1WGNA

Solution structure of uba domain of human ubiquitin associated protein 1 (ubap1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
GSSGSSGAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENIEQILDYLFAHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of UBA domain of Human Ubiquitin Associated Protein 1 (UBAP1)
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords ubiquitin associated protein
total genus 13
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wgnA00
3FE3A 2JP7A 1OQYA 3GLHE 3GLFE 1NV9A 1WGNA 2DNAA 2OOBA 3F92A 4G3OA 1SG9A 3GLIE 2BWEA 3E21A 1TR8A 5JI2E 2B3TA 2DI0A 1OTRA 1WJ7A 2KNVA 3E46A 2K9DA 2WZJA 1VG5A 3MMPA 2ZTDA 3K9PA 2EKKA 2JY5A 1IXSA 1TTEA 3FRIA 3T6PA 2OOAA 2KHHA 1NV8A 2DAIA 4F2LA 1DV0A 1OAIA 1DO0A 1WIVA 1ZMVA 2JZ1A 2CWBA 4F1IA 2DAGA 2QHOB 2CP8A 2L2DA 1IFYA 2JZ0A 2QSFX 3IHPA 1GO5A 2ZTCA 1WGLA 1BVSA 1G3IA 3B89A 2H5XA 2HAKA 1C7YA 2QNJA 1T6OA 1QZEA 2DENA 1P3QQ 2R0IA 2LVNC 2RRUA 1VDLA 2MR9A 2EKFA 1VEGA 2L4EA 1UFZA 1JR3E 2DAMA 1KYIA 1A5TA 3K9OA 1AIPC 2DKLA 4Q7JA 1V92A 3LCVB 1F4IA 2JNHA 3BBZA 2JUJA 2KNAA 1Y8GA 2LBCA 2G3QA 1E94E 1CUKA 1ZMWA 2O25A 3FRHA 3LCUA 4GEWA 2DAKA 2MROB 1G4AE 2JY7A 2KNZA 1HJPA 2K0BX 2LVQD 1HT2E 2JY6B 1VEKA 4UN2B 1T43A 1HQYE 1Q02A 1IM2A 5DFLA 2DHYA 1ZMUA 1WR1B 2DAEA 3IECA 1R4GA 4WP2A 2MGWA 1YLAA 1WHCA 3H4JA 1XXHE 4DBGB 1EFUB 4HEOA 1VEJA 2DZLA 2HWJA 2OO9A 1XB2B 1ZV1A 1PGYA 1DO2A 2BWBA 2EJSA 4R71A 1OKSA 2LTUA 1HT1E 1VQ1A 2L4FA 2LVOC 1G41A 2LVPC 2MJ5B 3GLGE 1MN3A 2JY8A 2LVAA
chains in the Genus database with same CATH superfamily
2JP7A 3CTWB 2UXBM 2XFTA 2CEAA 2ERCA 2VDBB 5C18A 3JAMS 1MU5A 2WSCF 1GVNA 4II7A 3LQQA 1XMOM 1WGNA 4CJ6A 2LXEA 2F5PA 3HJSA 1E9SA 2BJVA 3J81S 4G3OA 1HR0M 8CATA 4DR7M 1SG9A 4REZA 3U6CA 2CHGA 3R9XB 2XGNA 2KZSA 4DV2M 3SC3A 4R7GA 2DI0A 4LJ9A 2G5GX 1VG5A 3AFHA 1N36M 3T38A 2Y21A 3UGJA 4D80A 2EA0A 1SXJE 3B7NA 1ORYB 4HL4A 4OVZB 2QCUA 3UMMA 2H1RA 5FTJA 2KHHA 3W67A 3SYLA 5FSWA 1PJSA 2W82A 2C98A 4B7FA 1IXZA 1OAIA 5ITRA 2QBYB 1DGGA 2JZ1A 4F1IA 3DA1A 2DAGA 1XC8A 2CP8A 2FE8A 1N33M 2JZ0A 2QSFX 2EO2A 2ZTCA 2EUCA 1PJJA 1HNZM 4CGYB 1BVSA 2CRUA 3UZUA 4AI6A 2WSEF 3I01M 2CV2A 3SYKA 1IN7A 4WURA 4RF1A 1GL6A 2R0IA 5ITXA 2OQ4A 3VK7A 2ZBKB 2LVNC 2APLA 3ZCBB 2MR9A 2EKFA 4IBGA 1VEGA 1IXRC 1SXJD 4L6V6 2OPFA 4DR1M 3BOSA 3H4MA 3C3EA 3HKPA 2VF8A 3K9OA 2JXNA 4GKKM 1QDTA 4LRSA 4QHSA 4Q7JA 1JQJC 1D0LA 3GPXA 1V92A 4KT0F 2R65A 1G59A 4ANRA 2QBYA 4L78A 2F4VM 1F4IA 4XBOA 1HQCA 3WHLA 4LRTA 2O25A 4CISA 3L29A 4I4LA 2J7OA 2DWMA 2DAKA 1XWIA 1R7RA 2DWNA 1L2BA 1HJPA 4DV4M 2YQZA 2ZM6M 3VKGA 1QAQA 3J80S 1HT2E 3TL4X 3J7BA 4PDGA 3GO8A 3QWLA 1VEKA 4KHPM 1NNUC 2R45A 1T43A 1NVMA 1OFIA 1WXQA 4LY6A 