2LVOC

Structure of the gp78cue domain bound to monubiquitin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
b'SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/ligase
total genus 14
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvoC00
2DI0A 1OAIA 2DAKA 3H4JA 3K9OA 2DAMA 2JNHA 3GLIE 2EKFA 2ZTDA 1F4IA 3FRHA 2EJSA 1XB2B 2DHYA 1HQYE 2JY8A 2R0IA 2DAIA 2WZJA 3IECA 1WGLA 1JR3E 2QSFX 2JZ1A 1WR1B 2BWBA 2KNAA 1OKSA 1GO5A 3GLHE 4R71A 2L4FA 1Q02A 4WP2A 3FE3A 1HT2E 2BWEA 1TTEA 2L2DA 2OOBA 4F2LA 2O25A 3GLFE 4DBGB 1DO0A 2LVAA 4F1IA 1YLAA 1C7YA 1OQYA 1VG5A 2JZ0A 1V92A 1VQ1A 3E46A 2L4EA 2RRUA 1T6OA 3LCVB 1VDLA 2JY5A 3F92A 3E21A 3LCUA 4G3OA 2LTUA 3MMPA 1QZEA 3B89A 1IXSA 1WHCA 1UFZA 2DZLA 2LVPC 1TR8A 1T43A 1CUKA 3BBZA 2JY6B 2DAEA 3IHPA 1P3QQ 1G4AE 2OOAA 2CP8A 1G3IA 2LVQD 2LBCA 2MJ5B 2OO9A 1DV0A 1Y8GA 2K0BX 2JY7A 2HAKA 2JP7A 1A5TA 4HEOA 1ZMWA 2DAGA 1R4GA 4GEWA 1MN3A 1VEJA 1NV9A 1ZV1A 2MROB 1SG9A 2MR9A 2G3QA 1KYIA 1HJPA 1G41A 1ZMVA 2CWBA 2DKLA 2EKKA 1VEKA 1WJ7A 3T6PA 5DFLA 3GLGE 1HT1E 2H5XA 3FRIA 4UN2B 2B3TA 2LVNC 1WIVA 2ZTCA 1XXHE 4Q7JA 1BVSA 1IFYA 1ZMUA 2JUJA 2LVOC 2QHOB 1IM2A 3K9PA 2MGWA 2KNZA 1AIPC 1E94E 1OTRA 1WGNA 2KHHA 2KNVA 1EFUB 2K9DA 1DO2A 1PGYA 2DENA 2QNJA 5JI2E 1VEGA 1NV8A 2HWJA 2DNAA
chains in the Genus database with same CATH superfamily
2ZAMA 1KSFX 3KP1E 2KRUA 4IBBA 1DGFA 1LTMA 2DAKA 3KFUG 3GQ5A 4AKGA 4RF1A 4GHLA 2JA2A 2YQZA 3GLIE 4DV5M 3SBJA 5EXXA 4K0KM 1F4IA 1YE9A 3FRHA 4XBOA 3I4VA 2DWLA 1N32M 3PVSA 5KPRA 2VQEM 3U5ZA 3I04M 2DAIA 4GC5A 4DUYM 3SAWA 1PJJA 2D7EA 2WZJA 5GKNA 3GRRA 1DGHA 4LJ8A 1JR3E 1OIZA 2K6BA 4WURA 5DYGA 3T15A 1L2DA 2QSFX 4B3MM 2JZ1A 4R7GA 3SMPA 1QDRA 1IQPA 2R46A 4BBAA 2BWBA 4I8OA 2R62A 3JR5A 5EP2A 4IBDA 3RE8A 3GPUA 1Q02A 2R4JA 3BXWA 1GJSA 3GRUA 1HT2E 2FS1A 3VK7A 1NY6A 1TDHA 2KZSA 2OOBA 4PDGA 1T3TA 1OFIA 2CHGA 1MX0A 1IN8A 4DBGB 1DO0A 3UMMA 1IN4A 3UK6A 1AUAA 1IN7A 2YFQA 1VG5A 3AOEA 3FTDA 4YHHM 1G59A 2UXBM 2R18A 3FTEA 1N77A 3DOAA 2DWNA 2UUCM 2G5GX 1NVMA 4QOZC 1N78A 3AJIB 3KXEC 4OX9M 1SXJA 3QYEA 2LTUA 3MMPA 4L8RC 2J7NA 2Z4RA 2QP9X 4QHSA 4YY3M 2VF7A 4MGZE 2VDBB 3I51A 5ITUA 1WHCA 3EIEA 2E5LM 4G6ZA 5EP1A 2N35A 3VDUA 5LMUM 4LJ5A 1CUKA 1SXJE 2I7PA 3BBZA 4CISA 3U6EA 5EQTA 1N75A 3IHPA 3LW5F 1G4AE 3SARA 2OOAA 3FTCA 2MJ5B 3KOXE 3GP1A 5DYIA 1YSYA 3T38A 4IBKA 2DHRA 1IY2A 2DVWB 2YR0A 4RNAA 2F5PA 2J7OA 1JR3D 3IG8A 3MHVC 2DXIA 5EXTA 2VIIA 5KPZA 3UJNA 3KSJA 5EP4A 2R4EA 4DV1M 1R5LA 3QYBA 3FYCA 1SG9A 1XXHB 2MR9A 3KW6A 5ITRA 2LNHC 1HJPA 1ORYB 4LRSA 2QQ8A 4X66M 4JI2M 2WSFF 4B3TM 4LJ4A 3HGIA 1VEKA 1OAOC 1XWIA 1I4WA 4LFBM 1RU3A 1QAOA 4QNMA 2FOIC 5DFLA 2XSZA 3FRIA 4DR1M 4IJFA 1I94M 2FH0A 