2KNVA

Nmr dimer structure of the uba domain of p62 (sqstm1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimerisation of the UBA Domain of p62 Inhibits Ubiquitin Binding and Regulates NF-kappaB Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Sequestosome-1
total genus 13
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2knvA00
3K9OA 3IHPA 3FRHA 4HEOA 3B89A 2DKLA 3F92A 3FRIA 1WIVA 3BBZA 2EKFA 2DI0A 2JZ1A 1IM2A 2H5XA 1DO2A 2QSFX 3T6PA 2ZTCA 5JI2E 1XXHE 1T6OA 2BWBA 1ZMVA 2DHYA 2L2DA 2OOAA 2LTUA 2CP8A 1G3IA 2MGWA 3GLHE 3LCVB 2OOBA 1HT1E 2RRUA 2JP7A 1HT2E 1AIPC 1WHCA 1GO5A 2B3TA 1R4GA 1WGNA 1ZMUA 2CWBA 2BWEA 3MMPA 3K9PA 1V92A 3GLGE 1VDLA 2DAGA 2R0IA 1OTRA 4R71A 4G3OA 1P3QQ 2ZTDA 2DNAA 2LVOC 1QZEA 4F2LA 2K0BX 1PGYA 5DFLA 2KNAA 1Y8GA 1G41A 2DZLA 2KNZA 2LBCA 1ZV1A 2LVAA 1UFZA 1SG9A 1KYIA 1OAIA 1HJPA 2LVNC 1WR1B 2HAKA 2QNJA 1YLAA 1C7YA 2DENA 1VEGA 2KHHA 4UN2B 1E94E 3GLFE 1Q02A 1VEKA 1TTEA 3H4JA 1MN3A 4F1IA 1VQ1A 2WZJA 1CUKA 1NV8A 2O25A 2MR9A 2DAIA 1NV9A 1OKSA 1JR3E 1DO0A 2JZ0A 2EJSA 2L4EA 2KNVA 2HWJA 2JY8A 2MJ5B 4Q7JA 2G3QA 1OQYA 3E46A 2LVQD 1F4IA 1WJ7A 1IFYA 1DV0A 2QHOB 2DAEA 2MROB 2JY5A 4WP2A 1IXSA 2OO9A 3FE3A 1VG5A 3LCUA 4DBGB 3GLIE 2DAMA 1XB2B 1G4AE 2JY7A 1WGLA 2JUJA 1A5TA 1TR8A 1BVSA 3IECA 3E21A 2EKKA 1HQYE 1VEJA 2JY6B 1EFUB 2K9DA 2LVPC 4GEWA 2DAKA 2L4FA 1T43A 1ZMWA 2JNHA
chains in the Genus database with same CATH superfamily
1SXJA 4L15A 1HQCA 4M0WA 2E5LM 4MGYE 2VDBB 2KRKA 2D7HA 2X49A 3F92A 4XGIA 3RFWA 2UU9M 5EXPA 1WIVA 4JI8M 2Q2EB 1DO2A 4RNAA 2VQFM 1IXZA 4Z8XA 1DGHB 4GMQA 5ITTA 2C5RA 1N77A 1I94M 3AOEA 1DGBA 2AHMA 1YUBA 3U6CA 3PXGA 3C58A 3B7QA 2OOAA 4HLQA 5KPTA 2L6OA 1G3IA 5E6JA 3GPUA 2JA2A 1EE8A 2OOBA 1OIZA 3NWLA 3HJSA 2K6BA 1VDDA 2CRUA 3UK6A 1GO5A 3DFZA 1TF0B 2DWZB 4KODA 4G4NA 2GNOA 1ZMUA 3MMPA 3ZQJA 2DWLA 4ZPXA 2KZUA 2Z7JA 2ZAOA 2WSEF 3GLGE 1QDTA 1VDLA 4IBDA 4L16A 3DA1A 4G3OA 4LJ7A 1XXHA 1UM8A 2LVOC 3LMMA 3UZUA 3M6AA 1IQPA 5EP4A 4RF0A 2F4VM 3A46A 4KO8A 2LHCA 4R7GA 3HHZA 2LWXA 4GIPA 2A5YB 1Y8GA 2LXEA 4AW4A 4B3SM 2DZLA 3QYBA 1S3SA 4EIWA 5LMNM 2Y21A 2YNMD 3TWLA 3FUTA 4NXMM 4LFBM 3CF0A 1QAOA 2Y20A 2DWMA 1KYIA 4LF5M 1SXJC 2DHRA 4G4OA 4JI3M 2QNJA 2QP9X 2R4EA 2V6ZM 4M9XA 3GPYA 2F5PA 2R44A 4ITQA 2UXCM 2KHHA 5DYIA 1Q02A 3QWLA 3KVWA 2Z3XA 4JI1M 3HJQA 1D0KA 2QENA 1NVMA 4DR4M 4XBOA 4WW0A 1L8QA 3CGWA 3GLGA 5IZ7D 3I04M 1OKSA 1JR3E 4FW9A 4D80A 2EJSA 4LGYA 2KNVA 4AG6A 2R65A 4B08A 2VF7A 2MJ5B 3KOZE 4LY6A 3KP0E 1K3WA 3QAUA 3UJNA 2XF3A 4NSOB 1E9RA 5E26A 3VDPA 4A3VB 2OQ4A 2XH9A 4FCTA 1N36M 1WJ7A 1XHBA 4L4UA 4OU7A 1L2BA 1QAQA 3GPPA 4MGZE 1N75A 1H6UA 4WP2A 2HCBA 4I4LA 4LZJA 3LCUA 3RGPA 4B7HA 4LG2A 5EXTA 3GQ5A 