3RGPA 4GC5A 1R2ZA 2K6BA 3QYEA 2JWSA 1ZMUA 2DWLA 1QANA 3MHVC 1Z5AA 4B7HA 3PNVA 4R3DA 4AZFA 4GH9A 2XSZA 2XLJA 4NXNM 3DOAA 1EFUB 2K47A 1OFHA 2CE7A 3GQ5A 1PM5A 4LCBA 2DZOB 4FWGA 1PGYA 3A46A 2CV0A 3TPZA 4R71A 5EXTA 2LTUA 2N35A 1HT1E 2KZUA 2I7PA 1T3TA 3T15A 2MJ5B 3AOEA 3LMMA 4JN6A 4QNMA 4NL4H 3TE6A 1K3XA 3SASA 3U6EA 3I51A 3FE3A 3W0FA 4QHTA 1NJFA 1ZQ9A 2DZNB 2A5YB 5ITQA 4JI6M 1V34A 4KO8A 4D82A 3U61B 5JI3E 1IY2A 3VDUA 2BJWA 4QNRA 1TDZA 4D81A 1Z5BA 2I7NA 2KRKA 7CATA 1QYRA 3FUTA 5IT9S 3GLIA 3F92A 4DR2M 1OJLA 3HJQA 3FTCA 4XK8F 4FCVA 1GABA 2ZAMA 3CF6E 3HJ8A 3GLIE 1TR8A 1D2NA 5JI2E 4TUWA 2ZANA 4M9SA 1OTRA 4P16A 3EIEA 2C96A 3E46A 4I81A 3SFZA 3HZJA 3FTFA 3AV0A 3U60A 3LW5F 4MGIE 4AKIA 3OTOM 3K9PA 3Q8XA 2EKKA 1QAOA 1VDDA 5KPTA 1XXHA 4RF0A 1IXSA 2XF3A 3NBIA 4JI4M 3FRIA 4GIPA 3U6QA 4YY3M 1SXJB 3Q8GA 1V33A 2OOAA 3SATA 1RU3A 1FNNA 5FLXS 2DAIA 3C9PA 3BXWA 1DV0A 2VQEM 1J5EM 1TDHA 1WIVA 1ZMVA 5ITYA 1IY0A 3FUUA 2QHOB 4HLQA 3GLFA 3KOYE 2UUAM 2VQFM 2R4EA 3LQRA 4G4QA 1GO5A 1WGLA 1X37A 3KW6A 4DR5M 2WSFF 5KPRA 3U6DA 1NNJA 3HHWA 1MJGM 2QNJA 1T6OA 2DWZB 3GRRA 4KLNA 5EXXA 4DR3M 4LF7M 3TWMA 1EIJA 4LJ5A 2R6FA 3M6AA 4GRIA 3KDSE 4AG6A 2KRUA 3FYDA 3KOXE 4G4OA 1I4WA 1VDLA 1Q3BA 1QUSA 1S3SA 4DV6M 3J7AS 1AUAA 4BB9A 4GMQA 1JR3E 2FH0A 1DGFA 4RNAA 1AIPC 4IBJA 4LFAM 5EQTA 3NBXX 1TF0B 1NSFA 3FUXA 4GC9A 3GLHB 2G3QA 1ZAEA 3PXGA 3SHGB 3GLFB 1XNQM 2L7IA 3FUVA 2DXIA 3RE8A 1IN6A 1SXJA 1MX0A 4B3SM 3PFIA 2YFQA 3HWSA 1R2YA 4LF6M 2M60A 1NY5A 3I4YA 3TWLA 5L8RF 4L16A 3THGA 1PJIA 4B7GA 1E9RA 4UN2B 1DGBA 3RFWA 4IBKA 1HQYE 1JR3D 1N34M 3T1HM 2D7EA 3FUWA 2KEBA 4OU7A 2DHYA 4OW0A 5DYGA 4Y28F 1I94M 3C58A 3KS8A 3KP1E 3IG8A 3VDPA 2DAEA 1R4GA 3B7QA 3CF0A 3U6LA 3D8BA 5FTMA 3VFDA 1J7KA 2D7GA 1TH3A 4IBIA 3GP1A 3L25A 1L8QA 1YLAA 1WHCA 3U60B 2DVWB 2L6OA 3SAVA 3H4JA 1XXHE 5IZ7D 4DBGB 2NQ8C 4ITQA 2HWJA 4DV7M 4L8RC 1K82A 1YUBA 3SMSA 4LJ7A 4JXJA 1ZV1A 1OIPA 1TGUA 1DGHA 2D7HA 5E26A 1DO2A 2L09A 2LH0A 3FKEA 2XH9A 2EJSA 4DR4M 2R46A 2LVPC 1OKSA 2L4FA 2LVOC 3JR4A 3K8ZA 5BR8M 3L28A 1GJTA 3J27B 2HHHM 2F5QA 5KPZA 4FW9A 4IJEA 4M0DA 2C9OA 4LGMA 1OQYA 2Y0QA 4LZZA 3K1JA 3AL0C 3GPUA 3KFUG 1XMQM 2CV1A 1L2DA 1NV9A 3TQSA 4IBDA 1IQPA 2DNAA 3QAUA 1W5SA 3I4VA 1EE8A 1NY6A 2VIIA 1LV7A 2CHQA 1D0KA 2Z4SA 2QP9X 2UUBM 4X64M 2F5OA 4IBCA 3MJ5A 2BWEA 1Q3CA 3E21A 3J2PB 3L2AA 5FTLA 5BPVA 3AJIB 4G4RA 4B3TM 3U6SA 4DR6M 3W0LB 2KNVA 1G8PA 2KW0A 2K9DA 4B3MM 3MMPA 2ZTDA 4NSOB 3SHFA 2XZUA 4PD2A 4YHHM 5EXSA 4LJAA 3U6OA 1NHWC 3HU1A 4A3VB 3B7ZA 5DYIA 3ILKA 3PVSA 5EXPA 3HHXA 3KVWA 1QAMA 2QENA 1PJTA 4JI8M 4AKHA 4F2LA 3KSXA 1DO0A 4DUZM 4MGKE 2XZFA 4DV0M 4DV1M 3FYCA 4LFBM 2X8AA 1IFYA 3IHPA 3U61A 3A42A 3U6MA 5FTKA 4LJ8A 3U5ZB 1R6BX 2BNKA 