2KNVA

Nmr dimer structure of the uba domain of p62 (sqstm1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Sequestosome-1
publication title Dimerisation of the UBA Domain of p62 Inhibits Ubiquitin Binding and Regulates NF-kappaB Signalling
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2knvA00
3FE3A 2OOBA 1R4GA 2DNAA 1OKSA 2QHOB 2LVPC 2RRUA 2H5XA 4F1IA 2MJ5B 2QNJA 1Q02A 3H4JA 2ZTDA 5JI2E 2DZLA 1VEKA 2O25A 2DAKA 1Y8GA 1XB2B 4Q7JA 1IXSA 2EJSA 2JZ0A 2EKFA 1WR1B 1HT1E 3E46A 1ZMWA 3MMPA 1AIPC 1G3IA 2KNVA 4GEWA 2JY6B 2LVQD 1ZV1A 1A5TA 2K0BX 2DAMA 1TTEA 2DAGA 2BWEA 3LCUA 1NV9A 2JZ1A 1E94E 1YLAA 3T6PA 1ZMVA 5DFLA 4R71A 1F4IA 2JY5A 1V92A 1MN3A 1SG9A 1KYIA 2MR9A 1G4AE 2JY8A 2LVAA 1VEGA 2JUJA 2KHHA 2MROB 1DO2A 3IECA 1OAIA 3FRIA 1G41A 3LCVB 4UN2B 4DBGB 1P3QQ 2LVOC 3B89A 2OO9A 4WP2A 1WGLA 2DI0A 2B3TA 2OOAA 1WHCA 1DO0A 1WIVA 2MGWA 2WZJA 2JP7A 3E21A 3IHPA 2LTUA 3K9OA 4F2LA 1QZEA 2BWBA 3K9PA 1HQYE 3GLHE 4HEOA 2JNHA 2K9DA 1T6OA 1DV0A 3GLIE 1HT2E 1T43A 2DAEA 3FRHA 1ZMUA 1PGYA 1VG5A 2KNZA 2QSFX 2ZTCA 1JR3E 1EFUB 2L4FA 2DKLA 2R0IA 1BVSA 2JY7A 1IM2A 4G3OA 1IFYA 3F92A 1VEJA 1TR8A 2KNAA 2L4EA 3GLGE 1HJPA 2HAKA 2CP8A 2LBCA 1WJ7A 1OTRA 1XXHE 2EKKA 1C7YA 1UFZA 1VQ1A 2G3QA 2LVNC 2DAIA 3BBZA 3GLFE 2HWJA 2DHYA 2CWBA 2L2DA 1OQYA 1VDLA 1NV8A 1CUKA 2DENA 1GO5A 1WGNA
chains in the Genus database with same CATH superfamily
1I4WA 4MH0E 2VIIA 4FWHA 3A46A 5L8RF 2C99A 2HL7A 3U6LA 1OFIA 2Y21A 3KVWA 1NJFA 4KODA 5DYGA 3WHKA 1QQWA 3ZH9B 5H37D 1QDRA 2LVPC 3NBIA 3GPYA 4HLQA 2HCBA 2QNJA 2A5YB 1HNWM 3A42A 3SAUA 1NJGA 4A3VB 1Z59A 3FUUA 1TDZA 2FNAA 1N77A 3GRRA 3R9XB 3T1YM 2DZOB 3FUTA 1VEKA 2F5NA 4DR7M 4LZZA 2DAKA 4DR4M 2F4VM 1R7RA 4CJ6A 2QBYA 4JN6A 4D80A 3U6EA 1Z6TA 4GMQA 1KSFX 3JR4A 1NVMA 2EKFA 1W5TA 5FSWA 4Z6YA 1XNQM 3E46A 1QAQA 1NO1A 1GL7A 3GRYA 3LVWA 3W0FA 4AZFA 1MU5A 5KPZA 3EIEA 1L2DA 4M9SA 2DAMA 4CGYB 4X66M 1K3WA 3KOXE 3KSXA 1J5EM 1DGHA 1NHGC 3U61B 3T6PA 1ZMVA 3L27A 5DFLA 1MN3A 1JQJC 2JXNA 1KYIA 4IBIA 1G4AE 2JY8A 2R65A 5E26A 1D2NA 2OPFA 2Z4RA 2ZBKB 2P5TA 3DOAA 3FUVA 2C9OA 2R46A 3KW6A 4OVZB 3UMMA 3GPXA 3CGWA 3FRIA 4LF4M 2XZFA 3DFZA 4REZA 2W82A 1IN8A 1P3QQ 4GC9A 4LRSA 1PM5A 4JI6M 4ZPXA 2DI0A 1NNJA 4LG2A 3Q8XA 4JI3M 3UK6A 3L25A 2JP7A 4B3RM 2J5YA 3L29A 3B7NA 5IT9S 5IZ7D 3GRUA 4L16A 1EIJA 3GLIB 1HQYE 3QYBA 2CUZA 3GP1A 2K9DA 1KFVA 4LF9M 4NOOB 2FOIC 3THGA 3QWLA 1T6OA 3KOYE 1DV0A 3SHFA 3GQ5A 1HT2E 2Y20A 4K0KM 1OIZA 2KNZA 1VG5A 3AV0A 4DR3M 4AKGA 2GNOA 3R8FA 1D0KA 2C9CA 2CE7A 1XNRM 5C1BA 1HNXM 2QCUA 3AOEA 4NL4H 4DV2M 2LHCA 1SXJB 4G3OA 4KHPM 3J2PB 5EXSA 4BLCA 2VF8A 3TWLA 3KXEC 1E32A 2FS1A 3LW5F 1VEJA 4HL4A 2KNAA 2EUCA 3AOGA 2L4EA 1GLNA 