3HGIA

Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
258
structure length
258
Chain Sequence
b'ERATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 69
structure length 258
sequence length 258
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hgiA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hgiA02
2BUWB 3MI1M 3MI5M 1YKMB 1YKKA 2BUZB 3HHYA 3PCIM 3PCIA 4WHSD 1EO2A 1YKMA 3MV6A 3PCFA 1DLMA 2BUVB 1S9AA 4WHPA 3LKTM 4WHOD 2BUXB 2AZQA 1DLQA 2BUMB 2XSUA 1EOCA 2BOYA 3PCKA 5TD3A 2BV0A 1EOAA 3PCHM 2BUTB 3HKPA 3PCAM 3PCAA 2BUQB 3MI1A 3MI5A 3I4YA 2BUWA 2BUZA 3PCMM 3PCLM 3PCMA 3PCCM 4ILTA 2XSVA 3O6JA 3LKTA 2BUVA 1YKPB 1YKLB 4WHSB 1YKOB 2BUXA 1YKPA 4WHPD 1YKLA 3PCDM 1YKOA 1YKNB 3PCDA 2BUYB 2BURB 2XSRA 1YKNA 3HGIA 3HHXA 2BUMA 3PCHA 3HJSA 3PCGM 2BUTA 2BUQA 3T63M 3T63A 3HJQA 1DMHA 3PCLA 2PCDM 3O32A 3PCCA 3PCEM 4WHRB 3PCEA 4WHQB 1TMXA 3LXVM 1EOBB 3LXVA 3O5UA 1EO9B 2BUUB 4ILVA 3T67M 3I4VA 3T67A 4WHSA 1YKKB 3I51A 1DLTA 2BUYA 1EO2B 2BURA 4WHOB 4WHOA 3MV6M 3PCFM 3PCGA 4WHPB 3MFLM 3MFLA 3PCBM 3HJ8A 3PCBA 3PCNM 3PCNA 2PCDA 4WHQA 4WHRA 4WHRF 1EOCB 3PCJM 1EOBA 1EOAB 2BV0B 3PCJA 3N9TA 3PCKM 3TH1A 3O6RA 1EO9A 2BUUA 3LMXM 3MV4M 3LMXA 3MV4A
chains in the Genus database with same CATH superfamily
1JR3A 2FE8A 3LVWA 3HX3A 3PFIA 2Y20A 1P3QQ 4M9ZA 1YKMB 4RNAA 4F1IA 4B3SM 1VDLA 4CGYB 3PCIM 3GPYA 2KA6B 3M6AA 3U6LA 2LVQD 1YKMA 1N33M 4W5WA 3B89A 2HCBA 4L4UA 2DVWB 3GLGB 4JI7M 1XWIA 2XFTA 2DWNA 2EO2A 3C58A 2ERCA 5EXTA 3VDPA 3GLGA 4M0WA 5E6JA 2QBYB 3LKTM 2FOIC 4GRIA 1QQWA 2WSCF 3JR4A 3SAUA 1OFHA 2HWJA 3U5ZB 3L25A 2QQ8A 2XGNA 2CWBA 4QOZC 5H37D 1N77A 1HT2E 3L2AA 1IN5A 4RKUF 2HHHM 2BOYA 3PCKA 3L27A 2DAMA 1OIPA 4L6V6 4AZFA 4CJ6A 1N34M 3FUXA 2M5ZA 2DENA 3E46A 3U6CA 1TR8A 1N36M 3CF6E 3I4YA 3B7NA 2FH0A 3UMMA 3ILKA 3TWLA 2KW0A 2MR9A 4LZZA 4XGIA 2CUZA 3WHLA 5KO3A 3SAVA 3UZUA 3PCLM 3PCMA 4ILTA 3GRRA 3CTWB 4M9SA 1R5LA 2W82A 3LKTA 5LMUM 2R6FA 4IJFA 1Y8GA 4WHSB 1H6UA 2XH9A 2BUXA 1OAOC 2K0BX 4R3DA 4BLCA 3W67A 3R8FA 4AKGA 1VEKA 3KVWA 1N78A 4X62M 2BUYB 2CHVA 2XSRA 4NOOB 2N35A 3CF0A 4DR7M 1XXHB 2FFJA 2V6ZM 4IIWA 4DR1M 3HU1A 4B3RM 2CFOA 2VDBB 3U6EA 1ZMUA 2L4EA 1EFUB 1TGUA 4X64M 4AW4A 4IBKA 3L26A 1DGBA 1QZEA 3T63M 2CE7A 4QHSA 4PDIA 2HAKA 2APLA 4LJ6A 1ZMVA 1IXSA 3HHZA 3Q8GA 1SG9A 1DMHA 3GPXA 1AIPC 1GKIA 2LTUA 3PCLA 4WHQB 3U6OA 4AKIA 1G59A 4OVZB 3SAWA 3MJ5A 1TMXA 3PCEM 2BJVA 2WSEF 3SC3A 1C1KA 1YE9A 2C99A 2WSFF 1DO0A 4IBFA 3LXVM 3GLIE 4L15A 4JI3M 3AL0C 1E9RA 2OOAA 1EO9B 2BUUB 4G4QA 2R44A 2VF7A 3T67M 3FUWA 3FYCA 4DBGB 5C18A 2HL7A 2K9DA 5FTLA 3OTOM 1R7RA 3FUVA 3U60B 1EE8A 3PNVA 3AKZA 1EO2B 2BURA 2YQZA 4P16A 1XMOM 2DWMA 5DYGA 2JY8A 3GO8A 2CRUA 1KSFX 1PRBA 2LHGA 2KHHA 3J2PB 3U6QA 3U60A 4LJ8A 3MV6M 4FW9A 4XK8F 3PCFM 4WHPB 4DR6M 1HR0M 1HNWM 2QP9X 3UK6A 1W5SA 1VG5A 2X49A 4JI6M 1SXJE 3HJ8A 2UUAM 1TTEA 2GQFA 3PCNA 2EKFA 1PM5A 3LQQA 3PNYA 2JNHA 3WHKA 2O5RA 4WHRA 4OW0A 1QZMA 1TF0B 2CHGA 1TH2A 4GH9A 5EP3A 3H4JA 1L2DA 1EOBA 1EOAB 1Z6TA 1VEJA 1GJTA 2C96A 3B7QA 3FE3A 3KOZE 2VQFM 4DV0M 4G4OA 3MV4A 4QHTA 2Y0TA 5EXPA 3MI5M 3HHWA 2Z8YM 1L2BA 2L4FA 4LGMA 1BVSA 2EKKA 4LGYA 3TWKA 4UN2B 4LG2A 3KFUG 3C9PA 4WHSD 3MV6A 2LWXA 3PCFA 1YLAA 4MGKE 1DLMA 3B9PA 3RGPA 2BUVB 1ORYB 2QCUA 4IJEA 3DZDA 3Q8XA 2QPAA 4RF1A 5EXXA 3GLFB 1R2YA 2F5NA 4LF6M 4B7GA 3J7AS 2AZQA 4WHOD 4Q7JA 3GLFA 1TH4A 2CV2A 3ZCBB 3L28A 4MGYE 1RU3A 4NRVA 4JYAM 1Q02A 1NNUC 2L09A 5KPZA 4MH0E 1ZAEA 4R7GA 3QAUA 2J7NA 2JP7A 3SYKA 1IBKM 4YY3M 1EOCA 1CUKA 1WHCA 4M0DA 4WHQA 5TD3A 5FLXS 3PCHM 1TH3A 3W0FA 3HKPA 3KOWE 3FUUA 2UXBM 3PCAA 2BUQB 2H5XA 3J7BA 4I8OA 4CIZA 3MI5A 1QANA 4DV1M 1HQCA 3GLHE 4GKJM 1PJIA 2EUCA 5IREB 3PCMM 1OKSA 2KZUA 3LW5F 3J27B 1QDRA 1W5TA 1DV0A 3O6JA 4G3OA 4II7A 4Z8XA 3VFDA 5FSWA 1YKPB 4OU7A 3ZH9B 2QBYA 4B3TM 1YKPA 5E26A 3R9XB 4B3MM 1NJFA 2P5TA 1L1ZA 4WHPD 1IN4A 1I4WA 2MGWA 3PCDA 4QNRA 3B74A 5L8RF 1G4AE 4ANRA 4FVMA 2DAIA 3U5ZA 2B3TA 1NV9A 3HGIA 4LF7M 4AG5A 4P17A 2R4JA 3HHXA 3PCHA 1JR3E 2QNJA 3FTDA 4LF9M 2FS1A 1R6BX 1QYRA 2XEPA 2OQ4A 1PJQA 2FNAA 2RGHA 4G6ZA 1Q3CA 3PXGA 4KODA 3KDSE 2RKOA 4IBDA 2KZSA 1Z5CA 1QUTA 2M60A 3GPPA 2PCDM 2Z7JA 3GPUA 4ZPXA 3GLGE 4DV3M 1IM2A 1D2NA 3BXWA 3SHFA 2XFSA 3ZC7B 3IHPA 4HL4A 2V1UA 1N75A 5ITRA 4JI0M 3U61B 4WHSA 2X8AA 2D7HA 4IBGA 2E5LM 1XNQM 1HNZM 2C9CA 1GLNA 1GL6A 1YKKB 5EP2A 2D7GA 1ZV1A 2BUYA 