1FJGM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1fjgM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1fjgM02
1MX0A 3GQ4A 4LF6M 3SAUA 3TWMA 4NRWA 1KFVA 5ITXA 1EE8A 4PDGA 4JYAM 1N36M 5ITQA 3TWKA 4CISA 4B3SM 1N32M 1N34M 3VK7A 2UXCM 1L2CA 4LF7M 4DV0M 4DV3M 3A45A 1TDHA 4MB7A 3U6CA 1Q3CA 4NXMM 2UUAM 3U6SA 4JI6M 4JI5M 5LMUM 5LMNM 1PM5A 1Z5AA 4AQYM 1Z59A 4DV4M 1HNZM 1FJGM 4DV2M 3VK8A 1R2YA 4PDIA 1XC8A 4YY3M 4LFCM 4JI3M 3A46A 3GQ3A 3U6DA 3SASA 3JR4A 1PJJA 3SATA 1IBLM 5FLXS 2Q2EB 4DR1M 1R2ZA 4NRVA 1IBMM 3SAWA 5ITXE 3T1YM 2XZFA 3U6EA 3GQ5A 1J5EM 1K3WA 4ITQA 4DV1M 1IBKM 2UUCM 4DV6M 2OQ4A 1MU5A 1PJIA 3J80S 4DV5M 1Z5BA 5ITTA 2ZM6M 4G4RA 1TDZA 1Q3BA 4DR3M 4DR4M 3GPUA 4DV7M 4X65M 3W0FA 5ITUA 1XMQM 2ZBKB 2UUBM 4B3TM 1Q39A 2E5LM 4DUZM 2F5QA 1XNQM 1I94M 4JI8M 4GKKM 4KHPM 3U6LA 4GKJM 4DR2M 5ITYA 3U6MA 4LF4M 2F4VM 1HNWM 4DUYM 4LFAM 3A42A 3JR5A 4DR7M 4X66M 2F5SA 2UU9M 5IWAM 5IT9S 1L2BA 1L1TA 2XZUA 4OX9M 1HNXM 4JI0M 3SAVA 4G4QA 1K82A 2F5PA 4JI2M 2VQFM 3C58A 3OTOM 3U6QA 3T1HM 5BR8M 4B3MM 2HHHM 2HKJA 2VQEM 3JAMS 3U6PA 1NNJA 4DR5M 4X64M 4LF5M 4LF8M 2F5OA 3GPPA 4YHHM 2EA0A 4G4NA 1HR0M 4JI7M 1XNRM 5A2QS 2UXBM 4X62M 2OPFA 4JI4M 3J7AS 2F5NA 4LF9M 3GPYA 3SARA 4G4OA 2UXDM 3U6OA 1N33M 4LFBM 5ITRA 4JI1M 1XMOM 4PCZA 3GP1A 3GPXA 1L2DA 4PD2A 4JV5M 1L1ZA 3GO8A 4DR6M 4K0KM 3DOAA 1K3XA 4B3RM 3TWLA 4NXNM 3SBJA 3J81S 1Z5CA
chains in the Genus database with same CATH superfamily
4M9XA 4FCTA 3TWMA 4MGYE 3SAUA 3GRRA 4PDGA 4GC9A 2GQFA 3TWKA 3HWSA 1DGHA 4HLQA 1H6UA 1NO1A 3D8LA 1C7YA 2Z4SA 1GJTA 3FKEA 4WURA 4CJ6A 1N32M 1N34M 2JWSA 2LXEA 1JQJC 3BBZA 3FRIA 1XXHE 2KZSA 1VEJA 3A45A 4GH9A 3FE3A 4CIZA 3FUXA 5DYGA 4KODA 1WXQA 3KSXA 3DFZA 2BJWA 2RGOA 2ZANA 5LMUM 5LMNM 3GRYA 1PM5A 1W5TA 2JZ1A 1Z59A 4MGZE 3LW5F 1HNZM 4LRTA 1FJGM 4LF9M 3FRHA 1R2YA 1G71A 3A46A 3GLIE 2L7HA 3SMPA 1ZMUA 1G4AE 3SATA 4IBFA 1T6OA 2LNHC 2H1RA 2CEAA 4GHLA 3HHYA 5BPVA 2DAIA 2LHCA 3PFIA 5ITXE 2XF3A 3K92A 4AKHA 3DZDA 3RGSA 4FW9A 1IN8A 3KXEC 2UUCM 2K9DA 1DO0A 1MJGM 2OOAA 3HHWA 1YLAA 2XEPA 3IHPA 4LJAA 3D8BA 1HT2E 1OIPA 4X65M 4EIWA 1V33A 1Q39A 2KXEA 2QPAA 4LJ5A 4XK8F 2F5QA 3GLFE 1XNQM 2VDBB 2FE8A 3SC3A 2FOIC 2JY6B 4GRIA 1JR3D 4LJ6A 3U6MA 3KP0E 3AL0C 4FWHA 4M9SA 1HNWM 4HL4A 3KDSE 2Y21A 3M0EA 4FWDA 3JR5A 1P3QQ 2BWBA 3VKHA 2UU9M 4IBGA 1NVMA 2FNAA 3NBXX 3RGPA 3T6PA 1HNXM 4JI0M 2LVOC 2Z8YM 5L8RF 2K47A 2VIIA 1IN4A 4DBGB 3C58A 2EKFA 5EP4A 5BR8M 2APLA 4NSRA 3HHXA 2YQZA 1JB0F 3UZUA 4BB9A 4OVZA 2QQ8A 1HJPA 4LF8M 5JI3E 2EA0A 2QBYA 3QYBA 5A2QS 4AZFA 4X62M 4RNAA 1E32A 2OPFA 1WGLA 2DWLA 2F5NA 4NL4H 4FD2A 2WSEF 4S12A 2L6OA 1IN7A 3GPYA 3SARA 3B9PA 3E46A 4IBJA 1PJSA 4LJ7A 4G3OA 4KO8A 4ZPXA 3T38A 2J7NA 4LFBM 2XH9A 1E9RA 2XLJA 3KOWE 1JR3A 1DGFA 2FFJA 3RE8A 3GP1A 1L2DA 3ZH9B 4PD2A 4NC6A 3GO8A 1N77A 3K2LA 1SXJA 4II7A 3HU3A 2DZOB 1K3XA 2FS1A 3H4JA 1NHGC 1S3SA 3C3DA 3L27A 2Z7JA 2DXIA 3GLHE 3GQ4A 2M60A 2R4EA 4L8RC 1QZMA 4NRWA 1T43A 4D82A 3FTDA 4GMQA 1WR1B 2RRUA 3I4VA 3LCUA 3F92A 1PJQA 4JXJA 1TH3A 2XGNA 2XSZA 2CUZA 3VK7A 3E21A 2UXCM 4RF1A 5FTKA 2P5TA 4B08A 2R4JA 3T15A 3V76A 4DV0M 4DV3M 2ZAOA 2B3TA 3LQQA 1PRBA 4MB7A 1IY1A 3U6CA 5DNYA 2DHYA 3MHVC 4MM3B 3U6SA 2UUAM 3FTEA 3FUUA 4QOZC 4AQYM 4L15A 4NSOB 2G3QA 4DV4M 1A5TA 2EJSA 2KDLA 3K8ZA 4DV2M 2QBYB 1GLNA 4PDIA 2X8AA 1UM8A 2FH0A 3R8FA 1F4IA 3GLGE 3WHKA 4L78A 1OJLA 3M6AA 3BOSA 4IBKA 3K1JA 4DR1M 3B7NA 2LH0A 1NSFA 3CGWA 1IBMM 4I81A 1C1KA 4CGYB 2DAEA 3U6EA 5FTMA 3IG5A 4ITQA 5EP2A 2KRKA 1QVRA 2D7EA 1NV9A 2HL7A 1L8QA 1NNUC 1MU5A 4DV5M 2JNHA 3NBIA 2OOBA 3SYKA 3ZQJA 2LWXA 1QDRA 2MR9A 3DA1A 4JN6A 3GLIA 3FYCA 3GLIB 4DR4M 1Q3BA 2CFOA 2QHOB 1J09A 1IM2A 4QHTA 1IN5A 1OQYA 2JXNA 5ITUA 1R6BX 1R7RA 2ZBKB 2CV2A 2VF7A 3PXGA 4REZA 4GKKM 5IZ7D 4DR2M 2F4VM 4LF4M 1EFUB 1TTEA 2DWZB 4LZJA 1Y8GA 4LFAM 3GLHB 3J7BA 3HKPA 4LJ9A 2D7HA 2RKOA 4BBAA 4Z6YA 3KVWA 4X66M 4LG2A 2DKLA 3KS8A 3I4YA 1IQPA 2KEBA 1NV8A 5C18A 3UMMA 2QZ4A 