2KNVA

Nmr dimer structure of the uba domain of p62 (sqstm1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sequestosome-1
publication title Dimerisation of the UBA Domain of p62 Inhibits Ubiquitin Binding and Regulates NF-kappaB Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2knvA00
1NV9A 2DAMA 1AIPC 1T43A 2OOBA 2RRUA 2LTUA 2ZTCA 3LCVB 2BWEA 4G3OA 3IHPA 1G41A 3B89A 1KYIA 4WP2A 2MJ5B 1E94E 2QSFX 2EJSA 4DBGB 1DO2A 1A5TA 1G3IA 3FE3A 2QHOB 1WGNA 2MR9A 2R0IA 1DO0A 1VG5A 2LVAA 1Q02A 2LVNC 1T6OA 3FRIA 2CP8A 4R71A 2OO9A 1IM2A 1XB2B 4F2LA 3K9OA 2JY8A 2ZTDA 1Y8GA 4Q7JA 1WIVA 4UN2B 1ZMUA 3F92A 1ZV1A 2L2DA 2JNHA 1VEKA 3GLIE 2JY5A 2LBCA 1DV0A 2BWBA 1P3QQ 3GLGE 1TR8A 1HT1E 2EKFA 1JR3E 1TTEA 2KNVA 3GLFE 2DHYA 2HAKA 1NV8A 1IXSA 3E21A 1UFZA 2LVPC 2MGWA 2H5XA 1VQ1A 2WZJA 1VEJA 1EFUB 1VDLA 1G4AE 1WGLA 1CUKA 1GO5A 1QZEA 2DAEA 1ZMWA 1OKSA 2KNZA 3E46A 2JUJA 1WHCA 1R4GA 3LCUA 2DENA 2G3QA 4HEOA 2CWBA 2DNAA 1YLAA 1OQYA 1WJ7A 1HJPA 2KHHA 2QNJA 2JY6B 1V92A 1OAIA 2HWJA 3K9PA 3MMPA 3T6PA 2DKLA 5DFLA 4GEWA 2OOAA 3BBZA 2L4FA 2DAIA 1PGYA 2MROB 3FRHA 2K0BX 1HT2E 2JP7A 2JZ1A 2L4EA 1ZMVA 1F4IA 2KNAA 1IFYA 2K9DA 2B3TA 3IECA 1BVSA 1OTRA 2LVOC 1VEGA 3H4JA 1C7YA 1MN3A 2DAKA 2EKKA 2DI0A 2JZ0A 2LVQD 1WR1B 2DAGA 1HQYE 2O25A 1SG9A 4F1IA 5JI2E 3GLHE 2DZLA 1XXHE 2JY7A
chains in the Genus database with same CATH superfamily
4QNRA 3DFZA 5ITXE 2RKOA 1NV9A 2DAMA 3VKGA 3CTWB 4AI6A 3SAUA 1G59A 4S12A 1QVRA 1DGGA 2OQ4A 4GH9A 3LCVB 4B3TM 1SXJE 3AJIB 5IREB 2BWEA 1Q39A 3HZJA 1IN8A 3HJSA 4L16A 3U6MA 1G41A 3E4RA 3QYEA 4G4QA 1IY2A 2A5YB 4FCVA 1IBLM 5EXPA 5KPRA 3HX3A 3IG5A 3HHWA 2CHGA 2EJSA 2Y0TA 4DBGB 1DO2A 1R2YA 3L2AA 5FTKA 2QHOB 4MGIE 2MR9A 2R0IA 4NC6A 2Z8YM 3QYBA 3KS4A 3FRIA 4CISA 1GLNA 1T6OA 3V76A 3T1HM 3U6CA 2CHVA 3TL4X 1IM2A 1E9SA 1XB2B 4GMQA 3FUTA 5ITUA 1NSFA 3K9OA 2ZTDA 4G6ZA 2R4EA 4FWHA 1WIVA 1KSFX 3J27B 1ZMUA 4GITA 5EXTA 1ZV1A 2EUCA 3BOSA 3J2PB 1VEKA 1E9RA 2Z4RA 3FYCA 2BWBA 4JI8M 2HHHM 1P3QQ 1QZMA 1K82A 1NNUC 3GLGE 3FTEA 4II7A 4RF1A 1TGUA 4DV0M 4JI2M 1JR3E 1R7RA 3KOWE 3KP0E 4LCBA 3T38A 3GLFE 3TQSA 2DHYA 1PJIA 2HAKA 4X65M 2KEBA 2RGHA 3K1JA 3VLFB 2LVPC 2ZAOA 3U6OA 1SXJD 4IBKA 1NJGA 2CRUA 2HL7A 3FUWA 1Q3BA 4LRTA 2F5OA 1CUKA 1Q3CA 3SC3A 1GO5A 3A98B 1XXHA 2DAEA 4RF0A 2DWMA 4JI7M 1K3XA 4OU7A 4IBBA 3GQ4A 2CHQA 4B7HA 1SXJC 3LCUA 5ITTA 4BLCA 4LZJA 4LJ5A 1GL7A 3KS8A 4OW0A 4D80A 1L8QA 3T15A 2DNAA 1N36M 2I7NA 4BBAA 1QQWA 3SATA 4IBDA 3KSXA 3W0LB 2KHHA 3TPZA 1DGHA 2QNJA 4IIWA 3DZDA 2L7IA 3VK7A 1XMOM 1V92A 3TE6A 1OAIA 1H6UA 2QQ8A 5C1BA 4PDGA 3UMMA 2VF8A 3K9PA 3GPYA 1LV7A 1D0LA 2DKLA 2FS1A 2WSFF 5E6JA 2DZOB 5E26A 1V34A 3W0FA 3HJ8A 2F5SA 1UM8A 1R5LA 