1FJGM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1fjgM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1fjgM02
2F4VM 4GKJM 2OQ4A 5LMNM 1K3WA 3VK8A 3U6PA 4JV5M 4B3TM 1XC8A 1TDHA 2E5LM 4G4QA 4DV6M 3J7AS 5ITXE 1IBKM 1L2CA 4G4NA 3W0FA 1N36M 4LF9M 4KHPM 1Z5AA 2UXDM 4PCZA 4PDIA 5A2QS 3OTOM 1XMOM 4MB7A 4JI3M 3VK7A 1J5EM 2HHHM 4DV1M 3TWMA 2UUCM 4YY3M 1N34M 4DV4M 4B3SM 4OX9M 4DUYM 3SAVA 5IT9S 3SBJA 1K82A 4G4RA 3GQ3A 4X66M 3GO8A 3SAWA 4K0KM 4B3MM 4JI4M 3T1YM 3U6MA 2F5NA 2UXBM 4JI0M 3A45A 4LF6M 2F5OA 4B3RM 1L2DA 3JR4A 4G4OA 1Z5CA 5ITXA 4JYAM 1NNJA 4DR6M 5BR8M 1L1TA 4JI1M 1HR0M 1HNXM 4YHHM 1Q3BA 1MX0A 3U6QA 3C58A 3U6EA 4JI8M 1HNZM 1HNWM 3J80S 3GPUA 3DOAA 4DV7M 3U6OA 3U6LA 3JAMS 4LFAM 4DUZM 4PD2A 2UUBM 4LFBM 3TWKA 1R2YA 1TDZA 3GQ4A 3J81S 3GPYA 2XZFA 1IBLM 3JR5A 3SARA 5ITYA 4DR7M 1MU5A 3GP1A 4X64M 4GKKM 4DR4M 2VQEM 1PJJA 4ITQA 1IBMM 3A42A 4NXMM 4LF7M 4LF8M 3SATA 3GPXA 1XNRM 2OPFA 4NRWA 1L1ZA 4DV2M 1PM5A 1R2ZA 4DV0M 1Z5BA 5ITTA 4AQYM 2UUAM 4LFCM 4X65M 3A46A 1N33M 1Q3CA 4LF4M 4DR1M 1N32M 5FLXS 4NXNM 5ITQA 2HKJA 3GQ5A 4DR5M 5ITUA 2F5QA 1XNQM 2F5SA 5LMUM 1Z59A 4NRVA 1L2BA 1I94M 5ITRA 4X62M 2ZBKB 1Q39A 4LF5M 4CISA 4DV5M 3U6DA 3T1HM 1KFVA 4JI5M 3U6CA 2VQFM 3GPPA 1K3XA 4DR3M 1PJIA 3SAUA 2ZM6M 2UXCM 3SASA 4PDGA 2Q2EB 2XZUA 3U6SA 2UU9M 5IWAM 2F5PA 1FJGM 1EE8A 4JI7M 2EA0A 4JI6M 4DV3M 4DR2M 4JI2M 3TWLA 1XMQM
chains in the Genus database with same CATH superfamily
4DBGB 2XSZA 3EIEA 3L27A 4GIPA 5LMNM 3U5ZB 3WHLA 1K3WA 2LVNC 3FYCA 3HZJA 3LW5F 1DGBA 2L6OA 4IBDA 4BLCA 4DV6M 1DGHA 4BBAA 2C9OA 1N36M 4ANRA 1QUTA 4KHPM 2LVOC 1DO0A 2RGOA 2BJWA 2LWXA 3VDUA 1QVRA 1VEGA 1WR1B 4PCZA 5A2QS 1XMOM 3GLIB 4JI3M 3GLFE 4DV1M 4YY3M 2DZOB 4DV4M 3HHXA 3HHZA 2CRUA 4IBFA 3SBJA 3FRIA 2JA2A 4G4RA 3FRHA 3MJ5A 4G3OA 3AV0A 3T38A 3ZCBB 3GQ3A 3GO8A 3J7BA 3NBXX 4JI4M 2L4EA 1DGHB 4JI0M 1IN5A 2F5OA 1L2DA 4S12A 3JR4A 1JB0F 2FH0A 5ITXA 3V76A 3M7GA 3UK6A 4LRTA 1TGUA 3J2PB 4JI1M 4JYAM 1ZMWA 2C5RA 4YHHM 1Q3BA 3VFDA 4GH9A 3U6QA 1AIPC 3C3EA 3GRVA 3BXWA 2V1UA 3SHGB 4WURA 2R18A 3L25A 4TUWA 2C96A 5L8RF 3TPZA 3U61B 2R62A 3AKZA 4DV7M 3U6LA 3FUTA 3RGPA 1YE9A 2JY6B 2EO2A 3QYEA 3L28A 1TDZA 2R4JA 5EXXA 1EFUB 2G8LA 3LVWA 4LRSA 4QHSA 3B74A 4F2LA 2XZFA 4KT0F 4P16A 3GPYA 1NV8A 3JR5A 5KO3A 2DZLA 4GHAA 1MU5A 4X64M 1PRBA 1E94E 1HT2E 2DVWB 2L09A 3M0EA 4B08A 2K0BX 3RGSA 1PJJA 4M9SA 3HHYA 4LF7M 2L7IA 4LF8M 3GRRA 1IFYA 2KRKA 2X4AA 4L6V6 2OO9A 2JWSA 3E9SA 2OPFA 1VEJA 2MH8A 4M9XA 4REZA 4IIWA 1I4WA 2MJ5B 4FWHA 2LVAA 4LJ4A 3CF2A 2Y21A 5EJCA 1T43A 2CEAA 5EXTA 2MROB 5GKNA 4CHTB 3K8ZA 5ITTA 1F4IA 4NOOB 4X65M 4HEOA 1DV0A 4IBEA 3UMMA 2Z4SA 3W67A 2CHVA 1OIPA 4CJ6A 3PNYA 1D0MA 3KDSE 3KOXE 4DR1M 1T3TA 1J09A 2W82A 4DR5M 2F5QA 1OAOC 2DI0A 1XNQM 4AI6A 1P3QQ 3ZQJA 1GL7A 2JUJA 4FCVA 5ITRA 4X62M 2QENA 5FTLA 1GKIA 2QHOB 4CISA 1NNUC 2L4FA 4LJ8A 1PGYA 3CF0A 1KFVA 4LJAA 1QDTA 4I4LA 1FNNA 3AOGA 5EP2A 4AKHA 2C98A 1PJTA 3KP1E 5KPZA 4RF1A 4IBJA 2ZM6M 4KODA 1YUBA 4L16A 2JY5A 4GMQA 1ZQ9A 2D7EA 3HJQA 4AW4A 2ZTCA 2KHHA 1IQPA 3SMSA 4JI6M 2EUCA 1R6BX 3TWLA 4I81A 5JI3E 4LGYA 3FUVA 1NV9A 2KDLA 1ZAEA 1Z6TA 2LHGA 2R44A 3THGA 4KLNA 2CFOA 1G3IA 2DHYA 3L29A 2VIIA 1TDHA 1VDLA 3KW6A 4G4QA 2DHRA 3NBIA 3SMPA 1TH3A 1UM8A 5ITXE 4EIWA 5F3WA 5EP1A 1DGGA 4B7FA 4LZJA 1G41A 1OTRA 2D7GA 2XGNA 3M6AA 4LF9M 3TL4X 1NY6A 4F1IA 2BNKA 4UN2B 4XK8F 1JR3A 4PDIA 3VK7A 1IXZA 4ZPXA 3E21A 1TF0B 3F92A 1WXQA 4OX9M 4DUYM 1MJGM 1R7RA 1K82A 3D8BA 8CATA 2V6ZM 2G3QA 4LGMA 3GLIA 3C9PA 1JR3D 2KNZA 2EKKA 3SAWA 4FCWA 3HY5A 1QANA 2V1CA 3FUWA 3T1YM 2UXBM 3K9PA 3A45A 2K47A 3RE8A 3R9XB 2QP9X 3I04M 3LVVA 4MGZE 4G4OA 2B3TA 3HGIA 5BR8M 1L1TA 1W5SA 2R6FA 2DENA 1IM2A 1HNXM 4G6ZA 3HJ8A 3KP0E 3SFZA 2MGWA 3SHFA 2VDBB 3U6EA 2RGHA 2QCUA 3KXEC 4D82A 1H6UA 1ZMUA 3R8FA 4M0WA 3KSJA 2KZUA 1VQ1A 2O5RA 5FTNA 1DO2A 4FWGA 3KOZE 1NJGA 1J7KA 1W5TA 4DUZM 2BWBA 4PD2A 2UUBM 1R2YA 3I01M 3U61A 1IN8A 2AHMA 2M5ZA 4FVMA 