1FJGM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1fjgM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1fjgM02
4JV5M 1HNXM 3GPXA 3U6OA 4DV4M 4LFCM 1IBMM 4X64M 3JR5A 4AQYM 4OX9M 2VQEM 1PM5A 1KFVA 4LF8M 4JI4M 2UUBM 1L2CA 2HKJA 4PDIA 1N32M 3SBJA 2UU9M 1L1ZA 4DR4M 4DR6M 2F5QA 1L1TA 5A2QS 1TDZA 1IBKM 2UUCM 3SARA 1NNJA 3A45A 4PDGA 3U6CA 2F5OA 3GPUA 4DR7M 1L2DA 1HNWM 2ZBKB 3A42A 4LFAM 4JI7M 3T1HM 3TWLA 5IWAM 3SAVA 3J81S 3SAWA 1Q3BA 1HNZM 5ITQA 2UUAM 3JAMS 3VK8A 4X65M 4DV2M 3VK7A 1Z5BA 4B3MM 3U6LA 1Z59A 1K3XA 1R2ZA 4NRWA 4JYAM 4B3TM 4B3SM 3GQ3A 1XMQM 3OTOM 5FLXS 4JI2M 1EE8A 1XMOM 4JI3M 4JI5M 3DOAA 4DR2M 5ITYA 4JI8M 4DV5M 4DR3M 3C58A 1IBLM 4JI1M 2HHHM 4K0KM 4DR5M 4DV6M 1HR0M 3SAUA 4NXMM 4X66M 3J7AS 1PJJA 2UXCM 4G4NA 2F5NA 5ITRA 2OPFA 4DV7M 4CISA 1XNRM 4DV0M 5ITTA 1PJIA 4GKKM 3GO8A 3TWKA 1N33M 3U6DA 1FJGM 1J5EM 4LF6M 2XZUA 5IT9S 4JI6M 4G4QA 4MB7A 3J80S 3TWMA 3SATA 1N36M 5ITXA 4YHHM 3U6SA 1Q39A 4DV1M 3T1YM 5LMNM 3U6QA 1XC8A 2XZFA 5BR8M 2EA0A 2F5PA 3U6MA 5ITXE 1Q3CA 4G4OA 2UXDM 3A46A 2VQFM 2E5LM 1Z5AA 1I94M 1MU5A 4ITQA 4LFBM 4LF7M 1TDHA 4DR1M 2Q2EB 3GP1A 1MX0A 1XNQM 1L2BA 4LF5M 3SASA 3GPYA 3GQ4A 2ZM6M 2F4VM 3JR4A 5LMUM 1K3WA 4NXNM 5ITUA 4DUYM 4DUZM 4GKJM 1Z5CA 4JI0M 2OQ4A 4G4RA 4LF9M 4NRVA 2UXBM 4KHPM 3W0FA 4PD2A 4X62M 3GPPA 4PCZA 2F5SA 4YY3M 3U6EA 4B3RM 3GQ5A 4LF4M 1R2YA 3U6PA 4DV3M 1K82A 1N34M
chains in the Genus database with same CATH superfamily
2KNAA 1IQPA 3UK6A 3R9XB 4L15A 2LVOC 2L09A 3TQSA 4LFCM 2DHYA 4GH9A 4OVZB 4OX9M 4AQYM 3SYKA 3L26A 1VQ1A 1HT2E 2DAKA 3L27A 4OVZA 3VLFB 3PXGA 4LJ8A 2UUBM 1L2CA 2J5YA 2G5GX 2HL7A 3I4VA 1G71A 1N32M 1TGUA 1NO1A 5EQTA 5FTJA 3MK6A 4LZJA 1R5LA 2UU9M 1QZEA 2H5XA 2VF8A 3VDPA 2CHVA 2MJ5B 2JP7A 1C1KA 4LG2A 2C99A 3M0EA 1J7KA 2P5TA 2HWJA 5EP1A 4RF1A 2L7HA 2WSFF 2QSFX 2XH9A 4PDGA 2Y20A 5EXPA 3GLIB 2F5OA 2DKLA 2EKKA 2XLJA 3GLIA 4DR7M 1YE9A 2XEPA 2ZBKB 3AOGA 1NY6A 4IBIA 2EO2A 1TR8A 1OKSA 3J81S 2KA6B 4LJ5A 4RF0A 2APLA 3FYDA 3T6PA 3JAMS 4GHAA 3MHVC 1IFYA 4ZPXA 1XXHE 3HKPA 1QUSA 1W5SA 2LWXA 2Y0QA 4BB9A 1Z59A 1K3XA 4F1IA 4NRWA 3KW6A 2Z3XA 3SMPA 2LHCA 5E26A 1TF0B 4BBAA 1MN3A 3HY5A 3FD9A 4LJ4A 2YQZA 2XF3A 3GLHB 2JY7A 2R62A 3LCUA 1G59A 3GLHA 2L4FA 4JI8M 5KQDA 2FE8A 3KP1E 4FW9A 4DV5M 1C7YA 1WGNA 1E94E 3L2AA 4I5SA 3C58A 1HT1E 3RE8A 4K0KM 3QAUA 3HU1A 4NXMM 4X66M 3B74A 3ILKA 4CIZA 4L4UA 1PJJA 3AJIB 3FKEA 2FNAA 1V34A 4NC6A 2LHGA 1WHCA 1GL6A 3GRUA 4JXJA 4P16A 3GO8A 1OQYA 4GRIA 3U6DA 1ZV1A 4LF6M 5IT9S 1IXZA 1SXJD 5EJCA 3FUWA 2MGWA 3SATA 2O25A 2KDLA 3FUVA 5ITXA 4B08A 3TE6A 5GKNA 5LMNM 3U6QA 1XC8A 1V33A 2J7OA 3SHFA 3B89A 4IBCA 1AUAA 1Q3CA 1YSYA 1NVMA 4FCWA 2DAEA 2CP8A 2JY8A 4AZFA 3A46A 1MU5A 3A98B 4D81A 3BOSA 4LFBM 1LV7A 1D0LA 1SXJC 1TDHA 3PFIA 1ORYB 2XFSA 2VDBB 3B7QA 3GP1A 1WJ7A 4FCVA 2Y21A 4LF5M 1NHWC 3SASA 2LXEA 3GPYA 2F4VM 3VFDA 4L6V6 4LCBA 4OW0A 3UJNA 4KODA 5KPZA 2FS1A 3JR4A 4IBBA 3SFZA 1K3WA 3QWLA 4NXNM 5ITUA 5JI3E 1SXJE 2CUZA 3KDSE 4QHTA 2UXBM 4KHPM 2DAIA 4ANRA 4PD2A 4X62M 4PCZA 3B7NA 2R6FA 3GQ5A 2R4JA 1NHGC 1K82A 5DYGA 4B7HA 2R18A 3U61A 2LH0A 3K1JA 3EIHA 3K8ZA 3HZJA 4WW0A 2RGHA 4D82A 3U6OA 2AHMA 3ZC7B 4X64M 4IIWA 2K6BA 3AOEC 1HQCA 1QYRA 4IBJA 1PM5A 4M0WA 2XGNA 3HJSA 5DFLA 3TPZA 3HHZA 3FRHA 1QUTA 1UFZA 4IBFA 4AKIA 2L7IA 4MGKE 2CV2A 1QAOA 2XFTA 1L1ZA 2R44A 1DV0A 4LRSA 1X37A 2DZOB 3KP0E 3QYEA 5DYIA 1NNJA 2D7EA 1S3SA 1OIPA 3A45A 2DZLA 3BBZA 3D8LA 2QENA 3GPUA 2KNVA 1GO5A 1OIZA 3WHKA 1D0MA 1E32A 3I01M 1GLNA 3A42A 3C3EA 2ZAOA 1VEJA 4LJ6A 3TWLA 3SAWA 1WXQA 2CV1A 1HNZM 1LTMA 5ITQA 3FTCA 1JR3A 3VK8A 4X65M 1IN5A 3GLFE 3KSXA 3IHPA 3K9PA 4QNRA 3W68A 2RGOA 3B7ZA 3CF2A 2CE7A 3KOWE 5FTLA 4B3MM 5IZ7D 4FWHA 4JYAM 3LQRA 4B3TM 3GQ3A 2KXEA 4DBGB 1GJTA 2G3QA 3OTOM 2XSZA 3HJQA 5FLXS 4QNMA 2Z4RA 3ZH9B 3KOZE 4JI3M 2W82A 1G8PA 5EXTA 4GEWA 4L16A 1N78A 3HX3A 4DR2M 2DHRA 4UN2B 2D7HA 3FTFA 4DR3M 3T15A 1IBLM 4JI1M 2QNJA 4CHTB 4EIWA 4DV6M 1HR0M 4QOSA 