2ZTCA 1L8QA 4OU7A 4JXJA 3KOYE 2KA6B 3VKHA 3K8ZA 4MH0E 3PNVA 4B7FA 2Z7JA 3E4RA 3HWSA 3U60B 2CE7A 5BPVA 2V1CA 5E6JA 4LJAA 4DR4M 3FD9A 3CF6E 2OPFA 2EO2A 3GLIB 1AIPC 4MGKE 4P17A 1L1TA 2KNVA 2Y21A 2K9DA 4D82A 3SMSA 2VQFM 1R2ZA 2CV0A 4FW9A 4AI6A 2HHHM 4AKIA 2KXEA 1NV8A 2HWJA 2DNAA 2W82A 4LZZA 4GMQA 1SXJD 1QVRA 2DI0A 4S12A 1OAIA 1XXHA 1JQJC 3H4JA 3K9OA 3V76A 2DAMA 2JNHA 3HU3A 2EKFA 4X62M 2EJSA 5LMNM 3U5ZB 2DHYA 2JWSA 4PCZA 4DV7M 1K3WA 3AKZA 2R0IA 3C3EA 4I4LA 4LGMA 4HLQA 4IBJA 1XHBA 1WGLA 2QENA 3VLFB 3DZDA 4DR3M 5EP3A 3A42A 1W5TA 3GQ4A 2UU9M 4LF8M 3SAUA 3U60A 4NXNM 2K47A 2HL7A 2UUBM 4R71A 3GLIA 2L4FA 3RFWA 5ITXE 3J81S 4WW0A 2FNAA 3TQSA 4JI7M 1TDZA 2VF8A 4ZPXA 3A98B 4JI1M 2KDLA 2L2DA 4LG2A 5FTLA 3A45A 1DGBA 3CF0A 4GH9A 4L4UA 2O25A 1Q3CA 2LH0A 3L2AA 4IBGA 2QZ4A 4MGYE 3GLFE 1N36M 2LVAA 4IBIA 1JR3A 2QCUA 4FD2A 3HHXA 4FWGA 1PRBA 2LWXA 4I81A 1N34M 1V92A 1VQ1A 3SYLA 4A3VB 1NJGA 4AKHA 2XH9A 2C96A 3F92A 4M0WA 1W5SA 1SXJB 4KT0F 3ZH9B 3TPZA 3W0FA 5FSWA 2C9OA 3CF2A 5ITYA 2XSZD 3U6DA 4G3OA 4DV3M 1IBLM 1IY0A 3B89A 1QZMA 3LVWA 4AQYM 3SHGB 1NHWC 1UFZA 4XK8F 2R65A 3SATA 2LVPC 3CTWB 4GITA 1T43A 4HL4A 1QYRA 3RGPA 3AOGA 3CGWA 1GKIA 3L26A 2JY6B 4QNRA 3AOEC 5F3WA 1GABA 2H1RA 2LHGA 1PJQA 1G3IA 2C98A 3KS4A 3J80S 3PXGA 1XMOM 1DV0A 3VKGA 3KP0E 4DR2M 1SXJC 2L7IA 4R3DA 4NOOB 3PFIA 3R8FA 2KW0A 4B7GA 2Y20A 5IT9S 2OQ4A 5KQDA 4BLCA 4M0DA 4LF5M 3LMMA 4L15A 2L09A 2ERCA 2C5RA 1XNRM 1NO1A 4IBCA 2L7HA 2MROB 1VDDA 3JAMS 3GO8A 2KEBA 3L25A 1NSFA 2G3QA 2F4VM 4LGYA 4JI4M 1ZMVA 3L28A 1PJIA 3B7QA 3UGJA 1WJ7A 3R9XB 4JI3M 3W0LB 1GVNA 1EIJA 3M6AA 2B3TA 2DZNB 4UN2B 3SC3A 4DR5M 3GPXA 1H6UA 1QAQA 1WIVA 1MU5A 4Q7JA 4EIWA 4OVZB 1ZMUA 5IWAM 1IXZA 2X4AA 5L8RF 2GQFA 2ZBKB 3HHWA 1IM2A 3TWLA 2MGWA 1E9RA 3J27B 3QAUA 2KNZA 1OTRA 2KHHA 1IN5A 4DR6M 3VK8A 2DZOB 3HZJA 1XNQM 4IBFA 2DENA 3U6LA 4ITQA 3DFZA 3A46A 1VDLA 1NJFA 3T6PA 4PD2A 1ZQ9A 3L29A 3ZC7B 3TL4X 4NRWA 2Y0QA 3D8BA 3HJSA 3HJ8A 2ZTDA 3KSXA 5FLXS 4DV2M 3LQQA 1XB2B 2R45A 4FWDA 3L27A 5A2QS 4I5SA 1IY1A 1OFHA 2JXNA 1IBKM 1D2NA 3GLHA 1EE8A 2WSEF 3K2LA 1NHGC 1IXSB 4X64M 4OVZA 3C9PA 5KQ8A 3HX3A 4Z8XA 1X37A 3GLFB 1LV7A 1Z6TA 2KNAA 4CJ6A 5IREB 3KS8A 1QQWA 4L16A 3GLHE 2CUZA 4FVMA 4LRTA 3GQ3A 4DUZM 4B3RM 4WP2A 1Z59A 4DV4M 1HQCA 3FE3A 1R6BX 3AL0C 4REZA 4F2LA 4QHTA 1OIPA 5EJCA 2F5SA 4NXMM 5C18A 4PT5A 1C7YA 2JZ0A 4FWHA 3E46A 2RRUA 1T6OA 1WXQA 3U6PA 4LJ7A 2C99A 2G8LA 5ITXA 4B7HA 3LCUA 4II7A 4QOSA 4X65M 2MH8A 1QZEA 2F5OA 1Z5CA 1IXSA 3IG5A 4IBEA 4LZJA 3U6MA 2Q2EB 3MK6A 3GLFA 4NC6A 1QANA 5FTNA 4GHAA 4GC9A 3KOWE 5EXSA 4JI6M 1TR8A 3FUWA 4RF0A 1TGUA 3HY5A 2RGOA 3GPPA 3U6QA 3K1JA 5DNYA 3U6CA 4GKJM 4M9ZA 1P3QQ 2AHMA 4M9SA 