1WGNA

Solution structure of uba domain of human ubiquitin associated protein 1 (ubap1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
GSSGSSGAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENIEQILDYLFAHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords ubiquitin associated protein
publication title Solution Structure of UBA domain of Human Ubiquitin Associated Protein 1 (UBAP1)
rcsb
source organism Homo sapiens
total genus 13
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wgnA00
1WGNA 1G4AE 3LCVB 3FRHA 4Q7JA 1TTEA 1OKSA 2MJ5B 1G41A 2OOBA 1P3QQ 3K9OA 2ZTDA 2DI0A 2BWEA 1IM2A 3GLHE 3H4JA 2HAKA 2JY5A 2QNJA 4UN2B 1VG5A 2JY6B 1WHCA 2JP7A 2JY7A 1HQYE 2KNZA 3E46A 4WP2A 2OO9A 3GLGE 1OTRA 2O25A 2OOAA 1XB2B 1V92A 1QZEA 1SG9A 2DHYA 1C7YA 2RRUA 1DV0A 3F92A 1XXHE 1WR1B 1GO5A 2EKFA 2LTUA 2LBCA 1ZMWA 2EJSA 2K9DA 2HWJA 1CUKA 2K0BX 1R4GA 2B3TA 3MMPA 2DAEA 1EFUB 1DO2A 2DZLA 3IECA 2JNHA 1DO0A 3FRIA 4HEOA 1WGLA 1T43A 2L4FA 3K9PA 5JI2E 1HT1E 1UFZA 1TR8A 3T6PA 1AIPC 3FE3A 2DAGA 2L2DA 2DAIA 2KNAA 2R0IA 1NV8A 2LVOC 3LCUA 2BWBA 1PGYA 1VEKA 1IXSA 2LVPC 1WIVA 1HJPA 3GLIE 2CP8A 2CWBA 4G3OA 2LVQD 1JR3E 1BVSA 2JY8A 1VDLA 4R71A 2DKLA 2MGWA 1OAIA 2JZ1A 4GEWA 3B89A 1YLAA 1WJ7A 1VEJA 2ZTCA 1VQ1A 2G3QA 5DFLA 1ZMUA 2EKKA 1KYIA 1ZV1A 1A5TA 1E94E 1F4IA 2KNVA 1Q02A 1IFYA 2LVNC 2WZJA 4F1IA 2DNAA 2KHHA 1T6OA 1G3IA 2MR9A 2JZ0A 2QSFX 2QHOB 4DBGB 2DAKA 1Y8GA 2L4EA 1OQYA 3BBZA 3IHPA 2H5XA 2JUJA 1MN3A 1VEGA 1ZMVA 3E21A 2MROB 1NV9A 2DAMA 4F2LA 3GLFE 2DENA 1HT2E 2LVAA
chains in the Genus database with same CATH superfamily
1T3TA 5IWAM 2Z4RA 5ITXA 3FTFA 1TTEA 3RGSA 2L7IA 1AUAA 2EUCA 1I4WA 1MX0A 2RKOA 4GIPA 1S3SA 2VQEM 4L8RC 3HHWA 3U6LA 2DI0A 1N32M 3GPXA 4AG5A 3HU1A 4D80A 3U6DA 1JB0F 1HR0M 1H6UA 3AL0C 3J7AS 1D2NA 2R4JA 1IN6A 3TWLA 1QYRA 4OU7A 4HL4A 1XXHA 5A2QS 3I04M 4M0DA 5FTMA 5ITRA 1K3WA 2F4VM 2H1RA 1YE9A 2XSZA 3E46A 3HHXA 3KOXE 1G71A 2QENA 3VLFB 3GLGE 4NL4H 4W5WA 2O25A 2R6FA 3HU2A 2DXIA 2QP9X 2D7GA 1GKIA 3KW6A 1L1ZA 1N78A 3VKGA 2O01F 1QZEA 4B7GA 3RFWA 2ZANA 1PJQA 1SG9A 2XSZD 4FD2A 1C7YA 3A98B 3I4YA 4JI0M 1QDRA 2GNOA 1K82A 5KPRA 3HHYA 5EP3A 2EKFA 4Y28F 1TF0B 4D81A 2LTUA 3HJ8A 4WURA 4IBEA 1NJGA 2LBCA 4LZZA 3SARA 2KDLA 5F3WA 3WHLA 3SASA 2APLA 3FD9A 5BR8M 2K9DA 4DUZM 2HWJA 4LGYA 5DNYA 2X4AA 1L1TA 2DWZB 1QAQA 4KO8A 1GABA 4PDGA 1D0KA 2F5NA 3GO8A 4X64M 3GLFB 2YR0A 3KSJA 1GL6A 3HX3A 1XMQM 1E9SA 2XFTA 4FVMA 1L2BA 4IBCA 4NSRA 1L8QA 1DO0A 2JNHA 4FWDA 2CHGA 1WGLA 2Z4SA 3M7GA 1HNXM 2CRUA 3QAUA 4ANRA 3J27B 1AIPC 2XF3A 5JI3E 1J09A 5LMNM 1UM8A 1ORYB 1PJSA 5GKNA 2UUCM 3FKEA 5DYGA 1TDZA 4GRIA 1NV8A 2OPFA 4P17A 3U6OA 5EXPA 1IXSA 1R5LA 2LVPC 4AKIA 1Q3CA 2UUAM 