4D82A 4XK8F 1XXHB 3SYLA 1HJPA 3FTDA 4AG5A 3U60A 2CP8A 1N34M 4MGZE 5ITXA 5ITYA 3GLFB 4FW9A 5EXTA 1QANA 1OTRA 4JXJA 1XC8A 1VDDA 2O01F 2G3QA 2DAIA 3CF2A 3MJ5A 2CWBA 2VDBB 3PNYA 5EXPA 4LF6M 1AUAA 2DENA 4FWGA 2VQFM 1GO5A 1WGNA 4LFBM 3U6DA 1HNZM 3SATA 4X65M 2UUAM 1PJTA 5FTMA 2X49A 4IBKA 2I7PA 4B7GA 2LNHC 3FE3A 2OOBA 3ZQJA 1R4GA 5ITXE 2D7HA 1S3SA 1ZQ9A 1RU3A 1JB0F 2DNAA 4LGYA 1OKSA 2EA0A 3U6QA 4L8RC 3J7AS 2H5XA 2ZAOA 3DA1A 1IBMM 3KOZE 1QYRA 3H4JA 1GJSA 2K6BA 3CTWB 4B3SM 2X4AA 3SMPA 2UUBM 1NHWC 4ITQA 2DZLA 1TH2A 4LF8M 2UXDM 1QUTA 4G4QA 4GKJM 3KP0E 2YR0A 3FYCA 3M0EA 2O25A 1OAOC 3HJSA 1Q3CA 1Y8GA 4JYAM 1XB2B 4RKUF 2KXEA 4Q7JA 4LFCM 5ITQA 2FH0A 2Y0QA 4L6V6 4LJ9A 4QOZC 8CATA 1Z5CA 3U61A 1HT1E 3TL4X 3I4VA 3GO8A 2I7NA 1G3IA 4MGHA 1QUSA 4GEWA 2JY6B 2LVQD 1Z5AA 2WSCF 3HWSA 3IG8A 3NWLA 3GPUA 2XGNA 1ZV1A 4DV0M 3LVVA 1K82A 4IBFA 1Q3BA 4QNRA 4DV5M 1TTEA 4OVZA 3LCUA 1TF0B 3B7ZA 1NY5A 1YLAA 2DHRA 2CEAA 2RGOA 2XZUA 4LY6A 3GQ3A 1IN7A 2MR9A 2LVAA 3MHVC 1GKIA 1VEGA 4I8OA 4BBAA 2L6OA 3SC3A 5DNYA 3K92A 5BR8M 2KHHA 4DR6M 1DO2A 2C98A 3HU2A 4DV3M 1IY0A 4PDIA 1G8PA 3GLIA 2UXBM 1G41A 3LCVB 4DBGB 4S12A 3FTEA 5FTJA 2G8LA 3B89A 3QYEA 4WP2A 5E6JA 4B7FA 2F5OA 2R6FA 5KO3A 4JI1M 2OOAA 2J7OA 2BJWA 3W68A 4PDGA 1TH4A 1G71A 2C96A 2LTUA 2L7HA 2R44A 3IHPA 4FCVA 1IBKM 1IQPA 2YQZA 1Q39A 2L09A 3HU3A 3K9PA 4GIPA 3SYKA 5C18A 1R2ZA 2KA6B 3BXWA 3GLHE 2KW0A 2KZUA 4W5WA 2J7NA 1N33M 4G6ZA 4D81A 1SXJA 3GLIE 1PJIA 4IBDA 2F5PA 1IXZA 1YUBA 1ZMUA 1PGYA 2QSFX 1L2BA 3U6CA 4IJEA 1EFUB 1E9SA 3D8BA 3TWKA 4I81A 2DKLA 2XF3A 5A2QS 3HX3A 1UM8A 1XXHA 4LJAA 1PRBA 2DWMA 3SAWA 1ZAEA 1IM2A 5ITRA 3GLFA 3VKGA 2CV2A 2GQFA 2XSZD 4GHLA 3OTOM 4L15A 3GLHB 1SXJE 4XBOA 2WSFF 3SMSA 3VLFB 5ITTA 3SBJA 1R2YA 1DGFA 1J7KA 1GJTA 2XEPA 1X37A 4IIWA 3A45A 1XXHE 3C3DA 3M6AA 4LJ4A 4X64M 3AJIB 1C7YA 1TDHA 2YNMD 4M9XA 1XMQM 2K47A 3BBZA 3BOSA 4BB9A 2HWJA 2DHYA 2XLJA 3GLFE 2L2DA 2Z8YM 5KQDA 1IXRC 1WXQA 2RGHA 3J7BA 5KPTA 2X8AA 3C9PA 2F5QA 3B74A 2M5ZA 4NC6A 1PJJA 3FTFA 4LGMA 3H4MA 5EXXA 3D8LA 2O5RA 4L78A 4AW4A 4JI0M 1N75A 2QHOB 3AFHA 4F1IA 2RRUA 3EIHA 3JAMS 2HHHM 3LMMA 4RF1A 2ZTDA 4IBCA 5JI2E 4G4RA 3U6MA 3C58A 3SASA 2FE8A 2R4EA 4NRVA 2DWZB 4AQYM 1L1TA 1L8QA 4KLNA 5EP1A 4EIWA 4DV1M 3TPZA 4DUYM 4YHHM 3B9PA 2Z7JA 4Y28F 5FTKA 2L7IA 3PNVA 2K0BX 1IXSB 3HHWA 2DAGA 4ANRA 3J81S 2BWEA 2KDLA 1NNUC 4LZJA 1NV9A 2DWLA 1R5LA 1E94E 2ERCA 2QPAA 2DWNA 3RE8A 1D0MA 3RGSA 4R71A 3ZCBB 2JY5A 4NXMM 3ZC7B 1F4IA 1DGBA 4IBEA 4B7HA 3SAVA 5IWAM 4AI6A 2KRKA 2LWXA 3HZJA 3HJQA 2R62A 4LF7M 4GHAA 2JUJA 3Q8GA 2Z3XA 2MROB 5EP3A 4DR2M 3IECA 2DZNB 4NSOB 4B3TM 4UN2B 2VF7A 2BJVA 2D7EA 4CHTB 4GC5A 2CV0A 4P17A 4WW0A 1JR3A 1MX0A 2OO9A 