1VDLA 5EXSA 3SAUA 3K92A 4GC9A 3J7AS 5FTKA 1T43A 2WSEF 4G4NA 3IG8A 4MGZE 5ITRA 2OPFA 3HHYA 2F5NA 1XNRM 2FOIC 2C98A 3AL0C 2DWZB 3VKGA 4GKKM 4AKHA 3LVWA 2XZUA 3IECA 4JI6M 4KO8A 4G6ZA 3L28A 1H6UA 4B7FA 2LNHC 2KZUA 1G4AE 3TWMA 3SYLA 3TL4X 1QANA 3KSJA 1NV8A 3C9PA 3FUUA 2M5ZA 4AG5A 2F5PA 2D7GA 2DWMA 3U6MA 2YR0A 3HHWA 1IY0A 4I8OA 1WR1B 1TTEA 4FVMA 2V6ZM 2HCBA 3SMSA 2DNAA 2O5RA 1Z5AA 5C1BA 3U5ZB 1MJGM 3FYCA 4ITQA 3E9SA 1W5TA 3U5ZA 4D80A 3CF6E 3R8FA 4RKUF 1JR3D 1XNQM 1L2BA 2FH0A 4Z6YA 1ZMWA 5EXXA 2ZM6M 3RGPA 4MGIE 1GABA 3DFZA 4NSOB 4QHSA 2CRUA 2KHHA 2MH8A 4DUYM 4GKJM 1Z5CA 2OOBA 3HU2A 2OQ4A 3VKHA 5FTMA 4LF9M 2L6OA 4NOOB 2R45A 2BJWA 3AKZA 5IREB 4AKGA 2X8AA 4LJAA 2F5SA 4YY3M 2MROB 2QP9X 3U6EA 4B3RM 2JY6B 3GLFB 4AI6A 2OO9A 4FWDA 4DV3M 3U6PA 1R2YA 3GLGE 1D0KA 1HNXM 4JV5M 2ERCA 3MJ5A 4WURA 2EJSA 2R4EA 3V76A 2QCUA 1IBMM 1PJSA 1XWIA 2VQEM 1KFVA 1OAOC 1UM8A 3H4JA 4JI4M 1YUBA 4GITA 4I4LA 3FE3A 1BVSA 2HKJA 3LW5F 1PRBA 4FCTA 3L25A 4DR4M 1OTRA 1A5TA 1NSFA 5H37D 4L78A 2WSCF 2F5QA 1ZMUA 2RRUA 4R7GA 1L1TA 4MGHA 3K2LA 1WIVA 4HEOA 4GIPA 1SG9A 1T6OA 2JNHA 1IBKM 2UUCM 1OAIA 3SARA 2A5YB 3E21A 4DV2M 4LRTA 3U6CA 4IBGA 4IJEA 4B7GA 1QVRA 2BWBA 3FTDA 3F92A 2HAKA 3DZDA 1L2DA 1XXHB 1DGHB 2DVWB 3D8BA 3U60B 1JQJC 5EP3A 3SAVA 1IXRC 1FNNA 1Q3BA 1PJQA 3I04M 3PNYA 2UUAM 2QQ8A 4Q7JA 3GLIE 3QYBA 3M7GA 1NY5A 1QZMA 1Z5BA 2DAMA 1DGBA 4NL4H 2B3TA 1R2ZA 2VF7A 7CATA 2KW0A 4B3SM 1EIJA 2BNKA 4AW4A 1XMQM 3KFUG 1Y8GA 5BPVA 3HJ8A 3SC3A 1TH4A 1VEKA 4WP2A 1XB2B 3DOAA 2RKOA 5KPTA 3HWSA 2KRUA 4MM3B 4L8RC 3UZUA 1IN7A 2M60A 5FSWA 1T3TA 2QBYB 3GLHE 1AIPC 4A3VB 4DR5M 1E9RA 1IN6A 2GQFA 2I7PA 3THGA 2EKFA 2CEAA 4OU7A 2CFOA 4AG6A 2KRKA 4REZA 2KEBA 3J7BA 2CHQA 3J2PB 4DV7M 4CISA 3C3DA 1NJGA 3PVSA 5EP4A 4DV0M 3CTWB 1PJIA 4Y28F 1L8QA 1XHBA 3WHLA 4LGMA 4MH0E 1OFIA 3FTEA 3CF0A 1PGYA 1I4WA 3LMMA 2K9DA 2G8LA 3PNVA 3J80S 2Z4SA 2X4AA 3FUTA 3T1YM 1N75A 2OOAA 4NSRA 2XZFA 3KVWA 1QDRA 4FWGA 2LVNC 2DENA 5BR8M 2EA0A 3AFHA 3SHGB 5ITXE 5KPRA 4TUWA 4G4OA 1ZMVA 2UXDM 4M9XA 2KNZA 4IBEA 4HLQA 2VQFM 3EIEA 5F3WA 2E5LM 1I94M 4LF7M 1G3IA 1JB0F 5KQ8A 4F2LA 2DAGA 3J27B 3RFWA 1MX0A 3KXEC 5JI2E 4M0DA 3UMMA 3W67A 2Z8YM 1NNUC 2JA2A 3AV0A 1SXJB 5C18A 1J09A 1KSFX 4JN6A 1SXJA 1HQYE 4PT5A 3FUXA 8CATA 4LJ7A 3HGIA 5L8RF 3LVVA 4G4RA 3Q8XA 2DWLA 4QOZC 3FRIA 3GPPA 2ZTCA 1YLAA 5DNYA 2JZ0A 4LF4M 3I4YA 4LZZA 1VDDA 2V1CA 1IY2A 2JZ1A 1NJFA 2YNMD 3E46A 4IBKA 3GRRA 3KS4A 4KLNA 1Z6TA 1NV9A 3GPXA 4DV4M 1DO0A 3JR5A 3GRVA 2C5RA 1GVNA 2R46A 4LF8M 3DA1A 4IBDA 4RNAA 2DZNB 1QDTA 5E6JA 2O01F 3NBXX 4PDIA 3AOEA 4G3OA 3SBJA 3IG5A 4W5WA 3LCVB 4DR6M 2L4EA 2X49A 1ZQ9A 2XSZD 1R7RA 3KS8A 5A2QS 2QZ4A 1CUKA 1DGGA 2JY5A 3NBIA 1TDZA 3UGJA 4GHLA 1DO2A 4I81A 4M9ZA 2H1RA 1G41A 4Z8XA 1R6BX 2R0IA 1IY1A 2Z7JA 2N35A 4MGYE 3L29A 1HJPA 3GLFA 1HNWM 4LGYA 4LY6A 3ZCBB 4LFAM 4FD2A 4JI7M 1IN4A 3T1HM 5IWAM 2Y0TA 3VK7A 1WGLA 3Q8GA 2VIIA 2J7NA 3U6LA 4GC5A 1VG5A 1JR3E 4S12A 1GL7A 1N77A 4XK8F 1ZAEA 5FTNA 1EE8A 4JI2M 2QHOB 2FFJA 2K47A 3B9PA 1XMOM 1VEGA 2YFQA 4JI5M 1IXSB 2MR9A 4HL4A 4CGYB 5ITYA 1IXSA 3VDUA 3I51A 4M9SA 1TH2A 2L2DA 2HHHM 4XGIA 5KO3A 5EP2A 2DWNA 2R65A 2NQ8C 3KOXE 2ZAMA 3KOYE 1XXHA 1DGHA 2C9CA 2UXCM 1OFHA 2LVQD 3K9OA 4KT0F 3ZQJA 3U60A 4BLCA 4R3DA 2C96A 5ITTA 3E4RA 3HHXA 2LBCA 4II7A 2I7NA 3TWKA 1FJGM 1N33M 1J5EM 3GRYA 2CV0A 4G4QA 1OJLA 4MB7A 2CWBA 1RU3A 2ZTDA 1GJSA 3CGWA 1N36M 4YHHM 3U6SA 1D2NA 1Q39A 3BXWA 4DV1M 2WZJA 1GKIA 2LTUA 3U61B 4XBOA 1DGFA 2DI0A 2KZSA 1EFUB 2K0BX 2EUCA 2CHGA 1QAQA 2QBYA 1F4IA 4P17A 1IN8A 2GNOA 2JWSA 4DR1M 2C9OA 2Q2EB 2DXIA 1Q02A 1P3QQ 2JUJA 3GQ4A 4LJ9A 2BJVA 1QAMA 1TH3A 2BWEA 2V1UA 2LVAA 3RGSA 5LMUM 4CJ6A 1KYIA 1QQWA 2QPAA 2JXNA 1R4GA 3W0LB 1PJTA 3T38A 4DUZM 4JI0M 4GMQA 1V92A 3MMPA 3NWLA 4NRVA 2LVPC 3HU3A 3W0FA 3GLGB 1IM2A 3GLGA 3LQQA 4R71A 1E9SA 3M6AA 2ZANA 3H4MA 4IJFA 1N34M
chains in the Genus database with same CATH topology