3GQ4A 1OFIA 3J27B 2KNVA 3J81S 1NJFA 1IN4A 1LTMA 2N35A 4GKKM 1HT1E 3DFZA 2VQEM 1V34A 2R46A 3AFHA 2O01F 1C1KA 1IN7A 3CF6E 4ITQA 2L7HA 2FNAA 4QOSA 2DAMA 1RU3A 4IBKA 3VLFB 5EP3A 1XNRM 2CWBA 3GRYA 1OJLA 2Z3XA 1XXHA 2YFQA 3KSXA 1E32A 4I5SA 4DV2M 4GHLA 2DKLA 2VF7A 3HKPA 4A3VB 4LCBA 3Q8XA 5DFLA 3B89A 1ZV1A 2FOIC 5FTKA 3VKHA 1Q3CA 4LF4M 4P17A 5DNYA 1QAOA 2DAGA 3KVWA 1Q02A 2DWLA 2C99A 5ITUA 3FTDA 4AG6A 2JZ0A 1E9RA 1I94M 4QNRA 1Q39A 5E6JA 1XXHB 2R4EA 4DV0M 2LVPC 4DV5M 3T1HM 3PFIA 1VG5A 1WIVA 1K3XA 2R0IA 1WJ7A 3T15A 1V33A 4MGIE 1JR3E 3B7QA 3K1JA 4PDGA 2EKFA 1MN3A 2Q2EB 3DA1A 1N78A 3LQQA 2XZUA 5IWAM 2HAKA 4JI7M 1HJPA 1UFZA 4JI2M 1G4AE 1GLNA 3GLIE 1ZMVA 4FWDA 4D80A 3VK8A 4R3DA 1TTEA 3PNVA 5FTMA 2KW0A 3U6PA 3TE6A 1G59A 1L8QA 1XC8A 2JNHA 2J7OA 3DZDA 2E5LM 2QSFX 3AOEA 3FTEA 1IBKM 4I8OA 2QZ4A 3W0FA 1E9SA 2QQ8A 2XF3A 2L2DA 2QBYA 2JZ1A 3PXGA 2O25A 3I4YA 1Z5AA 2UXDM 3ILKA 1SXJA 3GLGB 2I7NA 3QAUA 1EIJA 1QDRA 3OTOM 1J5EM 4MB7A 4II7A 3QWLA 3TWMA 3IG5A 3FTCA 1GABA 4NL4H 1OKSA 3RFWA 4B3SM 4GRIA 5IT9S 2C9CA 2Y20A 1SXJD 2Y0QA 2YQZA 2KEBA 4IJFA 3I4VA 4XBOA 4X66M 4M0DA 4K0KM 2J5YA 4JXJA 4B3MM 2H5XA 2WSEF 1QZMA 4GC9A 5KPRA 2QBYB 2CV1A 2QPAA 1Z5CA 1NNJA 3HHWA 4MGYE 4MGHA 1D2NA 1SXJB 5JI2E 3GLFB 1MX0A 3K2LA 3C58A 2LH0A 3CTWB 4Y28F 1D0LA 4D81A 3HWSA 3BOSA 3J80S 3GPUA 4HLQA 3H4MA 2XLJA 1XXHE 2R65A 1OIZA 2HL7A 3U6OA 4Z8XA 3JAMS 4LFAM 3ZC7B 2K9DA 3TWKA 2G5GX 2Z8YM 3UGJA 3L26A 1N75A 1PJSA 1IBLM 1VDDA 4IBIA 5FTJA 2EJSA 3CGWA 4W5WA 3SC3A 3FD9A 3W0LB 4B7GA 2CV2A 1QQWA 3SARA 3KS8A 2GNOA 2GQFA 4M9ZA 4QNMA 3B7ZA 4L78A 4LJ9A 5DYIA 5IZ7D 4DR4M 4IBBA 1TH2A 2OOAA 1IBMM 2J7NA 3A42A 1PJQA 2OOBA 5IREB 2KNAA 3GRUA 3KOWE 3SATA 3BBZA 2CUZA 3GPXA 3B9PA 1IY2A 3HU1A 5H37D 1Z5BA 4LJ7A 4MM3B 1CUKA 3LCUA 2WSFF 5FSWA 2UUAM 4GEWA 1IY0A 3FTFA 3A46A 3GLGE 4KO8A 3B7NA 3UZUA 1N32M 4NXNM 1TH4A 2XFTA 4L4UA 1NVMA 3MHVC 1G8PA 5E26A 1NO1A 2F5SA 2QNJA 2Z7JA 4AKIA 1OAIA 3AL0C 2XSZD 2ZBKB 4LF5M 3U6DA 1OFHA 2Y0TA 4GITA 3U6CA 2Z4RA 4PT5A 2VQFM 1V92A 3GPPA 1R5LA 1SXJE 2YNMD 3H4JA 4BB9A 3MK6A 4DR3M 2XH9A 3SAUA 3K92A 3SASA 2XFSA 2APLA 3FUUA 1KYIA 1WGLA 1N77A 2F5PA 1EE8A 2EA0A 2ERCA 4MH0E 5EQTA 2A5YB 2DAEA 3L2AA 4DV3M 4DR2M 1VEKA 3NWLA 2JP7A 3KFUG 2RRUA 1S3SA 2P5TA 3GLHA 1XMQM 2F4VM 4GKJM 2OQ4A 1YSYA 2MR9A 2H1RA 4GC5A 1QUSA 3VKGA 4JV5M 4RNAA 3U60A 4AG5A 5EP4A 3HU3A 3J7AS 2HWJA 4G4NA 1L2CA 3KOYE 2I7PA 1QZEA 3HJSA 3W68A 1OQYA 1IN6A 2HCBA 3IG8A 2KXEA 4B3TM 4WW0A 2HHHM 3FE3A 1QAQA 2UUCM 3E46A 1N34M 1TR8A 1YLAA 3GLHB 4NC6A 2DWMA 4AKGA 3LQRA 3SAVA 2DNAA 1HQYE 2CP8A 4HL4A 3GLGA 3SYLA 4AZFA 2CHQA 4IBCA 5KQDA 3U60B 2LBCA 2KRUA 3LCVB 3UJNA 1ORYB 2LNHC 2F5NA 3U6MA 4FW9A 4Q7JA 4LF6M 4FCTA 4IBGA 4B3RM 3IHPA 5EXSA 3FUXA 2KA6B 4LG2A 4DR6M 3IECA 1HR0M 2LHCA 2KZSA 4JN6A 3K9OA 2FFJA 2FE8A 4LZZA 4JI8M 4LY6A 2LVQD 1HNZM 2JXNA 1HNWM 1AUAA 5DYGA 1QAMA 3TQSA 5BPVA 3GLFA 5C18A 4IJEA 3DOAA 5KQ8A 4OU7A 2DWNA 1JQJC 2CV0A 3EIHA 3E4RA 1GVNA 1NHGC 2X49A 2DAIA 2LTUA 2WZJA 3SYKA 4LFBM 2CHGA 3A98B 1IXRC 4LJ6A 2NQ8C 3FKEA 2DAKA 4MGKE 2DZNB 2M60A 3WHKA 3ZH9B 1GJTA 4B7HA 4LJ5A 5ITYA 4DR7M 3GP1A 2VF8A 1NHWC 2ZTDA 4RKUF 1GL6A 1XHBA 4RF0A 1XB2B 1BVSA 2JY8A 1NY5A 4XGIA 2FS1A 4NXMM 5KPTA 2LXEA 3HU2A 4OVZA 4QHTA 4R71A 4CIZA 5C1BA 1L1ZA 4NRWA 1PM5A 2DWZB 1R2ZA 2BWEA 1GJSA 1GO5A 4FD2A 4AQYM 1T6OA 1IXSA 4R7GA 4LFCM 1SG9A 1LV7A 4NSOB 1N33M 3FYDA 4L8RC 2R45A 4OW0A 3D8LA 5FLXS 2K6BA 2XEPA 3GLHE 5ITQA 1WHCA 2BJVA 2HKJA 3Q8GA 2RKOA 7CATA 3GQ5A 3KS4A 2ZAOA 4L15A 1KSFX 5LMUM 1Z59A 1C7YA 3PVSA 4NRVA 4OVZB 3I51A 2YR0A 3U5ZA 1L2BA 2DXIA 2ZAMA 4Z6YA 1X37A 1IY1A 1NSFA 1XWIA 2X8AA 3QYBA 2WSCF 3C3DA 3AJIB 1A5TA 3LMMA 1DGFA 4JI5M 1G71A 1IXSB 3AOEC 3VDPA 1HQCA 3T6PA 2CE7A 1WGNA 1R4GA 1PJIA 1D0KA 2ZANA 4CGYB 4QOZC 2UXCM 3U6SA 2UU9M 1FJGM 1QYRA 1Y8GA 5EXPA 1SXJC 4WP2A 2D7HA 3MMPA 3HX3A 2JY7A 4NSRA
chains in the Genus database with same CATH topology
