1WGNA

Solution structure of uba domain of human ubiquitin associated protein 1 (ubap1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
b'GSSGSSGAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENIEQILDYLFAHSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin associated protein
molecule tags Structural genomics, unknown function
source organism Homo sapiens
publication title Solution Structure of UBA domain of Human Ubiquitin Associated Protein 1 (UBAP1)
rcsb
total genus 13
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wgnA00
2KNZA 1OTRA 1VG5A 1JR3E 1OAIA 2OOBA 4F1IA 1CUKA 1WGLA 3K9OA 2L2DA 1G4AE 1E94E 1WHCA 1OKSA 1ZMWA 2K0BX 2MGWA 1BVSA 4WP2A 1HQYE 1HT2E 2DAGA 3E21A 2L4FA 2LVOC 1HT1E 2MR9A 2DKLA 3E46A 3T6PA 1V92A 2RRUA 1G41A 1TR8A 1ZMUA 2ZTDA 1DO2A 2OOAA 2HAKA 2DAKA 2LBCA 4F2LA 2DI0A 1VQ1A 1ZV1A 3BBZA 3B89A 1G3IA 4GEWA 1XB2B 3LCUA 2BWBA 2CWBA 2DENA 3GLGE 3K9PA 1EFUB 1GO5A 1T43A 1P3QQ 2KHHA 1C7YA 4R71A 1ZMVA 2KNVA 2EKFA 2O25A 1MN3A 3GLHE 2BWEA 3F92A 1VEJA 2MROB 1WIVA 2HWJA 5DFLA 4DBGB 4G3OA 1Q02A 2CP8A 2LVPC 3IECA 2JZ1A 1A5TA 4Q7JA 1DO0A 1UFZA 2JY5A 1HJPA 2ZTCA 1F4IA 2DAEA 1IXSA 1NV9A 2LVNC 1WR1B 2G3QA 3GLIE 1SG9A 1IFYA 1QZEA 1PGYA 2EJSA 2DNAA 3FE3A 3FRHA 1WGNA 5JI2E 1KYIA 2JY7A 1VDLA 2DHYA 3GLFE 3LCVB 2JUJA 2L4EA 2QSFX 2JZ0A 2R0IA 3MMPA 2JY8A 1VEGA 2DAMA 4UN2B 2LVQD 2H5XA 3FRIA 1NV8A 2LTUA 4HEOA 1R4GA 1VEKA 3IHPA 2JNHA 1T6OA 1Y8GA 1WJ7A 2JY6B 2DAIA 2QNJA 2JP7A 1AIPC 2DZLA 2WZJA 1TTEA 1DV0A 1YLAA 2KNAA 2MJ5B 2QHOB 1XXHE 2EKKA 2B3TA 3H4JA 1IM2A 1OQYA 2K9DA 2OO9A 2LVAA
chains in the Genus database with same CATH superfamily
2FNAA 3QWLA 2XZFA 1Z6TA 4JI0M 1VG5A 3LW5F 3GLIA 3FTEA 3HJ8A 3RGPA 1MU5A 3KDSE 5H37D 3KSJA 1QVRA 1FNNA 3VFDA 3U6QA 3K2LA 1OJLA 3U60A 4JI5M 4WURA 3CF2A 1FJGM 3K92A 1SXJA 1OKSA 1Z5AA 1YSYA 1ZMWA 3C58A 3SAVA 1TF0B 3L28A 4AI6A 2Y0TA 4L6V6 4WP2A 4JI3M 3U61B 1R6BX 3GPPA 2KW0A 1HT2E 2G8LA 3E21A 1NNJA 5ITYA 