2LVOC

Structure of the gp78cue domain bound to monubiquitin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/ligase
total genus 14
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvoC00
1MN3A 5JI2E 2JP7A 2B3TA 1NV9A 2OOBA 1C7YA 2O25A 2CP8A 1VDLA 2G3QA 1ZMVA 1T6OA 2LVAA 3K9PA 1KYIA 3GLHE 1ZMWA 3K9OA 1Q02A 2OO9A 1VQ1A 1G3IA 1JR3E 4Q7JA 2JNHA 1VEKA 2CWBA 2JZ0A 2HWJA 2DAKA 3MMPA 2OOAA 1WGNA 1P3QQ 1HT2E 1OTRA 3B89A 3E21A 2JY6B 2DAIA 2K9DA 1Y8GA 3H4JA 3F92A 3LCVB 2KNVA 2MJ5B 2BWEA 3E46A 2EKKA 1F4IA 1WR1B 1WHCA 3BBZA 2ZTDA 1DO0A 1E94E 3FRIA 2KHHA 2JY7A 1TR8A 1GO5A 4R71A 2HAKA 1HQYE 4DBGB 1PGYA 4UN2B 1IXSA 2LVOC 1CUKA 1DV0A 1XXHE 1XB2B 3LCUA 5DFLA 2LTUA 2JY5A 2JUJA 1OKSA 4F2LA 1NV8A 3GLIE 4HEOA 1QZEA 1OQYA 1BVSA 1R4GA 2L2DA 2H5XA 2JY8A 2DKLA 1IFYA 2QSFX 2KNAA 2MR9A 2MROB 2DZLA 2LVPC 4G3OA 1G4AE 2L4FA 1OAIA 1WGLA 2JZ1A 2QHOB 2DAEA 2L4EA 3IHPA 3FRHA 2DAMA 1VG5A 2LBCA 4WP2A 1HJPA 2EJSA 1WIVA 2WZJA 2DI0A 2QNJA 4GEWA 1TTEA 3FE3A 3IECA 3GLFE 1V92A 2LVNC 2K0BX 1VEGA 1T43A 1WJ7A 2KNZA 1SG9A 2EKFA 1YLAA 1VEJA 1ZMUA 2ZTCA 4F1IA 2BWBA 1G41A 2MGWA 1DO2A 1AIPC 2R0IA 1ZV1A 1IM2A 2DENA 2RRUA 2LVQD 1UFZA 2DAGA 2DHYA 3T6PA 1A5TA 1EFUB 2DNAA 3GLGE 1HT1E
chains in the Genus database with same CATH superfamily
3GLHB 5KPRA 3TQSA 5JI2E 4OVZB 4QOSA 2F5NA 3U6SA 2L7IA 5A2QS 4BB9A 4Z8XA 3LVWA 4IBGA 4AW4A 3U6DA 1C7YA 1VDLA 3GPPA 3DA1A 4LF7M 4IBJA 1XNQM 1R2ZA 2QENA 1SXJC 1DGGA 1SXJA 1ZMVA 1T6OA 1PJIA 4GITA 1N33M 3V76A 1ZMWA 1JR3A 1NSFA 2XH9A 3FKEA 2OO9A 1ZQ9A 4GH9A 4LCBA 1G59A 3SAUA 1H6UA 3IG5A 3AOEC 1VEKA 3AOEA 2JZ0A 3FTDA 3MMPA 1HT2E 4FVMA 2A5YB 4FWHA 4LJ9A 2JY6B 1TH3A 2DAIA 2K9DA 3GPXA 3SAWA 4LF5M 3WHLA 3JR5A 4D81A 3LVVA 1N77A 3IG8A 4OU7A 4AG5A 3SC3A 2XGNA 3MK6A 1QVRA 2KNVA 2G5GX 4CIZA 2I7NA 3D8LA 4LFBM 1GVNA 3K2LA 1IN4A 4NRVA 1WR1B 1WHCA 1PM5A 1PJSA 4XGIA 1D0KA 5FTJA 4GHAA 3RFWA 4AKGA 3U60B 3D8BA 1NY5A 3SYLA 1E94E 1XWIA 3I01M 5EP1A 5IZ7D 1TR8A 2Y0QA 2F5OA 1GLNA 4KO8A 2JWSA 5KPZA 2M5ZA 4HLQA 2X49A 4UN2B 4FWGA 2LVOC 3KOZE 4LFAM 5F3WA 2CV2A 2C96A 3LCUA 5FTKA 4D80A 5GKNA 2YQZA 3GRUA 1JQJC 3AOGA 1J7KA 3I51A 1W5TA 4FCVA 1OKSA 2ZANA 3EIEA 3GRRA 2J7NA 4W5WA 3GLIE 3B7ZA 1IXZA 5EP3A 2QPAA 1R4GA 2C9CA 2I7PA 5ITUA 2Z4RA 2CHQA 3L29A 3HU2A 3UJNA 2DKLA 2HHHM 1IFYA 2F5SA 3C3EA 1QUSA 2HL7A 2KNAA 4LF4M 1YE9A 1XNRM 4I5SA 1G4AE 2OQ4A 2JZ1A 2AHMA 2Z7JA 1L2CA 1DGHA 4KODA 1K82A 3IHPA 4NL4H 2CUZA 4R7GA 2O01F 3KS4A 4II7A 1TH2A 3GPUA 1MJGM 3TWMA 1YSYA 2R46A 3I4VA 3KOXE 4CISA 3QYEA 2EA0A 2K6BA 4B3MM 3K92A 3GLFE 3KSJA 3PXGA 2NQ8C 2JA2A 2LVNC 3HHYA 4I8OA 3U61A 1VEGA 2R65A 1T43A 4IBIA 1HQCA 1QAMA 3J81S 1K3XA 4NSRA 2W82A 3HX3A 2QP9X 