2LVOC

Structure of the gp78cue domain bound to monubiquitin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/ligase
molecule keywords Ubiquitin
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvoC00
3FE3A 2LVQD 1QZEA 1WHCA 2DAIA 1P3QQ 2KNAA 1ZMUA 3GLIE 1GO5A 2EKFA 2JY6B 2LTUA 2DAGA 2QNJA 2CP8A 3GLFE 3T6PA 2DAKA 2MROB 3GLGE 1WGLA 2JNHA 3H4JA 5JI2E 2JUJA 2RRUA 1ZMWA 1WJ7A 1MN3A 1VG5A 1E94E 2HAKA 4GEWA 2DNAA 1KYIA 4WP2A 1TR8A 1OKSA 1Q02A 2LVAA 3FRIA 1WGNA 1G3IA 1ZV1A 2LVOC 2JZ1A 1G41A 3LCUA 2DKLA 2LBCA 2K0BX 3B89A 2JP7A 3GLHE 2JY7A 2KNVA 1IXSA 2CWBA 1OTRA 1DO2A 2ZTDA 2JY5A 2B3TA 1WIVA 3IECA 1XB2B 2L4EA 1VEKA 4Q7JA 2JY8A 3K9PA 2BWEA 1OAIA 1T6OA 1IM2A 4F2LA 1VQ1A 4G3OA 2HWJA 1SG9A 2H5XA 1HQYE 1NV8A 2ZTCA 1NV9A 1CUKA 1XXHE 2O25A 4HEOA 2L2DA 1A5TA 3FRHA 2MR9A 1WR1B 1HT1E 5DFLA 3F92A 1OQYA 1EFUB 2DI0A 1PGYA 1T43A 2JZ0A 1ZMVA 2KHHA 1AIPC 1IFYA 2KNZA 2DAMA 3BBZA 2WZJA 1VEJA 2EJSA 1JR3E 1VEGA 1R4GA 2EKKA 1DV0A 1F4IA 3LCVB 1YLAA 1V92A 3MMPA 2DENA 2LVNC 2DAEA 2DHYA 2QHOB 3K9OA 2OOAA 3IHPA 4R71A 2MGWA 1DO0A 2MJ5B 2OO9A 3E21A 2G3QA 1BVSA 2DZLA 1HT2E 1UFZA 4DBGB 1TTEA 2OOBA 1C7YA 1HJPA 4F1IA 2BWBA 2L4FA 2QSFX 1G4AE 1VDLA 1Y8GA 4UN2B 2LVPC 3E46A 2K9DA 2R0IA
chains in the Genus database with same CATH superfamily
3FE3A 2AHMA 2LVQD 1QZEA 3ZC7B 1WHCA 1XMOM 4XK8F 3TE6A 5ITRA 2KNAA 4PT5A 4LJ6A 1T3TA 2QPAA 1IY2A 3B9PA 2BJVA 1GO5A 1SXJA 2EKFA 5KPZA 3THGA 3I04M 3VFDA 4JI5M 3VDPA 3KOYE 1DGHB 3BOSA 5FTJA 3GRUA 4JI7M 1XXHA 1GL7A 4M9XA 3T6PA 3FUVA 2G8LA 3JAMS 5FSWA 3U60B 1HR0M 5DNYA 3LVVA 3KSXA 3L29A 3GLGE 2JNHA 3FUUA 2M5ZA 2Q2EB 1E32A 2FH0A 3SHFA 4S12A 2UUAM 1QVRA 3KW6A 1VDDA 1WJ7A 4DR4M 1E94E 3ILKA 4HL4A 5GKNA 4GEWA 1N33M 5KPRA 2KZUA 2CFOA 3SYKA 1TR8A 4P16A 5E26A 5A2QS 1ZQ9A 2RKOA 3L2AA 4LJ8A 3QWLA 1TH3A 1HNXM 5EXTA 3M0EA 1MX0A 2Z7JA 2J5YA 1KFVA 1N32M 2LBCA 3HU1A 3U6CA 1LTMA 3SMSA 2EO2A 2Y20A 3PNYA 4BLCA 4K0KM 1OAOC 1IXRC 4I8OA 4I4LA 5ITYA 5F3WA 1DO2A 2V1CA 4RKUF 1HNWM 4IBFA 2OQ4A 3VKGA 1EIJA 2GNOA 1IY0A 1Z6TA 1Q39A 2Z4SA 2JY8A 1PRBA 2BWEA 2HKJA 1OFHA 4GC5A 4IJFA 3KOZE 1OIPA 1NNJA 2F5SA 3QYEA 3HU3A 3HHYA 5ITQA 2QCUA 1QUSA 3GPXA 1Z59A 3GP1A 3GLIB 1NO1A 2UU9M 4KODA 4GHLA 1JB0F 2Y0QA 1QUTA 2XFTA 4CIZA 4REZA 4B08A 3C58A 3K2LA 4LJ7A 3FRHA 4PD2A 1WR1B 3U5ZA 3U6OA 5DFLA 1OQYA 4B7FA 2ZAMA 3W68A 4GRIA 4AKHA 1PGYA 4QOSA 3OTOM 1XMQM 3Q8XA 2F5PA 3PFIA 1L2CA 4I81A 1AIPC 4DR1M 3GLGA 1DGBA 2KEBA 2YQZA 1JR3E 1VEGA 4FW9A 3DOAA 4A3VB 2EKKA 1DV0A 2ZANA 2DHRA 2R44A 3I4YA 3SMPA 1I4WA 1V92A 4GC9A 4OU7A 2UXCM 1JQJC 2CEAA 4MB7A 3W67A 1PJQA 1IXZA 2QHOB 3RE8A 4X62M 4G4OA 2MGWA 4LJAA 4DR5M 2UXBM 4IBCA 2MJ5B 3VDUA 4FCVA 1E9RA 