4QOSA 4LFCM 3U6OA 2LVOC 3FYDA 2DWNA 4B7GA 4JI6M 2J5YA 2GNOA 3PNVA 3E46A 3K8ZA 4LJ5A 3T6PA 1V92A 3HHWA 4HLQA 4AW4A 1SXJE 3MK6A 5EP1A 2ZTDA 4IBKA 2OOAA 1MX0A 2HAKA 2LBCA 5EQTA 4CGYB 3LQRA 1QAQA 2VF7A 3UMMA 1ZV1A 2CEAA 4GIPA 3GLFA 3AFHA 4L78A 1XB2B 2UU9M 1EE8A 4PT5A 3K9PA 3GLGE 3GQ5A 1Q3BA 1T3TA 2DWLA 1NJFA 3U6MA 4LJ7A 7CATA 1NJGA 1DGGA 4R71A 2L09A 3GQ3A 4X64M 1MN3A 1VDDA 4LJ8A 2LXEA 1JQJC 4NRWA 2HWJA 1DGHB 3TL4X 4BLCA 1NSFA 2CRUA 4WW0A 3J81S 4DR2M 3EIEA 3IECA 2JZ1A 1N36M 2OPFA 2M5ZA 3D8BA 3BOSA 2VIIA 4JV5M 4I5SA 1DO0A 1XMOM 3U6DA 1K3XA 2ZTCA 2DAEA 3KFUG 2XSZA 1JR3A 2G3QA 5LMNM 3L27A 2E5LM 5EXXA 3A45A 1I4WA 2R4EA 3FE3A 1S3SA 3D8LA 3HHXA 3LQQA 1WGNA 4MGYE 1KYIA 3RFWA 3SAUA 1R2YA 4L15A 3TQSA 1QAOA 4DR5M 2JUJA 2QQ8A 2R0IA 2M60A 4CHTB 4PD2A 1PJJA 2R45A 4FWHA 2CE7A 2C9OA 2R18A 4G4QA 1I94M 1E9RA 4LF6M 2H5XA 4R3DA 2VQEM 3HU3A 2LTUA 3AL0C 3L25A 4B7FA 1VEKA 2KRKA 1LTMA 1IY1A 1OIZA 1OIPA 1XHBA 2JY6B 2JP7A 3SMSA 1HR0M 4KO8A 2KZSA 4JYAM 3SHGB 1TTEA 3KOZE 2O5RA 2HHHM 3ZCBB 1NHGC 4L4UA 1GABA 4JXJA 1RU3A 4NXNM 3HJSA 3W0LB 3GLIB 2UXCM 2XH9A 4IBJA 5EJCA 1GLNA 2H1RA 2B3TA 3M6AA 5FLXS 3EIHA 2K9DA 4LFAM 3JAMS 4OX9M 3GP1A 2OO9A 1IY2A 4MH0E 3KS8A 2MH8A 2OOBA 3HU2A 4MGZE 3U6LA 1PM5A 4B3MM 1SXJB 1WGLA 3K9OA 3U61A 1IBLM 2L2DA 1OFIA 4B3TM 5JI3E 1QDTA 3HZJA 1SXJD 3K1JA 4DV2M 1HNZM 2FS1A 2L7IA 2KRUA 2K0BX 2LHGA 2MGWA 3DA1A 4REZA 1BVSA 1Z5CA 2Z8YM 3C3DA 4LJ4A 4IBGA 1IN8A 3PNYA 2RGOA 1NY6A 2DAGA 4LJ6A 4LGMA 2Y0QA 5GKNA 3CTWB 4BB9A 3GPUA 4GC9A 2LNHC 4CJ6A 4MGHA 2MR9A 2DKLA 5FTJA 2CHQA 4FCVA 4AG6A 2RRUA 5FSWA 3KSXA 4IIWA 4JI2M 1TR8A 1ZMUA 3W68A 3LVVA 4F2LA 4AKIA 2DI0A 2HCBA 2QBYA 4B3RM 1VQ1A 3HKPA 5IREB 5DNYA 1G59A 4LRTA 4M9XA 1XXHA 3B89A 3QAUA 3U6EA 4DR7M 4LF7M 2DENA 1EFUB 3SBJA 1HQCA 2I7PA 3B7ZA 4X66M 1IQPA 2BJWA 2R44A 4II7A 3KOYE 4I81A 2X49A 3UZUA 5ITTA 1N75A 1K82A 1ZMVA 2G5GX 3RGSA 5FTLA 2O25A 3AOEC 1PJQA 4OW0A 2D7HA 3F92A 1XWIA 2ERCA 4DR3M 3T1HM 4IBIA 3WHKA 2MROB 