1WGLA 1J09A 4AKHA 2B3TA 4R7GA 1SXJD 2EO2A 4RNAA 1WHCA 1DO0A 1WIVA 2WZJA 3HKPA 1XHBA 2WSEF 5EP4A 2R4JA 2G5GX 2R45A 3K9OA 4F2LA 2BWBA 4Z8XA 1HR0M 2UUCM 4JI4M 3HU1A 4HEOA 3U6OA 2JNHA 3W67A 1LV7A 1LTMA 2ZANA 3QAUA 3PFIA 4I5SA 4JI8M 4LF5M 3IG5A 2N35A 2XH9A 4JI5M 1PJQA 3MK6A 1SXJC 1JR3E 2XFSA 3GLHA 4LJ7A 3VFDA 2L4FA 3KFUG 5ITUA 2R0IA 1T3TA 3WHLA 2QP9X 4CIZA 3KSJA 4JI2M 5LMNM 4P16A 2BNKA 1XMOM 1IFYA 5DYIA 4GH9A 2QQ8A 2QZ4A 4FD2A 1ORYB 3U6SA 4LFAM 3F92A 3FTCA 5EQTA 3GLGB 1QZMA 1TR8A 2HKJA 1H6UA 3L26A 3U5ZB 5KPRA 1C1KA 1GABA 2KZSA 1K3XA 2CRUA 1QDTA 4WURA 3E4RA 3K2LA 4M0DA 3TQSA 2LBCA 4FVMA 1WJ7A 4OX9M 1TH3A 2R18A 3FD9A 2EKKA 4IJFA 1UFZA 1V34A 2LVNC 1Z5BA 4OU7A 4LJ6A 1I94M 3UJNA 4M9ZA 4QHTA 4DV7M 1OQYA 1N32M 3VK7A 1CUKA 1NY6A 2LH0A 2FFJA 3I04M 4M0WA 4TUWA 2V1UA 4NSRA 3I01M 5FTNA 2Y0TA 2AHMA 3C3EA 4L4UA 3KDSE 4IBBA 4XGIA 3RGPA 3AOEC 2V6ZM 4B3MM 4LRTA 1R6BX 1V33A 1IY1A 2MJ5B 7CATA 4G4OA 2DXIA 1Q02A 4OW0A 4PT5A 3SARA 4CISA 3VK8A 4FCWA 2LHGA 2ZAMA 5F3WA 4QOSA 2CV1A 4FCTA 4DV6M 2OQ4A 3J27B 4II7A 4KO8A 4AG6A 4DUZM 5EP2A 1IXSA 3TWMA 3VKHA 2EJSA 1TGUA 2JZ0A 2RKOA 4KT0F 3GRVA 1WR1B 4MGKE 3J80S 2XFTA 2MH8A 4MB7A 4LJ8A 1ZMWA 3ILKA 3MMPA 4LCBA 1AIPC 1N78A 3M7GA 2KNVA 5FLXS 2LXEA 5LMUM 3FKEA 3NBXX 3KOWE 1QAMA 1A5TA 2DVWB 3V76A 2QBYB 1YSYA 3T15A 4RF0A 3A98B 4G4NA 2JZ1A 3L2AA 2QENA 1FJGM 3AL0C 3VDPA 1EE8A 4PD2A 2UU9M 1GL6A 1V92A 1SG9A 1W5SA 1JR3D 3HHZA 1XWIA 1OIPA 2ZM6M 5IREB 3LQRA 3W0LB 3FUWA 4YY3M 1NSFA 1OAIA 3K8ZA 1DGHB 3SHGB 2E5LM 4NRWA 1HQCA 3I4YA 2VQEM 4DR5M 3U6PA 3AKZA 2APLA 1E9RA 2LVOC 3B7QA 4IBJA 1DGGA 2KEBA 3DZDA 3RFWA 2MGWA 3E21A 3CF0A 4DR1M 1OFHA 2CHGA 1L2CA 1QZEA 3JR5A 2XSZA 1YE9A 2Q2EB 2YFQA 4MM3B 1OJLA 3SFZA 3GQ4A 1D0LA 1IBLM 5GKNA 3FUXA 3L28A 2C5RA 1T43A 2NQ8C 1IN5A 3KS4A 3GLGA 2DAEA 3FRHA 1L1ZA 2ZTCA 4GITA 3U5ZA 3E9SA 4FWDA 3VDUA 2M60A 1QVRA 4JI7M 2JA2A 1BVSA 3I51A 4GRIA 4B08A 1N36M 2JY7A 2Z4SA 1IN4A 3KP1E 4I4LA 1IY2A 4GKKM 3GPPA 3TE6A 2V1CA 5KQ8A 4X62M 1IN6A 4QHSA 3K1JA 3LQQA 3UZUA 3PVSA 3UGJA 1QAOA 5EJCA 2CHVA 3T38A 5JI3E 3HHXA 5BPVA 1GVNA 3GLGE 3HY5A 4R3DA 4JV5M 3HGIA 2HAKA 2UXCM 4MGIE 4IBGA 1G59A 4PCZA 2F5SA 4MGYE 3T1HM 1PJSA 3KS8A 4LJ5A 2CHQA 2H1RA 1VQ1A 3HJ8A 3HHYA 3CF6E 2KRUA 4NXNM 4QNMA 2CFOA 1FNNA 1VDLA 1MJGM 1NV8A 2JWSA 3FYDA 5FTLA 4DV4M 3PXGA 3U60B 2D7GA 4AKIA
chains in the Genus database with same CATH topology