3B74A 3SMPA 1XB2B 1HNXM 3HHYA 3GPXA 2X4AA 4P17A 2CHVA 4DUZM 1J09A 1TH4A 3FTFA 2JUJA 2R45A 1BVSA 4DV2M 4B7FA 1YE9A 2EKKA 1HQYE 4QOSA 1IBLM 3SHFA 3FYCA 1Q3CA 3FUXA 5F3WA 1EFUB 3SBJA 5JI3E 1D0MA 4FCVA 3CF2A 1DGGA 1ZQ9A 2BJWA 3JR4A 4NRWA 3R9XB 1T43A 2VF8A 2ERCA 1R2ZA 3HJ8A 3HU1A 3K9OA 3FRHA 4DR1M 4QNRA 3D8LA 3SFZA 3VK8A 2DKLA 2C99A 2KRUA 3I51A 5EP3A 3HHWA 4AI6A 4DV1M 2EKFA 1SXJB 2DI0A 2JZ1A 2O01F 2QSFX 3HWSA 3HY5A 2ZTCA 3KXEC 4QHTA 3CTWB 4M9SA 4D81A 1N33M 1T6OA 2YQZA 2V1UA 4LJ5A 2C96A 3BXWA 4JXJA 1IXRC 4GC9A 4JI4M 3TQSA 2R18A 2MH8A 1GABA 2MGWA 3GLHE 4IBGA 4M9ZA 4Y28F 1XMOM 2UXBM 1X37A 1QQWA 2K47A 2JP7A 2R6FA 2B3TA 5FTKA 4MM3B 1R4GA 3U60A 3EIHA 2L7IA 4GKJM 2BWEA 4LF8M 1IY0A 1NNUC 1NY5A 3IG8A 3CF6E 4IBIA 1K3XA 4LF4M 1C1KA 4LRSA 1P3QQ 5ITXA 3UGJA 2D7GA 3SHGB 2DNAA 3WHKA 2WSCF 4OW0A 1RU3A 1NNJA 1IN6A 3FD9A 4JI7M 4CGYB 1OJLA 3SAVA 1PGYA 4LCBA 3HKPA 2W82A 1QAMA 1R7RA 4YY3M 4DUYM 2F5QA 3T1YM 1G41A 2LBCA 1Z59A 3AFHA 3TE6A 3B9PA 3VK7A 3IG5A 2EA0A 1Q3BA 3U6DA 3GLIB 3MJ5A 2HL7A 1SG9A 2L7HA 4LJ9A 1TDHA 1HJPA 2RGHA 3RGSA 1IN5A 1WR1B 5ITQA 1QDRA 5FTNA 1D0LA 2HAKA 3OTOM 1YLAA 3T38A 5IWAM 2F5NA 3FTEA 3KSXA 3KFUG 1DGHA 1TTEA 2BNKA 1V33A 4B7GA 4LFCM 4GITA 2XZFA 1MN3A 4GRIA 1IBKM 4II7A 4QOZC 4RF1A 1NSFA 4GH9A 4KT0F 2WZJA 2J5YA 1CUKA 3AOEC 4PDGA 4OVZA 3JR5A 2MR9A 4JI0M 2DAIA 2L4EA 2WSFF 5EXXA 2JZ0A 1TH3A 3PFIA 2UUAM 3KOYE 4FWGA 1IBMM 3GP1A 2LVQD 4QNMA 1GJSA 3FYDA 2ZANA 2QHOB 2X8AA 2MROB 1MX0A 2OO9A 3T1HM 1VG5A 1XNRM 1I4WA 2UXDM 3VKGA 5EP2A 3J81S 4I81A 4KLNA 2DAMA 3GLHB 5EP1A 4G4RA 3U6EA 3L2AA 2JY7A 1IY2A 3J80S 4IBCA 5A2QS 2CFOA 3B7ZA 3IECA 2F5SA 5KPZA 2J7NA 1SXJE 5FTLA 2QPAA 1PM5A 2JY6B 2XFTA 2L09A 3AL0C 3ZC7B 1QANA 3GRRA 4REZA 2RGOA 3HU3A 2DZOB 1N34M 3K8ZA 5EJCA 3GQ4A 2VQEM 2CV2A 4I5SA 3V76A 1ZMWA 3TL4X 3J2PB 3KOWE 3D8BA 3IHPA 2XSZD 3J7BA 3U60B 3B89A 1Z5BA 3UMMA 1XC8A 1G59A 4GKKM 4YHHM 2CHGA 4LZZA 4B3MM 1GL7A 4LRTA 1T3TA 4IBBA 3FRIA 3BBZA 2XZUA 3T6PA 2H5XA 5JI2E 3MK6A 4GHAA 2APLA 3W67A 1LTMA 1LV7A 1XXHE 3KP1E 5KPRA 3SARA 2BWBA 2KXEA 4PCZA 1ZMVA 2Y0QA 1N78A 2DHYA 2QCUA 4LJ4A 2L2DA 4DV7M 1NHWC 1E32A 3U6SA 3LCVB 2Y0TA 3I4VA 4RKUF 1HT1E 3KSJA 4FWDA 4DV5M 3LVVA 4NC6A 3ZCBB 1AIPC 1G71A 1QUSA 1MU5A 1WHCA 2RKOA 5L8RF 2YFQA 1WGNA 3SYLA 3U61B 1PJJA 2CWBA 1GVNA 2LHGA 3SAUA 3J7AS 5LMUM 1V92A 1NJGA 3EIEA 1PJTA 2DAGA 5FTMA 4R71A 4AQYM 1FJGM 1AUAA 4ANRA 1HNWM 3U6LA 1OFIA 1QYRA 1KFVA 2UUCM 2QZ4A 1IN8A 4MGHA 4Z6YA 3FUWA 3SYKA 2K0BX 1XNQM 4JI6M 3KOXE 4DV3M 1Z5AA 3KS4A 3PNYA 5DFLA 3C9PA 4IJEA 4KHPM 4DV0M 4NXNM 2I7PA 4I8OA 1G8PA 3GRUA 1Z6TA 3LW5F 3VLFB 1V34A 3A98B 3VFDA 5BPVA 3GLIA 3DZDA 4LFAM 2F5OA 4NSRA 3DOAA 4OX9M 3K2LA 3RE8A 4X66M 3AKZA 