1AUAA 2C9OA 2G8LA 2R62A 4L15A 4CGYB 2OOAA 4WURA 1L2BA 2UXDM 2D7EA 2DAIA 2C9CA 2JP7A 2L4EA 3TWLA 4NXMM 3RE8A 3KOYE 1N34M 5EP1A 1F4IA 3MK6A 2K9DA 1QUSA 1N77A 4AZFA 4JYAM 4FCTA 2LVOC 4B08A 3H4JA 4P17A 4OVZB 1MN3A 4R3DA 2EKKA 2K6BA 3SMSA 2YNMD 4IBCA 4AW4A 1Z6TA 2VQFM 1HQYE 1SG9A 3LW5F 4P16A 5A2QS 4F1IA 2ZM6M 2O01F 3GLHE 5EP4A 5ITYA 2O25A 3BXWA 2JY7A 2XFTA 1N32M 2W82A 1LTMA 1V33A 3A46A 3OTOM 4I5SA 5F3WA 3FD9A 3I51A 1T43A 2OOBA 1GVNA 3HU1A 3W68A 3U6DA 3KVWA 2XF3A 2DXIA 3GP1A 3IHPA 2DWZB 3CGWA 3LVWA 4G4NA 2ERCA 2MJ5B 1E94E 4DR7M 2QSFX 3GLIA 2KA6B 1XMQM 4QOZC 4PCZA 2JA2A 1A5TA 3ZQJA 2YQZA 4DV3M 4Z8XA 5L8RF 1HNXM 3JAMS 2N35A 3FTFA 3SAWA 2KDLA 3C58A 4TUWA 1I94M 5LMUM 2D7GA 2XSZD 2X49A 3ILKA 3GLFB 4L78A 4PD2A 2JWSA 3GRVA 1N33M 3SFZA 4PDIA 3SMPA 3UJNA 2V1CA 1IN7A 3U60B 4Q7JA 5FTNA 3U5ZB 1IN5A 3KDSE 3F92A 1TH2A 1NJFA 2JNHA 4IBGA 2XZFA 1W5TA 3K2LA 2JY5A 2VIIA 3RGPA 4A3VB 1WXQA 4FCWA 2BNKA 2KNVA 2GNOA 2QENA 3CF6E 4GHAA 3R8FA 1L1ZA 4G4RA 3HWSA 2I7PA 3PNVA 5DYGA 1KFVA 1ZAEA 3HY5A 1QDTA 3FYDA 4GRIA 4NRWA 1YSYA 5FTJA 1VQ1A 3K8ZA 1J5EM 4DR6M 1VEJA 2BJVA 5EJCA 1EFUB 4LF9M 4LFCM 2C96A 3W67A 1WGLA 4IBFA 1IN4A 4FD2A 5IWAM 1QZEA 3EIEA 4LY6A 3R9XB 4KO8A 4XGIA 5EXSA 2DVWB 2JUJA 1WHCA 3D8BA 3SYKA 4DV1M 2ZAMA 4DR3M 4LJAA 1TH4A 2OPFA 1L2DA 3C9PA 4K0KM 2G3QA 4OVZA 4LF5M 2KRUA 3LQQA 4DV2M 1TF0B 4IBJA 1OQYA 3J7AS 2YR0A 4GKJM 1MX0A 3SHGB 4L6V6 3PXGA 4D81A 2UUAM 4LF7M 4LG2A 2LXEA 4NXNM 2CFOA 2X8AA 3M6AA 4AQYM 2JXNA 3J80S 2F5NA 3HHZA 5IZ7D 4LF6M 4GC9A 3JR5A 3GRRA 1EE8A 1N78A 3UK6A 3GPUA 4GC5A 1E32A 1PJJA 3SBJA 4CHTB 2QPAA 2L4FA 4I81A 1Z5AA 3FRHA 5LMNM 2K0BX 3KXEC 1HT2E 1MU5A 2FE8A 4FW9A 3JR4A 1TDZA 1QUTA 4MB7A 5EP3A 1IFYA 4CIZA 1R2ZA 3IECA 2FFJA 5EP2A 2CE7A 3L26A 5BR8M 2UU9M 4AKHA 2JZ0A 3IG8A 2KZUA 3GLFA 2DAGA 3GQ5A 4LJ9A 2QCUA 1ORYB 2LHGA 1QAQA 4DR5M 3PFIA 1NHGC 4QNMA 3RGSA 3H4MA 1OFIA 3U61B 4Z6YA 3FUUA 4I4LA 3U60A 2V6ZM 3U5ZA 4JXJA 1AIPC 2LHCA 2RRUA 2LTUA 2ZTCA 4KLNA 3KFUG 4EIWA 4B7GA 2ZBKB 3E9SA 2O5RA 4IJEA 1IXZA 5EXXA 2LWXA 3SYLA 3B89A 4LF8M 1KYIA 5DYIA 1IN6A 2LNHC 2UUBM 3K92A 3VDPA 3TWKA 1G8PA 5FTLA 1PJTA 4KHPM 1SXJB 1IY0A 4DV4M 3AFHA 1G3IA 3FE3A 2DWLA 2AHMA 3SARA 1QDRA 3SASA 1IY1A 1WGNA 1Z5CA 3AV0A 1IBKM 3MJ5A 1DO0A 1VG5A 2LVAA 1HNZM 4X64M 3TWMA 3I04M 4R71A 4NL4H 3B7NA 5KPTA 1QYRA 2J5YA 3ZH9B 1NNJA 4F2LA 2WSCF 2VQEM 4DV7M 1K3WA 1T3TA 3CF0A 2J7NA 2Y0QA 4B3RM 1Y8GA 3C3DA 4UN2B 2HKJA 3I4YA 1J7KA 3C3EA 5DNYA 3GLIE 1DV0A 2HCBA 3MHVC 3Q8GA 4JN6A 4CJ6A 3B9PA 1TR8A 1HT1E 4MGYE 3L25A 1R6BX 3GRUA 3L28A 5FSWA 4B3MM 1J09A 2XLJA 1UFZA 1JQJC 4W5WA 1D0KA 2MGWA 2H5XA 2WZJA 1X37A 4FWGA 3GLGB 4B7FA 4Y28F 4BB9A 2G5GX 2DWNA 4X66M 3NWLA 4M0DA 