3FE3A 2OOBA 1R4GA 2DNAA 1OKSA 2QHOB 2LVPC 2RRUA 2H5XA 4F1IA 2MJ5B 2QNJA 1Q02A 3H4JA 2ZTDA 5JI2E 2DZLA 1VEKA 2O25A 2DAKA 1Y8GA 1XB2B 4Q7JA 1IXSA 2EJSA 2JZ0A 2EKFA 1WR1B 1HT1E 3E46A 1ZMWA 3MMPA 1AIPC 1G3IA 2KNVA 4GEWA 2JY6B 2LVQD 1ZV1A 1A5TA 2K0BX 2DAMA 1TTEA 2DAGA 2BWEA 3LCUA 1NV9A 2JZ1A 1E94E 1YLAA 3T6PA 1ZMVA 5DFLA 4R71A 1F4IA 2JY5A 1V92A 1MN3A 1SG9A 1KYIA 2MR9A 1G4AE 2JY8A 2LVAA 1VEGA 2JUJA 2KHHA 2MROB 1DO2A 3IECA 1OAIA 3FRIA 1G41A 3LCVB 4UN2B 4DBGB 1P3QQ 2LVOC 3B89A 2OO9A 4WP2A 1WGLA 2DI0A 2B3TA 2OOAA 1WHCA 1DO0A 1WIVA 2MGWA 2WZJA 2JP7A 3E21A 3IHPA 2LTUA 3K9OA 4F2LA 1QZEA 2BWBA 3K9PA 1HQYE 3GLHE 4HEOA 2JNHA 2K9DA 1T6OA 1DV0A 3GLIE 1HT2E 1T43A 2DAEA 3FRHA 1ZMUA 1PGYA 1VG5A 2KNZA 2QSFX 2ZTCA 1JR3E 1EFUB 2L4FA 2DKLA 2R0IA 1BVSA 2JY7A 1IM2A 4G3OA 1IFYA 3F92A 1VEJA 1TR8A 2KNAA 2L4EA 3GLGE 1HJPA 2HAKA 2CP8A 2LBCA 1WJ7A 1OTRA 1XXHE 2EKKA 1C7YA 1UFZA 1VQ1A 2G3QA 2LVNC 2DAIA 3BBZA 3GLFE 2HWJA 2DHYA 2CWBA 2L2DA 1OQYA 1VDLA 1NV8A 1CUKA 2DENA 1GO5A 1WGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE3 A;  2OOB A;  1R4G A;  2DNA A;  1OKS A;  2QHO B;  2LVP C;  2RRU A;  2H5X A;  4F1I A;  2MJ5 B;  2QNJ A;  1Q02 A;  3H4J A;  2ZTD A;  5JI2 E;  2DZL A;  1VEK A;  2O25 A;  2DAK A;  1Y8G A;  1XB2 B;  4Q7J A;  1IXS A;  2EJS A;  2JZ0 A;  2EKF A;  1WR1 B;  1HT1 E;  3E46 A;  1ZMW A;  3MMP A;  1AIP C;  1G3I A;  2KNV A;  4GEW A;  2JY6 B;  2LVQ D;  1ZV1 A;  1A5T A;  2K0B X;  2DAM A;  1TTE A;  2DAG A;  2BWE A;  3LCU A;  1NV9 A;  2JZ1 A;  1E94 E;  1YLA A;  3T6P A;  1ZMV A;  5DFL A;  4R71 A;  1F4I A;  2JY5 A;  1V92 A;  1MN3 A;  1SG9 A;  1KYI A;  2MR9 A;  1G4A E;  2JY8 A;  2LVA A;  1VEG A;  2JUJ A;  2KHH A;  2MRO B;  1DO2 A;  3IEC A;  1OAI A;  3FRI A;  1G41 A;  3LCV B;  4UN2 B;  4DBG B;  1P3Q Q;  2LVO C;  3B89 A;  2OO9 A;  4WP2 A;  1WGL A;  2DI0 A;  2B3T A;  2OOA A;  1WHC A;  1DO0 A;  1WIV A;  2MGW A;  2WZJ A;  2JP7 A;  3E21 A;  3IHP A;  2LTU A;  3K9O A;  4F2L A;  1QZE A;  2BWB A;  3K9P A;  1HQY E;  3GLH E;  4HEO A;  2JNH A;  2K9D A;  1T6O A;  1DV0 A;  3GLI E;  1HT2 E;  1T43 A;  2DAE A;  3FRH A;  1ZMU A;  1PGY A;  1VG5 A;  2KNZ A;  2QSF X;  2ZTC A;  1JR3 E;  1EFU B;  2L4F A;  2DKL A;  2R0I A;  1BVS A;  2JY7 A;  1IM2 A;  4G3O A;  1IFY A;  3F92 A;  1VEJ A;  1TR8 A;  2KNA A;  2L4E A;  3GLG E;  1HJP A;  2HAK A;  2CP8 A;  2LBC A;  1WJ7 A;  1OTR A;  1XXH E;  2EKK A;  1C7Y A;  1UFZ A;  1VQ1 A;  2G3Q A;  2LVN C;  2DAI A;  3BBZ A;  3GLF E;  2HWJ A;  2DHY A;  2CWB A;  2L2D A;  1OQY A;  1VDL A;  1NV8 A;  1CUK A;  2DEN A;  1GO5 A;  1WGN A; 
#chains in the Genus database with same CATH topology