1OAIA 1FNNA 2FE8A 3C3DA 4MGKE 5IREB 2KA6B 1L1ZA 1IY1A 2QBYB 5C18A 2OPFA 4MB7A 4HL4A 2J7OA 1OFHA 4R3DA 2DENA 2KDLA 2ZM6M 3GLFE 1WXQA 2FS1A 3HX3A 1VEKA 3H4JA 1L1TA 3FUUA 5ITXE 5ITRA 4BLCA 3BOSA 4NRVA 2M5ZA 2DXIA 3QYEA 3L28A 4CIZA 2O25A 7CATA 3M7GA 1NV9A 3HHXA 4PT5A 1DO0A 4G6ZA 1SXJD 3THGA 3AV0A 2HWJA 4Q7JA 4AKHA 2JXNA 1TGUA 1NHGC 1OQYA 1R6BX 1PJQA 3FTCA 5FSWA 4AKGA 2CV1A 3AJIB 2DVWB 3VKHA 3HU2A 3SMSA 1F4IA 1E9SA 3M0EA 1JR3A 2KZSA 2N35A 3Q8XA 4IBKA 4LF9M 3PNVA 1PJIA 2DAEA 2JY5A 2D7EA 1NJFA 4X64M 2LNHC 2KEBA 2G8LA 2JWSA 3FE3A 4DR5M 1ORYB 2R4JA 3ZH9B 1IN4A 2DZNB 2YR0A 3H4MA 4GHLA 1GLNA 4TUWA 4CHTB 2CV0A 1G4AE 4W5WA 3U61A 5FLXS 2ZBKB 3W0LB 1WGLA 4L78A 1GKIA 2FH0A 1A5TA 4PD2A 1TR8A 3NBXX 2HKJA 1HNZM 3E21A 2EUCA 4L6V6 1QUTA 3TWKA 4FD2A 2XLJA 3GRVA 4FWHA 3SAWA 3L25A 1VEJA 1JR3D 3Q8GA 3LQQA 4IBEA 4CJ6A 2QBYA 4X65M 4B3RM 2LVPC 4GEWA 3R8FA 5C1BA 2L4FA 3KW6A 4HEOA 2JNHA 3PVSA 1JQJC 3FTDA 2XFSA 3U6PA 2C98A 3J27B 3TWMA 2XEPA 2LH0A 4DR6M 4JI5M 5KQDA 1IM2A 3C3EA 4L8RC 3E9SA 3JAMS 4MH0E 1HR0M 4K0KM 1GJTA 3AOGA 3K92A 2FOIC 4LJAA 1XMQM 2C9CA 1L2CA 4JN6A 4LJ8A 3U6MA 4JV5M 4AG5A 8CATA 3KS8A 2LTUA 2CP8A 3GRYA 5KQ8A 2HHHM 2RRUA 3A42A 1HT2E 1Z5CA 5EQTA 2G5GX 4WURA 4BB9A 5DYGA 4G4QA 3B7NA 3GLHA 2BJVA 3HGIA 4LF7M 3K9PA 4IIWA 3W0FA 5ITUA 4S12A 2R0IA 1OTRA 2CHQA 2GQFA 2ZTDA 1IN7A 4NOOB 1XXHB 1QZEA 4IBFA 4IBJA 3U5ZB 4F2LA 2FFJA 4MGIE 4P16A 3ILKA 2EO2A 2KNAA 3T15A 1PJSA 4AKIA 2DWNA 1QVRA 2XSZA 2Z4SA 3TPZA 3U6QA 2C9OA 2KNZA 1D2NA 3I01M 1ZV1A 2UUBM 3SASA 3SATA 1W5SA 2R62A 2LVAA 3L27A 2XGNA 4DR3M 1L2DA 1UFZA 2Z8YM 3A45A 1TH2A 4AZFA 4B3TM 1J7KA 1IXSB 2LVNC 4LGMA 2Z4RA 4GC5A 4LF6M 2CUZA 3GO8A 2M60A 4D82A 1R2YA 1C7YA 4DR7M 5BR8M 1VEGA 2FNAA 4UN2B 1E94E 3KDSE 5GKNA 4JYAM 5IT9S 1QZMA 5FTJA 3GLGB 2V1CA 3L29A 3SC3A 1N32M 4F1IA 1VQ1A 2CEAA 2R46A 1NV8A 5ITYA 1NO1A 1K82A 1GL6A 4FCWA 2CE7A 4DV6M 3FUVA 3E4RA 3MHVC 2O5RA 3VDUA 2JY8A 2KW0A 1EIJA 2G3QA 4NL4H 2I7NA 3E46A 5KO3A 4CISA 5H37D 2ZAMA 1Q39A 1W5TA 1IFYA 1DV0A 3I4YA 1NY6A 1IXSA 1YSYA 3K1JA 4QHSA 1PRBA 3GLFB 1OIPA 4DBGB 4PDIA 3U6OA 4BBAA 4OVZB 3HZJA 3LQRA 5DNYA 3L26A 1JB0F 4DR2M 2P5TA 4X62M 1ZAEA 1TDZA 3GLFA 1DGFA 5EXSA 3FKEA 1OAOC 2VIIA 3WHLA 1XWIA 2H1RA 4IJFA 1KSFX 4LJ6A 4DV4M 1J5EM 4JI2M 1R5LA 1MJGM 3LVWA 4M0DA 3U5ZA 2K9DA 2QQ8A 3GQ3A 3NBIA 4FVMA 2DAKA 4XK8F 3W68A 2NQ8C 3GLIE
chains in the Genus database with same CATH topology