2FFJA 1LTMA 4L6V6 3U5ZB 1QDTA 4IBBA 2R62A 3SMSA 2D7GA 1DO2A 1AIPC 3E4RA 1D0LA 1IM2A 3HWSA 1PJQA 2LVQD 1UFZA 1QAQA 2BNKA 3J80S 2DAGA 3C58A 4DV3M 3T6PA 4GKJM 1A5TA 1X37A 1OIZA 1N32M 3VDPA 5JI3E 4GC5A 3KFUG 4FWDA 1HT1E 1EE8A 2V6ZM 4S12A 3W0FA 4RF1A 3U6LA 4ANRA 4D82A 3L26A 2Y20A 4CJ6A 1SXJB 4AZFA 4LFCM 1PJJA 4KHPM 4DR2M 4OX9M 2G3QA 4GIPA 3U6MA 2YR0A 3GRVA 4LG2A 2UXDM 1QANA 1L2BA 2VIIA 3GQ5A 4IBCA 2FOIC 2ZAOA 3ZCBB 1L8QA 2R45A 3SMPA 1HNWM 4GHLA 4IJFA 1Q02A 3HY5A 4MGHA 3FTEA 3KW6A 4Q7JA 4LJ5A 3PNVA 3R8FA 2R4EA 3KOWE 3KVWA 1Q39A 4I4LA 1N78A 1OTRA 3A45A 3B89A 3GO8A 4RNAA 1L1ZA 5EP2A 1G71A 4DR1M 7CATA 3SBJA 3SARA 1Y8GA 3DZDA 2KZUA 3DFZA 5L8RF 1IY1A 3OTOM 1WXQA 4IBKA 3LCVB 2X4AA 4M9ZA 2GQFA 4G6ZA 1HR0M 2APLA 2V1UA 2H1RA 1T3TA 3VFDA 4G4QA 1N75A 1TH4A 2M60A 4LF6M 1IBKM 2DXIA 4L4UA 1DO0A 4DR3M 1QUTA 3ZQJA 4PD2A 2HCBA 4YHHM 3MJ5A 1GO5A 2J7OA 3CF2A 1NJFA 4XK8F 3FTFA 5C1BA 2BJVA 2XF3A 3NWLA 4L78A 2FH0A 5ITQA 2ZBKB 4ZPXA 4A3VB 4G4OA 4LF9M 4DV2M 4FCTA 4L8RC 3GLIA 2DZOB 3FTCA 2JUJA 2LHCA 3THGA 3VDUA 5C18A 4JI5M 3J7BA 3T1YM 5EXTA 5E6JA 5IREB 4QNRA 2JXNA 1NNUC 1QZEA 4PCZA 4P17A 1TDZA 1GL6A 2L2DA 2C98A 4JXJA 4NXNM 2H5XA 1Z6TA 2JY8A 4LJ6A 1XXHB 1XMOM 1IXSB 3T38A 2LVPC 2C99A 3GLGA 1XC8A 2L4FA 2QCUA 2KZSA 3VK7A 1JB0F 2HKJA 2L4EA 2XEPA 3FRHA 3AJIB 2LHGA 3LQQA 4YY3M 3CTWB 1GABA 3GLFA 4PDIA 4GEWA 3HHZA 1QAOA 1DGBA 5ITYA 3T15A 1J5EM 2DWLA 3KP1E 4LRSA 2XSZA 3U6CA 3QWLA 4MGYE 4OVZA 1E32A 1J09A 1N34M 2QBYB 4ITQA 1IY2A 4DUZM 2R6FA 2EKFA 4DV5M 1VEJA 1QYRA 3SAVA 4JI0M 2GNOA 2KRKA 4FW9A 4DR5M 3HZJA 4M0DA 4CHTB 1C1KA 5FLXS 4B3RM 3HJSA 3LMMA 1ZV1A 2DENA 2RRUA 3KDSE 3RGSA 8CATA 2Q2EB 3GRYA 1FNNA 2ZAMA 1Q3CA 4I81A 1EFUB 1XHBA 1GJSA 3SFZA 3GLGE 4X65M 4DR7M 3KXEC 1MN3A 2KXEA 3AL0C 2B3TA 4JI4M 3R9XB 1XMQM 2R44A 1V33A 2O25A 1EIJA 2DZNB 2L7HA 3UK6A 3LW5F 4DV1M 3K9PA 1KYIA 1R5LA 3GLHE 3K9OA 4LJ8A 4XBOA 3FYDA 3JR4A 4MGZE 3I4YA 3U60A 4JN6A 2JNHA 3FUUA 3HJ8A 5FSWA 4JV5M 2HWJA 4IBEA 3VK8A 2OOAA 3M7GA 4BLCA 1P3QQ 1V34A 5ITXE 2UXCM 3Q8XA 4REZA 4RKUF 4JI8M 2DHRA 2QQ8A 4X66M 3ILKA 1TGUA 3GP1A 3HKPA 1R2YA 5FTLA 3E9SA 3B7NA 2BJWA 4G4RA 2MJ5B 2XLJA 1IXRC 1NO1A 2BWEA 2CV1A 1PJTA 3SYKA 3U6QA 1W5SA 1SXJD 2J5YA 4NRWA 2WSCF 2DWMA 2DVWB 4QHTA 2KEBA 4M9SA 1D0MA 1JR3D 3QAUA 5DYIA 2DWNA 2CRUA 4B7GA 3UGJA 2F5QA 3FRIA 2KHHA 2WSFF 3VKHA 5DYGA 4R71A 3CGWA 2N35A 2HAKA 4DBGB 4QOZC 4GKKM 1IY0A 5DNYA 2XZFA 4KLNA 3GLIB 1ORYB 1GL7A 1PGYA 3UZUA 4HL4A 4DR6M 3PFIA 2CEAA 2XZUA 4CGYB 1XXHE 1XB2B 1YUBA 5DFLA 3SATA 1E9RA 5IT9S 1QDRA 3J27B 2UUCM 3UMMA 4AQYM 4KT0F 4MB7A 3L27A 5EP4A 4DV4M 4LGMA 3HHWA 5BR8M 4NXMM 2D7HA 3AV0A 3B9PA 4GC9A 1AUAA 3FUXA 4LF8M 1OFHA 2EO2A 