4JI0M 1G3IA 4I8OA 2FNAA 4NC6A 2H5XA 2HAKA 4MGHA 1C7YA 3QYBA 4IJFA 2XEPA 5KQDA 2F5NA 1P3QQ 2KDLA 3GQ4A 5ITTA 4JI2M 1C1KA 2RRUA 1Z6TA 2E5LM 4X65M 2GQFA 4LF9M 2L4EA 3M0EA 3AKZA 3DZDA 2DAMA 1KYIA 4LF5M 2DHRA 4NOOB 2G8LA 3E4RA 2FFJA 4L15A 2C5RA 2CFOA 4PDIA 2RGOA 2LBCA 2JUJA 2KNAA 1Y8GA 2RKOA 1E94E 1ZMWA 4GEWA 3VK8A 2FOIC 3SBJA 3K92A 5ITXE 2AHMA 2MROB 1TH2A 5ITUA 3AOEC 2HKJA 1DGHB 1NO1A 1QDRA 2K0BX 4AW4A 3GRVA 4BBAA 2LVQD 4LJ6A 1N32M 3LVVA 4LF4M 4DUYM 5IREB 4RKUF 2UUCM 3EIHA 1R5LA 1W5TA 3D8LA 2HL7A 3CF2A 1L1TA 3WHKA 1XNRM 4X66M 1Q02A 4X62M 4MH0E 2XSZD 3L27A 5E6JA 5DFLA 2QPAA 3U5ZA 1WR1B 3SARA 5DNYA 1NJGA 3E9SA 1UM8A 4XGIA 4Z6YA 4GKJM 1G71A 2Z8YM 4M9ZA 3ZC7B 1JR3A 3KSJA 5EP2A 1GKIA 2R62A 3IG5A 3GLHA 4WW0A 3ZQJA 4PCZA 4G4NA 5GKNA 4P17A 1XXHB 5EP3A 4DV5M 2O01F 1XB2B 1PRBA 4FCWA 2UXCM 1GJSA 2L7HA 3GLGE 5F3WA 4NXMM 2Z7JA 4L4UA 4M0WA 2JY8A 1IBKM 4MGYE 2LVAA 1IXSB 4AG5A 1GL7A 3V76A 3PNYA 4M9XA 3GRYA 3GLHE 2X49A 3A45A 3UJNA 5IWAM 3GLFE 4GITA 2XFSA 4AQYM 3FD9A 2OOBA 3U6PA 4IBBA 4DV3M 2UXDM 4FWHA 4I5SA 2M5ZA 3GPPA 3MK6A 1OIZA 2LHCA 4CIZA 2LHGA 3CGWA 3UK6A 2B3TA 2R18A 1KFVA 1WJ7A 5EP4A 1N77A 3HHZA 3SMPA 1L2CA 2WZJA 1XHBA 2Z4RA 3FTEA 3DFZA 4KODA 4FVMA 3TWKA 3VLFB 5EP1A 1N75A 3HGIA 3K2LA 3L26A 2JY5A 3VKHA 1IN8A 1QZMA 3GLGA 3R8FA 2R4JA 1TTEA 2CUZA 1IBMM 4FD2A 2R44A 3I04M 3M7GA 3T6PA 4BLCA 1NV8A 2FS1A 3HU3A 4MB7A 3HY5A 4JI3M 1QQWA 2J5YA 2J7NA 2V6ZM 5KO3A 1FJGM 4JYAM 3RGSA 2CWBA 3GLIB 4W5WA 2CHVA 2YR0A 2L2DA 4OX9M 5KQ8A 2F5SA 2HCBA 3KS4A 4FWDA 4NRWA 4AKGA 1J09A 2P5TA 3GPYA 1YSYA 1PJQA 3B89A 5C1BA 1IN4A 5LMUM 2Y20A 4ZPXA 2V1CA 1LTMA 3SAUA 1QZEA 1NHGC 2DENA 2LNHC 2QZ4A 1JB0F 4B3RM 3KP0E 5LMNM 3HHYA 1QVRA 1HNXM 3GRUA 4NSRA 4K0KM 5H37D 1GLNA 2C99A 3KOWE 2Q2EB 2JA2A 1UFZA 3A98B 1Z5CA 1D0MA 2RGHA 3ZH9B 1A5TA 2VF7A 2O5RA 2DKLA 2QQ8A 4IIWA 3LCVB 2KXEA 3B74A 2JNHA 4MGZE 3JR5A 3BBZA 3T1YM 2Y0TA 1HNWM 2MH8A 3KXEC 2GNOA 3GLGB 4QOZC 1CUKA 1L1ZA 3FRHA 3LCUA 3GQ3A 2YNMD 1N78A 3FTDA 4LZJA 1G4AE 2JY7A 2KNZA 4JI7M 5A2QS 4Z8XA 2ZAOA 4LG2A 2Z3XA 1KSFX 3HU2A 2JY6B 1IN5A 3B9PA 1H6UA 3W68A 1IM2A 2X4AA 2LWXA 2V1UA 4EIWA 4JI1M 1YE9A 4FCTA 4JV5M 4GHAA 3IECA 4WP2A 4PT5A 2MGWA 3SAWA 3NWLA 1Q39A 4LF8M 1IBLM 1E32A 4IBEA 1QUTA 4B08A 4GHLA 1K3WA 1OAOC 4MM3B 4CHTB 3AOGA 4HEOA 2C9CA 1VEJA 4QOSA 2DZLA 3LVWA 4G6ZA 4OVZA 2OO9A 4S12A 1IY1A 2BWBA 3HX3A 1TH4A 2KA6B 1Z59A 3C3DA 3KOZE 4NRVA 1VQ1A 2UU9M 1G41A 4LJ4A 5FTNA 5EJCA 1SXJC 4JI5M 1MN3A 4LGYA 4LFCM 4IBFA
chains in the Genus database with same CATH topology