2XSZA 3EIEA 3L27A 4GIPA 5LMNM 3U5ZB 3WHLA 1K3WA 3FYCA 1DGBA 2L6OA 4IBDA 4BLCA 4DV6M 1DGHA 4BBAA 2C9OA 1N36M 4KHPM 1DO0A 2RGOA 2BJWA 2LWXA 3VDUA 1QVRA 4PCZA 1XMOM 5A2QS 3GLIB 4JI3M 4DV1M 4YY3M 2DZOB 4DV4M 3HHXA 3HHZA 4IBFA 3SBJA 2JA2A 4G4RA 3MJ5A 3AV0A 3T38A 3ZCBB 3GQ3A 3GO8A 3J7BA 4JI4M 1DGHB 4JI0M 1IN5A 2F5OA 1L2DA 4S12A 3JR4A 5ITXA 4JYAM 3M7GA 3UK6A 4LRTA 1TGUA 3J2PB 4JI1M 2C5RA 4YHHM 1Q3BA 3VFDA 4GH9A 3U6QA 3GRVA 2V1UA 3SHGB 4WURA 2R18A 3L25A 4TUWA 2C96A 3TPZA 3U61B 2R62A 3AKZA 4DV7M 3U6LA 3FUTA 3RGPA 1YE9A 2EO2A 3L28A 1TDZA 2R4JA 5EXXA 3LVWA 2G8LA 4LRSA 4QHSA 2XZFA 4P16A 3GPYA 3JR5A 5KO3A 4GHAA 1MU5A 4X64M 2L09A 1E94E 1HT2E 2DVWB 3M0EA 4B08A 3RGSA 1PJJA 4M9SA 3HHYA 4LF7M 2L7IA 4LF8M 3GRRA 2KRKA 2X4AA 3E9SA 2OPFA 4M9XA 4REZA 4IIWA 1I4WA 4FWHA 4LJ4A 5GKNA 3CF2A 2Y21A 5EJCA 2CEAA 5EXTA 4CHTB 4DV0M 3K8ZA 5ITTA 4NOOB 4X65M 4IBEA 3UMMA 2Z4SA 2CHVA 3PNYA 4DR1M 3KDSE 3KOXE 1T3TA 1J09A 2W82A 4DR5M 2F5QA 1XNQM 4AI6A 1GL7A 4FCVA 5ITRA 4X62M 2QENA 5FTLA 1GKIA 4CISA 1NNUC 4LJ8A 3CF0A 1KFVA 4LJAA 4I4LA 1FNNA 3AOGA 5EP2A 4AKHA 2C98A 3KP1E 5KPZA 4RF1A 4IBJA 2ZM6M 4KODA 1YUBA 4L16A 4GMQA 1ZQ9A 2D7EA 3HJQA 4AW4A 1IQPA 3SMSA 4JI6M 2EUCA 1R6BX 3TWLA 4I81A 5JI3E 4LGYA 3FUVA 3THGA 1ZAEA 1Z6TA 4KLNA 2CFOA 1G3IA 3L29A 2VIIA 1TDHA 3KW6A 4G4QA 2DHRA 3NBIA 3SMPA 1TH3A 1UM8A 5ITXE 4EIWA 5F3WA 5EP1A 1DGGA 4B7FA 4LZJA 1G41A 2D7GA 2XGNA 3M6AA 4LF9M 3TL4X 1NY6A 2BNKA 1JR3A 4PDIA 3VK7A 1IXZA 4ZPXA 1WXQA 4OX9M 4DUYM 1R7RA 1K82A 3D8BA 8CATA 2V6ZM 4LGMA 3GLIA 1JR3D 3SAWA 4FCWA 1QANA 2V1CA 3FUWA 3T1YM 2UXBM 3A45A 2K47A 3RE8A 3R9XB 2QP9X 3LVVA 4MGZE 4G4OA 3HGIA 5BR8M 1L1TA 1W5SA 1IM2A 1HNXM 4G6ZA 3HJ8A 3KP0E 3SFZA 3SHFA 3U6EA 2RGHA 2QCUA 3KXEC 4D82A 1H6UA 3R8FA 4M0WA 3KSJA 2KZUA 2O5RA 5FTNA 1DO2A 4FWGA 3KOZE 1NJGA 1J7KA 1W5TA 4DUZM 4PD2A 2UUBM 1R2YA 3U61A 1IN8A 2AHMA 2M5ZA 4FVMA 3GQ4A 1OFIA 3J27B 3J81S 1NJFA 1IN4A 4GKKM 1HT1E 3DFZA 2VQEM 2R46A 3AFHA 4ITQA 1C1KA 1IN7A 3CF6E 2L7HA 2FNAA 4QOSA 4IBKA 3VLFB 5EP3A 1XNRM 3GRYA 1OJLA 2Z3XA 1XXHA 2YFQA 3KSXA 1E32A 4I5SA 4DV2M 3HKPA 4A3VB 4LCBA 3Q8XA 2FOIC 5FTKA 1Q3CA 4LF4M 5DNYA 1QAOA 3KVWA 2DWLA 2C99A 5ITUA 3FTDA 4AG6A 1E9RA 1I94M 4QNRA 1Q39A 5E6JA 1XXHB 2R4EA 4DV5M 3T1HM 3PFIA 1K3XA 3T15A 4MGIE 3K1JA 4PDGA 2Q2EB 3DA1A 1N78A 3LQQA 2XZUA 5IWAM 4JI7M 4JI2M 1G4AE 1GLNA 4D80A 4FWDA 3VK8A 4R3DA 4GHLA 3PNVA 5FTMA 2KW0A 3U6PA 3TE6A 1G59A 1L8QA 1XC8A 2J7OA 3DZDA 2E5LM 3AOEA 3FTEA 1IBKM 4I8OA 2QZ4A 3W0FA 1E9SA 2XF3A 2QBYA 3PXGA 3I4YA 1Z5AA 2UXDM 3ILKA 1SXJA 3GLGB 2I7NA 3QAUA 3OTOM 1J5EM 4MB7A 4II7A 3QWLA 3TWMA 3IG5A 3FTCA 4NL4H 3RFWA 4B3SM 4GRIA 5IT9S 2C9CA 2Y20A 1SXJD 2Y0QA 2YQZA 2KEBA 4IJFA 3I4VA 4XBOA 4X66M 4M0DA 4K0KM 4JXJA 4B3MM 5KPRA 1QZMA 4GC9A 2QBYB 2CV1A 2QPAA 1Z5CA 1NNJA 3HHWA 4MGYE 4MGHA 1D2NA 1SXJB 5JI2E 3GLFB 1MX0A 3K2LA 3C58A 2LH0A 3CTWB 4D81A 3HWSA 3BOSA 3J80S 3GPUA 4HLQA 3H4MA 2XLJA 2R65A 2HL7A 3U6OA 4Z8XA 3JAMS 4LFAM 3ZC7B 3TWKA 2G5GX 3UGJA 3L26A 1N75A 1IBLM 1VDDA 4IBIA 5FTJA 3SC3A 3W0LB 4W5WA 4B7GA 3FD9A 2CV2A 3SARA 3VKHA 1QQWA 3KS8A 4QNMA 4M9ZA 5DYIA 4DR4M 4L78A 5IZ7D 4LJ9A 4IBBA 1TH2A 1IBMM 2J7NA 3A42A 5IREB 3GRUA 3KOWE 3SATA 2CUZA 3GPXA 3B9PA 1IY2A 3HU1A 5H37D 1Z5BA 4LJ7A 4MM3B 5FSWA 2UUAM 1IY0A 3FTFA 3A46A 4KO8A 3UZUA 1N32M 4NXNM 1TH4A 2XFTA 4L4UA 1NVMA 3MHVC 1G8PA 5E26A 2F5SA 2Z7JA 4AKIA 3AL0C 2XSZD 2ZBKB 4LF5M 3U6DA 1OFHA 2Y0TA 4GITA 3U6CA 2Z4RA 4PT5A 2VQFM 3GPPA 1SXJE 2YNMD 4BB9A 4DR3M 3MK6A 3SAUA 2XH9A 3K92A 3SASA 2XFSA 3FUUA 1KYIA 1N77A 2F5PA 1EE8A 2EA0A 2ERCA 4MH0E 5EQTA 2A5YB 3L2AA 4DV3M 4DR2M 3KFUG 3NWLA 1XMQM 2P5TA 3GLHA 1S3SA 2F4VM 4GKJM 2OQ4A 1YSYA 3VKGA 2H1RA 4GC5A 4JV5M 4RNAA 3U60A 5EP4A 3HU3A 3J7AS 1L2CA 4G4NA 3KOYE 2I7PA 3HJSA 1IN6A 2HCBA 3IG8A 2KXEA 4B3TM 4WW0A 2HHHM 1QAQA 2UUCM 1N34M 4AKGA 3GLHB 2DWMA 3LQRA 3SAVA 3GLGA 1HQYE 4HL4A 3SYLA 4AZFA 2CHQA 4IBCA 5KQDA 3U60B 2KRUA 3UJNA 1ORYB 2LNHC 2F5NA 3U6MA 4FW9A 4LF6M 4FCTA 4IBGA 4B3RM 