2LVOC

Structure of the gp78cue domain bound to monubiquitin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/ligase
total genus 14
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvoC00
1OQYA 2MR9A 2KNAA 2HAKA 1IFYA 2MROB 2KNVA 2JP7A 2MGWA 2H5XA 2R0IA 3FE3A 1WGNA 1WIVA 3B89A 2JY6B 1G3IA 1HT1E 1WJ7A 2LVNC 3LCUA 3GLIE 1VEJA 3K9PA 2L2DA 1V92A 2BWBA 2DKLA 2HWJA 1R4GA 4GEWA 4DBGB 2DAEA 3IECA 2LVAA 2K0BX 2QHOB 3T6PA 2EJSA 2RRUA 2JUJA 2K9DA 2DI0A 2DAKA 1HJPA 3H4JA 4F2LA 1PGYA 2JY7A 1VDLA 2WZJA 1T6OA 1DO2A 2ZTDA 1EFUB 2JY8A 1VG5A 2JZ0A 2JNHA 1ZV1A 2JZ1A 2QSFX 3F92A 1WHCA 4F1IA 2OO9A 4WP2A 2MJ5B 1IXSA 1SG9A 2DENA 1C7YA 1G41A 1Y8GA 4Q7JA 3IHPA 3K9OA 2LBCA 1TR8A 4HEOA 1VQ1A 2KNZA 1P3QQ 2O25A 1JR3E 2QNJA 3GLGE 3GLHE 1IM2A 2OOBA 2CWBA 1ZMWA 1T43A 2EKKA 1HQYE 3LCVB 1AIPC 1UFZA 1E94E 2DAIA 2OOAA 1A5TA 3FRIA 2L4FA 4UN2B 1BVSA 1XXHE 2G3QA 1WR1B 2DNAA 1ZMUA 2LVOC 2LVQD 2L4EA 4G3OA 1OAIA 1ZMVA 3E46A 3FRHA 1WGLA 1VEGA 3GLFE 2JY5A 3BBZA 2EKFA 2ZTCA 3E21A 1CUKA 4R71A 1GO5A 2B3TA 1NV8A 1G4AE 2DAMA 1DV0A 2LTUA 1XB2B 1TTEA 3MMPA 5DFLA 2DAGA 1HT2E 5JI2E 2DHYA 1OTRA 1KYIA 1OKSA 2KHHA 1VEKA 1Q02A 2CP8A 1NV9A 1YLAA 1MN3A 1DO0A 2BWEA 2LVPC 1F4IA 1QZEA 2DZLA
chains in the Genus database with same CATH superfamily
3AJIB 1OQYA 2H1RA 4QOSA 5EJCA 2A5YB 4P17A 2KNVA 2JP7A 5EP4A 1JB0F 3NBXX 3GPYA 4DUYM 4JI8M 1Z5CA 4LF7M 3KSJA 1Z59A 4NXMM 3OTOM 2JY6B 1G3IA 3I51A 4II7A 1HT1E 2L09A 3RFWA 1IBLM 4L8RC 3GLIE 2VDBB 1VEJA 3K9PA 2CV0A 3KOXE 3HHYA 1R5LA 2BWBA 1L2BA 3U6LA 3K1JA 1NO1A 1JR3A 1PJSA 2ZANA 4DBGB 3J81S 2OPFA 5BR8M 3KVWA 4OVZB 3U6SA 1K3WA 2CFOA 3LMMA 2Y20A 1QAQA 1W5SA 2EJSA 4FW9A 4I8OA 4LZZA 2JUJA 3U61A 3U6MA 4JYAM 4GC9A 1E9SA 1HJPA 4LJAA 3H4JA 3B74A 2JY7A 1RU3A 1VDLA 1PRBA 1DO2A 1TGUA 1EFUB 2CHVA 3U6PA 2JZ1A 2D7GA 3TWKA 5FTMA 3F92A 1D0LA 1D0KA 1WHCA 2EUCA 1NY6A 2OO9A 3HY5A 2MJ5B 2UUAM 3U5ZA 3R9XB 1IXSA 1FJGM 2J5YA 3DZDA 3KOWE 2RGHA 4IJFA 2DWZB 3HGIA 3W0LB 1SXJA 2W82A 3M0EA 2LNHC 2DVWB 5FTLA 4ITQA 1P3QQ 4JI6M 1YSYA 2WSCF 3IG5A 3UJNA 2ERCA 2XFTA 4ZPXA 4BB9A 4GKKM 3DOAA 2JWSA 4LZJA 1I4WA 2EKKA 3GO8A 3EIHA 1OIZA 2O01F 1PJTA 5ITTA 2VIIA 1AIPC 2K6BA 3K8ZA 1L2CA 2DAIA 3C9PA 3LW5F 1A5TA 2CHQA 3U6OA 4UN2B 4LF6M 1BVSA 4D82A 1GJTA 1I94M 1WR1B 2DNAA 3J80S 2XLJA 2LVOC 5BPVA 3SAVA 2HHHM 2YR0A 2F5OA 3FKEA 1WGLA 5FTJA 1SXJC 5A2QS 3U6EA 1VEGA 4OU7A 1J09A 3GLFE 1K3XA 2QBYB 3TE6A 3ILKA 2JY5A 1IXRC 3LVVA 5IZ7D 3KFUG 1DGHB 3E9SA 1D0MA 2K47A 1CUKA 3VDPA 4R71A 1GO5A 5DNYA 4FWHA 4PDGA 3T1HM 3A45A 3KS8A 4G6ZA 3Q8XA 4LF5M 1G4AE 2DAMA 4KLNA 1DV0A 3W67A 1AUAA 3U6DA 4NC6A 3LVWA 4IBGA 2GNOA 3MMPA 2GQFA 2YQZA 5DFLA 3A46A 5E6JA 4GKJM 4YHHM 