1IQPA 3UK6A 3R9XB 4L15A 3TQSA 2L09A 4LFCM 4GH9A 4OVZB 4OX9M 4AQYM 3SYKA 3L26A 1HT2E 4OVZA 3L27A 3VLFB 3PXGA 4LJ8A 2UUBM 1L2CA 2G5GX 2HL7A 3I4VA 1N32M 1TGUA 5EQTA 5FTJA 3MK6A 4LZJA 2UU9M 3VDPA 2CHVA 1C1KA 4LG2A 2C99A 3M0EA 1J7KA 2P5TA 5EP1A 4RF1A 2L7HA 2XH9A 4PDGA 2Y20A 5EXPA 3GLIB 2F5OA 2XLJA 4DR7M 3GLIA 1YE9A 2XEPA 2ZBKB 3AOGA 1NY6A 4IBIA 2EO2A 3J81S 2KA6B 4LJ5A 4RF0A 3JAMS 3FYDA 4GHAA 3MHVC 4ZPXA 3HKPA 1W5SA 2LWXA 2Y0QA 4BB9A 1Z59A 1K3XA 4NRWA 3KW6A 2Z3XA 3SMPA 5E26A 4BBAA 3FD9A 4LJ4A 2YQZA 2XF3A 3GLHB 2R62A 1G59A 3GLHA 4JI8M 5KQDA 2FE8A 3KP1E 4FW9A 4DV5M 1E94E 3L2AA 4I5SA 3C58A 1HT1E 3RE8A 4K0KM 3QAUA 3HU1A 4NXMM 4X66M 3ILKA 4L4UA 1PJJA 3AJIB 3FKEA 2FNAA 1GL6A 3GRUA 4JXJA 4P16A 3GO8A 4GRIA 3U6DA 4LF6M 5IT9S 1IXZA 1SXJD 5EJCA 3FUWA 3SATA 3FUVA 5ITXA 4B08A 3TE6A 5GKNA 5LMNM 3U6QA 1XC8A 2J7OA 3SHFA 4IBCA 1Q3CA 1YSYA 1NVMA 4FCWA 4AZFA 3A46A 1MU5A 3A98B 4D81A 3BOSA 4LFBM 1LV7A 1SXJC 1TDHA 3PFIA 1ORYB 2XFSA 3GP1A 4FCVA 2Y21A 4LF5M 1NHWC 3SASA 2LXEA 3GPYA 2F4VM 3VFDA 4LCBA 4OW0A 3UJNA 4KODA 5KPZA 3JR4A 4IBBA 3SFZA 1K3WA 3QWLA 4NXNM 5ITUA 5JI3E 1SXJE 2CUZA 3KDSE 4QHTA 2UXBM 4KHPM 4PD2A 4X62M 4PCZA 3GQ5A 2R4JA 1NHGC 1K82A 5DYGA 4B7HA 2R18A 3U61A 3K8ZA 2LH0A 3EIHA 3K1JA 4WW0A 2RGHA 4D82A 3U6OA 2AHMA 3ZC7B 4X64M 4IIWA 3AOEC 1HQCA 1QYRA 4IBJA 1PM5A 4M0WA 2XGNA 3HJSA 3TPZA 3HHZA 4IBFA 4AKIA 2L7IA 4MGKE 2CV2A 1QAOA 2XFTA 1L1ZA 4LRSA 1X37A 2DZOB 3KP0E 5DYIA 1NNJA 2D7EA 1S3SA 3A45A 3D8LA 2QENA 3GPUA 3WHKA 1E32A 1GLNA 3A42A 2ZAOA 4LJ6A 3TWLA 3SAWA 2CV1A 1WXQA 1HNZM 5ITQA 3FTCA 1JR3A 3VK8A 4X65M 1IN5A 4DV2M 3KSXA 4QNRA 3KOWE 2RGOA 3CF2A 2CE7A 5FTLA 4B3MM 5IZ7D 4FWHA 4JYAM 3LQRA 4B3TM 3GQ3A 2KXEA 3OTOM 2XSZA 3HJQA 5FLXS 4QNMA 2Z4RA 3ZH9B 3KOZE 4JI3M 2W82A 1G8PA 5EXTA 4L16A 1N78A 4DR2M 2DHRA 2D7HA 3FTFA 4DR3M 3T15A 1IBLM 4JI1M 4CHTB 4EIWA 4DV6M 1HR0M 4QOSA 5EXSA 3SAUA 3K92A 4GC9A 3J7AS 5FTKA 4G4NA 2F5NA 3IG8A 4MGZE 5ITRA 2OPFA 3HHYA 1XNRM 2FOIC 2C98A 3AL0C 2DWZB 3VKGA 4GKKM 4AKHA 3LVWA 2XZUA 4JI6M 4KO8A 4G6ZA 3L28A 1H6UA 4B7FA 2LNHC 2KZUA 1G4AE 3TWMA 3SYLA 3TL4X 1QANA 3KSJA 3FUUA 2M5ZA 4AG5A 2F5PA 2D7GA 2DWMA 3U6MA 2YR0A 3HHWA 1IY0A 4I8OA 4FVMA 2V6ZM 2HCBA 3SMSA 2O5RA 1Z5AA 5C1BA 3U5ZB 3FYCA 4ITQA 3E9SA 1W5TA 3U5ZA 4D80A 3CF6E 3R8FA 1JR3D 1XNQM 1L2BA 4Z6YA 5EXXA 2ZM6M 3RGPA 4MGIE 3DFZA 4NSOB 4QHSA 4DUYM 4GKJM 1Z5CA 3HU2A 2OQ4A 3VKHA 5FTMA 4LF9M 2L6OA 4NOOB 2R45A 2BJWA 3AKZA 5IREB 4AKGA 2X8AA 4LJAA 2F5SA 4YY3M 3U6EA 2QP9X 4AI6A 4B3RM 3GLFB 1R2YA 4FWDA 4DV3M 3U6PA 4JV5M 1HNXM 2ERCA 3MJ5A 4WURA 2R4EA 1IBMM 2QCUA 1XWIA 2VQEM 1KFVA 1UM8A 4JI4M 1YUBA 4GITA 4I4LA 2HKJA 4FCTA 3L25A 4DR4M 1NSFA 5H37D 4L78A 2F5QA 4R7GA 1L1TA 4MGHA 3K2LA 4GIPA 1IBKM 2UUCM 3SARA 2A5YB 4LRTA 3U6CA 4IBGA 4IJEA 4B7GA 1QVRA 3FTDA 3DZDA 1L2DA 1XXHB 1DGHB 2DVWB 3D8BA 3U60B 1JQJC 5EP3A 3SAVA 1IXRC 1FNNA 1Q3BA 2UUAM 3PNYA 3M7GA 1NY5A 1QZMA 1Z5BA 1DGBA 4NL4H 1R2ZA 7CATA 2KW0A 4B3SM 2BNKA 4AW4A 1XMQM 3KFUG 5BPVA 3HJ8A 3SC3A 1TH4A 3DOAA 2RKOA 5KPTA 3HWSA 2KRUA 4MM3B 4L8RC 3UZUA 1IN7A 2M60A 5FSWA 1T3TA 2QBYB 4A3VB 4DR5M 1IN6A 1E9RA 2I7PA 3THGA 2CEAA 4OU7A 2CFOA 4AG6A 2KRKA 4REZA 2KEBA 3J7BA 2CHQA 3J2PB 4DV7M 4CISA 1NJGA 3PVSA 5EP4A 4DV0M 3CTWB 1PJIA 1L8QA 1XHBA 3WHLA 4LGMA 4MH0E 1OFIA 3FTEA 3CF0A 1I4WA 3LMMA 2G8LA 3PNVA 3J80S 2Z4SA 2X4AA 3FUTA 3T1YM 1N75A 4NSRA 2XZFA 3KVWA 4FWGA 5BR8M 2EA0A 3AFHA 3SHGB 5ITXE 5KPRA 4TUWA 4G4OA 2UXDM 4M9XA 4IBEA 4HLQA 2VQFM 3EIEA 5F3WA 2E5LM 1I94M 4LF7M 1G3IA 5KQ8A 3J27B 3RFWA 1MX0A 3KXEC 5JI2E 4M0DA 3UMMA 1NNUC 2JA2A 3AV0A 1SXJB 5C18A 1J09A 1KSFX 4JN6A 1SXJA 1HQYE 4PT5A 3FUXA 8CATA 4LJ7A 3HGIA 3LVVA 4G4RA 3Q8XA 2DWLA 4QOZC 3GPPA 5DNYA 4LF4M 3I4YA 4LZZA 2V1CA 1VDDA 1IY2A 4IBKA 1NJFA 2YNMD 4KLNA 3GRRA 3KS4A 1Z6TA 3GPXA 4DV4M 1DO0A 3JR5A 3GRVA 2C5RA 1GVNA 2R46A 4LF8M 3DA1A 4IBDA 4RNAA 2DZNB 5E6JA 4PDIA 3AOEA 3SBJA 3IG5A 4W5WA 4DR6M 2X49A 1ZQ9A 2XSZD 1R7RA 3KS8A 5A2QS 2QZ4A 1DGGA 3NBIA 1TDZA 3UGJA 