5EXSA 3FUXA 2KA6B 4LG2A 4DR6M 1HR0M 2KZSA 4JN6A 2FFJA 2FE8A 4LZZA 4JI8M 4LY6A 1HNZM 1HNWM 5DYGA 1QAMA 3TQSA 5BPVA 3GLFA 5C18A 4IJEA 3DOAA 5KQ8A 4OU7A 2DWNA 1JQJC 2CV0A 3EIHA 3E4RA 1GVNA 1NHGC 2X49A 4LFBM 3SYKA 2CHGA 3A98B 1IXRC 4LJ6A 2NQ8C 3FKEA 3WHKA 4MGKE 2DZNB 2M60A 3ZH9B 4B7HA 4LJ5A 5ITYA 4DR7M 3GP1A 1NHWC 1GL6A 1XHBA 4RF0A 1NY5A 4XGIA 4NXMM 5KPTA 2LXEA 3HU2A 4OVZA 4QHTA 4NRWA 5C1BA 1L1ZA 1PM5A 2DWZB 1R2ZA 4FD2A 4AQYM 4R7GA 4LFCM 1LV7A 4NSOB 1N33M 3FYDA 4L8RC 2R45A 4OW0A 3D8LA 5FLXS 2XEPA 5ITQA 2BJVA 2HKJA 7CATA 3GQ5A 2RKOA 3KS4A 2ZAOA 4L15A 1KSFX 5LMUM 1Z59A 3PVSA 4NRVA 4OVZB 3I51A 2YR0A 3U5ZA 1L2BA 2DXIA 2ZAMA 4Z6YA 1X37A 1IY1A 1NSFA 1XWIA 2X8AA 3LMMA 3AJIB 4JI5M 1DGFA 1IXSB 3AOEC 3VDPA 1HQCA 2CE7A 1PJIA 2ZANA 4CGYB 4QOZC 2UXCM 3U6SA 2UU9M 1FJGM 1QYRA 5EXPA 1SXJC 2D7HA 4AG5A 4NSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V M;  4GKJ M;  2OQ4 A;  5LMN M;  1K3W A;  3VK8 A;  3U6P A;  4JV5 M;  4B3T M;  1XC8 A;  1TDH A;  2E5L M;  4G4Q A;  4DV6 M;  3J7A S;  5ITX E;  1IBK M;  1L2C A;  4G4N A;  3W0F A;  1N36 M;  4LF9 M;  4KHP M;  1Z5A A;  2UXD M;  4PCZ A;  4PDI A;  5A2Q S;  3OTO M;  1XMO M;  4MB7 A;  4JI3 M;  3VK7 A;  1J5E M;  2HHH M;  4DV1 M;  3TWM A;  2UUC M;  4YY3 M;  1N34 M;  4DV4 M;  4B3S M;  4OX9 M;  4DUY M;  3SAV A;  5IT9 S;  3SBJ A;  1K82 A;  4G4R A;  3GQ3 A;  4X66 M;  3GO8 A;  3SAW A;  4K0K M;  4B3M M;  4JI4 M;  3T1Y M;  3U6M A;  2F5N A;  2UXB M;  4JI0 M;  3A45 A;  4LF6 M;  2F5O A;  4B3R M;  1L2D A;  3JR4 A;  4G4O A;  1Z5C A;  5ITX A;  4JYA M;  1NNJ A;  4DR6 M;  5BR8 M;  1L1T A;  4JI1 M;  1HR0 M;  1HNX M;  4YHH M;  1Q3B A;  1MX0 A;  3U6Q A;  3C58 A;  3U6E A;  4JI8 M;  1HNZ M;  1HNW M;  3J80 S;  3GPU A;  3DOA A;  4DV7 M;  3U6O A;  3U6L A;  3JAM S;  4LFA M;  4DUZ M;  4PD2 A;  2UUB M;  4LFB M;  3TWK A;  1R2Y A;  1TDZ A;  3GQ4 A;  3J81 S;  3GPY A;  2XZF A;  1IBL M;  3JR5 A;  3SAR A;  5ITY A;  4DR7 M;  1MU5 A;  3GP1 A;  4X64 M;  4GKK M;  4DR4 M;  2VQE M;  1PJJ A;  4ITQ A;  1IBM M;  3A42 A;  4NXM M;  4LF7 M;  4LF8 M;  3SAT A;  3GPX A;  1XNR M;  2OPF A;  4NRW A;  1L1Z A;  4DV2 M;  1PM5 A;  1R2Z A;  4DV0 M;  1Z5B A;  5ITT A;  4AQY M;  2UUA M;  4LFC M;  4X65 M;  3A46 A;  1N33 M;  1Q3C A;  4LF4 M;  4DR1 M;  1N32 M;  5FLX S;  4NXN M;  5ITQ A;  2HKJ A;  3GQ5 A;  4DR5 M;  5ITU A;  2F5Q A;  1XNQ M;  2F5S A;  5LMU M;  1Z59 A;  4NRV A;  1L2B A;  1I94 M;  5ITR A;  4X62 M;  2ZBK B;  1Q39 A;  4LF5 M;  4CIS A;  4DV5 M;  3U6D A;  3T1H M;  1KFV A;  4JI5 M;  3U6C A;  2VQF M;  3GPP A;  1K3X A;  4DR3 M;  1PJI A;  3SAU A;  2ZM6 M;  2UXC M;  3SAS A;  4PDG A;  2Q2E B;  2XZU A;  3U6S A;  2UU9 M;  5IWA M;  2F5P A;  1FJG M;  1EE8 A;  4JI7 M;  2EA0 A;  4JI6 M;  4DV3 M;  4DR2 M;  4JI2 M;  3TWL A;  1XMQ M; 
#chains in the Genus database with same CATH topology
 4DBG B;  2XSZ A;  3EIE A;  3L27 A;  4GIP A;  5LMN M;  3U5Z B;  3WHL A;  1K3W A;  2LVN C;  3FYC A;  3HZJ A;  3LW5 F;  1DGB A;  2L6O A;  4IBD A;  4BLC A;  4DV6 M;  1DGH A;  4BBA A;  2C9O A;  1N36 M;  4ANR A;  1QUT A;  4KHP M;  2LVO C;  1DO0 A;  2RGO A;  2BJW A;  2LWX A;  3VDU A;  1QVR A;  1VEG A;  1WR1 B;  4PCZ A;  5A2Q S;  1XMO M;  3GLI B;  4JI3 M;  3GLF E;  4DV1 M;  4YY3 M;  2DZO B;  4DV4 M;  3HHX A;  3HHZ A;  2CRU A;  4IBF A;  3SBJ A;  3FRI A;  2JA2 A;  4G4R A;  3FRH A;  3MJ5 A;  4G3O A;  3AV0 A;  3T38 A;  3ZCB B;  3GQ3 A;  3GO8 A;  3J7B A;  3NBX X;  4JI4 M;  2L4E A;  1DGH B;  4JI0 M;  1IN5 A;  2F5O A;  1L2D A;  4S12 A;  3JR4 A;  1JB0 F;  2FH0 A;  5ITX A;  3V76 A;  3M7G A;  3UK6 A;  4LRT A;  1TGU A;  3J2P B;  4JI1 M;  4JYA M;  1ZMW A;  2C5R A;  4YHH M;  1Q3B A;  3VFD A;  4GH9 A;  3U6Q A;  1AIP C;  3C3E A;  3GRV A;  3BXW A;  2V1U A;  3SHG B;  4WUR A;  2R18 A;  3L25 A;  4TUW A;  2C96 A;  5L8R F;  3TPZ A;  3U61 B;  2R62 A;  3AKZ A;  4DV7 M;  3U6L A;  3FUT A;  3RGP A;  1YE9 A;  2JY6 B;  2EO2 A;  3QYE A;  