1FJGM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1fjgM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1fjgM02
4JI4M 5ITQA 5ITRA 3GO8A 4JI2M 3J7AS 5ITXE 1K3XA 1N33M 4DUZM 3U6EA 1L2CA 1XNQM 4DR7M 4DR4M 5A2QS 2F5SA 3A45A 5FLXS 2F4VM 3VK8A 4K0KM 1IBMM 3C58A 1KFVA 2ZBKB 2UUBM 4LF9M 4DR3M 1EE8A 3VK7A 4DV2M 3U6CA 1IBLM 1HNXM 4PDGA 4LFCM 2OQ4A 3SBJA 1XMOM 1N34M 4MB7A 2UUCM 3J80S 1XMQM 5ITXA 3GQ3A 4LFAM 4B3TM 4JI8M 3GP1A 5IT9S 4DV0M 2UU9M 4LF7M 1Z59A 4LFBM 4G4NA 3U6DA 2F5PA 3GPUA 5LMNM 4DV3M 3SARA 1I94M 4X66M 1L2DA 5BR8M 3SAWA 4DV1M 4YY3M 2UXCM 1Q39A 2XZUA 4LF4M 1TDHA 1R2YA 3SAVA 4JYAM 4NRVA 2F5OA 1Q3CA 3TWKA 2XZFA 1Q3BA 1N36M 1IBKM 4X65M 4X64M 3GQ4A 4B3RM 2VQEM 1L1TA 1Z5AA 4LF5M 4PDIA 4NXNM 4DR1M 5ITUA 3U6MA 2EA0A 4NRWA 1XNRM 4G4QA 4LF8M 4DV6M 1L1ZA 2HKJA 2ZM6M 1MX0A 3OTOM 3T1HM 2VQFM 4JI0M 4PD2A 4DV7M 4NXMM 3SAUA 3A42A 3U6SA 1HR0M 4JI1M 4GKJM 3JAMS 4DR6M 4G4RA 3GPYA 3JR5A 4DR2M 1HNZM 4DV4M 1MU5A 3TWMA 1R2ZA 3GQ5A 1HNWM 2Q2EB 3JR4A 1NNJA 4DV5M 4LF6M 1TDZA 1PJIA 2UXBM 1PM5A 3U6QA 4B3MM 1K3WA 3SASA 5IWAM 4CISA 1N32M 4PCZA 4JV5M 2F5QA 2UUAM 2HHHM 4JI6M 1FJGM 1PJJA 2F5NA 4KHPM 1L2BA 3SATA 1J5EM 1XC8A 3U6PA 3J81S 3GPXA 4DUYM 3GPPA 4G4OA 1K82A 2E5LM 1Z5CA 5ITYA 3TWLA 5ITTA 4AQYM 4JI5M 3DOAA 4X62M 5LMUM 4JI3M 3U6OA 2UXDM 4GKKM 4B3SM 4DR5M 3T1YM 3W0FA 3U6LA 3A46A 4JI7M 1Z5BA 4YHHM 2OPFA 4OX9M 4ITQA
chains in the Genus database with same CATH superfamily
1C7YA 4AI6A 2DAKA 4JI4M 4FCWA 3LVWA 2R46A 5EQTA 3U61B 1H6UA 3LMMA 4KT0F 1L2CA 2KNZA 1IN6A 1XNQM 4DR4M 4G3OA 1QUTA 3SC3A 1G8PA 4LJ8A 2F4VM 5BPVA 4MGZE 3B89A 5FTLA 3SHGB 1IXRC 3LCVB 4IBIA 2CV2A 1QZMA 2JY6B 5KQDA 2AHMA 2DWZB 2ZAMA 2Z8YM 3VDUA 1HNXM 2I7PA 2ERCA 3HJQA 5L8RF 3K8ZA 3E4RA 1AUAA 3LCUA 1OJLA 4GC9A 4I8OA 1QAMA 2DHYA 1W5SA 1IY1A 4DV0M 1GVNA 3THGA 3Q8XA 1GLNA 5EP1A 1Q02A 5FSWA 3GPUA 3BBZA 3U60B 3W68A 2DENA 3DZDA 3C9PA 4DV3M 4HEOA 1I94M 3KFUG 5EJCA 3KS8A 4S12A 1L2DA 3VFDA 3SAWA 2X8AA 2UXCM 2HL7A 1WR1B 1IN7A 3B7QA 4LF4M 1TDHA 3J7BA 3M0EA 3HHZA 1R2YA 2HAKA 1IN4A 1L8QA 2XFSA 4OU7A 4MGHA 2KZSA 2QSFX 4LGMA 1SXJE 4FD2A 1TGUA 4LJ5A 3PVSA 4IIWA 1LV7A 2V6ZM 1FNNA 2DKLA 2FOIC 4FCVA 3VLFB 4PDIA 4NXNM 2QZ4A 4MGYE 1V34A 1UFZA 3MMPA 4Q7JA 3PXGA 5DYGA 3UK6A 3QYBA 1V33A 4ANRA 3U6MA 1XNRM 2FE8A 4AZFA 3GLIE 2G8LA 2RGOA 3EIEA 1E9SA 3A98B 3MJ5A 5EP3A 2JY8A 3T1HM 4JI0M 2L4FA 4DV7M 4NXMM 2EKFA 3A42A 3U6SA 2DZNB 3HU2A 3GRVA 3Q8GA 2GQFA 3JAMS 1Z6TA 1UM8A 3JR5A 3HU1A 2LXEA 5IZ7D 2D7GA 1SXJD 3E21A 4KO8A 3U61A 1IM2A 2KZUA 1WGLA 1G71A 3DA1A 4BBAA 1E32A 2Q2EB 4IBEA 1PJTA 1PM5A 2XH9A 1TTEA 2LH0A 1N32M 4AKGA 2Y0QA 4QHSA 1WXQA 3L28A 1HQYE 2HHHM 2XSZD 3BXWA 1PJJA 3ILKA 3AFHA 1L2BA 1OKSA 3L26A 2CRUA 2KEBA 3SATA 4JN6A 2M5ZA 3TQSA 3U6PA 1G41A 3J81S 4FWHA 3GPXA 3QYEA 4LJAA 1GJSA 2QPAA 1DV0A 3B7NA 3HHYA 5ITTA 2FFJA 3LQQA 4BB9A 5E26A 1EFUB 2ZAOA 3U60A 2OOBA 4WP2A 2VF7A 4GKKM 4MGKE 5EXSA 3T1YM 1QUSA 1VDLA 4LRSA 2DXIA 4IBBA 2JP7A 2KA6B 3CF6E 1SXJB 2R18A 1E94E 2G5GX 1NHWC 1QYRA 4MGIE 4OW0A 4LY6A 4OX9M 3FUVA 3AOEC 5ITRA 1C1KA 5DNYA 4R7GA 3BOSA 4L15A 1N33M 4CIZA 3U6EA 3GLIB 2DWMA 3FYCA 3AKZA 3MHVC 2BWEA 2L09A 1WIVA 2WSCF 5KQ8A 5C18A 3VK8A 5E6JA 4IBGA 5KPTA 1DGGA 2C98A 2H5XA 2ZANA 3KOYE 1G3IA 2ZBKB 2L6OA 2LVNC 2VDBB 3NWLA 4REZA 4DR3M 2LBCA 3FUTA 4LF9M 3HHWA 4DV2M 3QAUA 3LW5F 4LFCM 2OQ4A 3SBJA 1XMOM 2M60A 2CUZA 1N34M 4MB7A 3SYLA 1I4WA 2L7HA 3J80S 3GQ3A 1G59A 4B3TM 3GP1A 4D81A 4D82A 4GMQA 3KXEC 2LVQD 4KODA 4GRIA 4G4NA 2F5PA 4FWGA 2LHGA 2R4JA 2D7HA 4M0DA 2DAMA 1S3SA 4B7HA 3KS4A 4DV1M 1IN8A 2Y21A 2BJWA 4L4UA 3QWLA 4YY3M 3C3EA 4IJFA 4Y28F 3SAVA 2N35A 2CHVA 1IQPA 2KNVA 1HQCA 1PJSA 1PRBA 2EJSA 1EIJA 3E9SA 4IBFA 5JI2E 5GKNA 3W0LB 1NY6A 4IBJA 3D8BA 1IBKM 1YSYA 2DAIA 1N75A 1DGFA 2X49A 4M0WA 3ZQJA 4NC6A 4X64M 1JQJC 1QAOA 3B74A 1Z5AA 2VQEM 2Z3XA 1TF0B 4GC5A 1VEKA 2FS1A 5ITUA 4LJ7A 5C1BA 1XB2B 2HCBA 4NRWA 4G4QA 1GL7A 2HKJA 3L2AA 2L7IA 4DR7M 1WGNA 