3J7BA 2M60A 3UZUA 2CP8A 3M0EA 4IIWA 4AG6A 3QWLA 4D81A 1J5EM 3SYKA 1Y8GA 4W5WA 3GRYA 2JP7A 1TH2A 2QPAA 1A5TA 4HEOA 1ZMWA 3SHFA 2DAGA 5FTKA 1G71A 2F5NA 4IJEA 4GEWA 4AG5A 4TUWA 4CIZA 1MN3A 1VEJA 3TWMA 1S3SA 1Z5BA 2R6FA 1NV9A 3B74A 4Y28F 1L1ZA 4XGIA 1ZV1A 3EIHA 1TH3A 3T1YM 2FFJA 1UM8A 1L2BA 2XEPA 4LF9M 3KDSE 2WSCF 3Q8XA 1IXRC 4FCVA 1KYIA 4NL4H 3HHZA 1PJTA 1FNNA 4B08A 3U6SA 3I01M 2J5YA 3ZQJA 2DKLA 4MB7A 4G4NA 1QUTA 2APLA 3J7AS 1J09A 2DWZB 5FTJA 3HKPA 1R7RA 4OW0A 8CATA 1IBMM 3GLGE 3H4MA 2ZANA 3D8LA 2LVNC 1K3XA 3KOZE 2BJWA 4GKKM 2CHVA 2CHQA 1ZAEA 4LY6A 1BVSA 3HJQA 1KFVA 1Q39A 1DGGA 2JUJA 4KO8A 2CRUA 4M9XA 3FUTA 4DR7M 2QHOB 3KVWA 3NWLA 3K9PA 4AZFA 2ZM6M 2KRKA 2UXCM 1E94E 3FUUA 3VDPA 2EA0A 2X49A 2Y0TA 2CEAA 2ZAOA 4P16A 4L6V6 3RGSA 4JV5M 5JI2E 2QNJA 4RKUF 3TE6A 2Z3XA 2Z8YM 4Z6YA 4D80A 3J2PB 2I7NA 2P5TA 1NNJA 3W68A 3ZCBB 2LXEA 1L2CA 1YUBA 3GLHB 1E9SA 1HQYE 2BNKA 3U6OA 1HNXM 2JY8A 3B7ZA 3K92A 2QBYB 3IECA 3THGA 3B9PA 4G4RA 2XZUA 3BOSA 5E26A 2DWMA 4L78A 4MM3B 2CV1A 3C3DA 2EUCA 3E9SA 2LHCA 1WR1B 3LVVA 3U61B 1OKSA 3FYDA 1GO5A 4MGHA 5FTMA 5BR8M 1Q3BA 2YNMD 3FKEA 4ANRA 2R44A 2Z4SA 4GIPA 2HCBA 4G4OA 4B3SM 4CHTB 2BWEA 1TTEA 4PDIA 2V1UA 2L6OA 4DV6M 5KPTA 1K82A 4JI8M 4F1IA 3HU1A 1YLAA 2XFTA 3ILKA 3HHYA 1XC8A 1OQYA 2D7HA 2CV2A 1D0KA 1QAMA 2L4EA 3LCVB 5IZ7D 4JYAM 2RGHA 3Q8GA 2JY5A 2O01F 4LF6M 1TH4A 3DA1A 3E21A 7CATA 3C58A 3WHLA 3GPYA 2V6ZM 2QBYA 1E32A 5KO3A 1NNUC 1D0MA 1FJGM 4BB9A 2CFOA 3U61A 4NRVA 4G4QA 3M7GA 4LCBA 1OJLA 4LF4M 1JB0F 2X8AA 1HNWM 3NBIA 1HR0M 4KLNA 2DAEA 2XFSA 1IN6A 4LFAM 2A5YB 3WHKA 3T1HM 1C1KA 1NY5A 4NSOB 1D0LA 2LVQD 2LBCA 2OO9A 3FUXA 3GRVA 2O5RA 3MJ5A 5C1BA 2K0BX 1TF0B 2JY7A 1G8PA 2HAKA 4FCTA 4CGYB 2KZUA 3NBXX 1XMQM 3HU2A 2C9CA 2M5ZA 1R4GA 2D7GA 3LQRA 2XLJA 1PM5A 3FTFA 3B7NA 2F5QA 5H37D 3GLGB 4DV0M 2UUAM 1PJSA 3OTOM 3I4YA 4AW4A 1QUSA 3AFHA 5ITTA 3SFZA 4MGIE 1GL6A 1G41A 2GNOA 4LJ9A 2XF3A 1GJTA 3SAVA 2CWBA 1J7KA 2BJVA 4LFCM 1GL7A 2FE8A 2EKKA 5EXPA 3FUVA 2NQ8C 2XZFA 1R2YA 2XGNA 3PNYA 1V34A 3VFDA 1HNZM 1HT1E 1Z5AA 2H5XA 4GRIA 3JR4A 3W67A 4LF7M 4NSRA 3SASA 2RKOA 1XXHE 1DGHB 3AV0A 2HKJA 4JI0M 1IFYA 2LVOC 3TWKA 4JI5M 1V33A 5JI3E 1GLNA 1WGNA 4KODA 1EFUB 4JN6A 1DO2A 4KHPM 1MJGM 1PGYA 3GLGA 5ITQA 4FCWA 1VEGA 1QDTA 1N33M 4LJ6A 2DZLA 2UXDM
chains in the Genus database with same CATH topology