 1I4W A;  4MH0 E;  2VII A;  4FWH A;  3A46 A;  5L8R F;  2C99 A;  2HL7 A;  3U6L A;  1OFI A;  2Y21 A;  3KVW A;  1NJF A;  4KOD A;  5DYG A;  3WHK A;  1QQW A;  3ZH9 B;  5H37 D;  1QDR A;  2LVP C;  3NBI A;  3GPY A;  4HLQ A;  2HCB A;  2QNJ A;  2A5Y B;  1HNW M;  3A42 A;  3SAU A;  1NJG A;  4A3V B;  1Z59 A;  3FUU A;  1TDZ A;  2FNA A;  1N77 A;  3GRR A;  3R9X B;  3T1Y M;  2DZO B;  3FUT A;  1VEK A;  2F5N A;  4DR7 M;  4LZZ A;  2DAK A;  4DR4 M;  2F4V M;  1R7R A;  4CJ6 A;  2QBY A;  4JN6 A;  4D80 A;  3U6E A;  1Z6T A;  4GMQ A;  1KSF X;  3JR4 A;  1NVM A;  2EKF A;  1W5T A;  5FSW A;  4Z6Y A;  1XNQ M;  3E46 A;  1QAQ A;  1NO1 A;  1GL7 A;  3GRY A;  3LVW A;  3W0F A;  4AZF A;  1MU5 A;  5KPZ A;  3EIE A;  1L2D A;  4M9S A;  2DAM A;  4CGY B;  4X66 M;  1K3W A;  3KOX E;  3KSX A;  1J5E M;  1DGH A;  1NHG C;  3U61 B;  3T6P A;  1ZMV A;  3L27 A;  5DFL A;  1MN3 A;  1JQJ C;  2JXN A;  1KYI A;  4IBI A;  1G4A E;  2JY8 A;  2R65 A;  5E26 A;  1D2N A;  2OPF A;  2Z4R A;  2ZBK B;  2P5T A;  3DOA A;  3FUV A;  2C9O A;  2R46 A;  3KW6 A;  4OVZ B;  3UMM A;  3GPX A;  3CGW A;  3FRI A;  4LF4 M;  2XZF A;  3DFZ A;  4REZ A;  2W82 A;  1IN8 A;  1P3Q Q;  4GC9 A;  4LRS A;  1PM5 A;  4JI6 M;  4ZPX A;  2DI0 A;  1NNJ A;  4LG2 A;  3Q8X A;  4JI3 M;  3UK6 A;  3L25 A;  2JP7 A;  4B3R M;  2J5Y A;  3L29 A;  3B7N A;  5IT9 S;  5IZ7 D;  3GRU A;  4L16 A;  1EIJ A;  3GLI B;  1HQY E;  3QYB A;  2CUZ A;  3GP1 A;  2K9D A;  1KFV A;  4LF9 M;  4NOO B;  2FOI C;  3THG A;  3QWL A;  1T6O A;  3KOY E;  1DV0 A;  3SHF A;  3GQ5 A;  1HT2 E;  2Y20 A;  4K0K M;  1OIZ A;  2KNZ A;  1VG5 A;  3AV0 A;  4DR3 M;  4AKG A;  2GNO A;  3R8F A;  1D0K A;  2C9C A;  2CE7 A;  1XNR M;  5C1B A;  1HNX M;  2QCU A;  3AOE A;  4NL4 H;  4DV2 M;  2LHC A;  1SXJ B;  4G3O A;  4KHP M;  3J2P B;  5EXS A;  4BLC A;  2VF8 A;  3TWL A;  3KXE C;  1E32 A;  2FS1 A;  3LW5 F;  1VEJ A;  4HL4 A;  2KNA A;  2EUC A;  3AOG A;  2L4E A;  1GLN A;  4D82 A;  4XK8 F;  1XXH B;  3SYL A;  1HJP A;  3FTD A;  4AG5 A;  3U60 A;  2CP8 A;  1N34 M;  4MGZ E;  5ITX A;  5ITY A;  3GLF B;  4FW9 A;  5EXT A;  1QAN A;  1OTR A;  4JXJ A;  1XC8 A;  1VDD A;  2O01 F;  2G3Q A;  2DAI A;  3CF2 A;  3MJ5 A;  2CWB A;  2VDB B;  3PNY A;  5EXP A;  4LF6 M;  1AUA A;  2DEN A;  4FWG A;  2VQF M;  1GO5 A;  1WGN A;  4LFB M;  3U6D A;  1HNZ M;  3SAT A;  4X65 M;  2UUA M;  1PJT A;  5FTM A;  2X49 A;  4IBK A;  2I7P A;  4B7G A;  2LNH C;  3FE3 A;  2OOB A;  3ZQJ A;  1R4G A;  5ITX E;  2D7H A;  1S3S A;  1ZQ9 A;  1RU3 A;  1JB0 F;  2DNA A;  4LGY A;  1OKS A;  2EA0 A;  3U6Q A;  4L8R C;  3J7A S;  2H5X A;  2ZAO A;  3DA1 A;  1IBM M;  3KOZ E;  1QYR A;  3H4J A;  1GJS A;  2K6B A;  3CTW B;  4B3S M;  2X4A A;  3SMP A;  2UUB M;  1NHW C;  4ITQ A;  2DZL A;  1TH2 A;  4LF8 M;  2UXD M;  1QUT A;  4G4Q A;  4GKJ M;  3KP0 E;  2YR0 A;  3FYC A;  3M0E A;  2O25 A;  1OAO C;  3HJS A;  1Q3C A;  1Y8G A;  4JYA M;  1XB2 B;  4RKU F;  2KXE A;  4Q7J A;  4LFC M;  5ITQ A;  2FH0 A;  2Y0Q A;  4L6V 6;  4LJ9 A;  4QOZ C;  8CAT A;  1Z5C A;  3U61 A;  1HT1 E;  