3RFWA 3SAVA 1K82A 1E94E 1LTMA 5DFLA 2KA6B 2KRUA 2V6ZM 2YFQA 2CRUA 3OTOM 1VEGA 1AUAA 3ILKA 3AKZA 3Q8XA 2HHHM 2HKJA 4LJ8A 3GLGB 2DAGA 3SHFA 2VQEM 3U61A 1I4WA 2KW0A 4LCBA 2HAKA 4G4NA 2DWMA 1PGYA 2UXBM 2L2DA 4AG6A 3A98B 2Z4RA 4Z8XA 4LJ4A 3VLFB 3UGJA 4UN2B 4GITA 5F3WA 2AHMA 8CATA 2UXDM 3U6OA 2GNOA 3CF6E 4MGHA 1N33M 2Z3XA 4OW0A 3K9PA 2CV1A 2R44A 1D0MA 3HU1A 4GIPA 3LVVA 4LZZA 2G5GX 1DGBA 2ERCA 3QAUA 3B7ZA 3TWLA 4NXNM 3KSJA 4GC5A 3FD9A 1QAMA 5EXPA 1TH2A 3EIEA 2C99A 3GRUA 4AKGA 2YR0A 3CF0A 4FCWA 4LF6M 3IECA 3B74A 4D81A 3KS4A 3THGA 1N36M 2KHHA 2C5RA 1KYIA 3TL4X 1N78A 3L28A 1QUSA 4D80A 1NY6A 1BVSA 1SXJE 1HQCA 2JA2A 5KPTA 1DO2A 1L2CA 4KLNA 4LF7M 3KFUG 2BNKA 2LVQD 1TDHA 3FUVA 1IN6A 4R71A 2ZTCA 3VFDA 2W82A 3WHLA 3IG8A 1TF0B 4NXMM 1XXHA 4JI6M 3PVSA 5KPZA 4JI5M 4GEWA 2QSFX 4W5WA 1QUTA 1GL7A 3Q8GA 4IBEA 3SMSA 4HEOA 5H37D 1XWIA 2A5YB 4LGYA 4JI3M 4F1IA 3CTWB 3HZJA 3SASA 1VDDA 4PT5A 3JR4A 3HJSA 2MH8A 5FLXS 3U5ZA 2LVPC 1YUBA 3J2PB 4NOOB 4NRVA 3SYLA 4RF0A 3T1YM 2XZFA 4GHAA 4FVMA 3GQ5A 1J5EM 1K3WA 4CHTB 2BJVA 3C9PA 3SHGB 2L4EA 1IBKM 2OQ4A 1IXRC 1CUKA 4AW4A 2CHQA 1Z5BA 3CF2A 2DHRA 3HY5A 2DI0A 3W67A 1TDZA 3U61B 2C98A 1G59A 3GPUA 4DV7M 2QP9X 4FWGA 3GLGA 3W0FA 1SG9A 1VEKA 1XMQM 2O01F 2E5LM 3HJQA 4DUZM 4R7GA 1WJ7A 1I94M 4KHPM 4GKJM 1HT1E 1Q02A 1V92A 3U6LA 2XSZD 3UK6A 1E9SA 3HX3A 3L2AA 1ORYB 4MGIE 5EXXA 4DUYM 2DNAA 3A42A 1ZQ9A 4DR7M 2H5XA 2EUCA 2WSFF 2Y20A 1OAOC 1Z6TA 5E6JA 5IT9S 1VG5A 1L2BA 3KP1E 4IJFA 3PNYA 4M0DA 1ZMVA 2L7IA 3VKGA 1TR8A 2XFSA 1OFIA 1FNNA 1XB2B 2F5PA 2C96A 4JI2M 1ZMWA 4ANRA 1MN3A 2O25A 3U6QA 1D0LA 2C9CA 4B3MM 1ZAEA 2EKKA 3FTCA 4FCVA 1NNJA 4DR5M 2DZNB 3FYDA 5JI2E 1GKIA 5FTLA 3AOEA 3GPPA 1HR0M 4JI7M 2R0IA 4G6ZA 3B7QA 4JI4M 3L25A 5FSWA 4LY6A 3J7AS 1LV7A 2LHGA 5KO3A 4F2LA 1JR3E 3KOXE 4WP2A 2C9OA 2R65A 3K9OA 3QWLA 1IY2A 1PJTA 3I51A 3E9SA 1WHCA 1IXSB 2VF8A 1NHWC 3L29A 3I04M 1IXSA 3KW6A 4JI1M 2CP8A 1OFHA 3AFHA 1QQWA 3HJ8A 2O5RA 3GPXA 2DAKA 3BXWA 3AOEC 2CE7A 1SXJB 1TH4A 1L1ZA 4A3VB 2R46A 1D2NA 1TGUA 1XXHB 1QAOA 2QNJA 3DOAA 4L16A 4B3RM 3SBJA 1VQ1A 1ZV1A 4QNRA 5C1BA 4QNMA 3J81S 1KSFX 1HQYE 2X49A 2G8LA 4TUWA 2X4AA 1EIJA 2YNMD 3J27B 1MX0A 1NJFA 2M5ZA 1KFVA 1G3IA 5ITXA 1EE8A 2MROB 3VDUA 3R9XB 4JYAM 2QENA 5ITQA 2KNVA 1AIPC 1OIZA 4CISA 4KT0F 2R18A 2V1CA 3U5ZB 5FTJA 2HWJA 1T3TA 4B3SM 2MGWA 3U60B 1IFYA 2JY7A 1J7KA 1G8PA 3AOGA 3TE6A 3TPZA 1W5SA 1GO5A 3C3EA 5DYIA 2R45A 1DV0A 4B7FA 4AI6A 1Q3CA 1D0KA 1XHBA 2MJ5B 4M0WA 2JZ0A 4I5SA 5EP1A 1QYRA 3MK6A 4RKUF 1Z5AA 2R6FA 3GRVA 1GJSA 4AKIA 1NJGA 3VK8A 4LFCM 1XC8A 2D7GA 2LTUA 4YY3M 2CHVA 3H4MA 2DVWB 1QDTA 5EQTA 1SXJC 2ZTDA 5KPRA 3KOYE 3GQ3A 3U6DA 2K0BX 3MMPA 1PJJA 1IBLM 2Q2EB 4IBBA 3MJ5A 1R2ZA 1X37A 2OO9A 1RU3A 1NY5A 3LMMA 4WW0A 3GLFB 3GLFA 3SAWA 4IJEA 2R62A 5EP3A 1IY0A 2JP7A 1WGNA 2NQ8C 4DV1M 2RGHA 2KNZA 1IXZA 1UFZA 4DV6M 2LBCA 2I7PA 1PJIA 3KOZE 3J80S 7CATA 2Y0QA 3HHZA 4B7GA 5ITTA 3VDPA 2ZM6M 3SFZA 2V1UA 2JY5A 4MGKE 4IIWA 4P17A 4G4RA 4DR3M 1R4GA 2WSCF 3NWLA 4XGIA 4I4LA 3LVWA 2DZLA 2ZAMA 2UUBM 5EJCA 4B3TM 4IBCA 1G41A 5IREB 2J7OA 2I7NA 4L6V6 5GKNA 2N35A 1R5LA 3M7GA 4JI8M 2CWBA 1N75A 5ITYA 4Y28F 5FTNA 4P16A 2XFTA 3TQSA 4R3DA 3ZCBB 5KQ8A 3I01M 2F5SA 3B89A 5IWAM 3L26A 1DGGA 2J5YA 1VDLA 3HU2A 4LGMA 1L1TA 2XZUA 4OX9M 2LVAA 3FUTA 2KNAA 4BLCA 1QANA 2DAMA 4M9ZA 4G4QA 4L4UA 4MH0E 2L09A 2VQFM 1WIVA 2CV0A 3AJIB 3T1HM 5KQDA 1OTRA 2Y0TA 4IBIA 5E26A 2JY8A 3ZC7B 3LCVB 3W68A 3JAMS 4OVZB 3U6PA 3EIHA 4X64M 4LRSA 4LF5M 2F5OA 2WZJA 5EXSA 4YHHM 1XNRM 1YE9A 2LVNC 1GL6A 2EO2A 1DGHB 2L4FA 1QAQA 2DENA 5EXTA 3GLHA 3AV0A 3W0LB 4AG5A 4B7HA 4QOSA 3UJNA 4G4OA 1V34A 1SXJD 3LQRA 3QYEA 3FTFA 3E4RA 3U60A 5ITRA 1GVNA 4XBOA 2HCBA 1XMOM 1GABA 4Q7JA 4PCZA 4OU7A 2K6BA 4QHSA 4I8OA 4JV5M 2BWEA 3PNVA 4DR6M 2DWNA 4K0KM 1OAIA 3HGIA 2KZUA 1OKSA 4IBDA 1YSYA 3FUWA 2JUJA 2QCUA 1QZEA 1Z5CA 2CHGA
chains in the Genus database with same CATH topology