3FE3A 2JP7A 1OQYA 3GLHE 3GLFE 1NV9A 1WGNA 2DNAA 2OOBA 3F92A 4G3OA 1SG9A 3GLIE 2BWEA 3E21A 1TR8A 5JI2E 2B3TA 2DI0A 1OTRA 1WJ7A 2KNVA 3E46A 2K9DA 2WZJA 1VG5A 3MMPA 2ZTDA 3K9PA 2EKKA 2JY5A 1IXSA 1TTEA 3FRIA 3T6PA 2OOAA 2KHHA 1NV8A 2DAIA 4F2LA 1DV0A 1OAIA 1DO0A 1WIVA 1ZMVA 2JZ1A 2CWBA 4F1IA 2DAGA 2QHOB 2CP8A 2L2DA 1IFYA 2JZ0A 2QSFX 3IHPA 1GO5A 2ZTCA 1WGLA 1BVSA 1G3IA 3B89A 2H5XA 2HAKA 1C7YA 2QNJA 1T6OA 1QZEA 2DENA 1P3QQ 2R0IA 2LVNC 2RRUA 1VDLA 2MR9A 2EKFA 1VEGA 2L4EA 1UFZA 1JR3E 2DAMA 1KYIA 1A5TA 3K9OA 1AIPC 2DKLA 4Q7JA 1V92A 3LCVB 1F4IA 2JNHA 3BBZA 2JUJA 2KNAA 1Y8GA 2LBCA 2G3QA 1E94E 1CUKA 1ZMWA 2O25A 3FRHA 3LCUA 4GEWA 2DAKA 2MROB 1G4AE 2JY7A 2KNZA 1HJPA 2K0BX 2LVQD 1HT2E 2JY6B 1VEKA 4UN2B 1T43A 1HQYE 1Q02A 1IM2A 5DFLA 2DHYA 1ZMUA 1WR1B 2DAEA 3IECA 1R4GA 4WP2A 2MGWA 1YLAA 1WHCA 3H4JA 1XXHE 4DBGB 1EFUB 4HEOA 1VEJA 2DZLA 2HWJA 2OO9A 1XB2B 1ZV1A 1PGYA 1DO2A 2BWBA 2EJSA 4R71A 1OKSA 2LTUA 1HT1E 1VQ1A 2L4FA 2LVOC 1G41A 2LVPC 2MJ5B 3GLGE 1MN3A 2JY8A 2LVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FE3 A;  2JP7 A;  1OQY A;  3GLH E;  3GLF E;  1NV9 A;  1WGN A;  2DNA A;  2OOB A;  3F92 A;  4G3O A;  1SG9 A;  3GLI E;  2BWE A;  3E21 A;  1TR8 A;  5JI2 E;  2B3T A;  2DI0 A;  1OTR A;  1WJ7 A;  2KNV A;  3E46 A;  2K9D A;  2WZJ A;  1VG5 A;  3MMP A;  2ZTD A;  3K9P A;  2EKK A;  2JY5 A;  1IXS A;  1TTE A;  3FRI A;  3T6P A;  2OOA A;  2KHH A;  1NV8 A;  2DAI A;  4F2L A;  1DV0 A;  1OAI A;  1DO0 A;  1WIV A;  1ZMV A;  2JZ1 A;  2CWB A;  4F1I A;  2DAG A;  2QHO B;  2CP8 A;  2L2D A;  1IFY A;  2JZ0 A;  2QSF X;  3IHP A;  1GO5 A;  2ZTC A;  1WGL A;  1BVS A;  1G3I A;  3B89 A;  2H5X A;  2HAK A;  1C7Y A;  2QNJ A;  1T6O A;  1QZE A;  2DEN A;  1P3Q Q;  2R0I A;  2LVN C;  2RRU A;  1VDL A;  2MR9 A;  2EKF A;  1VEG A;  2L4E A;  1UFZ A;  1JR3 E;  2DAM A;  1KYI A;  1A5T A;  3K9O A;  1AIP C;  2DKL A;  4Q7J A;  1V92 A;  3LCV B;  1F4I A;  2JNH A;  3BBZ A;  2JUJ A;  2KNA A;  1Y8G A;  2LBC A;  2G3Q A;  1E94 E;  1CUK A;  1ZMW A;  2O25 A;  3FRH A;  3LCU A;  4GEW A;  2DAK A;  2MRO B;  1G4A E;  2JY7 A;  2KNZ A;  1HJP A;  2K0B X;  2LVQ D;  1HT2 E;  2JY6 B;  1VEK A;  4UN2 B;  1T43 A;  1HQY E;  1Q02 A;  1IM2 A;  5DFL A;  2DHY A;  1ZMU A;  1WR1 B;  2DAE A;  3IEC A;  1R4G A;  4WP2 A;  2MGW A;  1YLA A;  1WHC A;  3H4J A;  1XXH E;  4DBG B;  1EFU B;  4HEO A;  1VEJ A;  2DZL A;  2HWJ A;  2OO9 A;  1XB2 B;  1ZV1 A;  1PGY A;  1DO2 A;  2BWB A;  2EJS A;  4R71 A;  1OKS A;  2LTU A;  1HT1 E;  1VQ1 A;  2L4F A;  2LVO C;  1G41 A;  2LVP C;  2MJ5 B;  3GLG E;  1MN3 A;  2JY8 A;  2LVA A; 
#chains in the Genus database with same CATH topology