2R4JA 1HNZM 4MH0E 2QZ4A 2LH0A 5E26A 3J7AS 1IN7A 3BOSA 4WURA 5EXXA 4K0KM 2QSFX 2Z8YM 1G8PA 3HU1A 3A46A 3U5ZA 1Z5BA 1IN8A 1GJTA 1KSFX 2DZLA 2FS1A 2YNMD 4RF0A 1OAIA 1WGLA 2QHOB 4B7FA 2DAEA 3M0EA 4JI7M 1R7RA 4X64M 4Y28F 4AKIA 1VG5A 2LBCA 4WP2A 2EJSA 2Y21A 4GMQA 3PVSA 1I4WA 2OPFA 1WIVA 3WHKA 2WZJA 3HJQA 5LMUM 2QNJA 1E9SA 2VQFM 1TF0B 2XSZD 3FE3A 2R18A 2P5TA 3IECA 4B3TM 1HNXM 4JI6M 1QQWA 1V92A 2FE8A 4QHSA 4WW0A 2K0BX 1PRBA 2F4VM 4AG6A 3Q8GA 2KNZA 1SG9A 1K3WA 1OJLA 2ZTCA 1Z59A 1G41A 5ITRA 2UUAM 1DGHB 2ERCA 2KW0A 1NJGA 4NC6A 1Z5AA 1NY6A 1VDDA 2VQEM 2VF7A 2YFQA 1NNJA 1QZMA 5KPTA 4JI3M 2DHYA 3I04M 2RGOA 3KS8A 4DV0M 3FUTA 4Z6YA 3A98B 1NHGC 3KOYE 2UUBM 1S3SA 2RGHA 4IBFA 2UXBM 2JP7A 1RU3A 3TPZA 3AKZA 3U6EA 3U61B 3L28A 1NV9A 3NBXX 2OOBA 2CP8A 4P16A 3TWKA 3VKGA 3GLHA 5ITTA 5H37D 1OFIA 1ZAEA 2CHGA 1IBMM 4GRIA 3GQ3A 2FNAA 4JI2M 2LVAA 2K47A 2CHVA 1IN5A 1SXJE 3ZC7B 4B08A 4IBDA 1VQ1A 4OW0A 3JAMS 1G3IA 1JR3E 4AKHA 2D7EA 2LWXA 2CWBA 5ITXA 2ZM6M 2DAKA 1N36M 2XFTA 3T1HM 1KFVA 1WGNA 3E21A 5IWAM 5KO3A 2LXEA 4JI1M 1UM8A 4DUYM 5EJCA 4PT5A 1L2DA 4MGIE 3H4JA 2UU9M 3SHGB 3F92A 4LZZA 2CE7A 2KRUA 3M6AA 3NBIA 5LMNM 3EIHA 2XFSA 4L15A 3E46A 2DWZB 3K1JA 2EKKA 1F4IA 4LJ7A 4AI6A 3GPYA 3BBZA 5KQ8A 2ZTDA 2C5RA 3B7QA 3FYCA 1NVMA 2Z4SA 2RKOA 2JY7A 3GQ4A 3A42A 2G8LA 1Z5CA 1HQYE 4IJEA 4LJ4A 4FCWA 3TL4X 2C9OA 1XXHA 2E5LM 2F5PA 1IXSA 3MHVC 1CUKA 2VF8A 3W68A 2CV0A 3RGPA 5BPVA 1DV0A 2CFOA 3KP0E 2LTUA 4TUWA 5KQDA 2JY5A 1IBLM 4G4NA 3HU3A 4MGKE 2LNHC 1MX0A 4NOOB 2VDBB 5FTMA 4F2LA 2WSEF 4DV6M 1NV8A 3FUVA 3KSXA 4IIWA 3TE6A 3SASA 1OAOC 4HEOA 4LRTA 5EXSA 2X8AA 1OQYA 1BVSA 2O5RA 3PNYA 4LZJA 3FUWA 3HHXA 2QBYA 1D2NA 3H4MA 2MR9A 3AFHA 1GKIA 4G3OA 4B3SM 3FD9A 1IN6A 1I94M 4M0WA 2DAMA 3HGIA 1DGFA 1HJPA 4M9XA 3W0LB 1LV7A 3TWLA 4PDGA 4DR4M 3BXWA 2DI0A 4LGYA 3L2AA 2EUCA 3SHFA 3RE8A 4EIWA 1TTEA 4BBAA 1TDHA 5FTNA 4LY6A 5EQTA 1FJGM 2MH8A 4FD2A 1MU5A 1IQPA 4QNMA 3DOAA 1WJ7A 4LJAA 2L09A 3VLFB 3ZH9B 1YLAA 1NHWC 1ZMUA 2KA6B 3LQRA 3L25A 3CF6E 5EXPA 1R6BX 3U6PA 3GLGB 3CF0A 2BWBA 1Q3BA 2MGWA 4L16A 4F1IA 4X62M 3B74A 3C3DA 2R0IA 3U6OA 4JYAM 2Y0TA 4R3DA 3W67A 1OIPA 4B7HA 3J2PB 4MM3B 2Z3XA 3GLFB 1L1TA 2KDLA 2L6OA 2DNAA 4NSOB 3QYBA 3K8ZA 2MROB 4DV7M 3C9PA 2V1CA
chains in the Genus database with same CATH topology