4WHOB 2MJ5B 5F3WA 4HLQA 3SMPA 3TL4X 2BUZA 4LJ9A 1XXHA 3I01M 2OPFA 2BNKA 1J7KA 2KEBA 4WHOA 4X65M 2JZ1A 4JI5M 2MH8A 1IY2A 1D0KA 3SASA 1GABA 1L2CA 1IY0A 4DR3M 1J09A 3GLIB 2LNHC 2ZAMA 2H1RA 2WZJA 1IN6A 2CV1A 1T43A 4BB9A 1L1TA 3PCNM 2KNZA 1Q39A 1QAQA 1DGHB 1MX0A 1ZMWA 1GJSA 2PCDA 4GKKM 1GL7A 2JY7A 3KOYE 2KRKA 2CEAA 4Y28F 4OVZA 5KPTA 2R62A 1G41A 3JR5A 2VQEM 2DXIA 2OO9A 4IBBA 3TWMA 2BV0B 1HT1E 1XB2B 2J5YA 1EO9A 2BUUA 4IBEA 3MV4M 2LVOC 2DZNB 3HY5A 4LY6A 5C1BA 1R4GA 3GQ3A 2BUWB 3U6DA 3DOAA 5IZ7D 5ITXA 3FTFA 4I5SA 4NL4H 2XZUA 2KRUA 2X4AA 3DFZA 4LRTA 3RFWA 1EO2A 1Z5BA 2R18A 2KNAA 2QENA 3KW6A 1HJPA 4LFBM 1IY1A 4I4LA 4WHPA 1NY6A 3E4RA 4A3VB 2DZOB 2I7PA 4L8RC 1OIZA 1FJGM 2DWLA 5FTJA 3BBZA 4Z6YA 1IBMM 1WJ7A 3KOXE 1MJGM 3K2LA 3K1JA 4LF4M 3FRIA 5KQ8A 4AKHA 2R0IA 1G71A 1PJTA 2K6BA 3V76A 2EA0A 3VKGA 2BUMB 2XSUA 1NV8A 4JI1M 2JXNA 4AQYM 4LFCM 4AG6A 4KHPM 1N32M 1EOAA 2BUTB 2J7OA 2XSZD 4B7FA 4F2LA 2C9OA 2V1CA 3PCAM 2I7NA 2JA2A 3K9OA 4D81A 2QHOB 1D0LA 4PDGA 1T3TA 3TQSA 2F5QA 4TUWA 3GRUA 4BBAA 2Z4RA 3KXEC 4XBOA 2KXEA 3HU3A 2OOBA 1XHBA 4L78A 1HQYE 2DZLA 3PCCM 1EIJA 2DAGA 1T6OA 1D0MA 3A42A 2JWSA 3NBXX 2ZBKB 2BUVA 5ITYA 4LJ4A 1YKLB 2F4VM 2DNAA 3FTEA 1VDDA 3FUTA 3E9SA 4EIWA 5BR8M 1YKLA 2G3QA 3PCDM 1IN7A 4NSRA 1OQYA 1OAIA 1WIVA 2L6OA 2R4EA 2UXDM 2JY5A 4M9XA 1JQJC 1OTRA 3UGJA 3U6PA 1OFIA 2CP8A 3GLHB 4DV6M 3SYLA 4DR5M 1KFVA 3J80S 2O25A 4DV4M 2C98A 3T38A 5LMNM 1E94E 1NJGA 3C3EA 1XNRM 2BUQA 1VEGA 1TDZA 3HJQA 3A45A 3AOEC 3FYDA 2BJWA 5EP4A 4GC9A 3SBJA 3QYBA 1NO1A 2C5RA 2LVAA 3O32A 1PGYA 3PCCA 4MGHA 1Z5AA 3KP0E 4WURA 5EJCA 3E21A 4IBIA 3AJIB 1IN8A 4FWHA 1SXJD 4MGIE 3J81S 3GLFE 1J5EM 4JV5M 2BWEA 4GEWA 1IBLM 2L7IA 2R45A 3MK6A 4LJ7A 1Z59A 3I4VA 3GRYA 2D7EA 5FTNA 3B7ZA 2LVNC 3GQ5A 5A2QS 4DV2M 3I51A 4AI6A 3SFZA 2CHQA 3HZJA 3LMMA 4KLNA 4JI4M 1DLTA 4G4NA 1WGLA 3GRVA 3TE6A 3T1YM 4NXMM 1ZQ9A 4LF8M 2JY6B 3IG5A 4LFAM 4X66M 1TDHA 3EIHA 2LBCA 5DYIA 4MB7A 3THGA 3UJNA 3RE8A 2G8LA 3QWLA 1UFZA 3MFLA 1AUAA 2KDLA 3C3DA 2DAKA 3PCBA 4ITQA 4G4RA 3IECA 2Y0QA 4KT0F 4WW0A 3D8BA 2UUCM 2ZAOA 1XMQM 1I94M 4JN6A 2XF3A 1YSYA 2KNVA 2XSZA 4MM3B 5IT9S 4WHRF 1IXRC 2Y21A 1PJJA 2UXCM 2DI0A 5FTMA 2L7HA 3PCJA 3AOEA 3T15A 3TH1A 1SXJC 4D82A 1WR1B 3HJSA 2Z4SA 3KSJA 1VQ1A 3LMXA 3U61A 4NXNM 3MMPA 3TPZA 1JB0F 1GO5A 3MI1M 5ITUA 5DNYA 2LXEA 2NQ8C 3KSXA 3HHYA 1YKKA 2BUZB 3PCIA 1QVRA 3VDUA 1G3IA 2VIIA 3SMSA 3W0LB 1IXZA 2Z3XA 4LRSA 1L8QA 4PCZA 4YHHM 4JXJA 2R46A 1S9AA 3NWLA 3LVVA 2YFQA 1DO2A 1NHGC 2HKJA 3K9PA 4GMQA 4GC5A 4R71A 2BUXB 3AV0A 4IBJA 4D80A 3GLIA 3A98B 3FTCA 5KPRA 3VK8A 3AFHA 1K82A 2UU9M 1DGHA 1X37A 4GHLA 4I81A 2ZM6M 1OJLA 3U6SA 1MN3A 4DV7M 1DLQA 4NRWA 5DFLA 4REZA 1WGNA 1G8PA 1IFYA 4JI8M 2BV0A 4PD2A 3T1HM 7CATA 2VF8A 3MI1A 4B08A 3F92A 2XLJA 1IXSB 1SXJB 1V33A 1XXHE 2BUWA 2DKLA 1QAOA 2ZTDA 4NSOB 4WP2A 1SXJA 3GP1A 1JR3D 2JZ0A 3NBIA 4HEOA 1HNXM 2GNOA 1NVMA 2QSFX 2F5OA 2XSVA 5BPVA 2DAEA 3MHVC 1QAMA 3L29A 3A46A 4DUYM 2CV0A 1XC8A 3HU2A 5JI2E 2EJSA 3I04M 3H4MA 2DWZB 1YKOB 1DGGA 1NSFA 5EQTA 1QUSA 3LCVB 1YKOA 1YKNB 2BURB 4LJAA 1DGFA 5FTKA 4GITA 5GKNA 1YKNA 1NHWC 2QZ4A 4PT5A 3JAMS 2RRUA 3VK7A 4RF0A 5EXSA 1E32A 3K8ZA 3FD9A 4FWGA 3SARA 2BUMA 4L16A 3PCGM 5ITXE 4QNMA 2G5GX 4NC6A 1QDTA 2JUJA 2BUTA 4LZJA 4FCTA 3K92A 3U6MA 4FCWA 3T63A 2XZFA 4DV5M 1WXQA 2LH0A 3VLFB 4CHTB 1NNJA 4K0KM 3BOSA 2LVPC 1V92A 2DHYA 2RGOA 8CATA 4GHAA 3PCEA 2MROB 5ITTA 4WHRB 2DHRA 2YR0A 1A5TA 1PJSA 5ITQA 2F5PA 2YNMD 4FCVA 1EOBB 2ZANA 3LXVA 4LJ5A 1Q3BA 2L2DA 1K3WA 3O5UA 5EP1A 2UUBM 3FKEA 2BWBA 2AHMA 1YUBA 3IG8A 4ILVA 4LCBA 4CISA 3T67A 3VKHA 4GIPA 5IWAM 3LQRA 3EIEA 3M7GA 4LF5M 3T6PA 1R2ZA 3D8LA 1MU5A 1C7YA 1IQPA 4OX9M 5KQDA 1FNNA 5JI3E 1V34A 4DR2M 4MGZE 3GLHA 3PCGA 2LHCA 1E9SA 2O01F 4KO8A 2R65A 2ZTCA 1K3XA 2A5YB 3MFLM 3SHGB 3PCBM 3RGSA 1F4IA 3CGWA 4DUZM 3HWSA 2F5SA 3GQ4A 3CF2A 3KS4A 1UM8A 4QOSA 3KP1E 3ZQJA 3LCUA 3M0EA 1LTMA 3SATA 4B7HA 3KS8A 3AOGA 4FD2A 3PVSA 3DA1A 4S12A 1EOCB 1NY5A 4JI2M 3QYEA 3FRHA 3PCJM 1GVNA 1LV7A 4FWDA 4IBCA 3N9TA 3PCKM 1S3SA 3O6RA 1KYIA 3W68A 2Q2EB 2K47A 3LMXM 4DR4M
chains in the Genus database with same CATH topology