4M9XA 4FCTA 3TWMA 4MGYE 3SAUA 3GRRA 4PDGA 4GC9A 3TWKA 3HWSA 1DGHA 4HLQA 1H6UA 3D8LA 2Z4SA 3FKEA 4WURA 1N32M 1N34M 2LXEA 1JQJC 2KZSA 3A45A 4GH9A 3FUXA 5DYGA 4KODA 1WXQA 3KSXA 3DFZA 2BJWA 2RGOA 2ZANA 5LMUM 5LMNM 1PM5A 1W5TA 1Z59A 4MGZE 1HNZM 4LRTA 1FJGM 1R2YA 3A46A 2L7HA 3SMPA 1G4AE 3SATA 4IBFA 2LNHC 2H1RA 2CEAA 4GHLA 3HHYA 5BPVA 3PFIA 5ITXE 2XF3A 3K92A 3DZDA 3RGSA 4FW9A 1IN8A 3KXEC 2UUCM 1DO0A 3HHWA 2XEPA 4LJAA 3D8BA 1HT2E 4X65M 4EIWA 1Q39A 2KXEA 2QPAA 4LJ5A 2F5QA 1XNQM 3SC3A 2FE8A 4AKHA 2FOIC 4GRIA 3U6MA 1JR3D 4LJ6A 3AL0C 3KP0E 4FWHA 4M9SA 1HNWM 4HL4A 2Y21A 3M0EA 4FWDA 3JR5A 3VKHA 2UU9M 4IBGA 1NVMA 2FNAA 3RGPA 1HNXM 4JI0M 2K47A 2VIIA 1IN4A 3C58A 5EP4A 5BR8M 4NSRA 3HHXA 2YQZA 3UZUA 4BB9A 4OVZA 4LF8M 5JI3E 2EA0A 2QBYA 5A2QS 4AZFA 4X62M 4RNAA 1E32A 2OPFA 2DWLA 2F5NA 4NL4H 4FD2A 4LF9M 4S12A 2L6OA 1IN7A 3GPYA 3SARA 3B9PA 4IBJA 4LJ7A 4KO8A 4ZPXA 3T38A 2J7NA 4LFBM 2XH9A 1E9RA 2XLJA 3KOWE 1JR3A 1DGFA 2FFJA 3RE8A 3GP1A 1L2DA 3ZH9B 4PD2A 3GO8A 1N77A 3K2LA 1SXJA 4II7A 3HU3A 2DZOB 1K3XA 1NHGC 1S3SA 3L27A 2Z7JA 2DXIA 3GQ4A 2M60A 2R4EA 4L8RC 1QZMA 4NRWA 4D82A 3FTDA 4GMQA 3I4VA 4JXJA 1TH3A 2XGNA 2XSZA 2CUZA 3VK7A 2UXCM 4RF1A 5FTKA 2P5TA 4B08A 2R4JA 3T15A 4DV0M 4DV3M 2ZAOA 3LQQA 4MB7A 1IY1A 3U6CA 5DNYA 3MHVC 4MM3B 3U6SA 2UUAM 3FTEA 3FUUA 4QOZC 4AQYM 4L15A 4NSOB 4DV4M 3K8ZA 4DV2M 2QBYB 1GLNA 4PDIA 2X8AA 1UM8A 3R8FA 3WHKA 4L78A 1OJLA 3M6AA 3BOSA 4IBKA 3K1JA 4DR1M 2LH0A 1NSFA 1IBMM 4I81A 1C1KA 4CGYB 3U6EA 5FTMA 3IG5A 4ITQA 5EP2A 2KRKA 1QVRA 2D7EA 2HL7A 1L8QA 1MU5A 1NNUC 4DV5M 3NBIA 3SYKA 2LWXA 3DA1A 4JN6A 3GLIA 3FYCA 3GLIB 4DR4M 1Q3BA 2CFOA 1J09A 1IM2A 4QHTA 1IN5A 5ITUA 1R6BX 1R7RA 2ZBKB 2CV2A 3PXGA 4REZA 4GKKM 5IZ7D 4DR2M 2F4VM 4LF4M 2DWZB 4LZJA 4LFAM 3GLHB 3J7BA 3HKPA 4LJ9A 2D7HA 2RKOA 4BBAA 4Z6YA 3KVWA 4X66M 4LG2A 3KS8A 3I4YA 1IQPA 2KEBA 5C18A 3UMMA 2QZ4A 3RFWA 3SAVA 1K82A 1E94E 2KA6B 2KRUA 2V6ZM 2YFQA 3OTOM 3ILKA 3AKZA 3Q8XA 2HHHM 2HKJA 4LJ8A 3GLGB 2VQEM 3SHFA 3U61A 1I4WA 2KW0A 4LCBA 4G4NA 2DWMA 2UXBM 4AG6A 3A98B 2Z4RA 4Z8XA 4LJ4A 3VLFB 3UGJA 4GITA 5F3WA 2AHMA 8CATA 2UXDM 3U6OA 3CF6E 4MGHA 1N33M 2Z3XA 4OW0A 2CV1A 3HU1A 4GIPA 3LVVA 4LZZA 2G5GX 1DGBA 2ERCA 3QAUA 3TWLA 4NXNM 3KSJA 4GC5A 3FD9A 1QAMA 5EXPA 1TH2A 3EIEA 2C99A 3GRUA 4AKGA 2YR0A 3CF0A 4FCWA 4LF6M 4D81A 3KS4A 3THGA 1N36M 2C5RA 1KYIA 3TL4X 1N78A 3L28A 4D80A 1NY6A 1SXJE 1HQCA 2JA2A 5KPTA 1DO2A 1L2CA 4KLNA 4LF7M 3KFUG 2BNKA 1TDHA 3FUVA 1IN6A 3VFDA 2W82A 3WHLA 3IG8A 4NXMM 1XXHA 4JI6M 3PVSA 5KPZA 4JI5M 4W5WA 1GL7A 4IBEA 3SMSA 5H37D 1XWIA 2A5YB 4LGYA 4JI3M 3CTWB 3SASA 1VDDA 4PT5A 3JR4A 3HJSA 5FLXS 3U5ZA 1YUBA 3J2PB 4NOOB 1Z5CA 4NRVA 3SYLA 4RF0A 3T1YM 2XZFA 4GHAA 4FVMA 3GQ5A 1J5EM 1K3WA 4CHTB 2BJVA 3SHGB 1IBKM 2OQ4A 1IXRC 4AW4A 2CHQA 1Z5BA 3CF2A 2DHRA 1TDZA 2CHGA 3U61B 2C98A 1G59A 3GPUA 4DV7M 2QP9X 4FWGA 3GLGA 3W0FA 1XMQM 2E5LM 3HJQA 4DUZM 4R7GA 1I94M 4KHPM 4GKJM 1HT1E 3U6LA 2XSZD 3UK6A 1E9SA 3L2AA 1ORYB 4MGIE 5EXXA 4DUYM 3A42A 1ZQ9A 4DR7M 2Y20A 2EUCA 1Z6TA 5E6JA 5IT9S 1L2BA 3KP1E 4IJFA 3PNYA 4M0DA 2L7IA 3VKGA 2XFSA 1OFIA 1FNNA 2F5PA 2C96A 4JI2M 3U6QA 2C9CA 4B3MM 1ZAEA 3FTCA 4FCVA 1NNJA 4DR5M 2DZNB 3FYDA 5JI2E 1GKIA 5FTLA 3AOEA 3GPPA 1HR0M 4JI7M 4G6ZA 4JI4M 3L25A 5FSWA 4LY6A 3J7AS 1LV7A 5KO3A 3KOXE 2C9OA 2R65A 3QWLA 1IY2A 3I51A 3E9SA 3L29A 1IXSB 1NHWC 3KW6A 4JI1M 3HJ8A 1OFHA 3AFHA 1QQWA 2O5RA 3GPXA 3AOEC 2CE7A 1SXJB 1TH4A 1L1ZA 4A3VB 2R46A 1D2NA 1TGUA 1XXHB 1QAOA 3DOAA 4L16A 4B3RM 3SBJA 4QNRA 5C1BA 4QNMA 3J81S 1KSFX 1HQYE 2X49A 2G8LA 4TUWA 2X4AA 2YNMD 3J27B 1MX0A 1NJFA 2M5ZA 1KFVA 1G3IA 5ITXA 1EE8A 3VDUA 3R9XB 4JYAM 2QENA 5ITQA 4CISA 2R18A 2V1CA 3U5ZB 5FTJA 1T3TA 4B3SM 3U60B 1J7KA 1G8PA 3AOGA 3TE6A 3TPZA 1W5SA 5DYIA 2R45A 4B7FA 4AI6A 1Q3CA 1XHBA 4M0WA 5EP1A 4I5SA 1QYRA 3MK6A 1Z5AA 3GRVA 4AKIA 1NJGA 3VK8A 4LFCM 1XC8A 2D7GA 4YY3M 2CHVA 3H4MA 2DVWB 5EQTA 5KPRA 1SXJC 3KOYE 3GQ3A 3U6DA 1PJJA 1IBLM 2Q2EB 4IBBA 3MJ5A 1R2ZA 1X37A 1NY5A 3LMMA 