2KNVA

Nmr dimer structure of the uba domain of p62 (sqstm1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sequestosome-1
publication title Dimerisation of the UBA Domain of p62 Inhibits Ubiquitin Binding and Regulates NF-kappaB Signalling
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2knvA00
1Y8GA 1WIVA 3K9OA 1VG5A 2LVQD 2WZJA 1ZMUA 1DV0A 1OTRA 2MR9A 1VQ1A 2JZ1A 2KNZA 2K0BX 2OOBA 2H5XA 1QZEA 5DFLA 3E46A 2JZ0A 1XB2B 1R4GA 2JP7A 2DKLA 1CUKA 3GLHE 1YLAA 5JI2E 4F1IA 1ZMVA 4HEOA 2MGWA 1XXHE 1V92A 1AIPC 2L4EA 3T6PA 2MROB 1NV8A 2EKKA 2DHYA 1Q02A 2O25A 1PGYA 2OOAA 1ZV1A 2OO9A 1IFYA 2DI0A 2LVNC 2QSFX 1OKSA 2EKFA 2EJSA 1T43A 1ZMWA 4R71A 1F4IA 3IHPA 1WHCA 3H4JA 4F2LA 1KYIA 3MMPA 1WGLA 2DAGA 2G3QA 1HT2E 1G3IA 2JNHA 2JY8A 2LTUA 3FRIA 1A5TA 2DENA 3FRHA 2B3TA 1VEKA 2KNAA 1DO0A 3LCUA 3GLGE 2ZTDA 2R0IA 2QNJA 2ZTCA 1OAIA 4WP2A 1MN3A 1WR1B 1NV9A 2KNVA 1E94E 1IXSA 3GLFE 2L2DA 3GLIE 1UFZA 1TTEA 1C7YA 2LVPC 2L4FA 3FE3A 1JR3E 3E21A 3LCVB 2DAIA 2RRUA 2HAKA 2CWBA 2JUJA 4DBGB 1TR8A 3F92A 2DAKA 4UN2B 2HWJA 2QHOB 1WGNA 1GO5A 1VEGA 1BVSA 2LVOC 1EFUB 1VDLA 2DAMA 1HJPA 2BWEA 1P3QQ 2DAEA 2LVAA 3IECA 1IM2A 2DNAA 2MJ5B 1VEJA 1DO2A 1G41A 1OQYA 2JY7A 2JY5A 2KHHA 3BBZA 2BWBA 1HT1E 1SG9A 3K9PA 2JY6B 2K9DA 4Q7JA 1HQYE 2CP8A 3B89A 1G4AE 1T6OA 4G3OA 2LBCA 1WJ7A 4GEWA 2DZLA
chains in the Genus database with same CATH superfamily
3UK6A 4LFBM 2V1UA 4I8OA 4FCVA 4GC5A 4II7A 1R2ZA 3K9OA 1VG5A 4RF1A 3ZC7B 2ZAMA 4MGYE 5KPTA 3FUUA 1OTRA 2K0BX 3JR5A 1QZEA 1D0KA 2CEAA 2FNAA 3B74A 2LHCA 4DV3M 1XB2B 1R4GA 4FCWA 2JP7A 4M9ZA 1CUKA 4WURA 1N78A 4CIZA 4L4UA 1ZMVA 3FTDA 3KFUG 5FTMA 1GVNA 2XFTA 3KS4A 4DV1M 3R9XB 4IJFA 4RNAA 4AKHA 2WSEF 5EJCA 4NC6A 4DR4M 1AUAA 3KS8A 4AKGA 1NV8A 3U60B 1R7RA 4X62M 3FKEA 3MK6A 1ZV1A 4QNMA 4JI4M 1J09A 5F3WA 2DI0A 1QUTA 3PFIA 3KP1E 1IXSB 3THGA 2X8AA 1GL6A 3KDSE 4B3SM 4I5SA 4JI7M 4GKKM 1ZMWA 4F2LA 4FWGA 4B3RM 1PJSA 3AOEA 2DWNA 3W67A 1WGLA 4GHAA 2JY8A 1G3IA 2JNHA 5FSWA 1NJFA 5EP1A 1IN7A 2KW0A 1GABA 3UGJA 3QYEA 2A5YB 4Y28F 2CV2A 3GPYA 2H1RA 4WW0A 1I4WA 3J81S 2LXEA 4B7GA 1QAQA 2J7NA 3AFHA 2F5PA 3LW5F 3C3EA 3SMSA 2CRUA 5EXSA 4DV2M 3VK8A 3HWSA 3KOWE 1L2CA 1OAOC 2D7EA 3EIEA 3ILKA 3FUXA 1C7YA 2CV0A 4L8RC 2KEBA 4I81A 4DV6M 4PT5A 2HAKA 2CV1A 4NXNM 3K2LA 4M0DA 1SXJE 2KA6B 3AOGA 3RFWA 3WHLA 4IBKA 3U6EA 2QHOB 4D81A 3SAVA 1GO5A 2VDBB 3HJSA 2DAMA 1VDLA 4JI8M 4AI6A 4R3DA 4NSOB 1HNXM 3PVSA 1QAOA 2HKJA 2DAEA 2M5ZA 1N34M 3KW6A 2VQEM 4ANRA 2LWXA 4LF6M 1OIPA 1ORYB 1VEJA 2KZSA 1DO2A 5DNYA 3HHZA 4L16A 1G41A 3M6AA 2JY7A 4YHHM 4LF4M 1QUSA 2BWBA 4NRVA 4B7HA 1D2NA 3DZDA 4M9XA 5EXPA 2DWLA 3SATA 2UXCM 2UXDM 2FS1A 2K9DA 3LVVA 2LHGA 1HQYE 2O01F 