3TL4 X;  3I4V A;  3GO8 A;  2I7N A;  1G3I A;  4MGH A;  1QUS A;  4GEW A;  2JY6 B;  2LVQ D;  1Z5A A;  2WSC F;  3HWS A;  3IG8 A;  3NWL A;  3GPU A;  2XGN A;  1ZV1 A;  4DV0 M;  3LVV A;  1K82 A;  4IBF A;  1Q3B A;  4QNR A;  4DV5 M;  1TTE A;  4OVZ A;  3LCU A;  1TF0 B;  3B7Z A;  1NY5 A;  1YLA A;  2DHR A;  2CEA A;  2RGO A;  2XZU A;  4LY6 A;  3GQ3 A;  1IN7 A;  2MR9 A;  2LVA A;  3MHV C;  1GKI A;  1VEG A;  4I8O A;  4BBA A;  2L6O A;  3SC3 A;  5DNY A;  3K92 A;  5BR8 M;  2KHH A;  4DR6 M;  1DO2 A;  2C98 A;  3HU2 A;  4DV3 M;  1IY0 A;  4PDI A;  1G8P A;  3GLI A;  2UXB M;  1G41 A;  3LCV B;  4DBG B;  4S12 A;  3FTE A;  5FTJ A;  2G8L A;  3B89 A;  3QYE A;  4WP2 A;  5E6J A;  4B7F A;  2F5O A;  2R6F A;  5KO3 A;  4JI1 M;  2OOA A;  2J7O A;  2BJW A;  3W68 A;  4PDG A;  1TH4 A;  1G71 A;  2C96 A;  2LTU A;  2L7H A;  2R44 A;  3IHP A;  4FCV A;  1IBK M;  1IQP A;  2YQZ A;  1Q39 A;  2L09 A;  3HU3 A;  3K9P A;  4GIP A;  3SYK A;  5C18 A;  1R2Z A;  2KA6 B;  3BXW A;  3GLH E;  2KW0 A;  2KZU A;  4W5W A;  2J7N A;  1N33 M;  4G6Z A;  4D81 A;  1SXJ A;  3GLI E;  1PJI A;  4IBD A;  2F5P A;  1IXZ A;  1YUB A;  1ZMU A;  1PGY A;  2QSF X;  1L2B A;  3U6C A;  4IJE A;  1EFU B;  1E9S A;  3D8B A;  3TWK A;  4I81 A;  2DKL A;  2XF3 A;  5A2Q S;  3HX3 A;  1UM8 A;  1XXH A;  4LJA A;  1PRB A;  2DWM A;  3SAW A;  1ZAE A;  1IM2 A;  5ITR A;  3GLF A;  3VKG A;  2CV2 A;  2GQF A;  2XSZ D;  4GHL A;  3OTO M;  4L15 A;  3GLH B;  1SXJ E;  4XBO A;  2WSF F;  3SMS A;  3VLF B;  5ITT A;  3SBJ A;  1R2Y A;  1DGF A;  1J7K A;  1GJT A;  2XEP A;  1X37 A;  4IIW A;  3A45 A;  1XXH E;  3C3D A;  3M6A A;  4LJ4 A;  4X64 M;  3AJI B;  1C7Y A;  1TDH A;  2YNM D;  4M9X A;  1XMQ M;  2K47 A;  3BBZ A;  3BOS A;  4BB9 A;  2HWJ A;  2DHY A;  2XLJ A;  3GLF E;  2L2D A;  2Z8Y M;  5KQD A;  1IXR C;  1WXQ A;  2RGH A;  3J7B A;  5KPT A;  2X8A A;  3C9P A;  2F5Q A;  3B74 A;  2M5Z A;  4NC6 A;  1PJJ A;  3FTF A;  4LGM A;  3H4M A;  5EXX A;  3D8L A;  2O5R A;  4L78 A;  4AW4 A;  4JI0 M;  1N75 A;  2QHO B;  3AFH A;  4F1I A;  2RRU A;  3EIH A;  3JAM S;  2HHH M;  3LMM A;  4RF1 A;  2ZTD A;  4IBC A;  5JI2 E;  4G4R A;  3U6M A;  3C58 A;  3SAS A;  2FE8 A;  2R4E A;  4NRV A;  2DWZ B;  4AQY M;  1L1T A;  1L8Q A;  4KLN A;  5EP1 A;  4EIW A;  4DV1 M;  3TPZ A;  4DUY M;  4YHH M;  3B9P A;  2Z7J A;  4Y28 F;  5FTK A;  2L7I A;  3PNV A;  2K0B X;  1IXS B;  3HHW A;  2DAG A;  4ANR A;  3J81 S;  2BWE A;  2KDL A;  1NNU C;  4LZJ A;  1NV9 A;  2DWL A;  1R5L A;  1E94 E;  2ERC A;  2QPA A;  2DWN A;  3RE8 A;  1D0M A;  3RGS A;  4R71 A;  3ZCB B;  2JY5 A;  4NXM M;  3ZC7 B;  1F4I A;  1DGB A;  4IBE A;  4B7H A;  3SAV A;  5IWA M;  4AI6 A;  2KRK A;  2LWX A;  3HZJ A;  