1WGNA

Solution structure of uba domain of human ubiquitin associated protein 1 (ubap1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
GSSGSSGAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENIEQILDYLFAHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of UBA domain of Human Ubiquitin Associated Protein 1 (UBAP1)
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords ubiquitin associated protein
total genus 13
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wgnA00
1ZV1A 1HJPA 3B89A 4GEWA 1F4IA 5DFLA 1ZMUA 3GLHE 2DI0A 1JR3E 1T43A 2HWJA 1DO0A 4WP2A 1A5TA 2QHOB 2DKLA 1DO2A 3IECA 2L4EA 1UFZA 1OTRA 2JY8A 1NV8A 3H4JA 2BWEA 2MROB 1HT1E 1WR1B 2HAKA 2L2DA 1YLAA 3K9PA 1IXSA 3K9OA 2MR9A 4DBGB 2LBCA 2JY7A 2R0IA 2B3TA 2DNAA 1CUKA 1XB2B 1VEKA 2CWBA 2JZ0A 1VEGA 2LVOC 2JY5A 2QNJA 2DAEA 2CP8A 2O25A 2H5XA 1QZEA 2K9DA 3E46A 1OKSA 4F2LA 1IM2A 2EJSA 3E21A 1EFUB 3FE3A 2LVAA 2MJ5B 2G3QA 3FRHA 1ZMWA 4UN2B 2JP7A 1KYIA 1AIPC 2LVNC 2ZTDA 1P3QQ 2KNZA 1WIVA 1WHCA 3F92A 2WZJA 1VG5A 3MMPA 2LVQD 1G3IA 1WJ7A 1OAIA 1WGLA 1WGNA 2BWBA 1C7YA 1TTEA 2DAGA 2EKKA 2LVPC 2EKFA 4G3OA 2JUJA 3GLGE 2DAKA 4F1IA 2DAMA 1GO5A 1OQYA 1VQ1A 1G41A 2JNHA 3GLFE 2QSFX 2MGWA 1HQYE 1MN3A 1V92A 1SG9A 1G4AE 1Q02A 2L4FA 4Q7JA 4HEOA 2JZ1A 1R4GA 3T6PA 5JI2E 1PGYA 2DAIA 1XXHE 1HT2E 2KNVA 3LCUA 3LCVB 2RRUA 1BVSA 2LTUA 2DZLA 1VDLA 3IHPA 3BBZA 1Y8GA 2K0BX 2OOAA 2OOBA 2JY6B 1ZMVA 2KNAA 2DHYA 2OO9A 2KHHA 2ZTCA 3GLIE 1TR8A 1IFYA 1VEJA 4R71A 1E94E 1DV0A 3FRIA 2DENA 1T6OA 1NV9A
chains in the Genus database with same CATH superfamily
2DVWB 2JA2A 4AQYM 3J27B 1NNUC 2C98A 4PD2A 2HCBA 4Y28F 1XHBA 3I4VA 4KO8A 4XK8F 2C9CA 4R7GA 4MGKE 2BJWA 2CHVA 2DI0A 3U6MA 5KO3A 1JR3E 3KP0E 4B08A 4K0KM 5DYIA 3FYDA 2APLA 4GKJM 1ZQ9A 2DKLA 2KRKA 3AOEC 1NY5A 2KA6B 5IWAM 2Y21A 3U61A 1PJQA 1GKIA 1TH2A 3ZC7B 1IXSB 2F5PA 4JI6M 4I5SA 3IG5A 2MROB 5EP2A 4GH9A 2HKJA 4M0WA 3THGA 3HHWA 3T15A 5IREB 3K9PA 1IXSA 1HQCA 1OFIA 4FCVA 4X62M 3M6AA 2LBCA 1HNZM 1NNJA 2JY7A 1IN6A 4DR1M 2R0IA 3VK7A 4LF5M 2CEAA 8CATA 4JI7M 2FNAA 2XFSA 1XB2B 3SYKA 2O5RA 1LTMA 3H4MA 2JZ0A 4DR3M 1J7KA 2JY5A 3U5ZA 4YY3M 4AI6A 4JV5M 4AG6A 2CP8A 2R4EA 3TPZA 2O25A 4LRSA 2R18A 4OX9M 1QUSA 4RKUF 4LGMA 4ANRA 1Z5CA 3GLIB 4Z8XA 1N77A 3SYLA 4CGYB 1IM2A 2CV0A 4NL4H 4PDGA 1S3SA 2R45A 3DZDA 3AV0A 1QDTA 1L2DA 1GABA 2XFTA 2KXEA 4QOSA 1JR3A 1TF0B 3KOYE 3AOEA 1SXJB 5FTNA 3FTEA 1NVMA 3KS8A 1XXHB 1WIVA 1IY0A 1E9SA 1PM5A 3EIHA 3K92A 3U61B 1WJ7A 2M5ZA 1UM8A 1AUAA 2KW0A 2Z4RA 3LMMA 4I4LA 4G3OA 2EKKA 1NSFA 5FTLA 2XSZD 3GRUA 1I4WA 2EUCA 1N32M 1QDRA 2C99A 1OQYA 1IY1A 1FJGM 3GPPA 1N33M 2XLJA 3QAUA 3U6PA 2QCUA 4LF7M 2JNHA 2X4AA 1HQYE 3CGWA 4LJ8A 3HU1A 1IY2A 4JI4M 