1JR3A 2FE8A 3LVWA 3PFIA 2Y20A 4M9ZA 1YKMB 4RNAA 4B3SM 3PCIM 4CGYB 3GPYA 2KA6B 3M6AA 3U6LA 1YKMA 1N33M 4W5WA 2HCBA 4L4UA 2DVWB 3GLGB 4JI7M 1XWIA 2XFTA 2DWNA 2EO2A 3C58A 2ERCA 5EXTA 3VDPA 3GLGA 4M0WA 5E6JA 2QBYB 3LKTM 2FOIC 4GRIA 1QQWA 3JR4A 3SAUA 1OFHA 3L25A 3U5ZB 2XGNA 4QOZC 5H37D 1N77A 1HT2E 3L2AA 1IN5A 2HHHM 2BOYA 3PCKA 3L27A 4AZFA 1N34M 3FUXA 2M5ZA 3U6CA 1N36M 3CF6E 3I4YA 3UMMA 3ILKA 3TWLA 2KW0A 3WHLA 4LZZA 4XGIA 2CUZA 5KO3A 3SAVA 2BUZA 3UZUA 3PCLM 3PCMA 4ILTA 3GRRA 3CTWB 4M9SA 2W82A 3LKTA 5LMUM 4IJFA 4WHSB 1H6UA 2XH9A 2BUXA 4R3DA 4BLCA 3R8FA 4AKGA 3KVWA 1N78A 4X62M 2BUYB 2CHVA 2XSRA 4NOOB 3CF0A 1XXHB 2FFJA 2V6ZM 4IIWA 4DR1M 3HU1A 4B3RM 2CFOA 3U6EA 1TGUA 3L26A 4X64M 4AW4A 4IBKA 1DGBA 3T63M 2CE7A 4QHSA 4PDIA 4LJ6A 3HHZA 1DMHA 3PCLA 3GPXA 1GKIA 4WHQB 3U6OA 4AKIA 1G59A 4OVZB 3SAWA 3MJ5A 1TMXA 3PCEM 2BJVA 3SC3A 1C1KA 1YE9A 2C99A 4IBFA 1DO0A 3LXVM 4L15A 4JI3M 3AL0C 1E9RA 1EO9B 2BUUB 4G4QA 3T67M 3FUWA 3FYCA 5C18A 5FTLA 2HL7A 3OTOM 1R7RA 3FUVA 3U60B 1EE8A 3PNVA 3AKZA 1EO2B 2BURA 2YQZA 4P16A 1XMOM 2DWMA 5DYGA 3GO8A 3U60A 4NXMM 1KSFX 3J2PB 3U6QA 4LJ8A 3MV6M 4FW9A 3PCFM 4WHPB 4DR6M 1HR0M 1HNWM 2QP9X 3UK6A 1W5SA 2X49A 4JI6M 1SXJE 3HJ8A 2UUAM 3PCNA 1PM5A 3LQQA 3PNYA 3WHKA 2O5RA 4WHRA 4OW0A 1QZMA 2CHGA 4GH9A 1TH2A 5EP3A 1L2DA 1EOBA 1EOAB 1Z6TA 2C96A 3KOZE 2VQFM 4DV0M 4G4OA 3MV4A 4QHTA 2Y0TA 5EXPA 3MI5M 3HHWA 1L2BA 4LGMA 4LGYA 4WHSD 3TWKA 4LG2A 3KFUG 3MV6A 2LWXA 3PCFA 4MGKE 1DLMA 3B9PA 3RGPA 2BUVB 1ORYB 2QCUA 4IJEA 3DZDA 3Q8XA 2QPAA 4RF1A 5EXXA 3GLFB 1R2YA 2F5NA 4LF6M 4B7GA 3J7AS 2AZQA 4WHOD 3GLFA 1TH4A 2CV2A 3ZCBB 3L28A 4MGYE 4NRVA 4JYAM 1NNUC 2L09A 5KPZA 4MH0E 1ZAEA 4R7GA 3QAUA 2J7NA 3SYKA 1IBKM 4YY3M 1EOCA 4M0DA 5TD3A 5FLXS 3PCHM 1TH3A 3W0FA 3HKPA 3KOWE 3FUUA 2UXBM 3PCAA 2BUQB 3J7BA 4I8OA 3MI5A 1QANA 4DV1M 1HQCA 4GKJM 1PJIA 2EUCA 5IREB 3PCMM 2KZUA 3J27B 1W5TA 3O6JA 4II7A 4Z8XA 3VFDA 5FSWA 1YKPB 4OU7A 3ZH9B 2QBYA 4B3TM 1YKPA 5E26A 3R9XB 4B3MM 1NJFA 2P5TA 1L1ZA 4WHPD 1IN4A 1I4WA 3PCDA 4QNRA 1G4AE 4FVMA 3U5ZA 3HGIA 4LF7M 4AG5A 2R4JA 3HHXA 3PCHA 3FTDA 4LF9M 2XEPA 1R6BX 1QYRA 2OQ4A 2RGHA 2FNAA 4G6ZA 3PXGA 1Q3CA 4KODA 3KDSE 2RKOA 4IBDA 2KZSA 1Z5CA 2M60A 3GPPA 2PCDM 2Z7JA 3GPUA 4ZPXA 4DV3M 1IM2A 1D2NA 3SHFA 2XFSA 3ZC7B 4HL4A 2V1UA 1N75A 5ITRA 4JI0M 3U61B 4WHSA 2X8AA 2D7HA 4IBGA 2E5LM 1XNQM 1HNZM 2C9CA 1GLNA 1GL6A 1YKKB 5EP2A 2D7GA 2BUYA 4WHOB 5F3WA 4HLQA 3SMPA 3TL4X 4LJ9A 1XXHA 4WHOA 2OPFA 2BNKA 1J7KA 2KEBA 4X65M 4JI5M 1IY2A 3SASA 1L2CA 1IY0A 4DR3M 1J09A 3GLIB 2LNHC 2ZAMA 2H1RA 1IN6A 2CV1A 4BB9A 1L1TA 3PCNM 1Q39A 1QAQA 1DGHB 1MX0A 2PCDA 4GKKM 1GL7A 5KPTA 3KOYE 2KRKA 2CEAA 4DR7M 4OVZA 4WHQA 2R62A 1G41A 3JR5A 2VQEM 2DXIA 4IBBA 3TWMA 2BV0B 1HT1E 1EO9A 2BUUA 4IBEA 3MV4M 2DZNB 4LY6A 5C1BA 3GQ3A 2BUWB 3U6DA 3DOAA 5IZ7D 5ITXA 3FTFA 4I5SA 4NL4H 2XZUA 2KRUA 2X4AA 3DFZA 4LRTA 3RFWA 1EO2A 1Z5BA 2R18A 2QENA 3KW6A 4LFBM 1IY1A 4I4LA 4WHPA 1NY6A 3E4RA 4A3VB 2DZOB 2I7PA 4L8RC 1FJGM 2DWLA 5FTJA 4Z6YA 1IBMM 3KOXE 3K2LA 4LF4M 3K1JA 5KQ8A 4AKHA 2EA0A 3VKGA 2BUMB 2XSUA 4JI1M 4AQYM 4LFCM 4AG6A 4KHPM 1N32M 1EOAA 2BUTB 2J7OA 2XSZD 4B7FA 2C9OA 2V1CA 3PCAM 2I7NA 2JA2A 4D81A 2F5QA 4PDGA 4TUWA 1T3TA 3TQSA 3GRUA 4BBAA 2Z4RA 3KXEC 4XBOA 2KXEA 3HU3A 1XHBA 4L78A 1HQYE 3PCCM 3A42A 2ZBKB 2BUVA 5ITYA 4LJ4A 1YKLB 2F4VM 3FTEA 1VDDA 3FUTA 3E9SA 4EIWA 5BR8M 1YKLA 3PCDM 1IN7A 4NSRA 2L6OA 2R4EA 2UXDM 4M9XA 1JQJC 3UGJA 3U6PA 1OFIA 3GLHB 4DV6M 3SYLA 4DR5M 1KFVA 3J80S 4DV4M 2C98A 3T38A 5LMNM 1E94E 1NJGA 1XNRM 2BUQA 1TDZA 3HJQA 3A45A 3AOEC 3FYDA 2BJWA 5EP4A 4GC9A 3SBJA 2C5RA 3O32A 3PCCA 4MGHA 1Z5AA 3KP0E 4WURA 5EJCA 4IBIA 3AJIB 1IN8A 4FWHA 1SXJD 4MGIE 3J81S 1J5EM 4JV5M 1IBLM 2L7IA 2R45A 3MK6A 4LJ7A 1Z59A 3I4VA 3GRYA 2D7EA 5FTNA 3GQ5A 4DV2M 5A2QS 4AI6A 3I51A 3SFZA 2CHQA 4JI4M 3LMMA 4KLNA 1DLTA 4G4NA 3GRVA 3TE6A 3T1YM 1ZQ9A 4LF8M 3IG5A 4LFAM 4X66M 1TDHA 3EIHA 5DYIA 4MB7A 3THGA 3UJNA 3RE8A 2G8LA 3QWLA 3MFLA 3PCBA 4ITQA 4G4RA 2Y0QA 4WW0A 3D8BA 2UUCM 2ZAOA 1XMQM 1I94M 4JN6A 2XF3A 1YSYA 2XSZA 5IT9S 4MM3B 4WHRF 1IXRC 2Y21A 1PJJA 2UXCM 5FTMA 2L7HA 3PCJA 3AOEA 3T15A 3TH1A 1SXJC 4D82A 3HJSA 2Z4SA 3KSJA 3LMXA 3U61A 4NXNM 3TPZA 3MI1M 5ITUA 5DNYA 2LXEA 2NQ8C 3KSXA 3HHYA 1YKKA 2BUZB 3PCIA 1QVRA 3VDUA 1G3IA 2VIIA 3SMSA 3W0LB 1IXZA 2Z3XA 4LRSA 1L8QA 4PCZA 4YHHM 4JXJA 2R46A 1S9AA 3NWLA 3LVVA 2YFQA 1DO2A 1NHGC 2HKJA 4GMQA 4GC5A 2BUXB 3AV0A 4IBJA 4D80A 3GLIA 3A98B 3FTCA 5KPRA 3VK8A 3AFHA 1K82A 2UU9M 1DGHA 1X37A 4GHLA 4I81A 2ZM6M 1OJLA 3U6SA 4DV7M 1DLQA 4NRWA 4REZA 1G8PA 4JI8M 2BV0A 4PD2A 3T1HM 7CATA 3MI1A 