3K9OA 3IHPA 3FRHA 4HEOA 3B89A 2DKLA 3F92A 3FRIA 1WIVA 3BBZA 2EKFA 2DI0A 2JZ1A 1IM2A 2H5XA 1DO2A 2QSFX 3T6PA 2ZTCA 5JI2E 1XXHE 1T6OA 2BWBA 1ZMVA 2DHYA 2L2DA 2OOAA 2LTUA 2CP8A 1G3IA 2MGWA 3GLHE 3LCVB 2OOBA 1HT1E 2RRUA 2JP7A 1HT2E 1AIPC 1WHCA 1GO5A 2B3TA 1R4GA 1WGNA 1ZMUA 2CWBA 2BWEA 3MMPA 3K9PA 1V92A 3GLGE 1VDLA 2DAGA 2R0IA 1OTRA 4R71A 4G3OA 1P3QQ 2ZTDA 2DNAA 2LVOC 1QZEA 4F2LA 2K0BX 1PGYA 5DFLA 2KNAA 1Y8GA 1G41A 2DZLA 2KNZA 2LBCA 1ZV1A 2LVAA 1UFZA 1SG9A 1KYIA 1OAIA 1HJPA 2LVNC 1WR1B 2HAKA 2QNJA 1YLAA 1C7YA 2DENA 1VEGA 2KHHA 4UN2B 1E94E 3GLFE 1Q02A 1VEKA 1TTEA 3H4JA 1MN3A 4F1IA 1VQ1A 2WZJA 1CUKA 1NV8A 2O25A 2MR9A 2DAIA 1NV9A 1OKSA 1JR3E 1DO0A 2JZ0A 2EJSA 2L4EA 2KNVA 2HWJA 2JY8A 2MJ5B 4Q7JA 2G3QA 1OQYA 3E46A 2LVQD 1F4IA 1WJ7A 1IFYA 1DV0A 2QHOB 2DAEA 2MROB 2JY5A 4WP2A 1IXSA 2OO9A 3FE3A 1VG5A 3LCUA 4DBGB 3GLIE 2DAMA 1XB2B 1G4AE 2JY7A 1WGLA 2JUJA 1A5TA 1TR8A 1BVSA 3IECA 3E21A 2EKKA 1HQYE 1VEJA 2JY6B 1EFUB 2K9DA 2LVPC 4GEWA 2DAKA 2L4FA 1T43A 1ZMWA 2JNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9O A;  3IHP A;  3FRH A;  4HEO A;  3B89 A;  2DKL A;  3F92 A;  3FRI A;  1WIV A;  3BBZ A;  2EKF A;  2DI0 A;  2JZ1 A;  1IM2 A;  2H5X A;  1DO2 A;  2QSF X;  3T6P A;  2ZTC A;  5JI2 E;  1XXH E;  1T6O A;  2BWB A;  1ZMV A;  2DHY A;  2L2D A;  2OOA A;  2LTU A;  2CP8 A;  1G3I A;  2MGW A;  3GLH E;  3LCV B;  2OOB A;  1HT1 E;  2RRU A;  2JP7 A;  1HT2 E;  1AIP C;  1WHC A;  1GO5 A;  2B3T A;  1R4G A;  1WGN A;  1ZMU A;  2CWB A;  2BWE A;  3MMP A;  3K9P A;  1V92 A;  3GLG E;  1VDL A;  2DAG A;  2R0I A;  1OTR A;  4R71 A;  4G3O A;  1P3Q Q;  2ZTD A;  2DNA A;  2LVO C;  1QZE A;  4F2L A;  2K0B X;  1PGY A;  5DFL A;  2KNA A;  1Y8G A;  1G41 A;  2DZL A;  2KNZ A;  2LBC A;  1ZV1 A;  2LVA A;  1UFZ A;  1SG9 A;  1KYI A;  1OAI A;  1HJP A;  2LVN C;  1WR1 B;  2HAK A;  2QNJ A;  1YLA A;  1C7Y A;  2DEN A;  1VEG A;  2KHH A;  4UN2 B;  1E94 E;  3GLF E;  1Q02 A;  1VEK A;  1TTE A;  3H4J A;  1MN3 A;  4F1I A;  1VQ1 A;  2WZJ A;  1CUK A;  1NV8 A;  2O25 A;  2MR9 A;  2DAI A;  1NV9 A;  1OKS A;  1JR3 E;  1DO0 A;  2JZ0 A;  2EJS A;  2L4E A;  2KNV A;  2HWJ A;  2JY8 A;  2MJ5 B;  4Q7J A;  2G3Q A;  1OQY A;  3E46 A;  2LVQ D;  1F4I A;  1WJ7 A;  1IFY A;  1DV0 A;  2QHO B;  2DAE A;  2MRO B;  2JY5 A;  4WP2 A;  1IXS A;  2OO9 A;  3FE3 A;  1VG5 A;  3LCU A;  4DBG B;  3GLI E;  2DAM A;  1XB2 B;  1G4A E;  2JY7 A;  1WGL A;  2JUJ A;  1A5T A;  1TR8 A;  1BVS A;  3IEC A;  3E21 A;  2EKK A;  1HQY E;  1VEJ A;  2JY6 B;  1EFU B;  2K9D A;  2LVP C;  4GEW A;  2DAK A;  2L4F A;  1T43 A;  1ZMW A;  2JNH A; 
#chains in the Genus database with same CATH topology