1W5SA 1W5TA 4PDIA 4LF9M 4MGZE 3KXEC 3SAVA 3VFDA 3L25A 3B9PA 3FUXA 2JZ1A 4R3DA 2OQ4A 2R62A 1OFHA 4WW0A 4OW0A 1XXHE 1QZMA 4MGIE 3I04M 4OVZA 3KW6A 1NJGA 1VDLA 3ZH9B 3JR5A 1HNWM 1QAQA 3SARA 2OOBA 2QPAA 4TUWA 2UXCM 4GIPA 4LG2A 1ZMVA 3JAMS 3UMMA 4LFBM 5ITXE 7CATA 4LFCM 2CRUA 5EP3A 3TE6A 2E5LM 3HJQA 4CJ6A 3GLIE 3HX3A 2VF8A 3FD9A 1D0LA 2F5OA 4LJ4A 3HWSA 1Q3CA 4B3TM 1IXZA 4FWDA 1IBKM 3VDUA 2KZSA 3SASA 4DR5M 5FTKA 4LJ9A 4P16A 4PCZA 1R7RA 4IBJA 3HGIA 1ZV1A 2AHMA 3PVSA 4LZZA 1HJPA 4GEWA 3VKHA 2ZAOA 1ZMUA 5EP4A 3HZJA 2LWXA 2R6FA 2XH9A 1T43A 1A5TA 2DWMA 1Z59A 3GLIA 3BOSA 2M60A 3GO8A 1DO2A 3IECA 4Z6YA 2VQEM 3L2AA 5GKNA 1Q3BA 1UFZA 3FUTA 3ZQJA 4LGYA 4JI0M 4L15A 2P5TA 2JXNA 1R2ZA 1IN7A 1XWIA 2R4JA 4HL4A 2KZUA 4HLQA 1TH4A 2L2DA 1WR1B 2CHGA 4LJAA 1L1ZA 2L7HA 2QBYB 4DV7M 3GLGA 4DBGB 1HR0M 2MH8A 1MX0A 3CF2A 2OPFA 4IJFA 2B3TA 4I81A 1R2YA 5EXPA 1K3XA 3U6LA 4ITQA 4X66M 2R65A 4DR7M 1QYRA 1PRBA 4GHAA 3GP1A 2FFJA 3FTDA 4FCWA 4M9ZA 4NSOB 2DAEA 4B3RM 2D7GA 3L28A 3LW5F 2K9DA 4NOOB 1SXJA 4QHTA 1DGBA 4F2LA 2VQFM 4NXMM 5FSWA 1IBMM 1LV7A 2XZFA 4IBDA 3FTCA 1NY6A 3GLHA 2EJSA 1FNNA 3GRVA 4X65M 3E21A 4UN2B 2MJ5B 1JB0F 2LVAA 3PNYA 4NC6A 4JI1M 1MJGM 1KYIA 1XMQM 3UZUA 3IG8A 4FWHA 4AKHA 3WHLA 1Q39A 2LXEA 2WSEF 4GC9A 2KNZA 1WHCA 3F92A 3W0FA 2WZJA 1L8QA 3MMPA 1G3IA 3KOXE 1DGHA 3C9PA 1OAIA 2LNHC 2BWBA 1C7YA 2Y20A 3DFZA 2DZOB 2C96A 4DR2M 1QVRA 3E4RA 1HNXM 4M0DA 2CE7A 3AL0C 4F1IA 1G71A 2DAMA 3U6QA 1QAMA 2UU9M 4D81A 5ITTA 1VQ1A 1G41A 2FOIC 4IBKA 2MGWA 1MN3A 3FUUA 1V92A 2UXDM 5LMNM 4KHPM 4B3MM 3HJSA 3LVVA 1SG9A 4FVMA 3TWLA 4G4RA 2BNKA 3D8LA 2C9OA 4AW4A 2L4FA 5EXXA 3UGJA 3LVWA 1QQWA 4LJ7A 2Y0TA 5C1BA 1PGYA 1PJJA 2RRUA 4AG5A 3KFUG 2DZLA 2VF7A 3IHPA 3W0LB 3BBZA 3HHZA 1Y8GA 2DWNA 2V1UA 2X49A 2R46A 3ZCBB 3J81S 2L09A 4JYAM 2XSZA 4M9XA 1TDHA 3AOGA 3SC3A 2FE8A 5KPZA 2ZTCA 4DUYM 3FUVA 4IBEA 1IFYA 2YNMD 1VEJA 4NXNM 3HU2A 1TGUA 3HHXA 5BR8M 2XEPA 3D8BA 3UJNA 3R9XB 1OJLA 1IQPA 1SXJE 1L1TA 3A42A 3GQ4A 2A5YB 1NV9A 2RGHA 1JR3D 4L4UA 1L2BA 4QNRA 4LF4M 4L78A 4BBAA 3ILKA 3FTFA 3B89A 2X8AA 1E32A 4P17A 1XC8A 4LRTA 5DFLA 3NBIA 4LJ5A 2HWJA 1DO0A 3K1JA 2CV1A 3VK8A 1PJIA 3GRYA 1X37A 2L6OA 1Z5BA 1N34M 3LQQA 1GL6A 5A2QS 2D7EA 3MHVC 3U6SA 1D2NA 2L4EA 1IBLM 1Z5AA 1OTRA 3NBXX 4L6V6 3H4JA 1GJTA 4A3VB 4XBOA 2NQ8C 3EIEA 1ORYB 1GJSA 1HT1E 2HAKA 2RGOA 2QP9X 3A98B 3CTWB 4LF8M 1XNQM 1YLAA 4B7GA 3KOZE 3SHFA 3K9OA 2ZM6M 1GVNA 2K6BA 2MR9A 2DXIA 3W68A 3GLHB 2LHCA 2CV2A 4L8RC 4QOZC 1SXJD 2DNAA 3BXWA 2ZBKB 4DR4M 3VKGA 3PFIA 2UUAM 3HHYA 3T38A 1GL7A 3TQSA 4DV1M 2KEBA 4G4NA 2DWLA 3I01M 1VEGA 2CUZA 1TDZA 3TWMA 4G4OA 4II7A 3DOAA 2O01F 4GC5A 3KP1E 4AKIA 2D7HA 3J2PB 3E46A 5ITRA 1OKSA 1N78A 2J7OA 4DR6M 5DYGA 5IT9S 