4B08A 2XLJA 1IXSB 1SXJB 2BUWA 1QAOA 4NSOB 1SXJA 3GP1A 1JR3D 3NBIA 1HNXM 1NVMA 2F5OA 2XSVA 5BPVA 3MHVC 1QAMA 3L29A 3A46A 4DUYM 2CV0A 1XC8A 3HU2A 5JI2E 3H4MA 2DWZB 1YKOB 1DGGA 1NSFA 5EQTA 1YKOA 1YKNB 2BURB 4LJAA 1DGFA 5FTKA 4GITA 5GKNA 1YKNA 1NHWC 2QZ4A 4PT5A 3JAMS 3VK7A 4RF0A 5EXSA 1E32A 3K8ZA 3FD9A 4FWGA 3SARA 2BUMA 4L16A 3PCGM 5ITXE 4QNMA 2G5GX 2BUTA 4LZJA 4FCTA 3K92A 3U6MA 4FCWA 3T63A 2XZFA 4DV5M 1WXQA 2LH0A 3VLFB 4CHTB 1NNJA 4K0KM 3BOSA 2RGOA 8CATA 4GHAA 3PCEA 4WHRB 5ITTA 2DHRA 2YR0A 5ITQA 2F5PA 2YNMD 4FCVA 1EOBB 2ZANA 3LXVA 4LJ5A 1Q3BA 1K3WA 3O5UA 5EP1A 2UUBM 3FKEA 2AHMA 1YUBA 3IG8A 4ILVA 4LCBA 4CISA 3T67A 3VKHA 4GIPA 5IWAM 3LQRA 3EIEA 3M7GA 4LF5M 1R2ZA 3D8LA 1MU5A 4OX9M 1IQPA 5KQDA 1FNNA 5JI3E 4DR2M 4MGZE 3GLHA 3PCGA 1E9SA 4KO8A 2R65A 1K3XA 2A5YB 3MFLM 3SHGB 3PCBM 3RGSA 4DUZM 2F5SA 3HWSA 3GQ4A 3CF2A 3KS4A 1UM8A 4QOSA 3KP1E 3M0EA 3SATA 4B7HA 3KS8A 3AOGA 4FD2A 3PVSA 3DA1A 4S12A 1EOCB 1NY5A 4JI2M 3PCJM 1GVNA 1LV7A 4FWDA 4IBCA 3N9TA 3PCKM 1S3SA 3O6RA 1KYIA 2Q2EB 2K47A 3LMXM 4DR4M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUW B;  3MI1 M;  3MI5 M;  1YKM B;  1YKK A;  2BUZ B;  3HHY A;  3PCI M;  3PCI A;  4WHS D;  1EO2 A;  1YKM A;  3MV6 A;  3PCF A;  1DLM A;  2BUV B;  1S9A A;  4WHP A;  3LKT M;  4WHO D;  2BUX B;  2AZQ A;  1DLQ A;  2BUM B;  2XSU A;  1EOC A;  2BOY A;  3PCK A;  5TD3 A;  2BV0 A;  1EOA A;  3PCH M;  2BUT B;  3HKP A;  3PCA M;  3PCA A;  2BUQ B;  3MI1 A;  3MI5 A;  3I4Y A;  2BUW A;  2BUZ A;  3PCM M;  3PCL M;  3PCM A;  3PCC M;  4ILT A;  2XSV A;  3O6J A;  3LKT A;  2BUV A;  1YKP B;  1YKL B;  4WHS B;  1YKO B;  2BUX A;  1YKP A;  4WHP D;  1YKL A;  3PCD M;  1YKO A;  1YKN B;  3PCD A;  2BUY B;  2BUR B;  2XSR A;  1YKN A;  3HGI A;  3HHX A;  2BUM A;  3PCH A;  3HJS A;  3PCG M;  2BUT A;  2BUQ A;  3T63 M;  3T63 A;  3HJQ A;  1DMH A;  3PCL A;  2PCD M;  3O32 A;  3PCC A;  3PCE M;  4WHR B;  3PCE A;  4WHQ B;  1TMX A;  3LXV M;  1EOB B;  3LXV A;  3O5U A;  1EO9 B;  2BUU B;  4ILV A;  3T67 M;  3I4V A;  3T67 A;  4WHS A;  1YKK B;  3I51 A;  1DLT A;  2BUY A;  1EO2 B;  2BUR A;  4WHO B;  4WHO A;  3MV6 M;  3PCF M;  3PCG A;  4WHP B;  3MFL M;  3MFL A;  3PCB M;  3HJ8 A;  3PCB A;  3PCN M;  3PCN A;  2PCD A;  4WHQ A;  4WHR A;  4WHR F;  1EOC B;  3PCJ M;  1EOB A;  1EOA B;  2BV0 B;  3PCJ A;  3N9T A;  3PCK M;  3TH1 A;  3O6R A;  1EO9 A;  2BUU A;  3LMX M;  3MV4 M;  3LMX A;  3MV4 A; 
#chains in the Genus database with same CATH topology
 1JR3 A;  2FE8 A;  3LVW A;  3HX3 A;  3PFI A;  2Y20 A;  1P3Q Q;  4M9Z A;  1YKM B;  4RNA A;  4F1I A;  4B3S M;  1VDL A;  4CGY B;  3PCI M;  3GPY A;  2KA6 B;  3M6A A;  3U6L A;  2LVQ D;  1YKM A;  1N33 M;  4W5W A;  3B89 A;  2HCB A;  4L4U A;  2DVW B;  3GLG B;  4JI7 M;  1XWI A;  2XFT A;  2DWN A;  2EO2 A;  3C58 A;  2ERC A;  5EXT A;  3VDP A;  3GLG A;  4M0W A;  5E6J A;  2QBY B;  3LKT M;  2FOI C;  4GRI A;  1QQW A;  2WSC F;  3JR4 A;  3SAU A;  1OFH A;  2HWJ A;  3U5Z B;  3L25 A;  2QQ8 A;  2XGN A;  2CWB A;  4QOZ C;  5H37 D;  1N77 A;  1HT2 E;  3L2A A;  1IN5 A;  4RKU F;  2HHH M;  2BOY A;  3PCK A;  3L27 A;  2DAM A;  1OIP A;  4L6V 6;  4AZF A;  4CJ6 A;  1N34 M;  3FUX A;  2M5Z A;  2DEN A;  3E46 A;  3U6C A;  1TR8 A;  1N36 M;  3CF6 E;  3I4Y A;  3B7N A;  2FH0 A;  3UMM A;  3ILK A;  3TWL A;  2KW0 A;  2MR9 A;  4LZZ A;  4XGI A;  2CUZ A;  3WHL A;  5KO3 A;  3SAV A;  3UZU A;  3PCL M;  3PCM A;  4ILT A;  3GRR A;  3CTW B;  4M9S A;  1R5L A;  2W82 A;  3LKT A;  5LMU M;  2R6F A;  4IJF A;  1Y8G A;  4WHS B;  1H6U A;  2XH9 A;  2BUX A;  1OAO C;  2K0B X;  4R3D A;  4BLC A;  3W67 A;  3R8F A;  4AKG A;  1VEK A;  3KVW A;  1N78 A;  4X62 M;  2BUY B;  2CHV A;  2XSR A;  4NOO B;  2N35 A;  3CF0 A;  4DR7 M;  1XXH B;  2FFJ A;  2V6Z M;  4IIW A;  4DR1 M;  3HU1 A;  4B3R M;  2CFO A;  2VDB B;  3U6E A;  1ZMU A;  2L4E A;  1EFU B;  1TGU A;  4X64 M;  4AW4 A;  4IBK A;  3L26 A;  1DGB A;  1QZE A;  3T63 M;  2CE7 A;  4QHS A;  4PDI A;  2HAK A;  2APL A;  4LJ6 A;  1ZMV A;  1IXS A;  3HHZ A;  3Q8G A;  1SG9 A;  1DMH A;  3GPX A;  1AIP C;  1GKI A;  2LTU A;  3PCL A;  4WHQ B;  3U6O A;  4AKI A;  1G59 A;  4OVZ B;  3SAW A;  3MJ5 A;  1TMX A;  3PCE M;  2BJV A;  2WSE F;  3SC3 A;  1C1K A;  1YE9 A;  2C99 A;  2WSF F;  1DO0 A;  4IBF A;  3LXV M;  3GLI E;  4L15 A;  4JI3 M;  3AL0 C;  1E9R A;  2OOA A;  1EO9 B;  2BUU B;  4G4Q