4WW0A 3GLFB 3GLFA 3SAWA 4IJEA 2R62A 5EP3A 1IY0A 2NQ8C 4DV1M 2RGHA 1IXZA 4DV6M 2I7PA 1PJIA 3KOZE 3J80S 7CATA 2Y0QA 3HHZA 4B7GA 5ITTA 3VDPA 2ZM6M 3SFZA 2V1UA 4MGKE 4IIWA 4G4RA 4DR3M 3NWLA 4XGIA 4I4LA 3LVWA 2ZAMA 2UUBM 5EJCA 4B3TM 4IBCA 1G41A 5IREB 2J7OA 2I7NA 5GKNA 4JI8M 3M7GA 1N75A 5ITYA 5FTNA 4P16A 2XFTA 3TQSA 4R3DA 3ZCBB 5KQ8A 2F5SA 5IWAM 3L26A 1DGGA 3HU2A 4LGMA 1L1TA 2XZUA 4OX9M 3FUTA 4BLCA 1QANA 4M9ZA 4G4QA 4L4UA 4MH0E 2L09A 2VQFM 2CV0A 3AJIB 3T1HM 5KQDA 2Y0TA 4IBIA 5E26A 3ZC7B 3JAMS 4OVZB 3U6PA 3EIHA 4X64M 4LRSA 4LF5M 2F5OA 5EXSA 4YHHM 1XNRM 1YE9A 1GL6A 2EO2A 1DGHB 1QAQA 5EXTA 4AG5A 3GLHA 3AV0A 3W0LB 4B7HA 4QOSA 3UJNA 4G4OA 1SXJD 3LQRA 3FTFA 3E4RA 3U60A 5ITRA 1GVNA 4XBOA 2HCBA 1XMOM 4PCZA 4OU7A 4QHSA 4I8OA 4JV5M 3PNVA 4DR6M 2DWNA 4K0KM 3HGIA 2KZUA 4IBDA 1YSYA 3FUWA 2QCUA 3KDSE 3GRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MX0 A;  3GQ4 A;  4LF6 M;  3SAU A;  3TWM A;  4NRW A;  1KFV A;  5ITX A;  1EE8 A;  4PDG A;  4JYA M;  1N36 M;  5ITQ A;  3TWK A;  4CIS A;  4B3S M;  1N32 M;  1N34 M;  3VK7 A;  2UXC M;  1L2C A;  4LF7 M;  4DV0 M;  4DV3 M;  3A45 A;  1TDH A;  4MB7 A;  3U6C A;  1Q3C A;  4NXM M;  2UUA M;  3U6S A;  4JI6 M;  4JI5 M;  5LMU M;  5LMN M;  1PM5 A;  1Z5A A;  4AQY M;  1Z59 A;  4DV4 M;  1HNZ M;  1FJG M;  4DV2 M;  3VK8 A;  1R2Y A;  4PDI A;  1XC8 A;  4YY3 M;  4LFC M;  4JI3 M;  3A46 A;  3GQ3 A;  3U6D A;  3SAS A;  3JR4 A;  1PJJ A;  3SAT A;  1IBL M;  5FLX S;  2Q2E B;  4DR1 M;  1R2Z A;  4NRV A;  1IBM M;  3SAW A;  5ITX E;  3T1Y M;  2XZF A;  3U6E A;  3GQ5 A;  1J5E M;  1K3W A;  4ITQ A;  4DV1 M;  1IBK M;  2UUC M;  4DV6 M;  2OQ4 A;  1MU5 A;  1PJI A;  3J80 S;  4DV5 M;  1Z5B A;  5ITT A;  2ZM6 M;  4G4R A;  1TDZ A;  1Q3B A;  4DR3 M;  4DR4 M;  3GPU A;  4DV7 M;  4X65 M;  3W0F A;  5ITU A;  1XMQ M;  2ZBK B;  2UUB M;  4B3T M;  1Q39 A;  2E5L M;  4DUZ M;  2F5Q A;  1XNQ M;  1I94 M;  4JI8 M;  4GKK M;  4KHP M;  3U6L A;  4GKJ M;  4DR2 M;  5ITY A;  3U6M A;  4LF4 M;  2F4V M;  1HNW M;  4DUY M;  4LFA M;  3A42 A;  3JR5 A;  4DR7 M;  4X66 M;  2F5S A;  2UU9 M;  5IWA M;  5IT9 S;  1L2B A;  1L1T A;  2XZU A;  4OX9 M;  1HNX M;  4JI0 M;  3SAV A;  4G4Q A;  1K82 A;  2F5P A;  4JI2 M;  2VQF M;  3C58 A;  3OTO M;  3U6Q A;  3T1H M;  5BR8 M;  4B3M M;  2HHH M;  2HKJ A;  2VQE M;  3JAM S;  3U6P A;  1NNJ A;  4DR5 M;  4X64 M;  4LF5 M;  4LF8 M;  2F5O A;  3GPP A;  4YHH M;  2EA0 A;  4G4N A;  1HR0 M;  4JI7 M;  1XNR M;  5A2Q S;  2UXB M;  4X62 M;  2OPF A;  4JI4 M;  3J7A S;  2F5N A;  4LF9 M;  3GPY A;  3SAR A;  4G4O A;  2UXD M;  3U6O A;  1N33 M;  4LFB M;  5ITR A;  4JI1 M;  1XMO M;  4PCZ A;  3GP1 A;  3GPX A;  1L2D A;  4PD2 A;  4JV5 M;  1L1Z A;  3GO8 A;  4DR6 M;  4K0K M;  3DOA A;  1K3X A;  4B3R M;  3TWL A;  4NXN M;  3SBJ A;  3J81 S;  1Z5C A; 
#chains in the Genus database with same CATH topology
 4M9X A;  4FCT A;  3TWM A;  4MGY E;  3SAU A;  3GRR A;  4PDG A;  4GC9 A;  2GQF A;  3TWK A;  3HWS A;  1DGH A;  4HLQ A;  1H6U A;  1NO1 A;  3D8L A;  1C7Y A;  2Z4S A;  1GJT A;  3FKE A;  4WUR A;  4CJ6 A;  1N32 M;  1N34 M;  2JWS A;  2LXE A;  1JQJ C;  3BBZ A;  3FRI A;  1XXH E;  2KZS A;  1VEJ A;  3A45 A;  4GH9 A;  3FE3 A;  4CIZ A;  3FUX A;  5DYG A;  4KOD A;  1WXQ A;  3KSX A;  3DFZ A;  2BJW A;  2RGO A;  2ZAN A;  5LMU M;  5LMN M;  3GRY A;  1PM5 A;  1W5T A;  2JZ1 A;  1Z59 A;  4MGZ E;  3LW5 F;  1HNZ M;  4LRT A;  1FJG M;  4LF9 M;  3FRH A;  1R2Y A;  1G71 A;  3A46 A;  3GLI E;  2L7H A;  3SMP A;  1ZMU A;  1G4A E;  3SAT A;  4IBF A;  1T6O A;  2LNH C;  2H1R A;  2CEA A;  4GHL A;  3HHY A;  5BPV A;  2DAI A;  2LHC A;  3PFI A;  5ITX E;  2XF3 A;  3K92 A;  4AKH A;  3DZD A;  3RGS A;  4FW9 A;  1IN8 A;  3KXE C;  2UUC M;  2K9D A;  1DO0 A;  1MJG M;  2OOA A;  3HHW A;  1YLA A;  2XEP A;  3IHP A;  4LJA A;  3D8B A;  1HT2 E;  1OIP A;  4X65 M;  4EIW A;  1V33 A;  1Q39 A;  2KXE A;  2QPA A;  4LJ5 A;  4XK8 F;  2F5Q A;  3GLF E;  1XNQ M;  2VDB