2DI0A 1OAIA 2DAKA 3H4JA 3K9OA 2DAMA 2JNHA 3GLIE 2EKFA 2ZTDA 1F4IA 3FRHA 2EJSA 1XB2B 2DHYA 1HQYE 2JY8A 2R0IA 2DAIA 2WZJA 3IECA 1WGLA 1JR3E 2QSFX 2JZ1A 1WR1B 2BWBA 2KNAA 1OKSA 1GO5A 3GLHE 4R71A 2L4FA 1Q02A 4WP2A 3FE3A 1HT2E 2BWEA 1TTEA 2L2DA 2OOBA 4F2LA 2O25A 3GLFE 4DBGB 1DO0A 2LVAA 4F1IA 1YLAA 1C7YA 1OQYA 1VG5A 2JZ0A 1V92A 1VQ1A 3E46A 2L4EA 2RRUA 1T6OA 3LCVB 1VDLA 2JY5A 3F92A 3E21A 3LCUA 4G3OA 2LTUA 3MMPA 1QZEA 3B89A 1IXSA 1WHCA 1UFZA 2DZLA 2LVPC 1TR8A 1T43A 1CUKA 3BBZA 2JY6B 2DAEA 3IHPA 1P3QQ 1G4AE 2OOAA 2CP8A 1G3IA 2LVQD 2LBCA 2MJ5B 2OO9A 1DV0A 1Y8GA 2K0BX 2JY7A 2HAKA 2JP7A 1A5TA 4HEOA 1ZMWA 2DAGA 1R4GA 4GEWA 1MN3A 1VEJA 1NV9A 1ZV1A 2MROB 1SG9A 2MR9A 2G3QA 1KYIA 1HJPA 1G41A 1ZMVA 2CWBA 2DKLA 2EKKA 1VEKA 1WJ7A 3T6PA 5DFLA 3GLGE 1HT1E 2H5XA 3FRIA 4UN2B 2B3TA 2LVNC 1WIVA 2ZTCA 1XXHE 4Q7JA 1BVSA 1IFYA 1ZMUA 2JUJA 2LVOC 2QHOB 1IM2A 3K9PA 2MGWA 2KNZA 1AIPC 1E94E 1OTRA 1WGNA 2KHHA 2KNVA 1EFUB 2K9DA 1DO2A 1PGYA 2DENA 2QNJA 5JI2E 1VEGA 1NV8A 2HWJA 2DNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DI0 A;  1OAI A;  2DAK A;  3H4J A;  3K9O A;  2DAM A;  2JNH A;  3GLI E;  2EKF A;  2ZTD A;  1F4I A;  3FRH A;  2EJS A;  1XB2 B;  2DHY A;  1HQY E;  2JY8 A;  2R0I A;  2DAI A;  2WZJ A;  3IEC A;  1WGL A;  1JR3 E;  2QSF X;  2JZ1 A;  1WR1 B;  2BWB A;  2KNA A;  1OKS A;  1GO5 A;  3GLH E;  4R71 A;  2L4F A;  1Q02 A;  4WP2 A;  3FE3 A;  1HT2 E;  2BWE A;  1TTE A;  2L2D A;  2OOB A;  4F2L A;  2O25 A;  3GLF E;  4DBG B;  1DO0 A;  2LVA A;  4F1I A;  1YLA A;  1C7Y A;  1OQY A;  1VG5 A;  2JZ0 A;  1V92 A;  1VQ1 A;  3E46 A;  2L4E A;  2RRU A;  1T6O A;  3LCV B;  1VDL A;  2JY5 A;  3F92 A;  3E21 A;  3LCU A;  4G3O A;  2LTU A;  3MMP A;  1QZE A;  3B89 A;  1IXS A;  1WHC A;  1UFZ A;  2DZL A;  2LVP C;  1TR8 A;  1T43 A;  1CUK A;  3BBZ A;  2JY6 B;  2DAE A;  3IHP A;  1P3Q Q;  1G4A E;  2OOA A;  2CP8 A;  1G3I A;  2LVQ D;  2LBC A;  2MJ5 B;  2OO9 A;  1DV0 A;  1Y8G A;  2K0B X;  2JY7 A;  2HAK A;  2JP7 A;  1A5T A;  4HEO A;  1ZMW A;  2DAG A;  1R4G A;  4GEW A;  1MN3 A;  1VEJ A;  1NV9 A;  1ZV1 A;  2MRO B;  1SG9 A;  2MR9 A;  2G3Q A;  1KYI A;  1HJP A;  1G41 A;  1ZMV A;  2CWB A;  2DKL A;  2EKK A;  1VEK A;  1WJ7 A;  3T6P A;  5DFL A;  3GLG E;  1HT1 E;  2H5X A;  3FRI A;  4UN2 B;  2B3T A;  2LVN C;  1WIV A;  2ZTC A;  1XXH E;  4Q7J A;  1BVS A;  1IFY A;  1ZMU A;  2JUJ A;  2LVO C;  2QHO B;  1IM2 A;  3K9P A;  2MGW A;  2KNZ A;  1AIP C;  1E94 E;  1OTR A;  1WGN A;  2KHH A;  2KNV A;  1EFU B;  2K9D A;  1DO2 A;  1PGY A;  2DEN A;  2QNJ A;  5JI2 E;  1VEG A;  1NV8 A;  2HWJ A;  2DNA A; 
#chains in the Genus database with same CATH topology