4CHTB 2QPAA 4X64M 4LJ8A 1KYIA 3KOZE 4GIPA 3KS4A 1NHWC 1J5EM 2V1UA 4IBJA 4DV7M 4IBIA 4MGIE 4CISA 1L1TA 4Z8XA 4PDIA 3T15A 2L7HA 1NV9A 3FUXA 4FWDA 1S3SA 2C96A 4CGYB 4IBDA 3RGPA 4RNAA 1LV7A 2BNKA 2QCUA 4NL4H 1GJSA 3J7BA 3LCUA 5KPZA 1QZEA 2JA2A 3HU2A 3U60A 4AKHA 4LCBA 4DR4M 2VF7A 1OAOC 4FCTA 2LHGA 1NHGC 1QYRA 2H5XA 4W5WA 1YUBA 3B89A 4REZA 3L28A 1FNNA 7CATA 1WJ7A 2I7NA 1XMQM 2CV1A 2CE7A 4MB7A 1V92A 3BXWA 2YNMD 1N77A 2UUCM 1ORYB 1NSFA 3T6PA 4LF4M 2FOIC 4AW4A 1NVMA 1UM8A 2P5TA 2DI0A 3C3DA 3HKPA 1T3TA 4F2LA 4AZFA 1PGYA 4G4RA 3HX3A 4JI2M 1XHBA 2NQ8C 1J7KA 2R62A 2ZTDA 4FVMA 3UK6A 3WHKA 4EIWA 4DV4M 3U61B 3R8FA 1XNRM 3FYCA 3CF0A 5IT9S 4FCWA 4XK8F 3GQ4A 2M5ZA 3D8LA 1F4IA 4LRTA 1NNJA 3HZJA 4NRWA 2XH9A 2QQ8A 4WP2A 4L6V6 5ITQA 1QQWA 1SG9A 2R45A 4B3MM 4PD2A 4QHSA 3QWLA 4M9XA 4ANRA 1ZAEA 1LTMA 3PNYA 3K9OA 3TWMA 3GQ5A 3U5ZB 1IXSB 1VQ1A 2CUZA 2V6ZM 3FTCA 3FUWA 3FYDA 2KNZA 4IBKA 2O5RA 3E4RA 3M7GA 3GLGE 3TQSA 1SXJB 1MJGM 4B7HA 2BJWA 4JI1M 1IXZA 4GH9A 1IN7A 5EP2A 3LCVB 4M9SA 4AI6A 1E94E 1JQJC 3CGWA 1NY5A 3GP1A 2Y0QA 1N32M 1G8PA 3FRIA 2L4FA 1H6UA 2CV2A 1XXHE 3B7NA 2VF8A 2HCBA 4NRVA 4B08A 4I81A 2ZAOA 1Z5AA 3CTWB 2UUBM 4B7FA 3UGJA 3GRYA 1IN5A 3SHFA 1IN4A 1TH3A 3GRRA 4D80A 4LGYA 3BBZA 3T38A 4B3SM 3L27A 3KXEC 2EKFA 5GKNA 5EXPA 2QP9X 5F3WA 1QVRA 1OFIA 3C3EA 4FD2A 3SYLA 2B3TA 4LY6A 4M9ZA 3MK6A 2FH0A 4LRSA 2LTUA 4RKUF 1R6BX 3GLIA 3SAWA 5EXTA 1YE9A 3HHWA 1HR0M 3KW6A 1XMOM 3KDSE 2DAGA 5JI2E 2DXIA 2OQ4A 2UXBM 1OTRA 2VQEM 4PCZA 2KHHA 2Z8YM 3H4MA 1Q02A 4WW0A 3D8BA 4X66M 5JI3E 3GLGA 1QAMA 3HU3A 2E5LM 4DR6M 2WSFF 1TDHA 1NJFA 2Z4RA 2L7IA 2DWMA 1N78A 3L29A 2Z3XA 3HHZA 3J7AS 2LHCA 4IBEA 3ZCBB 2G5GX 2R44A 1DO0A 2ZBKB 1K82A 2BWEA 2LVPC 1G71A 5C18A 1EE8A 4LF8M 5ITYA 2KNAA 2RGOA 2HAKA 1XXHA 3RGSA 1XC8A 5EP3A 2MGWA 3TWLA 3MJ5A 2R0IA 3FE3A 1WGNA 4LFBM 1WIVA 2F4VM 3U60B 3GPPA 2ZM6M 2LVNC 2FNAA 3FUVA 1QDTA 3GRUA 3B7QA 2C99A 4MM3B 4D81A 2R46A 3JAMS 2DKLA 3Q8GA 3QYEA 4M0WA 1IY2A 3FTEA 3I4VA 2HWJA 5KPTA 1R4GA 4GEWA 4IBCA 4IIWA 3RE8A 1C1KA 2V1CA 3AOEA 2F5NA 3VK8A 4OX9M 2DAEA 4S12A 2C5RA 3CF2A 2KZSA 2XZUA 3FUTA 2ZAMA 3SATA 3UZUA 2D7HA 4AKIA 2DAKA 5EQTA 2KEBA 3GLHB 1G59A 1HNXM 4KT0F 5FTNA 4JXJA 2WZJA 1PJJA 1T6OA 8CATA 2C9OA 3W0FA 2J7NA 3L25A 4FCVA 1MX0A 2JY8A 4LFCM 3SFZA 1VG5A 5FSWA 1N33M 2Q2EB 2QSFX 4DV0M 2XSZD 2QBYA 1DGBA 3A42A 3GLFA 1TH2A 3HJ8A 3LQRA 3PNVA 5E26A 3AOEC 1C7YA 3SASA 1G41A 1KSFX 4Q7JA 2LBCA 1TR8A 2X4AA 1XWIA 2KRUA 5FTKA 1OFHA 4MGKE 1JR3E 2G8LA 5KPRA 4CIZA 2QNJA 3L2AA 3GPXA 2CWBA 1ZMWA 5KQDA 4QNMA 1V34A 3M6AA 5H37D 2DZNB 1IN8A 1HNZM 2APLA 1UFZA 3GQ3A 2OOAA 4GHLA 4JN6A 3FD9A 4MGYE 2KXEA 4FWGA 1IN6A 2C9CA 2G3QA 4TUWA 2YFQA 