4QOZC 4I5SA 3MJ5A 1QUTA 3E9SA 5C18A 5ITYA 4G3OA 2HCBA 1GJTA 3VFDA 1JR3E 5IT9S 1MU5A 1VDLA 1E32A 2QBYA 4JI5M 3BXWA 3C58A 7CATA 3GQ5A 2X8AA 3ZH9B 4G4RA 1OIPA 2G3QA 4RF1A 4DUYM 3T15A 1PM5A 4RF0A 4IBJA 3T1YM 3I4VA 3HJSA 4LJ9A 3K92A 3GRVA 3PVSA 1SXJB 4GHAA 4B3TM 2KW0A 2I7PA 2DNAA 3BOSA 3FUWA 4G6ZA 4CJ6A 3LQRA 2XFSA 4P16A 1G3IA 2MR9A 2JZ0A 2R62A 3KP0E 3DA1A 3ZC7B 4D82A 5C1BA 5ITUA 3JR4A 4MM3B 2R4EA 3HGIA 4GH9A 3IHPA 2H5XA 2JUJA 3L28A 4FWHA 1VEGA 1ZMVA 4G4NA 2MROB 5EJCA 3GLFE 8CATA 2XLJA 2DENA 1OAOC 2LVAA 4IBDA 4PCZA 1WGNA 1V34A 4RNAA 4Q7JA 3J80S 4LF5M 3KOZE 3SFZA 3AKZA 5ITTA 3CF2A 2CE7A 3SMPA 3SAWA 1Q39A 4NC6A 1XNQM 2OOBA 3R9XB 4AKHA 1OFIA 3K9OA 2VIIA 3JR5A 3SBJA 3L26A 4PDIA 1IM2A 1WXQA 3FUUA 4BBAA 3H4JA 1X37A 2DHRA 4LRTA 2HAKA 4DV0M 2XZUA 1GLNA 5L8RF 2UXDM 4G4OA 4UN2B 1VG5A 3Q8GA 3L25A 3KS4A 3GLIB 4LF6M 3GLHA 3LVVA 3GPPA 5KO3A 2L7HA 1IQPA 2JY7A 3HKPA 3U60B 2JA2A 2YFQA 5BPVA 1HQYE 2BJVA 3MHVC 4REZA 1QQWA 3W0LB 4AG6A 1IY1A 1Z5CA 3TQSA 3AJIB 1D0MA 4QNMA 4AQYM 1IXRC 2D7EA 3HZJA 3QWLA 4PD2A 2V6ZM 4CIZA 2M5ZA 2KZUA 1Z59A 3GRUA 3L27A 2JXNA 1QZMA 4S12A 3SMSA 2I7NA 2YNMD 2F5QA 4GKKM 4GKJM 4TUWA 1DGFA 3NBXX 4KODA 1SXJE 1WR1B 2CV1A 2R44A 3FYDA 1GO5A 3K1JA 1L2DA 4X66M 4B3MM 1L2CA 2VF7A 2KRKA 3HY5A 2RGOA 3JAMS 2FH0A 4QHTA 2J7NA 3VK8A 4B7FA 4JI4M 1CUKA 1KFVA 4GC5A 2R45A 4IBGA 5EXXA 3FTDA 2FOIC 3VDPA 4B3SM 1E9RA 3U6PA 1GL7A 1NHWC 5EQTA 1EFUB 3HHZA 1DGBA 2DZLA 4IBKA 2BNKA 5EP1A 2WSCF 5KQDA 2Q2EB 1JR3A 1DGHB 1HNWM 2Y21A 3K9PA 4R7GA 3U61A 1UFZA 3ZCBB 4JYAM 3FE3A 1IY2A 4OW0A 3AV0A 3AOEC 1NO1A 3FTCA 4KHPM 3B7QA 1PJJA 2W82A 3A45A 3CTWB 2LVOC 2BWBA 2CUZA 3LMMA 2DWLA 4BB9A 4DR4M 3LQQA 4L4UA 4KT0F 1Q3BA 5KPTA 2F5OA 5KPZA 1ZAEA 3U6MA 1Z5AA 1HJPA 3GLIE 1OJLA 3TE6A 2CP8A 2CWBA 1YSYA 2DZNB 2Z3XA 1IY0A 4EIWA 4JI1M 2WSEF 2JY8A 2P5TA 3FUXA 4OVZB 3W68A 4LFBM 3EIHA 2JZ1A 3B89A 1VEJA 3NWLA 3SYKA 3GPYA 1NNJA 1VQ1A 2E5LM 3Q8XA 2ZBKB 3W0FA 3VK7A 1YUBA 2XZFA 1QDTA 3UZUA 2QZ4A 1IFYA 2CFOA 4JI6M 1IN8A 4PT5A 4QHSA 3B7ZA 1PJTA 4FCWA 2HKJA 4LJ5A 3L2AA 3SHFA 1IBMM 1OFHA 1SXJC 3C9PA 1NY5A 2D7HA 1OQYA 4B7HA 1MJGM 1XNRM 5ITXE 3EIEA 3SATA 4XGIA 3SAUA 5IZ7D 1NV9A 4LF7M 4F2LA 2F5SA 3B7NA 4M9SA 1N36M 1I94M 2OQ4A 1G4AE 1IXZA 3LCVB 2L6OA 2AHMA 2G5GX 5FTKA 4ITQA 3VKHA 4DR7M 1OKSA 4MH0E 2MJ5B 1G41A 3PXGA 1P3QQ 1IXSB 3L29A 5EXSA 3PNVA 2DZOB 4JXJA 4L15A 4B3RM 4JI8M 4CGYB 2QBYB 3TPZA 2HHHM 3DOAA 4LFAM 3GQ4A 2JY6B 4DV4M 4FCTA 2O5RA 2HL7A 2JP7A 3M0EA 3HWSA 5EP4A 3I51A 4NOOB 1VDDA 3K2LA 4LCBA 2KNZA 3W67A 4CHTB 5FLXS 3T1HM 2OO9A 3A46A 3SC3A 5FTJA 1Z5BA 4DV2M 4NXNM 4A3VB 2LNHC 1N34M 3KFUG 4FW9A 4I4LA 3THGA 4LJ4A 1XB2B 4IBBA 3U5ZA 3UGJA 4DV6M 3GLGA 4DV7M 1DV0A 2KXEA 1IN4A 3F92A 3R8FA 2MH8A 