4LJ5A 3HZJA 2UUCM 3B89A 2Y20A 1V34A 3DOAA 3TPZA 3CF0A 4DV5M 1WJ7A 1IXRC 4OW0A 2DZLA 2CHVA 4X66M 2Q2EB 4REZA 1Y8GA 3U61B 2C5RA 3GPUA 3I01M 3FUVA 4FD2A 1J5EM 1ZMUA 4KHPM 1L1TA 2ZAOA 5GKNA 4AKIA 1D0MA 1IN8A 1DGHB 1Z5AA 1L2BA 5E6JA 3E46A 2JZ0A 4PD2A 4AZFA 2DKLA 3CTWB 3BOSA 3CF6E 2QBYA 4LJ7A 3VDUA 4TUWA 1IN4A 2C99A 4L6V6 1S3SA 3RGPA 4W5WA 2RGHA 2Z8YM 1Q3BA 3W0FA 2HHHM 2V1CA 3GLHA 3NWLA 2KZUA 3U6DA 4LZZA 3GLHB 5A2QS 1L1ZA 5LMNM 3TE6A 4IBDA 3I51A 4GKJM 3FTEA 1NO1A 2L4EA 4CISA 2MROB 3VK7A 4OU7A 2OQ4A 1QANA 5FLXS 3U6LA 2OOAA 2OO9A 1XXHB 3M0EA 4JXJA 3GP1A 1PJIA 2P5TA 3SYKA 3VKGA 3AOEC 4NRWA 1OKSA 4P17A 4ITQA 1T43A 3AKZA 1XHBA 1EIJA 2CUZA 4MH0E 4OVZA 4G4OA 1GJTA 3MMPA 2EUCA 4OVZB 1K3XA 2DAGA 1E9RA 5KQ8A 2C98A 1NSFA 2L7IA 4D80A 2LTUA 3L29A 1A5TA 3SAUA 2V6ZM 3OTOM 1N77A 1HNWM 3J7AS 4IBFA 1C1KA 1VEKA 1DO0A 2KNAA 4KLNA 2FOIC 3HGIA 3J27B 2LH0A 4DV4M 1KFVA 3KXEC 1DGFA 5FTKA 2KXEA 2F4VM 2BJVA 3U60A 1LV7A 2R0IA 2MH8A 2QNJA 2ZTCA 2ERCA 1WR1B 1V33A 4Z6YA 3GQ4A 1QDTA 1NV9A 1PRBA 2XEPA 1IXSA 4BLCA 5BPVA 4MGKE 2GNOA 2Y0TA 2RKOA 3PXGA 1PJQA 2E5LM 1TDHA 1TTEA 1XC8A 1I94M 4QHTA 3E9SA 4DUZM 2L4FA 2JA2A 1N32M 1JR3E 1TDZA 3QAUA 3CGWA 5H37D 1TGUA 1UM8A 1L8QA 4FCTA 5ITXE 4YY3M 4IBBA 4LF8M 2YNMD 2Z7JA 4UN2B 4DV0M 5ITQA 2XH9A 3J2PB 4EIWA 3KSJA 3QWLA 4A3VB 2R44A 1MJGM 1NNUC 2DVWB 5IREB 3J80S 4DV7M 5EQTA 4MGIE 2XF3A 3WHKA 5KQDA 1VEGA 4JI3M 2LNHC 1EFUB 2F5OA 3LQRA 1EE8A 1HJPA 1P3QQ 2DWZB 3E4RA 3GRRA 3IECA 1OFHA 1IM2A 1TH3A 3RE8A 5DYGA 3L2AA 3M7GA 4JYAM 2APLA 5JI3E 2DZNB 3KVWA 2DZOB 4KT0F 3NBXX 3K92A 3BBZA 4FVMA 4B08A 5L8RF 4G4RA 4MGZE 1HT1E 5FTJA 1HR0M 4LRTA 3AV0A 5ITRA 4LFAM 3ZQJA 2UUAM 4Q7JA 3DFZA 1ZAEA 4GIPA 4JI0M 7CATA 1PJTA 3T1HM 1XMQM 4JI5M 3PNYA 1XWIA 2LBCA 1DGGA 1SXJC 3B7NA 5E26A 1JR3A 4X65M 5LMUM 3FTFA 3U6PA 3B7QA 1QZMA 4XGIA 3T15A 4JI2M 2VF7A 1N33M 1E9SA 5ITXA 2OPFA 1MU5A 2JXNA 2KDLA 4AW4A 4OX9M 2BJWA 4LGYA 3KOYE 4B3MM 3U6MA 1LTMA 2WSFF 1Z5BA 2H5XA 3L27A 5DFLA 3HHXA 2R45A 3GO8A 3HKPA 3AJIB 3J7BA 4P16A 3W0LB 4GH9A 1R6BX 3GLHE 3A98B 1T3TA 5JI2E 2FE8A 4F1IA 3D8BA 3IG5A 3SYLA 4LRSA 4IIWA 1E32A 1FNNA 1H6UA 4RKUF 4MB7A 5IWAM 1VDDA 4ZPXA 1XXHE 1V92A 1AIPC 3A45A 3EIHA 5EXXA 4S12A 2F5SA 3GRYA 1TH2A 3U61A 1ZQ9A 3T6PA 2UXBM 3Q8GA 2KRKA 2EKKA 1OJLA 2GQFA 1Q02A 2XSZA 3I04M 4X64M 3SASA 3JR4A 1PGYA 3W68A 3C3DA 3U6OA 3UJNA 1RU3A 2K6BA 1DGHA 1NNJA 4Z8XA 1IFYA 1GLNA 2LVNC 2QSFX 3HY5A 4XK8F 4DR1M 1K3WA 1SXJD 3HU2A 3HU3A 3SMPA 1WHCA 4R71A 3GPXA 2HCBA 4DUYM 3H4MA 3JAMS 2KRUA 3ZCBB 4CHTB 2G3QA 2YFQA 5KPRA 2C9OA 4GMQA 3FRIA 1J7KA 2I7NA 3FUWA 1YE9A 2DENA 4NSRA 1IQPA 2D7HA 3LCUA 1IN5A 4JN6A 3GRVA 1NY5A 3SC3A 2O5RA 3IG8A 4GRIA 4LF7M 1QAMA 1JB0F 