1NVMA 2VQFM 4JXJA 4NSOB 2QP9X 1SXJA 1XXHA 1TH3A 2JZ1A 5FTMA 1QAQA 1GL6A 1PGYA 4NSRA 4DR2M 4GEWA 2RGHA 2R65A 1MU5A 3SHFA 3GRRA 3TWMA 1R2ZA 2HWJA 2A5YB 1ZQ9A 2B3TA 4P16A 3GQ5A 2ZTDA 1NV9A 1ZMWA 3GLIA 4ZPXA 1IY0A 4LF6M 1SXJC 4L6V6 2LWXA 2OOAA 2LNHC 3FTCA 4L78A 4XBOA 3FUWA 1OFIA 3CF2A 4HLQA 3HU3A 4JV5M 3UMMA 1ZMUA 1TR8A 3HZJA 4G6ZA 3I51A 3SYKA 2KXEA 3KOZE 3HY5A 2YNMD 4GHLA 3FTEA 1J5EM 1NY5A 5KPZA 1VEGA 4AG6A 3L29A 2R45A 2QCUA 2YQZA 3GPPA 1XWIA 1YLAA 2BJVA 4LG2A 1NSFA 4AW4A 3UGJA 1OAOC 4LJ6A 3DOAA 3RGSA 2YFQA 4MM3B 4X62M 4JI3M 2EUCA 2EKKA 3GRUA 3U6OA 1OQYA 2QBYB 2X4AA 4I81A 3GLGE 4IJEA 4GITA 2MH8A 3A46A 1TH2A 4JI7M 1MN3A 1JR3E 1VEJA 4YHHM 3FYDA 3R8FA 1IFYA 3HHXA 2C9OA 5ITQA 3J7AS 3GO8A 4JI2M 5ITXE 2MROB 3IG8A 3FTDA 3VKHA 2G3QA 2K0BX 1NJFA 2R62A 3I4YA 4QOSA 3H4MA 2I7NA 1LTMA 3WHLA 4K0KM 2DVWB 1IBMM 1IXZA 2LTUA 1GABA 2WSEF 2APLA 1ZAEA 2UUBM 1GO5A 1EE8A 1VDDA 3FRHA 1SG9A 5FTKA 2OO9A 3AOEA 3VK7A 1IBLM 4FVMA 1NNUC 2R0IA 3HKPA 3V76A 5EXXA 3FE3A 2UUCM 1T43A 2JY5A 3KOWE 3MK6A 1JR3D 2KRKA 2Y0TA 3IG5A 4LF7M 1Z59A 4LFBM 3U6DA 3LVVA 3I4VA 2RKOA 4RNAA 5LMNM 1AIPC 3SARA 4I5SA 2FH0A 4LZZA 1IXSB 3RGPA 2R6FA 1XHBA 1Q39A 2ZTCA 4JYAM 4LJ4A 3IHPA 4OVZB 2XLJA 3L25A 2F5OA 1Q3CA 4RF0A 1R4GA 1R5LA 5FTJA 4LRTA 1D0KA 3TWKA 3WHKA 1OAIA 2DHRA 2MGWA 1Q3BA 2K47A 4DBGB 2CV0A 3R9XB 2C9CA 4M9ZA 1ZMVA 3HGIA 4X65M 2Z7JA 3TE6A 4B3RM 3GLGB 4RF1A 4LF5M 2K9DA 8CATA 3FD9A 5FTNA 3K1JA 3DFZA 4DR1M 2VF8A 1F4IA 2EA0A 1ORYB 1PJQA 2FNAA 3TL4X 2CV1A 4LF8M 3E46A 3PFIA 4DV6M 1L1ZA 3H4JA 3GLFE 2ZM6M 1MX0A 4QNRA 4IBKA 7CATA 2V1CA 3K2LA 3OTOM 2QBYA 2J5YA 3SMSA 4LGYA 3CTWB 3SAUA 4JI1M 3J27B 3HJ8A 5KPRA 4DR6M 3M7GA 1NHGC 4M9XA 2O25A 1KFVA 1DO2A 1YUBA 2O5RA 1V92A 1QZEA 5KO3A 2LHCA 3EIHA 1DO0A 4GH9A 3T38A 4CJ6A 4IBCA 4Z6YA 1NJGA 3B9PA 3SFZA 2LVOC 3JR4A 3GLHE 4DV5M 2W82A 1QDRA 2UXBM 1TH4A 3U6QA 1K3WA 3KW6A 5IWAM 4CISA 2BNKA 4PCZA 2F5QA 1N77A 4JI6M 3HWSA 2DAEA 4XK8F 2KHHA 4KHPM 1DGHB 1VG5A 5IREB 2DZOB 2EO2A 3ZCBB 4B08A 3NBXX 4KLNA 1D0MA 3FTFA 1GKIA 4XGIA 1Z5CA 5ITYA 3M6AA 3TWLA 4F1IA 4AQYM 3HJSA 1WHCA 4B7FA 1ZV1A 2KRUA 5LMUM 1BVSA 2CHGA 1E9RA 1HT2E 4B3SM 4UN2B 1R7RA 2J7NA 3CF0A 1IXSA 1QDTA 1WJ7A 3U5ZB 1Z5BA 2XSZA 3T15A 1HJPA 2Y20A 4ITQA 2CE7A 2JUJA 1T3TA 4OVZA 4LZJA 2CHQA 1HT1E 2QNJA 2DWNA 2JXNA 2LVAA 4CHTB 1NO1A 1NV8A 1K3XA 4DUZM 5EXTA 4NL4H 3GLFB 1OIZA 3T6PA 5A2QS 1W5TA 2F5SA 3A45A 2QHOB 5FLXS 4P17A 2C5RA 1JB0F 3I01M 3VKGA 4R71A 3GLGA 4FW9A 3C58A 4WW0A 2JY7A 1JR3A 3U6CA 1QVRA 2L4EA 1D0LA 2YR0A 4PDGA 2KNAA 3FRIA 1XXHE 3K9PA 2DNAA 3ZH9B 4B7GA 2GNOA 2XGNA 5ITXA 1XMQM 4LFAM 2Z4RA 1YE9A 3LQRA 4JI8M 2UU9M 4TUWA 5IT9S 4AKHA 1IY2A 2O01F 3GRYA 2H1RA 5EP4A 2Z4SA 3KP0E 1RU3A 3GLHB 4Z8XA 3RFWA 2BWBA 2R4EA 4HL4A 3NBIA 2D7EA 2XEPA 4X66M 5BR8M 2K6BA 4QOZC 2CWBA 4I4LA 2JZ0A 4R3DA 2XZUA 4AKIA 2NQ8C 4NRVA 2DI0A 4WURA 4A3VB 3C3DA 2KW0A 2XZFA 2XFTA 3KVWA 3FUUA 3KDSE 3TPZA 2R44A 4LCBA 4LJ9A 1N36M 3KSXA 2L2DA 3FKEA 2C99A 2WZJA 5EXPA 1G4AE 3HX3A 4BLCA 3IECA 4CGYB 3GQ4A 1VQ1A 4FCTA 1KYIA 4F2LA 1L1TA 2WSFF 1CUKA 1DGHA 1MJGM 4PT5A 1KSFX 3W67A 3K92A 2JA2A 2P5TA 4II7A 3I04M 5H37D 4L8RC 2RRUA 4GIPA 2V1UA 3UZUA 2J7OA 5EP2A 2VIIA 1QANA 3B7ZA 4L16A 1OTRA 4NOOB 3J2PB 4PD2A 1J09A 4MH0E 2DZLA 4QHTA 2CFOA 3SMPA 1HR0M 3U5ZA 4GKJM 2CP8A 5F3WA 4G4RA 3GPYA 1N78A 3ZC7B 5JI3E 1P3QQ 2XF3A 3F92A 1HNZM 4DV4M 2KDLA 1A5TA 2JNHA 3PNVA 1D2NA 3AV0A 3PNYA 1XXHB 1HNWM 3GLFA 1NNJA 1TDZA 1PJIA 3UJNA 4B3MM 3KOXE 3SASA 3RE8A 3L27A 2C96A 3VDPA 2QQ8A 2QENA 3KP1E 4M9SA 4D80A 2UUAM 1FJGM 1OFHA 2F5NA 1T6OA 1OIPA 5DFLA 4GHAA 1J7KA 1XC8A 2DWLA 2LVPC 3CGWA 4DUYM 4G4OA 1K82A 2E5LM 4W5WA 3K9OA 3AOGA 4IBDA 4JI5M 3D8LA 4AG5A 1IN5A 1GJTA 2CEAA 3FUXA 3GLHA 3AJIB 1DGBA 2UXDM 2MR9A 4DR5M 1Y8GA 3W0FA 2JWSA 3U6LA 1R6BX 4QNMA 4RKUF 5DYIA 3AL0C 4FWDA 2OPFA 2DAGA 2MJ5B 1QQWA 3KSJA 1X37A 4EIWA
chains in the Genus database with same CATH topology