 2ZAM A;  1KSF X;  3KP1 E;  2KRU A;  4IBB A;  1DGF A;  1LTM A;  2DAK A;  3KFU G;  3GQ5 A;  4AKG A;  4RF1 A;  4GHL A;  2JA2 A;  2YQZ A;  3GLI E;  4DV5 M;  3SBJ A;  5EXX A;  4K0K M;  1F4I A;  1YE9 A;  3FRH A;  4XBO A;  3I4V A;  2DWL A;  1N32 M;  3PVS A;  5KPR A;  2VQE M;  3U5Z A;  3I04 M;  2DAI A;  4GC5 A;  4DUY M;  3SAW A;  1PJJ A;  2D7E A;  2WZJ A;  5GKN A;  3GRR A;  1DGH A;  4LJ8 A;  1JR3 E;  1OIZ A;  2K6B A;  4WUR A;  5DYG A;  3T15 A;  1L2D A;  2QSF X;  4B3M M;  2JZ1 A;  4R7G A;  3SMP A;  1QDR A;  1IQP A;  2R46 A;  4BBA A;  2BWB A;  4I8O A;  2R62 A;  3JR5 A;  5EP2 A;  4IBD A;  3RE8 A;  3GPU A;  1Q02 A;  2R4J A;  3BXW A;  1GJS A;  3GRU A;  1HT2 E;  2FS1 A;  3VK7 A;  1NY6 A;  1TDH A;  2KZS A;  2OOB A;  4PDG A;  1T3T A;  1OFI A;  2CHG A;  1MX0 A;  1IN8 A;  4DBG B;  1DO0 A;  3UMM A;  1IN4 A;  3UK6 A;  1AUA A;  1IN7 A;  2YFQ A;  1VG5 A;  3AOE A;  3FTD A;  4YHH M;  1G59 A;  2UXB M;  2R18 A;  3FTE A;  1N77 A;  3DOA A;  2DWN A;  2UUC M;  2G5G X;  1NVM A;  4QOZ C;  1N78 A;  3AJI B;  3KXE C;  4OX9 M;  1SXJ A;  3QYE A;  2LTU A;  3MMP A;  4L8R C;  2J7N A;  2Z4R A;  2QP9 X;  4QHS A;  4YY3 M;  2VF7 A;  4MGZ E;  2VDB B;  3I51 A;  5ITU A;  1WHC A;  3EIE A;  2E5L M;  4G6Z A;  5EP1 A;  2N35 A;  3VDU A;  5LMU M;  4LJ5 A;  1CUK A;  1SXJ E;  2I7P A;  3BBZ A;  4CIS A;  3U6E A;  5EQT A;  1N75 A;  3IHP A;  3LW5 F;  1G4A E;  3SAR A;  2OOA A;  3FTC A;  2MJ5 B;  3KOX E;  3GP1 A;  5DYI A;  1YSY A;  3T38 A;  4IBK A;  2DHR A;  1IY2 A;  2DVW B;  2YR0 A;  4RNA A;  2F5P A;  2J7O A;  1JR3 D;  3IG8 A;  3MHV C;  2DXI A;  5EXT A;  2VII A;  5KPZ A;  3UJN A;  3KSJ A;  5EP4 A;  2R4E A;  4DV1 M;  1R5L A;  3QYB A;  3FYC A;  1SG9 A;  1XXH B;  2MR9 A;  3KW6 A;  5ITR A;  2LNH C;  1HJP A;  1ORY B;  4LRS A;  2QQ8 A;  4X66 M;  4JI2 M;  2WSF F;  4B3T M;  4LJ4 A;  3HGI A;  1VEK A;  1OAO C;  1XWI A;  1I4W A;  4LFB M;  1RU3 A;  1QAO A;  4QNM A;  2FOI C;  5DFL A;  2XSZ A;  3FRI A;  4DR1 M;  4IJF A;  1I94 M;  2FH0 A;  2ZTC A;  1L8Q A;  4OU7 A;  4JXJ A;  3KOY E;  2KA6 B;  3VKH A;  3K8Z A;  4MH0 E;  3PNV A;  4B7F A;  2Z7J A;  3E4R A;  3HWS A;  3U60 B;  2CE7 A;  5BPV A;  2V1C A;  5E6J A;  4LJA A;  4DR4 M;  3FD9 A;  3CF6 E;  2OPF A;  2EO2 A;  3GLI B;  1AIP C;  4MGK E;  4P17 A;  1L1T A;  2KNV A;  2Y21 A;  2K9D A;  4D82 A;  3SMS A;  2VQF M;  1R2Z A;  2CV0 A;  4FW9 A;  4AI6 A;  2HHH M;  4AKI A;  2KXE A;  1NV8 A;  2HWJ A;  2DNA A;  2W82 A;  4LZZ A;  4GMQ A;  1SXJ D;  1QVR A;  2DI0 A;  4S12 A;  1OAI A;  1XXH A;  1JQJ C;  3H4J A;  3K9O A;  3V76 A;  2DAM A;  2JNH A;  3HU3 A;  2EKF A;  4X62 M;  2EJS A;  5LMN M;  3U5Z B;  2DHY A;  2JWS A;  4PCZ A;  4DV7 M;  1K3W A;  3AKZ A;  2R0I A;  3C3E A;  4I4L A;  4LGM A;  4HLQ A;  4IBJ A;  1XHB A;  1WGL A;  2QEN A;  3VLF B;  3DZD A;  4DR3 M;  5EP3 A;  3A42 A;  1W5T A;  3GQ4 A;  2UU9 M;  4LF8 M;  3SAU A;  3U60 A;  4NXN M;  2K47 A;  2HL7 A;  2UUB M;  4R71 A;  3GLI A;  2L4F A;  3RFW A;  5ITX E;  3J81 S;  4WW0 A;  2FNA A;  3TQS A;  4JI7 M;  1TDZ A;  2VF8 A;  4ZPX