3TWMA 2ZTDA 2J5YA 2I7PA 4DR2M 1OAIA 4WP2A 2Z4RA 1MN3A 3K8ZA 1OIZA 1XXHA 3LVWA 1E94E 3GLGB 1TF0B 3B9PA 3D8LA 5EP3A 1W5SA 4MGHA 1UFZA 3FYCA 2VF8A 3MJ5A 2BNKA 2LVPC 1TH4A 3GLFA 3FE3A 3HJ8A 3GLFB 3KP0E 3E21A 2R4JA 1GKIA 2RRUA 3LCVB 3FTCA 2CWBA 4PDGA 3GLIB 2JUJA 4DBGB 1TR8A 2EA0A 3ZH9B 3F92A 2L09A 2Y0QA 3VKHA 1L2DA 1WGNA 4GITA 3L28A 2Y21A 1R5LA 3CF2A 3HX3A 2VQFM 2D7GA 3SBJA 4GHLA 2WSCF 2BWEA 3Q8XA 5FTLA 2LVAA 5EP2A 1NHGC 2QZ4A 4QNRA 2F5QA 1MX0A 3LMMA 4NOOB 3TWLA 4AG5A 1PM5A 4LG2A 4DR7M 2MJ5B 4M9SA 5FTNA 2G8LA 2AHMA 3SFZA 3L26A 3HHWA 3TQSA 2X4AA 1YUBA 1NY6A 4DR6M 2QPAA 3TWKA 1SG9A 3K9PA 4FWDA 3KOZE 2QCUA 2CHGA 4LY6A 3R8FA 1XNQM 4JI6M 2CHQA 2EO2A 3GRUA 2CP8A 3B7ZA 4FWHA 1G4AE 2ZBKB 3KSXA 3AL0C 4QOSA 2UU9M 4IJEA 4LCBA 4MM3B 3V76A 3GQ3A 1IBKM 5EP4A 4KO8A 2Z3XA 2FH0A 2XZUA 5C18A 2HL7A 2UUBM 2YQZA 1WIVA 3GQ5A 2LVQD 2WZJA 4LJ6A 1HQCA 4G4QA 2XFSA 4LF9M 1QDRA 4JI1M 2CE7A 3VDPA 1DV0A 2R62A 1IY2A 2MR9A 1VQ1A 2JZ1A 2KNZA 2OOBA 3FYDA 4D82A 1YSYA 4HLQA 3I4VA 4RF0A 1KSFX 2DHRA 1GL7A 2C9CA 1HNZM 3U6SA 1N75A 4K0KM 4IBCA 1QVRA 3SARA 1W5TA 2R4EA 1YLAA 5KPZA 2N35A 2QQ8A 3HHYA 3HU1A 1IXZA 4HEOA 4NL4H 1NVMA 2R46A 3FUTA 4IBJA 3MHVC 2XLJA 2MGWA 1G59A 4BB9A 3VLFB 1Z59A 4LJAA 3FD9A 5ITTA 4PDIA 2QP9X 4LF5M 2DHYA 4G6ZA 2O25A 2G5GX 4LZJA 3VFDA 8CATA 4L78A 4AQYM 2R6FA 1IBMM 3I4YA 1IN6A 1IY1A 1JR3D 2L6OA 4HL4A 3U6CA 2FFJA 4R7GA 5C1BA 2F5NA 5ITYA 3SHGB 2EKFA 2YR0A 2EJSA 1F4IA 2QENA 2R18A 3H4JA 3IHPA 3T38A 3UZUA 1KYIA 1N36M 4B3TM 4L15A 2VIIA 2Z4SA 1HT2E 3K1JA 1DGBA 2CFOA 4I4LA 1K82A 5IZ7D 2W82A 3FRHA 2B3TA 3BXWA 2J7OA 3TL4X 5EXTA 4XBOA 4PCZA 1QYRA 3GLGE 3U5ZA 1Q39A 3SHFA 2NQ8C 3U5ZB 4KODA 4DR3M 2DXIA 1FJGM 1Q3CA 3UMMA 1D0LA 3DA1A 4BBAA 4CJ6A 3PNVA 2KNVA 3GLFE 4LGMA 1XMOM 2L2DA 1Z6TA 1Z5CA 2K47A 3GLIE 3A46A 4FW9A 4LJ9A 2L7HA 2XSZD 1G71A 3QYBA 2R65A 2M60A 5DYIA 2DAIA 2X49A 1JQJC 4IBGA 3SAWA 3GPPA 3RGSA 4LFCM 4QOZC 4AG6A 1NJGA 1WXQA 3L25A 2DAKA 2C96A 2HWJA 5IT9S 4JV5M 3HJQA 1QQWA 1SXJA 1G8PA 3A42A 1BVSA 2LVOC 1SXJB 4LJ4A 3NBIA 2JWSA 4NXMM 4GC9A 5KO3A 1IBLM 1XNRM 1GJSA 2DNAA 3GLGA 1IY0A 5ITUA 4IBIA 2RGOA 1NHWC 1OQYA 2JY5A 2KHHA 2QBYB 4CGYB 3C58A 2JY6B 2DWMA 2XZFA 5BR8M 2XGNA 4QHSA 3GLIA 2ZM6M 4IBEA 3T1YM 1OFIA 2ZANA 3LQQA 1T6OA 3KOXE 4G3OA 4B7FA 3C9PA 4G4NA 4LJ8A 4DR5M 1PJJA 1X37A 4GEWA 4M0WA 1R2YA 3U6QA
chains in the Genus database with same CATH topology
