;  3LMM A;  3RGS A;  3MFL M;  1G3I A;  1TDZ A;  2D7E A;  2BUR A;  3FUX A;  1E94 E;  2CE7 A;  3U61 A;  4JI1 M;  1S9A A;  2AHM A;  2RGH A;  3QWL A;  2E5L M;  2KRU A;  3GLI B;  1GL7 A;  1YKP B;  2J7N A;  3U5Z A;  1YE9 A;  1L2C A;  3FYC A;  1Q3C A;  3PCH A;  4L16 A;  1OFI A;  2XSR A;  1QAO A;  3FTE A;  2CFO A;  5IT9 S;  3GPY A;  2F4V M;  1EOA A;  1OJL A;  3ZC7 B;  1YKM A;  1ZAE A;  5BR8 M;  3TWM A;  3L28 A;  2ERC A;  4BB9 A;  2BUV B;  3VDP A;  1E9R A;  1DGF A;  2L7I A;  3SAR A;  2X8A A;  3DA1 A;  2UUB M;  3MV6 M;  2LNH C;  2QBY A;  5FTL A;  3KVW A;  1DGB A;  3IG8 A;  3U6S A;  2BUZ A;  3GRY A;  4I8O A;  3MV4 A;  1HNX M;  1QYR A;  3U6D A;  1IY2 A;  4NRW A;  1EOB B;  4RF0 A;  1XXH B;  2I7P A;  4II7 A;  4JI0 M;  3GLH A;  3PCM A;  1SXJ C;  3TQS A;  1YKN B;  4WHS D;  3J81 S;  4NXM M;  4IBF A;  2Z4S A;  3EIE A;  5TD3 A;  3W0F A;  4FVM A;  2C9O A;  1IN5 A;  3AOE A;  4WHQ B;  1Z5C A;  3JAM S;  2EUC A;  5ITX E;  1DGH B;  2LH0 A;  4NSR A;  3U6L A;  3SHG B;  3JR4 A;  1YKO B;  4JI8 M;  3H4M A;  1ORY B;  1GKI A;  3SFZ A;  4GHL A;  4G4O A;  3PCI M;  4WHO B;  1TH4 A;  4AI6 A;  1XNQ M;  2BV0 A;  2H1R A;  2OPF A;  2CV2 A;  3BOS A;  4LJ9 A;  1K3X A;  2KXE A;  1IXS B;  4MB7 A;  4KHP M;  2BUM B;  4MGZ E;  3KW6 A;  2YNM D;  1SXJ D;  4MGH A;  5EP2 A;  5LMN M;  4DR1 M;  2BUQ B;  3PCL M;  4WHP A;  1SXJ E;  4JI7 M;  2ZAO A;  1NY5 A;  3U6Q A;  3J7B A;  4B3R M;  3AJI B;  3E9S A;  4L15 A;  1N77 A;  3GLG A;  3FTD A;  4IBG A;  1NSF A;  2UU9 M;  1L2B A;  1Q39 A;  5C18 A;  3O32 A;  2V6Z M;  1EO9 B;  4G4R A;  5DYI A;  3ZH9 B;  3PCG M;  2CUZ A;  2XGN A;  4M0D A;  2YR0 A;  3HKP A;  5EXP A;  4JI6 M;  3LKT A;  2QZ4 A;  2Z7J A;  4HLQ A;  4GMQ A;  3KS4 A;  4CHT B;  3TPZ A;  4X62 M;  3HJS A;  4KOD A;  2I7N A;  4LZZ A;  1TH2 A;  3KSJ A;  1L1Z A;  3T67 M;  1T3T A;  4LZJ A;  2Z4R A;  4W5W A;  4JV5 M;  3T38 A;  4LG2 A;  3LMX A;  1QZM A;  2Q2E B;  3PCD A;  2FOI C;  2R62 A;  3PVS A;  1DLQ A;  4JI2 M;  1HNW M;  4LF6 M;  4LJ8 A;  3I51 A;  5FTN A;  2CHV A;  3DFZ A;  3HU1 A;  3QAU A;  2CV1 A;  1YKK B;  2DWL A;  1EO2 A;  3KOY E;  1JR3 D;  3AFH A;  1DO0 A;  5EXX A;  3MFL A;  3O6R A;  1NNU C;  3FUV A;  1IM2 A;  4IBC A;  3U6P A;  4DV0 M;  2RGO A;  1YKL B;  1IXR C;  3HHW A;  3U60 B;  3GLF A;  3GLI A;  1NVM A;  4NXN M;  1YKP A;  4YY3 M;  1J09 A;  4WHR A;  4RF1 A;  3SC3 A;  3KOX E;  3PCF M;  1S3S A;  4LJ4 A;  3RGP A;  3WHK A;  3HWS A;  3HJQ A;  3R8F A;  5KPZ A;  3K2L A;  1FJG M;  3LXV