2C98A 3B7QA 1YE9A 2KNZA 3VDUA 1JB0F 4JI3M 1I4WA 3HJQA 2LH0A 4DUZM 4JI4M 4DR4M 8CATA 1D2NA 5JI3E 3QWLA 3HU3A 2XZUA 4FWDA 2QBYB 3J81S 2BJWA 3ZCBB 3DOAA 4MH0E 4YY3M 4IBEA 1YLAA 1NHWC 4B3SM 3KOZE 3UGJA 2KRKA 4M9SA 1FJGM 2UXCM 4L4UA 1GKIA 4HL4A 4R7GA 3GO8A 3U61A 3FTDA 2VDBB 2HWJA 4LJ7A 3MMPA 4QHSA 4ITQA 1IXSB 2FH0A 3GPPA 3B74A 3KP1E 3ZC7B 4ZPXA 5DFLA 4LF4M 7CATA 1G71A 2F4VM 3BBZA 2WSEF 3FTCA 5ITXA 4DV6M 3AOEA 4LFAM 2MROB 3HGIA 3LQRA 4NSRA 2XH9A 4OX9M 1MJGM 1SXJA 2YFQA 3GQ3A 4LJ4A 2J7OA 1BVSA 1OTRA 4DR2M 1OAOC 1VEGA 3GRYA 1QANA 2R46A 4MGHA 3HKPA 3U6EA 2DZNB 5IT9S 4JI0M 2DI0A 2CV2A 2LVQD 5H37D 1WR1B 4XBOA 2Z3XA 5FTMA 4LRSA 2MH8A 4NSOB 4D82A 1S3SA 3RFWA 4LGMA 1IXRC 1OFHA 4IBIA 1PJQA 2R44A 1C1KA 1HQCA 1TDHA 5KPZA 1XXHE 3HHYA 3VK8A 4WW0A 1XWIA 3SHFA 4L8RC 1IBMM 2DHRA 3AL0C 3SAVA 4QHTA 1NVMA 4REZA 4FVMA 2UUCM 4KODA 3U6QA 2GQFA 5KO3A 2CV1A 2XGNA 3GLHB 1GABA 2XEPA 4AKIA 4G3OA 5ITRA 3GPXA 3WHKA 1W5SA 4WP2A 2D7HA 2QP9X 4MGZE 1XNRM 3KW6A 4RKUF 1QAMA 3GLGA 3GLIB 2X4AA 1JR3A 4M9XA 3LVVA 4XK8F 1PM5A 2K47A 3VKHA 1Q02A 2FOIC 2LVNC 3EIHA 1L2CA 2CP8A 3I4VA 1OIZA 4RNAA 5BPVA 3AKZA 4JI1M 3AOEC 2KXEA 2OO9A 4M9ZA 2UXBM 2V1UA 1TH3A 2JY8A 3B7ZA 4DV5M 2Z7JA 1HNWM 3DA1A 4AKGA 3U6SA 1RU3A 2QBYA 2Y21A 3I01M 1DGBA 2L2DA 3QAUA 3LMMA 2LBCA 2KW0A 2XFSA 4DUYM 2Y20A 5ITQA 2EKFA 1GL6A 1TTEA 1XHBA 2VF7A 1L1TA 1EIJA 1NV8A 1IXSA 3E21A 5C18A 4AG5A 4LFBM 2FNAA 3Q8XA 4M0WA 2L09A 4KT0F 3U6LA 1VDDA 1IQPA 2Z4SA 1PRBA 2M5ZA 1G4AE 1VDLA 3VFDA 2KZSA 3L27A 4LGYA 3U6PA 1JR3D 4YHHM 1ZMWA 1OKSA 3E46A 1Z59A 4X62M 1YUBA 2R18A 4G4OA 3M0EA 1GJSA 1R4GA 1DGFA 3WHLA 2RGOA 4LJ6A 2DENA 2R4JA 3M7GA 4GIPA 4MM3B 2NQ8C 3A42A 4I8OA 3AOGA 4HEOA 5FLXS 2CWBA 2CEAA 2EO2A 2XSZA 3CF2A 2R6FA 3PVSA 1WJ7A 1HJPA 2R45A 3D8LA 2F5QA 2C99A 1NO1A 4GHLA 4LZZA 2JY6B 3UZUA 5KQ8A 3L29A 4NOOB 1XNQM 3KOXE 3A45A 2EA0A 1FNNA 4JI6M 4PT5A 3T6PA 2CUZA 2ZANA 1PJSA 4AG6A 5GKNA 4DR1M 4JV5M 1XC8A 2F5PA 3GLHA 1N75A 4GEWA 4JI5M 2CV0A 1QAOA 4LJ8A 3PNYA 1XXHB 2P5TA 1HR0M 5KQDA 1PGYA 2C5RA 2Q2EB 2JZ1A 3HHXA 3FKEA 2L7HA 1ZMVA 2KNAA 2B3TA 3T1YM 1D0MA 2H1RA 3NBXX 2M60A 1GJTA 2QZ4A 3J7BA 1C7YA 1ZQ9A 1NY6A 2DAKA 4IJFA 1Z5BA 3FUVA 4GKKM 3HU2A 2R65A 1NY5A 4QOSA 5EQTA 3THGA 1OJLA 1OIPA 4HLQA 3FUXA 4NRVA 4ANRA 5JI2E 2L6OA 4MGKE 3NBIA 1DGHB 2DZLA 3KSJA 2E5LM 2APLA
chains in the Genus database with same CATH topology