4DV2M 1EFUB 3FE3A 3FRHA 1D0KA 2G3QA 3NWLA 5EXTA 3R8FA 2JP7A 3W67A 3RGSA 1IN8A 1TH3A 3J80S 3HJ8A 1AIPC 1DGFA 2Z8YM 5ITXA 2LVNC 2ZTDA 4PT5A 1P3QQ 1G59A 2F5SA 2LVQD 4DV3M 1EIJA 4KT0F 3KSXA 3C3EA 1SXJC 1WGNA 3M0EA 4QNMA 1G8PA 4LF6M 2JUJA 3QYBA 2V1CA 4JN6A 2W82A 1IN5A 2DWZB 4KODA 3A46A 2DAKA 2FH0A 2QQ8A 3FKEA 5ITYA 1GLNA 4IBCA 1OIZA 2F5QA 3SMSA 1NHGC 3C58A 3FUWA 4IBFA 4FW9A 3QWLA 4BB9A 2DHRA 4W5WA 4ZPXA 2Z3XA 2F4VM 2V6ZM 4G6ZA 4LCBA 4JI5M 1MU5A 1J09A 4HEOA 4RNAA 3SFZA 2L7IA 1IN4A 3MJ5A 4DV6M 3B7ZA 3MK6A 3V76A 3HY5A 3GQ5A 4MH0E 4DV4M 3RGPA 1HT2E 1YE9A 1BVSA 4MB7A 2LHGA 3L26A 4S12A 1I94M 3GLGB 4FCTA 2HL7A 2OOAA 2XZUA 3PNVA 2XGNA 5KPRA 4NRWA 2LH0A 4CIZA 2J7NA 2EA0A 2OO9A 2KHHA 2ZAMA 4GRIA 1TR8A 4NRVA 2UUBM 1PJTA 1E94E 2CHQA 4MGYE 2J5YA 3FRIA 3KDSE 2DENA 1H6UA 1T6OA 2VDBB 3I4YA 3U6EA 4AZFA 2Y0QA 4EIWA 3B7NA 2VIIA 3U60A 3SATA 1F4IA 4JI8M 4B7FA 5FTMA 3GLHE 3Q8XA 2EO2A 4WP2A 1NJFA 4M9SA 3HU3A 2QHOB 3B7QA 2GQFA 3QYEA 2YR0A 4RF1A 5H37D 5ITQA 1JQJC 3AKZA 5FLXS 4DV5M 1E9RA 1D0MA 5E26A 3T1YM 3WHKA 3SAWA 2QBYA 2JY8A 4B7HA 3PXGA 1NV8A 1YSYA 4GITA 4IIWA 3GLFB 1XXHA 1J5EM 2BWEA 1K3WA 1IXRC 1L2CA 4CHTB 3M7GA 1NO1A 2KDLA 4I8OA 4OVZB 3U6DA 3KOWE 1T3TA 3GLFA 2RKOA 3LQRA 5KQDA 1XNRM 1NHWC 3KS4A 5ITUA 2UXBM 1CUKA 4DUZM 1VEKA 5EP1A 1PJSA 2CWBA 3AFHA 5EQTA 5IZ7D 4QHSA 4KLNA 1RU3A 2Z4SA 1N36M 4AKGA 2LVOC 2ZANA 3L29A 2G5GX 4JXJA 2QNJA 2XF3A 5LMUM 3GPYA 2UUCM 1Z6TA 1V33A 2H5XA 1QZEA 3SBJA 3GRRA 3E9SA 3KSJA 4BLCA 3RE8A 3J7AS 2QZ4A 2DZNB 2YFQA 4B3SM 1OAOC 2Q2EB 1DGHB 4G4QA 3U6OA 1ZMWA 5F3WA 3GPUA 2WSFF 4IBBA 4L16A 2I7PA 4IBIA 4REZA 3K8ZA 1VG5A 5E6JA 5KQ8A 3K2LA 1YUBA 4LY6A 1WGLA 4JI2M 1VDDA 1WXQA 1TTEA 2DAGA 2LVPC 3GPXA 2EKFA 1KFVA 2CFOA 3U6CA 4WURA 3SAUA 1R5LA 3CF0A 1QANA 4D82A 5FTJA 3GLGE 4IBGA 3SMPA 3T1HM 2GNOA 1GO5A 3CF6E 3B74A 5EXSA 2YQZA 5JI3E 3TL4X 1R6BX 3DA1A 2WSCF 4D80A 2F5NA 1QUTA 3L27A 2QSFX 2G8LA 3GLFE 4MM3B 1DGGA 3TWKA 4GHLA 4LZJA 5EJCA 3KVWA 1XMOM 4GMQA 3UK6A 2ERCA 1G4AE 4X64M 1Q02A 1OIPA 4FWGA 5C18A 3A45A 4Q7JA 1V34A 4YHHM 2FS1A 4LJ6A 3JR4A 1R4GA 3T6PA 5JI2E 1KSFX 4IJEA 2KNVA 2DAIA 3LCVB 3VLFB 5DNYA 3LCUA 3VDPA 4JI3M 2LTUA 1N75A 4LFAM 2QENA 3GQ3A 1C1KA 4GKKM 2K0BX 4FD2A 5BPVA 3C3DA 1K82A 3U60B 2JY6B 2I7NA 2BJVA 2Z7JA 2HHHM 3I51A 2H1RA 2KNAA 1QAOA 2DHYA 3J7BA 4MGHA 5L8RF 2C5RA 4OU7A 3Q8GA 4XGIA 4R71A 5KPTA 1DV0A 4RF0A 1EE8A 3RFWA 2K47A 3U5ZB 2JWSA 2R44A 1ZAEA 2KRUA 2N35A 4DV0M 3SHGB 4CISA 3OTOM 4NSRA 3HKPA 3FYCA 3AJIB
chains in the Genus database with same CATH topology