A;  3A98 B;  4JI1 M;  2KDL A;  2L2D A;  4LG2 A;  5FTL A;  3A45 A;  1DGB A;  3CF0 A;  4GH9 A;  4L4U A;  2O25 A;  1Q3C A;  2LH0 A;  3L2A A;  4IBG A;  2QZ4 A;  4MGY E;  3GLF E;  1N36 M;  2LVA A;  4IBI A;  1JR3 A;  2QCU A;  4FD2 A;  3HHX A;  4FWG A;  1PRB A;  2LWX A;  4I81 A;  1N34 M;  1V92 A;  1VQ1 A;  3SYL A;  4A3V B;  1NJG A;  4AKH A;  2XH9 A;  2C96 A;  3F92 A;  4M0W A;  1W5S A;  1SXJ B;  4KT0 F;  3ZH9 B;  3TPZ A;  3W0F A;  5FSW A;  2C9O A;  3CF2 A;  5ITY A;  2XSZ D;  3U6D A;  4G3O A;  4DV3 M;  1IBL M;  1IY0 A;  3B89 A;  1QZM A;  3LVW A;  4AQY M;  3SHG B;  1NHW C;  1UFZ A;  4XK8 F;  2R65 A;  3SAT A;  2LVP C;  3CTW B;  4GIT A;  1T43 A;  4HL4 A;  1QYR A;  3RGP A;  3AOG A;  3CGW A;  1GKI A;  3L26 A;  2JY6 B;  4QNR A;  3AOE C;  5F3W A;  1GAB A;  2H1R A;  2LHG A;  1PJQ A;  1G3I A;  2C98 A;  3KS4 A;  3J80 S;  3PXG A;  1XMO M;  1DV0 A;  3VKG A;  3KP0 E;  4DR2 M;  1SXJ C;  2L7I A;  4R3D A;  4NOO B;  3PFI A;  3R8F A;  2KW0 A;  4B7G A;  2Y20 A;  5IT9 S;  2OQ4 A;  5KQD A;  4BLC A;  4M0D A;  4LF5 M;  3LMM A;  4L15 A;  2L09 A;  2ERC A;  2C5R A;  1XNR M;  1NO1 A;  4IBC A;  2L7H A;  2MRO B;  1VDD A;  3JAM S;  3GO8 A;  2KEB A;  3L25 A;  1NSF A;  2G3Q A;  2F4V M;  4LGY A;  4JI4 M;  1ZMV A;  3L28 A;  1PJI A;  3B7Q A;  3UGJ A;  1WJ7 A;  3R9X B;  4JI3 M;  3W0L B;  1GVN A;  1EIJ A;  3M6A A;  2B3T A;  2DZN B;  4UN2 B;  3SC3 A;  4DR5 M;  3GPX A;  1H6U A;  1QAQ A;  1WIV A;  1MU5 A;  4Q7J A;  4EIW A;  4OVZ B;  1ZMU A;  5IWA M;  1IXZ A;  2X4A A;  5L8R F;  2GQF A;  2ZBK B;  3HHW A;  1IM2 A;  3TWL A;  2MGW A;  1E9R A;  3J27 B;  3QAU A;  2KNZ A;  1OTR A;  2KHH A;  1IN5 A;  4DR6 M;  3VK8 A;  2DZO B;  3HZJ A;  1XNQ M;  4IBF A;  2DEN A;  3U6L A;  4ITQ A;  3DFZ A;  3A46 A;  1VDL A;  1NJF A;  3T6P A;  4PD2 A;  1ZQ9 A;  3L29 A;  3ZC7 B;  3TL4 X;  4NRW A;  2Y0Q A;  3D8B A;  3HJS A;  3HJ8 A;  2ZTD A;  3KSX A;  5FLX S;  4DV2 M;  3LQQ A;  1XB2 B;  2R45 A;  4FWD A;  3L27 A;  5A2Q S;  4I5S A;  1IY1 A;  1OFH A;  2JXN A;  1IBK M;  1D2N A;  3GLH A;  1EE8 A;  2WSE F;  3K2L A;  1NHG C;  1IXS B;  4X64 M;  4OVZ A;  3C9P A;  5KQ8 A;  3HX3 A;  4Z8X A;  1X37 A;  3GLF B;  1LV7 A;  1Z6T A;  2KNA A;  4CJ6 A;  5IRE B;  3KS8 A;  1QQW A;  4L16 A;  3GLH E;  2CUZ A;  4FVM A;  4LRT A;  3GQ3 A;  4DUZ M;  4B3R M;  4WP2 A;  1Z59 A;  4DV4 M;  1HQC A;  3FE3 A;  1R6B X;  3AL0 C;  4REZ A;  4F2L A;  4QHT A;  1OIP A;  5EJC A;  2F5S A;  4NXM M;  5C18 A;  4PT5 A;  1C7Y A;  2JZ0 A;  4FWH A;  3E46 A;  2RRU A;  1T6O A;  1WXQ A;  3U6P A;  4LJ7 A;  2C99 A;  2G8L A;  5ITX A;  4B7H A;  3LCU A;  4II7 A;  4QOS A;  4X65 M;  2MH8 A;  1QZE A;  2F5O A;  1Z5C A;  1IXS