M;  4LFB M;  4AG6 A;  2BUV A;  3PXG A;  3GRU A;  5ITU A;  4MH0 E;  2BUT B;  1HT1 E;  4FW9 A;  3M7G A;  4CIS A;  3HHY A;  1R2Z A;  1HNZ M;  3K8Z A;  2DWZ B;  4L4U A;  4AW4 A;  3MV6 A;  4CGY B;  1N33 M;  2Y0Q A;  3KP1 E;  3L25 A;  1XXH A;  1QAM A;  4GHA A;  2M60 A;  3O6J A;  1IN6 A;  2R45 A;  1C1K A;  3KOZ E;  2V1C A;  5C1B A;  3M6A A;  4D80 A;  4WHQ A;  4MGI E;  4LFA M;  2UUA M;  3N9T A;  1DGH A;  4KO8 A;  2XSZ A;  2FE8 A;  2QCU A;  4IJF A;  3EIH A;  3VFD A;  2QEN A;  2XEP A;  3PFI A;  4MGK E;  4IJE A;  1XNR M;  4AKG A;  1YKO A;  3PCE M;  1OFH A;  2C9C A;  4WHO A;  2EA0 A;  3PCI A;  2BUY B;  3HHX A;  3ZCB B;  4JI4 M;  4I4L A;  3R9X B;  4DR4 M;  1WXQ A;  1NNJ A;  2XSU A;  2F5Q A;  3FKE A;  3RE8 A;  1TMX A;  2BUM A;  4S12 A;  2L6O A;  3FYD A;  4QNR A;  3PCL A;  4OX9 M;  4XGI A;  3T1H M;  3HGI A;  1ZQ9 A;  4I81 A;  3L26 A;  2CHG A;  2KZU A;  2BJV A;  4DUZ M;  2F5S A;  4JI3 M;  3A46 A;  1I4W A;  3LVW A;  2VQF M;  4Z6Y A;  4IBJ A;  4LJA A;  4AKH A;  2PCD A;  2XLJ A;  2CV0 A;  3SAS A;  1D2N A;  3AOE C;  1EOC B;  3LVV A;  2C96 A;  1TH3 A;  1E9S A;  5EP1 A;  1L2D A;  1XHB A;  1EO9 A;  4LJ5 A;  4LF7 M;  4TUW A;  1KYI A;  4B7G A;  3HHZ A;  1K3W A;  3UJN A;  1R6B X;  4WHS B;  2NQ8 C;  3TWL A;  3CF0 A;  4QHS A;  4DR3 M;  4AKI A;  5FTJ A;  5IZ7 D;  4PCZ A;  2LWX A;  4M9S A;  3PCH M;  3U6M A;  3UGJ A;  3TH1 A;  4MM3 B;  3VDU A;  5JI3 E;  1Z6T A;  4D81 A;  2KA6 B;  2BUU B;  2C5R A;  1DGG A;  3TL4 X;  1GVN A;  2BOY A;  1EOA B;  3PCA M;  1IN7 A;  3I4V A;  4FWG A;  4OU7 A;  4QOS A;  3T15 A;  3T67 A;  1L8Q A;  3HU3 A;  2ZAM A;  2P5T A;  2F5P A;  5EXS A;  4WW0 A;  1HT2 E;  2F5N A;  4IBD A;  3U6C A;  4DUY M;  1YKK A;  2BUZ B;  2YFQ A;  2UUC M;  4DV7 M;  1SXJ B;  5F3W A;  3PCB M;  3PCM M;  4DV1 M;  2XSV A;  1GL6 A;  3GLH B;  3KOW E;  1KSF X;  1MX0 A;  3T63 M;  1IY0 A;  3T1Y M;  3SAV A;  1YSY A;  1R7R A;  1YKL A;  3A45 A;  3PCJ M;  1LV7 A;  3PCN A;  2F5O A;  1GLN A;  3U60 A;  3UMM A;  3D8L A;  2J7O A;  2A5Y B;  3SAT A;  4WHP D;  2DWN A;  2CHQ A;  4PDG A;  3KXE C;  2R46 A;  4WHP B;  1TDH A;  3FUU A;  3PCF A;  3PNV A;  2QPA A;  3K92 A;  3MI1 M;  4D82 A;  4B3T M;  1NHG C;  5EQT A;  4B08 A;  4QOZ C;  3E4R A;  4HL4 A;  4NOO B;  4JXJ A;  1IBM M;  2Y0T A;  3TWK A;  2JA2 A;  1JQJ C;  2G8L A;  2KW0 A;  2X4A A;  4LY6 A;  5FSW A;  4JYA M;  3MI5 M;  2L09 A;  4DV6 M;  5ITQ A;  4ZPX A;  4LF5 M;  4ITQ A;  5FTK A;  1G8P A;  4DV5 M;  1Z5B A;  4BLC A;  1QVR A;  4I5S