4GHLA 1DO2A 4I81A 4M9ZA 2H1RA 1G41A 4Z8XA 1R6BX 1IY1A 2Z7JA 4MGYE 3L29A 3GLFA 1HNWM 4LGYA 4LY6A 3ZCBB 4LFAM 4FD2A 4JI7M 1IN4A 3T1HM 5IWAM 2Y0TA 3VK7A 2VIIA 2J7NA 3U6LA 4GC5A 4S12A 1GL7A 1N77A 5FTNA 1ZAEA 4JI2M 1EE8A 2FFJA 2K47A 3B9PA 1XMOM 2YFQA 4JI5M 1IXSB 4HL4A 4CGYB 5ITYA 3VDUA 3I51A 4M9SA 1TH2A 2HHHM 4XGIA 5KO3A 5EP2A 2DWNA 2R65A 3KOXE 2NQ8C 2ZAMA 3KOYE 1XXHA 1DGHA 2C9CA 2UXCM 1OFHA 3U60A 4BLCA 4R3DA 2C96A 5ITTA 3E4RA 3HHXA 4II7A 3TWKA 2I7NA 1N33M 1FJGM 1J5EM 3GRYA 2CV0A 4G4QA 1OJLA 4MB7A 1N36M 4YHHM 3U6SA 1D2NA 1Q39A 4DV1M 1GKIA 3U61B 4XBOA 1DGFA 2KZSA 2EUCA 2CHGA 1QAQA 2QBYA 1IN8A 4DR1M 2C9OA 2Q2EB 2DXIA 3GQ4A 4LJ9A 2BJVA 1QAMA 1TH3A 2V1UA 3RGSA 5LMUM 1KYIA 1QQWA 2QPAA 3W0LB 3T38A 4DUZM 4JI0M 4GMQA 3NWLA 4NRVA 3GLGB 3HU3A 3W0FA 1IM2A 3GLGA 3LQQA 1E9SA 3M6AA 2ZANA 3H4MA 4IJFA 1N34M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 M;  1HNX M;  3GPX A;  3U6O A;  4DV4 M;  4LFC M;  1IBM M;  4X64 M;  3JR5 A;  4AQY M;  4OX9 M;  2VQE M;  1PM5 A;  1KFV A;  4LF8 M;  4JI4 M;  2UUB M;  1L2C A;  2HKJ A;  4PDI A;  1N32 M;  3SBJ A;  2UU9 M;  1L1Z A;  4DR4 M;  4DR6 M;  2F5Q A;  1L1T A;  5A2Q S;  1TDZ A;  1IBK M;  2UUC M;  3SAR A;  1NNJ A;  3A45 A;  4PDG A;  3U6C A;  2F5O A;  3GPU A;  4DR7 M;  1L2D A;  1HNW M;  2ZBK B;  3A42 A;  4LFA M;  4JI7 M;  3T1H M;  3TWL A;  5IWA M;  3SAV A;  3J81 S;  3SAW A;  1Q3B A;  1HNZ M;  5ITQ A;  2UUA M;  3JAM S;  3VK8 A;  4X65 M;  4DV2 M;  3VK7 A;  1Z5B A;  4B3M M;  3U6L A;  1Z59 A;  1K3X A;  1R2Z A;  4NRW A;  4JYA M;  4B3T M;  4B3S M;  3GQ3 A;  1XMQ M;  3OTO M;  5FLX S;  4JI2 M;  1EE8 A;  1XMO M;  4JI3 M;  4JI5 M;  3DOA A;  4DR2 M;  5ITY A;  4JI8 M;  4DV5 M;  4DR3 M;  3C58 A;  1IBL M;  4JI1 M;  2HHH M;  4K0K M;  4DR5 M;  4DV6 M;  1HR0 M;  3SAU A;  4NXM M;  4X66 M;  3J7A S;  1PJJ A;  2UXC M;  4G4N A;  2F5N A;  5ITR A;  2OPF A;  4DV7 M;  4CIS A;  1XNR M;  4DV0 M;  5ITT A;  1PJI A;  4GKK M;  3GO8 A;  3TWK A;  1N33 M;  3U6D A;  1FJG M;  1J5E M;  4LF6 M;  2XZU A;  5IT9 S;  4JI6 M;  4G4Q A;  4MB7 A;  3J80 S;  3TWM A;  3SAT A;  1N36 M;  5ITX A;  4YHH M;  3U6S A;  1Q39 A;  4DV1 M;  3T1Y M;  5LMN M;  3U6Q A;  1XC8 A;  2XZF A;  5BR8 M;  2EA0 A;  2F5P A;  3U6M A;  5ITX E;  1Q3C A;  4G4O A;  2UXD M;  3A46 A;  2VQF M;  2E5L M;  1Z5A A;  1I94 M;  1MU5 A;  4ITQ A;  4LFB M;  4LF7 M;  1TDH A;  4DR1 M;  2Q2E B;  3GP1 A;  1MX0 A;  1XNQ M;  1L2B A;  4LF5 M;  3SAS A;  3GPY A;  3GQ4 A;  2ZM6 M;  2F4V M;  3JR4 A;  5LMU M;  1K3W A;  4NXN M;  5ITU A;  4DUY M;  4DUZ M;  4GKJ M;  1Z5C A;  4JI0 M;  2OQ4 A;  4G4R A;  4LF9 M;  4NRV A;  2UXB M;  4KHP M;  3W0F A;  4PD2 A;  4X62 M;  3GPP A;  4PCZ A;  2F5S A;  4YY3 M;  3U6E A;  4B3R M;  3GQ5 A;  4LF4 M;  1R2Y A;  3U6P A;  4DV3 M;  1K82 A;  1N34 M; 
#chains in the Genus database with same CATH topology
 2KNA A;  1IQP A;  3UK6 A;  3R9X B;  4L15 A;  2LVO C;  2L09 A;  3TQS A;  4LFC M;  2DHY A;  4GH9 A;  4OVZ B;  4OX9 M;  4AQY M;  3SYK A;  3L26 A;  1VQ1 A;  1HT2 E;  2DAK A;  3L27 A;  4OVZ A;  3VLF B;  3PXG A;  4LJ8 A;  2UUB M;  1L2C A;  2J5Y A;  2G5G X;  2HL7 A;  3I4V A;  1G71 A;  1N32 M;  1TGU A;  1NO1 A;  5EQT A;  5FTJ A;  3MK6 A;  4LZJ A;  1R5L A;  2UU9 M;  1QZE A;  2H5X A;  2VF8 A;  3VDP A;  2CHV A;  2MJ5 B;  2JP7 A;  1C1K A;  4LG2 A;  2C99 A;  3M0E A;  1J7K A;  2P5T A;  2HWJ A;  5EP1 A;  4RF1 A;  2L7H A;  2WSF F;  2QSF X;  2XH9 A;  4PDG A;  2Y20 A;  5EXP A;  3GLI B;  2F5O A;  2DKL A;  2EKK A;  2XLJ A;  3GLI A;  4DR7 M;  1YE9 A;  2XEP A;  2ZBK B;  3AOG A;  1NY6 A;  4IBI A;  2EO2 A;  1TR8 A;  1OKS A;  3J81 S;  2KA6 B;  4LJ5 A;  4RF0 A;  2APL A;  3FYD A;  3T6P A;  3JAM S;  4GHA A;  3MHV C;  1IFY A;  4ZPX A;  1XXH E;  3HKP A;  1QUS A;  1W5S A;  2LWX A;  2Y0Q A;  4BB9 A;  1Z59 A;  1K3X A;  4F1I A;  4NRW A;  3KW6 A;  2Z3X A;  3SMP A;  2LHC A;  5E26 A;  1TF0 B;  4BBA A;  1MN3 A;  3HY5 A;  3FD9 A;  4LJ4 A;  