1MN3A 5JI2E 2JP7A 2B3TA 1NV9A 2OOBA 1C7YA 2O25A 2CP8A 1VDLA 2G3QA 1ZMVA 1T6OA 2LVAA 3K9PA 1KYIA 3GLHE 1ZMWA 3K9OA 1Q02A 2OO9A 1VQ1A 1G3IA 1JR3E 4Q7JA 2JNHA 1VEKA 2CWBA 2JZ0A 2HWJA 2DAKA 3MMPA 2OOAA 1WGNA 1P3QQ 1HT2E 1OTRA 3B89A 3E21A 2JY6B 2DAIA 2K9DA 1Y8GA 3H4JA 3F92A 3LCVB 2KNVA 2MJ5B 2BWEA 3E46A 2EKKA 1F4IA 1WR1B 1WHCA 3BBZA 2ZTDA 1DO0A 1E94E 3FRIA 2KHHA 2JY7A 1TR8A 1GO5A 4R71A 2HAKA 1HQYE 4DBGB 1PGYA 4UN2B 1IXSA 2LVOC 1CUKA 1DV0A 1XXHE 1XB2B 3LCUA 5DFLA 2LTUA 2JY5A 2JUJA 1OKSA 4F2LA 1NV8A 3GLIE 4HEOA 1QZEA 1OQYA 1BVSA 1R4GA 2L2DA 2H5XA 2JY8A 2DKLA 1IFYA 2QSFX 2KNAA 2MR9A 2MROB 2DZLA 2LVPC 4G3OA 1G4AE 2L4FA 1OAIA 1WGLA 2JZ1A 2QHOB 2DAEA 2L4EA 3IHPA 3FRHA 2DAMA 1VG5A 2LBCA 4WP2A 1HJPA 2EJSA 1WIVA 2WZJA 2DI0A 2QNJA 4GEWA 1TTEA 3FE3A 3IECA 3GLFE 1V92A 2LVNC 2K0BX 1VEGA 1T43A 1WJ7A 2KNZA 1SG9A 2EKFA 1YLAA 1VEJA 1ZMUA 2ZTCA 4F1IA 2BWBA 1G41A 2MGWA 1DO2A 1AIPC 2R0IA 1ZV1A 1IM2A 2DENA 2RRUA 2LVQD 1UFZA 2DAGA 2DHYA 3T6PA 1A5TA 1EFUB 2DNAA 3GLGE 1HT1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MN3 A;  5JI2 E;  2JP7 A;  2B3T A;  1NV9 A;  2OOB A;  1C7Y A;  2O25 A;  2CP8 A;  1VDL A;  2G3Q A;  1ZMV A;  1T6O A;  2LVA A;  3K9P A;  1KYI A;  3GLH E;  1ZMW A;  3K9O A;  1Q02 A;  2OO9 A;  1VQ1 A;  1G3I A;  1JR3 E;  4Q7J A;  2JNH A;  1VEK A;  2CWB A;  2JZ0 A;  2HWJ A;  2DAK A;  3MMP A;  2OOA A;  1WGN A;  1P3Q Q;  1HT2 E;  1OTR A;  3B89 A;  3E21 A;  2JY6 B;  2DAI A;  2K9D A;  1Y8G A;  3H4J A;  3F92 A;  3LCV B;  2KNV A;  2MJ5 B;  2BWE A;  3E46 A;  2EKK A;  1F4I A;  1WR1 B;  1WHC A;  3BBZ A;  2ZTD A;  1DO0 A;  1E94 E;  3FRI A;  2KHH A;  2JY7 A;  1TR8 A;  1GO5 A;  4R71 A;  2HAK A;  1HQY E;  4DBG B;  1PGY A;  4UN2 B;  1IXS A;  2LVO C;  1CUK A;  1DV0 A;  1XXH E;  1XB2 B;  3LCU A;  5DFL A;  2LTU A;  2JY5 A;  2JUJ A;  1OKS A;  4F2L A;  1NV8 A;  3GLI E;  4HEO A;  1QZE A;  1OQY A;  1BVS A;  1R4G A;  2L2D A;  2H5X A;  2JY8 A;  2DKL A;  1IFY A;  2QSF X;  2KNA A;  2MR9 A;  2MRO B;  2DZL A;  2LVP C;  4G3O A;  1G4A E;  2L4F A;  1OAI A;  1WGL A;  2JZ1 A;  2QHO B;  2DAE A;  2L4E A;  3IHP A;  3FRH A;  2DAM A;  1VG5 A;  2LBC A;  4WP2 A;  1HJP A;  2EJS A;  1WIV A;  2WZJ A;  2DI0 A;  2QNJ A;  4GEW A;  1TTE A;  3FE3 A;  3IEC A;  3GLF E;  1V92 A;  2LVN C;  2K0B X;  1VEG A;  1T43 A;  1WJ7 A;  2KNZ A;  1SG9 A;  2EKF A;  1YLA A;  1VEJ A;  1ZMU A;  2ZTC A;  4F1I A;  2BWB A;  1G41 A;  2MGW A;  1DO2 A;  1AIP C;  2R0I A;  1ZV1 A;  1IM2 A;  2DEN A;  2RRU A;  2LVQ D;  1UFZ A;  2DAG A;  2DHY A;  3T6P A;  1A5T A;  1EFU B;  2DNA A;  3GLG E;  1HT1 E; 
#chains in the Genus database with same CATH topology
 3GLH B;  5KPR A;  3TQS A;  5JI2 E;  4OVZ B;  4QOS A;  2F5N A;  3U6S A;  2L7I A;  5A2Q S;  4BB9 A;  4Z8X A;  3LVW A;  4IBG A;  4AW4 A;  3U6D A;  1C7Y A;  1VDL A;  3GPP A;  3DA1 A;  4LF7 M;  4IBJ A;  1XNQ M;  1R2Z A;  2QEN A;  1SXJ C;  1DGG A;  1SXJ A;  1ZMV A;  1T6O A;  1PJI A;  4GIT A;  1N33 M;  3V76 A;  1ZMW A;  1JR3 A;  1NSF A;  2XH9 A;  3FKE A;  2OO9 A;  1ZQ9 A;  4GH9 A;  