1NV9A 2DAMA 1AIPC 1T43A 2OOBA 2RRUA 2LTUA 2ZTCA 3LCVB 2BWEA 4G3OA 3IHPA 1G41A 3B89A 1KYIA 4WP2A 2MJ5B 1E94E 2QSFX 2EJSA 4DBGB 1DO2A 1A5TA 1G3IA 3FE3A 2QHOB 1WGNA 2MR9A 2R0IA 1DO0A 1VG5A 2LVAA 1Q02A 2LVNC 1T6OA 3FRIA 2CP8A 4R71A 2OO9A 1IM2A 1XB2B 4F2LA 3K9OA 2JY8A 2ZTDA 1Y8GA 4Q7JA 1WIVA 4UN2B 1ZMUA 3F92A 1ZV1A 2L2DA 2JNHA 1VEKA 3GLIE 2JY5A 2LBCA 1DV0A 2BWBA 1P3QQ 3GLGE 1TR8A 1HT1E 2EKFA 1JR3E 1TTEA 2KNVA 3GLFE 2DHYA 2HAKA 1NV8A 1IXSA 3E21A 1UFZA 2LVPC 2MGWA 2H5XA 1VQ1A 2WZJA 1VEJA 1EFUB 1VDLA 1G4AE 1WGLA 1CUKA 1GO5A 1QZEA 2DAEA 1ZMWA 1OKSA 2KNZA 3E46A 2JUJA 1WHCA 1R4GA 3LCUA 2DENA 2G3QA 4HEOA 2CWBA 2DNAA 1YLAA 1OQYA 1WJ7A 1HJPA 2KHHA 2QNJA 2JY6B 1V92A 1OAIA 2HWJA 3K9PA 3MMPA 3T6PA 2DKLA 5DFLA 4GEWA 2OOAA 3BBZA 2L4FA 2DAIA 1PGYA 2MROB 3FRHA 2K0BX 1HT2E 2JP7A 2JZ1A 2L4EA 1ZMVA 1F4IA 2KNAA 1IFYA 2K9DA 2B3TA 3IECA 1BVSA 1OTRA 2LVOC 1VEGA 3H4JA 1C7YA 1MN3A 2DAKA 2EKKA 2DI0A 2JZ0A 2LVQD 1WR1B 2DAGA 1HQYE 2O25A 1SG9A 4F1IA 5JI2E 3GLHE 2DZLA 1XXHE 2JY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV9 A;  2DAM A;  1AIP C;  1T43 A;  2OOB A;  2RRU A;  2LTU A;  2ZTC A;  3LCV B;  2BWE A;  4G3O A;  3IHP A;  1G41 A;  3B89 A;  1KYI A;  4WP2 A;  2MJ5 B;  1E94 E;  2QSF X;  2EJS A;  4DBG B;  1DO2 A;  1A5T A;  1G3I A;  3FE3 A;  2QHO B;  1WGN A;  2MR9 A;  2R0I A;  1DO0 A;  1VG5 A;  2LVA A;  1Q02 A;  2LVN C;  1T6O A;  3FRI A;  2CP8 A;  4R71 A;  2OO9 A;  1IM2 A;  1XB2 B;  4F2L A;  3K9O A;  2JY8 A;  2ZTD A;  1Y8G A;  4Q7J A;  1WIV A;  4UN2 B;  1ZMU A;  3F92 A;  1ZV1 A;  2L2D A;  2JNH A;  1VEK A;  3GLI E;  2JY5 A;  2LBC A;  1DV0 A;  2BWB A;  1P3Q Q;  3GLG E;  1TR8 A;  1HT1 E;  2EKF A;  1JR3 E;  1TTE A;  2KNV A;  3GLF E;  2DHY A;  2HAK A;  1NV8 A;  1IXS A;  3E21 A;  1UFZ A;  2LVP C;  2MGW A;  2H5X A;  1VQ1 A;  2WZJ A;  1VEJ A;  1EFU B;  1VDL A;  1G4A E;  1WGL A;  1CUK A;  1GO5 A;  1QZE A;  2DAE A;  1ZMW A;  1OKS A;  2KNZ A;  3E46 A;  2JUJ A;  1WHC A;  1R4G A;  3LCU A;  2DEN A;  2G3Q A;  4HEO A;  2CWB A;  2DNA A;  1YLA A;  1OQY A;  1WJ7 A;  1HJP A;  2KHH A;  2QNJ A;  2JY6 B;  1V92 A;  1OAI A;  2HWJ A;  3K9P A;  3MMP A;  3T6P A;  2DKL A;  5DFL A;  4GEW A;  2OOA A;  3BBZ A;  2L4F A;  2DAI A;  1PGY A;  2MRO B;  3FRH A;  2K0B X;  1HT2 E;  2JP7 A;  2JZ1 A;  2L4E A;  1ZMV A;  1F4I A;  2KNA A;  1IFY A;  2K9D A;  2B3T A;  3IEC A;  1BVS A;  1OTR A;  2LVO C;  1VEG A;  3H4J A;  1C7Y A;  1MN3 A;  2DAK A;  2EKK A;  2DI0 A;  2JZ0 A;  2LVQ D;  1WR1 B;  2DAG A;  1HQY E;  2O25 A;  1SG9 A;  4F1I A;  5JI2 E;  3GLH E;  2DZL A;  1XXH E;  2JY7 A; 
#chains in the Genus database with same CATH topology