2YQZ A;  2XF3 A;  3GLH B;  2JY7 A;  2R62 A;  3LCU A;  1G59 A;  3GLH A;  2L4F A;  4JI8 M;  5KQD A;  2FE8 A;  3KP1 E;  4FW9 A;  4DV5 M;  1C7Y A;  1WGN A;  1E94 E;  3L2A A;  4I5S A;  3C58 A;  1HT1 E;  3RE8 A;  4K0K M;  3QAU A;  3HU1 A;  4NXM M;  4X66 M;  3B74 A;  3ILK A;  4CIZ A;  4L4U A;  1PJJ A;  3AJI B;  3FKE A;  2FNA A;  1V34 A;  4NC6 A;  2LHG A;  1WHC A;  1GL6 A;  3GRU A;  4JXJ A;  4P16 A;  3GO8 A;  1OQY A;  4GRI A;  3U6D A;  1ZV1 A;  4LF6 M;  5IT9 S;  1IXZ A;  1SXJ D;  5EJC A;  3FUW A;  2MGW A;  3SAT A;  2O25 A;  2KDL A;  3FUV A;  5ITX A;  4B08 A;  3TE6 A;  5GKN A;  5LMN M;  3U6Q A;  1XC8 A;  1V33 A;  2J7O A;  3SHF A;  3B89 A;  4IBC A;  1AUA A;  1Q3C A;  1YSY A;  1NVM A;  4FCW A;  2DAE A;  2CP8 A;  2JY8 A;  4AZF A;  3A46 A;  1MU5 A;  3A98 B;  4D81 A;  3BOS A;  4LFB M;  1LV7 A;  1D0L A;  1SXJ C;  1TDH A;  3PFI A;  1ORY B;  2XFS A;  2VDB B;  3B7Q A;  3GP1 A;  1WJ7 A;  4FCV A;  2Y21 A;  4LF5 M;  1NHW C;  3SAS A;  2LXE A;  3GPY A;  2F4V M;  3VFD A;  4L6V 6;  4LCB A;  4OW0 A;  3UJN A;  4KOD A;  5KPZ A;  2FS1 A;  3JR4 A;  4IBB A;  3SFZ A;  1K3W A;  3QWL A;  4NXN M;  5ITU A;  5JI3 E;  1SXJ E;  2CUZ A;  3KDS E;  4QHT A;  2UXB M;  4KHP M;  2DAI A;  4ANR A;  4PD2 A;  4X62 M;  4PCZ A;  3B7N A;  2R6F A;  3GQ5 A;  2R4J A;  1NHG C;  1K82 A;  5DYG A;  4B7H A;  2R18 A;  3U61 A;  2LH0 A;  3K1J A;  3EIH A;  3K8Z A;  3HZJ A;  4WW0 A;  2RGH A;  4D82 A;  3U6O A;  2AHM A;  3ZC7 B;  4X64 M;  4IIW A;  2K6B A;  3AOE C;  1HQC A;  1QYR A;  4IBJ A;  1PM5 A;  4M0W A;  2XGN A;  3HJS A;  5DFL A;  3TPZ A;  3HHZ A;  3FRH A;  1QUT A;  1UFZ A;  4IBF A;  4AKI A;  2L7I A;  4MGK E;  2CV2 A;  1QAO A;  2XFT A;  1L1Z A;  2R44 A;  1DV0 A;  4LRS A;  1X37 A;  2DZO B;  3KP0 E;  3QYE A;  5DYI A;  1NNJ A;  2D7E A;  1S3S A;  1OIP A;  3A45 A;  2DZL A;  3BBZ A;  3D8L A;  2QEN A;  3GPU A;  2KNV A;  1GO5 A;  1OIZ A;  3WHK A;  1D0M A;  1E32 A;  3I01 M;  1GLN A;  3A42 A;  3C3E A;  2ZAO A;  1VEJ A;  4LJ6 A;  3TWL A;  3SAW A;  1WXQ A;  2CV1 A;  1HNZ M;  1LTM A;  5ITQ A;  3FTC A;  1JR3 A;  3VK8 A;  4X65 M;  1IN5 A;  3GLF E;  3KSX A;  3IHP A;  3K9P A;  4QNR A;  3W68 A;  2RGO A;  3B7Z A;  3CF2 A;  2CE7 A;  3KOW E;  5FTL A;  4B3M M;  5IZ7 D;  4FWH A;  4JYA M;  3LQR A;  4B3T M;  3GQ3 A;  2KXE A;  4DBG B;  1GJT A;  2G3Q A;  3OTO M;  2XSZ A;  3HJQ A;  5FLX S;  4QNM A;  2Z4R A;  3ZH9 B;  3KOZ E;  4JI3 M;  2W82 A;  1G8P A;  5EXT A;  4GEW A;  4L16 A;  1N78 A;  3HX3 A;  4DR2 M;  2DHR A;  4UN2 B;  2D7H A;  3FTF A;  4DR3 M;  3T15 A;  1IBL M;  4JI1 M;  2QNJ A;  4CHT B;  4EIW A;  4DV6 M;  1HR0 M;  4QOS A;  1VDL A;  5EXS A;  3SAU A;  3K92 A;  4GC9 A;  3J7A S;  5FTK A;  1T43 A;  2WSE F;  4G4N A;  3IG8 A;  4MGZ E;  5ITR A;  2OPF A;  3HHY A;  2F5N A;  1XNR M;  2FOI C;  2C98 A;  3AL0 C;  2DWZ B;  3VKG A;  4GKK M;  4AKH A;  3LVW A;  2XZU A;  3IEC A;  4JI6 M;  4KO8 A;  4G6Z A;  3L28 A;  1H6U A;  4B7F A;  2LNH C;  2KZU A;  1G4A E;  3TWM A;  3SYL A;  3TL4 X;  1QAN A;  3KSJ A;  1NV8 A;  3C9P A;  3FUU A;  2M5Z A;  4AG5 A;  2F5P A;  2D7G A;  2DWM A;  3U6M A;  2YR0 A;  3HHW A;  1IY0 A;  4I8O A;  1WR1 B;  1TTE A;  4FVM A;  2V6Z M;  2HCB A;  3SMS A;  2DNA A;  2O5R A;  1Z5A A;  5C1B A;  3U5Z B;  1MJG M;  3FYC A;  4ITQ A;  3E9S A;  1W5T A;  3U5Z A;  4D80 A;  3CF6 E;  3R8F A;  4RKU F;  1JR3 D;  1XNQ M;  1L2B A;  2FH0 A;  4Z6Y A;  1ZMW A;  5EXX A;  2ZM6 M;  3RGP A;  4MGI E;  1GAB A;  3DFZ A;  4NSO B;  4QHS A;  2CRU A;  2KHH A;  2MH8 A;  4DUY M;  4GKJ M;  1Z5C A;  2OOB A;  3HU2 A;  2OQ4 A;  3VKH A;  5FTM A;  4LF9 M;  2L6O A;  4NOO B;  2R45 A;  2BJW A;  3AKZ A;  5IRE B;  4AKG A;  2X8A A;  4LJA A;  2F5S A;  4YY3 M;  2MRO B;  2QP9 X;  3U6E A;  4B3R M;  2JY6 B;  3GLF B;  4AI6 A;  2OO9 A;  4FWD A;  4DV3 M;  3U6P A;  1R2Y A;  3GLG E;  1D0K A;  1HNX M;  4JV5 M;  2ERC A;  3MJ5 A;  4WUR A;  2EJS A;  2R4E A;  3V76 A;  2QCU A;  1IBM M;  