3HJSA 1TH4A 1IBMM 4OW0A 3JR4A 4R7GA 4DR2M 4QOZC 2L4EA 2AHMA 2X8AA 3B9PA 4DR5M 3E46A 1GKIA 2L6OA 3ZQJA 4NSRA 3UMMA 4JI7M 2KDLA 2XFSA 5EP1A 4HLQA 2F5QA 2XGNA 1Z5BA 2R6FA 3U6QA 2D7EA 3NWLA 4XBOA 1SXJE 4L78A 3KP1E 1E9RA 1R2YA 3ZH9B 4IBFA 4LFAM 3SARA 2FFJA 3FUUA 1R7RA 4LG2A 1XB2B 1GL7A 3ZC7B 1L2DA 5EXXA 3PXGA 4DR3M 2N35A 3EIEA 1HT2E 1JR3D 4LJ7A 4R3DA 3GLIB 3W68A 4I5SA 3SMSA 3VK7A 2DWNA 1GVNA 1VEKA 5IREB 3VKHA 5ITXE 1TDZA 1IQPA 1QANA 2Y21A 4L15A 2CEAA 4AQYM 4BLCA 4G4NA 3AFHA 5LMNM 3VLFB 4X65M 1N34M 3AL0C 2RKOA 4I4LA 4AG6A 3VFDA 1MN3A 4PT5A 3GLGB 3DA1A 1MU5A 3I01M 2DZLA 5DYGA 2MR9A 4DV5M 4B3RM 4DR7M 5KQ8A 1IFYA 2MROB 4RF0A 4BBAA 2DWLA 2XF3A 1E32A 4MGHA 1R2ZA 3K92A 2QENA 3SYKA 4DV2M 3HHXA 1XXHB 2F5PA 1SXJD 4LJ6A 2KZUA 4LJ5A 2L2DA 4OVZA 1W5TA 3BOSA 2VQFM 2DZOB 3LQQA 4IJEA 4JI4M 4KHPM 1X37A 2Z7JA 3QYBA 4Z6YA 3HJQA 2I7PA 3SC3A 3IECA 3VDUA 2LVAA 2K0BX 2QHOB 1PJIA 1VDDA 4AKGA 2RRUA 4JI5M 2QZ4A 3CF6E 2K9DA 3GPUA 3FTDA 3PVSA 4DV3M 2LWXA 4X62M 4LF9M 1L1ZA 2FE8A 4K0KM 3VKGA 1QZMA 2R18A 4GRIA 4M0DA 5FLXS 3AKZA 3K2LA 3WHLA 1DGGA 1V33A 4L16A 5IWAM 5C1BA 2JZ0A 2KRKA 2JNHA 1GL6A 1ZV1A 4RF1A 4Y28F 1QAOA 5ITXA 4LJ4A 4MH0E 1NJGA 2LH0A 4F1IA 3JR5A 4DR1M 2DENA 4L4UA 3J27B 4QNRA 3U6CA 5EXSA 4G4QA 4DUZM 1OJLA 1GLNA 1Y8GA 3IHPA 3MHVC 3SMPA 3SHGB 3GLFB 2Z4SA 4HEOA 1N75A 3A98B 2DHRA 1HNWM 2O25A 3QAUA 1L8QA 2XZFA 2Y0TA 1IM2A 2OOBA 3GLHE 4XGIA 3L26A 1T43A 4HL4A 3SAUA 1Q39A 5ITRA 2FS1A 4KO8A 4JI0M 5L8RF 1HQYE 3I04M 1HQCA 4MGZE 2UXCM 3J2PB 4GMQA 3V76A 4DV6M 2HKJA 2M60A 1KFVA 2LXEA 2HL7A 4NOOB 4LGMA 4P16A 4A3VB 2F5SA 1Z6TA 2R4JA 2WSEF 3PFIA 3TL4X 3GRVA 3I4YA 4IBBA 3KSXA 4LJ9A 1PM5A 1ZMUA 3AOGA 2LVQD 5DYIA 4G3OA 5LMUM 1OAIA 2CRUA 1ZMVA 1DGHA 3FRHA 1DGFA 2CHGA 2XSZA 1D2NA 3B7ZA 1QUTA 2R4EA 1TF0B 2X49A 3IG8A 2UU9M 5ITUA 1QDRA 3T1YM 1IY1A 2R65A 2ZTCA 1EIJA 2KW0A 3E21A 3KOYE 3C58A 4DV1M 4G4OA 1QUSA 1NV8A 1OIPA 4KODA 3FTFA 4AG5A 3DFZA 1N36M 1TTEA 3HWSA 3KP0E 2JXNA 4CJ6A 4JV5M 4GC5A 3THGA 1WXQA 1GABA 1IY0A 2XEPA 1XNQM 2MH8A 2EA0A 4B3TM 2DHYA 4NXNM 4JI3M 1OKSA 4GHAA 3SBJA 4B7GA 1Q3BA 1PJQA 4GITA 4WURA 1NNUC 2CP8A 2EO2A 1IBKM 5KO3A 4QHTA 2UXDM 3GLHA 1YLAA 3TPZA 1Q3CA 1ZQ9A 2KA6B 2C98A 2J7OA 3HU1A 2BJVA 3AV0A 4YY3M 4NSOB 3NBIA
chains in the Genus database with same CATH topology