1Y8GA 1WIVA 3K9OA 1VG5A 2LVQD 2WZJA 1ZMUA 1DV0A 1OTRA 2MR9A 1VQ1A 2JZ1A 2KNZA 2K0BX 2OOBA 2H5XA 1QZEA 5DFLA 3E46A 2JZ0A 1XB2B 1R4GA 2JP7A 2DKLA 1CUKA 3GLHE 1YLAA 5JI2E 4F1IA 1ZMVA 4HEOA 2MGWA 1XXHE 1V92A 1AIPC 2L4EA 3T6PA 2MROB 1NV8A 2EKKA 2DHYA 1Q02A 2O25A 1PGYA 2OOAA 1ZV1A 2OO9A 1IFYA 2DI0A 2LVNC 2QSFX 1OKSA 2EKFA 2EJSA 1T43A 1ZMWA 4R71A 1F4IA 3IHPA 1WHCA 3H4JA 4F2LA 1KYIA 3MMPA 1WGLA 2DAGA 2G3QA 1HT2E 1G3IA 2JNHA 2JY8A 2LTUA 3FRIA 1A5TA 2DENA 3FRHA 2B3TA 1VEKA 2KNAA 1DO0A 3LCUA 3GLGE 2ZTDA 2R0IA 2QNJA 2ZTCA 1OAIA 4WP2A 1MN3A 1WR1B 1NV9A 2KNVA 1E94E 1IXSA 3GLFE 2L2DA 3GLIE 1UFZA 1TTEA 1C7YA 2LVPC 2L4FA 3FE3A 1JR3E 3E21A 3LCVB 2DAIA 2RRUA 2HAKA 2CWBA 2JUJA 4DBGB 1TR8A 3F92A 2DAKA 4UN2B 2HWJA 2QHOB 1WGNA 1GO5A 1VEGA 1BVSA 2LVOC 1EFUB 1VDLA 2DAMA 1HJPA 2BWEA 1P3QQ 2DAEA 2LVAA 3IECA 1IM2A 2DNAA 2MJ5B 1VEJA 1DO2A 1G41A 1OQYA 2JY7A 2JY5A 2KHHA 3BBZA 2BWBA 1HT1E 1SG9A 3K9PA 2JY6B 2K9DA 4Q7JA 1HQYE 2CP8A 3B89A 1G4AE 1T6OA 4G3OA 2LBCA 1WJ7A 4GEWA 2DZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8G A;  1WIV A;  3K9O A;  1VG5 A;  2LVQ D;  2WZJ A;  1ZMU A;  1DV0 A;  1OTR A;  2MR9 A;  1VQ1 A;  2JZ1 A;  2KNZ A;  2K0B X;  2OOB A;  2H5X A;  1QZE A;  5DFL A;  3E46 A;  2JZ0 A;  1XB2 B;  1R4G A;  2JP7 A;  2DKL A;  1CUK A;  3GLH E;  1YLA A;  5JI2 E;  4F1I A;  1ZMV A;  4HEO A;  2MGW A;  1XXH E;  1V92 A;  1AIP C;  2L4E A;  3T6P A;  2MRO B;  1NV8 A;  2EKK A;  2DHY A;  1Q02 A;  2O25 A;  1PGY A;  2OOA A;  1ZV1 A;  2OO9 A;  1IFY A;  2DI0 A;  2LVN C;  2QSF X;  1OKS A;  2EKF A;  2EJS A;  1T43 A;  1ZMW A;  4R71 A;  1F4I A;  3IHP A;  1WHC A;  3H4J A;  4F2L A;  1KYI A;  3MMP A;  1WGL A;  2DAG A;  2G3Q A;  1HT2 E;  1G3I A;  2JNH A;  2JY8 A;  2LTU A;  3FRI A;  1A5T A;  2DEN A;  3FRH A;  2B3T A;  1VEK A;  2KNA A;  1DO0 A;  3LCU A;  3GLG E;  2ZTD A;  2R0I A;  2QNJ A;  2ZTC A;  1OAI A;  4WP2 A;  1MN3 A;  1WR1 B;  1NV9 A;  2KNV A;  1E94 E;  1IXS A;  3GLF E;  2L2D A;  3GLI E;  1UFZ A;  1TTE A;  1C7Y A;  2LVP C;  2L4F A;  3FE3 A;  1JR3 E;  3E21 A;  3LCV B;  2DAI A;  2RRU A;  2HAK A;  2CWB A;  2JUJ A;  4DBG B;  1TR8 A;  3F92 A;  2DAK A;  4UN2 B;  2HWJ A;  2QHO B;  1WGN A;  1GO5 A;  1VEG A;  1BVS A;  2LVO C;  1EFU B;  1VDL A;  2DAM A;  1HJP A;  2BWE A;  1P3Q Q;  2DAE A;  2LVA A;  3IEC A;  1IM2 A;  2DNA A;  2MJ5 B;  1VEJ A;  1DO2 A;  1G41 A;  1OQY A;  2JY7 A;  2JY5 A;  2KHH A;  3BBZ A;  2BWB A;  1HT1 E;  1SG9 A;  3K9P A;  2JY6 B;  2K9D A;  4Q7J A;  1HQY E;  2CP8 A;  3B89 A;  1G4A E;  1T6O A;  4G3O A;  2LBC A;  1WJ7 A;  4GEW A;  2DZL A; 
#chains in the Genus database with same CATH topology