A;  3IG5 A;  4IBE A;  4LZJ A;  3U6M A;  2Q2E B;  3MK6 A;  3GLF A;  4NC6 A;  1QAN A;  5FTN A;  4GHA A;  4GC9 A;  3KOW E;  5EXS A;  4JI6 M;  1TR8 A;  3FUW A;  4RF0 A;  1TGU A;  3HY5 A;  2RGO A;  3GPP A;  3U6Q A;  3K1J A;  5DNY A;  3U6C A;  4GKJ M;  4M9Z A;  1P3Q Q;  2AHM A;  4M9S A;  3J7B A;  2M60 A;  3UZU A;  2CP8 A;  3M0E A;  4IIW A;  4AG6 A;  3QWL A;  4D81 A;  1J5E M;  3SYK A;  1Y8G A;  4W5W A;  3GRY A;  2JP7 A;  1TH2 A;  2QPA A;  1A5T A;  4HEO A;  1ZMW A;  3SHF A;  2DAG A;  5FTK A;  1G71 A;  2F5N A;  4IJE A;  4GEW A;  4AG5 A;  4TUW A;  4CIZ A;  1MN3 A;  1VEJ A;  3TWM A;  1S3S A;  1Z5B A;  2R6F A;  1NV9 A;  3B74 A;  4Y28 F;  1L1Z A;  4XGI A;  1ZV1 A;  3EIH A;  1TH3 A;  3T1Y M;  2FFJ A;  1UM8 A;  1L2B A;  2XEP A;  4LF9 M;  3KDS E;  2WSC F;  3Q8X A;  1IXR C;  4FCV A;  1KYI A;  4NL4 H;  3HHZ A;  1PJT A;  1FNN A;  4B08 A;  3U6S A;  3I01 M;  2J5Y A;  3ZQJ A;  2DKL A;  4MB7 A;  4G4N A;  1QUT A;  2APL A;  3J7A S;  1J09 A;  2DWZ B;  5FTJ A;  3HKP A;  1R7R A;  4OW0 A;  8CAT A;  1IBM M;  3GLG E;  3H4M A;  2ZAN A;  3D8L A;  2LVN C;  1K3X A;  3KOZ E;  2BJW A;  4GKK M;  2CHV A;  2CHQ A;  1ZAE A;  4LY6 A;  1BVS A;  3HJQ A;  1KFV A;  1Q39 A;  1DGG A;  2JUJ A;  4KO8 A;  2CRU A;  4M9X A;  3FUT A;  4DR7 M;  2QHO B;  3KVW A;  3NWL A;  3K9P A;  4AZF A;  2ZM6 M;  2KRK A;  2UXC M;  1E94 E;  3FUU A;  3VDP A;  2EA0 A;  2X49 A;  2Y0T A;  2CEA A;  2ZAO A;  4P16 A;  4L6V 6;  3RGS A;  4JV5 M;  5JI2 E;  2QNJ A;  4RKU F;  3TE6 A;  2Z3X A;  2Z8Y M;  4Z6Y A;  4D80 A;  3J2P B;  2I7N A;  2P5T A;  1NNJ A;  3W68 A;  3ZCB B;  2LXE A;  1L2C A;  1YUB A;  3GLH B;  1E9S A;  1HQY E;  2BNK A;  3U6O A;  1HNX M;  2JY8 A;  3B7Z A;  3K92 A;  2QBY B;  3IEC A;  3THG A;  3B9P A;  4G4R A;  2XZU A;  3BOS A;  5E26 A;  2DWM A;  4L78 A;  4MM3 B;  2CV1 A;  3C3D A;  2EUC A;  3E9S A;  2LHC A;  1WR1 B;  3LVV A;  3U61 B;  1OKS A;  3FYD A;  1GO5 A;  4MGH A;  5FTM A;  5BR8 M;  1Q3B A;  2YNM D;  3FKE A;  4ANR A;  2R44 A;  2Z4S A;  4GIP A;  2HCB A;  4G4O A;  4B3S M;  4CHT B;  2BWE A;  1TTE A;  4PDI A;  2V1U A;  2L6O A;  4DV6 M;  5KPT A;  1K82 A;  4JI8 M;  4F1I A;  3HU1 A;  1YLA A;  2XFT A;  3ILK A;  3HHY A;  1XC8 A;  1OQY A;  2D7H A;  2CV2 A;  1D0K A;  1QAM A;  2L4E A;  3LCV B;  5IZ7 D;  4JYA M;  2RGH A;  3Q8G A;  2JY5 A;  2O01 F;  4LF6 M;  1TH4 A;  3DA1 A;  3E21 A;  7CAT A;  3C58 A;  3WHL A;  3GPY A;  2V6Z M;  2QBY A;  1E32 A;  5KO3 A;  1NNU C;  1D0M A;  1FJG M;  4BB9 A;  2CFO A;  3U61 A;  4NRV A;  4G4Q A;  3M7G A;  4LCB A;  1OJL A;  4LF4 M;  1JB0 F;  2X8A A;  1HNW M;  3NBI A;  1HR0 M;  4KLN A;  2DAE A;  2XFS A;  1IN6 A;  4LFA M;  2A5Y B;  3WHK A;  