1G8PA 4LG2A 1YE9A 4D81A 2ZAOA 1R5LA 4DBGB 2XLJA 2LWXA 3W67A 1L2CA 2KA6B 2LVPC 4HL4A 3U5ZB 1QQWA 1N77A 3J27B 4AZFA 2KZUA 5EP2A 4CIZA 2I7NA 3A98B 2CV2A 5C1BA 2D7GA 3VK7A 3CF6E 5IT9S 3B74A 3E9SA 3Q8GA 4Z8XA 1IXSA 5LMUM 2LVNC 4MGKE 2V1CA 3GPYA 4MM3B 3VK8A 1PGYA 3TPZA 2XFTA 2DNAA 3FRHA 3KOXE 1D0LA 4IBBA 2WSEF 3I4YA 2JY7A 2KDLA 3FUVA 2DHYA 4Z6YA 3GLFE 4AQYM 4XGIA 3GLGA 2JWSA 2JY8A 1VEGA 2DAMA 3GLHB 4UN2B 2R46A 3WHLA 2ZANA 1NV8A 3SAWA 2UXBM 4RKUF 2CV1A 4DV1M 2NQ8C 3SC3A 4FCTA 1IN6A 3I01M 1Y8GA 1WJ7A 3L29A 4Y28F 1AIPC 3SASA 2DZLA 5DYIA 2R62A 1DV0A 3GO8A 1SXJC 2XFSA 3R8FA 4I8OA 3HGIA 5ITXA 3U60B 3IG5A 1IXZA 1YLAA 4B08A 1L2BA 2F5QA 4NRVA 2MJ5B 3HY5A 2EKKA 5IWAM 4OVZB 3FUWA 3VLFB 2R6FA 1IM2A 1OQYA 2A5YB 3H4JA 3B7QA 4P16A 2XZUA 4TUWA 3ZH9B 3KVWA 2KNZA 1OTRA 3T15A 2APLA 1JR3E 1Q3CA 3GRYA 1PJIA 4S12A 5KQ8A 3ILKA 4PDIA 4GRIA 5ITXE 1TDZA 1G4AE 4FCWA 4ZPXA 1WHCA 3UJNA 1TDHA 1NO1A 4DV5M 4L16A 4K0KM 3NWLA 2XGNA 2DWZB 3QYEA 5EP3A 4GH9A 1HQYE 3OTOM 2L7HA 5BPVA 4G4RA 2D7EA 3MHVC 3VDUA 1E32A 1HT1E 4NXMM 4DV6M 4GHAA 1V34A 1Q39A 3LMMA 4JI7M 5FTKA 1XXHB 3NBXX 4IBCA 3R9XB 1IXRC 4GKKM 2CHGA 4LFBM 1JB0F 4EIWA 3I51A 1TGUA 2QZ4A 4LJ9A 4R7GA 3PXGA 1IY0A 4X62M 1N33M 2C99A 3BBZA 1GJTA 1G3IA 4GEWA 4YY3M 3LCUA 2BWBA 2CWBA 1JR3D 4L8RC 4I4LA 4NOOB 5FTNA 2UUBM 1GO5A 2FH0A 2CHVA 3DOAA 3I04M 2Z3XA 1N78A 3SHFA 3J7BA 3HHZA 1P3QQ 1QDRA 4ITQA 1OAOC 1C7YA 4LF8M 4AKHA 1XMQM 3TWMA 3QYBA 2KNVA 3ZQJA 2EKFA 1KSFX 3U5ZA 4DUZM 2Z4SA 4NC6A 2JXNA 3U6SA 2BWEA 4LZZA 5KPTA 4DV4M 3KOWE 4KLNA 2QP9X 4DR1M 1NHWC 1GJSA 1WIVA 1ZAEA 2KXEA 3UK6A 3DZDA 5DFLA 3GLFB 2HL7A 4DV7M 3SATA 4LF4M 2DWMA 2UXDM 2FFJA 3SFZA 4DR6M 4NSOB 3L2AA 2ZM6M 4LY6A 2VF8A 4Q7JA 1IXSB 2R65A 5EP4A 1UFZA 1HJPA 1D0MA 3AOGA 5KQDA 3TWLA 3GQ4A 1F4IA 1NV9A 1GKIA 1WR1B 4LCBA 1IN5A 3GLIE 1R7RA 1SG9A 1IFYA 2GQFA 1QZEA 3GLGB 1GL7A 1QZMA 2KEBA 3HJQA 3HX3A 3T38A 3L26A 4AKGA 1GVNA 1IN7A 5JI2E 4GKJM 4A3VB 1DGHA 4DV3M 2WSFF 2F5PA 1VDLA 3PVSA 