 3UK6 A;  4LFB M;  2V1U A;  4I8O A;  4FCV A;  4GC5 A;  4II7 A;  1R2Z A;  3K9O A;  1VG5 A;  4RF1 A;  3ZC7 B;  2ZAM A;  4MGY E;  5KPT A;  3FUU A;  1OTR A;  2K0B X;  3JR5 A;  1QZE A;  1D0K A;  2CEA A;  2FNA A;  3B74 A;  2LHC A;  4DV3 M;  1XB2 B;  1R4G A;  4FCW A;  2JP7 A;  4M9Z A;  1CUK A;  4WUR A;  1N78 A;  4CIZ A;  4L4U A;  1ZMV A;  3FTD A;  3KFU G;  5FTM A;  1GVN A;  2XFT A;  3KS4 A;  4DV1 M;  3R9X B;  4IJF A;  4RNA A;  4AKH A;  2WSE F;  5EJC A;  4NC6 A;  4DR4 M;  1AUA A;  3KS8 A;  4AKG A;  1NV8 A;  3U60 B;  1R7R A;  4X62 M;  3FKE A;  3MK6 A;  1ZV1 A;  4QNM A;  4JI4 M;  1J09 A;  5F3W A;  2DI0 A;  1QUT A;  3PFI A;  3KP1 E;  1IXS B;  3THG A;  2X8A A;  1GL6 A;  3KDS E;  4B3S M;  4I5S A;  4JI7 M;  4GKK M;  1ZMW A;  4F2L A;  4FWG A;  4B3R M;  1PJS A;  3AOE A;  2DWN A;  3W67 A;  1WGL A;  4GHA A;  2JY8 A;  1G3I A;  2JNH A;  5FSW A;  1NJF A;  5EP1 A;  1IN7 A;  2KW0 A;  1GAB A;  3UGJ A;  3QYE A;  2A5Y B;  4Y28 F;  2CV2 A;  3GPY A;  2H1R A;  4WW0 A;  1I4W A;  3J81 S;  2LXE A;  4B7G A;  1QAQ A;  2J7N A;  3AFH A;  2F5P A;  3LW5 F;  3C3E A;  3SMS A;  2CRU A;  5EXS A;  4DV2 M;  3VK8 A;  3HWS A;  3KOW E;  1L2C A;  1OAO C;  2D7E A;  3EIE A;  3ILK A;  3FUX A;  1C7Y A;  2CV0 A;  4L8R C;  2KEB A;  4I81 A;  4DV6 M;  4PT5 A;  2HAK A;  2CV1 A;  4NXN M;  3K2L A;  4M0D A;  1SXJ E;  2KA6 B;  3AOG A;  3RFW A;  3WHL A;  4IBK A;  3U6E A;  2QHO B;  4D81 A;  3SAV A;  1GO5 A;  2VDB B;  3HJS A;  2DAM A;  1VDL A;  4JI8 M;  4AI6 A;  4R3D A;  4NSO B;  1HNX M;  3PVS A;  1QAO A;  2HKJ A;  2DAE A;  2M5Z A;  1N34 M;  3KW6 A;  2VQE M;  4ANR A;  2LWX A;  4LF6 M;  1OIP A;  1ORY B;  1VEJ A;  2KZS A;  1DO2 A;  5DNY A;  3HHZ A;  4L16 A;  1G41 A;  3M6A A;  2JY7 A;  4YHH M;  4LF4 M;  1QUS A;  2BWB A;  4NRV A;  4B7H A;  1D2N A;  3DZD A;  4M9X A;  5EXP A;  2DWL A;  3SAT A;  2UXC M;  2UXD M;  2FS1 A;  2K9D A;  3LVV A;  2LHG A;  1HQY E;  2O01 F;  4LJ5 A;  3HZJ A;  2UUC M;  3B89 A;  2Y20 A;  1V34 A;  3DOA A;  3TPZ A;  3CF0 A;  4DV5 M;  1WJ7 A;  1IXR C;  4OW0 A;  2DZL A;  2CHV A;  4X66 M;  2Q2E B;  4REZ A;  1Y8G A;  3U61 B;  2C5R A;  3GPU A;  3I01 M;  3FUV A;  4FD2 A;  1J5E M;  1ZMU A;  4KHP M;  1L1T A;  2ZAO A;  5GKN A;  4AKI A;  1D0M A;  1IN8 A;  1DGH B;  1Z5A A;  1L2B A;  5E6J A;  3E46 A;  2JZ0 A;  4PD2 A;  4AZF A;  2DKL A;  3CTW B;  3BOS A;  3CF6 E;  2QBY A;  4LJ7 A;  3VDU A;  4TUW A;  1IN4 A;  2C99 A;  4L6V 6;  1S3S A;  3RGP A;  4W5W A;  2RGH A;  2Z8Y M;  1Q3B A;  3W0F A;  2HHH M;  2V1C A;  3GLH A;  3NWL A;  2KZU A;  3U6D A;  4LZZ A;  3GLH B;  5A2Q S;  1L1Z A;  5LMN M;  3TE6 A;  4IBD A;  3I51 A;  4GKJ M;  3FTE A;  1NO1 A;  2L4E A;  4CIS A;  2MRO B;  3VK7 A;  4OU7 A;  2OQ4 A;  1QAN A;  5FLX S;  3U6L A;  2OOA A;  2OO9 A;  1XXH B;  3M0E A;  4JXJ A;  3GP1 A;  1PJI A;  2P5T A;  3SYK A;  3VKG A;  3AOE C;  4NRW A;  1OKS A;  4P17 A;  4ITQ A;  1T43 A;  3AKZ A;  1XHB A;  1EIJ A;  2CUZ A;  4MH0 E;  4OVZ A;  4G4O A;  1GJT A;  3MMP A;  2EUC A;  4OVZ B;  1K3X A;  2DAG A;  