1PJS A;  1XWI A;  2VQE M;  1KFV A;  1OAO C;  1UM8 A;  3H4J A;  4JI4 M;  1YUB A;  4GIT A;  4I4L A;  3FE3 A;  1BVS A;  2HKJ A;  3LW5 F;  1PRB A;  4FCT A;  3L25 A;  4DR4 M;  1OTR A;  1A5T A;  1NSF A;  5H37 D;  4L78 A;  2WSC F;  2F5Q A;  1ZMU A;  2RRU A;  4R7G A;  1L1T A;  4MGH A;  3K2L A;  1WIV A;  4HEO A;  4GIP A;  1SG9 A;  1T6O A;  2JNH A;  1IBK M;  2UUC M;  1OAI A;  3SAR A;  2A5Y B;  3E21 A;  4DV2 M;  4LRT A;  3U6C A;  4IBG A;  4IJE A;  4B7G A;  1QVR A;  2BWB A;  3FTD A;  3F92 A;  2HAK A;  3DZD A;  1L2D A;  1XXH B;  1DGH B;  2DVW B;  3D8B A;  3U60 B;  1JQJ C;  5EP3 A;  3SAV A;  1IXR C;  1FNN A;  1Q3B A;  1PJQ A;  3I04 M;  3PNY A;  2UUA M;  2QQ8 A;  4Q7J A;  3GLI E;  3QYB A;  3M7G A;  1NY5 A;  1QZM A;  1Z5B A;  2DAM A;  1DGB A;  4NL4 H;  2B3T A;  1R2Z A;  2VF7 A;  7CAT A;  2KW0 A;  4B3S M;  1EIJ A;  2BNK A;  4AW4 A;  1XMQ M;  3KFU G;  1Y8G A;  5BPV A;  3HJ8 A;  3SC3 A;  1TH4 A;  1VEK A;  4WP2 A;  1XB2 B;  3DOA A;  2RKO A;  5KPT A;  3HWS A;  2KRU A;  4MM3 B;  4L8R C;  3UZU A;  1IN7 A;  2M60 A;  5FSW A;  1T3T A;  2QBY B;  3GLH E;  1AIP C;  4A3V B;  4DR5 M;  1E9R A;  1IN6 A;  2GQF A;  2I7P A;  3THG A;  2EKF A;  2CEA A;  4OU7 A;  2CFO A;  4AG6 A;  2KRK A;  4REZ A;  2KEB A;  3J7B A;  2CHQ A;  3J2P B;  4DV7 M;  4CIS A;  3C3D A;  1NJG A;  3PVS A;  5EP4 A;  4DV0 M;  3CTW B;  1PJI A;  4Y28 F;  1L8Q A;  1XHB A;  3WHL A;  4LGM A;  4MH0 E;  1OFI A;  3FTE A;  3CF0 A;  1PGY A;  1I4W A;  3LMM A;  2K9D A;  2G8L A;  3PNV A;  3J80 S;  2Z4S A;  2X4A A;  3FUT A;  3T1Y M;  1N75 A;  2OOA A;  4NSR A;  2XZF A;  3KVW A;  1QDR A;  4FWG A;  2LVN C;  2DEN A;  5BR8 M;  2EA0 A;  3AFH A;  3SHG B;  5ITX E;  5KPR A;  4TUW A;  4G4O A;  1ZMV A;  2UXD M;  4M9X A;  2KNZ A;  4IBE A;  4HLQ A;  2VQF M;  3EIE A;  5F3W A;  2E5L M;  1I94 M;  4LF7 M;  1G3I A;  1JB0 F;  5KQ8 A;  4F2L A;  2DAG A;  3J27 B;  3RFW A;  1MX0 A;  3KXE C;  5JI2 E;  4M0D A;  3UMM A;  3W67 A;  2Z8Y M;  1NNU C;  2JA2 A;  3AV0 A;  1SXJ B;  5C18 A;  1J09 A;  1KSF X;  4JN6 A;  1SXJ A;  1HQY E;  4PT5 A;  3FUX A;  8CAT A;  4LJ7 A;  3HGI A;  5L8R F;  3LVV A;  4G4R A;  3Q8X A;  2DWL A;  4QOZ C;  3FRI A;  3GPP A;  2ZTC A;  1YLA A;  5DNY A;  2JZ0 A;  4LF4 M;  3I4Y A;  4LZZ A;  1VDD A;  2V1C A;  1IY2 A;  2JZ1 A;  1NJF A;  2YNM D;  3E46 A;  4IBK A;  3GRR A;  3KS4 A;  4KLN A;  1Z6T A;  1NV9 A;  3GPX A;  4DV4 M;  1DO0 A;  3JR5 A;  3GRV A;  2C5R A;  1GVN A;  2R46 A;  4LF8 M;  3DA1 A;  4IBD A;  4RNA A;  2DZN B;  1QDT A;  5E6J A;  2O01 F;  3NBX X;  4PDI A;  3AOE A;  4G3O A;  3SBJ A;  3IG5 A;  4W5W A;  3LCV B;  4DR6 M;  2L4E A;  2X49 A;  1ZQ9 A;  2XSZ D;  1R7R A;  3KS8 A;  5A2Q S;  2QZ4 A;  1CUK A;  1DGG A;  2JY5 A;  3NBI A;  1TDZ A;  3UGJ A;  4GHL A;  1DO2 A;  4I81 A;  4M9Z A;  2H1R A;  1G41 A;  4Z8X A;  1R6B X;  2R0I A;  1IY1 A;  2Z7J A;  2N35 A;  4MGY E;  3L29 A;  1HJP A;  3GLF A;  1HNW M;  4LGY A;  4LY6 A;  3ZCB B;  4LFA M;  4FD2 A;  4JI7 M;  1IN4 A;  3T1H M;  5IWA M;  2Y0T A;  3VK7 A;  1WGL A;  3Q8G A;  2VII A;  2J7N A;  3U6L A;  4GC5 A;  1VG5 A;  1JR3 E;  4S12 A;  1GL7 A;  1N77 A;  4XK8 F;  1ZAE A;  5FTN A;  1EE8 A;  4JI2 M;  2QHO B;  2FFJ A;  2K47 A;  3B9P A;  1XMO M;  1VEG A;  2YFQ A;  4JI5 M;  1IXS B;  2MR9 A;  4HL4 A;  4CGY B;  5ITY A;  1IXS A;  3VDU A;  3I51 A;  4M9S A;  1TH2 A;  2L2D A;  2HHH M;  4XGI A;  5KO3 A;  5EP2 A;  2DWN A;  2R65 A;  2NQ8 C;  3KOX E;  2ZAM A;  3KOY E;  1XXH A;  1DGH A;  2C9C A;  2UXC M;  1OFH A;  2LVQ D;  3K9O A;  4KT0 F;  3ZQJ A;  3U60 A;  4BLC A;  4R3D A;  2C96 A;  5ITT A;  3E4R A;  3HHX A;  2LBC A;  4II7 A;  2I7N A;  3TWK A;  1FJG M;  1N33 M;  1J5E M;  3GRY A;  2CV0 A;  4G4Q A;  1OJL A;  4MB7 A;  2CWB A;  1RU3 A;  2ZTD A;  1GJS A;  3CGW A;  1N36 M;  4YHH M;  3U6S A;  1D2N A;  1Q39 A;  3BXW A;  4DV1 M;  2WZJ A;  1GKI A;  2LTU A;  3U61 B;  4XBO A;  1DGF A;  2DI0 A;  2KZS A;  1EFU B;  2K0B X;  2EUC A;  2CHG A;  1QAQ A;  2QBY A;  1F4I A;  4P17 A;  1IN8 A;  2GNO A;  2JWS A;  4DR1 M;  2C9O A;  2Q2E B;  2DXI A;  1Q02 A;  1P3Q Q;  2JUJ A;  3GQ4 A;  4LJ9 A;  2BJV A;  1QAM A;  1TH3 A;  2BWE A;  2V1U A;  2LVA A;  3RGS A;  5LMU M;  4CJ6 A;  1KYI A;  1QQW A;  2QPA A;  2JXN A;  1R4G A;  3W0L B;  1PJT A;  3T38 A;  4DUZ M;  4JI0 M;  4GMQ A;  1V92 A;  3MMP A;  3NWL A;  4NRV A;  2LVP C;  3HU3 A;  3W0F A;  3GLG B;  1IM2 A;  3GLG A;  3LQQ A;  4R71 A;  1E9S A;  3M6A A;  2ZAN A;  3H4M A;  4IJF A;  1N34 M; 