1OQYA 2MR9A 2KNAA 2HAKA 1IFYA 2MROB 2KNVA 2JP7A 2MGWA 2H5XA 2R0IA 3FE3A 1WGNA 1WIVA 3B89A 2JY6B 1G3IA 1HT1E 1WJ7A 2LVNC 3LCUA 3GLIE 1VEJA 3K9PA 2L2DA 1V92A 2BWBA 2DKLA 2HWJA 1R4GA 4GEWA 4DBGB 2DAEA 3IECA 2LVAA 2K0BX 2QHOB 3T6PA 2EJSA 2RRUA 2JUJA 2K9DA 2DI0A 2DAKA 1HJPA 3H4JA 4F2LA 1PGYA 2JY7A 1VDLA 2WZJA 1T6OA 1DO2A 2ZTDA 1EFUB 2JY8A 1VG5A 2JZ0A 2JNHA 1ZV1A 2JZ1A 2QSFX 3F92A 1WHCA 4F1IA 2OO9A 4WP2A 2MJ5B 1IXSA 1SG9A 2DENA 1C7YA 1G41A 1Y8GA 4Q7JA 3IHPA 3K9OA 2LBCA 1TR8A 4HEOA 1VQ1A 2KNZA 1P3QQ 2O25A 1JR3E 2QNJA 3GLGE 3GLHE 1IM2A 2OOBA 2CWBA 1ZMWA 1T43A 2EKKA 1HQYE 3LCVB 1AIPC 1UFZA 1E94E 2DAIA 2OOAA 1A5TA 3FRIA 2L4FA 4UN2B 1BVSA 1XXHE 2G3QA 1WR1B 2DNAA 1ZMUA 2LVOC 2LVQD 2L4EA 4G3OA 1OAIA 1ZMVA 3E46A 3FRHA 1WGLA 1VEGA 3GLFE 2JY5A 3BBZA 2EKFA 2ZTCA 3E21A 1CUKA 4R71A 1GO5A 2B3TA 1NV8A 1G4AE 2DAMA 1DV0A 2LTUA 1XB2B 1TTEA 3MMPA 5DFLA 2DAGA 1HT2E 5JI2E 2DHYA 1OTRA 1KYIA 1OKSA 2KHHA 1VEKA 1Q02A 2CP8A 1NV9A 1YLAA 1MN3A 1DO0A 2BWEA 2LVPC 1F4IA 1QZEA 2DZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQY A;  2MR9 A;  2KNA A;  2HAK A;  1IFY A;  2MRO B;  2KNV A;  2JP7 A;  2MGW A;  2H5X A;  2R0I A;  3FE3 A;  1WGN A;  1WIV A;  3B89 A;  2JY6 B;  1G3I A;  1HT1 E;  1WJ7 A;  2LVN C;  3LCU A;  3GLI E;  1VEJ A;  3K9P A;  2L2D A;  1V92 A;  2BWB A;  2DKL A;  2HWJ A;  1R4G A;  4GEW A;  4DBG B;  2DAE A;  3IEC A;  2LVA A;  2K0B X;  2QHO B;  3T6P A;  2EJS A;  2RRU A;  2JUJ A;  2K9D A;  2DI0 A;  2DAK A;  1HJP A;  3H4J A;  4F2L A;  1PGY A;  2JY7 A;  1VDL A;  2WZJ A;  1T6O A;  1DO2 A;  2ZTD A;  1EFU B;  2JY8 A;  1VG5 A;  2JZ0 A;  2JNH A;  1ZV1 A;  2JZ1 A;  2QSF X;  3F92 A;  1WHC A;  4F1I A;  2OO9 A;  4WP2 A;  2MJ5 B;  1IXS A;  1SG9 A;  2DEN A;  1C7Y A;  1G41 A;  1Y8G A;  4Q7J A;  3IHP A;  3K9O A;  2LBC A;  1TR8 A;  4HEO A;  1VQ1 A;  2KNZ A;  1P3Q Q;  2O25 A;  1JR3 E;  2QNJ A;  3GLG E;  3GLH E;  1IM2 A;  2OOB A;  2CWB A;  1ZMW A;  1T43 A;  2EKK A;  1HQY E;  3LCV B;  1AIP C;  1UFZ A;  1E94 E;  2DAI A;  2OOA A;  1A5T A;  3FRI A;  2L4F A;  4UN2 B;  1BVS A;  1XXH E;  2G3Q A;  1WR1 B;  2DNA A;  1ZMU A;  2LVO C;  2LVQ D;  2L4E A;  4G3O A;  1OAI A;  1ZMV A;  3E46 A;  3FRH A;  1WGL A;  1VEG A;  3GLF E;  2JY5 A;  3BBZ A;  2EKF A;  2ZTC A;  3E21 A;  1CUK A;  4R71 A;  1GO5 A;  2B3T A;  1NV8 A;  1G4A E;  2DAM A;  1DV0 A;  2LTU A;  1XB2 B;  1TTE A;  3MMP A;  5DFL A;  2DAG A;  1HT2 E;  5JI2 E;  2DHY A;  1OTR A;  1KYI A;  1OKS A;  2KHH A;  1VEK A;  1Q02 A;  2CP8 A;  1NV9 A;  1YLA A;  1MN3 A;  1DO0 A;  2BWE A;  2LVP C;  1F4I A;  1QZE A;  2DZL A; 
#chains in the Genus database with same CATH topology
 3AJI B;  1OQY A;  2H1R A;  4QOS A;  5EJC A;  2A5Y B;  4P17 A;  2KNV A;  2JP7 A;  5EP4 A;  1JB0 F;  3NBX X;  3GPY A;  4DUY M;  4JI8 M;  1Z5C A;  4LF7 M;  3KSJ A;  1Z59 A;  4NXM M;  3OTO M;  2JY6 B;  1G3I A;  3I51 A;  4II7 A;  1HT1 E;  2L09 A;  3RFW A;  1IBL M;  4L8R C;  3GLI E;  2VDB B;  1VEJ A;  3K9P A;  2CV0 A;  3KOX E;  3HHY A;  1R5L A;  2BWB A;  1L2B A;  3U6L A;  3K1J A;  