1E9R A;  5KQ8 A;  2C98 A;  1NSF A;  2L7I A;  4D80 A;  2LTU A;  3L29 A;  1A5T A;  3SAU A;  2V6Z M;  3OTO M;  1N77 A;  1HNW M;  3J7A S;  4IBF A;  1C1K A;  1VEK A;  1DO0 A;  2KNA A;  4KLN A;  2FOI C;  3HGI A;  3J27 B;  2LH0 A;  4DV4 M;  1KFV A;  3KXE C;  1DGF A;  5FTK A;  2KXE A;  2F4V M;  2BJV A;  3U60 A;  1LV7 A;  2R0I A;  2MH8 A;  2QNJ A;  2ZTC A;  2ERC A;  1WR1 B;  1V33 A;  4Z6Y A;  3GQ4 A;  1QDT A;  1NV9 A;  1PRB A;  2XEP A;  1IXS A;  4BLC A;  5BPV A;  4MGK E;  2GNO A;  2Y0T A;  2RKO A;  3PXG A;  1PJQ A;  2E5L M;  1TDH A;  1TTE A;  1XC8 A;  1I94 M;  4QHT A;  3E9S A;  4DUZ M;  2L4F A;  2JA2 A;  1N32 M;  1JR3 E;  1TDZ A;  3QAU A;  3CGW A;  5H37 D;  1TGU A;  1UM8 A;  1L8Q A;  4FCT A;  5ITX E;  4YY3 M;  4IBB A;  4LF8 M;  2YNM D;  2Z7J A;  4UN2 B;  4DV0 M;  5ITQ A;  2XH9 A;  3J2P B;  4EIW A;  3KSJ A;  3QWL A;  4A3V B;  2R44 A;  1MJG M;  1NNU C;  2DVW B;  5IRE B;  3J80 S;  4DV7 M;  5EQT A;  4MGI E;  2XF3 A;  3WHK A;  5KQD A;  1VEG A;  4JI3 M;  2LNH C;  1EFU B;  2F5O A;  3LQR A;  1EE8 A;  1HJP A;  1P3Q Q;  2DWZ B;  3E4R A;  3GRR A;  3IEC A;  1OFH A;  1IM2 A;  1TH3 A;  3RE8 A;  5DYG A;  3L2A A;  3M7G A;  4JYA M;  2APL A;  5JI3 E;  2DZN B;  3KVW A;  2DZO B;  4KT0 F;  3NBX X;  3K92 A;  3BBZ A;  4FVM A;  4B08 A;  5L8R F;  4G4R A;  4MGZ E;  1HT1 E;  5FTJ A;  1HR0 M;  4LRT A;  3AV0 A;  5ITR A;  4LFA M;  3ZQJ A;  2UUA M;  4Q7J A;  3DFZ A;  1ZAE A;  4GIP A;  4JI0 M;  7CAT A;  1PJT A;  3T1H M;  1XMQ M;  4JI5 M;  3PNY A;  1XWI A;  2LBC A;  1DGG A;  1SXJ C;  3B7N A;  5E26 A;  1JR3 A;  4X65 M;  5LMU M;  3FTF A;  3U6P A;  3B7Q A;  1QZM A;  4XGI A;  3T15 A;  4JI2 M;  2VF7 A;  1N33 M;  1E9S A;  5ITX A;  2OPF A;  1MU5 A;  2JXN A;  2KDL A;  4AW4 A;  4OX9 M;  2BJW A;  4LGY A;  3KOY E;  4B3M M;  3U6M A;  1LTM A;  2WSF F;  1Z5B A;  2H5X A;  3L27 A;  5DFL A;  3HHX A;  2R45 A;  3GO8 A;  3HKP A;  3AJI B;  3J7B A;  4P16 A;  3W0L B;  4GH9 A;  1R6B X;  3GLH E;  3A98 B;  1T3T A;  5JI2 E;  2FE8 A;  4F1I A;  3D8B A;  3IG5 A;  3SYL A;  4LRS A;  4IIW A;  1E32 A;  1FNN A;  1H6U A;  4RKU F;  4MB7 A;  5IWA M;  1VDD A;  4ZPX A;  1XXH E;  1V92 A;  1AIP C;  3A45 A;  3EIH A;  5EXX A;  4S12 A;  2F5S A;  3GRY A;  1TH2 A;  3U61 A;  1ZQ9 A;  3T6P A;  2UXB M;  3Q8G A;  2KRK A;  2EKK A;  1OJL A;  2GQF A;  1Q02 A;  2XSZ A;  3I04 M;  4X64 M;  3SAS A;  3JR4 A;  1PGY A;  3W68 A;  3C3D A;  3U6O A;  3UJN A;  1RU3 A;  2K6B A;  1DGH A;  1NNJ A;  4Z8X A;  1IFY A;  1GLN A;  2LVN C;  2QSF X;  3HY5 A;  4XK8 F;  4DR1 M;  1K3W A;  1SXJ D;  3HU2 A;  3HU3 A;  3SMP A;  1WHC A;  4R71 A;  3GPX A;  2HCB A;  4DUY M;  3H4M A;  3JAM S;  2KRU A;  3ZCB B;  4CHT B;  