1ZV1A 1HJPA 3B89A 4GEWA 1F4IA 5DFLA 1ZMUA 3GLHE 2DI0A 1JR3E 1T43A 2HWJA 1DO0A 4WP2A 1A5TA 2QHOB 2DKLA 1DO2A 3IECA 2L4EA 1UFZA 1OTRA 2JY8A 1NV8A 3H4JA 2BWEA 2MROB 1HT1E 1WR1B 2HAKA 2L2DA 1YLAA 3K9PA 1IXSA 3K9OA 2MR9A 4DBGB 2LBCA 2JY7A 2R0IA 2B3TA 2DNAA 1CUKA 1XB2B 1VEKA 2CWBA 2JZ0A 1VEGA 2LVOC 2JY5A 2QNJA 2DAEA 2CP8A 2O25A 2H5XA 1QZEA 2K9DA 3E46A 1OKSA 4F2LA 1IM2A 2EJSA 3E21A 1EFUB 3FE3A 2LVAA 2MJ5B 2G3QA 3FRHA 1ZMWA 4UN2B 2JP7A 1KYIA 1AIPC 2LVNC 2ZTDA 1P3QQ 2KNZA 1WIVA 1WHCA 3F92A 2WZJA 1VG5A 3MMPA 2LVQD 1G3IA 1WJ7A 1OAIA 1WGLA 1WGNA 2BWBA 1C7YA 1TTEA 2DAGA 2EKKA 2LVPC 2EKFA 4G3OA 2JUJA 3GLGE 2DAKA 4F1IA 2DAMA 1GO5A 1OQYA 1VQ1A 1G41A 2JNHA 3GLFE 2QSFX 2MGWA 1HQYE 1MN3A 1V92A 1SG9A 1G4AE 1Q02A 2L4FA 4Q7JA 4HEOA 2JZ1A 1R4GA 3T6PA 5JI2E 1PGYA 2DAIA 1XXHE 1HT2E 2KNVA 3LCUA 3LCVB 2RRUA 1BVSA 2LTUA 2DZLA 1VDLA 3IHPA 3BBZA 1Y8GA 2K0BX 2OOAA 2OOBA 2JY6B 1ZMVA 2KNAA 2DHYA 2OO9A 2KHHA 2ZTCA 3GLIE 1TR8A 1IFYA 1VEJA 4R71A 1E94E 1DV0A 3FRIA 2DENA 1T6OA 1NV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZV1 A;  1HJP A;  3B89 A;  4GEW A;  1F4I A;  5DFL A;  1ZMU A;  3GLH E;  2DI0 A;  1JR3 E;  1T43 A;  2HWJ A;  1DO0 A;  4WP2 A;  1A5T A;  2QHO B;  2DKL A;  1DO2 A;  3IEC A;  2L4E A;  1UFZ A;  1OTR A;  2JY8 A;  1NV8 A;  3H4J A;  2BWE A;  2MRO B;  1HT1 E;  1WR1 B;  2HAK A;  2L2D A;  1YLA A;  3K9P A;  1IXS A;  3K9O A;  2MR9 A;  4DBG B;  2LBC A;  2JY7 A;  2R0I A;  2B3T A;  2DNA A;  1CUK A;  1XB2 B;  1VEK A;  2CWB A;  2JZ0 A;  1VEG A;  2LVO C;  2JY5 A;  2QNJ A;  2DAE A;  2CP8 A;  2O25 A;  2H5X A;  1QZE A;  2K9D A;  3E46 A;  1OKS A;  4F2L A;  1IM2 A;  2EJS A;  3E21 A;  1EFU B;  3FE3 A;  2LVA A;  2MJ5 B;  2G3Q A;  3FRH A;  1ZMW A;  4UN2 B;  2JP7 A;  1KYI A;  1AIP C;  2LVN C;  2ZTD A;  1P3Q Q;  2KNZ A;  1WIV A;  1WHC A;  3F92 A;  2WZJ A;  1VG5 A;  3MMP A;  2LVQ D;  1G3I A;  1WJ7 A;  1OAI A;  1WGL A;  1WGN A;  2BWB A;  1C7Y A;  1TTE A;  2DAG A;  2EKK A;  2LVP C;  2EKF A;  4G3O A;  2JUJ A;  3GLG E;  2DAK A;  4F1I A;  2DAM A;  1GO5 A;  1OQY A;  1VQ1 A;  1G41 A;  2JNH A;  3GLF E;  2QSF X;  2MGW A;  1HQY E;  1MN3 A;  1V92 A;  1SG9 A;  1G4A E;  1Q02 A;  2L4F A;  4Q7J A;  4HEO A;  2JZ1 A;  1R4G A;  3T6P A;  5JI2 E;  1PGY A;  2DAI A;  1XXH E;  1HT2 E;  2KNV A;  3LCU A;  3LCV B;  2RRU A;  1BVS A;  2LTU A;  2DZL A;  1VDL A;  3IHP A;  3BBZ A;  1Y8G A;  2K0B X;  2OOA A;  2OOB A;  2JY6 B;  1ZMV A;  2KNA A;  2DHY A;  2OO9 A;  2KHH A;  2ZTC A;  3GLI E;  1TR8 A;  1IFY A;  1VEJ A;  4R71 A;  1E94 E;  1DV0 A;  3FRI A;  2DEN A;  1T6O A;  1NV9 A; 
#chains in the Genus database with same CATH topology