1OIZA 1N77A 2LH0A 2GQFA 3K8ZA 2JWSA 3SYLA 2FNAA 1HQCA 2WSFF 5ITQA 1EIJA 4RKUF 2QCUA 4KLNA 2EJSA 2NQ8C 2LXEA 4JI7M 2VF8A 3QYBA 2V1UA 1R4GA 2B3TA 3GRYA 3MMPA 4GC9A 4AZFA 1TH4A 2KZSA 3D8LA 1W5SA 2CV0A 4LF4M 2FE8A 2J5YA 3GLIA 4AI6A 4AKGA 1DGGA 1NY6A 3IECA 2ERCA 3KP1E 4LJ7A 1QANA 3FUVA 3FRIA 3DZDA 4HEOA 2R65A 2N35A 3OTOM 2UUBM 3T6PA 2ZAMA 2DAGA 3FUTA 1TH3A 2DAIA 2K47A 3B9PA 2A5YB 2R46A 3GLHB 1QAMA 2XEPA 3B74A 3CF6E 2VQFM 4JV5M 1QAOA 1PGYA 1VEKA 1G8PA 4G4QA 2VDBB 3KOWE 3AFHA 4LJ8A 4L16A 2XGNA 4IIWA 1IBLM 4R3DA 1JQJC 4MGZE 1QUSA 2KA6B 4LJ6A 2LWXA 3UK6A 4X62M 1BVSA 4R71A 3LW5F 3AOGA 4DR1M 3E4RA 1TDHA 2QQ8A 4MGIE 2MGWA 4QOSA 1OAIA 5FSWA 4GEWA 1R2YA 1QVRA 4CISA 4L6V6 5DFLA 2UXCM 4DR6M 1TH2A 4LG2A 1ZMUA 1FJGM 2EKKA 1KYIA 4GITA 4DR3M 4LF9M 1IN7A 1A5TA 1E94E 3TL4X 2KNVA 3TWMA 4IJEA 4LF8M 2KRUA 3RE8A 2C5RA 1DGHA 1XXHB 2LVNC 3KDSE 4WW0A 2C99A 4M9XA 1NVMA 2FFJA 4LRSA 2QSFX 3GQ3A 4NRVA 4GMQA 1JR3D 2V1CA 4XK8F 2DAKA 1Y8GA 1LTMA 2L4EA 2ZM6M 4LGMA 5LMUM 1XHBA 1N75A 1MN3A 5EXTA 2Y20A 3E21A 4HLQA 1GVNA 3U61B 2DAMA 3J2PB 1NSFA 4FWGA 3GRRA 2BJWA 3T38A 5E26A 4X65M 1HT2E 3C3EA 1R7RA 3D8BA 3ILKA 4BLCA 2ZAOA 1ZQ9A 3FRHA 3ZQJA 4OVZA 4YHHM 3PNYA 4DV5M 2XH9A 2G8LA 3GLFA 4LY6A 2DWNA 4LZJA 3UJNA 2ZTDA 4Z8XA 4XBOA 2BWEA 3PFIA 2YQZA 1RU3A 3GLHE 3KS8A 3AOEA 4GHLA 3V76A 3CF0A 1R2ZA 2JY5A 2QNJA 1G59A 2RGHA 1WHCA 1R6BX 4MGYE 2UU9M 3LVWA 2C98A 1GJSA 3KOYE 4M0WA 3SHGB 2Y0QA 4WP2A 3MK6A 4LJAA 4MGHA 2CHQA 5H37D 2CHVA 1OTRA 2DVWB 4DV1M 2L09A 2OOAA 5FTLA 4K0KM 1XMOM 2QPAA 3FTEA 1V92A 4JN6A 1IN5A 5KQ8A 3KSXA 2DHYA 2EO2A 4IJFA 2RRUA 4B08A 3UMMA 4OX9M 2J7OA 3KXEC 4NXMM 1XXHE 4DR2M 1K3XA 4MB7A 1ZMWA 2Z8YM 4MGKE 1NHGC 5E6JA 2K0BX 1KSFX 1SXJA 3U6QA 2C96A 2DAEA 1D0LA 3GPUA 5DYIA 1DO2A 4LFCM 3I01M 1EE8A 3HU3A 4Z6YA 1T43A 2L4FA 5JI2E 4ZPXA 1HT1E 2LHCA 4JI3M 1SXJD 4DR5M 1TR8A 4IBIA 5EP2A 1TGUA 2L2DA 4I81A 2KNAA 2R0IA 3J7BA 3M6AA 2CV2A 3LCUA 4II7A 2C9CA 4DV3M 4IBFA 2UXBM 2X49A 2Z7JA 3KVWA 1FNNA 5FTNA 3VDUA 2EA0A 1XC8A 1WIVA 3FYCA 3A42A 3WHKA 2M60A 4QNRA 3IG8A 2LVQD 3J81S 3U5ZB 2DKLA 3GLGB 2FS1A 4FCVA 1YLAA 1WJ7A 2ZTCA 2DWMA 1N33M 1J7KA 1PRBA 3HJQA 3U6SA 2R18A 3H4MA 3C3DA 3U60A 1J5EM 3DFZA 1LV7A 2C9OA 3SAVA 4YY3M 1ZV1A 1PJIA 1F4IA 1Q02A 2K6BA 5IREB 4I8OA 3TWKA 1W5TA 1NNUC 2KEBA 1NJFA 1V33A 2WZJA 4NSOB 4F1IA 4NRWA 2KHHA 4M9ZA 1T6OA 3IG5A 2CEAA 3GP1A 2QHOB 3U6CA 2F5PA 3RGPA 4DBGB 2Y0TA 3BBZA 1XWIA 3NBIA 1IBKM 3U6EA 1C1KA 4JI2M 1HNZM 2LHGA 1Z6TA 3QYEA 3CGWA 4AW4A 4L78A
chains in the Genus database with same CATH topology