 2JP7 A;  3CTW B;  2UXB M;  2XFT A;  2CEA A;  2ERC A;  2VDB B;  5C18 A;  3JAM S;  1MU5 A;  2WSC F;  1GVN A;  4II7 A;  3LQQ A;  1XMO M;  1WGN A;  4CJ6 A;  2LXE A;  2F5P A;  3HJS A;  1E9S A;  2BJV A;  3J81 S;  4G3O A;  1HR0 M;  8CAT A;  4DR7 M;  1SG9 A;  4REZ A;  3U6C A;  2CHG A;  3R9X B;  2XGN A;  2KZS A;  4DV2 M;  3SC3 A;  4R7G A;  2DI0 A;  4LJ9 A;  2G5G X;  1VG5 A;  3AFH A;  1N36 M;  3T38 A;  2Y21 A;  3UGJ A;  4D80 A;  2EA0 A;  1SXJ E;  3B7N A;  1ORY B;  4HL4 A;  4OVZ B;  2QCU A;  3UMM A;  2H1R A;  5FTJ A;  2KHH A;  3W67 A;  3SYL A;  5FSW A;  1PJS A;  2W82 A;  2C98 A;  4B7F A;  1IXZ A;  1OAI A;  5ITR A;  2QBY B;  1DGG A;  2JZ1 A;  4F1I A;  3DA1 A;  2DAG A;  1XC8 A;  2CP8 A;  2FE8 A;  1N33 M;  2JZ0 A;  2QSF X;  2EO2 A;  2ZTC A;  2EUC A;  1PJJ A;  1HNZ M;  4CGY B;  1BVS A;  2CRU A;  3UZU A;  4AI6 A;  2WSE F;  3I01 M;  2CV2 A;  3SYK A;  1IN7 A;  4WUR A;  4RF1 A;  1GL6 A;  2R0I A;  5ITX A;  2OQ4 A;  3VK7 A;  2ZBK B;  2LVN C;  2APL A;  3ZCB B;  2MR9 A;  2EKF A;  4IBG A;  1VEG A;  1IXR C;  1SXJ D;  4L6V 6;  2OPF A;  4DR1 M;  3BOS A;  3H4M A;  3C3E A;  3HKP A;  2VF8 A;  3K9O A;  2JXN A;  4GKK M;  1QDT A;  4LRS A;  4QHS A;  4Q7J A;  1JQJ C;  1D0L A;  3GPX A;  1V92 A;  4KT0 F;  2R65 A;  1G59 A;  4ANR A;  2QBY A;  4L78 A;  2F4V M;  1F4I A;  4XBO A;  1HQC A;  3WHL A;  4LRT A;  2O25 A;  4CIS A;  3L29 A;  4I4L A;  2J7O A;  2DWM A;  2DAK A;  1XWI A;  1R7R A;  2DWN A;  1L2B A;  1HJP A;  4DV4 M;  2YQZ A;  2ZM6 M;  3VKG A;  1QAQ A;  3J80 S;  1HT2 E;  3TL4 X;  3J7B A;  4PDG A;  3GO8 A;  3QWL A;  1VEK A;  4KHP M;  1NNU C;  2R45 A;  1T43 A;  1NVM A;  1OFI A;  1WXQ A;  4LY6 A;  3RGP A;  4GC5 A;  1R2Z A;  2K6B A;  3QYE A;  2JWS A;  1ZMU A;  2DWL A;  1QAN A;  3MHV C;  1Z5A A;  4B7H A;  3PNV A;  4R3D A;  4AZF A;  4GH9 A;  2XSZ A;  2XLJ A;  4NXN M;  3DOA A;  1EFU B;  2K47 A;  1OFH A;  2CE7 A;  3GQ5 A;  1PM5 A;  4LCB A;  2DZO B;  4FWG A;  1PGY A;  3A46 A;  2CV0 A;  3TPZ A;  4R71 A;  5EXT A;  2LTU A;  2N35 A;  1HT1 E;  2KZU A;  2I7P A;  1T3T A;  3T15 A;  2MJ5 B;  3AOE A;  3LMM A;  4JN6 A;  4QNM A;  4NL4 H;  3TE6 A;  1K3X A;  3SAS A;  3U6E A;  3I51 A;  3FE3 A;  3W0F A;  4QHT A;  1NJF A;  1ZQ9 A;  2DZN B;  2A5Y B;  5ITQ A;  4JI6 M;  1V34 A;  4KO8 A;  4D82 A;  3U61 B;  5JI3 E;  1IY2 A;  3VDU A;  2BJW A;  4QNR A;  1TDZ A;  4D81 A;  1Z5B A;  2I7N A;  2KRK A;  7CAT A;  1QYR A;  3FUT A;  5IT9 S;  3GLI A;  3F92 A;  4DR2 M;  1OJL A;  3HJQ A;  3FTC A;  4XK8 F;  4FCV A;  1GAB A;  2ZAM A;  3CF6 E;  3HJ8 A;  3GLI E;  1TR8 A;  1D2N A;  5JI2 E;  4TUW A;  2ZAN A;  4M9S A;  1OTR A;  4P16 A;  3EIE A;  2C96 A;  3E46 A;  4I81 A;  3SFZ A;  3HZJ A;  3FTF A;  3AV0 A;  3U60 A;  3LW5 F;  4MGI E;  4AKI A;  3OTO M;  3K9P A;  3Q8X A;  2EKK A;  1QAO A;  1VDD A;  5KPT A;  1XXH A;  4RF0 A;  1IXS A;  2XF3 A;  3NBI A;  4JI4 M;  3FRI A;  4GIP A;  3U6Q A;  4YY3 M;  1SXJ B;  3Q8G A;  1V33 A;  2OOA A;  3SAT