 2DVW B;  2JA2 A;  4AQY M;  3J27 B;  1NNU C;  2C98 A;  4PD2 A;  2HCB A;  4Y28 F;  1XHB A;  3I4V A;  4KO8 A;  4XK8 F;  2C9C A;  4R7G A;  4MGK E;  2BJW A;  2CHV A;  2DI0 A;  3U6M A;  5KO3 A;  1JR3 E;  3KP0 E;  4B08 A;  4K0K M;  5DYI A;  3FYD A;  2APL A;  4GKJ M;  1ZQ9 A;  2DKL A;  2KRK A;  3AOE C;  1NY5 A;  2KA6 B;  5IWA M;  2Y21 A;  3U61 A;  1PJQ A;  1GKI A;  1TH2 A;  3ZC7 B;  1IXS B;  2F5P A;  4JI6 M;  4I5S A;  3IG5 A;  2MRO B;  5EP2 A;  4GH9 A;  2HKJ A;  4M0W A;  3THG A;  3HHW A;  3T15 A;  5IRE B;  3K9P A;  1IXS A;  1HQC A;  1OFI A;  4FCV A;  4X62 M;  3M6A A;  2LBC A;  1HNZ M;  1NNJ A;  2JY7 A;  1IN6 A;  4DR1 M;  2R0I A;  3VK7 A;  4LF5 M;  2CEA A;  8CAT A;  4JI7 M;  2FNA A;  2XFS A;  1XB2 B;  3SYK A;  2O5R A;  1LTM A;  3H4M A;  2JZ0 A;  4DR3 M;  1J7K A;  2JY5 A;  3U5Z A;  4YY3 M;  4AI6 A;  4JV5 M;  4AG6 A;  2CP8 A;  2R4E A;  3TPZ A;  2O25 A;  4LRS A;  2R18 A;  4OX9 M;  1QUS A;  4RKU F;  4LGM A;  4ANR A;  1Z5C A;  3GLI B;  4Z8X A;  1N77 A;  3SYL A;  4CGY B;  1IM2 A;  2CV0 A;  4NL4 H;  4PDG A;  1S3S A;  2R45 A;  3DZD A;  3AV0 A;  1QDT A;  1L2D A;  1GAB A;  2XFT A;  2KXE A;  4QOS A;  1JR3 A;  1TF0 B;  3KOY E;  3AOE A;  1SXJ B;  5FTN A;  3FTE A;  1NVM A;  3KS8 A;  1XXH B;  1WIV A;  1IY0 A;  1E9S A;  1PM5 A;  3EIH A;  3K92 A;  3U61 B;  1WJ7 A;  2M5Z A;  1UM8 A;  1AUA A;  2KW0 A;  2Z4R A;  3LMM A;  4I4L A;  4G3O A;  2EKK A;  1NSF A;  5FTL A;  2XSZ D;  3GRU A;  1I4W A;  2EUC A;  1N32 M;  1QDR A;  2C99 A;  1OQY A;  1IY1 A;  1FJG M;  3GPP A;  1N33 M;  2XLJ A;  3QAU A;  3U6P A;  2QCU A;  4LF7 M;  2JNH A;  2X4A A;  1HQY E;  3CGW A;  4LJ8 A;  3HU1 A;  1IY2 A;  4JI4 M;  1W5S A;  1W5T A;  4PDI A;  4LF9 M;  4MGZ E;  3KXE C;  3SAV A;  3VFD A;  3L25 A;  3B9P A;  3FUX A;  2JZ1 A;  4R3D A;  2OQ4 A;  2R62 A;  1OFH A;  4WW0 A;  4OW0 A;  1XXH E;  1QZM A;  4MGI E;  3I04 M;  4OVZ A;  3KW6 A;  1NJG A;  1VDL A;  3ZH9 B;  3JR5 A;  1HNW M;  1QAQ A;  3SAR A;  2OOB A;  2QPA A;  4TUW A;  2UXC M;  4GIP A;  4LG2 A;  1ZMV A;  3JAM S;  3UMM A;  4LFB M;  5ITX E;  7CAT A;  4LFC M;  2CRU A;  5EP3 A;  3TE6 A;  2E5L M;  3HJQ A;  4CJ6 A;  3GLI E;  3HX3 A;  2VF8 A;  3FD9 A;  1D0L A;  2F5O A;  4LJ4 A;  3HWS A;  1Q3C A;  4B3T M;  1IXZ A;  4FWD A;  1IBK M;  3VDU A;  2KZS A;  3SAS A;  4DR5 M;  5FTK A;  4LJ9 A;  4P16 A;  4PCZ A;  1R7R A;  4IBJ A;  3HGI A;  1ZV1 A;  2AHM A;  3PVS A;  4LZZ A;  1HJP A;  4GEW A;  3VKH A;  2ZAO A;  1ZMU A;  5EP4 A;  3HZJ A;  2LWX A;  2R6F A;  2XH9 A;  1T43 A;  1A5T A;  2DWM A;  1Z59 A;  3GLI A;  3BOS A;  2M60 A;  3GO8 A;  1DO2 A;  3IEC A;  4Z6Y A;  2VQE M;  3L2A A;  5GKN A;  1Q3B A;  1UFZ A;  3FUT A;  3ZQJ A;  4LGY A;  4JI0 M;  4L15 A;  2P5T A;  2JXN A;  1R2Z A;  1IN7 A;  1XWI A;  2R4J A;  4HL4 A;  2KZU A;  4HLQ A;  1TH4 A;  2L2D A;  1WR1 B;  2CHG A;  4LJA A;  1L1Z A;  2L7H A;  2QBY B;  4DV7 M;  3GLG A;  4DBG B;  1HR0 M;  2MH8 A;  1MX0 A;  3CF2 A;  2OPF A;  4IJF