2W82A 4NSRA 2XEPA 2L4EA 2JZ0A 5EXSA 5ITRA 4IBFA 1Z59A 4GHLA 3KP1E 1G71A 2C9CA 1EIJA 4DR4M 1NY5A 1XNRM 4X65M 1J7KA 1PJSA 4NL4H 1H6UA 2LHCA 1R4GA 3AJIB 3IHPA 4PCZA 2UUCM 4MGIE 1T6OA 1UM8A 2QBYB 2DAIA 2Y21A 2P5TA 4MB7A 5E26A 1W5TA 2J7NA 4OVZA 4KHPM 4FW9A 3FUTA 2YQZA 1GL6A 2XF3A 3GRRA 2K47A 2VDBB 3M0EA 3FUUA 2HKJA 1QUSA 4YHHM 4JI4M 5KPRA 1X37A 3FTCA 3MJ5A 2Z4RA 5DYGA 3GRVA 3SMPA 4G4NA 2C5RA 2QHOB 3SYLA 3UGJA 2VQFM 3U6CA 3VDPA 3JR4A 2CUZA 4QHTA 3RE8A 4AG5A 3HWSA 1ZQ9A 4XBOA 4ANRA 8CATA 1OAIA 3V76A 2RKOA 1L1ZA 4F1IA 1CUKA 1TH3A 4IJEA 3M7GA 2OQ4A 3AKZA 3FTFA 1E94E 3SYKA 4LZJA 4LF5M 1IN4A 3VKGA 3B7NA 2J7OA 4FWDA 4GC5A 4KODA 4D80A 5ITQA 2DZOB 3KXEC 4QNMA 5ITUA 1LV7A 3PFIA 2JA2A 5EXPA 2YNMD 4RF1A 2AHMA 3H4MA 4QOZC 1QAMA 1MJGM 4B7HA 2R4JA 2L4FA 3A46A 1TH4A 3U6PA 4GITA 2V1UA 4RF0A 2CFOA 3BXWA 2F5NA 2QCUA 2BJVA 3TWKA 1E9SA 2Y20A 3A42A 3JR5A 2DVWB 1G41A 2Q2EB 1DO2A 4OU7A 2DAKA 2QENA 1PRBA 3I4VA 3W0FA 4JI1M 2C98A 4BBAA 3KS4A 4FVMA 4M0WA 4P17A 1XNQM 3IG8A 2EUCA 2X8AA 5FTMA 1T43A 3CGWA 5KO3A 1QUTA 4PDGA 1HNXM 5L8RF 2O01F 2KHHA 3KW6A 2QPAA 5BR8M 1QYRA 4RNAA 2F5OA 3GLHE 3T1YM 4FWGA 3FYCA 1VEJA 4LGYA 4IJFA 1AUAA 4DUYM 1OFHA 3E4RA 3FKEA 4G3OA 3THGA 1Q02A 2CP8A 3TE6A 1DGFA 2XSZD 3B9PA 4LJAA 4QNRA 4W5WA 1A5TA 3AV0A 2EO2A 1L8QA 1XC8A 2DHRA 1TH2A 1L1TA 1N34M 4IBEA 1N32M 2WSCF 1J5EM 2JY5A 1IBKM 4G4OA 3NBIA 2ZBKB 3GLHA 3C3EA 5IZ7D 4GMQA 3HHYA 5F3WA 3GPXA 2N35A 1WXQA 2EJSA 5C18A 3J7AS 5A2QS 2DZNB 4KT0F 1YUBA 4QHSA 1KFVA 2F4VM 3C9PA 3Q8XA 2LH0A 2EA0A 4XK8F 2Z7JA 2CV0A 2X4AA 3LCVB 3GRUA 2FOIC 4LF9M 2QSFX 3MMPA 4FD2A 2UUAM 2C96A 2RGHA 1D0KA 2DXIA 1DGBA 1W5SA 3CF0A 4M9SA 5KPZA 2LVQD 3J80S 1HNWM 3FRIA 2K6BA 4G6ZA 1NNUC 2YFQA 3LVWA 3VKHA 4M0DA 2ZAMA 1PJTA 4HEOA 4CISA 2F5SA 2L6OA 4DV0M 4LRSA 1NVMA 4M9ZA 1L2DA 3KP0E 1C1KA 2JNHA 1J09A 2QNJA 3HU1A 1K3WA 2WZJA 3ZC7B 3FUXA 3FTDA 2V6ZM 4IBDA 1V33A 2BNKA 1IBMM 2FE8A 3AOEA 4JI8M 2YR0A 3SARA 5E6JA 2KNAA 3FD9A 1R2ZA 5EXTA 1XXHE 1ORYB 3DFZA 1D2NA 1Z5BA 1QANA 3J2PB 4B3SM 4D82A 4JN6A 2LVAA