4AI6A 4JI4M 4FCWA 3LVWA 2R46A 5EQTA 3U61B 1H6UA 3LMMA 1L2CA 1IN6A 1XNQM 4DR4M 3SC3A 1G8PA 4LJ8A 2F4VM 5BPVA 4MGZE 5FTLA 3SHGB 1IXRC 4IBIA 2CV2A 1QZMA 5KQDA 2AHMA 2DWZB 2ZAMA 3VDUA 1HNXM 2I7PA 2ERCA 3HJQA 3K8ZA 3E4RA 1OJLA 4GC9A 4I8OA 1QAMA 1W5SA 1IY1A 4DV0M 1GVNA 3THGA 3Q8XA 1GLNA 5EP1A 5FSWA 3GPUA 3U60B 4DV3M 3DZDA 3KFUG 1I94M 5EJCA 3KS8A 4S12A 1L2DA 3VFDA 3SAWA 2X8AA 2UXCM 2HL7A 1IN7A 4LF4M 1TDHA 3J7BA 3M0EA 3HHZA 1R2YA 1IN4A 1L8QA 2XFSA 4OU7A 4MGHA 2KZSA 4LGMA 1SXJE 4FD2A 1TGUA 4LJ5A 3PVSA 4IIWA 1LV7A 2V6ZM 1FNNA 4FCVA 2FOIC 3VLFB 4PDIA 4NXNM 2QZ4A 4MGYE 3UK6A 3PXGA 3U6MA 5DYGA 1XNRM 2FE8A 4AZFA 2G8LA 2RGOA 3EIEA 1E9SA 3A98B 3MJ5A 5EP3A 3T1HM 4JI0M 4DV7M 4NXMM 3A42A 3U6SA 2DZNB 3HU2A 3GRVA 3JAMS 1Z6TA 1UM8A 3JR5A 3HU1A 2LXEA 5IZ7D 2D7GA 1SXJD 4KO8A 3U61A 1IM2A 2KZUA 3DA1A 4BBAA 1E32A 2Q2EB 4IBEA 1PM5A 2XH9A 2LH0A 4AKGA 1N32M 2Y0QA 4QHSA 1WXQA 3L28A 1HQYE 2HHHM 2XSZD 1PJJA 3ILKA 3AFHA 1L2BA 3L26A 2KEBA 3SATA 4JN6A 2M5ZA 3TQSA 3U6PA 1G41A 3J81S 4FWHA 3GPXA 4LJAA 2QPAA 3HHYA 5ITTA 2FFJA 3LQQA 4BB9A 5E26A 3U60A 2ZAOA 4GKKM 4MGKE 5EXSA 3T1YM 4LRSA 2DXIA 4IBBA 2KA6B 3CF6E 1SXJB 2R18A 1E94E 2G5GX 1NHWC 1QYRA 4MGIE 4OW0A 4LY6A 4OX9M 3FUVA 3AOEC 5ITRA 1C1KA 5DNYA 4R7GA 3BOSA 4L15A 1N33M 3U6EA 2DWMA 3GLIB 3FYCA 3AKZA 3MHVC 2L09A 5KQ8A 5C18A 3VK8A 5E6JA 4IBGA 5KPTA 1DGGA 2C98A 2ZANA 3KOYE 1G3IA 2ZBKB 2L6OA 3NWLA 4REZA 1KFVA 4LF9M 4DR3M 3FUTA 3HHWA 4DV2M 3QAUA 4LFCM 2OQ4A 3SBJA 1XMOM 2M60A 2CUZA 1N34M 4MB7A 3SYLA 1I4WA 2L7HA 3J80S 3GQ3A 1G59A 4B3TM 3GP1A 4D81A 4D82A 4GMQA 3KXEC 4KODA 4GRIA 4G4NA 2F5PA 4FWGA 2R4JA 2D7HA 4M0DA 1S3SA 4B7HA 3KS4A 4DV1M 1IN8A 2Y21A 2BJWA 4L4UA 3QWLA 4YY3M 4IJFA 3SAVA 2CHVA 1IQPA 1HQCA 3E9SA 4IBFA 5JI2E 5GKNA 3W0LB 1NY6A 4IBJA 3D8BA 1IBKM 1YSYA 1N75A 1DGFA 2X49A 4M0WA 4X64M 2Z3XA 1QAOA 1JQJC 2VQEM 1Z5AA 4GC5A 5ITUA 4LJ7A 5C1BA 4NRWA 2HCBA 4G4QA 1GL7A 2HKJA 3L2AA 2L7IA 1NVMA 2VQFM 4JXJA 4NSOB 2QP9X 1SXJA 1XXHA 1TH3A 5FTMA 1QAQA 1GL6A 4NSRA 4DR2M 2RGHA 2R65A 1MU5A 3SHFA 3GRRA 3TWMA 1R2ZA 2A5YB 1ZQ9A 4P16A 3GQ5A 3GLIA 4ZPXA 1IY0A 4LF6M 1SXJC 2LWXA 2LNHC 3FTCA 4L78A 4XBOA 3FUWA 1OFIA 3CF2A 4HLQA 3HU3A 4JV5M 3UMMA 4G6ZA 3I51A 3SYKA 2KXEA 3KOZE 4GHLA 2YNMD 3FTEA 1J5EM 1NY5A 5KPZA 4AG6A 3L29A 2R45A 2QCUA 2YQZA 3GPPA 1XWIA 2BJVA 4LG2A 1NSFA 4AW4A 3UGJA 4LJ6A 3DOAA 3RGSA 2YFQA 4MM3B 4X62M 4JI3M 2EUCA 3U6OA 3GRUA 2QBYB 2X4AA 4I81A 4IJEA 4GITA 3A46A 4JI7M 1TH2A 4YHHM 3FYDA 3R8FA 3HHXA 2C9OA 5ITQA 3J7AS 3GO8A 4JI2M 5ITXE 3IG8A 3FTDA 3VKHA 1NJFA 2R62A 3I4YA 4QOSA 3H4MA 2I7NA 3WHLA 4K0KM 2DVWB 1IBMM 1IXZA 1ZAEA 2UUBM 1EE8A 1VDDA 3VK7A 5FTKA 3AOEA 1IBLM 4FVMA 1NNUC 3HKPA 5EXXA 2UUCM 3KOWE 3MK6A 1JR3D 2KRKA 2Y0TA 3IG5A 4LF7M 1Z59A 4LFBM 3U6DA 3LVVA 3I4VA 2RKOA 4RNAA 5LMNM 3SARA 4I5SA 4LZZA 1IXSB 3RGPA 1XHBA 1Q39A 4JYAM 4LJ4A 4OVZB 3L25A 2XLJA 2F5OA 1Q3CA 4RF0A 5FTJA 3TWKA 3WHKA 4LRTA 2DHRA 1Q3BA 2K47A 2CV0A 3R9XB 2C9CA 4M9ZA 3HGIA 4X65M 2Z7JA 3TE6A 4B3RM 3GLGB 4RF1A 4LF5M 8CATA 3FD9A 5FTNA 3K1JA 3DFZA 4DR1M 2EA0A 1ORYB 2FNAA 3TL4X 2CV1A 4LF8M 3PFIA 4DV6M 1L1ZA 2ZM6M 1MX0A 4QNRA 4IBKA 7CATA 2V1CA 3K2LA 3OTOM 2QBYA 3SMSA 4LGYA 3CTWB 3SAUA 4JI1M 3J27B 3HJ8A 5KPRA 4DR6M 3M7GA 1NHGC 4M9XA 1DO2A 1YUBA 2O5RA 5KO3A 3EIHA 1DO0A 4GH9A 3T38A 4IBCA 4Z6YA 1NJGA 3B9PA 3SFZA 3JR4A 4DV5M 2W82A 2UXBM 1TH4A 3U6QA 1K3WA 3KW6A 5IWAM 4CISA 2BNKA 4PCZA 2F5QA 1N77A 4JI6M 3HWSA 4KHPM 1DGHB 5IREB 2DZOB 2EO2A 3ZCBB 4B08A 4KLNA 3FTFA 1GKIA 4XGIA 1Z5CA 5ITYA 3M6AA 3TWLA 4AQYM 3HJSA 4B7FA 2KRUA 5LMUM 2CHGA 1E9RA 1HT2E 4B3SM 1R7RA 2J7NA 3CF0A 3U5ZB 1Z5BA 2XSZA 3T15A 2Y20A 4ITQA 2CE7A 1T3TA 4OVZA 4LZJA 2CHQA 1HT1E 2DWNA 4CHTB 1K3XA 4DUZM 5EXTA 4NL4H 3GLFB 4DR7M 5A2QS 1W5TA 2F5SA 3A45A 5FLXS 2C5RA 3VKGA 3GLGA 4FW9A 3C58A 4WW0A 1JR3A 3U6CA 1QVRA 2YR0A 4PDGA 3ZH9B 4B7GA 2XGNA 1XMQM 5ITXA 4LFAM 2Z4RA 1YE9A 3LQRA 4JI8M 2UU9M 4TUWA 5IT9S 4AKHA 1IY2A 5EP4A 3GRYA 2H1RA 2Z4SA 3KP0E 3GLHB 4Z8XA 3RFWA 2R4EA 