3HJQ A;  2R62 A;  4LF7 M;  4GHA A;  2JUJ A;  3Q8G A;  2Z3X A;  2MRO B;  5EP3 A;  4DR2 M;  3IEC A;  2DZN B;  4NSO B;  4B3T M;  4UN2 B;  2VF7 A;  2BJV A;  2D7E A;  4CHT B;  4GC5 A;  2CV0 A;  4P17 A;  4WW0 A;  1JR3 A;  1MX0 A;  2OO9 A;  1WGL A;  1J09 A;  4AKH A;  2B3T A;  4R7G A;  1SXJ D;  2EO2 A;  4RNA A;  1WHC A;  1DO0 A;  1WIV A;  2WZJ A;  3HKP A;  1XHB A;  2WSE F;  5EP4 A;  2R4J A;  2G5G X;  2R45 A;  3K9O A;  4F2L A;  2BWB A;  4Z8X A;  1HR0 M;  2UUC M;  4JI4 M;  3HU1 A;  4HEO A;  3U6O A;  2JNH A;  3W67 A;  1LV7 A;  1LTM A;  2ZAN A;  3QAU A;  3PFI A;  4I5S A;  4JI8 M;  4LF5 M;  3IG5 A;  2N35 A;  2XH9 A;  4JI5 M;  1PJQ A;  3MK6 A;  1SXJ C;  1JR3 E;  2XFS A;  3GLH A;  4LJ7 A;  3VFD A;  2L4F A;  3KFU G;  5ITU A;  2R0I A;  1T3T A;  3WHL A;  2QP9 X;  4CIZ A;  3KSJ A;  4JI2 M;  5LMN M;  4P16 A;  2BNK A;  1XMO M;  1IFY A;  5DYI A;  4GH9 A;  2QQ8 A;  2QZ4 A;  4FD2 A;  1ORY B;  3U6S A;  4LFA M;  3F92 A;  3FTC A;  5EQT A;  3GLG B;  1QZM A;  1TR8 A;  2HKJ A;  1H6U A;  3L26 A;  3U5Z B;  5KPR A;  1C1K A;  1GAB A;  2KZS A;  1K3X A;  2CRU A;  1QDT A;  4WUR A;  3E4R A;  3K2L A;  4M0D A;  3TQS A;  2LBC A;  4FVM A;  1WJ7 A;  4OX9 M;  1TH3 A;  2R18 A;  3FD9 A;  2EKK A;  4IJF A;  1UFZ A;  1V34 A;  2LVN C;  1Z5B A;  4OU7 A;  4LJ6 A;  1I94 M;  3UJN A;  4M9Z A;  4QHT A;  4DV7 M;  1OQY A;  1N32 M;  3VK7 A;  1CUK A;  1NY6 A;  2LH0 A;  2FFJ A;  3I04 M;  4M0W A;  4TUW A;  2V1U A;  4NSR A;  3I01 M;  5FTN A;  2Y0T A;  2AHM A;  3C3E A;  4L4U A;  3KDS E;  4IBB A;  4XGI A;  3RGP A;  3AOE C;  2V6Z M;  4B3M M;  4LRT A;  1R6B X;  1V33 A;  1IY1 A;  2MJ5 B;  7CAT A;  4G4O A;  2DXI A;  1Q02 A;  4OW0 A;  4PT5 A;  3SAR A;  4CIS A;  3VK8 A;  4FCW A;  2LHG A;  2ZAM A;  5F3W A;  4QOS A;  2CV1 A;  4FCT A;  4DV6 M;  2OQ4 A;  3J27 B;  4II7 A;  4KO8 A;  4AG6 A;  4DUZ M;  5EP2 A;  1IXS A;  3TWM A;  3VKH A;  2EJS A;  1TGU A;  2JZ0 A;  2RKO A;  4KT0 F;  3GRV A;  1WR1 B;  4MGK E;  3J80 S;  2XFT A;  2MH8 A;  4MB7 A;  4LJ8 A;  1ZMW A;  3ILK A;  3MMP A;  4LCB A;  1AIP C;  1N78 A;  3M7G A;  2KNV A;  5FLX S;  2LXE A;  5LMU M;  3FKE A;  3NBX X;  3KOW E;  1QAM A;  1A5T A;  2DVW B;  3V76 A;  2QBY B;  1YSY A;  3T15 A;  4RF0 A;  3A98 B;  4G4N A;  2JZ1 A;  3L2A A;  2QEN A;  1FJG M;  3AL0 C;  3VDP A;  1EE8 A;  4PD2 A;  2UU9 M;  1GL6 A;  1V92 A;  1SG9 A;  1W5S A;  1JR3 D;  3HHZ A;  1XWI A;  1OIP A;  2ZM6 M;  5IRE B;  3LQR A;  3W0L B;  3FUW A;  4YY3 M;  1NSF A;  1OAI A;  3K8Z A;  1DGH B;  3SHG B;  2E5L M;  4NRW A;  1HQC A;  3I4Y A;  2VQE M;  4DR5 M;  3U6P A;  3AKZ A;  2APL A;  1E9R A;  2LVO C;  3B7Q A;  4IBJ A;  1DGG A;  2KEB A;  3DZD A;  3RFW A;  2MGW A;  3E21 