chains in the Genus database with same CATH topology
2KNZA 1OTRA 1VG5A 1JR3E 1OAIA 2OOBA 4F1IA 1CUKA 1WGLA 3K9OA 2L2DA 1G4AE 1E94E 1WHCA 1OKSA 1ZMWA 2K0BX 2MGWA 1BVSA 4WP2A 1HQYE 1HT2E 2DAGA 3E21A 2L4FA 2LVOC 1HT1E 2MR9A 2DKLA 3E46A 3T6PA 1V92A 2RRUA 1G41A 1TR8A 1ZMUA 2ZTDA 1DO2A 2OOAA 2HAKA 2DAKA 2LBCA 4F2LA 2DI0A 1VQ1A 1ZV1A 3BBZA 3B89A 1G3IA 4GEWA 1XB2B 3LCUA 2BWBA 2CWBA 2DENA 3GLGE 3K9PA 1EFUB 1GO5A 1T43A 1P3QQ 2KHHA 1C7YA 4R71A 1ZMVA 2KNVA 2EKFA 2O25A 1MN3A 3GLHE 2BWEA 3F92A 1VEJA 2MROB 1WIVA 2HWJA 5DFLA 4DBGB 4G3OA 1Q02A 2CP8A 2LVPC 3IECA 2JZ1A 1A5TA 4Q7JA 1DO0A 1UFZA 2JY5A 1HJPA 2ZTCA 1F4IA 2DAEA 1IXSA 1NV9A 2LVNC 1WR1B 2G3QA 3GLIE 1SG9A 1IFYA 1QZEA 1PGYA 2EJSA 2DNAA 3FE3A 3FRHA 1WGNA 5JI2E 1KYIA 2JY7A 1VDLA 2DHYA 3GLFE 3LCVB 2JUJA 2L4EA 2QSFX 2JZ0A 2R0IA 3MMPA 2JY8A 1VEGA 2DAMA 4UN2B 2LVQD 2H5XA 3FRIA 1NV8A 2LTUA 4HEOA 1R4GA 1VEKA 3IHPA 2JNHA 1T6OA 1Y8GA 1WJ7A 2JY6B 2DAIA 2QNJA 2JP7A 1AIPC 2DZLA 2WZJA 1TTEA 1DV0A 1YLAA 2KNAA 2MJ5B 2QHOB 1XXHE 2EKKA 2B3TA 3H4JA 1IM2A 1OQYA 2K9DA 2OO9A 2LVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNZ A;  1OTR A;  1VG5 A;  1JR3 E;  1OAI A;  2OOB A;  4F1I A;  1CUK A;  1WGL A;  3K9O A;  2L2D A;  1G4A E;  1E94 E;  1WHC A;  1OKS A;  1ZMW A;  2K0B X;  2MGW A;  1BVS A;  4WP2 A;  1HQY E;  1HT2 E;  2DAG A;  3E21 A;  2L4F A;  2LVO C;  1HT1 E;  2MR9 A;  2DKL A;  3E46 A;  3T6P A;  1V92 A;  2RRU A;  1G41 A;  1TR8 A;  1ZMU A;  2ZTD A;  1DO2 A;  2OOA A;  2HAK A;  2DAK A;  2LBC A;  4F2L A;  2DI0 A;  1VQ1 A;  1ZV1 A;  3BBZ A;  3B89 A;  1G3I A;  4GEW A;  1XB2 B;  3LCU A;  2BWB A;  2CWB A;  2DEN A;  3GLG E;  3K9P A;  1EFU B;  1GO5 A;  1T43 A;  1P3Q Q;  2KHH A;  1C7Y A;  4R71 A;  1ZMV A;  2KNV A;  2EKF A;  2O25 A;  1MN3 A;  3GLH E;  2BWE A;  3F92 A;  1VEJ A;  2MRO B;  1WIV A;  2HWJ A;  5DFL A;  4DBG B;  4G3O A;  1Q02 A;  2CP8 A;  2LVP C;  3IEC