A;  1RU3 A;  1FNN A;  5FLX S;  2DAI A;  3C9P A;  3BXW A;  1DV0 A;  2VQE M;  1J5E M;  1TDH A;  1WIV A;  1ZMV A;  5ITY A;  1IY0 A;  3FUU A;  2QHO B;  4HLQ A;  3GLF A;  3KOY E;  2UUA M;  2VQF M;  2R4E A;  3LQR A;  4G4Q A;  1GO5 A;  1WGL A;  1X37 A;  3KW6 A;  4DR5 M;  2WSF F;  5KPR A;  3U6D A;  1NNJ A;  3HHW A;  1MJG M;  2QNJ A;  1T6O A;  2DWZ B;  3GRR A;  4KLN A;  5EXX A;  4DR3 M;  4LF7 M;  3TWM A;  1EIJ A;  4LJ5 A;  2R6F A;  3M6A A;  4GRI A;  3KDS E;  4AG6 A;  2KRU A;  3FYD A;  3KOX E;  4G4O A;  1I4W A;  1VDL A;  1Q3B A;  1QUS A;  1S3S A;  4DV6 M;  3J7A S;  1AUA A;  4BB9 A;  4GMQ A;  1JR3 E;  2FH0 A;  1DGF A;  4RNA A;  1AIP C;  4IBJ A;  4LFA M;  5EQT A;  3NBX X;  1TF0 B;  1NSF A;  3FUX A;  4GC9 A;  3GLH B;  2G3Q A;  1ZAE A;  3PXG A;  3SHG B;  3GLF B;  1XNQ M;  2L7I A;  3FUV A;  2DXI A;  3RE8 A;  1IN6 A;  1SXJ A;  1MX0 A;  4B3S M;  3PFI A;  2YFQ A;  3HWS A;  1R2Y A;  4LF6 M;  2M60 A;  1NY5 A;  3I4Y A;  3TWL A;  5L8R F;  4L16 A;  3THG A;  1PJI A;  4B7G A;  1E9R A;  4UN2 B;  1DGB A;  3RFW A;  4IBK A;  1HQY E;  1JR3 D;  1N34 M;  3T1H M;  2D7E A;  3FUW A;  2KEB A;  4OU7 A;  2DHY A;  4OW0 A;  5DYG A;  4Y28 F;  1I94 M;  3C58 A;  3KS8 A;  3KP1 E;  3IG8 A;  3VDP A;  2DAE A;  1R4G A;  3B7Q A;  3CF0 A;  3U6L A;  3D8B A;  5FTM A;  3VFD A;  1J7K A;  2D7G A;  1TH3 A;  4IBI A;  3GP1 A;  3L25 A;  1L8Q A;  1YLA A;  1WHC A;  3U60 B;  2DVW B;  2L6O A;  3SAV A;  3H4J A;  1XXH E;  5IZ7 D;  4DBG B;  2NQ8 C;  4ITQ A;  2HWJ A;  4DV7 M;  4L8R C;  1K82 A;  1YUB A;  3SMS A;  4LJ7 A;  4JXJ A;  1ZV1 A;  1OIP A;  1TGU A;  1DGH A;  2D7H A;  5E26 A;  1DO2 A;  2L09 A;  2LH0 A;  3FKE A;  2XH9 A;  2EJS A;  4DR4 M;  2R46 A;  2LVP C;  1OKS A;  2L4F A;  2LVO C;  3JR4 A;  3K8Z A;  5BR8 M;  3L28 A;  1GJT A;  3J27 B;  2HHH M;  2F5Q A;  5KPZ A;  4FW9 A;  4IJE A;  4M0D A;  2C9O A;  4LGM A;  1OQY A;  2Y0Q A;  4LZZ A;  3K1J A;  3AL0 C;  3GPU A;  3KFU G;  1XMQ M;  2CV1 A;  1L2D A;  1NV9 A;  3TQS A;  4IBD A;  1IQP A;  2DNA A;  3QAU A;  1W5S A;  3I4V A;  1EE8 A;  1NY6 A;  2VII A;  1LV7 A;  2CHQ A;  1D0K A;  2Z4S A;  2QP9 X;  2UUB M;  4X64 M;  2F5O A;  4IBC A;  3MJ5 A;  2BWE A;  1Q3C A;  3E21 A;  3J2P B;  3L2A A;  5FTL A;  5BPV A;  3AJI B;  4G4R A;  4B3T M;  3U6S A;  4DR6 M;  3W0L B;  2KNV A;  1G8P A;  2KW0 A;  2K9D A;  4B3M M;  3MMP A;  2ZTD A;  4NSO B;  3SHF A;  2XZU A;  4PD2 A;  4YHH M;  5EXS A;  4LJA A;  3U6O A;  1NHW C;  3HU1 A;  4A3V B;  3B7Z A;  5DYI A;  3ILK A;  3PVS A;  5EXP A;  3HHX A;  3KVW A;  1QAM A;  2QEN A;  1PJT A;  4JI8 M;  4AKH A;  4F2L A;  3KSX A;  1DO0 A;  4DUZ M;  4MGK E;  2XZF A;  4DV0 M;  4DV1 M;  3FYC A;  4LFB M;  2X8A A;  1IFY A;  3IHP A;  