A;  3CF0 A;  4DR1 M;  1OFH A;  2CHG A;  1L2C A;  1QZE A;  3JR5 A;  2XSZ A;  1YE9 A;  2Q2E B;  2YFQ A;  4MM3 B;  1OJL A;  3SFZ A;  3GQ4 A;  1D0L A;  1IBL M;  5GKN A;  3FUX A;  3L28 A;  2C5R A;  1T43 A;  2NQ8 C;  1IN5 A;  3KS4 A;  3GLG A;  2DAE A;  3FRH A;  1L1Z A;  2ZTC A;  4GIT A;  3U5Z A;  3E9S A;  4FWD A;  3VDU A;  2M60 A;  1QVR A;  4JI7 M;  2JA2 A;  1BVS A;  3I51 A;  4GRI A;  4B08 A;  1N36 M;  2JY7 A;  2Z4S A;  1IN4 A;  3KP1 E;  4I4L A;  1IY2 A;  4GKK M;  3GPP A;  3TE6 A;  2V1C A;  5KQ8 A;  4X62 M;  1IN6 A;  4QHS A;  3K1J A;  3LQQ A;  3UZU A;  3PVS A;  3UGJ A;  1QAO A;  5EJC A;  2CHV A;  3T38 A;  5JI3 E;  3HHX A;  5BPV A;  1GVN A;  3GLG E;  3HY5 A;  4R3D A;  4JV5 M;  3HGI A;  2HAK A;  2UXC M;  4MGI E;  4IBG A;  1G59 A;  4PCZ A;  2F5S A;  4MGY E;  3T1H M;  1PJS A;  3KS8 A;  4LJ5 A;  2CHQ A;  2H1R A;  1VQ1 A;  3HJ8 A;  3HHY A;  3CF6 E;  2KRU A;  4NXN M;  4QNM A;  2CFO A;  1FNN A;  1VDL A;  1MJG M;  1NV8 A;  2JWS A;  3FYD A;  5FTL A;  4DV4 M;  3PXG A;  3U60 B;  2D7G A;  4AKI A; 
#chains in the Genus database with same CATH homology
 3FE3 A;  2OOB A;  1R4G A;  2DNA A;  1OKS A;  2QHO B;  2LVP C;  2RRU A;  2H5X A;  4F1I A;  2MJ5 B;  2QNJ A;  1Q02 A;  3H4J A;  2ZTD A;  5JI2 E;  2DZL A;  1VEK A;  2O25 A;  2DAK A;  1Y8G A;  1XB2 B;  4Q7J A;  1IXS A;  2EJS A;  2JZ0 A;  2EKF A;  1WR1 B;  1HT1 E;  3E46 A;  1ZMW A;  3MMP A;  1AIP C;  1G3I A;  2KNV A;  4GEW A;  2JY6 B;  2LVQ D;  1ZV1 A;  1A5T A;  2K0B X;  2DAM A;  1TTE A;  2DAG A;  2BWE A;  3LCU A;  1NV9 A;  2JZ1 A;  1E94 E;  1YLA A;  3T6P A;  1ZMV A;  5DFL A;  4R71 A;  1F4I A;  2JY5 A;  1V92 A;  1MN3 A;  1SG9 A;  1KYI A;  2MR9 A;  1G4A E;  2JY8 A;  2LVA A;  1VEG A;  2JUJ A;  2KHH A;  2MRO B;  1DO2 A;  3IEC A;  1OAI A;  3FRI A;  1G41 A;  3LCV B;  4UN2 B;  4DBG B;  1P3Q Q;  2LVO C;  3B89 A;  2OO9 A;  4WP2 A;  1WGL A;  2DI0 A;  2B3T A;  2OOA A;  1WHC A;  1DO0 A;  1WIV A;  2MGW A;  2WZJ A;  2JP7 A;  3E21 A;  3IHP A;  2LTU A;  3K9O A;  4F2L A;  1QZE A;  2BWB A;  3K9P A;  1HQY E;  3GLH E;  4HEO A;  2JNH A;  2K9D A;  1T6O A;  1DV0 A;  3GLI E;  1HT2 E;  1T43 A;  2DAE A;  3FRH A;  1ZMU A;  1PGY A;  1VG5 A;  2KNZ A;  2QSF X;  2ZTC A;  1JR3 E;  1EFU B;  2L4F A;  2DKL A;  2R0I A;  1BVS A;  2JY7 A;  1IM2 A;  4G3O A;  1IFY A;  3F92 A;  1VEJ A;  1TR8 A;  2KNA A;  2L4E A;  3GLG E;  1HJP A;  2HAK A;  2CP8 A;  2LBC A;  1WJ7 A;  1OTR A;  1XXH E;  2EKK A;  1C7Y A;  1UFZ A;  1VQ1 A;  2G3Q A;  2LVN C;  2DAI A;  3BBZ A;  3GLF E;  2HWJ A;  2DHY A;  2CWB A;  2L2D A;  1OQY A;  1VDL A;  1NV8 A;  1CUK A;  2DEN A;  1GO5 A;  1WGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...