A;  2R44 A;  2VF7 A;  3T67 M;  3FUW A;  3FYC A;  4DBG B;  5C18 A;  2HL7 A;  2K9D A;  5FTL A;  3OTO M;  1R7R A;  3FUV A;  3U60 B;  1EE8 A;  3PNV A;  3AKZ A;  1EO2 B;  2BUR A;  2YQZ A;  4P16 A;  1XMO M;  2DWM A;  5DYG A;  2JY8 A;  3GO8 A;  2CRU A;  1KSF X;  1PRB A;  2LHG A;  2KHH A;  3J2P B;  3U6Q A;  3U60 A;  4LJ8 A;  3MV6 M;  4FW9 A;  4XK8 F;  3PCF M;  4WHP B;  4DR6 M;  1HR0 M;  1HNW M;  2QP9 X;  3UK6 A;  1W5S A;  1VG5 A;  2X49 A;  4JI6 M;  1SXJ E;  3HJ8 A;  2UUA M;  1TTE A;  2GQF A;  3PCN A;  2EKF A;  1PM5 A;  3LQQ A;  3PNY A;  2JNH A;  3WHK A;  2O5R A;  4WHR A;  4OW0 A;  1QZM A;  1TF0 B;  2CHG A;  1TH2 A;  4GH9 A;  5EP3 A;  3H4J A;  1L2D A;  1EOB A;  1EOA B;  1Z6T A;  1VEJ A;  1GJT A;  2C96 A;  3B7Q A;  3FE3 A;  3KOZ E;  2VQF M;  4DV0 M;  4G4O A;  3MV4 A;  4QHT A;  2Y0T A;  5EXP A;  3MI5 M;  3HHW A;  2Z8Y M;  1L2B A;  2L4F A;  4LGM A;  1BVS A;  2EKK A;  4LGY A;  3TWK A;  4UN2 B;  4LG2 A;  3KFU G;  3C9P A;  4WHS D;  3MV6 A;  2LWX A;  3PCF A;  1YLA A;  4MGK E;  1DLM A;  3B9P A;  3RGP A;  2BUV B;  1ORY B;  2QCU A;  4IJE A;  3DZD A;  3Q8X A;  2QPA A;  4RF1 A;  5EXX A;  3GLF B;  1R2Y A;  2F5N A;  4LF6 M;  4B7G A;  3J7A S;  2AZQ A;  4WHO D;  4Q7J A;  3GLF A;  1TH4 A;  2CV2 A;  3ZCB B;  3L28 A;  4MGY E;  1RU3 A;  4NRV A;  4JYA M;  1Q02 A;  1NNU C;  2L09 A;  5KPZ A;  4MH0 E;  1ZAE A;  4R7G A;  3QAU A;  2J7N A;  2JP7 A;  3SYK A;  1IBK M;  4YY3 M;  1EOC A;  1CUK A;  1WHC A;  4M0D A;  4WHQ A;  5TD3 A;  5FLX S;  3PCH M;  1TH3 A;  3W0F A;  3HKP A;  3KOW E;  3FUU A;  2UXB M;  3PCA A;  2BUQ B;  2H5X A;  3J7B A;  4I8O A;  4CIZ A;  3MI5 A;  1QAN A;  4DV1 M;  1HQC A;  3GLH E;  4GKJ M;  1PJI A;  2EUC A;  5IRE B;  3PCM M;  1OKS A;  2KZU A;  3LW5 F;  3J27 B;  1QDR A;  1W5T A;  1DV0 A;  3O6J A;  4G3O A;  4II7 A;  4Z8X A;  3VFD A;  5FSW A;  1YKP B;  4OU7 A;  3ZH9 B;  2QBY A;  4B3T M;  1YKP A;  5E26 A;  3R9X B;  4B3M M;  1NJF A;  2P5T A;  1L1Z A;  4WHP D;  1IN4 A;  1I4W A;  2MGW A;  3PCD A;  4QNR A;  3B74 A;  5L8R F;  1G4A E;  4ANR A;  4FVM A;  2DAI A;  3U5Z A;  2B3T A;  1NV9 A;  3HGI A;  4LF7 M;  4AG5 A;  4P17 A;  2R4J A;  3HHX A;  3PCH A;  1JR3 E;  2QNJ A;  3FTD A;  4LF9 M;  2FS1 A;  1R6B X;  1QYR A;  2XEP A;  2OQ4 A;  1PJQ A;  2FNA A;  2RGH A;  4G6Z A;  1Q3C A;  3PXG A;  4KOD A;  3KDS E;  2RKO A;  4IBD A;  2KZS A;  1Z5C A;  1QUT A;  2M60 A;  3GPP A;  2PCD M;  2Z7J A;  3GPU A;  4ZPX A;  3GLG E;  4DV3 M;  1IM2 A;  1D2N A;  3BXW A;  3SHF A;  2XFS A;  3ZC7 B;  3IHP A;  4HL4 A;  2V1U A;  1N75 A;  5ITR A;  4JI0 M;  3U61 B;  4WHS A;  2X8A A;  2D7H A;  4IBG A;  2E5L M;  1XNQ M;  1HNZ M;  2C9C A;  1GLN A;  1GL6 A;  1YKK B;  5EP2 A;  2D7G A;  1ZV1 A;  2BUY A;  4WHO B;  2MJ5 B;  5F3W A;  4HLQ A;  3SMP A;  3TL4 X;  2BUZ A;  4LJ9 A;  1XXH A;  3I01 M;  2OPF A;  2BNK A;  1J7K A;  2KEB A;  4WHO A;  4X65 M;  2JZ1 A;  4JI5 M;  2MH8 A;  1IY2 A;  1D0K A;  3SAS A;  1GAB A;  1L2C A;  1IY0 A;  4DR3 M;  1J09 A;  3GLI B;  2LNH C;  2ZAM A;  2H1R A;  2WZJ A;  1IN6 A;  2CV1 A;  1T43 A;  4BB9 A;  1L1T A;  3PCN M;  2KNZ A;  1Q39 A;  1QAQ A;  1DGH B;  1MX0 A;  1ZMW A;  1GJS A;  2PCD A;  4GKK M;  1GL7 A;  2JY7 A;  3KOY E;  2KRK A;  2CEA A;  4Y28 F;  4OVZ A;  5KPT A;  2R62 A;  1G41 A;  3JR5 A;  2VQE M;  2DXI A;  2OO9 A;  4IBB A;  3TWM A;  2BV0 B;  1HT1 E;  1XB2 B;  2J5Y A;  1EO9 A;  2BUU A;  4IBE A;  3MV4 M;  2LVO C;  2DZN B;  3HY5 A;  4LY6 A;  5C1B A;  1R4G A;  3GQ3 A;  2BUW B;  3U6D A;  3DOA A;  5IZ7 D;  5ITX A;  3FTF A;  4I5S A;  4NL4 H;  2XZU A;  2KRU A;  2X4A A;  3DFZ A;  4LRT A;  3RFW A;  1EO2 A;  1Z5B A;  2R18 A;  2KNA A;  2QEN A;  3KW6 A;  1HJP A;  4LFB M;  1IY1 A;  4I4L A;  4WHP A;  1NY6 A;  3E4R A;  4A3V B;  2DZO B;  2I7P A;  4L8R C;  1OIZ A;  1FJG M;  2DWL A;  5FTJ A;  3BBZ A;  4Z6Y A;  1IBM M;  1WJ7 A;  3KOX E;  1MJG M;  3K2L A;  3K1J A;  4LF4 M;  3FRI A;  5KQ8 A;  4AKH A;  2R0I A;  1G71 A;  1PJT A;  2K6B A;  3V76 A;  2EA0 A;  3VKG A;  2BUM B;  2XSU A;  1NV8 A;  4JI1 M;  2JXN A;  4AQY M;  4LFC M;  4AG6 A;  4KHP M;  1N32 M;  1EOA A;  2BUT B;  2J7O A;  2XSZ D;  4B7F A;  4F2L A;  2C9O A;  2V1C A;  3PCA M;  2I7N A;  2JA2 A;  3K9O A;  4D81 A;  2QHO B;  1D0L A;  4PDG A;  1T3T A;  3TQS A;  2F5Q A;  4TUW A;  3GRU A;  4BBA A;  2Z4R A;  3KXE C;  4XBO A;  2KXE A;  3HU3 