 4QNR A;  3DFZ A;  5ITX E;  2RKO A;  1NV9 A;  2DAM A;  3VKG A;  3CTW B;  4AI6 A;  3SAU A;  1G59 A;  4S12 A;  1QVR A;  1DGG A;  2OQ4 A;  4GH9 A;  3LCV B;  4B3T M;  1SXJ E;  3AJI B;  5IRE B;  2BWE A;  1Q39 A;  3HZJ A;  1IN8 A;  3HJS A;  4L16 A;  3U6M A;  1G41 A;  3E4R A;  3QYE A;  4G4Q A;  1IY2 A;  2A5Y B;  4FCV A;  1IBL M;  5EXP A;  5KPR A;  3HX3 A;  3IG5 A;  3HHW A;  2CHG A;  2EJS A;  2Y0T A;  4DBG B;  1DO2 A;  1R2Y A;  3L2A A;  5FTK A;  2QHO B;  4MGI E;  2MR9 A;  2R0I A;  4NC6 A;  2Z8Y M;  3QYB A;  3KS4 A;  3FRI A;  4CIS A;  1GLN A;  1T6O A;  3V76 A;  3T1H M;  3U6C A;  2CHV A;  3TL4 X;  1IM2 A;  1E9S A;  1XB2 B;  4GMQ A;  3FUT A;  5ITU A;  1NSF A;  3K9O A;  2ZTD A;  4G6Z A;  2R4E A;  4FWH A;  1WIV A;  1KSF X;  3J27 B;  1ZMU A;  4GIT A;  5EXT A;  1ZV1 A;  2EUC A;  3BOS A;  3J2P B;  1VEK A;  1E9R A;  2Z4R A;  3FYC A;  2BWB A;  4JI8 M;  2HHH M;  1P3Q Q;  1QZM A;  1K82 A;  1NNU C;  3GLG E;  3FTE A;  4II7 A;  4RF1 A;  1TGU A;  4DV0 M;  4JI2 M;  1JR3 E;  1R7R A;  3KOW E;  3KP0 E;  4LCB A;  3T38 A;  3GLF E;  3TQS A;  2DHY A;  1PJI A;  2HAK A;  4X65 M;  2KEB A;  2RGH A;  3K1J A;  3VLF B;  2LVP C;  2ZAO A;  3U6O A;  1SXJ D;  4IBK A;  1NJG A;  2CRU A;  2HL7 A;  3FUW A;  1Q3B A;  4LRT A;  2F5O A;  1CUK A;  1Q3C A;  3SC3 A;  1GO5 A;  3A98 B;  1XXH A;  2DAE A;  4RF0 A;  2DWM A;  4JI7 M;  1K3X A;  4OU7 A;  4IBB A;  3GQ4 A;  2CHQ A;  4B7H A;  1SXJ C;  3LCU A;  5ITT A;  4BLC A;  4LZJ A;  4LJ5 A;  1GL7 A;  3KS8 A;  4OW0 A;  4D80 A;  1L8Q A;  3T15 A;  2DNA A;  1N36 M;  2I7N A;  4BBA A;  1QQW A;  3SAT A;  4IBD A;  3KSX A;  3W0L B;  2KHH A;  3TPZ A;  1DGH A;  2QNJ A;  4IIW A;  3DZD A;  2L7I A;  3VK7 A;  1XMO M;  1V92 A;  3TE6 A;  1OAI A;  1H6U A;  2QQ8 A;  5C1B A;  4PDG A;  3UMM A;  2VF8 A;  3K9P A;  3GPY A;  1LV7 A;  1D0L A;  2DKL A;  2FS1 A;  2WSF F;  5E6J A;  2DZO B;  5E26 A;  1V34 A;  3W0F A;  3HJ8 A;  2F5S A;  1UM8 A;  1R5L A;  1AUA A;  2C9O A;  2G8L A;  2R62 A;  4L15 A;  4CGY B;  2OOA A;  4WUR A;  1L2B A;  2UXD M;  2D7E A;  2DAI A;  2C9C A;  2JP7 A;  2L4E A;  3TWL A;  4NXM M;  3RE8 A;  3KOY E;  1N34 M;  5EP1 A;  1F4I A;  3MK6 A;  2K9D A;  1QUS A;  1N77 A;  4AZF A;  4JYA M;  4FCT A;  2LVO C;  4B08 A;  3H4J A;  4P17 A;  4OVZ B;  1MN3 A;  4R3D A;  2EKK A;  2K6B A;  3SMS A;  2YNM D;  4IBC A;  4AW4 A;  1Z6T A;  2VQF M;  1HQY E;  1SG9 A;  3LW5 F;  4P16 A;  5A2Q S;  4F1I A;  2ZM6 M;  2O01 F;  3GLH E;  5EP4 A;  5ITY A;  2O25 A;  3BXW A;  2JY7 A;  2XFT A;  1N32 M;  2W82 A;  1LTM A;  1V33 A;  3A46 A;  3OTO M;  4I5S A;  5F3W A;  3FD9 A;  3I51 A;  1T43 A;  2OOB A;  1GVN A;  3HU1 A;  3W68 A;  3U6D A;  3KVW A;  2XF3 A;  2DXI A;  3GP1 A;  3IHP A;  2DWZ B;  3CGW A;  3LVW A;  4G4N A;  2ERC A;  2MJ5 B;  1E94 E;  4DR7 M;  2QSF X;  3GLI A;  2KA6 B;  1XMQ M;  4QOZ C;  4PCZ A;  2JA2 A;  1A5T A;  3ZQJ A;  2YQZ A;  4DV3 M;  4Z8X A;  5L8R F;  1HNX M;  3JAM S;  2N35 A;  3FTF A;  3SAW A;  2KDL A;  3C58 A;  4TUW A;  1I94 M;  5LMU M;  2D7G A;  2XSZ D;  2X49 