4HL4A 3NBIA 2D7EA 2XEPA 4X66M 5BR8M 4QOZC 4R3DA 4I4LA 2XZUA 4AKIA 2NQ8C 4NRVA 4A3VB 4WURA 2KW0A 2XZFA 2XFTA 3KVWA 3FUUA 3KDSE 3TPZA 4LCBA 4LJ9A 1N36M 3KSXA 3FKEA 2C99A 5EXPA 4BLCA 1G4AE 4CGYB 3GQ4A 4FCTA 1KYIA 1L1TA 1DGHA 4PT5A 1KSFX 3K92A 2JA2A 2P5TA 4II7A 5H37D 4L8RC 4GIPA 2V1UA 3UZUA 2J7OA 5EP2A 2VIIA 1QANA 4L16A 4NOOB 3J2PB 4PD2A 1J09A 4MH0E 4QHTA 2CFOA 3SMPA 1HR0M 3U5ZA 4GKJM 5F3WA 4G4RA 3GPYA 1N78A 3ZC7B 5JI3E 2XF3A 1HNZM 4DV4M 3PNVA 1D2NA 3AV0A 3PNYA 1XXHB 1HNWM 3GLFA 1NNJA 1TDZA 1PJIA 3UJNA 4B3MM 3KOXE 3SASA 3RE8A 3L27A 2C96A 3VDPA 2QENA 3KP1E 4M9SA 4D80A 2UUAM 1FJGM 1OFHA 2F5NA 4GHAA 1J7KA 1XC8A 2DWLA 4DUYM 4G4OA 1K82A 2E5LM 4W5WA 3AOGA 4IBDA 4JI5M 3D8LA 4AG5A 1IN5A 3GLHA 2CEAA 3FUXA 3AJIB 1DGBA 2UXDM 4DR5M 3W0FA 3U6LA 1R6BX 4QNMA 5DYIA 3AL0C 4FWDA 2OPFA 1QQWA 3KSJA 1X37A 4EIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 M;  5ITQ A;  5ITR A;  3GO8 A;  4JI2 M;  3J7A S;  5ITX E;  1K3X A;  1N33 M;  4DUZ M;  3U6E A;  1L2C A;  1XNQ M;  4DR7 M;  4DR4 M;  5A2Q S;  2F5S A;  3A45 A;  5FLX S;  2F4V M;  3VK8 A;  4K0K M;  1IBM M;  3C58 A;  1KFV A;  2ZBK B;  2UUB M;  4LF9 M;  4DR3 M;  1EE8 A;  3VK7 A;  4DV2 M;  3U6C A;  1IBL M;  1HNX M;  4PDG A;  4LFC M;  2OQ4 A;  3SBJ A;  1XMO M;  1N34 M;  4MB7 A;  2UUC M;  3J80 S;  1XMQ M;  5ITX A;  3GQ3 A;  4LFA M;  4B3T M;  4JI8 M;  3GP1 A;  5IT9 S;  4DV0 M;  2UU9 M;  4LF7 M;  1Z59 A;  4LFB M;  4G4N A;  3U6D A;  2F5P A;  3GPU A;  5LMN M;  4DV3 M;  3SAR A;  1I94 M;  4X66 M;  1L2D A;  5BR8 M;  3SAW A;  4DV1 M;  4YY3 M;  2UXC M;  1Q39 A;  2XZU A;  4LF4 M;  1TDH A;  1R2Y A;  3SAV A;  4JYA M;  4NRV A;  2F5O A;  1Q3C A;  3TWK A;  2XZF A;  1Q3B A;  1N36 M;  1IBK M;  4X65 M;  4X64 M;  3GQ4 A;  4B3R M;  2VQE M;  1L1T A;  1Z5A A;  4LF5 M;  4PDI A;  4NXN M;  4DR1 M;  5ITU A;  3U6M A;  2EA0 A;  4NRW A;  1XNR M;  4G4Q A;  4LF8 M;  4DV6 M;  1L1Z A;  2HKJ A;  2ZM6 M;  1MX0 A;  3OTO M;  3T1H M;  2VQF M;  4JI0 M;  4PD2 A;  4DV7 M;  4NXM M;  3SAU A;  3A42 A;  3U6S A;  1HR0 M;  4JI1 M;  4GKJ M;  3JAM S;  4DR6 M;  4G4R A;  3GPY A;  3JR5 A;  4DR2 M;  1HNZ M;  4DV4 M;  1MU5 A;  3TWM A;  1R2Z A;  3GQ5 A;  1HNW M;  2Q2E B;  3JR4 A;  1NNJ A;  4DV5 M;  4LF6 M;  1TDZ A;  1PJI A;  2UXB M;  1PM5 A;  3U6Q A;  4B3M M;  1K3W A;  3SAS A;  5IWA M;  4CIS A;  1N32 M;  4PCZ A;  4JV5 M;  2F5Q A;  2UUA M;  2HHH M;  4JI6 M;  1FJG M;  1PJJ A;  2F5N A;  4KHP M;  1L2B A;  3SAT A;  1J5E M;  1XC8 A;  3U6P A;  3J81 S;  3GPX A;  4DUY M;  3GPP A;  4G4O A;  1K82 A;  2E5L M;  1Z5C A;  5ITY A;  3TWL A;  5ITT A;  4AQY M;  4JI5 M;  3DOA A;  4X62 M;  5LMU M;  4JI3 M;  3U6O A;  2UXD M;  4GKK M;  4B3S M;  4DR5 M;  3T1Y M;  3W0F A;  3U6L A;  3A46 A;  4JI7 M;  1Z5B A;  4YHH M;  2OPF A;  4OX9 M;  4ITQ A; 
#chains in the Genus database with same CATH topology
 1C7Y A;  4AI6 A;  2DAK A;  4JI4 M;  4FCW A;  3LVW A;  2R46 A;  5EQT A;  3U61 B;  1H6U A;  3LMM A;  4KT0 F;  1L2C A;  2KNZ A;  1IN6 A;  1XNQ M;  4DR4 M;  4G3O A;  1QUT A;  3SC3 A;  1G8P A;  4LJ8 A;  2F4V M;  5BPV A;  4MGZ E;  3B89 A;  5FTL A;  3SHG B;  1IXR C;  3LCV B;  4IBI A;  2CV2 A;  1QZM A;  2JY6 B;  5KQD A;  2AHM A;  2DWZ B;  2ZAM A;  2Z8Y M;  3VDU A;  1HNX M;  2I7P A;  2ERC A;  3HJQ A;  5L8R F;  3K8Z A;  3E4R A;  1AUA A;  3LCU A;  1OJL A;  4GC9 A;  4I8O A;  1QAM A;  2DHY A;  1W5S A;  1IY1 A;  4DV0 M;  1GVN A;  3THG A;  3Q8X A;  1GLN A;  5EP1 A;  1Q02 A;  5FSW A;  3GPU A;  3BBZ A;  3U60 B;  3W68 A;  2DEN A;  3DZD A;  3C9P A;  4DV3 M;  4HEO A;  1I94 M;  3KFU G;  5EJC A;  3KS8 A;  4S12 A;  1L2D A;  3VFD A;  3SAW A;  2X8A A;  2UXC M;  2HL7 A;  1WR1 B;  1IN7 A;  3B7Q A;  4LF4 M;  1TDH A;  3J7B A;  3M0E A;  3HHZ A;  1R2Y A;  2HAK A;  1IN4 A;  1L8Q A;  2XFS A;  4OU7 A;  4MGH A;  2KZS A;  2QSF X;  4LGM A;  1SXJ E;  4FD2 A;  1TGU A;  4LJ5 A;  3PVS A;  4IIW A;  1LV7 A;  2V6Z M;  1FNN A;  2DKL A;  2FOI C;  