2G3Q A;  2YFQ A;  5KPR A;  2C9O A;  4GMQ A;  3FRI A;  1J7K A;  2I7N A;  3FUW A;  1YE9 A;  2DEN A;  4NSR A;  1IQP A;  2D7H A;  3LCU A;  1IN5 A;  4JN6 A;  3GRV A;  1NY5 A;  3SC3 A;  2O5R A;  3IG8 A;  4GRI A;  4LF7 M;  1QAM A;  1JB0 F;  3TWM A;  2ZTD A;  2J5Y A;  2I7P A;  4DR2 M;  1OAI A;  4WP2 A;  2Z4R A;  1MN3 A;  3K8Z A;  1OIZ A;  1XXH A;  3LVW A;  1E94 E;  3GLG B;  1TF0 B;  3B9P A;  3D8L A;  5EP3 A;  1W5S A;  4MGH A;  1UFZ A;  3FYC A;  2VF8 A;  3MJ5 A;  2BNK A;  2LVP C;  1TH4 A;  3GLF A;  3FE3 A;  3HJ8 A;  3GLF B;  3KP0 E;  3E21 A;  2R4J A;  1GKI A;  2RRU A;  3LCV B;  3FTC A;  2CWB A;  4PDG A;  3GLI B;  2JUJ A;  4DBG B;  1TR8 A;  2EA0 A;  3ZH9 B;  3F92 A;  2L09 A;  2Y0Q A;  3VKH A;  1L2D A;  1WGN A;  4GIT A;  3L28 A;  2Y21 A;  1R5L A;  3CF2 A;  3HX3 A;  2VQF M;  2D7G A;  3SBJ A;  4GHL A;  2WSC F;  2BWE A;  3Q8X A;  5FTL A;  2LVA A;  5EP2 A;  1NHG C;  2QZ4 A;  4QNR A;  2F5Q A;  1MX0 A;  3LMM A;  4NOO B;  3TWL A;  4AG5 A;  1PM5 A;  4LG2 A;  4DR7 M;  2MJ5 B;  4M9S A;  5FTN A;  2G8L A;  2AHM A;  3SFZ A;  3L26 A;  3HHW A;  3TQS A;  2X4A A;  1YUB A;  1NY6 A;  4DR6 M;  2QPA A;  3TWK A;  1SG9 A;  3K9P A;  4FWD A;  3KOZ E;  2QCU A;  2CHG A;  4LY6 A;  3R8F A;  1XNQ M;  4JI6 M;  2CHQ A;  2EO2 A;  3GRU A;  2CP8 A;  3B7Z A;  4FWH A;  1G4A E;  2ZBK B;  3KSX A;  3AL0 C;  4QOS A;  2UU9 M;  4IJE A;  4LCB A;  4MM3 B;  3V76 A;  3GQ3 A;  1IBK M;  5EP4 A;  4KO8 A;  2Z3X A;  2FH0 A;  2XZU A;  5C18 A;  2HL7 A;  2UUB M;  2YQZ A;  1WIV A;  3GQ5 A;  2LVQ D;  2WZJ A;  4LJ6 A;  1HQC A;  4G4Q A;  2XFS A;  4LF9 M;  1QDR A;  4JI1 M;  2CE7 A;  3VDP A;  1DV0 A;  2R62 A;  1IY2 A;  2MR9 A;  1VQ1 A;  2JZ1 A;  2KNZ A;  2OOB A;  3FYD A;  4D82 A;  1YSY A;  4HLQ A;  3I4V A;  4RF0 A;  1KSF X;  2DHR A;  1GL7 A;  2C9C A;  1HNZ M;  3U6S A;  1N75 A;  4K0K M;  4IBC A;  1QVR A;  3SAR A;  1W5T A;  2R4E A;  1YLA A;  5KPZ A;  2N35 A;  2QQ8 A;  3HHY A;  3HU1 A;  1IXZ A;  4HEO A;  4NL4 H;  1NVM A;  2R46 A;  3FUT A;  4IBJ A;  3MHV C;  2XLJ A;  2MGW A;  1G59 A;  4BB9 A;  3VLF B;  1Z59 A;  4LJA A;  3FD9 A;  5ITT A;  4PDI A;  2QP9 X;  4LF5 M;  2DHY A;  4G6Z A;  2O25 A;  2G5G X;  4LZJ A;  3VFD A;  8CAT A;  4L78 A;  4AQY M;  2R6F A;  1IBM M;  3I4Y A;  1IN6 A;  1IY1 A;  1JR3 D;  2L6O A;  4HL4 A;  3U6C A;  2FFJ A;  4R7G A;  5C1B A;  2F5N A;  5ITY A;  3SHG B;  2EKF A;  2YR0 A;  2EJS A;  1F4I A;  2QEN A;  2R18 A;  3H4J A;  3IHP A;  3T38 A;  3UZU A;  1KYI A;  1N36 M;  4B3T M;  4L15 A;  2VII A;  2Z4S A;  1HT2 E;  3K1J A;  1DGB A;  2CFO A;  4I4L A;  1K82 A;  5IZ7 D;  2W82 A;  3FRH A;  2B3T A;  3BXW A;  2J7O A;  3TL4 X;  5EXT A;  4XBO A;  4PCZ A;  1QYR A;  3GLG