B;  2FE8 A;  3SC3 A;  2FOI C;  2JY6 B;  4GRI A;  1JR3 D;  4LJ6 A;  3U6M A;  3KP0 E;  3AL0 C;  4FWH A;  4M9S A;  1HNW M;  4HL4 A;  3KDS E;  2Y21 A;  3M0E A;  4FWD A;  3JR5 A;  1P3Q Q;  2BWB A;  3VKH A;  2UU9 M;  4IBG A;  1NVM A;  2FNA A;  3NBX X;  3RGP A;  3T6P A;  1HNX M;  4JI0 M;  2LVO C;  2Z8Y M;  5L8R F;  2K47 A;  2VII A;  1IN4 A;  4DBG B;  3C58 A;  2EKF A;  5EP4 A;  5BR8 M;  2APL A;  4NSR A;  3HHX A;  2YQZ A;  1JB0 F;  3UZU A;  4BB9 A;  4OVZ A;  2QQ8 A;  1HJP A;  4LF8 M;  5JI3 E;  2EA0 A;  2QBY A;  3QYB A;  5A2Q S;  4AZF A;  4X62 M;  4RNA A;  1E32 A;  2OPF A;  1WGL A;  2DWL A;  2F5N A;  4NL4 H;  4FD2 A;  2WSE F;  4S12 A;  2L6O A;  1IN7 A;  3GPY A;  3SAR A;  3B9P A;  3E46 A;  4IBJ A;  1PJS A;  4LJ7 A;  4G3O A;  4KO8 A;  4ZPX A;  3T38 A;  2J7N A;  4LFB M;  2XH9 A;  1E9R A;  2XLJ A;  3KOW E;  1JR3 A;  1DGF A;  2FFJ A;  3RE8 A;  3GP1 A;  1L2D A;  3ZH9 B;  4PD2 A;  4NC6 A;  3GO8 A;  1N77 A;  3K2L A;  1SXJ A;  4II7 A;  3HU3 A;  2DZO B;  1K3X A;  2FS1 A;  3H4J A;  1NHG C;  1S3S A;  3C3D A;  3L27 A;  2Z7J A;  2DXI A;  3GLH E;  3GQ4 A;  2M60 A;  2R4E A;  4L8R C;  1QZM A;  4NRW A;  1T43 A;  4D82 A;  3FTD A;  4GMQ A;  1WR1 B;  2RRU A;  3I4V A;  3LCU A;  3F92 A;  1PJQ A;  4JXJ A;  1TH3 A;  2XGN A;  2XSZ A;  2CUZ A;  3VK7 A;  3E21 A;  2UXC M;  4RF1 A;  5FTK A;  2P5T A;  4B08 A;  2R4J A;  3T15 A;  3V76 A;  4DV0 M;  4DV3 M;  2ZAO A;  2B3T A;  3LQQ A;  1PRB A;  4MB7 A;  1IY1 A;  3U6C A;  5DNY A;  2DHY A;  3MHV C;  4MM3 B;  3U6S A;  2UUA M;  3FTE A;  3FUU A;  4QOZ C;  4AQY M;  4L15 A;  4NSO B;  2G3Q A;  4DV4 M;  1A5T A;  2EJS A;  2KDL A;  3K8Z A;  4DV2 M;  2QBY B;  1GLN A;  4PDI A;  2X8A A;  1UM8 A;  2FH0 A;  3R8F A;  1F4I A;  3GLG E;  3WHK A;  4L78 A;  1OJL A;  3M6A A;  3BOS A;  4IBK A;  3K1J A;  4DR1 M;  3B7N A;  2LH0 A;  1NSF A;  3CGW A;  1IBM M;  4I81 A;  1C1K A;  4CGY B;  2DAE A;  3U6E A;  5FTM A;  3IG5 A;  4ITQ A;  5EP2 A;  2KRK A;  1QVR A;  2D7E A;  1NV9 A;  2HL7 A;  1L8Q A;  1NNU C;  1MU5 A;  4DV5 M;  2JNH A;  3NBI A;  2OOB A;  3SYK A;  3ZQJ A;  2LWX A;  1QDR A;  2MR9 A;  3DA1 A;  4JN6 A;  3GLI A;  3FYC A;  3GLI B;  4DR4 M;  1Q3B A;  2CFO A;  2QHO B;  1J09 A;  1IM2 A;  4QHT A;  1IN5 A;  1OQY A;  2JXN A;  5ITU A;  1R6B X;  1R7R A;  2ZBK B;  2CV2 A;  2VF7 A;  3PXG A;  4REZ A;  4GKK M;  5IZ7 D;  4DR2 M;  2F4V M;  4LF4 M;  1EFU B;  1TTE A;  2DWZ B;  4LZJ A;  1Y8G A;  4LFA M;  3GLH B;  3J7B A;  3HKP A;  4LJ9 A;  2D7H A;  2RKO A;  4BBA A;  4Z6Y A;  3KVW A;  4X66 M;  4LG2 A;  2DKL A;  3KS8 A;  3I4Y A;  1IQP A;  2KEB A;  1NV8 A;  5C18 A;  3UMM A;  2QZ4 A;  3RFW A;  3SAV A;  1K82 A;  1E94 E;  1LTM A;  5DFL A;  2KA6 B;  2KRU A;  2V6Z M;  2YFQ A;  2CRU A;  3OTO M;  1VEG A;  1AUA A;  3ILK A;  3AKZ A;  3Q8X A;  2HHH M;  2HKJ A;  4LJ8 A;  3GLG B;  2DAG A;  3SHF A;  2VQE M;  3U61 A;  1I4W A;  2KW0 A;  4LCB A;  2HAK A;  4G4N A;  2DWM A;  1PGY A;  2UXB M;  2L2D A;  4AG6 A;  3A98 B;  2Z4R A;  4Z8X A;  4LJ4 A;  3VLF B;  3UGJ A;  4UN2 B;  4GIT A;  5F3W A;  2AHM A;  8CAT A;  2UXD M;  3U6O A;  2GNO A;  3CF6 E;  4MGH A;  1N33 M;  2Z3X A;  4OW0 A;  3K9P A;  2CV1 A;  2R44 A;  1D0M A;  3HU1 A;  4GIP A;  3LVV A;  4LZZ A;  2G5G X;  1DGB A;  2ERC A;  3QAU A;  3B7Z A;  3TWL A;  4NXN M;  3KSJ A;  4GC5 A;  3FD9 A;  1QAM A;  5EXP A;  1TH2 A;  3EIE A;  2C99 A;  3GRU A;  4AKG A;  2YR0 A;  3CF0 A;  4FCW A;  4LF6 M;  3IEC A;  3B74 A;  4D81 A;  3KS4 A;  3THG A;  1N36 M;  2KHH A;  2C5R A;  1KYI A;  3TL4 X;  1N78 A;  3L28 A;  1QUS A;  4D80 A;  1NY6 A;  1BVS A;  1SXJ E;  1HQC A;  2JA2 A;  5KPT A;  1DO2 A;  1L2C A;  4KLN A;  4LF7 M;  3KFU G;  2BNK A;  2LVQ D;  1TDH A;  3FUV A;  1IN6 A;  4R71 A;  2ZTC A;  3VFD A;  2W82 A;  3WHL A;  3IG8 A;  1TF0 B;  4NXM M;  1XXH A;  4JI6 M;  3PVS A;  5KPZ A;  4JI5 M;  4GEW A;  2QSF X;  4W5W A;  1QUT A;  1GL7 A;  3Q8G A;  4IBE A;  3SMS A;  4HEO A;  5H37 