1WGNA 1G4AE 3LCVB 3FRHA 4Q7JA 1TTEA 1OKSA 2MJ5B 1G41A 2OOBA 1P3QQ 3K9OA 2ZTDA 2DI0A 2BWEA 1IM2A 3GLHE 3H4JA 2HAKA 2JY5A 2QNJA 4UN2B 1VG5A 2JY6B 1WHCA 2JP7A 2JY7A 1HQYE 2KNZA 3E46A 4WP2A 2OO9A 3GLGE 1OTRA 2O25A 2OOAA 1XB2B 1V92A 1QZEA 1SG9A 2DHYA 1C7YA 2RRUA 1DV0A 3F92A 1XXHE 1WR1B 1GO5A 2EKFA 2LTUA 2LBCA 1ZMWA 2EJSA 2K9DA 2HWJA 1CUKA 2K0BX 1R4GA 2B3TA 3MMPA 2DAEA 1EFUB 1DO2A 2DZLA 3IECA 2JNHA 1DO0A 3FRIA 4HEOA 1WGLA 1T43A 2L4FA 3K9PA 5JI2E 1HT1E 1UFZA 1TR8A 3T6PA 1AIPC 3FE3A 2DAGA 2L2DA 2DAIA 2KNAA 2R0IA 1NV8A 2LVOC 3LCUA 2BWBA 1PGYA 1VEKA 1IXSA 2LVPC 1WIVA 1HJPA 3GLIE 2CP8A 2CWBA 4G3OA 2LVQD 1JR3E 1BVSA 2JY8A 1VDLA 4R71A 2DKLA 2MGWA 1OAIA 2JZ1A 4GEWA 3B89A 1YLAA 1WJ7A 1VEJA 2ZTCA 1VQ1A 2G3QA 5DFLA 1ZMUA 2EKKA 1KYIA 1ZV1A 1A5TA 1E94E 1F4IA 2KNVA 1Q02A 1IFYA 2LVNC 2WZJA 4F1IA 2DNAA 2KHHA 1T6OA 1G3IA 2MR9A 2JZ0A 2QSFX 2QHOB 4DBGB 2DAKA 1Y8GA 2L4EA 1OQYA 3BBZA 3IHPA 2H5XA 2JUJA 1MN3A 1VEGA 1ZMVA 3E21A 2MROB 1NV9A 2DAMA 4F2LA 3GLFE 2DENA 1HT2E 2LVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGN A;  1G4A E;  3LCV B;  3FRH A;  4Q7J A;  1TTE A;  1OKS A;  2MJ5 B;  1G41 A;  2OOB A;  1P3Q Q;  3K9O A;  2ZTD A;  2DI0 A;  2BWE A;  1IM2 A;  3GLH E;  3H4J A;  2HAK A;  2JY5 A;  2QNJ A;  4UN2 B;  1VG5 A;  2JY6 B;  1WHC A;  2JP7 A;  2JY7 A;  1HQY E;  2KNZ A;  3E46 A;  4WP2 A;  2OO9 A;  3GLG E;  1OTR A;  2O25 A;  2OOA A;  1XB2 B;  1V92 A;  1QZE A;  1SG9 A;  2DHY A;  1C7Y A;  2RRU A;  1DV0 A;  3F92 A;  1XXH E;  1WR1 B;  1GO5 A;  2EKF A;  2LTU A;  2LBC A;  1ZMW A;  2EJS A;  2K9D A;  2HWJ A;  1CUK A;  2K0B X;  1R4G A;  2B3T A;  3MMP A;  2DAE A;  1EFU B;  1DO2 A;  2DZL A;  3IEC A;  2JNH A;  1DO0 A;  3FRI A;  4HEO A;  1WGL A;  1T43 A;  2L4F A;  3K9P A;  5JI2 E;  1HT1 E;  1UFZ A;  1TR8 A;  3T6P A;  1AIP C;  3FE3 A;  2DAG A;  2L2D A;  2DAI A;  2KNA A;  2R0I A;  1NV8 A;  2LVO C;  3LCU A;  2BWB A;  1PGY A;  1VEK A;  1IXS A;  2LVP C;  1WIV A;  1HJP A;  3GLI E;  2CP8 A;  2CWB A;  4G3O A;  2LVQ D;  1JR3 E;  1BVS A;  2JY8 A;  1VDL A;  4R71 A;  2DKL A;  2MGW A;  1OAI A;  2JZ1 A;  4GEW A;  3B89 A;  1YLA A;  1WJ7 A;  1VEJ A;  2ZTC A;  1VQ1 A;  2G3Q A;  5DFL A;  1ZMU A;  2EKK A;  1KYI A;  1ZV1 A;  1A5T A;  1E94 E;  1F4I A;  2KNV A;  1Q02 A;  1IFY A;  2LVN C;  2WZJ A;  4F1I A;  2DNA A;  2KHH A;  1T6O A;  1G3I A;  2MR9 A;  2JZ0 A;  2QSF X;  2QHO B;  4DBG B;  2DAK A;  1Y8G A;  2L4E A;  1OQY A;  3BBZ A;  3IHP A;  2H5X A;  2JUJ A;  1MN3 A;  1VEG A;  1ZMV A;  3E21 A;  2MRO B;  1NV9 A;  2DAM A;  4F2L A;  3GLF E;  2DEN A;  1HT2 E;  2LVA A; 
#chains in the Genus database with same CATH topology