A;  2JZ1 A;  1A5T A;  4Q7J A;  1DO0 A;  1UFZ A;  2JY5 A;  1HJP A;  2ZTC A;  1F4I A;  2DAE A;  1IXS A;  1NV9 A;  2LVN C;  1WR1 B;  2G3Q A;  3GLI E;  1SG9 A;  1IFY A;  1QZE A;  1PGY A;  2EJS A;  2DNA A;  3FE3 A;  3FRH A;  1WGN A;  5JI2 E;  1KYI A;  2JY7 A;  1VDL A;  2DHY A;  3GLF E;  3LCV B;  2JUJ A;  2L4E A;  2QSF X;  2JZ0 A;  2R0I A;  3MMP A;  2JY8 A;  1VEG A;  2DAM A;  4UN2 B;  2LVQ D;  2H5X A;  3FRI A;  1NV8 A;  2LTU A;  4HEO A;  1R4G A;  1VEK A;  3IHP A;  2JNH A;  1T6O A;  1Y8G A;  1WJ7 A;  2JY6 B;  2DAI A;  2QNJ A;  2JP7 A;  1AIP C;  2DZL A;  2WZJ A;  1TTE A;  1DV0 A;  1YLA A;  2KNA A;  2MJ5 B;  2QHO B;  1XXH E;  2EKK A;  2B3T A;  3H4J A;  1IM2 A;  1OQY A;  2K9D A;  2OO9 A;  2LVA A; 
#chains in the Genus database with same CATH topology
 2FNA A;  3QWL A;  2XZF A;  1Z6T A;  4JI0 M;  1VG5 A;  3LW5 F;  3GLI A;  3FTE A;  3HJ8 A;  3RGP A;  1MU5 A;  3KDS E;  5H37 D;  3KSJ A;  1QVR A;  1FNN A;  3VFD A;  3U6Q A;  3K2L A;  1OJL A;  3U60 A;  4JI5 M;  4WUR A;  3CF2 A;  1FJG M;  3K92 A;  1SXJ A;  1OKS A;  1Z5A A;  1YSY A;  1ZMW A;  3C58 A;  3SAV A;  1TF0 B;  3L28 A;  4AI6 A;  2Y0T A;  4L6V 6;  4WP2 A;  4JI3 M;  3U61 B;  1R6B X;  3GPP A;  2KW0 A;  1HT2 E;  2G8L A;  3E21 A;  1NNJ A;  5ITY A;  4QOS A;  4LFC M;  3U6O A;  2LVO C;  3FYD A;  2DWN A;  4B7G A;  4JI6 M;  2J5Y A;  2GNO A;  3PNV A;  3E46 A;  3K8Z A;  4LJ5 A;  3T6P A;  1V92 A;  3HHW A;  4HLQ A;  4AW4 A;  1SXJ E;  3MK6 A;  5EP1 A;  2ZTD A;  4IBK A;  2OOA A;  1MX0 A;  2HAK A;  2LBC A;  5EQT A;  4CGY B;  3LQR A;  1QAQ A;  2VF7 A;  3UMM A;  1ZV1 A;  2CEA A;  4GIP A;  3GLF A;  3AFH A;  4L78 A;  1XB2 B;  2UU9 M;  1EE8 A;  4PT5 A;  3K9P A;  3GLG E;  3GQ5 A;  1Q3B A;  1T3T A;  2DWL A;  1NJF A;  3U6M A;  4LJ7 A;  7CAT A;  1NJG A;  1DGG A;  4R71 A;  2L09 A;  3GQ3 A;  4X64 M;  1MN3 A;  1VDD A;  4LJ8 A;  2LXE A;  1JQJ C;  4NRW A;  2HWJ A;  1DGH B;  3TL4 X;  4BLC A;  1NSF A;  2CRU A;  4WW0 A;  3J81 S;  