#chains in the Genus database with same CATH homology
 1IQP A;  3UK6 A;  3R9X B;  4L15 A;  3TQS A;  2L09 A;  4LFC M;  4GH9 A;  4OVZ B;  4OX9 M;  4AQY M;  3SYK A;  3L26 A;  1HT2 E;  4OVZ A;  3L27 A;  3VLF B;  3PXG A;  4LJ8 A;  2UUB M;  1L2C A;  2G5G X;  2HL7 A;  3I4V A;  1N32 M;  1TGU A;  5EQT A;  5FTJ A;  3MK6 A;  4LZJ A;  2UU9 M;  3VDP A;  2CHV A;  1C1K A;  4LG2 A;  2C99 A;  3M0E A;  1J7K A;  2P5T A;  5EP1 A;  4RF1 A;  2L7H A;  2XH9 A;  4PDG A;  2Y20 A;  5EXP A;  3GLI B;  2F5O A;  2XLJ A;  4DR7 M;  3GLI A;  1YE9 A;  2XEP A;  2ZBK B;  3AOG A;  1NY6 A;  4IBI A;  2EO2 A;  3J81 S;  2KA6 B;  4LJ5 A;  4RF0 A;  3JAM S;  3FYD A;  4GHA A;  3MHV C;  4ZPX A;  3HKP A;  1W5S A;  2LWX A;  2Y0Q A;  4BB9 A;  1Z59 A;  1K3X A;  4NRW A;  3KW6 A;  2Z3X A;  3SMP A;  5E26 A;  4BBA A;  3FD9 A;  4LJ4 A;  2YQZ A;  2XF3 A;  3GLH B;  2R62 A;  1G59 A;  3GLH A;  4JI8 M;  5KQD A;  2FE8 A;  3KP1 E;  4FW9 A;  4DV5 M;  1E94 E;  3L2A A;  4I5S A;  3C58 A;  1HT1 E;  3RE8 A;  4K0K M;  3QAU A;  3HU1 A;  4NXM M;  4X66 M;  3ILK A;  4L4U A;  1PJJ A;  3AJI B;  3FKE A;  2FNA A;  1GL6 A;  3GRU A;  4JXJ A;  4P16 A;  3GO8 A;  4GRI A;  3U6D A;  4LF6 M;  5IT9 S;  1IXZ A;  1SXJ D;  5EJC A;  3FUW A;  3SAT A;  3FUV A;  5ITX A;  4B08 A;  3TE6 A;  5GKN A;  5LMN M;  3U6Q A;  1XC8 A;  2J7O A;  3SHF A;  4IBC A;  1Q3C A;  1YSY A;  1NVM A;  4FCW A;  4AZF A;  3A46 A;  1MU5 A;  3A98 B;  4D81 A;  3BOS A;  4LFB M;  1LV7 A;  1SXJ C;  1TDH A;  3PFI A;  1ORY B;  2XFS A;  3GP1 A;  4FCV A;  2Y21 A;  4LF5 M;  1NHW C;  3SAS A;  2LXE A;  3GPY A;  2F4V M;  3VFD A;  4LCB A;  4OW0 A;  3UJN A;  4KOD A;  5KPZ A;  3JR4 A;  4IBB A;  3SFZ A;  1K3W A;  3QWL A;  4NXN M;  5ITU A;  5JI3 E;  1SXJ E;  2CUZ A;  3KDS E;  4QHT A;  2UXB M;  4KHP M;  4PD2 A;  4X62 M;  4PCZ A;  3GQ5 A;  2R4J A;  1NHG C;  1K82 A;  5DYG A;  4B7H A;  2R18 A;  3U61 A;  3K8Z A;  2LH0 A;  3EIH A;  3K1J A;  4WW0 A;  2RGH A;  4D82 A;  3U6O A;  2AHM A;  3ZC7 B;  4X64 M;  4IIW A;  3AOE C;  1HQC A;  1QYR A;  4IBJ A;  1PM5 A;  4M0W A;  2XGN A;  3HJS A;  3TPZ A;  3HHZ A;  4IBF A;  4AKI A;  2L7I A;  4MGK E;  2CV2 A;  1QAO A;  2XFT A;  1L1Z A;  4LRS A;  1X37 A;  2DZO B;  3KP0 E;  5DYI A;  1NNJ A;  2D7E A;  1S3S A;  3A45 A;  3D8L A;  2QEN A;  3GPU A;  3WHK A;  1E32 A;  1GLN A;  3A42 A;  2ZAO A;  4LJ6 A;  3TWL A;  3SAW A;  2CV1 A;  1WXQ A;  1HNZ M;  5ITQ A;  3FTC A;  1JR3 A;  3VK8 A;  4X65 M;  1IN5 A;  4DV2 M;  3KSX A;  4QNR A;  3KOW E;  2RGO A;  3CF2 A;  2CE7 A;  5FTL A;  4B3M M;  5IZ7 D;  4FWH A;  4JYA M;  3LQR A;  4B3T M;  3GQ3 A;  2KXE A;  3OTO M;  2XSZ A;  3HJQ A;  5FLX S;  4QNM A;  2Z4R A;  3ZH9 B;  3KOZ E;  4JI3 M;  2W82 A;  1G8P A;  5EXT A;  4L16 A;  1N78 A;  4DR2 M;  2DHR A;  2D7H A;  3FTF A;  4DR3 M;  3T15 A;  1IBL M;  4JI1 M;  4CHT B;  4EIW A;  4DV6 M;  1HR0 M;  4QOS A;  5EXS A;  3SAU A;  3K92 A;  4GC9 A;  3J7A S;  5FTK A;  4G4N A;  2F5N A;  3IG8 A;  4MGZ E;  5ITR A;  2OPF A;  3HHY A;  1XNR M;  2FOI C;  2C98 A;  3AL0 C;  2DWZ B;  3VKG A;  4GKK M;  4AKH A;  3LVW A;  2XZU A;  4JI6 M;  4KO8 A;  4G6Z A;  3L28 A;  1H6U A;  4B7F A;  2LNH C;  2KZU A;  1G4A E;  3TWM A;  3SYL A;  3TL4 X;  1QAN A;  3KSJ A;  3FUU A;  2M5Z A;  4AG5 A;  2F5P A;  2D7G A;  2DWM A;  3U6M A;  2YR0 A;  3HHW A;  1IY0 A;  4I8O A;  4FVM A;  2V6Z M;  2HCB A;  3SMS A;  2O5R A;  1Z5A A;  5C1B A;  