4FCV A;  3VLF B;  4PDI A;  4NXN M;  2QZ4 A;  4MGY E;  1V34 A;  1UFZ A;  3MMP A;  4Q7J A;  3PXG A;  5DYG A;  3UK6 A;  3QYB A;  1V33 A;  4ANR A;  3U6M A;  1XNR M;  2FE8 A;  4AZF A;  3GLI E;  2G8L A;  2RGO A;  3EIE A;  1E9S A;  3A98 B;  3MJ5 A;  5EP3 A;  2JY8 A;  3T1H M;  4JI0 M;  2L4F A;  4DV7 M;  4NXM M;  2EKF A;  3A42 A;  3U6S A;  2DZN B;  3HU2 A;  3GRV A;  3Q8G A;  2GQF A;  3JAM S;  1Z6T A;  1UM8 A;  3JR5 A;  3HU1 A;  2LXE A;  5IZ7 D;  2D7G A;  1SXJ D;  3E21 A;  4KO8 A;  3U61 A;  1IM2 A;  2KZU A;  1WGL A;  1G71 A;  3DA1 A;  4BBA A;  1E32 A;  2Q2E B;  4IBE A;  1PJT A;  1PM5 A;  2XH9 A;  1TTE A;  2LH0 A;  1N32 M;  4AKG A;  2Y0Q A;  4QHS A;  1WXQ A;  3L28 A;  1HQY E;  2HHH M;  2XSZ D;  3BXW A;  1PJJ A;  3ILK A;  3AFH A;  1L2B A;  1OKS A;  3L26 A;  2CRU A;  2KEB A;  3SAT A;  4JN6 A;  2M5Z A;  3TQS A;  3U6P A;  1G41 A;  3J81 S;  4FWH A;  3GPX A;  3QYE A;  4LJA A;  1GJS A;  2QPA A;  1DV0 A;  3B7N A;  3HHY A;  5ITT A;  2FFJ A;  3LQQ A;  4BB9 A;  5E26 A;  1EFU B;  2ZAO A;  3U60 A;  2OOB A;  4WP2 A;  2VF7 A;  4GKK M;  4MGK E;  5EXS A;  3T1Y M;  1QUS A;  1VDL A;  4LRS A;  2DXI A;  4IBB A;  2JP7 A;  2KA6 B;  3CF6 E;  1SXJ B;  2R18 A;  1E94 E;  2G5G X;  1NHW C;  1QYR A;  4MGI E;  4OW0 A;  4LY6 A;  4OX9 M;  3FUV A;  3AOE C;  5ITR A;  1C1K A;  5DNY A;  4R7G A;  3BOS A;  4L15 A;  1N33 M;  4CIZ A;  3U6E A;  3GLI B;  2DWM A;  3FYC A;  3AKZ A;  3MHV C;  2BWE A;  2L09 A;  1WIV A;  2WSC F;  5KQ8 A;  5C18 A;  3VK8 A;  5E6J A;  4IBG A;  5KPT A;  1DGG A;  2C98 A;  2H5X A;  2ZAN A;  3KOY E;  1G3I A;  2ZBK B;  2L6O A;  2LVN C;  2VDB B;  3NWL A;  4REZ A;  4DR3 M;  2LBC A;  3FUT A;  4LF9 M;  3HHW A;  4DV2 M;  3QAU A;  3LW5 F;  4LFC M;  2OQ4 A;  3SBJ A;  1XMO M;  2M60 A;  2CUZ A;  1N34 M;  4MB7 A;  3SYL A;  1I4W A;  2L7H A;  3J80 S;  3GQ3 A;  1G59 A;  4B3T M;  3GP1 A;  4D81 A;  4D82 A;  4GMQ A;  3KXE C;  2LVQ D;  4KOD A;  4GRI A;  4G4N A;  2F5P A;  4FWG A;  2LHG A;  2R4J A;  2D7H A;  4M0D A;  2DAM A;  1S3S A;  4B7H A;  3KS4 A;  4DV1 M;  1IN8 A;  2Y21 A;  2BJW A;  4L4U A;  3QWL A;  4YY3 M;  3C3E A;  4IJF A;  4Y28 F;  3SAV A;  2N35 A;  2CHV A;  1IQP A;  2KNV A;  1HQC A;  1PJS A;  1PRB A;  2EJS A;  1EIJ A;  3E9S A;  4IBF A;  5JI2 E;  5GKN A;  3W0L B;  1NY6 A;  4IBJ A;  3D8B A;  1IBK M;  1YSY A;  2DAI A;  1N75 A;  1DGF A;  2X49 A;  4M0W A;  3ZQJ A;  4NC6 A;  4X64 M;  1JQJ C;  1QAO A;  3B74 A;  1Z5A A;  2VQE M;  2Z3X A;  1TF0 B;  4GC5 A;  1VEK A;  2FS1 A;  5ITU A;  4LJ7 A;  5C1B A;  1XB2 B;  2HCB A;  4NRW A;  4G4Q A;  1GL7 A;  2HKJ A;  3L2A A;  2L7I A;  4DR7 M;  1WGN A;  1NVM A;  2VQF M;  4JXJ A;  4NSO B;  2QP9 X;  1SXJ A;  1XXH A;  1TH3 A;  2JZ1 A;  5FTM A;  1QAQ A;  1GL6 A;  1PGY A;  4NSR A;  4DR2 M;  4GEW A;  2RGH A;  2R65 A;  1MU5 A;  3SHF A;  3GRR A;  3TWM A;  1R2Z A;  2HWJ A;  2A5Y B;  1ZQ9 A;  2B3T A;  4P16 A;  3GQ5 A;  2ZTD A;  1NV9 A;  1ZMW A;  3GLI A;  4ZPX A;  1IY0 A;  4LF6 M;  1SXJ C;  4L6V 6;  2LWX A;  2OOA A;  2LNH C;  3FTC A;  4L78 A;  4XBO A;  3FUW A;  1OFI A;  3CF2 A;  4HLQ A;  3HU3 A;  4JV5 M;  3UMM A;  1ZMU A;  1TR8 A;  3HZJ A;  4G6Z A;  3I51 A;  3SYK A;  2KXE A;  3KOZ E;  3HY5 A;  2YNM D;  4GHL A;  3FTE A;  1J5E M;  1NY5 A;  5KPZ A;  1VEG A;  4AG6 A;  3L29 A;  2R45 A;  2QCU A;  2YQZ A;  3GPP A;  1XWI A;  1YLA A;  2BJV A;  4LG2 A;  1NSF A;  4AW4 A;  3UGJ A;  1OAO C;  4LJ6 A;  3DOA A;  3RGS A;  2YFQ A;  4MM3 B;  4X62 M;  4JI3 M;  2EUC A;  2EKK A;  3GRU A;  3U6O A;  1OQY A;  2QBY B;  2X4A A;  4I81 A;  3GLG E;  4IJE A;  4GIT A;  2MH8 A;  3A46 A;  1TH2 A;  4JI7 M;  1MN3 A;  1JR3 E;  1VEJ A;  4YHH M;  3FYD A;  3R8F A;  1IFY A;  3HHX A;  2C9O A;  5ITQ A;  3J7A S;  3GO8 A;  4JI2 M;  5ITX E;  2MRO B;  3IG8 A;  3FTD A;  3VKH A;  2G3Q A;  2K0B X;  1NJF A;  2R62 A;  3I4Y A;  4QOS A;  3H4M A;  2I7N A;  1LTM A;  3WHL A;  4K0K M;  2DVW B;  1IBM M;  1IXZ A;  2LTU A;  