3U61 A;  3A42 A;  3U6M A;  5FTK A;  4LJ8 A;  3U5Z B;  1R6B X;  2BNK A;  4JI0 M;  1G3I A;  4I8O A;  2FNA A;  4NC6 A;  2H5X A;  2HAK A;  4MGH A;  1C7Y A;  3QYB A;  4IJF A;  2XEP A;  5KQD A;  2F5N A;  1P3Q Q;  2KDL A;  3GQ4 A;  5ITT A;  4JI2 M;  1C1K A;  2RRU A;  1Z6T A;  2E5L M;  4X65 M;  2GQF A;  4LF9 M;  2L4E A;  3M0E A;  3AKZ A;  3DZD A;  2DAM A;  1KYI A;  4LF5 M;  2DHR A;  4NOO B;  2G8L A;  3E4R A;  2FFJ A;  4L15 A;  2C5R A;  2CFO A;  4PDI A;  2RGO A;  2LBC A;  2JUJ A;  2KNA A;  1Y8G A;  2RKO A;  1E94 E;  1ZMW A;  4GEW A;  3VK8 A;  2FOI C;  3SBJ A;  3K92 A;  5ITX E;  2AHM A;  2MRO B;  1TH2 A;  5ITU A;  3AOE C;  2HKJ A;  1DGH B;  1NO1 A;  1QDR A;  2K0B X;  4AW4 A;  3GRV A;  4BBA A;  2LVQ D;  4LJ6 A;  1N32 M;  3LVV A;  4LF4 M;  4DUY M;  5IRE B;  4RKU F;  2UUC M;  3EIH A;  1R5L A;  1W5T A;  3D8L A;  2HL7 A;  3CF2 A;  1L1T A;  3WHK A;  1XNR M;  4X66 M;  1Q02 A;  4X62 M;  4MH0 E;  2XSZ D;  3L27 A;  5E6J A;  5DFL A;  2QPA A;  3U5Z A;  1WR1 B;  3SAR A;  5DNY A;  1NJG A;  3E9S A;  1UM8 A;  4XGI A;  4Z6Y A;  4GKJ M;  1G71 A;  2Z8Y M;  4M9Z A;  3ZC7 B;  1JR3 A;  3KSJ A;  5EP2 A;  1GKI A;  2R62 A;  3IG5 A;  3GLH A;  4WW0 A;  3ZQJ A;  4PCZ A;  4G4N A;  5GKN A;  4P17 A;  1XXH B;  5EP3 A;  4DV5 M;  2O01 F;  1XB2 B;  1PRB A;  4FCW A;  2UXC M;  1GJS A;  2L7H A;  3GLG E;  5F3W A;  4NXM M;  2Z7J A;  4L4U A;  4M0W A;  2JY8 A;  1IBK M;  4MGY E;  2LVA A;  1IXS B;  4AG5 A;  1GL7 A;  3V76 A;  3PNY A;  4M9X A;  3GRY A;  3GLH E;  2X49 A;  3A45 A;  3UJN A;  5IWA M;  3GLF E;  4GIT A;  2XFS A;  4AQY M;  3FD9 A;  2OOB A;  3U6P A;  4IBB A;  4DV3 M;  2UXD M;  4FWH A;  4I5S A;  2M5Z A;  3GPP A;  3MK6 A;  1OIZ A;  2LHC A;  4CIZ A;  2LHG A;  3CGW A;  3UK6 A;  2B3T A;  2R18 A;  1KFV A;  1WJ7 A;  5EP4 A;  1N77 A;  3HHZ A;  3SMP A;  1L2C A;  2WZJ A;  1XHB A;  2Z4R A;  3FTE A;  3DFZ A;  4KOD A;  4FVM A;  3TWK A;  3VLF B;  5EP1 A;  1N75 A;  3HGI A;  3K2L A;  3L26 A;  2JY5 A;  3VKH A;  1IN8 A;  1QZM A;  3GLG A;  3R8F A;  2R4J A;  1TTE A;  2CUZ A;  1IBM M;  4FD2 A;  2R44 A;  3I04 M;  3M7G A;  3T6P A;  4BLC A;  1NV8 A;  2FS1 A;  3HU3 A;  4MB7 A;  3HY5 A;  4JI3 M;  1QQW A;  2J5Y A;  2J7N A;  2V6Z M;  5KO3 A;  1FJG M;  4JYA M;  3RGS A;  2CWB A;  3GLI B;  4W5W A;  2CHV A;  2YR0 A;  2L2D A;  4OX9 M;  5KQ8 A;  2F5S A;  2HCB A;  3KS4 A;  4FWD A;  4NRW A;  4AKG A;  1J09 A;  2P5T A;  3GPY A;  1YSY A;  1PJQ A;  3B89 A;  5C1B A;  1IN4 A;  5LMU M;  2Y20 A;  4ZPX A;  2V1C A;  1LTM A;  3SAU A;  1QZE A;  1NHG C;  2DEN A;  2LNH C;  2QZ4 A;  1JB0 F;  4B3R M;  3KP0 E;  5LMN M;  3HHY A;  1QVR A;  1HNX M;  3GRU A;  4NSR A;  4K0K M;  5H37 D;  1GLN A;  2C99 A;  3KOW E;  2Q2E B;  