 1SXJ A;  4L15 A;  1HQC A;  4M0W A;  2E5L M;  4MGY E;  2VDB B;  2KRK A;  2D7H A;  2X49 A;  3F92 A;  4XGI A;  3RFW A;  2UU9 M;  5EXP A;  1WIV A;  4JI8 M;  2Q2E B;  1DO2 A;  4RNA A;  2VQF M;  1IXZ A;  4Z8X A;  1DGH B;  4GMQ A;  5ITT A;  2C5R A;  1N77 A;  1I94 M;  3AOE A;  1DGB A;  2AHM A;  1YUB A;  3U6C A;  3PXG A;  3C58 A;  3B7Q A;  2OOA A;  4HLQ A;  5KPT A;  2L6O A;  1G3I A;  5E6J A;  3GPU A;  2JA2 A;  1EE8 A;  2OOB A;  1OIZ A;  3NWL A;  3HJS A;  2K6B A;  1VDD A;  2CRU A;  3UK6 A;  1GO5 A;  3DFZ A;  1TF0 B;  2DWZ B;  4KOD A;  4G4N A;  2GNO A;  1ZMU A;  3MMP A;  3ZQJ A;  2DWL A;  4ZPX A;  2KZU A;  2Z7J A;  2ZAO A;  2WSE F;  3GLG E;  1QDT A;  1VDL A;  4IBD A;  4L16 A;  3DA1 A;  4G3O A;  4LJ7 A;  1XXH A;  1UM8 A;  2LVO C;  3LMM A;  3UZU A;  3M6A A;  1IQP A;  5EP4 A;  4RF0 A;  2F4V M;  3A46 A;  4KO8 A;  2LHC A;  4R7G A;  3HHZ A;  2LWX A;  4GIP A;  2A5Y B;  1Y8G A;  2LXE A;  4AW4 A;  4B3S M;  2DZL A;  3QYB A;  1S3S A;  4EIW A;  5LMN M;  2Y21 A;  2YNM D;  3TWL A;  3FUT A;  4NXM M;  4LFB M;  3CF0 A;  1QAO A;  2Y20 A;  2DWM A;  1KYI A;  4LF5 M;  1SXJ C;  2DHR A;  4G4O A;  4JI3 M;  2QNJ A;  2QP9 X;  2R4E A;  2V6Z M;  4M9X A;  3GPY A;  2F5P A;  2R44 A;  4ITQ A;  2UXC M;  2KHH A;  5DYI A;  1Q02 A;  3QWL A;  3KVW A;  2Z3X A;  4JI1 M;  3HJQ A;  1D0K A;  2QEN A;  1NVM A;  4DR4 M;  4XBO A;  4WW0 A;  1L8Q A;  3CGW A;  3GLG A;  5IZ7 D;  3I04 M;  1OKS A;  1JR3 E;  4FW9 A;  4D80 A;  2EJS A;  4LGY A;  2KNV A;  4AG6 A;  2R65 A;  4B08 A;  2VF7 A;  2MJ5 B;  3KOZ E;  4LY6 A;  3KP0 E;  1K3W A;  3QAU A;  3UJN A;  2XF3 A;  4NSO B;  1E9R A;  5E26 A;  3VDP A;  4A3V B;  2OQ4 A;  2XH9 A;  4FCT A;  1N36 M;  1WJ7 A;  1XHB A;  4L4U A;  4OU7 A;  1L2B A;  1QAQ A;  3GPP A;  4MGZ E;  1N75 A;  1H6U A;  4WP2 A;  2HCB A;  4I4L A;  4LZJ A;  3LCU A;  3RGP A;  4B7H A;  4LG2 A;  5EXT A;  3GQ5 A;  3B74 A;  3SMP A;  1XB2 B;  1HNX M;  3HHY A;  3GPX A;  2X4A A;  4P17 A;  2CHV A;  4DUZ M;  1J09 A;  1TH4 A;  3FTF A;  2JUJ A;  2R45 A;  1BVS A;  4DV2 M;  4B7F A;  1YE9 A;  2EKK A;  1HQY E;  4QOS A;  1IBL M;  3SHF A;  3FYC A;  1Q3C A;  3FUX A;  5F3W A;  1EFU B;  3SBJ A;  5JI3 E;  1D0M A;  4FCV A;  3CF2 A;  1DGG A;  1ZQ9 A;  2BJW A;  3JR4 A;  4NRW A;  3R9X B;  1T43 A;  2VF8 A;  2ERC A;  1R2Z A;  3HJ8 A;  3HU1 A;  3K9O A;  3FRH A;  4DR1 M;  4QNR A;  3D8L A;  3SFZ A;  3VK8 A;  2DKL A;  2C99 A;  2KRU A;  3I51 A;  5EP3 A;  3HHW A;  4AI6 A;  4DV1 M;  2EKF A;  1SXJ B;  2DI0 A;  2JZ1 A;  2O01 F;  2QSF X;  3HWS A;  3HY5 A;  2ZTC A;  3KXE C;  4QHT A;  3CTW B;  4M9S A;  4D81 A;  1N33 M;  1T6O A;  2YQZ A;  2V1U A;  4LJ5 A;  2C96 A;  3BXW A;  4JXJ A;  1IXR C;  4GC9 A;  4JI4 M;  3TQS A;  2R18 A;  2MH8 A;  1GAB A;  2MGW A;  3GLH E;  4IBG A;  4M9Z A;  4Y28 F;  1XMO M;  2UXB M;  1X37 A;  1QQW A;  2K47 A;  2JP7 A;  2R6F A;  2B3T A;  5FTK A;  4MM3 B;  1R4G A;  3U60 A;  3EIH A;  2L7I A;  4GKJ M;  2BWE A;  4LF8 M;  1IY0 A;  1NNU C;  1NY5 A;  3IG8 A;  3CF6 E;  4IBI A;  1K3X