1XNQM 2DVWB 3HX3A 1PJIA 1EE8A 1HJPA 3FUTA 4G4QA 4MGKE 4GKJM 2QSFX 5EXXA 1G4AE 1Y8GA 2RGHA 4ITQA 4MGZE 5BPVA 4LRTA 3KXEC 4B3RM 3VK7A 3LQQA 2F4VM 4MM3B 3HU2A 4IBEA 2DAIA 1IN7A 2VDBB 3KOXE 4JI3M 4D81A 2R62A 3W0LB 2JA2A 4XBOA 3HJ8A 1D0LA 1NY6A 2WSEF 1DGFA 2BNKA 4DV7M 4L6V6 4RF0A 2GQFA 1GJTA 3H4MA 1YSYA 3ZQJA 2X8AA 4FWDA 1R2ZA 4ANRA 4D80A 2QNJA 3GLFE 5KQ8A 1QDRA 4JXJA 1DGGA 3QYBA 2I7NA 2VIIA 1LV7A 2P5TA 4EIWA 2W82A 1PJTA 2ZBKB 3A46A 2J7OA 2UUBM 1HQCA 5C18A 3SAWA 2HHHM 3FTFA 2RRUA 2Z8YM 3TL4X 1D2NA 4JI1M 2C98A 2V6ZM 2HAKA 3ZH9B 4B3MM 1AUAA 2DNAA 1PJJA 3U61B 1XNRM 3M7GA 3CGWA 5KPTA 1OKSA 3U6QA 1QANA 1JR3A 2L6OA 1WGNA 2JZ1A 3KFUG 2KRKA 4R7GA 4IIWA 2DKLA 1QQWA 4GMQA 2K0BX 2RGOA 3B89A 5DYIA 2JP7A 1TGUA 2XF3A 2KNVA 1IXSA 3C3EA 4W5WA 4DV5M 4LGMA 1FNNA 2XH9A 2JY5A 2B3TA 2D7HA 1WIVA 2XZFA 1IN4A 1JR3D 1IBKM 2L4EA 2L09A 3J80S 3PNVA 1QAMA 3JR4A 4DV6M 1IN6A 2XZUA 2HCBA 4QHTA 4Z6YA 4NC6A 2KZSA 1K3XA 4QOZC 1SXJD 4DR7M 3GRVA 2QENA 1IN5A 2DXIA 3AKZA 4G3OA 4M9SA 1QZMA 1NJGA 2KW0A 1L2BA 5EXPA 3U6DA 1CUKA 4R3DA 4CHTB 5JI3E 4WURA 3LQRA 4HEOA 1Z5BA 2L2DA 4M9ZA 2FE8A 4LZZA 2MR9A 1NY5A 4LRSA 3HZJA 2JXNA 1EFUB 2NQ8C 2DWNA 2DI0A 4IBJA 2XEPA 2QBYA 1T43A 2CV0A 3GPYA 3VLFB 2MH8A 3GLFA 1ZMVA 1TDZA 3IG5A 1IFYA 2KNZA 3BBZA 5IREB 4DV1M 3MHVC 4FCTA 1ZAEA 4JI8M 1R4GA 2JWSA 2D7GA 3C3DA 1I94M 3MMPA 1XWIA 3SATA 2LH0A 2HL7A 1PM5A 2DENA 3UMMA 2DAEA 4B3TM 3PVSA 1XHBA 2OOAA 3IHPA 2UXDM 2K6BA 5EP4A 1X37A 1TH4A 1S3SA 1YE9A 1TDHA 4HLQA 4JI0M 3E21A 2G3QA 4OW0A 1OFIA 2YNMD 2Y21A 3A42A 3UJNA 3GLHB 1HT2E 1L8QA 4B7GA 4LFAM 2K47A 4DBGB 4QNRA 1TTEA 1GL6A 4CJ6A 4X64M 2YR0A 3V76A 3A45A 4NL4H 1C7YA 2L4FA 4DUZM 1R2YA 5DYGA 3NWLA 4X65M 3KS4A 1NHWC 4IBGA 3FTEA 3I01M 4AQYM 2LVPC 2UUCM 1GJSA 1RU3A 4DV2M 3VK8A 1QDTA 1Q3BA 4DV3M 3W0FA 4B7HA 3SYLA 3GPPA 1J5EM 4LY6A 2VF8A 2E5LM 1SXJB 3FTCA 2QZ4A 1ZMUA 3AOGA 3GLIE 2ZAOA 1XXHB 3GO8A 2APLA 4OX9M 5FTKA 1ORYB 1GLNA 2Y0TA 2EA0A 3AV0A 2LTUA 4DR3M 4NSOB 2XLJA 2QQ8A 2DAGA 2WSFF 2QP9X 5EP3A 2DAKA 3TQSA 1N36M 5BR8M 3K8ZA 2CV2A 3H4JA 2CHQA 3TWMA 1UM8A 2R65A 4Y28F 4RNAA 4LG2A 3K92A 4NXNM 3RGSA 3U60A 3B7ZA 1VG5A 4LF4M 3DA1A 3FUWA 1KYIA 2FS1A 1QYRA 4WP2A 3DFZA 4NRVA 5EP1A 4D82A 5ITTA 4DUYM 3J27B 1Q02A 3GQ3A 2LHCA 3AFHA 3FRIA 1G3IA 2DWZB 3HGIA 5E6JA 1G41A 4JI2M 2VF7A 1N75A 1L1ZA 3JR5A 4AG6A 1R7RA 5LMNM 1Z5CA 2R45A 3J81S 4ZPXA 5ITUA 4LF7M 4LF8M 3HHXA 3U6SA 3FYDA 4L16A 5FTLA 2JY7A 3LVWA 3MJ5A 2F5QA 1NJFA 1IY1A 1N77A 1IN8A 3A98B 3BXWA 3IECA 3RGPA 4FWHA 4OVZA 1XB2B 2H1RA 4GH9A 1J7KA 1VEKA 2CHVA 2EUCA 4MGIE 3KDSE 3D8BA 3K9PA 2CHGA 1OAIA 1T6OA 1IM2A 2YFQA 4F2LA 1VQ1A 2HWJA 4JI4M 4GIPA 2WSCF 5FTMA 2ZTCA 1G8PA 1HQYE 2Z3XA 