A;  2B3T A;  4I81 A;  1R2Y A;  5EXP A;  1K3X A;  3U6L A;  4ITQ A;  4X66 M;  2R65 A;  4DR7 M;  1QYR A;  1PRB A;  4GHA A;  3GP1 A;  2FFJ A;  3FTD A;  4FCW A;  4M9Z A;  4NSO B;  2DAE A;  4B3R M;  2D7G A;  3L28 A;  3LW5 F;  2K9D A;  4NOO B;  1SXJ A;  4QHT A;  1DGB A;  4F2L A;  2VQF M;  4NXM M;  5FSW A;  1IBM M;  1LV7 A;  2XZF A;  4IBD A;  3FTC A;  1NY6 A;  3GLH A;  2EJS A;  1FNN A;  3GRV A;  4X65 M;  3E21 A;  4UN2 B;  2MJ5 B;  1JB0 F;  2LVA A;  3PNY A;  4NC6 A;  4JI1 M;  1MJG M;  1KYI A;  1XMQ M;  3UZU A;  3IG8 A;  4FWH A;  4AKH A;  3WHL A;  1Q39 A;  2LXE A;  2WSE F;  4GC9 A;  2KNZ A;  1WHC A;  3F92 A;  3W0F A;  2WZJ A;  1L8Q A;  3MMP A;  1G3I A;  3KOX E;  1DGH A;  3C9P A;  1OAI A;  2LNH C;  2BWB A;  1C7Y A;  2Y20 A;  3DFZ A;  2DZO B;  2C96 A;  4DR2 M;  1QVR A;  3E4R A;  1HNX M;  4M0D A;  2CE7 A;  3AL0 C;  4F1I A;  1G71 A;  2DAM A;  3U6Q A;  1QAM A;  2UU9 M;  4D81 A;  5ITT A;  1VQ1 A;  1G41 A;  2FOI C;  4IBK A;  2MGW A;  1MN3 A;  3FUU A;  1V92 A;  2UXD M;  5LMN M;  4KHP M;  4B3M M;  3HJS A;  3LVV A;  1SG9 A;  4FVM A;  3TWL A;  4G4R A;  2BNK A;  3D8L A;  2C9O A;  4AW4 A;  2L4F A;  5EXX A;  3UGJ A;  3LVW A;  1QQW A;  4LJ7 A;  2Y0T A;  5C1B A;  1PGY A;  1PJJ A;  2RRU A;  4AG5 A;  3KFU G;  2DZL A;  2VF7 A;  3IHP A;  3W0L B;  3BBZ A;  3HHZ A;  1Y8G A;  2DWN A;  2V1U A;  2X49 A;  2R46 A;  3ZCB B;  3J81 S;  2L09 A;  4JYA M;  2XSZ A;  4M9X A;  1TDH A;  3AOG A;  3SC3 A;  2FE8 A;  5KPZ A;  2ZTC A;  4DUY M;  3FUV A;  4IBE A;  1IFY A;  2YNM D;  1VEJ A;  4NXN M;  3HU2 A;  1TGU A;  3HHX A;  5BR8 M;  2XEP A;  3D8B A;  3UJN A;  3R9X B;  1OJL A;  1IQP A;  1SXJ E;  1L1T A;  3A42 A;  3GQ4 A;  2A5Y B;  1NV9 A;  2RGH A;  1JR3 D;  4L4U A;  1L2B A;  4QNR A;  4LF4 M;  4L78 A;  4BBA A;  3ILK A;  3FTF A;  3B89 A;  2X8A A;  1E32 A;  4P17 A;  1XC8 A;  4LRT A;  5DFL A;  3NBI A;  4LJ5 A;  2HWJ A;  1DO0 A;  3K1J A;  2CV1 A;  3VK8 A;  1PJI A;  3GRY A;  1X37 A;  2L6O A;  1Z5B A;  1N34 M;  3LQQ A;  1GL6 A;  5A2Q S;  2D7E A;  3MHV C;  3U6S A;  1D2N A;  2L4E A;  1IBL M;  1Z5A A;  1OTR A;  3NBX X;  4L6V 6;  3H4J A;  1GJT A;  4A3V B;  4XBO A;  2NQ8 C;  3EIE A;  1ORY B;  1GJS A;  1HT1 E;  2HAK A;  2RGO A;  2QP9 X;  3A98 B;  3CTW B;  4LF8 M;  1XNQ M;  1YLA A;  4B7G A;  3KOZ E;  3SHF A;  3K9O A;  2ZM6 M;  1GVN A;  2K6B A;  2MR9 A;  2DXI A;  3W68 A;  3GLH B;  2LHC A;  2CV2 A;  4L8R C;  4QOZ C;  1SXJ D;  2DNA A;  3BXW A;  2ZBK B;  4DR4 M;  3VKG A;  3PFI A;  2UUA M;  3HHY A;  3T38 A;  1GL7 A;  3TQS A;  4DV1 M;  2KEB A;  4G4N A;  2DWL A;  3I01 M;  1VEG A;  2CUZ A;  1TDZ A;  3TWM A;  4G4O A;  4II7 A;  3DOA A;  2O01 F;  4GC5 A;  3KP1 E;  4AKI A;  2D7H A;  3J2P B;  