A;  3ILK A;  3GLF B;  4L78 A;  4PD2 A;  2JWS A;  3GRV A;  1N33 M;  3SFZ A;  4PDI A;  3SMP A;  3UJN A;  2V1C A;  1IN7 A;  3U60 B;  4Q7J A;  5FTN A;  3U5Z B;  1IN5 A;  3KDS E;  3F92 A;  1TH2 A;  1NJF A;  2JNH A;  4IBG A;  2XZF A;  1W5T A;  3K2L A;  2JY5 A;  2VII A;  3RGP A;  4A3V B;  1WXQ A;  4FCW A;  2BNK A;  2KNV A;  2GNO A;  2QEN A;  3CF6 E;  4GHA A;  3R8F A;  1L1Z A;  4G4R A;  3HWS A;  2I7P A;  3PNV A;  5DYG A;  1KFV A;  1ZAE A;  3HY5 A;  1QDT A;  3FYD A;  4GRI A;  4NRW A;  1YSY A;  5FTJ A;  1VQ1 A;  3K8Z A;  1J5E M;  4DR6 M;  1VEJ A;  2BJV A;  5EJC A;  1EFU B;  4LF9 M;  4LFC M;  2C96 A;  3W67 A;  1WGL A;  4IBF A;  1IN4 A;  4FD2 A;  5IWA M;  1QZE A;  3EIE A;  4LY6 A;  3R9X B;  4KO8 A;  4XGI A;  5EXS A;  2DVW B;  2JUJ A;  1WHC A;  3D8B A;  3SYK A;  4DV1 M;  2ZAM A;  4DR3 M;  4LJA A;  1TH4 A;  2OPF A;  1L2D A;  3C9P A;  4K0K M;  2G3Q A;  4OVZ A;  4LF5 M;  2KRU A;  3LQQ A;  4DV2 M;  1TF0 B;  4IBJ A;  1OQY A;  3J7A S;  2YR0 A;  4GKJ M;  1MX0 A;  3SHG B;  4L6V 6;  3PXG A;  4D81 A;  2UUA M;  4LF7 M;  4LG2 A;  2LXE A;  4NXN M;  2CFO A;  2X8A A;  3M6A A;  4AQY M;  2JXN A;  3J80 S;  2F5N A;  3HHZ A;  5IZ7 D;  4LF6 M;  4GC9 A;  3JR5 A;  3GRR A;  1EE8 A;  1N78 A;  3UK6 A;  3GPU A;  4GC5 A;  1E32 A;  1PJJ A;  3SBJ A;  4CHT B;  2QPA A;  2L4F A;  4I81 A;  1Z5A A;  3FRH A;  5LMN M;  2K0B X;  3KXE C;  1HT2 E;  1MU5 A;  2FE8 A;  4FW9 A;  3JR4 A;  1TDZ A;  1QUT A;  4MB7 A;  5EP3 A;  1IFY A;  4CIZ A;  1R2Z A;  3IEC A;  2FFJ A;  5EP2 A;  2CE7 A;  3L26 A;  5BR8 M;  2UU9 M;  4AKH A;  2JZ0 A;  3IG8 A;  2KZU A;  3GLF A;  2DAG A;  3GQ5 A;  4LJ9 A;  2QCU A;  1ORY B;  2LHG A;  1QAQ A;  4DR5 M;  3PFI A;  1NHG C;  4QNM A;  3RGS A;  3H4M A;  1OFI A;  3U61 B;  4Z6Y A;  3FUU A;  4I4L A;  3U60 A;  2V6Z M;  3U5Z A;  4JXJ A;  1AIP C;  2LHC A;  2RRU A;  2LTU A;  2ZTC A;  4KLN A;  3KFU G;  4EIW A;  4B7G A;  2ZBK B;  3E9S A;  2O5R A;  4IJE A;  1IXZ A;  5EXX A;  2LWX A;  3SYL A;  3B89 A;  4LF8 M;  1KYI A;  5DYI A;  1IN6 A;  2LNH C;  2UUB M;  3K92 A;  3VDP A;  3TWK A;  1G8P A;  5FTL A;  1PJT A;  4KHP M;  1SXJ B;  1IY0 A;  4DV4 M;  3AFH A;  1G3I A;  3FE3 A;  2DWL A;  2AHM A;  3SAR A;  1QDR A;  3SAS A;  1IY1 A;  1WGN A;  1Z5C A;  3AV0 A;  1IBK M;  3MJ5 A;  1DO0 A;  1VG5 A;  2LVA A;  1HNZ M;  4X64 M;  3TWM A;  3I04 M;  4R71 A;  4NL4 H;  3B7N A;  5KPT A;  1QYR A;  2J5Y A;  3ZH9 B;  1NNJ A;  4F2L A;  2WSC F;  2VQE M;  4DV7 M;  1K3W A;  1T3T A;  3CF0 A;  2J7N A;  2Y0Q A;  4B3R M;  1Y8G A;  3C3D A;  4UN2 B;  2HKJ A;  3I4Y A;  1J7K A;  3C3E A;  5DNY A;  3GLI E;  1DV0 A;  2HCB A;  3MHV C;  3Q8G A;  4JN6 A;  4CJ6 A;  3B9P A;  1TR8 A;  1HT1 