A;  4LF4 M;  1C1K A;  4LRS A;  1P3Q Q;  5ITX A;  3UGJ A;  2D7G A;  3SHG B;  2DNA A;  3WHK A;  2WSC F;  4OW0 A;  1RU3 A;  1NNJ A;  1IN6 A;  3FD9 A;  4JI7 M;  4CGY B;  1OJL A;  3SAV A;  1PGY A;  4LCB A;  3HKP A;  2W82 A;  1QAM A;  1R7R A;  4YY3 M;  4DUY M;  2F5Q A;  3T1Y M;  1G41 A;  2LBC A;  1Z59 A;  3AFH A;  3TE6 A;  3B9P A;  3VK7 A;  3IG5 A;  2EA0 A;  1Q3B A;  3U6D A;  3GLI B;  3MJ5 A;  2HL7 A;  1SG9 A;  2L7H A;  4LJ9 A;  1TDH A;  1HJP A;  2RGH A;  3RGS A;  1IN5 A;  1WR1 B;  5ITQ A;  1QDR A;  5FTN A;  1D0L A;  2HAK A;  3OTO M;  1YLA A;  3T38 A;  5IWA M;  2F5N A;  3FTE A;  3KSX A;  3KFU G;  1DGH A;  1TTE A;  2BNK A;  1V33 A;  4B7G A;  4LFC M;  4GIT A;  2XZF A;  1MN3 A;  4GRI A;  1IBK M;  4II7 A;  4QOZ C;  4RF1 A;  1NSF A;  4GH9 A;  4KT0 F;  2WZJ A;  2J5Y A;  1CUK A;  3AOE C;  4PDG A;  4OVZ A;  3JR5 A;  2MR9 A;  4JI0 M;  2DAI A;  2L4E A;  2WSF F;  5EXX A;  2JZ0 A;  1TH3 A;  3PFI A;  2UUA M;  3KOY E;  4FWG A;  1IBM M;  3GP1 A;  2LVQ D;  4QNM A;  1GJS A;  3FYD A;  2ZAN A;  2QHO B;  2X8A A;  2MRO B;  1MX0 A;  2OO9 A;  3T1H M;  1VG5 A;  1XNR M;  1I4W A;  2UXD M;  3VKG A;  5EP2 A;  3J81 S;  4I81 A;  4KLN A;  2DAM A;  3GLH B;  5EP1 A;  4G4R A;  3U6E A;  3L2A A;  2JY7 A;  1IY2 A;  3J80 S;  4IBC A;  5A2Q S;  2CFO A;  3B7Z A;  3IEC A;  2F5S A;  5KPZ A;  2J7N A;  1SXJ E;  5FTL A;  2QPA A;  1PM5 A;  2JY6 B;  2XFT A;  2L09 A;  3AL0 C;  3ZC7 B;  1QAN A;  3GRR A;  4REZ A;  2RGO A;  3HU3 A;  2DZO B;  1N34 M;  3K8Z A;  5EJC A;  3GQ4 A;  2VQE M;  2CV2 A;  4I5S A;  3V76 A;  1ZMW A;  3TL4 X;  3J2P B;  3KOW E;  3D8B A;  3IHP A;  2XSZ D;  3J7B A;  3U60 B;  3B89 A;  1Z5B A;  3UMM A;  1XC8 A;  1G59 A;  4GKK M;  4YHH M;  2CHG A;  4LZZ A;  4B3M M;  1GL7 A;  4LRT A;  1T3T A;  4IBB A;  3FRI A;  3BBZ A;  2XZU A;  3T6P A;  2H5X A;  5JI2 E;  3MK6 A;  4GHA A;  2APL A;  3W67 A;  1LTM A;  1LV7 A;  1XXH E;  3KP1 E;  5KPR A;  3SAR A;  2BWB A;  2KXE A;  4PCZ A;  1ZMV A;  2Y0Q A;  1N78 A;  2DHY A;  2QCU A;  4LJ4 A;  2L2D A;  4DV7 M;  1NHW C;  1E32 A;  3U6S A;  3LCV B;  2Y0T A;  3I4V A;  4RKU F;  1HT1 E;  3KSJ A;  4FWD A;  4DV5 M;  3LVV A;  4NC6 A;  3ZCB B;  1AIP C;  1G71 A;  1QUS A;  1MU5 A;  1WHC A;  2RKO A;  5L8R F;  2YFQ A;  1WGN A;  3SYL A;  3U61 B;  1PJJ A;  2CWB A;  1GVN A;  2LHG A;  3SAU A;  3J7A S;  5LMU M;  1V92 A;  1NJG A;  3EIE A;  1PJT A;  2DAG A;  5FTM A;  4R71 A;  4AQY M;  1FJG M;  1AUA A;  4ANR A;  1HNW M;  3U6L A;  1OFI A;  1QYR A;  1KFV A;  2UUC M;  2QZ4 A;  1IN8 A;  4MGH A;  4Z6Y A;  3FUW A;  3SYK A;  2K0B X;  1XNQ M;  4JI6 M;  3KOX E;  4DV3 M;  1Z5A A;  3KS4 A;  3PNY A;  5DFL A;  3C9P A;  4IJE A;  4KHP M;  4DV0 M;  