E;  3U5Z A;  1Q39 A;  3SHF A;  2NQ8 C;  3U5Z B;  4KOD A;  4DR3 M;  2DXI A;  1FJG M;  1Q3C A;  3UMM A;  1D0L A;  3DA1 A;  4BBA A;  4CJ6 A;  3PNV A;  2KNV A;  3GLF E;  4LGM A;  1XMO M;  2L2D A;  1Z6T A;  1Z5C A;  2K47 A;  3GLI E;  3A46 A;  4FW9 A;  4LJ9 A;  2L7H A;  2XSZ D;  1G71 A;  3QYB A;  2R65 A;  2M60 A;  5DYI A;  2DAI A;  2X49 A;  1JQJ C;  4IBG A;  3SAW A;  3GPP A;  3RGS A;  4LFC M;  4QOZ C;  4AG6 A;  1NJG A;  1WXQ A;  3L25 A;  2DAK A;  2C96 A;  2HWJ A;  5IT9 S;  4JV5 M;  3HJQ A;  1QQW A;  1SXJ A;  1G8P A;  3A42 A;  1BVS A;  2LVO C;  1SXJ B;  4LJ4 A;  3NBI A;  2JWS A;  4NXM M;  4GC9 A;  5KO3 A;  1IBL M;  1XNR M;  1GJS A;  2DNA A;  3GLG A;  1IY0 A;  5ITU A;  4IBI A;  2RGO A;  1NHW C;  1OQY A;  2JY5 A;  2KHH A;  2QBY B;  4CGY B;  3C58 A;  2JY6 B;  2DWM A;  2XZF A;  5BR8 M;  2XGN A;  4QHS A;  3GLI A;  2ZM6 M;  4IBE A;  3T1Y M;  1OFI A;  2ZAN A;  3LQQ A;  1T6O A;  3KOX E;  4G3O A;  4B7F A;  3C9P A;  4G4N A;  4LJ8 A;  4DR5 M;  1PJJ A;  1X37 A;  4GEW A;  4M0W A;  1R2Y A;  3U6Q A; 
#chains in the Genus database with same CATH homology
 1Y8G A;  1WIV A;  3K9O A;  1VG5 A;  2LVQ D;  2WZJ A;  1ZMU A;  1DV0 A;  1OTR A;  2MR9 A;  1VQ1 A;  2JZ1 A;  2KNZ A;  2K0B X;  2OOB A;  2H5X A;  1QZE A;  5DFL A;  3E46 A;  2JZ0 A;  1XB2 B;  1R4G A;  2JP7 A;  2DKL A;  1CUK A;  3GLH E;  1YLA A;  5JI2 E;  4F1I A;  1ZMV A;  4HEO A;  2MGW A;  1XXH E;  1V92 A;  1AIP C;  2L4E A;  3T6P A;  2MRO B;  1NV8 A;  2EKK A;  2DHY A;  1Q02 A;  2O25 A;  1PGY A;  2OOA A;  1ZV1 A;  2OO9 A;  1IFY A;  2DI0 A;  2LVN C;  2QSF X;  1OKS A;  2EKF A;  2EJS A;  1T43 A;  1ZMW A;  4R71 A;  1F4I A;  3IHP A;  1WHC A;  3H4J A;  4F2L A;  1KYI A;  3MMP A;  1WGL A;  2DAG A;  2G3Q A;  1HT2 E;  1G3I A;  2JNH A;  2JY8 A;  2LTU A;  3FRI A;  1A5T A;  2DEN A;  3FRH A;  2B3T A;  1VEK A;  2KNA A;  1DO0 A;  3LCU A;  3GLG E;  2ZTD A;  2R0I A;  2QNJ A;  2ZTC A;  1OAI A;  4WP2 A;  1MN3 A;  1WR1 B;  1NV9 A;  2KNV A;  1E94 E;  1IXS A;  3GLF E;  2L2D A;  3GLI E;  1UFZ A;  1TTE A;  1C7Y A;  2LVP C;  2L4F A;  3FE3 A;  1JR3 E;  3E21 A;  3LCV B;  2DAI A;  2RRU A;  2HAK A;  2CWB A;  2JUJ A;  4DBG B;  1TR8 A;  3F92 A;  2DAK A;  4UN2 B;  2HWJ A;  2QHO B;  1WGN A;  1GO5 A;  1VEG A;  1BVS A;  2LVO C;  1EFU B;  1VDL A;  2DAM A;  1HJP A;  2BWE A;  1P3Q Q;  2DAE A;  2LVA A;  3IEC A;  1IM2 A;  2DNA A;  2MJ5 B;  1VEJ A;  1DO2 A;  1G41 A;  1OQY A;  2JY7 A;  2JY5 A;  2KHH A;  3BBZ A;  2BWB A;  1HT1 E;  1SG9 A;  3K9P A;  2JY6 B;  2K9D A;  4Q7J A;  1HQY E;  2CP8 A;  3B89 A;  1G4A E;  1T6O A;  4G3O A;  2LBC A;  1WJ7 A;  4GEW A;  2DZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...