3E46 A;  5ITR A;  1OKS A;  1N78 A;  2J7O A;  4DR6 M;  5DYG A;  5IT9 S;  4DV2 M;  1EFU B;  3FE3 A;  3FRH A;  1D0K A;  2G3Q A;  3NWL A;  5EXT A;  3R8F A;  2JP7 A;  3W67 A;  3RGS A;  1IN8 A;  1TH3 A;  3J80 S;  3HJ8 A;  1AIP C;  1DGF A;  2Z8Y M;  5ITX A;  2LVN C;  2ZTD A;  4PT5 A;  1P3Q Q;  1G59 A;  2F5S A;  2LVQ D;  4DV3 M;  1EIJ A;  4KT0 F;  3KSX A;  3C3E A;  1SXJ C;  1WGN A;  3M0E A;  4QNM A;  1G8P A;  4LF6 M;  2JUJ A;  3QYB A;  2V1C A;  4JN6 A;  2W82 A;  1IN5 A;  2DWZ B;  4KOD A;  3A46 A;  2DAK A;  2FH0 A;  2QQ8 A;  3FKE A;  5ITY A;  1GLN A;  4IBC A;  1OIZ A;  2F5Q A;  3SMS A;  1NHG C;  3C58 A;  3FUW A;  4IBF A;  4FW9 A;  3QWL A;  4BB9 A;  2DHR A;  4W5W A;  4ZPX A;  2Z3X A;  2F4V M;  2V6Z M;  4G6Z A;  4LCB A;  4JI5 M;  1MU5 A;  1J09 A;  4HEO A;  4RNA A;  3SFZ A;  2L7I A;  1IN4 A;  3MJ5 A;  4DV6 M;  3B7Z A;  3MK6 A;  3V76 A;  3HY5 A;  3GQ5 A;  4MH0 E;  4DV4 M;  3RGP A;  1HT2 E;  1YE9 A;  1BVS A;  4MB7 A;  2LHG A;  3L26 A;  4S12 A;  1I94 M;  3GLG B;  4FCT A;  2HL7 A;  2OOA A;  2XZU A;  3PNV A;  2XGN A;  5KPR A;  4NRW A;  2LH0 A;  4CIZ A;  2J7N A;  2EA0 A;  2OO9 A;  2KHH A;  2ZAM A;  4GRI A;  1TR8 A;  4NRV A;  2UUB M;  1PJT A;  1E94 E;  2CHQ A;  4MGY E;  2J5Y A;  3FRI A;  3KDS E;  2DEN A;  1H6U A;  1T6O A;  2VDB B;  3I4Y A;  3U6E A;  4AZF A;  2Y0Q A;  4EIW A;  3B7N A;  2VII A;  3U60 A;  3SAT A;  1F4I A;  4JI8 M;  4B7F A;  5FTM A;  3GLH E;  3Q8X A;  2EO2 A;  4WP2 A;  1NJF A;  4M9S A;  3HU3 A;  2QHO B;  3B7Q A;  2GQF A;  3QYE A;  2YR0 A;  4RF1 A;  5H37 D;  5ITQ A;  1JQJ C;  3AKZ A;  5FLX S;  4DV5 M;  1E9R A;  1D0M A;  5E26 A;  3T1Y M;  3WHK A;  3SAW A;  2QBY A;  2JY8 A;  4B7H A;  3PXG A;  1NV8 A;  1YSY A;  4GIT A;  4IIW A;  3GLF B;  1XXH A;  1J5E M;  2BWE A;  1K3W A;  1IXR C;  1L2C A;  4CHT B;  3M7G A;  1NO1 A;  2KDL A;  4I8O A;  4OVZ B;  3U6D A;  3KOW E;  1T3T A;  3GLF A;  2RKO A;  3LQR A;  5KQD A;  1XNR M;  1NHW C;  3KS4 A;  5ITU A;  2UXB M;  1CUK A;  4DUZ M;  1VEK A;  5EP1 A;  1PJS A;  2CWB A;  3AFH A;  5EQT A;  5IZ7 D;  4QHS A;  4KLN A;  1RU3 A;  2Z4S A;  1N36 M;  4AKG A;  2LVO C;  2ZAN A;  3L29 A;  2G5G X;  4JXJ A;  2QNJ A;  2XF3 A;  5LMU M;  3GPY A;  2UUC M;  1Z6T A;  1V33 A;  2H5X A;  1QZE A;  3SBJ A;  3GRR A;  3E9S A;  3KSJ A;  4BLC A;  3RE8 A;  3J7A S;  2QZ4 A;  2DZN B;  2YFQ A;  4B3S M;  1OAO C;  2Q2E B;  1DGH B;  4G4Q A;  3U6O A;  1ZMW A;  5F3W A;  3GPU A;  2WSF F;  4IBB A;  4L16 A;  2I7P A;  4IBI A;  4REZ A;  3K8Z A;  1VG5 A;  5E6J A;  5KQ8 A;  3K2L A;  1YUB A;  4LY6 A;  1WGL A;  4JI2 M;  1VDD A;  1WXQ A;  1TTE A;  2DAG A;  2LVP C;  3GPX A;  2EKF A;  1KFV A;  2CFO A;  3U6C A;  4WUR A;  3SAU A;  1R5L A;  3CF0 A;  1QAN A;  4D82 A;  5FTJ A;  3GLG E;  4IBG A;  3SMP A;  3T1H M;  2GNO A;  1GO5 A;  3CF6 E;  3B74 A;  5EXS A;  2YQZ A;  5JI3 E;  3TL4 X;  1R6B X;  3DA1 A;  2WSC F;  4D80 A;  2F5N A;  1QUT A;  3L27 A;  2QSF X;  2G8L A;  3GLF E;  4MM3 B;  1DGG A;  3TWK A;  4GHL A;  4LZJ A;  5EJC A;  3KVW A;  1XMO M;  4GMQ A;  3UK6 A;  2ERC A;  1G4A E;  4X64 M;  1Q02 A;  1OIP A;  4FWG A;  5C18 A;  3A45 A;  4Q7J A;  1V34 A;  4YHH M;  2FS1 A;  4LJ6 A;  3JR4 A;  1R4G A;  3T6P A;  5JI2 E;  1KSF X;  4IJE A;  2KNV A;  2DAI A;  3LCV B;  3VLF B;  5DNY A;  3LCU A;  3VDP A;  4JI3 M;  2LTU A;  1N75 A;  4LFA M;  2QEN A;  3GQ3 A;  1C1K A;  4GKK M;  2K0B X;  4FD2 A;  5BPV A;  3C3D A;  1K82 A;  3U60 B;  2JY6 B;  2I7N A;  2BJV A;  2Z7J A;  2HHH M;  3I51 A;  2H1R A;  2KNA A;  1QAO A;  2DHY A;  3J7B A;  4MGH A;  5L8R F;  2C5R A;  4OU7 A;  3Q8G A;  4XGI A;  4R71 A;  5KPT A;  1DV0 A;  4RF0 A;  1EE8 A;  3RFW A;  2K47 A;  3U5Z B;  2JWS A;  2R44 A;  1ZAE A;  2KRU A;  2N35 A;  4DV0 M;  3SHG B;  4CIS A;  3OTO M;  4NSR A;  3HKP A;  3FYC A;  3AJI B; 
#chains in the Genus database with same CATH homology
 1ZV1 A;  1HJP A;  3B89 A;  4GEW A;  1F4I A;  5DFL A;  1ZMU A;  3GLH E;  2DI0 A;  1JR3 E;  1T43 A;  2HWJ A;  1DO0 A;  4WP2 A;  1A5T A;  2QHO B;  2DKL A;  1DO2 A;  3IEC A;  2L4E A;  1UFZ A;  1OTR A;  2JY8 A;  1NV8 A;  3H4J A;  2BWE A;  2MRO B;  1HT1 E;  1WR1 B;  2HAK A;  2L2D A;  1YLA A;  3K9P A;  1IXS A;  3K9O A;  2MR9 A;  4DBG B;  2LBC A;  2JY7 A;  2R0I A;  2B3T A;  2DNA A;  1CUK A;  1XB2 B;  1VEK A;  2CWB A;  2JZ0 A;  1VEG A;  2LVO C;  2JY5 A;  2QNJ A;  2DAE A;  2CP8 A;  2O25 A;  2H5X A;  1QZE A;  2K9D A;  3E46 A;  1OKS A;  4F2L A;  1IM2 A;  2EJS A;  3E21 A;  1EFU B;  3FE3 A;  2LVA A;  2MJ5 B;  2G3Q A;  3FRH A;  1ZMW A;  4UN2 B;  2JP7 A;  1KYI A;  1AIP C;  2LVN C;  2ZTD A;  1P3Q Q;  2KNZ A;  1WIV A;  1WHC A;  3F92 A;  2WZJ A;  1VG5 A;  3MMP A;  2LVQ D;  1G3I A;  1WJ7 A;  1OAI A;  1WGL A;  1WGN A;  2BWB A;  1C7Y A;  1TTE A;  2DAG A;  2EKK A;  2LVP C;  2EKF A;  4G3O A;  2JUJ A;  3GLG E;  2DAK A;  4F1I A;  2DAM A;  1GO5 A;  1OQY A;  1VQ1 A;  1G41 A;  2JNH A;  3GLF E;  2QSF X;  2MGW A;  1HQY E;  1MN3 A;  1V92 A;  1SG9 A;  1G4A E;  1Q02 A;  2L4F A;  4Q7J A;  4HEO A;  2JZ1 A;  1R4G A;  3T6P A;  5JI2 E;  1PGY A;  2DAI A;  1XXH E;  1HT2 E;  2KNV A;  3LCU A;  3LCV B;  2RRU A;  1BVS A;  2LTU A;  2DZL A;  1VDL A;  3IHP A;  3BBZ A;  1Y8G A;  2K0B X;  2OOA A;  2OOB A;  2JY6 B;  1ZMV A;  2KNA A;  2DHY A;  2OO9 A;  2KHH A;  2ZTC A;  3GLI E;  1TR8 A;  1IFY A;  1VEJ A;  4R71 A;  1E94 E;  1DV0 A;  3FRI A;  2DEN A;  1T6O A;  1NV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...