4NXN M;  2I7P A;  4I8O A;  1G8P A;  3GRU A;  1Z6T A;  3LW5 F;  3VLF B;  1V34 A;  3A98 B;  3VFD A;  5BPV A;  3GLI A;  3DZD A;  4LFA M;  2F5O A;  4NSR A;  3DOA A;  4OX9 M;  3K2L A;  3RE8 A;  4X66 M;  3AKZ A;  1OAI A;  1FNN A;  2FE8 A;  3C3D A;  4MGK E;  5IRE B;  2KA6 B;  1L1Z A;  1IY1 A;  2QBY B;  5C18 A;  2OPF A;  4MB7 A;  4HL4 A;  2J7O A;  1OFH A;  4R3D A;  2DEN A;  2KDL A;  2ZM6 M;  3GLF E;  1WXQ A;  2FS1 A;  3HX3 A;  1VEK A;  3H4J A;  1L1T A;  3FUU A;  5ITX E;  5ITR A;  4BLC A;  3BOS A;  4NRV A;  2M5Z A;  2DXI A;  3QYE A;  3L28 A;  4CIZ A;  2O25 A;  7CAT A;  3M7G A;  1NV9 A;  3HHX A;  4PT5 A;  1DO0 A;  4G6Z A;  1SXJ D;  3THG A;  3AV0 A;  2HWJ A;  4Q7J A;  4AKH A;  2JXN A;  1TGU A;  1NHG C;  1OQY A;  1R6B X;  1PJQ A;  3FTC A;  5FSW A;  4AKG A;  2CV1 A;  3AJI B;  2DVW B;  3VKH A;  3HU2 A;  3SMS A;  1F4I A;  1E9S A;  3M0E A;  1JR3 A;  2KZS A;  2N35 A;  3Q8X A;  4IBK A;  4LF9 M;  3PNV A;  1PJI A;  2DAE A;  2JY5 A;  2D7E A;  1NJF A;  4X64 M;  2LNH C;  2KEB A;  2G8L A;  2JWS A;  3FE3 A;  4DR5 M;  1ORY B;  2R4J A;  3ZH9 B;  1IN4 A;  2DZN B;  2YR0 A;  3H4M A;  4GHL A;  1GLN A;  4TUW A;  4CHT B;  2CV0 A;  1G4A E;  4W5W A;  3U61 A;  5FLX S;  2ZBK B;  3W0L B;  1WGL A;  4L78 A;  1GKI A;  2FH0 A;  1A5T A;  4PD2 A;  1TR8 A;  3NBX X;  2HKJ A;  1HNZ M;  3E21 A;  2EUC A;  4L6V 6;  1QUT A;  3TWK A;  4FD2 A;  2XLJ A;  3GRV A;  4FWH A;  3SAW A;  3L25 A;  1VEJ A;  1JR3 D;  3Q8G A;  3LQQ A;  4IBE A;  4CJ6 A;  2QBY A;  4X65 M;  4B3R M;  2LVP C;  4GEW A;  3R8F A;  5C1B A;  2L4F A;  3KW6 A;  4HEO A;  2JNH A;  3PVS A;  1JQJ C;  3FTD A;  2XFS A;  3U6P A;  2C98 A;  3J27 B;  3TWM A;  2XEP A;  2LH0 A;  4DR6 M;  4JI5 M;  5KQD A;  1IM2 A;  3C3E A;  4L8R C;  3E9S A;  3JAM S;  4MH0 E;  1HR0 M;  4K0K M;  1GJT A;  3AOG A;  3K92 A;  2FOI C;  4LJA A;  1XMQ M;  2C9C A;  1L2C A;  4JN6 A;  4LJ8 A;  3U6M A;  4JV5 M;  4AG5 A;  8CAT A;  3KS8 A;  2LTU A;  2CP8 A;  3GRY A;  5KQ8 A;  2HHH M;  2RRU A;  3A42 A;  1HT2 E;  1Z5C A;  5EQT A;  2G5G X;  4WUR A;  4BB9 A;  5DYG A;  4G4Q A;  3B7N A;  3GLH A;  2BJV A;  3HGI A;  4LF7 M;  3K9P A;  4IIW A;  3W0F A;  5ITU A;  4S12 A;  2R0I A;  1OTR A;  2CHQ A;  2GQF A;  2ZTD A;  1IN7 A;  4NOO B;  1XXH B;  1QZE A;  4IBF A;  4IBJ A;  3U5Z B;  4F2L A;  2FFJ A;  4MGI E;  4P16 A;  3ILK A;  2EO2 A;  2KNA A;  3T15 A;  1PJS A;  4AKI A;  2DWN A;  1QVR A;  2XSZ A;  2Z4S A;  3TPZ A;  3U6Q A;  2C9O A;  2KNZ A;  1D2N A;  3I01 M;  1ZV1 A;  2UUB M;  3SAS A;  3SAT A;  1W5S A;  2R62 A;  2LVA A;  3L27 A;  2XGN A;  4DR3 M;  1L2D A;  1UFZ A;  2Z8Y M;  3A45 A;  1TH2 A;  4AZF A;  4B3T M;  1J7K A;  1IXS B;  2LVN C;  4LGM A;  2Z4R A;  