1GAB A;  2WSE F;  2APL A;  1ZAE A;  2UUB M;  1GO5 A;  1EE8 A;  1VDD A;  3FRH A;  1SG9 A;  5FTK A;  2OO9 A;  3AOE A;  3VK7 A;  1IBL M;  4FVM A;  1NNU C;  2R0I A;  3HKP A;  3V76 A;  5EXX A;  3FE3 A;  2UUC M;  1T43 A;  2JY5 A;  3KOW E;  3MK6 A;  1JR3 D;  2KRK A;  2Y0T A;  3IG5 A;  4LF7 M;  1Z59 A;  4LFB M;  3U6D A;  3LVV A;  3I4V A;  2RKO A;  4RNA A;  5LMN M;  1AIP C;  3SAR A;  4I5S A;  2FH0 A;  4LZZ A;  1IXS B;  3RGP A;  2R6F A;  1XHB A;  1Q39 A;  2ZTC A;  4JYA M;  4LJ4 A;  3IHP A;  4OVZ B;  2XLJ A;  3L25 A;  2F5O A;  1Q3C A;  4RF0 A;  1R4G A;  1R5L A;  5FTJ A;  4LRT A;  1D0K A;  3TWK A;  3WHK A;  1OAI A;  2DHR A;  2MGW A;  1Q3B A;  2K47 A;  4DBG B;  2CV0 A;  3R9X B;  2C9C A;  4M9Z A;  1ZMV A;  3HGI A;  4X65 M;  2Z7J A;  3TE6 A;  4B3R M;  3GLG B;  4RF1 A;  4LF5 M;  2K9D A;  8CAT A;  3FD9 A;  5FTN A;  3K1J A;  3DFZ A;  4DR1 M;  2VF8 A;  1F4I A;  2EA0 A;  1ORY B;  1PJQ A;  2FNA A;  3TL4 X;  2CV1 A;  4LF8 M;  3E46 A;  3PFI A;  4DV6 M;  1L1Z A;  3H4J A;  3GLF E;  2ZM6 M;  1MX0 A;  4QNR A;  4IBK A;  7CAT A;  2V1C A;  3K2L A;  3OTO M;  2QBY A;  2J5Y A;  3SMS A;  4LGY A;  3CTW B;  3SAU A;  4JI1 M;  3J27 B;  3HJ8 A;  5KPR A;  4DR6 M;  3M7G A;  1NHG C;  4M9X A;  2O25 A;  1KFV A;  1DO2 A;  1YUB A;  2O5R A;  1V92 A;  1QZE A;  5KO3 A;  2LHC A;  3EIH A;  1DO0 A;  4GH9 A;  3T38 A;  4CJ6 A;  4IBC A;  4Z6Y A;  1NJG A;  3B9P A;  3SFZ A;  2LVO C;  3JR4 A;  3GLH E;  4DV5 M;  2W82 A;  1QDR A;  2UXB M;  1TH4 A;  3U6Q A;  1K3W A;  3KW6 A;  5IWA M;  4CIS A;  2BNK A;  4PCZ A;  2F5Q A;  1N77 A;  4JI6 M;  3HWS A;  2DAE A;  4XK8 F;  2KHH A;  4KHP M;  1DGH B;  1VG5 A;  5IRE B;  2DZO B;  2EO2 A;  3ZCB B;  4B08 A;  3NBX X;  4KLN A;  1D0M A;  3FTF A;  1GKI A;  4XGI A;  1Z5C A;  5ITY A;  3M6A A;  3TWL A;  4F1I A;  4AQY M;  3HJS A;  1WHC A;  4B7F A;  1ZV1 A;  2KRU A;  5LMU M;  1BVS A;  2CHG A;  1E9R A;  1HT2 E;  4B3S M;  4UN2 B;  1R7R A;  2J7N A;  3CF0 A;  1IXS A;  1QDT A;  1WJ7 A;  3U5Z B;  1Z5B A;  2XSZ A;  3T15 A;  1HJP A;  2Y20 A;  4ITQ A;  2CE7 A;  2JUJ A;  1T3T A;  4OVZ A;  4LZJ A;  2CHQ A;  1HT1 E;  2QNJ A;  2DWN A;  2JXN A;  2LVA A;  4CHT B;  1NO1 A;  1NV8 A;  1K3X A;  4DUZ M;  5EXT A;  4NL4 H;  3GLF B;  1OIZ A;  3T6P A;  5A2Q S;  1W5T A;  2F5S A;  3A45 A;  2QHO B;  5FLX S;  4P17 A;  2C5R A;  1JB0 F;  3I01 M;  3VKG A;  4R71 A;  3GLG A;  4FW9 A;  3C58 A;  4WW0 A;  2JY7 A;  1JR3 A;  3U6C A;  1QVR A;  2L4E A;  1D0L A;  2YR0 A;  4PDG A;  2KNA A;  3FRI A;  1XXH E;  3K9P A;  2DNA A;  3ZH9 B;  4B7G A;  2GNO A;  2XGN A;  5ITX A;  1XMQ M;  4LFA M;  2Z4R A;  1YE9 A;  3LQR A;  4JI8 M;  2UU9 M;  4TUW A;  5IT9 S;  4AKH A;  1IY2 A;  2O01 F;  3GRY A;  2H1R A;  5EP4 A;  2Z4S A;  3KP0 E;  1RU3 A;  3GLH B;  4Z8X A;  3RFW A;  2BWB A;  2R4E A;  4HL4 A;  3NBI A;  2D7E A;  2XEP A;  4X66 M;  5BR8 M;  2K6B A;  4QOZ C;  2CWB A;  4I4L A;  2JZ0 A;  4R3D A;  2XZU A;  4AKI A;  2NQ8 C;  4NRV A;  2DI0 A;  4WUR A;  4A3V B;  3C3D A;  2KW0 A;  2XZF A;  2XFT A;  3KVW A;  3FUU A;  3KDS E;  3TPZ A;  2R44 A;  4LCB A;  4LJ9 A;  1N36 M;  3KSX A;  2L2D A;  3FKE A;  2C99 A;  2WZJ A;  5EXP A;  1G4A E;  3HX3 A;  4BLC A;  3IEC A;  4CGY B;  3GQ4 A;  1VQ1 A;  4FCT A;  1KYI A;  4F2L A;  1L1T A;  2WSF F;  1CUK A;  1DGH A;  1MJG M;  4PT5 A;  1KSF X;  3W67 A;  3K92 A;  2JA2 A;  2P5T A;  4II7 A;  3I04 M;  5H37 D;  4L8R C;  2RRU A;  4GIP A;  2V1U A;  3UZU A;  2J7O A;  5EP2 A;  2VII A;  1QAN A;  3B7Z A;  4L16 A;  1OTR A;  4NOO B;  3J2P B;  4PD2 A;  1J09 A;  4MH0 E;  2DZL A;  4QHT A;  2CFO A;  3SMP A;  1HR0 M;  3U5Z A;  4GKJ M;  2CP8 A;  5F3W A;  4G4R A;  3GPY A;  1N78 A;  3ZC7 B;  5JI3 E;  1P3Q Q;  2XF3 A;  3F92 A;  1HNZ M;  4DV4 M;  2KDL A;  1A5T A;  2JNH A;  3PNV A;  1D2N A;  3AV0 A;  3PNY A;  1XXH B;  1HNW M;  3GLF A;  1NNJ A;  1TDZ A;  1PJI A;  3UJN A;  4B3M M;  3KOX E;  3SAS A;  3RE8 A;  3L27 A;  2C96 A;  3VDP A;  2QQ8 A;  2QEN A;  3KP1 E;  4M9S A;  4D80 A;  2UUA M;  1FJG M;  1OFH A;  2F5N A;  1T6O A;  1OIP A;  5DFL A;  4GHA A;  1J7K A;  1XC8 A;  2DWL A;  2LVP C;  3CGW A;  4DUY M;  4G4O A;  1K82 A;  2E5L M;  4W5W A;  3K9O A;  3AOG A;  4IBD A;  4JI5 M;  3D8L A;  4AG5 A;  1IN5 A;  1GJT A;  2CEA A;  3FUX A;  3GLH A;  3AJI B;  1DGB A;  2UXD M;  2MR9 A;  4DR5 M;  1Y8G A;  3W0F A;  2JWS A;  3U6L A;  1R6B X;  4QNM A;  4RKU F;  5DYI A;  3AL0 C;  4FWD A;  2OPF A;  2DAG A;  2MJ5 B;  1QQW A;  3KSJ A;  1X37 A;  4EIW A; 