4DR2 M;  3EIE A;  3IEC A;  2JZ1 A;  1N36 M;  2OPF A;  2M5Z A;  3D8B A;  3BOS A;  2VII A;  4JV5 M;  4I5S A;  1DO0 A;  1XMO M;  3U6D A;  1K3X A;  2ZTC A;  2DAE A;  3KFU G;  2XSZ A;  1JR3 A;  2G3Q A;  5LMN M;  3L27 A;  2E5L M;  5EXX A;  3A45 A;  1I4W A;  2R4E A;  3FE3 A;  1S3S A;  3D8L A;  3HHX A;  3LQQ A;  1WGN A;  4MGY E;  1KYI A;  3RFW A;  3SAU A;  1R2Y A;  4L15 A;  3TQS A;  1QAO A;  4DR5 M;  2JUJ A;  2QQ8 A;  2R0I A;  2M60 A;  4CHT B;  4PD2 A;  1PJJ A;  2R45 A;  4FWH A;  2CE7 A;  2C9O A;  2R18 A;  4G4Q A;  1I94 M;  1E9R A;  4LF6 M;  2H5X A;  4R3D A;  2VQE M;  3HU3 A;  2LTU A;  3AL0 C;  3L25 A;  4B7F A;  1VEK A;  2KRK A;  1LTM A;  1IY1 A;  1OIZ A;  1OIP A;  1XHB A;  2JY6 B;  2JP7 A;  3SMS A;  1HR0 M;  4KO8 A;  2KZS A;  4JYA M;  3SHG B;  1TTE A;  3KOZ E;  2O5R A;  2HHH M;  3ZCB B;  1NHG C;  4L4U A;  1GAB A;  4JXJ A;  1RU3 A;  4NXN M;  3HJS A;  3W0L B;  3GLI B;  2UXC M;  2XH9 A;  4IBJ A;  5EJC A;  1GLN A;  2H1R A;  2B3T A;  3M6A A;  5FLX S;  3EIH A;  2K9D A;  4LFA M;  3JAM S;  4OX9 M;  3GP1 A;  2OO9 A;  1IY2 A;  4MH0 E;  3KS8 A;  2MH8 A;  2OOB A;  3HU2 A;  4MGZ E;  3U6L A;  1PM5 A;  4B3M M;  1SXJ B;  1WGL A;  3K9O A;  3U61 A;  1IBL M;  2L2D A;  1OFI A;  4B3T M;  5JI3 E;  1QDT A;  3HZJ A;  1SXJ D;  3K1J A;  4DV2 M;  1HNZ M;  2FS1 A;  2L7I A;  2KRU A;  2K0B X;  2LHG A;  2MGW A;  3DA1 A;  4REZ A;  1BVS A;  1Z5C A;  2Z8Y M;  3C3D A;  4LJ4 A;  4IBG A;  1IN8 A;  3PNY A;  2RGO A;  1NY6 A;  2DAG A;  4LJ6 A;  4LGM A;  2Y0Q A;  5GKN A;  3CTW B;  4BB9 A;  3GPU A;  4GC9 A;  2LNH C;  4CJ6 A;  4MGH A;  2MR9 A;  2DKL A;  5FTJ A;  2CHQ A;  4FCV A;  4AG6 A;  2RRU A;  5FSW A;  3KSX A;  4IIW A;  4JI2 M;  1TR8 A;  1ZMU A;  3W68 A;  3LVV A;  4F2L A;  4AKI A;  2DI0 A;  2HCB A;  2QBY A;  4B3R M;  1VQ1 A;  3HKP A;  5IRE B;  5DNY A;  1G59 A;  4LRT A;  4M9X A;  1XXH A;  3B89 A;  3QAU A;  3U6E A;  4DR7 M;  4LF7 M;  2DEN A;  1EFU B;  3SBJ A;  1HQC A;  2I7P A;  3B7Z