A;  2OOB A;  1XHB A;  4L78 A;  1HQY E;  2DZL A;  3PCC M;  1EIJ A;  2DAG A;  1T6O A;  1D0M A;  3A42 A;  2JWS A;  3NBX X;  2ZBK B;  2BUV A;  5ITY A;  4LJ4 A;  1YKL B;  2F4V M;  2DNA A;  3FTE A;  1VDD A;  3FUT A;  3E9S A;  4EIW A;  5BR8 M;  1YKL A;  2G3Q A;  3PCD M;  1IN7 A;  4NSR A;  1OQY A;  1OAI A;  1WIV A;  2L6O A;  2R4E A;  2UXD M;  2JY5 A;  4M9X A;  1JQJ C;  1OTR A;  3UGJ A;  3U6P A;  1OFI A;  2CP8 A;  3GLH B;  4DV6 M;  3SYL A;  4DR5 M;  1KFV A;  3J80 S;  2O25 A;  4DV4 M;  2C98 A;  3T38 A;  5LMN M;  1E94 E;  1NJG A;  3C3E A;  1XNR M;  2BUQ A;  1VEG A;  1TDZ A;  3HJQ A;  3A45 A;  3AOE C;  3FYD A;  2BJW A;  5EP4 A;  4GC9 A;  3SBJ A;  3QYB A;  1NO1 A;  2C5R A;  2LVA A;  3O32 A;  1PGY A;  3PCC A;  4MGH A;  1Z5A A;  3KP0 E;  4WUR A;  5EJC A;  3E21 A;  4IBI A;  3AJI B;  1IN8 A;  4FWH A;  1SXJ D;  4MGI E;  3J81 S;  3GLF E;  1J5E M;  4JV5 M;  2BWE A;  4GEW A;  1IBL M;  2L7I A;  2R45 A;  3MK6 A;  4LJ7 A;  1Z59 A;  3I4V A;  3GRY A;  2D7E A;  5FTN A;  3B7Z A;  2LVN C;  3GQ5 A;  5A2Q S;  4DV2 M;  3I51 A;  4AI6 A;  3SFZ A;  2CHQ A;  3HZJ A;  3LMM A;  4KLN A;  4JI4 M;  1DLT A;  4G4N A;  1WGL A;  3GRV A;  3TE6 A;  3T1Y M;  4NXM M;  1ZQ9 A;  4LF8 M;  2JY6 B;  3IG5 A;  4LFA M;  4X66 M;  1TDH A;  3EIH A;  2LBC A;  5DYI A;  4MB7 A;  3THG A;  3UJN A;  3RE8 A;  2G8L A;  3QWL A;  1UFZ A;  3MFL A;  1AUA A;  2KDL A;  3C3D A;  2DAK A;  3PCB A;  4ITQ A;  4G4R A;  3IEC A;  2Y0Q A;  4KT0 F;  4WW0 A;  3D8B A;  2UUC M;  2ZAO A;  1XMQ M;  1I94 M;  4JN6 A;  2XF3 A;  1YSY A;  2KNV A;  2XSZ A;  4MM3 B;  5IT9 S;  4WHR F;  1IXR C;  2Y21 A;  1PJJ A;  2UXC M;  2DI0 A;  5FTM A;  2L7H A;  3PCJ A;  3AOE A;  3T15 A;  3TH1 A;  1SXJ C;  4D82 A;  1WR1 B;  3HJS A;  2Z4S A;  3KSJ A;  1VQ1 A;  3LMX A;  3U61 A;  4NXN M;  3MMP A;  3TPZ A;  1JB0 F;  1GO5 A;  3MI1 M;  5ITU A;  5DNY A;  2LXE A;  2NQ8 C;  3KSX A;  3HHY A;  1YKK A;  2BUZ B;  3PCI A;  1QVR A;  3VDU A;  1G3I A;  2VII A;  3SMS A;  3W0L B;  1IXZ A;  2Z3X A;  4LRS A;  1L8Q A;  4PCZ A;  4YHH M;  4JXJ A;  2R46 A;  1S9A A;  3NWL A;  3LVV A;  2YFQ A;  1DO2 A;  1NHG C;  2HKJ A;  3K9P A;  4GMQ A;  4GC5 A;  4R71 A;  2BUX B;  3AV0 A;  4IBJ A;  4D80 A;  3GLI A;  3A98 B;  3FTC A;  5KPR A;  3VK8 A;  3AFH A;  1K82 A;  2UU9 M;  1DGH A;  1X37 A;  4GHL A;  4I81 A;  2ZM6 M;  1OJL A;  3U6S A;  1MN3 A;  4DV7 M;  1DLQ A;  4NRW A;  5DFL A;  4REZ A;  1WGN A;  1G8P A;  1IFY A;  4JI8 M;  2BV0 A;  4PD2 A;  3T1H M;  7CAT A;  2VF8 A;  3MI1 A;  4B08 A;  3F92 A;  2XLJ A;  1IXS B;  1SXJ B;  1V33 A;  1XXH E;  2BUW A;  2DKL A;  1QAO A;  2ZTD A;  4NSO B;  4WP2 A;  1SXJ A;  3GP1 A;  1JR3 D;  2JZ0 A;  3NBI A;  4HEO A;  1HNX M;  2GNO A;  1NVM A;  2QSF X;  2F5O A;  2XSV A;  5BPV A;  2DAE A;  3MHV C;  1QAM A;  3L29 A;  3A46 A;  4DUY M;  2CV0 A;  1XC8 A;  3HU2 A;  5JI2 E;  2EJS A;  3I04 M;  3H4M A;  2DWZ B;  1YKO B;  1DGG A;  1NSF A;  5EQT A;  1QUS A;  3LCV B;  1YKO A;  1YKN B;  2BUR B;  4LJA A;  1DGF A;  5FTK A;  4GIT A;  5GKN A;  1YKN A;  1NHW C;  2QZ4 A;  4PT5 A;  3JAM S;  2RRU A;  3VK7 A;  4RF0 A;  5EXS A;  1E32 A;  3K8Z A;  3FD9 A;  4FWG A;  3SAR A;  2BUM A;  4L16 A;  3PCG M;  5ITX E;  4QNM A;  2G5G X;  4NC6 A;  1QDT A;  2JUJ A;  2BUT A;  4LZJ A;  4FCT A;  3K92 A;  3U6M A;  4FCW A;  3T63 A;  2XZF A;  4DV5 M;  1WXQ A;  2LH0 A;  3VLF B;  4CHT B;  1NNJ A;  4K0K M;  3BOS A;  2LVP C;  1V92 A;  2DHY A;  2RGO A;  8CAT A;  4GHA A;  3PCE A;  2MRO B;  5ITT A;  4WHR B;  2DHR A;  2YR0 A;  1A5T A;  1PJS A;  5ITQ A;  2F5P A;  2YNM D;  4FCV A;  1EOB B;  2ZAN A;  3LXV A;  4LJ5 A;  1Q3B A;  2L2D A;  1K3W A;  3O5U A;  5EP1 A;  2UUB M;  3FKE A;  2BWB A;  2AHM A;  1YUB A;  3IG8 A;  4ILV A;  4LCB A;  4CIS A;  3T67 A;  3VKH A;  4GIP A;  5IWA M;  3LQR A;  3EIE A;  3M7G A;  4LF5 M;  3T6P A;  1R2Z A;  3D8L A;  1MU5 A;  1C7Y A;  1IQP A;  4OX9 M;  5KQD A;  1FNN A;  5JI3 E;  1V34 A;  4DR2 M;  4MGZ E;  3GLH A;  3PCG A;  2LHC A;  1E9S A;  2O01 F;  4KO8 A;  2R65 A;  2ZTC A;  1K3X A;  2A5Y B;  3MFL M;  3SHG B;  3PCB M;  3RGS A;  1F4I A;  3CGW A;  4DUZ M;  3HWS A;  2F5S A;  3GQ4 A;  3CF2 A;  3KS4 A;  1UM8 A;  4QOS A;  3KP1 E;  3ZQJ A;  3LCU A;  3M0E A;  1LTM A;  3SAT A;  4B7H A;  3KS8 A;  3AOG A;  4FD2 A;  3PVS A;  3DA1 A;  4S12 A;  1EOC B;  1NY5 A;  4JI2 M;  3QYE A;  3FRH A;  3PCJ M;  1GVN A;  1LV7 A;  4FWD A;  4IBC A;  3N9T A;  3PCK M;  1S3S A;  3O6R A;  1KYI A;  3W68 A;  2Q2E B;  2K47 A;  3LMX M;  4DR4 M; 