3U5ZB 2BJWA 2O25A 2R4EA 2D7EA 4FVMA 3RFWA 1K3WA 4II7A 1NHGC 1GKIA 2R18A 3L27A 1L2DA 4CISA 4Z8XA 3GLIA 3LMMA 1YUBA 3K1JA 3F92A 3GLGB 1H6UA 3VKHA 3FTDA 3IG8A 2L7IA 1WXQA 1IQPA 7CATA 4L15A 4LF6M 3HHWA 3AOEC 4LJ4A 1NNUC 1VEJA 1W5SA 2XFSA 3B7NA 4LZJA 4GHAA 3HWSA 4TUWA 1F4IA 3LCVB 1YLAA 4LF9M 2O01F 3E9SA 2C5RA 4AKIA 4LFCM 4IJEA 4AW4A 3SHGB 3GRRA 4AZFA 8CATA 5KO3A 1D0KA 2OPFA 4R71A 4KLNA 3R8FA 1DO0A 4IBIA 4LJ9A 1XC8A 1BVSA 2DZLA 2V1UA 3UGJA 3FYCA 1N78A 3AL0C 2L7HA 2J7NA 3L25A 2OOBA 3SARA 4FCWA 4GITA 4L4UA 1NSFA 2A5YB 3LW5F 3AJIB 1C1KA 4LGYA 3GQ4A 4G4NA 1OJLA 4P17A 4UN2B 4MGHA 3HJSA 3CF0A 4G6ZA 4PCZA 3NBXX 3HHZA 4AG5A 3E46A 3TPZA 4KO8A 3EIHA 1P3QQ 3U6LA 1FJGM 1KSFX 3UZUA 1MU5A 2LNHC 4KT0F 2I7PA 5L8RF 3KP0E 4LFBM 3SFZA 2G5GX 5FLXS 3T1HM 3GRYA 3SBJA 2JY6B 1TH2A 3T1YM 1GABA 5FTNA 4OVZB 3FKEA 3NBIA 2CP8A 3Q8GA 1V33A 1HNZM 1L1TA 2MROB 5ITXE 3J2PB 2VQFM 1WGLA 1E9SA 3FD9A 3KOWE 4IBBA 1W5TA 1SXJC 5JI2E 4NSRA 3PXGA 2JUJA 1ZMWA 2DZNB 2X4AA 1D0MA 1G71A 4LF5M 1MN3A 2FOIC 1J09A 4NXMM 2FFJA 3L28A 4RF1A 1K82A 1QAOA 2CE7A 4MH0E 3I4VA 3HJQA 5KQDA 2LVAA 3CF6E 3QAUA 4DR2M 1NVMA 5EP2A 1ZV1A 2LVOC 2KDLA 3KP1E 4MGYE 3LCUA 3U61A 4JYAM 1IXSB 4NOOB 3HY5A 5IZ7D 4CGYB 4B3SM 2LHGA 3R9XB 4AKGA 3SC3A 4I5SA 2DZOB 2N35A 3GLHE 2XSZA 2C9CA 2O5RA 1N34M 2CWBA 1OTRA 4YHHM 2ZTDA 5C1BA 3CTWB 3U6MA 5H37D 1DGHA 4JV5M 1V34A 4Q7JA 4DV0M 5IT9S 2R6FA 4JN6A 2CUZA 2ZM6M 3C9PA 4QNMA 3J7BA 2XSZD 1SXJE 2C9OA 2R4JA 1SG9A 2M60A 5LMUM 4DV4M 2KA6B 4LCBA 4GKKM 3L26A 2H5XA 1NV8A 4FWGA 4AI6A 1NV9A 1QAQA 3MK6A 1XXHE 4M0WA 3J7AS 1Z5AA 3UK6A 2QBYB 1IBLM 1A5TA 3KSJA 4IBDA 5IWAM 3AOEA 3GLFB 1HT1E 3B74A 2VQEM 4WW0A 4PDGA 3GPUA 4KHPM 1GVNA 1MJGM 4G4RA 1R6BX 3CF2A 2CV1A 3TWLA 2JZ0A 4YY3M 3KVWA 4LJ5A 2KHHA 1IBMM 3T15A 3GQ5A 2DAMA 5ITXA 4BB9A 2WZJA 4BBAA 2EJSA 3D8LA 2DWMA 5EJCA 4FD2A 2Z4RA 3TWKA 2F5OA 2DWLA 2LXEA 3EIEA 5EXSA 4X66M 2LVNC 2DHYA 3K9OA 5EQTA 3ZCBB 4DR6M 1R5LA 1TF0B 2C99A 2ERCA 3SAVA 2LWXA 3E4RA 4M0DA 2KXEA 3M6AA 4L78A 2OO9A 4XGIA 3T38A 3U6PA 3FUXA 3B7QA 2R46A 2XGNA 3WHLA 3U6EA 1UFZA 4QHSA 1OIZA 2X49A 4L8RC 4F1IA 4JI6M 2BWBA 4NRWA 4IBKA 2FNAA 4PDIA 3GLHA 1VDLA 2KRUA 3HKPA 1PJSA 3I51A 2C96A 3DZDA 2CRUA 1G59A 2F5NA 3WHKA 1Q3CA 3SAUA 2K9DA 3SASA 2R0IA 3KS8A
chains in the Genus database with same CATH topology