3T1H M;  1C1K A;  1NY5 A;  4NSO B;  1D0L A;  2LVQ D;  2LBC A;  2OO9 A;  3FUX A;  3GRV A;  2O5R A;  3MJ5 A;  5C1B A;  2K0B X;  1TF0 B;  2JY7 A;  1G8P A;  2HAK A;  4FCT A;  4CGY B;  2KZU A;  3NBX X;  1XMQ M;  3HU2 A;  2C9C A;  2M5Z A;  1R4G A;  2D7G A;  3LQR A;  2XLJ A;  1PM5 A;  3FTF A;  3B7N A;  2F5Q A;  5H37 D;  3GLG B;  4DV0 M;  2UUA M;  1PJS A;  3OTO M;  3I4Y A;  4AW4 A;  1QUS A;  3AFH A;  5ITT A;  3SFZ A;  4MGI E;  1GL6 A;  1G41 A;  2GNO A;  4LJ9 A;  2XF3 A;  1GJT A;  3SAV A;  2CWB A;  1J7K A;  2BJV A;  4LFC M;  1GL7 A;  2FE8 A;  2EKK A;  5EXP A;  3FUV A;  2NQ8 C;  2XZF A;  1R2Y A;  2XGN A;  3PNY A;  1V34 A;  3VFD A;  1HNZ M;  1HT1 E;  1Z5A A;  2H5X A;  4GRI A;  3JR4 A;  3W67 A;  4LF7 M;  4NSR A;  3SAS A;  2RKO A;  1XXH E;  1DGH B;  3AV0 A;  2HKJ A;  4JI0 M;  1IFY A;  2LVO C;  3TWK A;  4JI5 M;  1V33 A;  5JI3 E;  1GLN A;  1WGN A;  4KOD A;  1EFU B;  4JN6 A;  1DO2 A;  4KHP M;  1MJG M;  1PGY A;  3GLG A;  5ITQ A;  4FCW A;  1VEG A;  1QDT A;  1N33 M;  4LJ6 A;  2DZL A;  2UXD M; 
#chains in the Genus database with same CATH homology
 2DI0 A;  1OAI A;  2DAK A;  3H4J A;  3K9O A;  2DAM A;  2JNH A;  3GLI E;  2EKF A;  2ZTD A;  1F4I A;  3FRH A;  2EJS A;  1XB2 B;  2DHY A;  1HQY E;  2JY8 A;  2R0I A;  2DAI A;  2WZJ A;  3IEC A;  1WGL A;  1JR3 E;  2QSF X;  2JZ1 A;  1WR1 B;  2BWB A;  2KNA A;  1OKS A;  1GO5 A;  3GLH E;  4R71 A;  2L4F A;  1Q02 A;  4WP2 A;  3FE3 A;  1HT2 E;  2BWE A;  1TTE A;  2L2D A;  2OOB A;  4F2L A;  2O25 A;  3GLF E;  4DBG B;  1DO0 A;  2LVA A;  4F1I A;  1YLA A;  1C7Y A;  1OQY A;  1VG5 A;  2JZ0 A;  1V92 A;  1VQ1 A;  3E46 A;  2L4E A;  2RRU A;  1T6O A;  3LCV B;  1VDL A;  2JY5 A;  3F92 A;  3E21 A;  3LCU A;  4G3O A;  2LTU A;  3MMP A;  1QZE A;  3B89 A;  1IXS A;  1WHC A;  1UFZ A;  2DZL A;  2LVP C;  1TR8 A;  1T43 A;  1CUK A;  3BBZ A;  2JY6 B;  2DAE A;  3IHP A;  1P3Q Q;  1G4A E;  2OOA A;  2CP8 A;  1G3I A;  2LVQ D;  2LBC A;  2MJ5 B;  2OO9 A;  1DV0 A;  1Y8G A;  2K0B X;  2JY7 A;  2HAK A;  2JP7 A;  1A5T A;  4HEO A;  1ZMW A;  2DAG A;  1R4G A;  4GEW A;  1MN3 A;  1VEJ A;  1NV9 A;  1ZV1 A;  2MRO B;  1SG9 A;  2MR9 A;  2G3Q A;  1KYI A;  1HJP A;  1G41 A;  1ZMV A;  2CWB A;  2DKL A;  2EKK A;  1VEK A;  1WJ7 A;  3T6P A;  5DFL A;  3GLG E;  1HT1 E;  2H5X A;  3FRI A;  4UN2 B;  2B3T A;  2LVN C;  1WIV A;  2ZTC A;  1XXH E;  4Q7J A;  1BVS A;  1IFY A;  1ZMU A;  2JUJ A;  2LVO C;  2QHO B;  1IM2 A;  3K9P A;  2MGW A;  2KNZ A;  1AIP C;  1E94 E;  1OTR A;  1WGN A;  2KHH A;  2KNV A;  1EFU B;  2K9D A;  1DO2 A;  1PGY A;  2DEN A;  2QNJ A;  5JI2 E;  1VEG A;  1NV8 A;  2HWJ A;  2DNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...