 1T3T A;  5IWA M;  2Z4R A;  5ITX A;  3FTF A;  1TTE A;  3RGS A;  2L7I A;  1AUA A;  2EUC A;  1I4W A;  1MX0 A;  2RKO A;  4GIP A;  1S3S A;  2VQE M;  4L8R C;  3HHW A;  3U6L A;  2DI0 A;  1N32 M;  3GPX A;  4AG5 A;  3HU1 A;  4D80 A;  3U6D A;  1JB0 F;  1HR0 M;  1H6U A;  3AL0 C;  3J7A S;  1D2N A;  2R4J A;  1IN6 A;  3TWL A;  1QYR A;  4OU7 A;  4HL4 A;  1XXH A;  5A2Q S;  3I04 M;  4M0D A;  5FTM A;  5ITR A;  1K3W A;  2F4V M;  2H1R A;  1YE9 A;  2XSZ A;  3E46 A;  3HHX A;  3KOX E;  1G71 A;  2QEN A;  3VLF B;  3GLG E;  4NL4 H;  4W5W A;  2O25 A;  2R6F A;  3HU2 A;  2DXI A;  2QP9 X;  2D7G A;  1GKI A;  3KW6 A;  1L1Z A;  1N78 A;  3VKG A;  2O01 F;  1QZE A;  4B7G A;  3RFW A;  2ZAN A;  1PJQ A;  1SG9 A;  2XSZ D;  4FD2 A;  1C7Y A;  3A98 B;  3I4Y A;  4JI0 M;  1QDR A;  2GNO A;  1K82 A;  5KPR A;  3HHY A;  5EP3 A;  2EKF A;  4Y28 F;  1TF0 B;  4D81 A;  2LTU A;  3HJ8 A;  4WUR A;  4IBE A;  1NJG A;  2LBC A;  4LZZ A;  3SAR A;  2KDL A;  5F3W A;  3WHL A;  3SAS A;  2APL A;  3FD9 A;  5BR8 M;  2K9D A;  4DUZ M;  2HWJ A;  4LGY A;  5DNY A;  2X4A A;  1L1T A;  2DWZ B;  1QAQ A;  4KO8 A;  1GAB A;  4PDG A;  1D0K A;  2F5N A;  3GO8 A;  4X64 M;  3GLF B;  2YR0 A;  3KSJ A;  1GL6 A;  3HX3 A;  1XMQ M;  1E9S A;  2XFT A;  4FVM A;  1L2B A;  4IBC A;  4NSR A;  1L8Q A;  1DO0 A;  2JNH A;  4FWD A;  2CHG A;  1WGL A;  2Z4S A;  3M7G A;  1HNX M;  2CRU A;  3QAU A;  4ANR A;  3J27 B;  1AIP C;  2XF3 A;  5JI3 E;  1J09 A;  5LMN M;  1UM8 A;  1ORY B;  1PJS A;  5GKN A;  2UUC M;  3FKE A;  5DYG A;  1TDZ A;  4GRI A;  1NV8 A;  2OPF A;  4P17 A;  3U6O A;  5EXP A;  1IXS A;  1R5L A;  2LVP C;  4AKI A;  1Q3C A;  2UUA M;  4QOZ C;  4I5S A;  3MJ5 A;  1QUT A;  3E9S A;  5C18 A;  5ITY A;  4G3O A;  2HCB A;  1GJT A;  3VFD A;  1JR3 E;  5IT9 S;  1MU5 A;  1VDL A;  1E32 A;  2QBY A;  4JI5 M;  3BXW A;  3C58 A;  7CAT A;  3GQ5 A;  2X8A A;  3ZH9 B;  4G4R A;  1OIP A;  2G3Q A;  4RF1 A;  4DUY M;  3T15 A;  1PM5 A;  4RF0 A;  4IBJ A;  3T1Y M;  3I4V A;  3HJS A;  4LJ9 A;  3K92 A;  3GRV A;  3PVS A;  1SXJ B;  4GHA A;  4B3T M;  2KW0 A;  2I7P A;  2DNA A;  3BOS A;  3FUW A;  4G6Z A;  4CJ6 A;  3LQR A;  2XFS A;  4P16 A;  1G3I A;  2MR9 A;  2JZ0 A;  2R62 A;  3KP0 E;  3DA1 A;  3ZC7 B;  4D82 A;  5C1B A;  5ITU A;  3JR4 A;  4MM3 B;  2R4E A;  3HGI A;  4GH9 A;  3IHP A;  2H5X A;  2JUJ A;  3L28 A;  4FWH A;  1VEG A;  1ZMV A;  4G4N A;  2MRO B;  5EJC A;  3GLF E;  8CAT A;  2XLJ A;  2DEN A;  1OAO C;  2LVA A;  4IBD A;  4PCZ A;  1WGN A;  1V34 A;  4RNA A;  4Q7J A;  3J80 S;  4LF5 M;  3KOZ E;  3SFZ A;  3AKZ A;  5ITT A;  3CF2 A;  2CE7 A;  3SMP A;  3SAW A;  1Q39 A;  4NC6 A;  1XNQ M;  2OOB A;  3R9X B;  4AKH A;  1OFI A;  3K9O A;  2VII A;  3JR5 A;  3SBJ A;  3L26 A;  4PDI A;  1IM2 A;  1WXQ A;  3FUU A;  4BBA A;  3H4J A;  1X37 A;  2DHR A;  4LRT A;  2HAK A;  4DV0 M;  2XZU A;  1GLN A;  5L8R F;  2UXD M;  4G4O A;  4UN2 B;  1VG5 A;  3Q8G A;  3L25 A;  3KS4 A;  3GLI B;  4LF6 M;  3GLH A;  3LVV