3L28 A;  1TDZ A;  2R4J A;  5EXX A;  1EFU B;  2G8L A;  3LVW A;  4LRS A;  4QHS A;  3B74 A;  4F2L A;  2XZF A;  4KT0 F;  4P16 A;  3GPY A;  1NV8 A;  3JR5 A;  5KO3 A;  2DZL A;  4GHA A;  1MU5 A;  4X64 M;  1PRB A;  1E94 E;  1HT2 E;  2DVW B;  2L09 A;  3M0E A;  4B08 A;  2K0B X;  3RGS A;  1PJJ A;  4M9S A;  3HHY A;  4LF7 M;  2L7I A;  4LF8 M;  3GRR A;  1IFY A;  2KRK A;  2X4A A;  4L6V 6;  2OO9 A;  2JWS A;  3E9S A;  2OPF A;  1VEJ A;  2MH8 A;  4M9X A;  4REZ A;  4IIW A;  1I4W A;  2MJ5 B;  4FWH A;  2LVA A;  4LJ4 A;  3CF2 A;  2Y21 A;  5EJC A;  1T43 A;  2CEA A;  5EXT A;  2MRO B;  5GKN A;  4CHT B;  3K8Z A;  5ITT A;  1F4I A;  4NOO B;  4X65 M;  4HEO A;  1DV0 A;  4IBE A;  3UMM A;  2Z4S A;  3W67 A;  2CHV A;  1OIP A;  4CJ6 A;  3PNY A;  1D0M A;  3KDS E;  3KOX E;  4DR1 M;  1T3T A;  1J09 A;  2W82 A;  4DR5 M;  2F5Q A;  1OAO C;  2DI0 A;  1XNQ M;  4AI6 A;  1P3Q Q;  3ZQJ A;  1GL7 A;  2JUJ A;  4FCV A;  5ITR A;  4X62 M;  2QEN A;  5FTL A;  1GKI A;  2QHO B;  4CIS A;  1NNU C;  2L4F A;  4LJ8 A;  1PGY A;  3CF0 A;  1KFV A;  4LJA A;  1QDT A;  4I4L A;  1FNN A;  3AOG A;  5EP2 A;  4AKH A;  2C98 A;  1PJT A;  3KP1 E;  5KPZ A;  4RF1 A;  4IBJ A;  2ZM6 M;  4KOD A;  1YUB A;  4L16 A;  2JY5 A;  4GMQ A;  1ZQ9 A;  2D7E A;  3HJQ A;  4AW4 A;  2ZTC A;  2KHH A;  1IQP A;  3SMS A;  4JI6 M;  2EUC A;  1R6B X;  3TWL A;  4I81 A;  5JI3 E;  4LGY A;  3FUV A;  1NV9 A;  2KDL A;  1ZAE A;  1Z6T A;  2LHG A;  2R44 A;  3THG A;  4KLN A;  2CFO A;  1G3I A;  2DHY A;  3L29 A;  2VII A;  1TDH A;  1VDL A;  3KW6 A;  4G4Q A;  2DHR A;  3NBI A;  3SMP A;  1TH3 A;  1UM8 A;  5ITX E;  4EIW A;  5F3W A;  5EP1 A;  1DGG A;  4B7F A;  4LZJ A;  1G41 A;  1OTR A;  2D7G A;  2XGN A;  3M6A A;  4LF9 M;  3TL4 X;  1NY6 A;  4F1I A;  2BNK A;  4UN2 B;  4XK8 F;  1JR3 A;  4PDI A;  3VK7 A;  1IXZ A;  4ZPX A;  3E21 A;  1TF0 B;  3F92 A;  1WXQ A;  4OX9 M;  4DUY M;  1MJG M;  1R7R A;  1K82 A;  3D8B A;  8CAT A;  2V6Z M;  2G3Q A;  4LGM A;  3GLI A;  3C9P A;  1JR3 D;  2KNZ A;  2EKK A;  3SAW A;  4FCW A;  3HY5 A;  1QAN A;  2V1C A;  3FUW A;  3T1Y M;  2UXB M;  3K9P A;  3A45 A;  2K47 A;  3RE8 A;  3R9X B;  2QP9 X;  3I04 M;  3LVV A;  4MGZ E;  4G4O A;  2B3T A;  3HGI A;  5BR8 M;  1L1T A;  1W5S A;  2R6F A;  2DEN A;  1IM2 A;  1HNX M;  4G6Z A;  3HJ8 A;  3KP0 E;  3SFZ A;  2MGW A;  3SHF A;  2VDB B;  3U6E A;  2RGH A;  2QCU A;  3KXE C;  4D82 A;  1H6U A;  1ZMU A;  3R8F A;  4M0W A;  3KSJ A;  2KZU A;  1VQ1 A;  2O5R A;  5FTN A;  1DO2 A;  4FWG A;  3KOZ E;  1NJG A;  1J7K A;  1W5T A;  4DUZ M;  2BWB A;  4PD2 A;  2UUB M;  1R2Y A;  3I01 M;  3U61 A;  1IN8 A;  2AHM A;  2M5Z A;  4FVM A;  3GQ4 A;  1OFI A;  3J27 B;  2KNV A;  3J81 S;  1NJF A;  1IN4 A;  1LTM A;  2N35 A;  4GKK M;  1HT1 E;  3DFZ A;  2VQE M;  1V34 A;  2R46 A;  3AFH A;  2O01 F;  1C1K A;  1IN7 A;  3CF6 E;  4ITQ A;  2L7H A;  2FNA A;  4QOS A;  2DAM A;  1RU3 A;  4IBK A;  3VLF B;  5EP3 A;  1XNR M;  2CWB A;  3GRY A;  1OJL A;  2Z3X A;  1XXH A;  2YFQ A;  3KSX A;  1E32 A;  4I5S A;  4DV2 M;  4GHL A;  2DKL A;  2VF7 A;  3HKP A;  4A3V B;  4LCB A;  3Q8X A;  5DFL A;  3B89 A;  1ZV1 A;  2FOI C;  5FTK A;  3VKH A;  1Q3C A;  4LF4 M;  4P17 A;  5DNY A;  1QAO A;  2DAG A;  3KVW A;  1Q02 A;  2DWL A;  2C99 A;  5ITU A;  3FTD A;  4AG6 A;  2JZ0 A;  1E9R A;  1I94 M;  4QNR A;  1Q39 A;  5E6J A;  1XXH B;  2R4E A;  4DV0 M;  2LVP C;  4DV5 M;  3T1H M;  3PFI A;  1VG5 A;  1WIV A;  1K3X A;  2R0I A;  1WJ7 A;  3T15 A;  1V33 A;  4MGI E;  1JR3 E;  3B7Q A;  3K1J A;  4PDG A;  2EKF A;  1MN3 A;  2Q2E B;  3DA1 A;  1N78 A;  3LQQ A;  2XZU A;  5IWA M;  2HAK A;  4JI7 M;  1HJP A;  1UFZ A;  4JI2 M;  1G4A E;  1GLN A;  3GLI E;  1ZMV A;  4FWD A;  4D80 A;  3VK8 A;  4R3D A;  1TTE A;  3PNV A;  5FTM A;  2KW0 A;  3U6P A;  3TE6 A;  1G59 A;  1L8Q A;  1XC8 A;  2JNH A;  2J7O A;  3DZD A;  2E5L M;  2QSF X;  3AOE A;  3FTE A;  1IBK M;  4I8O A;  2QZ4 A;  3W0F A;  1E9S A;  2QQ8 A;  2XF3 A;  2L2D A;  