3FE3A 2LVQD 1QZEA 1WHCA 2DAIA 1P3QQ 2KNAA 1ZMUA 3GLIE 1GO5A 2EKFA 2JY6B 2LTUA 2DAGA 2QNJA 2CP8A 3GLFE 3T6PA 2DAKA 2MROB 3GLGE 1WGLA 2JNHA 3H4JA 5JI2E 2JUJA 2RRUA 1ZMWA 1WJ7A 1MN3A 1VG5A 1E94E 2HAKA 4GEWA 2DNAA 1KYIA 4WP2A 1TR8A 1OKSA 1Q02A 2LVAA 3FRIA 1WGNA 1G3IA 1ZV1A 2LVOC 2JZ1A 1G41A 3LCUA 2DKLA 2LBCA 2K0BX 3B89A 2JP7A 3GLHE 2JY7A 2KNVA 1IXSA 2CWBA 1OTRA 1DO2A 2ZTDA 2JY5A 2B3TA 1WIVA 3IECA 1XB2B 2L4EA 1VEKA 4Q7JA 2JY8A 3K9PA 2BWEA 1OAIA 1T6OA 1IM2A 4F2LA 1VQ1A 4G3OA 2HWJA 1SG9A 2H5XA 1HQYE 1NV8A 2ZTCA 1NV9A 1CUKA 1XXHE 2O25A 4HEOA 2L2DA 1A5TA 3FRHA 2MR9A 1WR1B 1HT1E 5DFLA 3F92A 1OQYA 1EFUB 2DI0A 1PGYA 1T43A 2JZ0A 1ZMVA 2KHHA 1AIPC 1IFYA 2KNZA 2DAMA 3BBZA 2WZJA 1VEJA 2EJSA 1JR3E 1VEGA 1R4GA 2EKKA 1DV0A 1F4IA 3LCVB 1YLAA 1V92A 3MMPA 2DENA 2LVNC 2DAEA 2DHYA 2QHOB 3K9OA 2OOAA 3IHPA 4R71A 2MGWA 1DO0A 2MJ5B 2OO9A 3E21A 2G3QA 1BVSA 2DZLA 1HT2E 1UFZA 4DBGB 1TTEA 2OOBA 1C7YA 1HJPA 4F1IA 2BWBA 2L4FA 2QSFX 1G4AE 1VDLA 1Y8GA 4UN2B 2LVPC 3E46A 2K9DA 2R0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE3 A;  2LVQ D;  1QZE A;  1WHC A;  2DAI A;  1P3Q Q;  2KNA A;  1ZMU A;  3GLI E;  1GO5 A;  2EKF A;  2JY6 B;  2LTU A;  2DAG A;  2QNJ A;  2CP8 A;  3GLF E;  3T6P A;  2DAK A;  2MRO B;  3GLG E;  1WGL A;  2JNH A;  3H4J A;  5JI2 E;  2JUJ A;  2RRU A;  1ZMW A;  1WJ7 A;  1MN3 A;  1VG5 A;  1E94 E;  2HAK A;  4GEW A;  2DNA A;  1KYI A;  4WP2 A;  1TR8 A;  1OKS A;  1Q02 A;  2LVA A;  3FRI A;  1WGN A;  1G3I A;  1ZV1 A;  2LVO C;  2JZ1 A;  1G41 A;  3LCU A;  2DKL A;  2LBC A;  2K0B X;  3B89 A;  2JP7 A;  3GLH E;  2JY7 A;  2KNV A;  1IXS A;  2CWB A;  1OTR A;  1DO2 A;  2ZTD A;  2JY5 A;  2B3T A;  1WIV A;  3IEC A;  1XB2 B;  2L4E A;  1VEK A;  4Q7J A;  2JY8 A;  3K9P A;  2BWE A;  1OAI A;  1T6O A;  1IM2 A;  4F2L A;  1VQ1 A;  4G3O A;  2HWJ A;  1SG9 A;  2H5X A;  1HQY E;  1NV8 A;  2ZTC A;  1NV9 A;  1CUK A;  1XXH E;  2O25 A;  4HEO A;  2L2D A;  1A5T A;  3FRH A;  2MR9 A;  1WR1 B;  1HT1 E;  5DFL A;  3F92 A;  1OQY A;  1EFU B;  2DI0 A;  1PGY A;  1T43 A;  2JZ0 A;  1ZMV A;  2KHH A;  1AIP C;  1IFY A;  2KNZ A;  2DAM A;  3BBZ A;  2WZJ A;  1VEJ A;  2EJS A;  1JR3 E;  1VEG A;  1R4G A;  2EKK A;  1DV0 A;  1F4I A;  3LCV B;  1YLA A;  1V92 A;  3MMP A;  2DEN A;  2LVN C;  2DAE A;  2DHY A;  2QHO B;  3K9O A;  2OOA A;  3IHP A;  4R71 A;  2MGW A;  1DO0 A;  2MJ5 B;  2OO9 A;  3E21 A;  2G3Q A;  1BVS A;  2DZL A;  1HT2 E;  1UFZ A;  4DBG B;  1TTE A;  2OOB A;  1C7Y A;  1HJP A;  4F1I A;  2BWB A;  2L4F A;  2QSF X;  1G4A E;  1VDL A;  1Y8G A;  4UN2 B;  2LVP C;  3E46 A;  2K9D A;  2R0I A; 
#chains in the Genus database with same CATH topology