A;  4GC5 A;  3GQ5 A;  4IBI A;  4GH9 A;  2AZQ A;  3AKZ A;  3J80 S;  2DWM A;  4RNA A;  1I94 M;  1IY1 A;  1XC8 A;  2HCB A;  3A42 A;  2BUX B;  4DV4 M;  3LKT M;  2BUW B;  4G4N A;  4AQY M;  8CAT A;  3K1J A;  2XZF A;  2XH9 A;  3SYK A;  4JI5 M;  3ILK A;  3MJ5 A;  4PD2 A;  5ITT A;  3IG5 A;  1J5E M;  2X49 A;  1N78 A;  5EJC A;  4FCW A;  3PCC M;  3HU2 A;  1EOB A;  3C58 A;  4X66 M;  3LMX M;  1E32 A;  2ZBK B;  2C98 A;  1NHW C;  1YKN A;  3O5U A;  3B9P A;  3L29 A;  3PCK M;  3VK7 A;  2ZM6 M;  2DVW B;  2O5R A;  4LRT A;  3SBJ A;  2HL7 A;  1QAN A;  1HR0 M;  4ILV A;  3GPU A;  5KQ8 A;  1H6U A;  3VKG A;  3M0E A;  1NJG A;  1PJI A;  4GKJ M;  4DV2 M;  2UXD M;  2DZN B;  3NWL A;  4IIW A;  4WHS A;  1L1T A;  3GLF B;  1NY6 A;  2V1U A;  4L8R C;  1DLT A;  1DLM A;  2BUQ A;  5ITX A;  4WHR B;  5E6J A;  5H37 D;  4B3S M;  1XWI A;  2BNK A;  3FUW A;  4B7H A;  5EP4 A;  2BUU A;  1YUB A;  4NL4 H;  1PM5 A;  1KFV A;  4LGY A;  4PDI A;  4OVZ B;  4GC9 A;  3D8B A;  5FTM A;  5DNY A;  3U6O A;  3PCA A;  3SYL A;  3UZU A;  2R18 A;  5JI2 E;  5KQD A;  4M9X A;  2DZO B;  4IBB A;  4LJ7 A;  4M9Z A;  1IBL M;  4GRI A;  2XSZ D;  4G6Z A;  1G59 A;  2BUR B;  4PT5 A;  4WHR F;  3U61 B;  3GQ3 A;  3J27 B;  1SXJ A;  3FUT A;  4WHO D;  3PCG A;  1Q3B A;  5A2Q S;  4A3V B;  3PCB A;  3FTC A;  3I4Y A;  3VKH A;  1HQY E;  3UK6 A;  3U5Z B;  1QQW A;  2QP9 X;  3T63 A;  3GP1 A;  4REZ A;  2Z3X A;  2K47 A;  3PCJ A;  3J7A S;  2Y21 A;  4FD2 A;  2L7H A;  5EXT A;  3SMS A;  4AZF A;  2VQE M;  2M5Z A;  2HKJ A;  1J7K A;  5IWA M;  4XBO A;  2KRK A;  1YKM B;  1N75 A;  1HQC A;  4LGM A;  4WUR A;  1DMH A;  4JN6 A;  4MGY E;  3PNY A;  2FFJ A;  3KP0 E;  4LJ6 A;  2EO2 A;  5FLX S;  2QBY B;  4DR6 M;  3MV4 M;  3MI1 A;  3AV0 A;  2C99 A;  4B3M M;  3A98 B;  3VK8 A;  1G4A E;  4X65 M;  5IRE B;  3SAW A;  2CEA A;  1G41 A;  1Z5A A;  3L2A A;  4G4Q A;  1NJF A;  1UM8 A;  4IBE A;  1QAQ A;  3JR5 A;  3MHV C;  4K0K M;  1IBK M;  1X37 A;  3MI5 A;  4GKK M;  3GQ4 A;  2XZU A;  5LMU M;  2PCD M;  5KO3 A;  2LXE A;  4LRS A;  4R7G A;  3GO8 A;  4DV3 M;  3AL0 C;  4DR7 M;  2R4J A;  4P16 A;  1W5S A;  4LF9 M;  2D7G A;  3OTO M;  4LFC M;  2BJW A;  3LQQ A;  3W0L B;  1EE8 A;  1JR3 A;  2BV0 B;  2DXI A;  3RFW A;  2BUX A;  2DHR A;  4OW0 A;  5GKN A;  4DR5 M;  3SAU A;  2BUW A;  4ILT A;  4L78 A;  3AOG A;  2R4E A;  5EP3 A;  3LXV A;  2BUT A;  3CTW B;  1IN4 A;  3J2P B;  1VDD A;  4FWD A;  2W82 A;  2RKO A;  3FTF A;  2ZAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...