1NO1 A;  1JR3 A;  1PJS A;  2ZAN A;  4DBG B;  3J81 S;  2OPF A;  5BR8 M;  3KVW A;  4OVZ B;  3U6S A;  1K3W A;  2CFO A;  3LMM A;  2Y20 A;  1QAQ A;  1W5S A;  2EJS A;  4FW9 A;  4I8O A;  4LZZ A;  2JUJ A;  3U61 A;  3U6M A;  4JYA M;  4GC9 A;  1E9S A;  1HJP A;  4LJA A;  3H4J A;  3B74 A;  2JY7 A;  1RU3 A;  1VDL A;  1PRB A;  1DO2 A;  1TGU A;  1EFU B;  2CHV A;  3U6P A;  2JZ1 A;  2D7G A;  3TWK A;  5FTM A;  3F92 A;  1D0L A;  1D0K A;  1WHC A;  2EUC A;  1NY6 A;  2OO9 A;  3HY5 A;  2MJ5 B;  2UUA M;  3U5Z A;  3R9X B;  1IXS A;  1FJG M;  2J5Y A;  3DZD A;  3KOW E;  2RGH A;  4IJF A;  2DWZ B;  3HGI A;  3W0L B;  1SXJ A;  2W82 A;  3M0E A;  2LNH C;  2DVW B;  5FTL A;  4ITQ A;  1P3Q Q;  4JI6 M;  1YSY A;  2WSC F;  3IG5 A;  3UJN A;  2ERC A;  2XFT A;  4ZPX A;  4BB9 A;  4GKK M;  3DOA A;  2JWS A;  4LZJ A;  1I4W A;  2EKK A;  3GO8 A;  3EIH A;  1OIZ A;  2O01 F;  1PJT A;  5ITT A;  2VII A;  1AIP C;  2K6B A;  3K8Z A;  1L2C A;  2DAI A;  3C9P A;  3LW5 F;  1A5T A;  2CHQ A;  3U6O A;  4UN2 B;  4LF6 M;  1BVS A;  4D82 A;  1GJT A;  1I94 M;  1WR1 B;  2DNA A;  3J80 S;  2XLJ A;  2LVO C;  5BPV A;  3SAV A;  2HHH M;  2YR0 A;  2F5O A;  3FKE A;  1WGL A;  5FTJ A;  1SXJ C;  5A2Q S;  3U6E A;  1VEG A;  4OU7 A;  1J09 A;  3GLF E;  1K3X A;  2QBY B;  3TE6 A;  3ILK A;  2JY5 A;  1IXR C;  3LVV A;  5IZ7 D;  3KFU G;  1DGH B;  3E9S A;  1D0M A;  2K47 A;  1CUK A;  3VDP A;  4R71 A;  1GO5 A;  5DNY A;  4FWH A;  4PDG A;  3T1H M;  3A45 A;  3KS8 A;  4G6Z A;  3Q8X A;  4LF5 M;  1G4A E;  2DAM A;  4KLN A;  1DV0 A;  3W67 A;  1AUA A;  3U6D A;  4NC6 A;  3LVW A;  4IBG A;  2GNO A;  3MMP A;  2GQF A;  2YQZ A;  5DFL A;  3A46 A;  5E6J A;  4GKJ M;  4YHH M;  4CHT B;  2QPA A;  4X64 M;  4LJ8 A;  1KYI A;  3KOZ E;  4GIP A;  3KS4 A;  1NHW C;  1J5E M;  2V1U A;  4IBJ A;  4DV7 M;  4IBI A;  4MGI E;  4CIS A;  1L1T A;  4Z8X A;  4PDI A;  3T15 A;  2L7H A;  1NV9 A;  3FUX A;  4FWD A;  1S3S A;  2C96 A;  4CGY B;  4IBD A;  3RGP A;  4RNA A;  1LV7 A;  2BNK A;  2QCU A;  4NL4 H;  1GJS A;  3J7B A;  3LCU A;  5KPZ A;  1QZE A;  2JA2 A;  3HU2 A;  3U60 A;  4AKH A;  4LCB A;  4DR4 M;  2VF7 A;  1OAO C;  4FCT A;  2LHG A;  1NHG C;  1QYR A;  2H5X A;  4W5W A;  1YUB A;  3B89 A;  4REZ A;  3L28 A;  1FNN A;  7CAT A;  1WJ7 A;  2I7N A;  1XMQ M;  2CV1 A;  2CE7 A;  4MB7 A;  1V92 A;  3BXW A;  2YNM D;  1N77 A;  2UUC M;  1ORY B;  1NSF A;  3T6P A;  4LF4 M;  2FOI C;  4AW4 A;  1NVM A;  1UM8 A;  2P5T A;  2DI0 A;  3C3D A;  3HKP A;  1T3T A;  4F2L A;  4AZF A;  1PGY A;  4G4R A;  3HX3 A;  4JI2 M;  1XHB A;  2NQ8 C;  1J7K A;  2R62 A;  2ZTD A;  4FVM A;  3UK6 A;  3WHK A;  4EIW A;  4DV4 M;  3U61 B;  3R8F A;  1XNR M;  3FYC A;  3CF0 