4LCB A;  1G59 A;  3SAU A;  1H6U A;  3IG5 A;  3AOE C;  1VEK A;  3AOE A;  2JZ0 A;  3FTD A;  3MMP A;  1HT2 E;  4FVM A;  2A5Y B;  4FWH A;  4LJ9 A;  2JY6 B;  1TH3 A;  2DAI A;  2K9D A;  3GPX A;  3SAW A;  4LF5 M;  3WHL A;  3JR5 A;  4D81 A;  3LVV A;  1N77 A;  3IG8 A;  4OU7 A;  4AG5 A;  3SC3 A;  2XGN A;  3MK6 A;  1QVR A;  2KNV A;  2G5G X;  4CIZ A;  2I7N A;  3D8L A;  4LFB M;  1GVN A;  3K2L A;  1IN4 A;  4NRV A;  1WR1 B;  1WHC A;  1PM5 A;  1PJS A;  4XGI A;  1D0K A;  5FTJ A;  4GHA A;  3RFW A;  4AKG A;  3U60 B;  3D8B A;  1NY5 A;  3SYL A;  1E94 E;  1XWI A;  3I01 M;  5EP1 A;  5IZ7 D;  1TR8 A;  2Y0Q A;  2F5O A;  1GLN A;  4KO8 A;  2JWS A;  5KPZ A;  2M5Z A;  4HLQ A;  2X49 A;  4UN2 B;  4FWG A;  2LVO C;  3KOZ E;  4LFA M;  5F3W A;  2CV2 A;  2C96 A;  3LCU A;  5FTK A;  4D80 A;  5GKN A;  2YQZ A;  3GRU A;  1JQJ C;  3AOG A;  1J7K A;  3I51 A;  1W5T A;  4FCV A;  1OKS A;  2ZAN A;  3EIE A;  3GRR A;  2J7N A;  4W5W A;  3GLI E;  3B7Z A;  1IXZ A;  5EP3 A;  2QPA A;  1R4G A;  2C9C A;  2I7P A;  5ITU A;  2Z4R A;  2CHQ A;  3L29 A;  3HU2 A;  3UJN A;  2DKL A;  2HHH M;  1IFY A;  2F5S A;  3C3E A;  1QUS A;  2HL7 A;  2KNA A;  4LF4 M;  1YE9 A;  1XNR M;  4I5S A;  1G4A E;  2OQ4 A;  2JZ1 A;  2AHM A;  2Z7J A;  1L2C A;  1DGH A;  4KOD A;  1K82 A;  3IHP A;  4NL4 H;  2CUZ A;  4R7G A;  2O01 F;  3KS4 A;  4II7 A;  1TH2 A;  3GPU A;  1MJG M;  3TWM A;  1YSY A;  2R46 A;  3I4V A;  3KOX E;  4CIS A;  3QYE A;  2EA0 A;  2K6B A;  4B3M M;  3K92 A;  3GLF E;  3KSJ A;  3PXG A;  2NQ8 C;  2JA2 A;  2LVN C;  3HHY A;  4I8O A;  3U61 A;  1VEG A;  2R65 A;  1T43 A;  4IBI A;  1HQC A;  1QAM A;  3J81 S;  1K3X A;  4NSR A;  2W82 A;  3HX3 A;  2QP9 X;  2FFJ A;  1LTM A;  4L6V 6;  3U5Z B;  1QDT A;  4IBB A;  2R62 A;  3SMS A;  2D7G A;  1DO2 A;  1AIP C;  3E4R A;  1D0L A;  1IM2 A;  3HWS A;  1PJQ A;  2LVQ D;  1UFZ A;  1QAQ A;  2BNK A;  3J80 S;  2DAG A;  3C58 A;  4DV3 M;  3T6P A;  4GKJ M;  1A5T A;  1X37 A;  1OIZ A;  1N32 M;  3VDP A;  5JI3 E;  4GC5 A;  3KFU G;  4FWD A;  1HT1 E;  1EE8 A;  2V6Z M;  4S12 A;  3W0F A;  4RF1 A;  3U6L A;  4ANR A;  4D82 A;  3L26 A;  2Y20 A;  4CJ6 A;  1SXJ B;  4AZF A;  4LFC M;  1PJJ A;  4KHP M;  4DR2 M;  4OX9 M;  2G3Q A;  4GIP A;  3U6M A;  2YR0 A;  3GRV A;  4LG2 A;  2UXD M;  1QAN A;  1L2B A;  2VII A;  3GQ5 A;  4IBC A;  2FOI C;  2ZAO A;  3ZCB B;  1L8Q A;  2R45 A;  3SMP A;  1HNW M;  4GHL A;  4IJF A;  1Q02 A;  3HY5 A;  4MGH A;  3FTE A;  3KW6 A;  4Q7J A;  4LJ5 A;  3PNV A;  3R8F A;  2R4E A;  3KOW E;  3KVW A;  1Q39 A;  4I4L A;  1N78 A;  1OTR A;  3A45 A;  3B89 A;  3GO8 A;  4RNA A;  1L1Z A;  5EP2 A;  1G71 A;  4DR1 M;  7CAT A;  3SBJ A;  3SAR A;  1Y8G A;  3DZD