E;  4MGY E;  3L25 A;  1R6B X;  3GRU A;  3L28 A;  5FSW A;  4B3M M;  1J09 A;  2XLJ A;  1UFZ A;  1JQJ C;  4W5W A;  1D0K A;  2MGW A;  2H5X A;  2WZJ A;  1X37 A;  4FWG A;  3GLG B;  4B7F A;  4Y28 F;  4BB9 A;  2G5G X;  2DWN A;  4X66 M;  3NWL A;  4M0D A;  2C98 A;  3B7Q A;  1YE9 A;  2KNZ A;  3VDU A;  1JB0 F;  4JI3 M;  1I4W A;  3HJQ A;  2LH0 A;  4DUZ M;  4JI4 M;  4DR4 M;  8CAT A;  1D2N A;  5JI3 E;  3QWL A;  3HU3 A;  2XZU A;  4FWD A;  2QBY B;  3J81 S;  2BJW A;  3ZCB B;  3DOA A;  4MH0 E;  4YY3 M;  4IBE A;  1YLA A;  1NHW C;  4B3S M;  3KOZ E;  3UGJ A;  2KRK A;  4M9S A;  1FJG M;  2UXC M;  4L4U A;  1GKI A;  4HL4 A;  4R7G A;  3GO8 A;  3U61 A;  3FTD A;  2VDB B;  2HWJ A;  4LJ7 A;  3MMP A;  4QHS A;  4ITQ A;  1IXS B;  2FH0 A;  3GPP A;  3B74 A;  3KP1 E;  3ZC7 B;  4ZPX A;  5DFL A;  4LF4 M;  7CAT A;  1G71 A;  2F4V M;  3BBZ A;  2WSE F;  3FTC A;  5ITX A;  4DV6 M;  3AOE A;  4LFA M;  2MRO B;  3HGI A;  3LQR A;  4NSR A;  2XH9 A;  4OX9 M;  1MJG M;  1SXJ A;  2YFQ A;  3GQ3 A;  4LJ4 A;  2J7O A;  1BVS A;  1OTR A;  4DR2 M;  1OAO C;  1VEG A;  3GRY A;  1QAN A;  2R46 A;  4MGH A;  3HKP A;  3U6E A;  2DZN B;  5IT9 S;  4JI0 M;  2DI0 A;  2CV2 A;  2LVQ D;  5H37 D;  1WR1 B;  4XBO A;  2Z3X A;  5FTM A;  4LRS A;  2MH8 A;  4NSO B;  4D82 A;  1S3S A;  3RFW A;  4LGM A;  1IXR C;  1OFH A;  4IBI A;  1PJQ A;  2R44 A;  1C1K A;  1HQC A;  1TDH A;  5KPZ A;  1XXH E;  3HHY A;  3VK8 A;  4WW0 A;  1XWI A;  3SHF A;  4L8R C;  1IBM M;  2DHR A;  3AL0 C;  3SAV A;  4QHT A;  1NVM A;  4REZ A;  4FVM A;  2UUC M;  4KOD A;  3U6Q A;  2GQF A;  5KO3 A;  2CV1 A;  2XGN A;  3GLH B;  1GAB A;  2XEP A;  4AKI A;  4G3O A;  5ITR A;  3GPX A;  3WHK A;  1W5S A;  4WP2 A;  2D7H A;  2QP9 X;  4MGZ E;  1XNR M;  3KW6 A;  4RKU F;  1QAM A;  3GLG A;  3GLI B;  2X4A A;  1JR3 A;  4M9X A;  3LVV A;  4XK8 F;  1PM5 A;  2K47 A;  3VKH A;  1Q02 A;  2FOI C;  2LVN C;  3EIH A;  1L2C A;  2CP8 A;  3I4V A;  1OIZ A;  4RNA A;  5BPV A;  3AKZ A;  4JI1 M;  3AOE C;  2KXE A;  2OO9 A;  4M9Z A;  2UXB M;  2V1U A;  1TH3 A;  2JY8 A;  3B7Z A;  4DV5 M;  2Z7J A;  1HNW M;  3DA1 A;  4AKG A;  3U6S A;  1RU3 A;  2QBY A;  2Y21 A;  3I01 M;  1DGB A;  2L2D A;  3QAU A;  3LMM A;  2LBC A;  2KW0 A;  2XFS A;  4DUY M;  2Y20 A;  5ITQ A;  2EKF A;  1GL6 A;  1TTE A;  1XHB A;  2VF7 A;  1L1T A;  1EIJ A;  1NV8 A;  1IXS A;  3E21 A;  5C18 A;  4AG5 A;  4LFB M;  2FNA A;  3Q8X A;  4M0W A;  2L09 A;  4KT0 F;  3U6L A;  1VDD A;  1IQP A;  2Z4S A;  1PRB A;  2M5Z A;  1G4A E;  1VDL A;  3VFD A;  2KZS A;  3L27 A;  4LGY A;  3U6P A;  1JR3 D;  4YHH M;  1ZMW A;  1OKS A;  3E46 A;  1Z59 A;  4X62 M;  1YUB A;  2R18 A;  4G4O A;  3M0E A;  1GJS A;  1R4G A;  1DGF A;  3WHL