A;  5IT9 S;  4FCW A;  4XK8 F;  3GQ4 A;  2M5Z A;  3D8L A;  1F4I A;  4LRT A;  1NNJ A;  3HZJ A;  4NRW A;  2XH9 A;  2QQ8 A;  4WP2 A;  4L6V 6;  5ITQ A;  1QQW A;  1SG9 A;  2R45 A;  4B3M M;  4PD2 A;  4QHS A;  3QWL A;  4M9X A;  4ANR A;  1ZAE A;  1LTM A;  3PNY A;  3K9O A;  3TWM A;  3GQ5 A;  3U5Z B;  1IXS B;  1VQ1 A;  2CUZ A;  2V6Z M;  3FTC A;  3FUW A;  3FYD A;  2KNZ A;  4IBK A;  2O5R A;  3E4R A;  3M7G A;  3GLG E;  3TQS A;  1SXJ B;  1MJG M;  4B7H A;  2BJW A;  4JI1 M;  1IXZ A;  4GH9 A;  1IN7 A;  5EP2 A;  3LCV B;  4M9S A;  4AI6 A;  1E94 E;  1JQJ C;  3CGW A;  1NY5 A;  3GP1 A;  2Y0Q A;  1N32 M;  1G8P A;  3FRI A;  2L4F A;  1H6U A;  2CV2 A;  1XXH E;  3B7N A;  2VF8 A;  2HCB A;  4NRV A;  4B08 A;  4I81 A;  2ZAO A;  1Z5A A;  3CTW B;  2UUB M;  4B7F A;  3UGJ A;  3GRY A;  1IN5 A;  3SHF A;  1IN4 A;  1TH3 A;  3GRR A;  4D80 A;  4LGY A;  3BBZ A;  3T38 A;  4B3S M;  3L27 A;  3KXE C;  2EKF A;  5GKN A;  5EXP A;  2QP9 X;  5F3W A;  1QVR A;  1OFI A;  3C3E A;  4FD2 A;  3SYL A;  2B3T A;  4LY6 A;  4M9Z A;  3MK6 A;  2FH0 A;  4LRS A;  2LTU A;  4RKU F;  1R6B X;  3GLI A;  3SAW A;  5EXT A;  1YE9 A;  3HHW A;  1HR0 M;  3KW6 A;  1XMO M;  3KDS E;  2DAG A;  5JI2 E;  2DXI A;  2OQ4 A;  2UXB M;  1OTR A;  2VQE M;  4PCZ A;  2KHH A;  2Z8Y M;  3H4M A;  1Q02 A;  4WW0 A;  3D8B A;  4X66 M;  5JI3 E;  3GLG A;  1QAM A;  3HU3 A;  2E5L M;  4DR6 M;  2WSF F;  1TDH A;  1NJF A;  2Z4R A;  2L7I A;  2DWM A;  1N78 A;  3L29 A;  2Z3X A;  3HHZ A;  3J7A S;  2LHC A;  4IBE A;  3ZCB B;  2G5G X;  2R44 A;  1DO0 A;  2ZBK B;  1K82 A;  2BWE A;  2LVP C;  1G71 A;  5C18 A;  1EE8 A;  4LF8 M;  5ITY A;  2KNA A;  2RGO A;  2HAK A;  1XXH A;  3RGS A;  1XC8 A;  5EP3 A;  2MGW A;  3TWL A;  3MJ5 A;  2R0I A;  3FE3 A;  1WGN A;  4LFB M;  1WIV A;  2F4V M;  3U60 B;  3GPP A;  2ZM6 M;  2LVN C;  2FNA A;  3FUV A;  1QDT A;  3GRU A;  3B7Q A;  2C99 A;  4MM3 B;  4D81 A;  2R46 A;  3JAM S;  2DKL A;  3Q8G A;  3QYE A;  4M0W A;  1IY2 A;  3FTE A;  3I4V A;  2HWJ A;  5KPT A;  1R4G A;  4GEW A;  4IBC A;  4IIW A;  3RE8 A;  1C1K A;  2V1C A;  3AOE A;  2F5N A;  3VK8 A;  4OX9 M;  2DAE A;  4S12 A;  2C5R A;  3CF2 A;  2KZS A;  2XZU A;  3FUT A;  2ZAM A;  3SAT A;  3UZU A;  2D7H A;  4AKI A;  2DAK A;  5EQT A;  2KEB A;  3GLH B;  1G59 A;  1HNX M;  4KT0 F;  5FTN A;  4JXJ A;  2WZJ A;  1PJJ A;  1T6O A;  8CAT A;  2C9O A;  3W0F A;  2J7N A;  3L25 A;  4FCV A;  1MX0 A;  2JY8 A;  4LFC M;  3SFZ A;  1VG5 A;  5FSW A;  1N33 M;  2Q2E B;  2QSF X;  4DV0 M;  2XSZ D;  2QBY A;  1DGB A;  3A42 A;  3GLF A;  1TH2 A;  3HJ8 A;  3LQR A;  3PNV A;  5E26 A;  3AOE C;  1C7Y A;  3SAS A;  1G41 A;  1KSF X;  4Q7J A;  2LBC A;  1TR8 A;  2X4A A;  1XWI