#chains in the Genus database with same CATH homology
 1JR3 A;  2FE8 A;  3LVW A;  3PFI A;  2Y20 A;  4M9Z A;  1YKM B;  4RNA A;  4B3S M;  3PCI M;  4CGY B;  3GPY A;  2KA6 B;  3M6A A;  3U6L A;  1YKM A;  1N33 M;  4W5W A;  2HCB A;  4L4U A;  2DVW B;  3GLG B;  4JI7 M;  1XWI A;  2XFT A;  2DWN A;  2EO2 A;  3C58 A;  2ERC A;  5EXT A;  3VDP A;  3GLG A;  4M0W A;  5E6J A;  2QBY B;  3LKT M;  2FOI C;  4GRI A;  1QQW A;  3JR4 A;  3SAU A;  1OFH A;  3L25 A;  3U5Z B;  2XGN A;  4QOZ C;  5H37 D;  1N77 A;  1HT2 E;  3L2A A;  1IN5 A;  2HHH M;  2BOY A;  3PCK A;  3L27 A;  4AZF A;  1N34 M;  3FUX A;  2M5Z A;  3U6C A;  1N36 M;  3CF6 E;  3I4Y A;  3UMM A;  3ILK A;  3TWL A;  2KW0 A;  3WHL A;  4LZZ A;  4XGI A;  2CUZ A;  5KO3 A;  3SAV A;  2BUZ A;  3UZU A;  3PCL M;  3PCM A;  4ILT A;  3GRR A;  3CTW B;  4M9S A;  2W82 A;  3LKT A;  5LMU M;  4IJF A;  4WHS B;  1H6U A;  2XH9 A;  2BUX A;  4R3D A;  4BLC A;  3R8F A;  4AKG A;  3KVW A;  1N78 A;  4X62 M;  2BUY B;  2CHV A;  2XSR A;  4NOO B;  3CF0 A;  1XXH B;  2FFJ A;  2V6Z M;  4IIW A;  4DR1 M;  3HU1 A;  4B3R M;  2CFO A;  3U6E A;  1TGU A;  3L26 A;  4X64 M;  4AW4 A;  4IBK A;  1DGB A;  3T63 M;  2CE7 A;  4QHS A;  4PDI A;  4LJ6 A;  3HHZ A;  1DMH A;  3PCL A;  3GPX A;  1GKI A;  4WHQ B;  3U6O A;  4AKI A;  1G59 A;  4OVZ B;  3SAW A;  3MJ5 A;  1TMX A;  3PCE M;  2BJV A;  3SC3 A;  1C1K A;  1YE9 A;  2C99 A;  4IBF A;  1DO0 A;  3LXV M;  4L15 A;  4JI3 M;  3AL0 C;  1E9R A;  1EO9 B;  2BUU B;  4G4Q A;  3T67 M;  3FUW A;  3FYC A;  5C18 A;  5FTL A;  2HL7 A;  3OTO M;  1R7R A;  3FUV A;  3U60 B;  1EE8 A;  3PNV A;  3AKZ A;  1EO2 B;  2BUR A;  2YQZ A;  4P16 A;  1XMO M;  2DWM A;  5DYG A;  3GO8 A;  3U60 A;  4NXM M;  1KSF X;  3J2P B;  3U6Q A;  4LJ8 A;  3MV6 M;  4FW9 A;  3PCF M;  4WHP B;  4DR6 M;  1HR0 M;  1HNW M;  2QP9 X;  3UK6 A;  1W5S A;  2X49 A;  4JI6 M;  1SXJ E;  3HJ8 A;  2UUA M;  3PCN A;  1PM5 A;  3LQQ A;  3PNY A;  3WHK A;  2O5R A;  4WHR A;  4OW0 A;  1QZM A;  2CHG A;  4GH9 A;  1TH2 A;  5EP3 A;  1L2D A;  1EOB A;  1EOA B;  1Z6T A;  2C96 A;  3KOZ E;  2VQF M;  4DV0 M;  4G4O A;  3MV4 A;  4QHT A;  2Y0T A;  5EXP A;  3MI5 M;  3HHW A;  1L2B A;  4LGM A;  4LGY A;  4WHS D;  3TWK A;  4LG2 A;  3KFU G;  3MV6 A;  2LWX A;  3PCF A;  4MGK E;  1DLM A;  3B9P A;  3RGP A;  2BUV B;  1ORY B;  2QCU A;  4IJE A;  3DZD A;  3Q8X A;  2QPA A;  4RF1 A;  5EXX A;  3GLF B;  1R2Y A;  2F5N A;  4LF6 M;  4B7G A;  3J7A S;  2AZQ A;  4WHO D;  3GLF A;  1TH4 A;  2CV2 A;  3ZCB B;  3L28 A;  4MGY E;  4NRV A;  4JYA M;  1NNU C;  2L09 A;  5KPZ A;  4MH0 E;  1ZAE A;  4R7G A;  3QAU A;  2J7N A;  3SYK A;  1IBK M;  4YY3 M;  1EOC A;  4M0D A;  5TD3 A;  5FLX S;  3PCH M;  1TH3 A;  3W0F A;  3HKP A;  3KOW E;  3FUU A;  2UXB M;  3PCA A;  2BUQ B;  3J7B A;  4I8O A;  3MI5 A;  1QAN A;  4DV1 M;  1HQC A;  4GKJ M;  1PJI A;  2EUC A;  5IRE B;  3PCM M;  2KZU A;  3J27 B;  1W5T A;  3O6J A;  4II7 A;  4Z8X A;  3VFD A;  5FSW A;  1YKP B;  4OU7 A;  3ZH9 B;  2QBY A;  4B3T M;  1YKP A;  5E26 A;  3R9X B;  4B3M M;  1NJF A;  2P5T A;  1L1Z A;  4WHP D;  1IN4 A;  1I4W A;  3PCD A;  4QNR A;  1G4A E;  4FVM A;  3U5Z A;  3HGI A;  4LF7 M;  4AG5 A;  2R4J A;  3HHX A;  3PCH A;  3FTD A;  4LF9 M;  2XEP A;  1R6B X;  1QYR A;  2OQ4 A;  2RGH A;  2FNA A;  4G6Z A;  3PXG A;  1Q3C A;  4KOD A;  3KDS E;  2RKO A;  4IBD A;  2KZS A;  1Z5C A;  2M60 A;  3GPP A;  2PCD M;  2Z7J A;  3GPU A;  4ZPX A;  4DV3 M;  1IM2 A;  1D2N A;  3SHF A;  2XFS A;  3ZC7 B;  4HL4 A;  2V1U A;  1N75 A;  5ITR A;  4JI0 M;  3U61 B;  4WHS A;  2X8A A;  2D7H A;  4IBG A;  2E5L M;  1XNQ M;  1HNZ M;  2C9C A;  1GLN A;  1GL6 A;  1YKK B;  5EP2 A;  2D7G A;  2BUY A;  4WHO B;  5F3W A;  4HLQ A;  3SMP A;  3TL4 X;  4LJ9 A;  1XXH A;  4WHO A;  2OPF A;  2BNK A;  1J7K A;  2KEB A;  4X65 M;  4JI5 M;  1IY2 A;  3SAS A;  1L2C A;  1IY0 A;  4DR3 M;  1J09 A;  3GLI B;  2LNH C;  2ZAM A;  2H1R A;  1IN6 A;  2CV1 A;  4BB9 A;  1L1T A;  3PCN M;  1Q39 A;  1QAQ A;  1DGH B;  1MX0 A;  2PCD A;  4GKK M;  1GL7 A;  5KPT A;  3KOY E;  2KRK A;  2CEA A;  4DR7 M;  4OVZ A;  4WHQ A;  2R62 A;  1G41 A;  3JR5 A;  2VQE M;  2DXI A;  4IBB A;  3TWM A;  2BV0 B;  1HT1 E;  1EO9 A;  2BUU A;  4IBE A;  3MV4 M;  2DZN B;  4LY6 