 3FE3 A;  2AHM A;  2LVQ D;  1QZE A;  3ZC7 B;  1WHC A;  1XMO M;  4XK8 F;  3TE6 A;  5ITR A;  2KNA A;  4PT5 A;  4LJ6 A;  1T3T A;  2QPA A;  1IY2 A;  3B9P A;  2BJV A;  1GO5 A;  1SXJ A;  2EKF A;  5KPZ A;  3THG A;  3I04 M;  3VFD A;  4JI5 M;  3VDP A;  3KOY E;  1DGH B;  3BOS A;  5FTJ A;  3GRU A;  4JI7 M;  1XXH A;  1GL7 A;  4M9X A;  3T6P A;  3FUV A;  2G8L A;  3JAM S;  5FSW A;  3U60 B;  1HR0 M;  5DNY A;  3LVV A;  3KSX A;  3L29 A;  3GLG E;  2JNH A;  3FUU A;  2M5Z A;  2Q2E B;  1E32 A;  2FH0 A;  3SHF A;  4S12 A;  2UUA M;  1QVR A;  3KW6 A;  1VDD A;  1WJ7 A;  4DR4 M;  1E94 E;  3ILK A;  4HL4 A;  5GKN A;  4GEW A;  1N33 M;  5KPR A;  2KZU A;  2CFO A;  3SYK A;  1TR8 A;  4P16 A;  5E26 A;  5A2Q S;  1ZQ9 A;  2RKO A;  3L2A A;  4LJ8 A;  3QWL A;  1TH3 A;  1HNX M;  5EXT A;  3M0E A;  1MX0 A;  2Z7J A;  2J5Y A;  1KFV A;  1N32 M;  2LBC A;  3HU1 A;  3U6C A;  1LTM A;  3SMS A;  2EO2 A;  2Y20 A;  3PNY A;  4BLC A;  4K0K M;  1OAO C;  1IXR C;  4I8O A;  4I4L A;  5ITY A;  5F3W A;  1DO2 A;  2V1C A;  4RKU F;  1HNW M;  4IBF A;  2OQ4 A;  3VKG A;  1EIJ A;  2GNO A;  1IY0 A;  1Z6T A;  1Q39 A;  2Z4S A;  2JY8 A;  1PRB A;  2BWE A;  2HKJ A;  1OFH A;  4GC5 A;  4IJF A;  3KOZ E;  1OIP A;  1NNJ A;  2F5S A;  3QYE A;  3HU3 A;  3HHY A;  5ITQ A;  2QCU A;  1QUS A;  3GPX A;  1Z59 A;  3GP1 A;  3GLI B;  1NO1 A;  2UU9 M;  4KOD A;  4GHL A;  1JB0 F;  2Y0Q A;  1QUT A;  2XFT A;  4CIZ A;  4REZ A;  4B08 A;  3C58 A;  3K2L A;  4LJ7 A;  3FRH A;  4PD2 A;  1WR1 B;  3U5Z A;  3U6O A;  5DFL A;  1OQY A;  4B7F A;  2ZAM A;  3W68 A;  4GRI A;  4AKH A;  1PGY A;  4QOS A;  3OTO M;  1XMQ M;  3Q8X A;  2F5P A;  3PFI A;  1L2C A;  4I81 A;  1AIP C;  4DR1 M;  3GLG A;  1DGB A;  2KEB A;  2YQZ A;  1JR3 E;  1VEG A;  4FW9 A;  3DOA A;  4A3V B;  2EKK A;  1DV0 A;  2ZAN A;  2DHR A;  2R44 A;  3I4Y A;  3SMP A;  1I4W A;  1V92 A;  4GC9 A;  4OU7 A;  2UXC M;  1JQJ C;  2CEA A;  4MB7 A;  3W67 A;  1PJQ A;  1IXZ A;  2QHO B;  3RE8 A;  4X62 M;  4G4O A;  2MGW A;  4LJA A;  4DR5 M;  2UXB M;  4IBC A;  2MJ5 B;  3VDU A;  4FCV A;  1E9R A;  1XNQ M;  2DVW B;  3HX3 A;  1PJI A;  1EE8 A;  1HJP A;  3FUT A;  4G4Q A;  4MGK E;  4GKJ M;  2QSF X;  5EXX A;  1G4A E;  1Y8G A;  2RGH A;  4ITQ A;  4MGZ E;  5BPV A;  4LRT A;  3KXE C;  4B3R M;  3VK7 A;  3LQQ A;  2F4V M;  4MM3 B;  3HU2 A;  4IBE A;  2DAI A;  1IN7 A;  2VDB B;  3KOX E;  4JI3 M;  4D81 A;  2R62 A;  3W0L B;  2JA2 A;  4XBO A;  3HJ8 A;  1D0L A;  1NY6 A;  2WSE F;  1DGF A;  2BNK A;  4DV7 M;  4L6V 6;  4RF0 A;  2GQF A;  1GJT A;  3H4M A;  1YSY A;  3ZQJ A;  2X8A A;  4FWD A;  1R2Z A;  4ANR A;  4D80 A;  2QNJ A;  3GLF E;  5KQ8 A;  1QDR A;  4JXJ A;  1DGG A;  3QYB A;  2I7N A;  2VII A;  1LV7 A;  2P5T A;  4EIW A;  2W82 A;  1PJT A;  2ZBK B;  3A46 A;  2J7O A;  2UUB M;  1HQC A;  5C18 A;  3SAW A;  2HHH M;  3FTF A;  2RRU A;  2Z8Y M;  3TL4 X;  1D2N A;  4JI1 M;  2C98 A;  2V6Z M;  2HAK A;  3ZH9 B;  4B3M M;  1AUA A;  2DNA A;  1PJJ A;  3U61 B;  1XNR M;  3M7G A;  3CGW A;  5KPT A;  1OKS A;  3U6Q A;  1QAN A;  1JR3 A;  2L6O A;  1WGN A;  2JZ1 A;  3KFU G;  