D;  1XWI A;  2A5Y B;  4LGY A;  4JI3 M;  4F1I A;  3CTW B;  3HZJ A;  3SAS A;  1VDD A;  4PT5 A;  3JR4 A;  3HJS A;  2MH8 A;  5FLX S;  3U5Z A;  2LVP C;  1YUB A;  3J2P B;  4NOO B;  4NRV A;  3SYL A;  4RF0 A;  3T1Y M;  2XZF A;  4GHA A;  4FVM A;  3GQ5 A;  1J5E M;  1K3W A;  4CHT B;  2BJV A;  3C9P A;  3SHG B;  2L4E A;  1IBK M;  2OQ4 A;  1IXR C;  1CUK A;  4AW4 A;  2CHQ A;  1Z5B A;  3CF2 A;  2DHR A;  3HY5 A;  2DI0 A;  3W67 A;  1TDZ A;  3U61 B;  2C98 A;  1G59 A;  3GPU A;  4DV7 M;  2QP9 X;  4FWG A;  3GLG A;  3W0F A;  1SG9 A;  1VEK A;  1XMQ M;  2O01 F;  2E5L M;  3HJQ A;  4DUZ M;  4R7G A;  1WJ7 A;  1I94 M;  4KHP M;  4GKJ M;  1HT1 E;  1Q02 A;  1V92 A;  3U6L A;  2XSZ D;  3UK6 A;  1E9S A;  3HX3 A;  3L2A A;  1ORY B;  4MGI E;  5EXX A;  4DUY M;  2DNA A;  3A42 A;  1ZQ9 A;  4DR7 M;  2H5X A;  2EUC A;  2WSF F;  2Y20 A;  1OAO C;  1Z6T A;  5E6J A;  5IT9 S;  1VG5 A;  1L2B A;  3KP1 E;  4IJF A;  3PNY A;  4M0D A;  1ZMV A;  2L7I A;  3VKG A;  1TR8 A;  2XFS A;  1OFI A;  1FNN A;  1XB2 B;  2F5P A;  2C96 A;  4JI2 M;  1ZMW A;  4ANR A;  1MN3 A;  2O25 A;  3U6Q A;  1D0L A;  2C9C A;  4B3M M;  1ZAE A;  2EKK A;  3FTC A;  4FCV A;  1NNJ A;  4DR5 M;  2DZN B;  3FYD A;  5JI2 E;  1GKI A;  5FTL A;  3AOE A;  3GPP A;  1HR0 M;  4JI7 M;  2R0I A;  4G6Z A;  3B7Q A;  4JI4 M;  3L25 A;  5FSW A;  4LY6 A;  3J7A S;  1LV7 A;  2LHG A;  5KO3 A;  4F2L A;  1JR3 E;  3KOX E;  4WP2 A;  2C9O A;  2R65 A;  3K9O A;  3QWL A;  1IY2 A;  1PJT A;  3I51 A;  3E9S A;  1WHC A;  1IXS B;  2VF8 A;  1NHW C;  3L29 A;  3I04 M;  1IXS A;  3KW6 A;  4JI1 M;  2CP8 A;  1OFH A;  3AFH A;  1QQW A;  3HJ8 A;  2O5R A;  3GPX A;  2DAK A;  3BXW A;  3AOE C;  2CE7 A;  1SXJ B;  1TH4 A;  1L1Z A;  4A3V B;  2R46 A;  1D2N A;  1TGU A;  1XXH B;  1QAO A;  2QNJ A;  3DOA A;  4L16 A;  4B3R M;  3SBJ A;  1VQ1 A;  1ZV1 A;  4QNR A;  5C1B A;  4QNM A;  3J81 S;  1KSF X;  1HQY E;  2X49 A;  2G8L A;  4TUW A;  2X4A A;  1EIJ A;  2YNM D;  3J27 B;  1MX0 A;  1NJF A;  2M5Z A;  1KFV A;  1G3I A;  5ITX A;  1EE8 A;  2MRO B;  3VDU A;  3R9X B;  4JYA M;  2QEN A;  5ITQ A;  2KNV A;  1AIP C;  1OIZ A;  4CIS A;  4KT0 F;  2R18 A;  2V1C A;  3U5Z B;  5FTJ A;  2HWJ A;  1T3T A;  4B3S M;  2MGW A;  3U60 B;  1IFY A;  2JY7 A;  1J7K A;  1G8P A;  3AOG A;  3TE6 A;  3TPZ A;  1W5S A;  1GO5 A;  3C3E A;  5DYI A;  2R45 A;  1DV0 A;  4B7F A;  4AI6 A;  1Q3C A;  1D0K A;  1XHB A;  2MJ5 B;  4M0W A;  2JZ0 A;  4I5S A;  5EP1 A;  1QYR A;  3MK6 A;  4RKU F;  1Z5A A;  2R6F A;  3GRV A;  1GJS A;  4AKI A;  1NJG A;  3VK8 A;  4LFC M;  1XC8 A;  2D7G A;  2LTU A;  4YY3 M;  2CHV A;  3H4M A;  2DVW B;  1QDT A;  5EQT A;  1SXJ C;  2ZTD A;  5KPR A;  3KOY E;  3GQ3 A;  3U6D A;  2K0B X;  3MMP A;  1PJJ A;  1IBL M;  2Q2E B;  4IBB A;  3MJ5 A;  1R2Z A;  1X37 A;  2OO9 A;  1RU3 A;  1NY5 A;  3LMM A;  4WW0 A;  3GLF B;  3GLF A;  3SAW A;  4IJE A;  2R62 A;  5EP3 A;  1IY0 A;  2JP7 A;  1WGN A;  2NQ8 C;  4DV1 M;  2RGH A;  2KNZ A;  1IXZ A;  1UFZ A;  4DV6 M;  2LBC A;  2I7P A;  1PJI A;  3KOZ E;  3J80 S;  7CAT A;  2Y0Q A;  3HHZ A;  4B7G A;  5ITT A;  3VDP A;  2ZM6 M;  3SFZ A;  2V1U A;  2JY5 A;  4MGK E;  4IIW A;  4P17 A;  4G4R A;  4DR3 M;  1R4G A;  2WSC F;  3NWL A;  4XGI A;  4I4L A;  3LVW A;  2DZL A;  2ZAM A;  2UUB M;  5EJC A;  4B3T M;  4IBC A;  1G41 A;  5IRE B;  2J7O A;  2I7N A;  4L6V 6;  5GKN A;  2N35 A;  1R5L A;  3M7G A;  4JI8 M;  2CWB A;  1N75 A;  5ITY A;  4Y28 F;  5FTN A;  4P16 A;  2XFT A;  3TQS A;  4R3D A;  3ZCB B;  5KQ8 A;  3I01 M;  2F5S A;  3B89 A;  5IWA M;  3L26 A;  1DGG A;  2J5Y A;  1VDL A;  3HU2 A;  4LGM A;  1L1T A;  2XZU A;  4OX9 M;  2LVA A;  3FUT A;  2KNA A;  4BLC A;  1QAN A;  2DAM A;  4M9Z A;  4G4Q A;  4L4U A;  4MH0 E;  2L09 A;  2VQF M;  1WIV A;  2CV0 A;  3AJI B;  3T1H M;  5KQD A;  1OTR A;  2Y0T A;  4IBI A;  5E26 A;  2JY8 A;  3ZC7 B;  3LCV B;  3W68 A;  3JAM S;  4OVZ B;  3U6P A;  3EIH A;  4X64 M;  4LRS A;  4LF5 M;  2F5O A;  2WZJ A;  5EXS A;  4YHH M;  1XNR M;  1YE9 A;  2LVN C;  1GL6 A;  2EO2 A;  1DGH B;  2L4F A;  1QAQ A;  2DEN A;  5EXT A;  3GLH A;  3AV0 A;  3W0L B;  4AG5 A;  4B7H A;  4QOS A;  3UJN A;  4G4O A;  1V34 A;  1SXJ D;  3LQR A;  3QYE A;  3FTF A;  3E4R A;  3U60 A;  5ITR A;  1GVN A;  4XBO A;  2HCB A;  1XMO M;  1GAB A;  4Q7J A;  4PCZ A;  4OU7 A;  2K6B A;  4QHS A;  4I8O A;  4JV5 M;  2BWE A;  3PNV A;  4DR6 M;  2DWN A;  4K0K M;  1OAI A;  3HGI A;  2KZU A;  1OKS A;  4IBD A;  1YSY A;  3FUW A;  2JUJ A;  2QCU A;  1QZE A;  1Z5C A;  2CHG A; 