A;  3GPP A;  5KO3 A;  2L7H A;  1IQP A;  2JY7 A;  3HKP A;  3U60 B;  2JA2 A;  2YFQ A;  5BPV A;  1HQY E;  2BJV A;  3MHV C;  4REZ A;  1QQW A;  3W0L B;  4AG6 A;  1IY1 A;  1Z5C A;  3TQS A;  3AJI B;  1D0M A;  4QNM A;  4AQY M;  1IXR C;  2D7E A;  3HZJ A;  3QWL A;  4PD2 A;  2V6Z M;  4CIZ A;  2M5Z A;  2KZU A;  1Z59 A;  3GRU A;  3L27 A;  2JXN A;  1QZM A;  4S12 A;  3SMS A;  2I7N A;  2YNM D;  2F5Q A;  4GKK M;  4GKJ M;  4TUW A;  1DGF A;  3NBX X;  4KOD A;  1SXJ E;  1WR1 B;  2CV1 A;  2R44 A;  3FYD A;  1GO5 A;  3K1J A;  1L2D A;  4X66 M;  4B3M M;  1L2C A;  2VF7 A;  2KRK A;  3HY5 A;  2RGO A;  3JAM S;  2FH0 A;  4QHT A;  2J7N A;  3VK8 A;  4B7F A;  4JI4 M;  1CUK A;  1KFV A;  4GC5 A;  2R45 A;  4IBG A;  5EXX A;  3FTD A;  2FOI C;  3VDP A;  4B3S M;  1E9R A;  3U6P A;  1GL7 A;  1NHW C;  5EQT A;  1EFU B;  3HHZ A;  1DGB A;  2DZL A;  4IBK A;  2BNK A;  5EP1 A;  2WSC F;  5KQD A;  2Q2E B;  1JR3 A;  1DGH B;  1HNW M;  2Y21 A;  3K9P A;  4R7G A;  3U61 A;  1UFZ A;  3ZCB B;  4JYA M;  3FE3 A;  1IY2 A;  4OW0 A;  3AV0 A;  3AOE C;  1NO1 A;  3FTC A;  4KHP M;  3B7Q A;  1PJJ A;  2W82 A;  3A45 A;  3CTW B;  2LVO C;  2BWB A;  2CUZ A;  3LMM A;  2DWL A;  4BB9 A;  4DR4 M;  3LQQ A;  4L4U A;  4KT0 F;  1Q3B A;  5KPT A;  2F5O A;  5KPZ A;  1ZAE A;  3U6M A;  1Z5A A;  1HJP A;  3GLI E;  1OJL A;  3TE6 A;  2CP8 A;  2CWB A;  1YSY A;  2DZN B;  2Z3X A;  1IY0 A;  4EIW A;  4JI1 M;  2WSE F;  2JY8 A;  2P5T A;  3FUX A;  4OVZ B;  3W68 A;  4LFB M;  3EIH A;  2JZ1 A;  3B89 A;  1VEJ A;  3NWL A;  3SYK A;  3GPY A;  1NNJ A;  1VQ1 A;  2E5L M;  3Q8X A;  2ZBK B;  3W0F A;  3VK7 A;  1YUB A;  2XZF A;  1QDT A;  3UZU A;  2QZ4 A;  1IFY A;  2CFO A;  4JI6 M;  1IN8 A;  4PT5 A;  4QHS A;  3B7Z A;  1PJT A;  4FCW A;  2HKJ A;  4LJ5 A;  3L2A A;  3SHF A;  1IBM M;  1OFH A;  1SXJ C;  3C9P A;  1NY5 A;  2D7H A;  1OQY A;  4B7H A;  1MJG M;  1XNR M;  5ITX E;  3EIE A;  3SAT A;  4XGI A;  3SAU A;  5IZ7 D;  1NV9 A;  4LF7 M;  4F2L A;  2F5S A;  3B7N A;  4M9S A;  1N36 M;  1I94 M;  2OQ4 A;  1G4A E;  1IXZ A;  3LCV B;  2L6O A;  2AHM A;  2G5G X;  5FTK A;  4ITQ A;  3VKH A;  4DR7 M;  1OKS A;  4MH0 E;  2MJ5 B;  1G41 A;  3PXG A;  1P3Q Q;  1IXS B;  3L29 A;  5EXS A;  3PNV A;  2DZO B;  4JXJ A;  4L15 A;  4B3R M;  4JI8 M;  4CGY B;  2QBY B;  3TPZ A;  2HHH M;  3DOA A;  4LFA M;  3GQ4 A;  2JY6 B;  4DV4 M;  4FCT A;  2O5R A;  2HL7 A;  2JP7 A;  3M0E A;  3HWS A;  5EP4 A;  3I51 A;  4NOO B;  1VDD A;  3K2L A;  4LCB A;  2KNZ A;  3W67 A;  4CHT B;  5FLX S;  3T1H M;  2OO9 A;  3A46 A;  3SC3 A;  5FTJ A;  1Z5B A;  4DV2 M;  4NXN M;  4A3V B;  2LNH C;  1N34 M;  3KFU G;  4FW9 A;  4I4L A;  3THG A;  4LJ4 A;  1XB2 B;  4IBB A;  3U5Z A;  3UGJ A;  4DV6 M;  3GLG A;  4DV7 