2JA2 A;  1UFZ A;  3A98 B;  1Z5C A;  1D0M A;  2RGH A;  3ZH9 B;  1A5T A;  2VF7 A;  2O5R A;  2DKL A;  2QQ8 A;  4IIW A;  3LCV B;  2KXE A;  3B74 A;  2JNH A;  4MGZ E;  3JR5 A;  3BBZ A;  3T1Y M;  2Y0T A;  1HNW M;  2MH8 A;  3KXE C;  2GNO A;  3GLG B;  4QOZ C;  1CUK A;  1L1Z A;  3FRH A;  3LCU A;  3GQ3 A;  2YNM D;  1N78 A;  3FTD A;  4LZJ A;  1G4A E;  2JY7 A;  2KNZ A;  4JI7 M;  5A2Q S;  4Z8X A;  2ZAO A;  4LG2 A;  2Z3X A;  1KSF X;  3HU2 A;  2JY6 B;  1IN5 A;  3B9P A;  1H6U A;  3W68 A;  1IM2 A;  2X4A A;  2LWX A;  2V1U A;  4EIW A;  4JI1 M;  1YE9 A;  4FCT A;  4JV5 M;  4GHA A;  3IEC A;  4WP2 A;  4PT5 A;  2MGW A;  3SAW A;  3NWL A;  1Q39 A;  4LF8 M;  1IBL M;  1E32 A;  4IBE A;  1QUT A;  4B08 A;  4GHL A;  1K3W A;  1OAO C;  4MM3 B;  4CHT B;  3AOG A;  4HEO A;  2C9C A;  1VEJ A;  4QOS A;  2DZL A;  3LVW A;  4G6Z A;  4OVZ A;  2OO9 A;  4S12 A;  1IY1 A;  2BWB A;  3HX3 A;  1TH4 A;  2KA6 B;  1Z59 A;  3C3D A;  3KOZ E;  4NRV A;  1VQ1 A;  2UU9 M;  1G41 A;  4LJ4 A;  5FTN A;  5EJC A;  1SXJ C;  4JI5 M;  1MN3 A;  4LGY A;  4LFC M;  4IBF A; 
#chains in the Genus database with same CATH homology
 3FE3 A;  2JP7 A;  1OQY A;  3GLH E;  3GLF E;  1NV9 A;  1WGN A;  2DNA A;  2OOB A;  3F92 A;  4G3O A;  1SG9 A;  3GLI E;  2BWE A;  3E21 A;  1TR8 A;  5JI2 E;  2B3T A;  2DI0 A;  1OTR A;  1WJ7 A;  2KNV A;  3E46 A;  2K9D A;  2WZJ A;  1VG5 A;  3MMP A;  2ZTD A;  3K9P A;  2EKK A;  2JY5 A;  1IXS A;  1TTE A;  3FRI A;  3T6P A;  2OOA A;  2KHH A;  1NV8 A;  2DAI A;  4F2L A;  1DV0 A;  1OAI A;  1DO0 A;  1WIV A;  1ZMV A;  2JZ1 A;  2CWB A;  4F1I A;  2DAG A;  2QHO B;  2CP8 A;  2L2D A;  1IFY A;  2JZ0 A;  2QSF X;  3IHP A;  1GO5 A;  2ZTC A;  1WGL A;  1BVS A;  1G3I A;  3B89 A;  2H5X A;  2HAK A;  1C7Y A;  2QNJ A;  1T6O A;  1QZE A;  2DEN A;  1P3Q Q;  2R0I A;  2LVN C;  2RRU A;  1VDL A;  2MR9 A;  2EKF A;  1VEG A;  2L4E A;  1UFZ A;  1JR3 E;  2DAM A;  1KYI A;  1A5T A;  3K9O A;  1AIP C;  2DKL A;  4Q7J A;  1V92 A;  3LCV B;  1F4I A;  2JNH A;  3BBZ A;  2JUJ A;  2KNA A;  1Y8G A;  2LBC A;  2G3Q A;  1E94 E;  1CUK A;  1ZMW A;  2O25 A;  3FRH A;  3LCU A;  4GEW A;  2DAK A;  2MRO B;  1G4A E;  2JY7 A;  2KNZ A;  1HJP A;  2K0B X;  2LVQ D;  1HT2 E;  2JY6 B;  1VEK A;  4UN2 B;  1T43 A;  1HQY E;  1Q02 A;  1IM2 A;  5DFL A;  2DHY A;  1ZMU A;  1WR1 B;  2DAE A;  3IEC A;  1R4G A;  4WP2 A;  2MGW A;  1YLA A;  1WHC A;  3H4J A;  1XXH E;  4DBG B;  1EFU B;  4HEO A;  1VEJ A;  2DZL A;  2HWJ A;  2OO9 A;  1XB2 B;  1ZV1 A;  1PGY A;  1DO2 A;  2BWB A;  2EJS A;  4R71 A;  1OKS A;  2LTU A;  1HT1 E;  1VQ1 A;  2L4F A;  2LVO C;  1G41 A;  2LVP C;  2MJ5 B;  3GLG E;  1MN3 A;  2JY8 A;  2LVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...