A;  2KRU A;  5FTK A;  1OFH A;  4MGK E;  1JR3 E;  2G8L A;  5KPR A;  4CIZ A;  2QNJ A;  3L2A A;  3GPX A;  2CWB A;  1ZMW A;  5KQD A;  4QNM A;  1V34 A;  3M6A A;  5H37 D;  2DZN B;  1IN8 A;  1HNZ M;  2APL A;  1UFZ A;  3GQ3 A;  2OOA A;  4GHL A;  4JN6 A;  3FD9 A;  4MGY E;  2KXE A;  4FWG A;  1IN6 A;  2C9C A;  2G3Q A;  4TUW A;  2YFQ A;  3HJS A;  1TH4 A;  1IBM M;  4OW0 A;  3JR4 A;  4R7G A;  4DR2 M;  4QOZ C;  2L4E A;  2AHM A;  2X8A A;  3B9P A;  4DR5 M;  3E46 A;  1GKI A;  2L6O A;  3ZQJ A;  4NSR A;  3UMM A;  4JI7 M;  2KDL A;  2XFS A;  5EP1 A;  4HLQ A;  2F5Q A;  2XGN A;  1Z5B A;  2R6F A;  3U6Q A;  2D7E A;  3NWL A;  4XBO A;  1SXJ E;  4L78 A;  3KP1 E;  1E9R A;  1R2Y A;  3ZH9 B;  4IBF A;  4LFA M;  3SAR A;  2FFJ A;  3FUU A;  1R7R A;  4LG2 A;  1XB2 B;  1GL7 A;  3ZC7 B;  1L2D A;  5EXX A;  3PXG A;  4DR3 M;  2N35 A;  3EIE A;  1HT2 E;  1JR3 D;  4LJ7 A;  4R3D A;  3GLI B;  3W68 A;  4I5S A;  3SMS A;  3VK7 A;  2DWN A;  1GVN A;  1VEK A;  5IRE B;  3VKH A;  5ITX E;  1TDZ A;  1IQP A;  1QAN A;  2Y21 A;  4L15 A;  2CEA A;  4AQY M;  4BLC A;  4G4N A;  3AFH A;  5LMN M;  3VLF B;  4X65 M;  1N34 M;  3AL0 C;  2RKO A;  4I4L A;  4AG6 A;  3VFD A;  1MN3 A;  4PT5 A;  3GLG B;  3DA1 A;  1MU5 A;  3I01 M;  2DZL A;  5DYG A;  2MR9 A;  4DV5 M;  4B3R M;  4DR7 M;  5KQ8 A;  1IFY A;  2MRO B;  4RF0 A;  4BBA A;  2DWL A;  2XF3 A;  1E32 A;  4MGH A;  1R2Z A;  3K92 A;  2QEN A;  3SYK A;  4DV2 M;  3HHX A;  1XXH B;  2F5P A;  1SXJ D;  4LJ6 A;  2KZU A;  4LJ5 A;  2L2D A;  4OVZ A;  1W5T A;  3BOS A;  2VQF M;  2DZO B;  3LQQ A;  4IJE A;  4JI4 M;  4KHP M;  1X37 A;  2Z7J A;  3QYB A;  4Z6Y A;  3HJQ A;  2I7P A;  3SC3 A;  3IEC A;  3VDU A;  2LVA A;  2K0B X;  2QHO B;  1PJI A;  1VDD A;  4AKG A;  2RRU A;  4JI5 M;  2QZ4 A;  3CF6 E;  2K9D A;  3GPU A;  3FTD A;  3PVS A;  4DV3 M;  2LWX A;  4X62 M;  4LF9 M;  1L1Z A;  2FE8 A;  4K0K M;  3VKG A;  1QZM A;  2R18 A;  4GRI A;  4M0D A;  5FLX S;  3AKZ A;  3K2L A;  3WHL A;  1DGG A;  1V33 A;  4L16 A;  5IWA M;  5C1B A;  2JZ0 A;  2KRK A;  2JNH A;  1GL6 A;  1ZV1 A;  4RF1 A;  4Y28 F;  1QAO A;  5ITX A;  4LJ4 A;  4MH0 E;  1NJG A;  2LH0 A;  4F1I A;  3JR5 A;  4DR1 M;  2DEN A;  4L4U A;  3J27 B;  4QNR A;  3U6C A;  5EXS A;  4G4Q A;  4DUZ M;  1OJL A;  1GLN A;  1Y8G A;  3IHP A;  3MHV C;  3SMP A;  3SHG B;  3GLF B;  2Z4S A;  4HEO A;  1N75 A;  3A98 B;  2DHR A;  1HNW M;  2O25 A;  3QAU A;  1L8Q A;  2XZF A;  2Y0T A;  1IM2 A;  2OOB A;  3GLH E;  4XGI A;  3L26 A;  1T43 A;  4HL4 A;  3SAU A;  1Q39 A;  5ITR A;  2FS1 A;  4KO8 A;  4JI0 M;  5L8R F;  1HQY E;  3I04 M;  1HQC A;  4MGZ E;  2UXC M;  3J2P B;  4GMQ A;  3V76 A;  4DV6 M;  2HKJ A;  2M60 A;  1KFV A;  