M;  1DV0 A;  2KXE A;  1IN4 A;  3F92 A;  3R8F A;  2MH8 A;  1OIZ A;  1N77 A;  2LH0 A;  2GQF A;  3K8Z A;  2JWS A;  3SYL A;  2FNA A;  1HQC A;  2WSF F;  5ITQ A;  1EIJ A;  4RKU F;  2QCU A;  4KLN A;  2EJS A;  2NQ8 C;  2LXE A;  4JI7 M;  2VF8 A;  3QYB A;  2V1U A;  1R4G A;  2B3T A;  3GRY A;  3MMP A;  4GC9 A;  4AZF A;  1TH4 A;  2KZS A;  3D8L A;  1W5S A;  2CV0 A;  4LF4 M;  2FE8 A;  2J5Y A;  3GLI A;  4AI6 A;  4AKG A;  1DGG A;  1NY6 A;  3IEC A;  2ERC A;  3KP1 E;  4LJ7 A;  1QAN A;  3FUV A;  3FRI A;  3DZD A;  4HEO A;  2R65 A;  2N35 A;  3OTO M;  2UUB M;  3T6P A;  2ZAM A;  2DAG A;  3FUT A;  1TH3 A;  2DAI A;  2K47 A;  3B9P A;  2A5Y B;  2R46 A;  3GLH B;  1QAM A;  2XEP A;  3B74 A;  3CF6 E;  2VQF M;  4JV5 M;  1QAO A;  1PGY A;  1VEK A;  1G8P A;  4G4Q A;  2VDB B;  3KOW E;  3AFH A;  4LJ8 A;  4L16 A;  2XGN A;  4IIW A;  1IBL M;  4R3D A;  1JQJ C;  4MGZ E;  1QUS A;  2KA6 B;  4LJ6 A;  2LWX A;  3UK6 A;  4X62 M;  1BVS A;  4R71 A;  3LW5 F;  3AOG A;  4DR1 M;  3E4R A;  1TDH A;  2QQ8 A;  4MGI E;  2MGW A;  4QOS A;  1OAI A;  5FSW A;  4GEW A;  1R2Y A;  1QVR A;  4CIS A;  4L6V 6;  5DFL A;  2UXC M;  4DR6 M;  1TH2 A;  4LG2 A;  1ZMU A;  1FJG M;  2EKK A;  1KYI A;  4GIT A;  4DR3 M;  4LF9 M;  1IN7 A;  1A5T A;  1E94 E;  3TL4 X;  2KNV A;  3TWM A;  4IJE A;  4LF8 M;  2KRU A;  3RE8 A;  2C5R A;  1DGH A;  1XXH B;  2LVN C;  3KDS E;  4WW0 A;  2C99 A;  4M9X A;  1NVM A;  2FFJ A;  4LRS A;  2QSF X;  3GQ3 A;  4NRV A;  4GMQ A;  1JR3 D;  2V1C A;  4XK8 F;  2DAK A;  1Y8G A;  1LTM A;  2L4E A;  2ZM6 M;  4LGM A;  5LMU M;  1XHB A;  1N75 A;  1MN3 A;  5EXT A;  2Y20 A;  3E21 A;  4HLQ A;  1GVN A;  3U61 B;  2DAM A;  3J2P B;  1NSF A;  4FWG A;  3GRR A;  2BJW A;  3T38 A;  5E26 A;  4X65 M;  1HT2 E;  3C3E A;  1R7R A;  3D8B A;  3ILK A;  4BLC A;  2ZAO A;  1ZQ9 A;  3FRH A;  3ZQJ A;  4OVZ A;  4YHH M;  3PNY A;  4DV5 M;  2XH9 A;  2G8L A;  3GLF A;  4LY6 A;  2DWN A;  4LZJ A;  3UJN A;  2ZTD A;  4Z8X A;  4XBO A;  2BWE A;  3PFI A;  2YQZ A;  1RU3 A;  3GLH E;  3KS8 A;  3AOE A;  4GHL A;  3V76 A;  3CF0 A;  1R2Z A;  2JY5 A;  2QNJ A;  1G59 A;  2RGH A;  1WHC A;  1R6B X;  4MGY E;  2UU9 M;  3LVW A;  2C98 A;  1GJS A;  3KOY E;  4M0W A;  3SHG B;  2Y0Q A;  4WP2 A;  3MK6 A;  4LJA A;  4MGH A;  2CHQ A;  5H37 D;  2CHV A;  1OTR A;  2DVW B;  4DV1 M;  2L09 A;  2OOA A;  5FTL A;  4K0K M;  1XMO M;  2QPA A;  3FTE A;  1V92 A;  4JN6 A;  1IN5 A;  5KQ8 A;  3KSX A;  2DHY A;  2EO2 A;  4IJF A;  2RRU A;  4B08 A;  3UMM A;  4OX9 M;  2J7O A;  3KXE C;  4NXM M;  1XXH E;  4DR2 M;  1K3X A;  4MB7 A;  1ZMW A;  2Z8Y M;  4MGK E;  1NHG C;  5E6J A;  2K0B X;  1KSF X;  1SXJ A;  3U6Q A;  2C96 A;  2DAE A;  1D0L A;  3GPU A;  5DYI A;  1DO2 A;  4LFC M;  3I01 