A;  2KZU A;  3DFZ A;  5L8R F;  1IY1 A;  3OTO M;  1WXQ A;  4IBK A;  3LCV B;  2X4A A;  4M9Z A;  2GQF A;  4G6Z A;  1HR0 M;  2APL A;  2V1U A;  2H1R A;  1T3T A;  3VFD A;  4G4Q A;  1N75 A;  1TH4 A;  2M60 A;  4LF6 M;  1IBK M;  2DXI A;  4L4U A;  1DO0 A;  4DR3 M;  1QUT A;  3ZQJ A;  4PD2 A;  2HCB A;  4YHH M;  3MJ5 A;  1GO5 A;  2J7O A;  3CF2 A;  1NJF A;  4XK8 F;  3FTF A;  5C1B A;  2BJV A;  2XF3 A;  3NWL A;  4L78 A;  2FH0 A;  5ITQ A;  2ZBK B;  4ZPX A;  4A3V B;  4G4O A;  4LF9 M;  4DV2 M;  4FCT A;  4L8R C;  3GLI A;  2DZO B;  3FTC A;  2JUJ A;  2LHC A;  3THG A;  3VDU A;  5C18 A;  4JI5 M;  3J7B A;  3T1Y M;  5EXT A;  5E6J A;  5IRE B;  4QNR A;  2JXN A;  1NNU C;  1QZE A;  4PCZ A;  4P17 A;  1TDZ A;  1GL6 A;  2L2D A;  2C98 A;  4JXJ A;  4NXN M;  2H5X A;  1Z6T A;  2JY8 A;  4LJ6 A;  1XXH B;  1XMO M;  1IXS B;  3T38 A;  2LVP C;  2C99 A;  3GLG A;  1XC8 A;  2L4F A;  2QCU A;  2KZS A;  3VK7 A;  1JB0 F;  2HKJ A;  2L4E A;  2XEP A;  3FRH A;  3AJI B;  2LHG A;  3LQQ A;  4YY3 M;  3CTW B;  1GAB A;  3GLF A;  4PDI A;  4GEW A;  3HHZ A;  1QAO A;  1DGB A;  5ITY A;  3T15 A;  1J5E M;  2DWL A;  3KP1 E;  4LRS A;  2XSZ A;  3U6C A;  3QWL A;  4MGY E;  4OVZ A;  1E32 A;  1J09 A;  1N34 M;  2QBY B;  4ITQ A;  1IY2 A;  4DUZ M;  2R6F A;  2EKF A;  4DV5 M;  1VEJ A;  1QYR A;  3SAV A;  4JI0 M;  2GNO A;  2KRK A;  4FW9 A;  4DR5 M;  3HZJ A;  4M0D A;  4CHT B;  1C1K A;  5FLX S;  4B3R M;  3HJS A;  3LMM A;  1ZV1 A;  2DEN A;  2RRU A;  3KDS E;  3RGS A;  8CAT A;  2Q2E B;  3GRY A;  1FNN A;  2ZAM A;  1Q3C A;  4I81 A;  1EFU B;  1XHB A;  1GJS A;  3SFZ A;  3GLG E;  4X65 M;  4DR7 M;  3KXE C;  1MN3 A;  2KXE A;  3AL0 C;  2B3T A;  4JI4 M;  3R9X B;  1XMQ M;  2R44 A;  1V33 A;  2O25 A;  1EIJ A;  2DZN B;  2L7H A;  3UK6 A;  3LW5 F;  4DV1 M;  3K9P A;  1KYI A;  1R5L A;  3GLH E;  3K9O A;  4LJ8 A;  4XBO A;  3FYD A;  3JR4 A;  4MGZ E;  3I4Y A;  3U60 A;  4JN6 A;  2JNH A;  3FUU A;  3HJ8 A;  5FSW A;  4JV5 M;  2HWJ A;  4IBE A;  3VK8 A;  2OOA A;  3M7G A;  4BLC A;  1P3Q Q;  1V34 A;  5ITX E;  2UXC M;  3Q8X A;  4REZ A;  4RKU F;  4JI8 M;  2DHR A;  2QQ8 A;  4X66 M;  3ILK A;  1TGU A;  3GP1 A;  3HKP A;  1R2Y A;  5FTL A;  3E9S A;  3B7N A;  2BJW A;  4G4R A;  2MJ5 B;  2XLJ A;  1IXR C;  1NO1 A;  2BWE A;  2CV1 A;  1PJT A;  3SYK A;  3U6Q A;  1W5S A;  1SXJ D;  2J5Y A;  4NRW A;  2WSC F;  2DWM A;  2DVW B;  4QHT A;  2KEB A;  4M9S A;  1D0M A;  1JR3 D;  3QAU A;  5DYI A;  2DWN A;  2CRU A;  4B7G A;  3UGJ A;  2F5Q A;  3FRI A;  2KHH A;  2WSF F;  3VKH A;  5DYG A;  4R71 A;  3CGW A;  2N35 A;  2HAK A;  4DBG B;  4QOZ C;  4GKK M;  1IY0 A;  5DNY A;  2XZF A;  4KLN A;  3GLI B;  1ORY B;  1GL7 A;  1PGY A;  3UZU