2KRK A;  4R7G A;  4IIW A;  2DKL A;  1QQW A;  4GMQ A;  2K0B X;  2RGO A;  3B89 A;  5DYI A;  2JP7 A;  1TGU A;  2XF3 A;  2KNV A;  1IXS A;  3C3E A;  4W5W A;  4DV5 M;  4LGM A;  1FNN A;  2XH9 A;  2JY5 A;  2B3T A;  2D7H A;  1WIV A;  2XZF A;  1IN4 A;  1JR3 D;  1IBK M;  2L4E A;  2L09 A;  3J80 S;  3PNV A;  1QAM A;  3JR4 A;  4DV6 M;  1IN6 A;  2XZU A;  2HCB A;  4QHT A;  4Z6Y A;  4NC6 A;  2KZS A;  1K3X A;  4QOZ C;  1SXJ D;  4DR7 M;  3GRV A;  2QEN A;  1IN5 A;  2DXI A;  3AKZ A;  4G3O A;  4M9S A;  1QZM A;  1NJG A;  2KW0 A;  1L2B A;  5EXP A;  3U6D A;  1CUK A;  4R3D A;  4CHT B;  5JI3 E;  4WUR A;  3LQR A;  4HEO A;  1Z5B A;  2L2D A;  4M9Z A;  2FE8 A;  4LZZ A;  2MR9 A;  1NY5 A;  4LRS A;  3HZJ A;  2JXN A;  1EFU B;  2NQ8 C;  2DWN A;  2DI0 A;  4IBJ A;  2XEP A;  2QBY A;  1T43 A;  2CV0 A;  3GPY A;  3VLF B;  2MH8 A;  3GLF A;  1ZMV A;  1TDZ A;  3IG5 A;  1IFY A;  2KNZ A;  3BBZ A;  5IRE B;  4DV1 M;  3MHV C;  4FCT A;  1ZAE A;  4JI8 M;  1R4G A;  2JWS A;  2D7G A;  3C3D A;  1I94 M;  3MMP A;  1XWI A;  3SAT A;  2LH0 A;  2HL7 A;  1PM5 A;  2DEN A;  3UMM A;  2DAE A;  4B3T M;  3PVS A;  1XHB A;  2OOA A;  3IHP A;  2UXD M;  2K6B A;  5EP4 A;  1X37 A;  1TH4 A;  1S3S A;  1YE9 A;  1TDH A;  4HLQ A;  4JI0 M;  3E21 A;  2G3Q A;  4OW0 A;  1OFI A;  2YNM D;  2Y21 A;  3A42 A;  3UJN A;  3GLH B;  1HT2 E;  1L8Q A;  4B7G A;  4LFA M;  2K47 A;  4DBG B;  4QNR A;  1TTE A;  1GL6 A;  4CJ6 A;  4X64 M;  2YR0 A;  3V76 A;  3A45 A;  4NL4 H;  1C7Y A;  2L4F A;  4DUZ M;  1R2Y A;  5DYG A;  3NWL A;  4X65 M;  3KS4 A;  1NHW C;  4IBG A;  3FTE A;  3I01 M;  4AQY M;  2LVP C;  2UUC M;  1GJS A;  1RU3 A;  4DV2 M;  3VK8 A;  1QDT A;  1Q3B A;  4DV3 M;  3W0F A;  4B7H A;  3SYL A;  3GPP A;  1J5E M;  4LY6 A;  2VF8 A;  2E5L M;  1SXJ B;  3FTC A;  2QZ4 A;  1ZMU A;  3AOG A;  3GLI E;  2ZAO A;  1XXH B;  3GO8 A;  2APL A;  4OX9 M;  5FTK A;  1ORY B;  1GLN A;  2Y0T A;  2EA0 A;  3AV0 A;  2LTU A;  4DR3 M;  4NSO B;  2XLJ A;  2QQ8 A;  2DAG A;  2WSF F;  2QP9 X;  5EP3 A;  2DAK A;  3TQS A;  1N36 M;  5BR8 M;  3K8Z A;  2CV2 A;  3H4J A;  2CHQ A;  3TWM A;  1UM8 A;  2R65 A;  4Y28 F;  4RNA A;  4LG2 A;  3K92 A;  4NXN M;  3RGS A;  3U60 A;  3B7Z A;  1VG5 A;  4LF4 M;  3DA1 A;  3FUW A;  1KYI A;  2FS1 A;  1QYR A;  4WP2 A;  3DFZ A;  4NRV A;  5EP1 A;  4D82 A;  5ITT A;  4DUY M;  3J27 B;  1Q02 A;  3GQ3 A;  2LHC A;  3AFH A;  3FRI A;  1G3I A;  2DWZ B;  3HGI A;  5E6J A;  1G41 A;  4JI2 M;  2VF7 A;  1N75 A;  1L1Z A;  3JR5 A;  4AG6 A;  1R7R A;  5LMN M;  1Z5C A;  2R45 A;  3J81 S;  4ZPX A;  5ITU A;  4LF7 M;  4LF8 M;  3HHX A;  3U6S A;  3FYD A;  4L16 A;  5FTL A;  2JY7 A;  3LVW A;  3MJ5 A;  2F5Q A;  1NJF A;  1IY1 A;  