2QBY A;  2JZ1 A;  3PXG A;  2O25 A;  3I4Y A;  1Z5A A;  2UXD M;  3ILK A;  1SXJ A;  3GLG B;  2I7N A;  3QAU A;  1EIJ A;  1QDR A;  3OTO M;  1J5E M;  4MB7 A;  4II7 A;  3QWL A;  3TWM A;  3IG5 A;  3FTC A;  1GAB A;  4NL4 H;  1OKS A;  3RFW A;  4B3S M;  4GRI A;  5IT9 S;  2C9C A;  2Y20 A;  1SXJ D;  2Y0Q A;  2YQZ A;  2KEB A;  4IJF A;  3I4V A;  4XBO A;  4X66 M;  4M0D A;  4K0K M;  2J5Y A;  4JXJ A;  4B3M M;  2H5X A;  2WSE F;  1QZM A;  4GC9 A;  5KPR A;  2QBY B;  2CV1 A;  2QPA A;  1Z5C A;  1NNJ A;  3HHW A;  4MGY E;  4MGH A;  1D2N A;  1SXJ B;  5JI2 E;  3GLF B;  1MX0 A;  3K2L A;  3C58 A;  2LH0 A;  3CTW B;  4Y28 F;  1D0L A;  4D81 A;  3HWS A;  3BOS A;  3J80 S;  3GPU A;  4HLQ A;  3H4M A;  2XLJ A;  1XXH E;  2R65 A;  1OIZ A;  2HL7 A;  3U6O A;  4Z8X A;  3JAM S;  4LFA M;  3ZC7 B;  2K9D A;  3TWK A;  2G5G X;  2Z8Y M;  3UGJ A;  3L26 A;  1N75 A;  1PJS A;  1IBL M;  1VDD A;  4IBI A;  5FTJ A;  2EJS A;  3CGW A;  4W5W A;  3SC3 A;  3FD9 A;  3W0L B;  4B7G A;  2CV2 A;  1QQW A;  3SAR A;  3KS8 A;  2GNO A;  2GQF A;  4M9Z A;  4QNM A;  3B7Z A;  4L78 A;  4LJ9 A;  5DYI A;  5IZ7 D;  4DR4 M;  4IBB A;  1TH2 A;  2OOA A;  1IBM M;  2J7N A;  3A42 A;  1PJQ A;  2OOB A;  5IRE B;  2KNA A;  3GRU A;  3KOW E;  3SAT A;  3BBZ A;  2CUZ A;  3GPX A;  3B9P A;  1IY2 A;  3HU1 A;  5H37 D;  1Z5B A;  4LJ7 A;  4MM3 B;  1CUK A;  3LCU A;  2WSF F;  5FSW A;  2UUA M;  4GEW A;  1IY0 A;  3FTF A;  3A46 A;  3GLG E;  4KO8 A;  3B7N A;  3UZU A;  1N32 M;  4NXN M;  1TH4 A;  2XFT A;  4L4U A;  1NVM A;  3MHV C;  1G8P A;  5E26 A;  1NO1 A;  2F5S A;  2QNJ A;  2Z7J A;  4AKI A;  1OAI A;  3AL0 C;  2XSZ D;  2ZBK B;  4LF5 M;  3U6D A;  1OFH A;  2Y0T A;  4GIT A;  3U6C A;  2Z4R A;  4PT5 A;  2VQF M;  1V92 A;  3GPP A;  1R5L A;  1SXJ E;  2YNM D;  3H4J A;  4BB9 A;  3MK6 A;  4DR3 M;  2XH9 A;  3SAU A;  3K92 A;  3SAS A;  2XFS A;  2APL A;  3FUU A;  1KYI A;  1WGL A;  1N77 A;  2F5P A;  1EE8 A;  2EA0 A;  2ERC A;  4MH0 E;  5EQT A;  2A5Y B;  2DAE A;  3L2A A;  4DV3 M;  4DR2 M;  1VEK A;  3NWL A;  2JP7 A;  3KFU G;  2RRU A;  1S3S A;  2P5T A;  3GLH A;  1XMQ M;  2F4V M;  4GKJ M;  2OQ4 A;  1YSY A;  2MR9 A;  2H1R A;  4GC5 A;  1QUS A;  3VKG A;  4JV5 M;  4RNA A;  3U60 A;  4AG5 A;  5EP4 A;  3HU3 A;  3J7A S;  2HWJ A;  4G4N A;  1L2C A;  3KOY E;  2I7P A;  1QZE A;  3HJS A;  3W68 A;  1OQY A;  1IN6 A;  2HCB A;  3IG8 A;  2KXE A;  4B3T M;  4WW0 A;  2HHH M;  3FE3 A;  1QAQ A;  2UUC M;  3E46 A;  1N34 M;  1TR8 A;  1YLA A;  3GLH B;  4NC6 A;  2DWM A;  4AKG A;  3LQR A;  3SAV A;  2DNA A;  1HQY E;  2CP8 A;  4HL4 A;  3GLG A;  3SYL A;  4AZF A;  2CHQ A;  4IBC A;  5KQD A;  3U60 B;  2LBC A;  2KRU A;  3LCV B;  3UJN A;  1ORY B;  2LNH C;  2F5N A;  3U6M A;  4FW9 A;  4Q7J A;  4LF6 M;  4FCT A;  4IBG A;  4B3R M;  3IHP A;  5EXS A;  3FUX A;  2KA6 B;  4LG2 A;  4DR6 M;  3IEC A;  1HR0 M;  2LHC A;  2KZS A;  4JN6 A;  3K9O A;  2FFJ A;  2FE8 A;  4LZZ A;  4JI8 M;  4LY6 A;  2LVQ D;  1HNZ M;  2JXN A;  1HNW M;  1AUA A;  5DYG A;  1QAM A;  3TQS A;  5BPV A;  3GLF A;  5C18 A;  4IJE A;  3DOA A;  5KQ8 A;  4OU7 A;  2DWN A;  1JQJ C;  2CV0 A;  3EIH A;  3E4R A;  1GVN A;  1NHG C;  2X49 A;  2DAI A;  2LTU A;  2WZJ A;  3SYK A;  4LFB M;  2CHG A;  3A98 B;  1IXR C;  4LJ6 A;  2NQ8 C;  3FKE A;  2DAK A;  4MGK E;  2DZN B;  2M60 A;  3WHK A;  3ZH9 B;  1GJT A;  4B7H A;  4LJ5 A;  5ITY A;  4DR7 M;  3GP1 A;  2VF8 A;  1NHW C;  2ZTD A;  4RKU F;  1GL6 A;  1XHB A;  4RF0 A;  1XB2 B;  1BVS A;  2JY8 A;  1NY5 A;  4XGI A;  2FS1 A;  4NXM M;  5KPT A;  2LXE A;  3HU2 A;  4OVZ A;  4QHT A;  4R71 A;  4CIZ A;  5C1B A;  1L1Z A;  4NRW A;  1PM5 A;  2DWZ B;  1R2Z A;  2BWE A;  1GJS A;  1GO5 A;  4FD2 A;  4AQY M;  1T6O A;  1IXS A;  4R7G A;  4LFC M;  1SG9 A;  1LV7 A;  4NSO B;  1N33 M;  3FYD A;  4L8R C;  2R45 A;  4OW0 A;  3D8L A;  5FLX S;  2K6B A;  2XEP A;  3GLH E;  5ITQ A;  1WHC A;  2BJV A;  2HKJ A;  3Q8G A;  2RKO A;  7CAT A;  3GQ5 A;  3KS4 A;  2ZAO A;  4L15 A;  1KSF X;  5LMU M;  1Z59 A;  1C7Y A;  3PVS A;  4NRV A;  4OVZ B;  3I51 A;  2YR0 A;  3U5Z A;  1L2B A;  2DXI A;  2ZAM A;  4Z6Y A;  1X37 A;  1IY1 A;  1NSF A;  1XWI A;  2X8A A;  3QYB A;  2WSC F;  3C3D A;  3AJI B;  1A5T A;  3LMM A;  1DGF A;  4JI5 M;  1G71 A;  1IXS B;  3AOE C;  3VDP A;  1HQC A;  3T6P A;  2CE7 A;  1WGN A;  1R4G A;  1PJI A;  1D0K A;  2ZAN A;  4CGY B;  4QOZ C;  2UXC M;  3U6S A;  2UU9 M;  1FJG M;  1QYR A;  1Y8G A;  5EXP A;  1SXJ C;  4WP2 A;  2D7H A;  3MMP A;  3HX3 A;  2JY7 A;  4NSR A; 