A;  4HL4 A;  4DR6 M;  3PFI A;  2CEA A;  2XZU A;  4CGY B;  1XXH E;  1XB2 B;  1YUB A;  5DFL A;  3SAT A;  1E9R A;  5IT9 S;  1QDR A;  3J27 B;  2UUC M;  3UMM A;  4AQY M;  4KT0 F;  4MB7 A;  3L27 A;  5EP4 A;  4DV4 M;  4LGM A;  3HHW A;  5BR8 M;  4NXM M;  2D7H A;  3AV0 A;  3B9P A;  4GC9 A;  1AUA A;  3FUX A;  4LF8 M;  1OFH A;  2EO2 A;  2R4J A;  1HNZ M;  4MH0 E;  2QZ4 A;  2LH0 A;  5E26 A;  3J7A S;  1IN7 A;  3BOS A;  4WUR A;  5EXX A;  4K0K M;  2QSF X;  2Z8Y M;  1G8P A;  3HU1 A;  3A46 A;  3U5Z A;  1Z5B A;  1IN8 A;  1GJT A;  1KSF X;  2DZL A;  2FS1 A;  2YNM D;  4RF0 A;  1OAI A;  1WGL A;  2QHO B;  4B7F A;  2DAE A;  3M0E A;  4JI7 M;  1R7R A;  4X64 M;  4Y28 F;  4AKI A;  1VG5 A;  2LBC A;  4WP2 A;  2EJS A;  2Y21 A;  4GMQ A;  3PVS A;  1I4W A;  2OPF A;  1WIV A;  3WHK A;  2WZJ A;  3HJQ A;  5LMU M;  2QNJ A;  1E9S A;  2VQF M;  1TF0 B;  2XSZ D;  3FE3 A;  2R18 A;  2P5T A;  3IEC A;  4B3T M;  1HNX M;  4JI6 M;  1QQW A;  1V92 A;  2FE8 A;  4QHS A;  4WW0 A;  2K0B X;  1PRB A;  2F4V M;  4AG6 A;  3Q8G A;  2KNZ A;  1SG9 A;  1K3W A;  1OJL A;  2ZTC A;  1Z59 A;  1G41 A;  5ITR A;  2UUA M;  1DGH B;  2ERC A;  2KW0 A;  1NJG A;  4NC6 A;  1Z5A A;  1NY6 A;  1VDD A;  2VQE M;  2VF7 A;  2YFQ A;  1NNJ A;  1QZM A;  5KPT A;  4JI3 M;  2DHY A;  3I04 M;  2RGO A;  3KS8 A;  4DV0 M;  3FUT A;  4Z6Y A;  3A98 B;  1NHG C;  3KOY E;  2UUB M;  1S3S A;  2RGH A;  4IBF A;  2UXB M;  2JP7 A;  1RU3 A;  3TPZ A;  3AKZ A;  3U6E A;  3U61 B;  3L28 A;  1NV9 A;  3NBX X;  2OOB A;  2CP8 A;  4P16 A;  3TWK A;  3VKG A;  3GLH A;  5ITT A;  5H37 D;  1OFI A;  1ZAE A;  2CHG A;  1IBM M;  4GRI A;  3GQ3 A;  2FNA A;  4JI2 M;  2LVA A;  2K47 A;  2CHV A;  1IN5 A;  1SXJ E;  3ZC7 B;  4B08 A;  4IBD A;  1VQ1 A;  4OW0 A;  3JAM S;  1G3I A;  1JR3 E;  4AKH A;  2D7E A;  2LWX A;  2CWB A;  5ITX A;  2ZM6 M;  2DAK A;  1N36 M;  2XFT A;  3T1H M;  1KFV A;  1WGN A;  3E21 A;  5IWA M;  5KO3 A;  2LXE A;  4JI1 M;  1UM8 A;  4DUY M;  5EJC A;  4PT5 A;  1L2D A;  4MGI E;  3H4J A;  2UU9 M;  3SHG B;  3F92 A;  4LZZ A;  2CE7 A;  2KRU A;  3M6A A;  3NBI A;  5LMN M;  3EIH A;  2XFS A;  4L15 A;  3E46 A;  2DWZ B;  3K1J A;  2EKK A;  1F4I A;  4LJ7 A;  4AI6 A;  3GPY A;  3BBZ A;  5KQ8 A;  2ZTD A;  2C5R A;  3B7Q A;  3FYC A;  1NVM A;  2Z4S A;  2RKO A;  2JY7 A;  3GQ4 A;  3A42 A;  2G8L A;  1Z5C A;  1HQY E;  4IJE A;  4LJ4 A;  4FCW A;  3TL4 X;  2C9O A;  1XXH A;  2E5L M;  2F5P A;  1IXS A;  3MHV C;  1CUK A;  2VF8 A;  3W68 A;  2CV0 A;  3RGP A;  5BPV A;  1DV0 A;  2CFO A;  3KP0 E;  2LTU A;  4TUW A;  5KQD A;  2JY5 A;  1IBL M;  4G4N A;  3HU3 A;  4MGK E;  2LNH C;  1MX0 A;  4NOO B;  2VDB B;  5FTM A;  4F2L A;  2WSE F;  4DV6 M;  