1N77 A;  1IN8 A;  3A98 B;  3BXW A;  3IEC A;  3RGP A;  4FWH A;  4OVZ A;  1XB2 B;  2H1R A;  4GH9 A;  1J7K A;  1VEK A;  2CHV A;  2EUC A;  4MGI E;  3KDS E;  3D8B A;  3K9P A;  2CHG A;  1OAI A;  1T6O A;  1IM2 A;  2YFQ A;  4F2L A;  1VQ1 A;  2HWJ A;  4JI4 M;  4GIP A;  2WSC F;  5FTM A;  2ZTC A;  1G8P A;  1HQY E;  2Z3X A;  3U5Z B;  2BJW A;  2O25 A;  2R4E A;  2D7E A;  4FVM A;  3RFW A;  1K3W A;  4II7 A;  1NHG C;  1GKI A;  2R18 A;  3L27 A;  1L2D A;  4CIS A;  4Z8X A;  3GLI A;  3LMM A;  1YUB A;  3K1J A;  3F92 A;  3GLG B;  1H6U A;  3VKH A;  3FTD A;  3IG8 A;  2L7I A;  1WXQ A;  1IQP A;  7CAT A;  4L15 A;  4LF6 M;  3HHW A;  3AOE C;  4LJ4 A;  1NNU C;  1VEJ A;  1W5S A;  2XFS A;  3B7N A;  4LZJ A;  4GHA A;  3HWS A;  4TUW A;  1F4I A;  3LCV B;  1YLA A;  4LF9 M;  2O01 F;  3E9S A;  2C5R A;  4AKI A;  4LFC M;  4IJE A;  4AW4 A;  3SHG B;  3GRR A;  4AZF A;  8CAT A;  5KO3 A;  1D0K A;  2OPF A;  4R71 A;  4KLN A;  3R8F A;  1DO0 A;  4IBI A;  4LJ9 A;  1XC8 A;  1BVS A;  2DZL A;  2V1U A;  3UGJ A;  3FYC A;  1N78 A;  3AL0 C;  2L7H A;  2J7N A;  3L25 A;  2OOB A;  3SAR A;  4FCW A;  4GIT A;  4L4U A;  1NSF A;  2A5Y B;  3LW5 F;  3AJI B;  1C1K A;  4LGY A;  3GQ4 A;  4G4N A;  1OJL A;  4P17 A;  4UN2 B;  4MGH A;  3HJS A;  3CF0 A;  4G6Z A;  4PCZ A;  3NBX X;  3HHZ A;  4AG5 A;  3E46 A;  3TPZ A;  4KO8 A;  3EIH A;  1P3Q Q;  3U6L A;  1FJG M;  1KSF X;  3UZU A;  1MU5 A;  2LNH C;  4KT0 F;  2I7P A;  5L8R F;  3KP0 E;  4LFB M;  3SFZ A;  2G5G X;  5FLX S;  3T1H M;  3GRY A;  3SBJ A;  2JY6 B;  1TH2 A;  3T1Y M;  1GAB A;  5FTN A;  4OVZ B;  3FKE A;  3NBI A;  2CP8 A;  3Q8G A;  1V33 A;  1HNZ M;  1L1T A;  2MRO B;  5ITX E;  3J2P B;  2VQF M;  1WGL A;  1E9S A;  3FD9 A;  3KOW E;  4IBB A;  1W5T A;  1SXJ C;  5JI2 E;  4NSR A;  3PXG A;  2JUJ A;  1ZMW A;  2DZN B;  2X4A A;  1D0M A;  1G71 A;  4LF5 M;  1MN3 A;  2FOI C;  1J09 A;  4NXM M;  2FFJ A;  3L28 A;  4RF1 A;  1K82 A;  1QAO A;  2CE7 A;  4MH0 E;  3I4V A;  3HJQ A;  5KQD A;  2LVA A;  3CF6 E;  3QAU A;  4DR2 M;  1NVM A;  5EP2 A;  1ZV1 A;  2LVO C;  2KDL A;  3KP1 E;  4MGY E;  3LCU A;  3U61 A;  4JYA M;  1IXS B;  4NOO B;  3HY5 A;  5IZ7 D;  4CGY B;  4B3S M;  2LHG A;  3R9X B;  4AKG A;  3SC3 A;  4I5S A;  2DZO B;  2N35 A;  3GLH E;  2XSZ A;  2C9C A;  2O5R A;  1N34 M;  2CWB A;  1OTR A;  4YHH M;  2ZTD A;  5C1B A;  3CTW B;  3U6M A;  5H37 D;  1DGH A;  4JV5 M;  1V34 A;  4Q7J A;  4DV0 M;  5IT9 S;  2R6F A;  4JN6 A;  2CUZ A;  2ZM6 M;  3C9P A;  4QNM A;  3J7B A;  2XSZ D;  1SXJ E;  2C9O A;  2R4J A;  1SG9 A;  2M60 A;  5LMU M;  4DV4 M;  2KA6 B;  4LCB A;  4GKK M;  3L26 A;  2H5X A;  1NV8 A;  4FWG A;  4AI6 A;  1NV9 A;  1QAQ A;  3MK6 A;  1XXH E;  