#chains in the Genus database with same CATH homology
 2XSZ A;  3EIE A;  3L27 A;  4GIP A;  5LMN M;  3U5Z B;  3WHL A;  1K3W A;  3FYC A;  1DGB A;  2L6O A;  4IBD A;  4BLC A;  4DV6 M;  1DGH A;  4BBA A;  2C9O A;  1N36 M;  4KHP M;  1DO0 A;  2RGO A;  2BJW A;  2LWX A;  3VDU A;  1QVR A;  4PCZ A;  1XMO M;  5A2Q S;  3GLI B;  4JI3 M;  4DV1 M;  4YY3 M;  2DZO B;  4DV4 M;  3HHX A;  3HHZ A;  4IBF A;  3SBJ A;  2JA2 A;  4G4R A;  3MJ5 A;  3AV0 A;  3T38 A;  3ZCB B;  3GQ3 A;  3GO8 A;  3J7B A;  4JI4 M;  1DGH B;  4JI0 M;  1IN5 A;  2F5O A;  1L2D A;  4S12 A;  3JR4 A;  5ITX A;  4JYA M;  3M7G A;  3UK6 A;  4LRT A;  1TGU A;  3J2P B;  4JI1 M;  2C5R A;  4YHH M;  1Q3B A;  3VFD A;  4GH9 A;  3U6Q A;  3GRV A;  2V1U A;  3SHG B;  4WUR A;  2R18 A;  3L25 A;  4TUW A;  2C96 A;  3TPZ A;  3U61 B;  2R62 A;  3AKZ A;  4DV7 M;  3U6L A;  3FUT A;  3RGP A;  1YE9 A;  2EO2 A;  3L28 A;  1TDZ A;  2R4J A;  5EXX A;  3LVW A;  2G8L A;  4LRS A;  4QHS A;  2XZF A;  4P16 A;  3GPY A;  3JR5 A;  5KO3 A;  4GHA A;  1MU5 A;  4X64 M;  2L09 A;  1E94 E;  1HT2 E;  2DVW B;  3M0E A;  4B08 A;  3RGS A;  1PJJ A;  4M9S A;  3HHY A;  4LF7 M;  2L7I A;  4LF8 M;  3GRR A;  2KRK A;  2X4A A;  3E9S A;  2OPF A;  4M9X A;  4REZ A;  4IIW A;  1I4W A;  4FWH A;  4LJ4 A;  5GKN A;  3CF2 A;  2Y21 A;  5EJC A;  2CEA A;  5EXT A;  4CHT B;  4DV0 M;  3K8Z A;  5ITT A;  4NOO B;  4X65 M;  4IBE A;  3UMM A;  2Z4S A;  2CHV A;  3PNY A;  4DR1 M;  3KDS E;  3KOX E;  1T3T A;  1J09 A;  2W82 A;  4DR5 M;  2F5Q A;  1XNQ M;  4AI6 A;  1GL7 A;  4FCV A;  5ITR A;  4X62 M;  2QEN A;  5FTL A;  1GKI A;  4CIS A;  1NNU C;  4LJ8 A;  3CF0 A;  1KFV A;  4LJA A;  4I4L A;  1FNN A;  3AOG A;  5EP2 A;  4AKH A;  2C98 A;  3KP1 E;  5KPZ A;  4RF1 A;  4IBJ A;  2ZM6 M;  4KOD A;  1YUB A;  4L16 A;  4GMQ A;  1ZQ9 A;  2D7E A;  3HJQ A;  4AW4 A;  1IQP A;  3SMS A;  4JI6 M;  2EUC A;  1R6B X;  3TWL A;  4I81 A;  5JI3 E;  4LGY A;  3FUV A;  3THG A;  1ZAE A;  1Z6T A;  4KLN A;  2CFO A;  1G3I A;  3L29 A;  2VII A;  1TDH A;  3KW6 A;  4G4Q A;  2DHR A;  3NBI A;  3SMP A;  1TH3 A;  1UM8 A;  5ITX E;  4EIW A;  5F3W A;  5EP1 A;  1DGG A;  4B7F A;  4LZJ A;  1G41 A;  2D7G A;  2XGN A;  3M6A A;  4LF9 M;  3TL4 X;  1NY6 A;  2BNK A;  1JR3 A;  4PDI A;  3VK7 A;  1IXZ A;  4ZPX A;  1WXQ A;  4OX9 M;  4DUY M;  1R7R A;  1K82 A;  3D8B A;  8CAT A;  2V6Z M;  4LGM A;  3GLI A;  1JR3 D;  3SAW A;  4FCW A;  1QAN A;  2V1C A;  3FUW A;  3T1Y M;  2UXB M;  3A45 A;  2K47 A;  3RE8 A;  3R9X B;  2QP9 X;  3LVV A;  4MGZ E;  4G4O A;  3HGI A;  5BR8 M;  1L1T A;  1W5S A;  1IM2 A;  1HNX M;  4G6Z A;  3HJ8 A;  3KP0 E;  3SFZ A;  3SHF A;  3U6E A;  2RGH A;  2QCU A;  3KXE C;  4D82 A;  1H6U A;  3R8F A;  4M0W A;  3KSJ A;  2KZU A;  2O5R A;  5FTN A;  1DO2 A;  4FWG A;  3KOZ E;  1NJG A;  1J7K A;  1W5T A;  4DUZ M;  4PD2 A;  2UUB M;  1R2Y A;  3U61 A;  1IN8 A;  2AHM A;  2M5Z A;  4FVM A;  3GQ4 A;  1OFI A;  3J27 B;  3J81 S;  1NJF A;  1IN4 A;  4GKK M;  1HT1 E;  3DFZ A;  2VQE M;  2R46 A;  3AFH A;  4ITQ A;  1C1K A;  1IN7 A;  3CF6 E;  2L7H A;  2FNA A;  4QOS A;  4IBK A;  3VLF B;  5EP3 A;  1XNR M;  3GRY A;  1OJL A;  2Z3X A;  1XXH A;  2YFQ A;  3KSX A;  1E32 A;  4I5S A;  4DV2 M;  3HKP A;  4A3V B;  4LCB A;  3Q8X A;  2FOI C;  5FTK A;  1Q3C A;  4LF4 M;  5DNY A;  1QAO A;  3KVW A;  2DWL A;  2C99 A;  5ITU A;  3FTD A;  4AG6 A;  1E9R A;  1I94 M;  4QNR A;  1Q39 A;  5E6J A;  1XXH