M;  1EE8 A;  3HU3 A;  4Z6Y A;  1T43 A;  2L4F A;  5JI2 E;  4ZPX A;  1HT1 E;  2LHC A;  4JI3 M;  1SXJ D;  4DR5 M;  1TR8 A;  4IBI A;  5EP2 A;  1TGU A;  2L2D A;  4I81 A;  2KNA A;  2R0I A;  3J7B A;  3M6A A;  2CV2 A;  3LCU A;  4II7 A;  2C9C A;  4DV3 M;  4IBF A;  2UXB M;  2X49 A;  2Z7J A;  3KVW A;  1FNN A;  5FTN A;  3VDU A;  2EA0 A;  1XC8 A;  1WIV A;  3FYC A;  3A42 A;  3WHK A;  2M60 A;  4QNR A;  3IG8 A;  2LVQ D;  3J81 S;  3U5Z B;  2DKL A;  3GLG B;  2FS1 A;  4FCV A;  1YLA A;  1WJ7 A;  2ZTC A;  2DWM A;  1N33 M;  1J7K A;  1PRB A;  3HJQ A;  3U6S A;  2R18 A;  3H4M A;  3C3D A;  3U60 A;  1J5E M;  3DFZ A;  1LV7 A;  2C9O A;  3SAV A;  4YY3 M;  1ZV1 A;  1PJI A;  1F4I A;  1Q02 A;  2K6B A;  5IRE B;  4I8O A;  3TWK A;  1W5T A;  1NNU C;  2KEB A;  1NJF A;  1V33 A;  2WZJ A;  4NSO B;  4F1I A;  4NRW A;  2KHH A;  4M9Z A;  1T6O A;  3IG5 A;  2CEA A;  3GP1 A;  2QHO B;  3U6C A;  2F5P A;  3RGP A;  4DBG B;  2Y0T A;  3BBZ A;  1XWI A;  3NBI A;  1IBK M;  3U6E A;  1C1K A;  4JI2 M;  1HNZ M;  2LHG A;  1Z6T A;  3QYE A;  3CGW A;  4AW4 A;  4L78 A; 
#chains in the Genus database with same CATH homology
 1WGN A;  1G4A E;  3LCV B;  3FRH A;  4Q7J A;  1TTE A;  1OKS A;  2MJ5 B;  1G41 A;  2OOB A;  1P3Q Q;  3K9O A;  2ZTD A;  2DI0 A;  2BWE A;  1IM2 A;  3GLH E;  3H4J A;  2HAK A;  2JY5 A;  2QNJ A;  4UN2 B;  1VG5 A;  2JY6 B;  1WHC A;  2JP7 A;  2JY7 A;  1HQY E;  2KNZ A;  3E46 A;  4WP2 A;  2OO9 A;  3GLG E;  1OTR A;  2O25 A;  2OOA A;  1XB2 B;  1V92 A;  1QZE A;  1SG9 A;  2DHY A;  1C7Y A;  2RRU A;  1DV0 A;  3F92 A;  1XXH E;  1WR1 B;  1GO5 A;  2EKF A;  2LTU A;  2LBC A;  1ZMW A;  2EJS A;  2K9D A;  2HWJ A;  1CUK A;  2K0B X;  1R4G A;  2B3T A;  3MMP A;  2DAE A;  1EFU B;  1DO2 A;  2DZL A;  3IEC A;  2JNH A;  1DO0 A;  3FRI A;  4HEO A;  1WGL A;  1T43 A;  2L4F A;  3K9P A;  5JI2 E;  1HT1 E;  1UFZ A;  1TR8 A;  3T6P A;  1AIP C;  3FE3 A;  2DAG A;  2L2D A;  2DAI A;  2KNA A;  2R0I A;  1NV8 A;  2LVO C;  3LCU A;  2BWB A;  1PGY A;  1VEK A;  1IXS A;  2LVP C;  1WIV A;  1HJP A;  3GLI E;  2CP8 A;  2CWB A;  4G3O A;  2LVQ D;  1JR3 E;  1BVS A;  2JY8 A;  1VDL A;  4R71 A;  2DKL A;  2MGW A;  1OAI A;  2JZ1 A;  4GEW A;  3B89 A;  1YLA A;  1WJ7 A;  1VEJ A;  2ZTC A;  1VQ1 A;  2G3Q A;  5DFL A;  1ZMU A;  2EKK A;  1KYI A;  1ZV1 A;  1A5T A;  1E94 E;  1F4I A;  2KNV A;  1Q02 A;  1IFY A;  2LVN C;  2WZJ A;  4F1I A;  2DNA A;  2KHH A;  1T6O A;  1G3I A;  2MR9 A;  2JZ0 A;  2QSF X;  2QHO B;  4DBG B;  2DAK A;  1Y8G A;  2L4E A;  1OQY A;  3BBZ A;  3IHP A;  2H5X A;  2JUJ A;  1MN3 A;  1VEG A;  1ZMV A;  3E21 A;  2MRO B;  1NV9 A;  2DAM A;  4F2L A;  3GLF E;  2DEN A;  1HT2 E;  2LVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...