4M0W A;  3J7A S;  1Z5A A;  3UK6 A;  2QBY B;  1IBL M;  1A5T A;  3KSJ A;  4IBD A;  5IWA M;  3AOE A;  3GLF B;  1HT1 E;  3B74 A;  2VQE M;  4WW0 A;  4PDG A;  3GPU A;  4KHP M;  1GVN A;  1MJG M;  4G4R A;  1R6B X;  3CF2 A;  2CV1 A;  3TWL A;  2JZ0 A;  4YY3 M;  3KVW A;  4LJ5 A;  2KHH A;  1IBM M;  3T15 A;  3GQ5 A;  2DAM A;  5ITX A;  4BB9 A;  2WZJ A;  4BBA A;  2EJS A;  3D8L A;  2DWM A;  5EJC A;  4FD2 A;  2Z4R A;  3TWK A;  2F5O A;  2DWL A;  2LXE A;  3EIE A;  5EXS A;  4X66 M;  2LVN C;  2DHY A;  3K9O A;  5EQT A;  3ZCB B;  4DR6 M;  1R5L A;  1TF0 B;  2C99 A;  2ERC A;  3SAV A;  2LWX A;  3E4R A;  4M0D A;  2KXE A;  3M6A A;  4L78 A;  2OO9 A;  4XGI A;  3T38 A;  3U6P A;  3FUX A;  3B7Q A;  2R46 A;  2XGN A;  3WHL A;  3U6E A;  1UFZ A;  4QHS A;  1OIZ A;  2X49 A;  4L8R C;  4F1I A;  4JI6 M;  2BWB A;  4NRW A;  4IBK A;  2FNA A;  4PDI A;  3GLH A;  1VDL A;  2KRU A;  3HKP A;  1PJS A;  3I51 A;  2C96 A;  3DZD A;  2CRU A;  1G59 A;  2F5N A;  3WHK A;  1Q3C A;  3SAU A;  2K9D A;  3SAS A;  2R0I A;  3KS8 A; 
#chains in the Genus database with same CATH homology
 3FE3 A;  2LVQ D;  1QZE A;  1WHC A;  2DAI A;  1P3Q Q;  2KNA A;  1ZMU A;  3GLI E;  1GO5 A;  2EKF A;  2JY6 B;  2LTU A;  2DAG A;  2QNJ A;  2CP8 A;  3GLF E;  3T6P A;  2DAK A;  2MRO B;  3GLG E;  1WGL A;  2JNH A;  3H4J A;  5JI2 E;  2JUJ A;  2RRU A;  1ZMW A;  1WJ7 A;  1MN3 A;  1VG5 A;  1E94 E;  2HAK A;  4GEW A;  2DNA A;  1KYI A;  4WP2 A;  1TR8 A;  1OKS A;  1Q02 A;  2LVA A;  3FRI A;  1WGN A;  1G3I A;  1ZV1 A;  2LVO C;  2JZ1 A;  1G41 A;  3LCU A;  2DKL A;  2LBC A;  2K0B X;  3B89 A;  2JP7 A;  3GLH E;  2JY7 A;  2KNV A;  1IXS A;  2CWB A;  1OTR A;  1DO2 A;  2ZTD A;  2JY5 A;  2B3T A;  1WIV A;  3IEC A;  1XB2 B;  2L4E A;  1VEK A;  4Q7J A;  2JY8 A;  3K9P A;  2BWE A;  1OAI A;  1T6O A;  1IM2 A;  4F2L A;  1VQ1 A;  4G3O A;  2HWJ A;  1SG9 A;  2H5X A;  1HQY E;  1NV8 A;  2ZTC A;  1NV9 A;  1CUK A;  1XXH E;  2O25 A;  4HEO A;  2L2D A;  1A5T A;  3FRH A;  2MR9 A;  1WR1 B;  1HT1 E;  5DFL A;  3F92 A;  1OQY A;  1EFU B;  2DI0 A;  1PGY A;  1T43 A;  2JZ0 A;  1ZMV A;  2KHH A;  1AIP C;  1IFY A;  2KNZ A;  2DAM A;  3BBZ A;  2WZJ A;  1VEJ A;  2EJS A;  1JR3 E;  1VEG A;  1R4G A;  2EKK A;  1DV0 A;  1F4I A;  3LCV B;  1YLA A;  1V92 A;  3MMP A;  2DEN A;  2LVN C;  2DAE A;  2DHY A;  2QHO B;  3K9O A;  2OOA A;  3IHP A;  4R71 A;  2MGW A;  1DO0 A;  2MJ5 B;  2OO9 A;  3E21 A;  2G3Q A;  1BVS A;  2DZL A;  1HT2 E;  1UFZ A;  4DBG B;  1TTE A;  2OOB A;  1C7Y A;  1HJP A;  4F1I A;  2BWB A;  2L4F A;  2QSF X;  1G4A E;  1VDL A;  1Y8G A;  4UN2 B;  2LVP C;  3E46 A;  2K9D A;  2R0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...