A;  5C1B A;  3GQ3 A;  2BUW B;  3U6D A;  3DOA A;  5IZ7 D;  5ITX A;  3FTF A;  4I5S A;  4NL4 H;  2XZU A;  2KRU A;  2X4A A;  3DFZ A;  4LRT A;  3RFW A;  1EO2 A;  1Z5B A;  2R18 A;  2QEN A;  3KW6 A;  4LFB M;  1IY1 A;  4I4L A;  4WHP A;  1NY6 A;  3E4R A;  4A3V B;  2DZO B;  2I7P A;  4L8R C;  1FJG M;  2DWL A;  5FTJ A;  4Z6Y A;  1IBM M;  3KOX E;  3K2L A;  4LF4 M;  3K1J A;  5KQ8 A;  4AKH A;  2EA0 A;  3VKG A;  2BUM B;  2XSU A;  4JI1 M;  4AQY M;  4LFC M;  4AG6 A;  4KHP M;  1N32 M;  1EOA A;  2BUT B;  2J7O A;  2XSZ D;  4B7F A;  2C9O A;  2V1C A;  3PCA M;  2I7N A;  2JA2 A;  4D81 A;  2F5Q A;  4PDG A;  4TUW A;  1T3T A;  3TQS A;  3GRU A;  4BBA A;  2Z4R A;  3KXE C;  4XBO A;  2KXE A;  3HU3 A;  1XHB A;  4L78 A;  1HQY E;  3PCC M;  3A42 A;  2ZBK B;  2BUV A;  5ITY A;  4LJ4 A;  1YKL B;  2F4V M;  3FTE A;  1VDD A;  3FUT A;  3E9S A;  4EIW A;  5BR8 M;  1YKL A;  3PCD M;  1IN7 A;  4NSR A;  2L6O A;  2R4E A;  2UXD M;  4M9X A;  1JQJ C;  3UGJ A;  3U6P A;  1OFI A;  3GLH B;  4DV6 M;  3SYL A;  4DR5 M;  1KFV A;  3J80 S;  4DV4 M;  2C98 A;  3T38 A;  5LMN M;  1E94 E;  1NJG A;  1XNR M;  2BUQ A;  1TDZ A;  3HJQ A;  3A45 A;  3AOE C;  3FYD A;  2BJW A;  5EP4 A;  4GC9 A;  3SBJ A;  2C5R A;  3O32 A;  3PCC A;  4MGH A;  1Z5A A;  3KP0 E;  4WUR A;  5EJC A;  4IBI A;  3AJI B;  1IN8 A;  4FWH A;  1SXJ D;  4MGI E;  3J81 S;  1J5E M;  4JV5 M;  1IBL M;  2L7I A;  2R45 A;  3MK6 A;  4LJ7 A;  1Z59 A;  3I4V A;  3GRY A;  2D7E A;  5FTN A;  3GQ5 A;  4DV2 M;  5A2Q S;  4AI6 A;  3I51 A;  3SFZ A;  2CHQ A;  4JI4 M;  3LMM A;  4KLN A;  1DLT A;  4G4N A;  3GRV A;  3TE6 A;  3T1Y M;  1ZQ9 A;  4LF8 M;  3IG5 A;  4LFA M;  4X66 M;  1TDH A;  3EIH A;  5DYI A;  4MB7 A;  3THG A;  3UJN A;  3RE8 A;  2G8L A;  3QWL A;  3MFL A;  3PCB A;  4ITQ A;  4G4R A;  2Y0Q A;  4WW0 A;  3D8B A;  2UUC M;  2ZAO A;  1XMQ M;  1I94 M;  4JN6 A;  2XF3 A;  1YSY A;  2XSZ A;  5IT9 S;  4MM3 B;  4WHR F;  1IXR C;  2Y21 A;  1PJJ A;  2UXC M;  5FTM A;  2L7H A;  3PCJ A;  3AOE A;  3T15 A;  3TH1 A;  1SXJ C;  4D82 A;  3HJS A;  2Z4S A;  3KSJ A;  3LMX A;  3U61 A;  4NXN M;  3TPZ A;  3MI1 M;  5ITU A;  5DNY A;  2LXE A;  2NQ8 C;  3KSX A;  3HHY A;  1YKK A;  2BUZ B;  3PCI A;  1QVR A;  3VDU A;  1G3I A;  2VII A;  3SMS A;  3W0L B;  1IXZ A;  2Z3X A;  4LRS A;  1L8Q A;  4PCZ A;  4YHH M;  4JXJ A;  2R46 A;  1S9A A;  3NWL A;  3LVV A;  2YFQ A;  1DO2 A;  1NHG C;  2HKJ A;  4GMQ A;  4GC5 A;  2BUX B;  3AV0 A;  4IBJ A;  4D80 A;  3GLI A;  3A98 B;  3FTC A;  5KPR A;  3VK8 A;  3AFH A;  1K82 A;  2UU9 M;  1DGH A;  1X37 A;  4GHL A;  4I81 A;  2ZM6 M;  1OJL A;  3U6S A;  4DV7 M;  1DLQ A;  4NRW A;  4REZ A;  1G8P A;  4JI8 M;  2BV0 A;  4PD2 A;  3T1H M;  7CAT A;  3MI1 A;  4B08 A;  2XLJ A;  1IXS B;  1SXJ B;  2BUW A;  1QAO A;  4NSO B;  1SXJ A;  3GP1 A;  1JR3 D;  3NBI A;  1HNX M;  1NVM A;  2F5O A;  2XSV A;  5BPV A;  3MHV C;  1QAM A;  3L29 A;  3A46 A;  4DUY M;  2CV0 A;  1XC8 A;  3HU2 A;  5JI2 E;  3H4M A;  2DWZ B;  1YKO B;  1DGG A;  1NSF A;  5EQT A;  1YKO A;  1YKN B;  2BUR B;  4LJA A;  1DGF A;  5FTK A;  4GIT A;  5GKN A;  1YKN A;  1NHW C;  2QZ4 A;  4PT5 A;  3JAM S;  3VK7 A;  4RF0 A;  5EXS A;  1E32 A;  3K8Z A;  3FD9 A;  4FWG A;  3SAR A;  2BUM A;  4L16 A;  3PCG M;  5ITX E;  4QNM A;  2G5G X;  2BUT A;  4LZJ A;  4FCT A;  3K92 A;  3U6M A;  4FCW A;  3T63 A;  2XZF A;  4DV5 M;  1WXQ A;  2LH0 A;  3VLF B;  4CHT B;  1NNJ A;  4K0K M;  3BOS A;  2RGO A;  8CAT A;  4GHA A;  3PCE A;  4WHR B;  5ITT A;  2DHR A;  2YR0 A;  5ITQ A;  2F5P A;  2YNM D;  4FCV A;  1EOB B;  2ZAN A;  3LXV A;  4LJ5 A;  1Q3B A;  1K3W A;  3O5U A;  5EP1 A;  2UUB M;  3FKE A;  2AHM A;  1YUB A;  3IG8 A;  4ILV A;  4LCB A;  4CIS A;  3T67 A;  3VKH A;  4GIP A;  5IWA M;  3LQR A;  3EIE A;  3M7G A;  4LF5 M;  1R2Z A;  3D8L A;  1MU5 A;  4OX9 M;  1IQP A;  5KQD A;  1FNN A;  5JI3 E;  4DR2 M;  4MGZ E;  3GLH A;  3PCG A;  1E9S A;  4KO8 A;  2R65 A;  1K3X A;  2A5Y B;  3MFL M;  3SHG B;  3PCB M;  3RGS A;  4DUZ M;  2F5S A;  3HWS A;  3GQ4 A;  3CF2 A;  3KS4 A;  1UM8 A;  4QOS A;  3KP1 E;  3M0E A;  3SAT A;  4B7H A;  3KS8 A;  3AOG A;  4FD2 A;  3PVS A;  3DA1 A;  4S12 A;  1EOC B;  1NY5 A;  4JI2 M;  3PCJ M;  1GVN A;  1LV7 A;  4FWD A;  4IBC A;  3N9T A;  3PCK M;  1S3S A;  3O6R A;  1KYI A;  2Q2E B;  2K47 A;  3LMX M;  4DR4 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...