1NV8 A;  3FUV A;  3KSX A;  4IIW A;  3TE6 A;  3SAS A;  1OAO C;  4HEO A;  4LRT A;  5EXS A;  2X8A A;  1OQY A;  1BVS A;  2O5R A;  3PNY A;  4LZJ A;  3FUW A;  3HHX A;  2QBY A;  1D2N A;  3H4M A;  2MR9 A;  3AFH A;  1GKI A;  4G3O A;  4B3S M;  3FD9 A;  1IN6 A;  1I94 M;  4M0W A;  2DAM A;  3HGI A;  1DGF A;  1HJP A;  4M9X A;  3W0L B;  1LV7 A;  3TWL A;  4PDG A;  4DR4 M;  3BXW A;  2DI0 A;  4LGY A;  3L2A A;  2EUC A;  3SHF A;  3RE8 A;  4EIW A;  1TTE A;  4BBA A;  1TDH A;  5FTN A;  4LY6 A;  5EQT A;  1FJG M;  2MH8 A;  4FD2 A;  1MU5 A;  1IQP A;  4QNM A;  3DOA A;  1WJ7 A;  4LJA A;  2L09 A;  3VLF B;  3ZH9 B;  1YLA A;  1NHW C;  1ZMU A;  2KA6 B;  3LQR A;  3L25 A;  3CF6 E;  5EXP A;  1R6B X;  3U6P A;  3GLG B;  3CF0 A;  2BWB A;  1Q3B A;  2MGW A;  4L16 A;  4F1I A;  4X62 M;  3B74 A;  3C3D A;  2R0I A;  3U6O A;  4JYA M;  2Y0T A;  4R3D A;  3W67 A;  1OIP A;  4B7H A;  3J2P B;  4MM3 B;  2Z3X A;  3GLF B;  1L1T A;  2KDL A;  2L6O A;  2DNA A;  4NSO B;  3QYB A;  3K8Z A;  2MRO B;  4DV7 M;  3C9P A;  2V1C A; 
#chains in the Genus database with same CATH homology
 1MN3 A;  5JI2 E;  2JP7 A;  2B3T A;  1NV9 A;  2OOB A;  1C7Y A;  2O25 A;  2CP8 A;  1VDL A;  2G3Q A;  1ZMV A;  1T6O A;  2LVA A;  3K9P A;  1KYI A;  3GLH E;  1ZMW A;  3K9O A;  1Q02 A;  2OO9 A;  1VQ1 A;  1G3I A;  1JR3 E;  4Q7J A;  2JNH A;  1VEK A;  2CWB A;  2JZ0 A;  2HWJ A;  2DAK A;  3MMP A;  2OOA A;  1WGN A;  1P3Q Q;  1HT2 E;  1OTR A;  3B89 A;  3E21 A;  2JY6 B;  2DAI A;  2K9D A;  1Y8G A;  3H4J A;  3F92 A;  3LCV B;  2KNV A;  2MJ5 B;  2BWE A;  3E46 A;  2EKK A;  1F4I A;  1WR1 B;  1WHC A;  3BBZ A;  2ZTD A;  1DO0 A;  1E94 E;  3FRI A;  2KHH A;  2JY7 A;  1TR8 A;  1GO5 A;  4R71 A;  2HAK A;  1HQY E;  4DBG B;  1PGY A;  4UN2 B;  1IXS A;  2LVO C;  1CUK A;  1DV0 A;  1XXH E;  1XB2 B;  3LCU A;  5DFL A;  2LTU A;  2JY5 A;  2JUJ A;  1OKS A;  4F2L A;  1NV8 A;  3GLI E;  4HEO A;  1QZE A;  1OQY A;  1BVS A;  1R4G A;  2L2D A;  2H5X A;  2JY8 A;  2DKL A;  1IFY A;  2QSF X;  2KNA A;  2MR9 A;  2MRO B;  2DZL A;  2LVP C;  4G3O A;  1G4A E;  2L4F A;  1OAI A;  1WGL A;  2JZ1 A;  2QHO B;  2DAE A;  2L4E A;  3IHP A;  3FRH A;  2DAM A;  1VG5 A;  2LBC A;  4WP2 A;  1HJP A;  2EJS A;  1WIV A;  2WZJ A;  2DI0 A;  2QNJ A;  4GEW A;  1TTE A;  3FE3 A;  3IEC A;  3GLF E;  1V92 A;  2LVN C;  2K0B X;  1VEG A;  1T43 A;  1WJ7 A;  2KNZ A;  1SG9 A;  2EKF A;  1YLA A;  1VEJ A;  1ZMU A;  2ZTC A;  4F1I A;  2BWB A;  1G41 A;  2MGW A;  1DO2 A;  1AIP C;  2R0I A;  1ZV1 A;  1IM2 A;  2DEN A;  2RRU A;  2LVQ D;  1UFZ A;  2DAG A;  2DHY A;  3T6P A;  1A5T A;  1EFU B;  2DNA A;  3GLG E;  1HT1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...