A;  2RGO A;  4LJ6 A;  2DEN A;  2R4J A;  3M7G A;  4GIP A;  4MM3 B;  2NQ8 C;  3A42 A;  4I8O A;  3AOG A;  4HEO A;  5FLX S;  2CWB A;  2CEA A;  2EO2 A;  2XSZ A;  3CF2 A;  2R6F A;  3PVS A;  1WJ7 A;  1HJP A;  2R45 A;  3D8L A;  2F5Q A;  2C99 A;  1NO1 A;  4GHL A;  4LZZ A;  2JY6 B;  3UZU A;  5KQ8 A;  3L29 A;  4NOO B;  1XNQ M;  3KOX E;  3A45 A;  2EA0 A;  1FNN A;  4JI6 M;  4PT5 A;  3T6P A;  2CUZ A;  2ZAN A;  1PJS A;  4AG6 A;  5GKN A;  4DR1 M;  4JV5 M;  1XC8 A;  2F5P A;  3GLH A;  1N75 A;  4GEW A;  4JI5 M;  2CV0 A;  1QAO A;  4LJ8 A;  3PNY A;  1XXH B;  2P5T A;  1HR0 M;  5KQD A;  1PGY A;  2C5R A;  2Q2E B;  2JZ1 A;  3HHX A;  3FKE A;  2L7H A;  1ZMV A;  2KNA A;  2B3T A;  3T1Y M;  1D0M A;  2H1R A;  3NBX X;  2M60 A;  1GJT A;  2QZ4 A;  3J7B A;  1C7Y A;  1ZQ9 A;  1NY6 A;  2DAK A;  4IJF A;  1Z5B A;  3FUV A;  4GKK M;  3HU2 A;  2R65 A;  1NY5 A;  4QOS A;  5EQT A;  3THG A;  1OJL A;  1OIP A;  4HLQ A;  3FUX A;  4NRV A;  4ANR A;  5JI2 E;  2L6O A;  4MGK E;  3NBI A;  1DGH B;  2DZL A;  3KSJ A;  2E5L M;  2APL A; 
#chains in the Genus database with same CATH homology
 1NV9 A;  2DAM A;  1AIP C;  1T43 A;  2OOB A;  2RRU A;  2LTU A;  2ZTC A;  3LCV B;  2BWE A;  4G3O A;  3IHP A;  1G41 A;  3B89 A;  1KYI A;  4WP2 A;  2MJ5 B;  1E94 E;  2QSF X;  2EJS A;  4DBG B;  1DO2 A;  1A5T A;  1G3I A;  3FE3 A;  2QHO B;  1WGN A;  2MR9 A;  2R0I A;  1DO0 A;  1VG5 A;  2LVA A;  1Q02 A;  2LVN C;  1T6O A;  3FRI A;  2CP8 A;  4R71 A;  2OO9 A;  1IM2 A;  1XB2 B;  4F2L A;  3K9O A;  2JY8 A;  2ZTD A;  1Y8G A;  4Q7J A;  1WIV A;  4UN2 B;  1ZMU A;  3F92 A;  1ZV1 A;  2L2D A;  2JNH A;  1VEK A;  3GLI E;  2JY5 A;  2LBC A;  1DV0 A;  2BWB A;  1P3Q Q;  3GLG E;  1TR8 A;  1HT1 E;  2EKF A;  1JR3 E;  1TTE A;  2KNV A;  3GLF E;  2DHY A;  2HAK A;  1NV8 A;  1IXS A;  3E21 A;  1UFZ A;  2LVP C;  2MGW A;  2H5X A;  1VQ1 A;  2WZJ A;  1VEJ A;  1EFU B;  1VDL A;  1G4A E;  1WGL A;  1CUK A;  1GO5 A;  1QZE A;  2DAE A;  1ZMW A;  1OKS A;  2KNZ A;  3E46 A;  2JUJ A;  1WHC A;  1R4G A;  3LCU A;  2DEN A;  2G3Q A;  4HEO A;  2CWB A;  2DNA A;  1YLA A;  1OQY A;  1WJ7 A;  1HJP A;  2KHH A;  2QNJ A;  2JY6 B;  1V92 A;  1OAI A;  2HWJ A;  3K9P A;  3MMP A;  3T6P A;  2DKL A;  5DFL A;  4GEW A;  2OOA A;  3BBZ A;  2L4F A;  2DAI A;  1PGY A;  2MRO B;  3FRH A;  2K0B X;  1HT2 E;  2JP7 A;  2JZ1 A;  2L4E A;  1ZMV A;  1F4I A;  2KNA A;  1IFY A;  2K9D A;  2B3T A;  3IEC A;  1BVS A;  1OTR A;  2LVO C;  1VEG A;  3H4J A;  1C7Y A;  1MN3 A;  2DAK A;  2EKK A;  2DI0 A;  2JZ0 A;  2LVQ D;  1WR1 B;  2DAG A;  1HQY E;  2O25 A;  1SG9 A;  4F1I A;  5JI2 E;  3GLH E;  2DZL A;  1XXH E;  2JY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...