#chains in the Genus database with same CATH homology
 4AI6 A;  4JI4 M;  4FCW A;  3LVW A;  2R46 A;  5EQT A;  3U61 B;  1H6U A;  3LMM A;  1L2C A;  1IN6 A;  1XNQ M;  4DR4 M;  3SC3 A;  1G8P A;  4LJ8 A;  2F4V M;  5BPV A;  4MGZ E;  5FTL A;  3SHG B;  1IXR C;  4IBI A;  2CV2 A;  1QZM A;  5KQD A;  2AHM A;  2DWZ B;  2ZAM A;  3VDU A;  1HNX M;  2I7P A;  2ERC A;  3HJQ A;  3K8Z A;  3E4R A;  1OJL A;  4GC9 A;  4I8O A;  1QAM A;  1W5S A;  1IY1 A;  4DV0 M;  1GVN A;  3THG A;  3Q8X A;  1GLN A;  5EP1 A;  5FSW A;  3GPU A;  3U60 B;  4DV3 M;  3DZD A;  3KFU G;  1I94 M;  5EJC A;  3KS8 A;  4S12 A;  1L2D A;  3VFD A;  3SAW A;  2X8A A;  2UXC M;  2HL7 A;  1IN7 A;  4LF4 M;  1TDH A;  3J7B A;  3M0E A;  3HHZ A;  1R2Y A;  1IN4 A;  1L8Q A;  2XFS A;  4OU7 A;  4MGH A;  2KZS A;  4LGM A;  1SXJ E;  4FD2 A;  1TGU A;  4LJ5 A;  3PVS A;  4IIW A;  1LV7 A;  2V6Z M;  1FNN A;  4FCV A;  2FOI C;  3VLF B;  4PDI A;  4NXN M;  2QZ4 A;  4MGY E;  3UK6 A;  3PXG A;  3U6M A;  5DYG A;  1XNR M;  2FE8 A;  4AZF A;  2G8L A;  2RGO A;  3EIE A;  1E9S A;  3A98 B;  3MJ5 A;  5EP3 A;  3T1H M;  4JI0 M;  4DV7 M;  4NXM M;  3A42 A;  3U6S A;  2DZN B;  3HU2 A;  3GRV A;  3JAM S;  1Z6T A;  1UM8 A;  3JR5 A;  3HU1 A;  2LXE A;  5IZ7 D;  2D7G A;  1SXJ D;  4KO8 A;  3U61 A;  1IM2 A;  2KZU A;  3DA1 A;  4BBA A;  1E32 A;  2Q2E B;  4IBE A;  1PM5 A;  2XH9 A;  2LH0 A;  4AKG A;  1N32 M;  2Y0Q A;  4QHS A;  1WXQ A;  3L28 A;  1HQY E;  2HHH M;  2XSZ D;  1PJJ A;  3ILK A;  3AFH A;  1L2B A;  3L26 A;  2KEB A;  3SAT A;  4JN6 A;  2M5Z A;  3TQS A;  3U6P A;  1G41 A;  3J81 S;  4FWH A;  3GPX A;  4LJA A;  2QPA A;  3HHY A;  5ITT A;  2FFJ A;  3LQQ A;  4BB9 A;  5E26 A;  3U60 A;  2ZAO A;  4GKK M;  4MGK E;  5EXS A;  3T1Y M;  4LRS A;  2DXI A;  4IBB A;  2KA6 B;  3CF6 E;  1SXJ B;  2R18 A;  1E94 E;  2G5G X;  1NHW C;  1QYR A;  4MGI E;  4OW0 A;  4LY6 A;  4OX9 M;  3FUV A;  3AOE C;  5ITR A;  1C1K A;  5DNY A;  4R7G A;  3BOS A;  4L15 A;  1N33 M;  3U6E A;  2DWM A;  3GLI B;  3FYC A;  3AKZ A;  3MHV C;  2L09 A;  5KQ8 A;  5C18 A;  3VK8 A;  5E6J A;  4IBG A;  5KPT A;  1DGG A;  2C98 A;  2ZAN A;  3KOY E;  1G3I A;  2ZBK B;  2L6O A;  3NWL A;  4REZ A;  1KFV A;  4LF9 M;  4DR3 M;  3FUT A;  3HHW A;  4DV2 M;  3QAU A;  4LFC M;  2OQ4 A;  3SBJ A;  1XMO M;  2M60 A;  2CUZ A;  1N34 M;  4MB7 A;  3SYL A;  1I4W A;  2L7H A;  3J80 S;  3GQ3 A;  1G59 A;  4B3T M;  3GP1 A;  4D81 A;  4D82 A;  4GMQ A;  3KXE C;  4KOD A;  4GRI A;  4G4N A;  2F5P A;  4FWG A;  2R4J A;  2D7H A;  4M0D A;  1S3S A;  4B7H A;  3KS4 A;  4DV1 M;  1IN8 A;  2Y21 A;  2BJW A;  4L4U A;  3QWL A;  4YY3 M;  4IJF A;  3SAV A;  2CHV A;  1IQP A;  1HQC A;  3E9S A;  4IBF A;  5JI2 E;  5GKN A;  3W0L B;  1NY6 A;  4IBJ A;  3D8B A;  1IBK M;  1YSY A;  1N75 A;  1DGF A;  2X49 A;  4M0W A;  4X64 M;  2Z3X A;  1QAO A;  1JQJ C;  2VQE M;  1Z5A A;  4GC5 A;  5ITU A;  4LJ7 A;  5C1B A;  4NRW A;  2HCB A;  4G4Q A;  1GL7 A;  2HKJ A;  3L2A A;  2L7I A;  1NVM A;  2VQF M;  4JXJ A;  4NSO B;  2QP9 X;  1SXJ A;  1XXH A;  1TH3 A;  5FTM A;  1QAQ A;  1GL6 A;  4NSR A;  4DR2 M;  2RGH A;  2R65 A;  1MU5 A;  3SHF A;  3GRR A;  3TWM A;  1R2Z A;  2A5Y B;  1ZQ9 A;  4P16 A;  3GQ5 A;  3GLI A;  4ZPX A;  1IY0 A;  4LF6 M;  1SXJ C;  2LWX A;  2LNH C;  3FTC A;  4L78 A;  4XBO A;  3FUW A;  1OFI A;  3CF2 A;  4HLQ A;  3HU3 A;  4JV5 M;  3UMM A;  4G6Z A;  3I51 A;  3SYK A;  2KXE A;  3KOZ E;  4GHL