3U5Z B;  3FYC A;  4ITQ A;  3E9S A;  1W5T A;  3U5Z A;  4D80 A;  3CF6 E;  3R8F A;  1JR3 D;  1XNQ M;  1L2B A;  4Z6Y A;  5EXX A;  2ZM6 M;  3RGP A;  4MGI E;  3DFZ A;  4NSO B;  4QHS A;  4DUY M;  4GKJ M;  1Z5C A;  3HU2 A;  2OQ4 A;  3VKH A;  5FTM A;  4LF9 M;  2L6O A;  4NOO B;  2R45 A;  2BJW A;  3AKZ A;  5IRE B;  4AKG A;  2X8A A;  4LJA A;  2F5S A;  4YY3 M;  3U6E A;  2QP9 X;  4AI6 A;  4B3R M;  3GLF B;  1R2Y A;  4FWD A;  4DV3 M;  3U6P A;  4JV5 M;  1HNX M;  2ERC A;  3MJ5 A;  4WUR A;  2R4E A;  1IBM M;  2QCU A;  1XWI A;  2VQE M;  1KFV A;  1UM8 A;  4JI4 M;  1YUB A;  4GIT A;  4I4L A;  2HKJ A;  4FCT A;  3L25 A;  4DR4 M;  1NSF A;  5H37 D;  4L78 A;  2F5Q A;  4R7G A;  1L1T A;  4MGH A;  3K2L A;  4GIP A;  1IBK M;  2UUC M;  3SAR A;  2A5Y B;  4LRT A;  3U6C A;  4IBG A;  4IJE A;  4B7G A;  1QVR A;  3FTD A;  3DZD A;  1L2D A;  1XXH B;  1DGH B;  2DVW B;  3D8B A;  3U60 B;  1JQJ C;  5EP3 A;  3SAV A;  1IXR C;  1FNN A;  1Q3B A;  2UUA M;  3PNY A;  3M7G A;  1NY5 A;  1QZM A;  1Z5B A;  1DGB A;  4NL4 H;  1R2Z A;  7CAT A;  2KW0 A;  4B3S M;  2BNK A;  4AW4 A;  1XMQ M;  3KFU G;  5BPV A;  3HJ8 A;  3SC3 A;  1TH4 A;  3DOA A;  2RKO A;  5KPT A;  3HWS A;  2KRU A;  4MM3 B;  4L8R C;  3UZU A;  1IN7 A;  2M60 A;  5FSW A;  1T3T A;  2QBY B;  4A3V B;  4DR5 M;  1IN6 A;  1E9R A;  2I7P A;  3THG A;  2CEA A;  4OU7 A;  2CFO A;  4AG6 A;  2KRK A;  4REZ A;  2KEB A;  3J7B A;  2CHQ A;  3J2P B;  4DV7 M;  4CIS A;  1NJG A;  3PVS A;  5EP4 A;  4DV0 M;  3CTW B;  1PJI A;  1L8Q A;  1XHB A;  3WHL A;  4LGM A;  4MH0 E;  1OFI A;  3FTE A;  3CF0 A;  1I4W A;  3LMM A;  2G8L A;  3PNV A;  3J80 S;  2Z4S A;  2X4A A;  3FUT A;  3T1Y M;  1N75 A;  4NSR A;  2XZF A;  3KVW A;  4FWG A;  5BR8 M;  2EA0 A;  3AFH A;  3SHG B;  5ITX E;  5KPR A;  4TUW A;  4G4O A;  2UXD M;  4M9X A;  4IBE A;  4HLQ A;  2VQF M;  3EIE A;  5F3W A;  2E5L M;  1I94 M;  4LF7 M;  1G3I A;  5KQ8 A;  3J27 B;  3RFW A;  1MX0 A;  3KXE C;  5JI2 E;  4M0D A;  3UMM A;  1NNU C;  2JA2 A;  3AV0 A;  1SXJ B;  5C18 A;  1J09 A;  1KSF X;  4JN6 A;  1SXJ A;  1HQY E;  4PT5 A;  3FUX A;  8CAT A;  4LJ7 A;  3HGI A;  3LVV A;  4G4R A;  3Q8X A;  2DWL A;  4QOZ C;  3GPP A;  5DNY A;  4LF4 M;  3I4Y A;  4LZZ A;  2V1C A;  1VDD A;  1IY2 A;  4IBK A;  1NJF A;  2YNM D;  4KLN A;  3GRR A;  3KS4 A;  1Z6T A;  3GPX A;  4DV4 M;  1DO0 A;  3JR5 A;  3GRV A;  2C5R A;  1GVN A;  2R46 A;  4LF8 M;  3DA1 A;  4IBD A;  4RNA A;  2DZN B;  5E6J A;  4PDI A;  3AOE A;  3SBJ A;  3IG5 A;  4W5W A;  4DR6 M;  2X49 A;  1ZQ9 A;  2XSZ D;  1R7R A;  3KS8 A;  5A2Q S;  2QZ4 A;  1DGG A;  3NBI A;  1TDZ A;  3UGJ A;  4GHL A;  1DO2 A;  4I81 A;  4M9Z A;  2H1R A;  1G41 A;  4Z8X A;  1R6B X;  1IY1 A;  2Z7J A;  4MGY E;  3L29 A;  3GLF A;  1HNW M;  4LGY A;  4LY6 A;  3ZCB B;  4LFA M;  4FD2 A;  4JI7 M;  1IN4 A;  3T1H M;  5IWA M;  2Y0T A;  3VK7 A;  2VII A;  2J7N A;  3U6L A;  4GC5 A;  4S12 A;  1GL7 A;  1N77 A;  5FTN A;  1ZAE A;  4JI2 M;  1EE8 A;  2FFJ A;  2K47 A;  3B9P A;  1XMO M;  2YFQ A;  4JI5 M;  1IXS B;  4HL4 A;  4CGY B;  5ITY A;  3VDU A;  3I51 A;  4M9S A;  1TH2 A;  2HHH M;  4XGI A;  5KO3 A;  5EP2 A;  2DWN A;  2R65 A;  3KOX E;  2NQ8 C;  2ZAM A;  3KOY E;  1XXH A;  1DGH A;  2C9C A;  2UXC M;  1OFH A;  3U60 A;  4BLC A;  4R3D A;  2C96 A;  5ITT A;  3E4R A;  3HHX A;  4II7 A;  3TWK A;  2I7N A;  1N33 M;  1FJG M;  1J5E M;  3GRY A;  2CV0 A;  4G4Q A;  1OJL A;  4MB7 A;  1N36 M;  4YHH M;  3U6S A;  1D2N A;  1Q39 A;  4DV1 M;  1GKI A;  3U61 B;  4XBO A;  1DGF A;  2KZS A;  2EUC A;  2CHG A;  1QAQ A;  2QBY A;  1IN8 A;  4DR1 M;  2C9O A;  2Q2E B;  2DXI A;  3GQ4 A;  4LJ9 A;  2BJV A;  1QAM A;  1TH3 A;  2V1U A;  3RGS A;  5LMU M;  1KYI A;  1QQW A;  2QPA A;  3W0L B;  3T38 A;  4DUZ M;  4JI0 M;  4GMQ A;  3NWL A;  4NRV A;  3GLG B;  3HU3 A;  3W0F A;  1IM2 A;  3GLG A;  3LQQ A;  1E9S A;  3M6A A;  2ZAN A;  3H4M A;  4IJF A;  1N34 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...