#chains in the Genus database with same CATH homology
 4M9X A;  4FCT A;  3TWM A;  4MGY E;  3SAU A;  3GRR A;  4PDG A;  4GC9 A;  3TWK A;  3HWS A;  1DGH A;  4HLQ A;  1H6U A;  3D8L A;  2Z4S A;  3FKE A;  4WUR A;  1N32 M;  1N34 M;  2LXE A;  1JQJ C;  2KZS A;  3A45 A;  4GH9 A;  3FUX A;  5DYG A;  4KOD A;  1WXQ A;  3KSX A;  3DFZ A;  2BJW A;  2RGO A;  2ZAN A;  5LMU M;  5LMN M;  1PM5 A;  1W5T A;  1Z59 A;  4MGZ E;  1HNZ M;  4LRT A;  1FJG M;  1R2Y A;  3A46 A;  2L7H A;  3SMP A;  1G4A E;  3SAT A;  4IBF A;  2LNH C;  2H1R A;  2CEA A;  4GHL A;  3HHY A;  5BPV A;  3PFI A;  5ITX E;  2XF3 A;  3K92 A;  3DZD A;  3RGS A;  4FW9 A;  1IN8 A;  3KXE C;  2UUC M;  1DO0 A;  3HHW A;  2XEP A;  4LJA A;  3D8B A;  1HT2 E;  4X65 M;  4EIW A;  1Q39 A;  2KXE A;  2QPA A;  4LJ5 A;  2F5Q A;  1XNQ M;  3SC3 A;  2FE8 A;  4AKH A;  2FOI C;  4GRI A;  3U6M A;  1JR3 D;  4LJ6 A;  3AL0 C;  3KP0 E;  4FWH A;  4M9S A;  1HNW M;  4HL4 A;  2Y21 A;  3M0E A;  4FWD A;  3JR5 A;  3VKH A;  2UU9 M;  4IBG A;  1NVM A;  2FNA A;  3RGP A;  1HNX M;  4JI0 M;  2K47 A;  2VII A;  1IN4 A;  3C58 A;  5EP4 A;  5BR8 M;  4NSR A;  3HHX A;  2YQZ A;  3UZU A;  4BB9 A;  4OVZ A;  4LF8 M;  5JI3 E;  2EA0 A;  2QBY A;  5A2Q S;  4AZF A;  4X62 M;  4RNA A;  1E32 A;  2OPF A;  2DWL A;  2F5N A;  4NL4 H;  4FD2 A;  4LF9 M;  4S12 A;  2L6O A;  1IN7 A;  3GPY A;  3SAR A;  3B9P A;  4IBJ A;  4LJ7 A;  4KO8 A;  4ZPX A;  3T38 A;  2J7N A;  4LFB M;  2XH9 A;  1E9R A;  2XLJ A;  3KOW E;  1JR3 A;  1DGF A;  2FFJ A;  3RE8 A;  3GP1 A;  1L2D A;  3ZH9 B;  4PD2 A;  3GO8 A;  1N77 A;  3K2L A;  1SXJ A;  4II7 A;  3HU3 A;  2DZO B;  1K3X A;  1NHG C;  1S3S A;  3L27 A;  2Z7J A;  2DXI A;  3GQ4 A;  2M60 A;  2R4E A;  4L8R C;  1QZM A;  4NRW A;  4D82 A;  3FTD A;  4GMQ A;  3I4V A;  4JXJ A;  1TH3 A;  2XGN A;  2XSZ A;  2CUZ A;  3VK7 A;  2UXC M;  4RF1 A;  5FTK A;  2P5T A;  4B08 A;  2R4J A;  3T15 A;  4DV0 M;  4DV3 M;  2ZAO A;  3LQQ A;  4MB7 A;  1IY1 A;  3U6C A;  5DNY A;  3MHV C;  4MM3 B;  3U6S A;  2UUA M;  3FTE A;  3FUU A;  4QOZ C;  4AQY M;  4L15 A;  4NSO B;  4DV4 M;  3K8Z A;  4DV2 M;  2QBY B;  1GLN A;  4PDI A;  2X8A A;  1UM8 A;  3R8F A;  3WHK A;  4L78 A;  1OJL A;  3M6A A;  3BOS A;  4IBK A;  3K1J A;  4DR1 M;  2LH0 A;  1NSF A;  1IBM M;  4I81 A;  1C1K A;  4CGY B;  3U6E A;  5FTM A;  3IG5 A;  4ITQ A;  5EP2 A;  2KRK A;  1QVR A;  2D7E A;  2HL7 A;  1L8Q A;  1MU5 A;  1NNU C;  4DV5 M;  3NBI A;  3SYK A;  2LWX A;  3DA1 A;  4JN6 A;  3GLI A;  3FYC A;  3GLI B;  4DR4 M;  1Q3B A;  2CFO A;  1J09 A;  1IM2 A;  4QHT A;  1IN5 A;  5ITU A;  1R6B X;  1R7R A;  2ZBK B;  2CV2 A;  3PXG A;  4REZ A;  4GKK M;  5IZ7 D;  4DR2 M;  2F4V M;  4LF4 M;  2DWZ B;  4LZJ A;  4LFA M;  3GLH B;  3J7B A;  3HKP A;  4LJ9 A;  2D7H A;  2RKO A;  4BBA A;  4Z6Y A;  3KVW A;  4X66 M;  4LG2 A;  3KS8 A;  3I4Y A;  1IQP A;  2KEB A;  5C18 A;  3UMM A;  2QZ4 A;  3RFW A;  3SAV A;  1K82 A;  1E94 E;  2KA6 B;  2KRU A;  2V6Z M;  2YFQ A;  3OTO M;  3ILK A;  3AKZ A;  3Q8X A;  2HHH M;  2HKJ A;  4LJ8 A;  3GLG B;  2VQE M;  3SHF A;  3U61 A;  1I4W A;  2KW0 A;  4LCB A;  4G4N A;  2DWM A;  2UXB M;  4AG6 A;  3A98 B;  2Z4R A;  4Z8X A;  4LJ4 A;  3VLF B;  3UGJ A;  4GIT A;  5F3W A;  2AHM A;  8CAT A;  2UXD M;  3U6O A;  3CF6 E;  4MGH A;  1N33 M;  2Z3X A;  4OW0 A;  2CV1 A;  3HU1 A;  4GIP A;  3LVV A;  4LZZ A;  2G5G X;  1DGB A;  2ERC A;  3QAU A;  3TWL A;  4NXN M;  3KSJ A;  4GC5 A;  3FD9 A;  1QAM A;  5EXP A;  1TH2 A;  3EIE A;  2C99 A;  3GRU A;  4AKG A;  2YR0 A;  3CF0 A;  4FCW A;  4LF6 M;  4D81 A;  3KS4 A;  3THG A;  1N36 M;  2C5R A;  1KYI A;  3TL4 X;  1N78 A;  3L28 A;  4D80 A;  1NY6 A;  1SXJ E;  1HQC A;  2JA2 A;  5KPT A;  1DO2 A;  1L2C A;  4KLN A;  4LF7 M;  3KFU G;  2BNK A;  1TDH A;  3FUV A;  1IN6 A;  3VFD A;  2W82 A;  3WHL A;  3IG8 A;  4NXM M;  1XXH A;  4JI6 M;  3PVS A;  5KPZ A;  4JI5 M;  4W5W A;  1GL7 A;  4IBE A;  3SMS A;  5H37 D;  1XWI A;  2A5Y B;  4LGY A;  4JI3 M;  3CTW B;  3SAS A;  1VDD A;  4PT5 A;  3JR4 A;  3HJS A;  5FLX S;  3U5Z A;  1YUB A;  3J2P B;  4NOO B;  1Z5C A;  4NRV A;  3SYL A;  4RF0 A;  3T1Y M;  2XZF A;  4GHA A;  4FVM A;  3GQ5 A;  1J5E M;  1K3W A;  4CHT B;  2BJV A;  3SHG B;  1IBK M;  2OQ4 A;  1IXR C;  4AW4 A;  2CHQ A;  1Z5B A;  3CF2 A;  2DHR A;  1TDZ A;  2CHG A;  3U61 B;  2C98 A;  1G59 A;  3GPU A;  4DV7 M;  2QP9 X;  4FWG A;  3GLG A;  3W0F A;  1XMQ M;  2E5L M;  3HJQ A;  4DUZ M;  4R7G A;  1I94 M;  4KHP M;  4GKJ M;  1HT1 E;  3U6L A;  2XSZ D;  3UK6 A;  1E9S A;  3L2A A;  1ORY B;  4MGI E;  5EXX A;  4DUY M;  3A42 A;  1ZQ9 A;  4DR7 M;  2Y20 A;  2EUC A;  1Z6T A;  5E6J A;  5IT9 S;  1L2B A;  3KP1 E;  4IJF A;  3PNY A;  4M0D A;  2L7I A;  3VKG A;  2XFS A;  1OFI A;  1FNN A;  2F5P A;  2C96 A;  4JI2 M;  3U6Q A;  2C9C A;  4B3M M;  1ZAE A;  3FTC A;  4FCV A;  1NNJ A;  4DR5 M;  2DZN B;  3FYD A;  5JI2 E;  1GKI A;  5FTL A;  3AOE A;  3GPP A;  1HR0 M;  4JI7 M;  4G6Z A;  4JI4 M;  3L25 A;  5FSW A;  4LY6 A;  3J7A S;  1LV7 A;  5KO3 A;  3KOX E;  2C9O A;  2R65 A;  3QWL A;  1IY2 A;  3I51 A;  3E9S A;  3L29 A;  1IXS B;  1NHW C;  3KW6 A;  4JI1 M;  3HJ8 A;  1OFH A;  3AFH A;  1QQW A;  2O5R A;  3GPX A;  3AOE C;  2CE7 A;  1SXJ B;  1TH4 A;  1L1Z A;  4A3V B;  2R46 A;  1D2N A;  1TGU A;  1XXH B;  1QAO A;  3DOA A;  4L16 A;  4B3R M;  3SBJ A;  4QNR A;  5C1B A;  4QNM A;  3J81 S;  1KSF X;  1HQY E;  2X49 A;  2G8L A;  4TUW A;  2X4A A;  2YNM D;  3J27 B;  1MX0 A;  1NJF A;  2M5Z A;  1KFV A;  1G3I A;  5ITX A;  1EE8 A;  3VDU A;  3R9X B;  4JYA M;  2QEN A;  5ITQ A;  4CIS A;  2R18 A;  2V1C A;  3U5Z B;  5FTJ A;  1T3T A;  4B3S M;  3U60 B;  1J7K A;  1G8P A;  3AOG A;  3TE6 A;  3TPZ A;  1W5S A;  5DYI A;  2R45 A;  4B7F A;  4AI6 A;  1Q3C A;  1XHB A;  4M0W A;  5EP1 A;  4I5S A;  1QYR A;  3MK6 A;  1Z5A A;  3GRV A;  4AKI A;  1NJG A;  3VK8 A;  4LFC M;  1XC8 A;  2D7G A;  4YY3 M;  2CHV A;  3H4M A;  2DVW B;  5EQT A;  5KPR A;  1SXJ C;  3KOY E;  3GQ3 A;  3U6D A;  1PJJ A;  1IBL M;  2Q2E B;  4IBB A;  3MJ5 A;  1R2Z A;  1X37 A;  1NY5 A;  3LMM A;  4WW0 A;  3GLF B;  3GLF A;  3SAW A;  4IJE A;  2R62 A;  5EP3 A;  1IY0 A;  2NQ8 C;  4DV1 M;  2RGH A;  1IXZ A;  4DV6 M;  2I7P A;  1PJI A;  3KOZ E;  3J80 S;  7CAT A;  2Y0Q A;  3HHZ A;  4B7G A;  5ITT A;  3VDP A;  2ZM6 M;  3SFZ A;  2V1U A;  4MGK E;  4IIW A;  4G4R A;  4DR3 M;  3NWL A;  4XGI A;  4I4L A;  3LVW A;  2ZAM A;  2UUB M;  5EJC A;  4B3T M;  4IBC A;  1G41 A;  5IRE B;  2J7O A;  2I7N A;  5GKN A;  4JI8 M;  3M7G A;  1N75 A;  5ITY A;  5FTN A;  4P16 A;  2XFT A;  3TQS A;  4R3D A;  3ZCB B;  5KQ8 A;  2F5S A;  5IWA M;  3L26 A;  1DGG A;  3HU2 A;  4LGM A;  1L1T A;  2XZU A;  4OX9 M;  3FUT A;  4BLC A;  1QAN A;  4M9Z A;  4G4Q A;  4L4U A;  4MH0 E;  2L09 A;  2VQF M;  2CV0 A;  3AJI B;  3T1H M;  5KQD A;  2Y0T A;  4IBI A;  5E26 A;  3ZC7 B;  3JAM S;  4OVZ B;  3U6P A;  3EIH A;  4X64 M;  4LRS A;  4LF5 M;  2F5O A;  5EXS A;  4YHH M;  1XNR M;  1YE9 A;  1GL6 A;  2EO2 A;  1DGH B;  1QAQ A;  5EXT A;  4AG5 A;  3GLH A;  3AV0 A;  3W0L B;  4B7H A;  4QOS A;  3UJN A;  4G4O A;  1SXJ D;  3LQR A;  3FTF A;  3E4R A;  3U60 A;  5ITR A;  1GVN A;  4XBO A;  2HCB A;  1XMO M;  4PCZ A;  4OU7 A;  4QHS A;  4I8O A;  4JV5 M;  3PNV A;  4DR6 M;  2DWN A;  4K0K M;  3HGI A;  2KZU A;  4IBD A;  1YSY A;  3FUW A;  2QCU A;  3KDS E;  3GRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...