A;  2YNM D;  3FTE A;  1J5E M;  1NY5 A;  5KPZ A;  4AG6 A;  3L29 A;  2R45 A;  2QCU A;  2YQZ A;  3GPP A;  1XWI A;  2BJV A;  4LG2 A;  1NSF A;  4AW4 A;  3UGJ A;  4LJ6 A;  3DOA A;  3RGS A;  2YFQ A;  4MM3 B;  4X62 M;  4JI3 M;  2EUC A;  3U6O A;  3GRU A;  2QBY B;  2X4A A;  4I81 A;  4IJE A;  4GIT A;  3A46 A;  4JI7 M;  1TH2 A;  4YHH M;  3FYD A;  3R8F A;  3HHX A;  2C9O A;  5ITQ A;  3J7A S;  3GO8 A;  4JI2 M;  5ITX E;  3IG8 A;  3FTD A;  3VKH A;  1NJF A;  2R62 A;  3I4Y A;  4QOS A;  3H4M A;  2I7N A;  3WHL A;  4K0K M;  2DVW B;  1IBM M;  1IXZ A;  1ZAE A;  2UUB M;  1EE8 A;  1VDD A;  3VK7 A;  5FTK A;  3AOE A;  1IBL M;  4FVM A;  1NNU C;  3HKP A;  5EXX A;  2UUC M;  3KOW E;  3MK6 A;  1JR3 D;  2KRK A;  2Y0T A;  3IG5 A;  4LF7 M;  1Z59 A;  4LFB M;  3U6D A;  3LVV A;  3I4V A;  2RKO A;  4RNA A;  5LMN M;  3SAR A;  4I5S A;  4LZZ A;  1IXS B;  3RGP A;  1XHB A;  1Q39 A;  4JYA M;  4LJ4 A;  4OVZ B;  3L25 A;  2XLJ A;  2F5O A;  1Q3C A;  4RF0 A;  5FTJ A;  3TWK A;  3WHK A;  4LRT A;  2DHR A;  1Q3B A;  2K47 A;  2CV0 A;  3R9X B;  2C9C A;  4M9Z A;  3HGI A;  4X65 M;  2Z7J A;  3TE6 A;  4B3R M;  3GLG B;  4RF1 A;  4LF5 M;  8CAT A;  3FD9 A;  5FTN A;  3K1J A;  3DFZ A;  4DR1 M;  2EA0 A;  1ORY B;  2FNA A;  3TL4 X;  2CV1 A;  4LF8 M;  3PFI A;  4DV6 M;  1L1Z A;  2ZM6 M;  1MX0 A;  4QNR A;  4IBK A;  7CAT A;  2V1C A;  3K2L A;  3OTO M;  2QBY A;  3SMS A;  4LGY A;  3CTW B;  3SAU A;  4JI1 M;  3J27 B;  3HJ8 A;  5KPR A;  4DR6 M;  3M7G A;  1NHG C;  4M9X A;  1DO2 A;  1YUB A;  2O5R A;  5KO3 A;  3EIH A;  1DO0 A;  4GH9 A;  3T38 A;  4IBC A;  4Z6Y A;  1NJG A;  3B9P A;  3SFZ A;  3JR4 A;  4DV5 M;  2W82 A;  2UXB M;  1TH4 A;  3U6Q A;  1K3W A;  3KW6 A;  5IWA M;  4CIS A;  2BNK A;  4PCZ A;  2F5Q A;  1N77 A;  4JI6 M;  3HWS A;  4KHP M;  1DGH B;  5IRE B;  2DZO B;  2EO2 A;  3ZCB B;  4B08 A;  4KLN A;  3FTF A;  1GKI A;  4XGI A;  1Z5C A;  5ITY A;  3M6A A;  3TWL A;  4AQY M;  3HJS A;  4B7F A;  2KRU A;  5LMU M;  2CHG A;  1E9R A;  1HT2 E;  4B3S M;  1R7R A;  2J7N A;  3CF0 A;  3U5Z B;  1Z5B A;  2XSZ A;  3T15 A;  2Y20 A;  4ITQ A;  2CE7 A;  1T3T A;  4OVZ A;  4LZJ A;  2CHQ A;  1HT1 E;  2DWN A;  4CHT B;  1K3X A;  4DUZ M;  5EXT A;  4NL4 H;  3GLF B;  4DR7 M;  5A2Q S;  1W5T A;  2F5S A;  3A45 A;  5FLX S;  2C5R A;  3VKG A;  3GLG A;  4FW9 A;  3C58 A;  4WW0 A;  1JR3 A;  3U6C A;  1QVR A;  2YR0 A;  4PDG A;  3ZH9 B;  4B7G A;  2XGN A;  1XMQ M;  5ITX A;  4LFA M;  2Z4R A;  1YE9 A;  3LQR A;  4JI8 M;  2UU9 M;  4TUW A;  5IT9 S;  4AKH A;  1IY2 A;  5EP4 A;  3GRY A;  2H1R A;  2Z4S A;  3KP0 E;  3GLH B;  4Z8X A;  3RFW A;  2R4E A;  4HL4 A;  3NBI A;  2D7E A;  2XEP A;  4X66 M;  5BR8 M;  4QOZ C;  4R3D A;  4I4L A;  2XZU A;  4AKI A;  2NQ8 C;  4NRV A;  4A3V B;  4WUR A;  2KW0 A;  2XZF A;  2XFT A;  3KVW A;  3FUU A;  3KDS E;  3TPZ A;  4LCB A;  4LJ9 A;  1N36 M;  3KSX A;  3FKE A;  2C99 A;  5EXP A;  4BLC A;  1G4A E;  4CGY B;  3GQ4 A;  4FCT A;  1KYI A;  1L1T A;  1DGH A;  4PT5 A;  1KSF X;  3K92 A;  2JA2 A;  2P5T A;  4II7 A;  5H37 D;  4L8R C;  4GIP A;  2V1U A;  3UZU A;  2J7O A;  5EP2 A;  2VII A;  1QAN A;  4L16 A;  4NOO B;  3J2P B;  4PD2 A;  1J09 A;  4MH0 E;  4QHT A;  2CFO A;  3SMP A;  1HR0 M;  3U5Z A;  4GKJ M;  5F3W A;  4G4R A;  3GPY A;  1N78 A;  3ZC7 B;  5JI3 E;  2XF3 A;  1HNZ M;  4DV4 M;  3PNV A;  1D2N A;  3AV0 A;  3PNY A;  1XXH B;  1HNW M;  3GLF A;  1NNJ A;  1TDZ A;  1PJI A;  3UJN A;  4B3M M;  3KOX E;  3SAS A;  3RE8 A;  3L27 A;  2C96 A;  3VDP A;  2QEN A;  3KP1 E;  4M9S A;  4D80 A;  2UUA M;  1FJG M;  1OFH A;  2F5N A;  4GHA A;  1J7K A;  1XC8 A;  2DWL A;  4DUY M;  4G4O A;  1K82 A;  2E5L M;  4W5W A;  3AOG A;  4IBD A;  4JI5 M;  3D8L A;  4AG5 A;  1IN5 A;  3GLH A;  2CEA A;  3FUX A;  3AJI B;  1DGB A;  2UXD M;  4DR5 M;  3W0F A;  3U6L A;  1R6B X;  4QNM A;  5DYI A;  3AL0 C;  4FWD A;  2OPF A;  1QQW A;  3KSJ A;  1X37 A;  4EIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...