B;  2R4E A;  4DV5 M;  3T1H M;  3PFI A;  1K3X A;  3T15 A;  4MGI E;  3K1J A;  4PDG A;  2Q2E B;  3DA1 A;  1N78 A;  3LQQ A;  2XZU A;  5IWA M;  4JI7 M;  4JI2 M;  1G4A E;  1GLN A;  4D80 A;  4FWD A;  3VK8 A;  4R3D A;  4GHL A;  3PNV A;  5FTM A;  2KW0 A;  3U6P A;  3TE6 A;  1G59 A;  1L8Q A;  1XC8 A;  2J7O A;  3DZD A;  2E5L M;  3AOE A;  3FTE A;  1IBK M;  4I8O A;  2QZ4 A;  3W0F A;  1E9S A;  2XF3 A;  2QBY A;  3PXG A;  3I4Y A;  1Z5A A;  2UXD M;  3ILK A;  1SXJ A;  3GLG B;  2I7N A;  3QAU A;  3OTO M;  1J5E M;  4MB7 A;  4II7 A;  3QWL A;  3TWM A;  3IG5 A;  3FTC A;  4NL4 H;  3RFW A;  4B3S M;  4GRI A;  5IT9 S;  2C9C A;  2Y20 A;  1SXJ D;  2Y0Q A;  2YQZ A;  2KEB A;  4IJF A;  3I4V A;  4XBO A;  4X66 M;  4M0D A;  4K0K M;  4JXJ A;  4B3M M;  5KPR A;  1QZM A;  4GC9 A;  2QBY B;  2CV1 A;  2QPA A;  1Z5C A;  1NNJ A;  3HHW A;  4MGY E;  4MGH A;  1D2N A;  1SXJ B;  5JI2 E;  3GLF B;  1MX0 A;  3K2L A;  3C58 A;  2LH0 A;  3CTW B;  4D81 A;  3HWS A;  3BOS A;  3J80 S;  3GPU A;  4HLQ A;  3H4M A;  2XLJ A;  2R65 A;  2HL7 A;  3U6O A;  4Z8X A;  3JAM S;  4LFA M;  3ZC7 B;  3TWK A;  2G5G X;  3UGJ A;  3L26 A;  1N75 A;  1IBL M;  1VDD A;  4IBI A;  5FTJ A;  3SC3 A;  3W0L B;  4W5W A;  4B7G A;  3FD9 A;  2CV2 A;  3SAR A;  3VKH A;  1QQW A;  3KS8 A;  4QNM A;  4M9Z A;  5DYI A;  4DR4 M;  4L78 A;  5IZ7 D;  4LJ9 A;  4IBB A;  1TH2 A;  1IBM M;  2J7N A;  3A42 A;  5IRE B;  3GRU A;  3KOW E;  3SAT A;  2CUZ A;  3GPX A;  3B9P A;  1IY2 A;  3HU1 A;  5H37 D;  1Z5B A;  4LJ7 A;  4MM3 B;  5FSW A;  2UUA M;  1IY0 A;  3FTF A;  3A46 A;  4KO8 A;  3UZU A;  1N32 M;  4NXN M;  1TH4 A;  2XFT A;  4L4U A;  1NVM A;  3MHV C;  1G8P A;  5E26 A;  2F5S A;  2Z7J A;  4AKI A;  3AL0 C;  2XSZ D;  2ZBK B;  4LF5 M;  3U6D A;  1OFH A;  2Y0T A;  4GIT A;  3U6C A;  2Z4R A;  4PT5 A;  2VQF M;  3GPP A;  1SXJ E;  2YNM D;  4BB9 A;  4DR3 M;  3MK6 A;  3SAU A;  2XH9 A;  3K92 A;  3SAS A;  2XFS A;  3FUU A;  1KYI A;  1N77 A;  2F5P A;  1EE8 A;  2EA0 A;  2ERC A;  4MH0 E;  5EQT A;  2A5Y B;  3L2A A;  4DV3 M;  4DR2 M;  3KFU G;  3NWL A;  1XMQ M;  2P5T A;  3GLH A;  1S3S A;  2F4V M;  4GKJ M;  2OQ4 A;  1YSY A;  3VKG A;  2H1R A;  4GC5 A;  4JV5 M;  4RNA A;  3U60 A;  5EP4 A;  3HU3 A;  3J7A S;  1L2C A;  4G4N A;  3KOY E;  2I7P A;  3HJS A;  1IN6 A;  2HCB A;  3IG8 A;  2KXE A;  4B3T M;  4WW0 A;  2HHH M;  1QAQ A;  2UUC M;  1N34 M;  4AKG A;  3GLH B;  2DWM A;  3LQR A;  3SAV A;  3GLG A;  1HQY E;  4HL4 A;  3SYL A;  4AZF A;  2CHQ A;  4IBC A;  5KQD A;  3U60 B;  2KRU A;  3UJN A;  1ORY B;  2LNH C;  2F5N A;  3U6M A;  4FW9 A;  4LF6 M;  4FCT A;  4IBG A;  4B3R M;  5EXS A;  3FUX A;  2KA6 B;  4LG2 A;  4DR6 M;  1HR0 M;  2KZS A;  4JN6 A;  2FFJ A;  2FE8 A;  4LZZ A;  4JI8 M;  4LY6 A;  1HNZ M;  1HNW M;  5DYG A;  1QAM A;  3TQS A;  5BPV A;  3GLF A;  5C18 A;  4IJE A;  3DOA A;  5KQ8 A;  4OU7 A;  2DWN A;  1JQJ C;  2CV0 A;  3EIH A;  3E4R A;  1GVN A;  1NHG C;  2X49 A;  4LFB M;  3SYK A;  2CHG A;  3A98 B;  1IXR C;  4LJ6 A;  2NQ8 C;  3FKE A;  3WHK A;  4MGK E;  2DZN B;  2M60 A;  3ZH9 B;  4B7H A;  4LJ5 A;  5ITY A;  4DR7 M;  3GP1 A;  1NHW C;  1GL6 A;  1XHB A;  4RF0 A;  1NY5 A;  4XGI A;  4NXM M;  5KPT A;  2LXE A;  3HU2 A;  4OVZ A;  4QHT A;  4NRW A;  5C1B A;  1L1Z A;  1PM5 A;  2DWZ B;  1R2Z A;  4FD2 A;  4AQY M;  4R7G A;  4LFC M;  1LV7 A;  4NSO B;  1N33 M;  3FYD A;  4L8R C;  2R45 A;  4OW0 A;  3D8L A;  5FLX S;  2XEP A;  5ITQ A;  2BJV A;  2HKJ A;  7CAT A;  3GQ5 A;  2RKO A;  3KS4 A;  2ZAO A;  4L15 A;  1KSF X;  5LMU M;  1Z59 A;  3PVS A;  4NRV A;  4OVZ B;  3I51 A;  2YR0 A;  3U5Z A;  1L2B A;  2DXI A;  2ZAM A;  4Z6Y A;  1X37 A;  1IY1 A;  1NSF A;  1XWI A;  2X8A A;  3LMM A;  3AJI B;  4JI5 M;  1DGF A;  1IXS B;  3AOE C;  3VDP A;  1HQC A;  2CE7 A;  1PJI A;  2ZAN A;  4CGY B;  4QOZ C;  2UXC M;  3U6S A;  2UU9 M;  1FJG M;  1QYR A;  5EXP A;  1SXJ C;  2D7H A;  4AG5 A;  4NSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...