4GC5 A;  4LF6 M;  2CUZ A;  3GO8 A;  2M60 A;  4D82 A;  1R2Y A;  1C7Y A;  4DR7 M;  5BR8 M;  1VEG A;  2FNA A;  4UN2 B;  1E94 E;  3KDS E;  5GKN A;  4JYA M;  5IT9 S;  1QZM A;  5FTJ A;  3GLG B;  2V1C A;  3L29 A;  3SC3 A;  1N32 M;  4F1I A;  1VQ1 A;  2CEA A;  2R46 A;  1NV8 A;  5ITY A;  1NO1 A;  1K82 A;  1GL6 A;  4FCW A;  2CE7 A;  4DV6 M;  3FUV A;  3E4R A;  3MHV C;  2O5R A;  3VDU A;  2JY8 A;  2KW0 A;  1EIJ A;  2G3Q A;  4NL4 H;  2I7N A;  3E46 A;  5KO3 A;  4CIS A;  5H37 D;  2ZAM A;  1Q39 A;  1W5T A;  1IFY A;  1DV0 A;  3I4Y A;  1NY6 A;  1IXS A;  1YSY A;  3K1J A;  4QHS A;  1PRB A;  3GLF B;  1OIP A;  4DBG B;  4PDI A;  3U6O A;  4BBA A;  4OVZ B;  3HZJ A;  3LQR A;  5DNY A;  3L26 A;  1JB0 F;  4DR2 M;  2P5T A;  4X62 M;  1ZAE A;  1TDZ A;  3GLF A;  1DGF A;  5EXS A;  3FKE A;  1OAO C;  2VII A;  3WHL A;  1XWI A;  2H1R A;  4IJF A;  1KSF X;  4LJ6 A;  4DV4 M;  1J5E M;  4JI2 M;  1R5L A;  1MJG M;  3LVW A;  4M0D A;  3U5Z A;  2K9D A;  2QQ8 A;  3GQ3 A;  3NBI A;  4FVM A;  2DAK A;  4XK8 F;  3W68 A;  2NQ8 C;  3GLI E; 
#chains in the Genus database with same CATH homology
 3K9O A;  3IHP A;  3FRH A;  4HEO A;  3B89 A;  2DKL A;  3F92 A;  3FRI A;  1WIV A;  3BBZ A;  2EKF A;  2DI0 A;  2JZ1 A;  1IM2 A;  2H5X A;  1DO2 A;  2QSF X;  3T6P A;  2ZTC A;  5JI2 E;  1XXH E;  1T6O A;  2BWB A;  1ZMV A;  2DHY A;  2L2D A;  2OOA A;  2LTU A;  2CP8 A;  1G3I A;  2MGW A;  3GLH E;  3LCV B;  2OOB A;  1HT1 E;  2RRU A;  2JP7 A;  1HT2 E;  1AIP C;  1WHC A;  1GO5 A;  2B3T A;  1R4G A;  1WGN A;  1ZMU A;  2CWB A;  2BWE A;  3MMP A;  3K9P A;  1V92 A;  3GLG E;  1VDL A;  2DAG A;  2R0I A;  1OTR A;  4R71 A;  4G3O A;  1P3Q Q;  2ZTD A;  2DNA A;  2LVO C;  1QZE A;  4F2L A;  2K0B X;  1PGY A;  5DFL A;  2KNA A;  1Y8G A;  1G41 A;  2DZL A;  2KNZ A;  2LBC A;  1ZV1 A;  2LVA A;  1UFZ A;  1SG9 A;  1KYI A;  1OAI A;  1HJP A;  2LVN C;  1WR1 B;  2HAK A;  2QNJ A;  1YLA A;  1C7Y A;  2DEN A;  1VEG A;  2KHH A;  4UN2 B;  1E94 E;  3GLF E;  1Q02 A;  1VEK A;  1TTE A;  3H4J A;  1MN3 A;  4F1I A;  1VQ1 A;  2WZJ A;  1CUK A;  1NV8 A;  2O25 A;  2MR9 A;  2DAI A;  1NV9 A;  1OKS A;  1JR3 E;  1DO0 A;  2JZ0 A;  2EJS A;  2L4E A;  2KNV A;  2HWJ A;  2JY8 A;  2MJ5 B;  4Q7J A;  2G3Q A;  1OQY A;  3E46 A;  2LVQ D;  1F4I A;  1WJ7 A;  1IFY A;  1DV0 A;  2QHO B;  2DAE A;  2MRO B;  2JY5 A;  4WP2 A;  1IXS A;  2OO9 A;  3FE3 A;  1VG5 A;  3LCU A;  4DBG B;  3GLI E;  2DAM A;  1XB2 B;  1G4A E;  2JY7 A;  1WGL A;  2JUJ A;  1A5T A;  1TR8 A;  1BVS A;  3IEC A;  3E21 A;  2EKK A;  1HQY E;  1VEJ A;  2JY6 B;  1EFU B;  2K9D A;  2LVP C;  4GEW A;  2DAK A;  2L4F A;  1T43 A;  1ZMW A;  2JNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...