2LXE A;  2HL7 A;  4NOO B;  4LGM A;  4P16 A;  4A3V B;  2F5S A;  1Z6T A;  2R4J A;  2WSE F;  3PFI A;  3TL4 X;  3GRV A;  3I4Y A;  4IBB A;  3KSX A;  4LJ9 A;  1PM5 A;  1ZMU A;  3AOG A;  2LVQ D;  5DYI A;  4G3O A;  5LMU M;  1OAI A;  2CRU A;  1ZMV A;  1DGH A;  3FRH A;  1DGF A;  2CHG A;  2XSZ A;  1D2N A;  3B7Z A;  1QUT A;  2R4E A;  1TF0 B;  2X49 A;  3IG8 A;  2UU9 M;  5ITU A;  1QDR A;  3T1Y M;  1IY1 A;  2R65 A;  2ZTC A;  1EIJ A;  2KW0 A;  3E21 A;  3KOY E;  3C58 A;  4DV1 M;  4G4O A;  1QUS A;  1NV8 A;  1OIP A;  4KOD A;  3FTF A;  4AG5 A;  3DFZ A;  1N36 M;  1TTE A;  3HWS A;  3KP0 E;  2JXN A;  4CJ6 A;  4JV5 M;  4GC5 A;  3THG A;  1WXQ A;  1GAB A;  1IY0 A;  2XEP A;  1XNQ M;  2MH8 A;  2EA0 A;  4B3T M;  2DHY A;  4NXN M;  4JI3 M;  1OKS A;  4GHA A;  3SBJ A;  4B7G A;  1Q3B A;  1PJQ A;  4GIT A;  4WUR A;  1NNU C;  2CP8 A;  2EO2 A;  1IBK M;  5KO3 A;  4QHT A;  2UXD M;  3GLH A;  1YLA A;  3TPZ A;  1Q3C A;  1ZQ9 A;  2KA6 B;  2C98 A;  2J7O A;  3HU1 A;  2BJV A;  3AV0 A;  4YY3 M;  4NSO B;  3NBI A; 
#chains in the Genus database with same CATH homology
 1OQY A;  2MR9 A;  2KNA A;  2HAK A;  1IFY A;  2MRO B;  2KNV A;  2JP7 A;  2MGW A;  2H5X A;  2R0I A;  3FE3 A;  1WGN A;  1WIV A;  3B89 A;  2JY6 B;  1G3I A;  1HT1 E;  1WJ7 A;  2LVN C;  3LCU A;  3GLI E;  1VEJ A;  3K9P A;  2L2D A;  1V92 A;  2BWB A;  2DKL A;  2HWJ A;  1R4G A;  4GEW A;  4DBG B;  2DAE A;  3IEC A;  2LVA A;  2K0B X;  2QHO B;  3T6P A;  2EJS A;  2RRU A;  2JUJ A;  2K9D A;  2DI0 A;  2DAK A;  1HJP A;  3H4J A;  4F2L A;  1PGY A;  2JY7 A;  1VDL A;  2WZJ A;  1T6O A;  1DO2 A;  2ZTD A;  1EFU B;  2JY8 A;  1VG5 A;  2JZ0 A;  2JNH A;  1ZV1 A;  2JZ1 A;  2QSF X;  3F92 A;  1WHC A;  4F1I A;  2OO9 A;  4WP2 A;  2MJ5 B;  1IXS A;  1SG9 A;  2DEN A;  1C7Y A;  1G41 A;  1Y8G A;  4Q7J A;  3IHP A;  3K9O A;  2LBC A;  1TR8 A;  4HEO A;  1VQ1 A;  2KNZ A;  1P3Q Q;  2O25 A;  1JR3 E;  2QNJ A;  3GLG E;  3GLH E;  1IM2 A;  2OOB A;  2CWB A;  1ZMW A;  1T43 A;  2EKK A;  1HQY E;  3LCV B;  1AIP C;  1UFZ A;  1E94 E;  2DAI A;  2OOA A;  1A5T A;  3FRI A;  2L4F A;  4UN2 B;  1BVS A;  1XXH E;  2G3Q A;  1WR1 B;  2DNA A;  1ZMU A;  2LVO C;  2LVQ D;  2L4E A;  4G3O A;  1OAI A;  1ZMV A;  3E46 A;  3FRH A;  1WGL A;  1VEG A;  3GLF E;  2JY5 A;  3BBZ A;  2EKF A;  2ZTC A;  3E21 A;  1CUK A;  4R71 A;  1GO5 A;  2B3T A;  1NV8 A;  1G4A E;  2DAM A;  1DV0 A;  2LTU A;  1XB2 B;  1TTE A;  3MMP A;  5DFL A;  2DAG A;  1HT2 E;  5JI2 E;  2DHY A;  1OTR A;  1KYI A;  1OKS A;  2KHH A;  1VEK A;  1Q02 A;  2CP8 A;  1NV9 A;  1YLA A;  1MN3 A;  1DO0 A;  2BWE A;  2LVP C;  1F4I A;  1QZE A;  2DZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...