A;  4X66 M;  1IQP A;  2BJW A;  2R44 A;  4II7 A;  3KOY E;  4I81 A;  2X49 A;  3UZU A;  5ITT A;  1N75 A;  1K82 A;  1ZMV A;  2G5G X;  3RGS A;  5FTL A;  2O25 A;  3AOE C;  1PJQ A;  4OW0 A;  2D7H A;  3F92 A;  1XWI A;  2ERC A;  4DR3 M;  3T1H M;  4IBI A;  3WHK A;  2MRO B;  1G8P A;  4LG2 A;  1YE9 A;  4D81 A;  2ZAO A;  1R5L A;  4DBG B;  2XLJ A;  2LWX A;  3W67 A;  1L2C A;  2KA6 B;  2LVP C;  4HL4 A;  3U5Z B;  1QQW A;  1N77 A;  3J27 B;  4AZF A;  2KZU A;  5EP2 A;  4CIZ A;  2I7N A;  3A98 B;  2CV2 A;  5C1B A;  2D7G A;  3VK7 A;  3CF6 E;  5IT9 S;  3B74 A;  3E9S A;  3Q8G A;  4Z8X A;  1IXS A;  5LMU M;  2LVN C;  4MGK E;  2V1C A;  3GPY A;  4MM3 B;  3VK8 A;  1PGY A;  3TPZ A;  2XFT A;  2DNA A;  3FRH A;  3KOX E;  1D0L A;  4IBB A;  2WSE F;  3I4Y A;  2JY7 A;  2KDL A;  3FUV A;  2DHY A;  4Z6Y A;  3GLF E;  4AQY M;  4XGI A;  3GLG A;  2JWS A;  2JY8 A;  1VEG A;  2DAM A;  3GLH B;  4UN2 B;  2R46 A;  3WHL A;  2ZAN A;  1NV8 A;  3SAW A;  2UXB M;  4RKU F;  2CV1 A;  4DV1 M;  2NQ8 C;  3SC3 A;  4FCT A;  1IN6 A;  3I01 M;  1Y8G A;  1WJ7 A;  3L29 A;  4Y28 F;  1AIP C;  3SAS A;  2DZL A;  5DYI A;  2R62 A;  1DV0 A;  3GO8 A;  1SXJ C;  2XFS A;  3R8F A;  4I8O A;  3HGI A;  5ITX A;  3U60 B;  3IG5 A;  1IXZ A;  1YLA A;  4B08 A;  1L2B A;  2F5Q A;  4NRV A;  2MJ5 B;  3HY5 A;  2EKK A;  5IWA M;  4OVZ B;  3FUW A;  3VLF B;  2R6F A;  1IM2 A;  1OQY A;  2A5Y B;  3H4J A;  3B7Q A;  4P16 A;  2XZU A;  4TUW A;  3ZH9 B;  3KVW A;  2KNZ A;  1OTR A;  3T15 A;  2APL A;  1JR3 E;  1Q3C A;  3GRY A;  1PJI A;  4S12 A;  5KQ8 A;  3ILK A;  4PDI A;  4GRI A;  5ITX E;  1TDZ A;  1G4A E;  4FCW A;  4ZPX A;  1WHC A;  3UJN A;  1TDH A;  1NO1 A;  4DV5 M;  4L16 A;  4K0K M;  3NWL A;  2XGN A;  2DWZ B;  3QYE A;  5EP3 A;  4GH9 A;  1HQY E;  3OTO M;  2L7H A;  5BPV A;  4G4R A;  2D7E A;  3MHV C;  3VDU A;  1E32 A;  1HT1 E;  4NXM M;  4DV6 M;  4GHA A;  1V34 A;  1Q39 A;  3LMM A;  4JI7 M;  5FTK A;  1XXH B;  3NBX X;  4IBC A;  3R9X B;  1IXR C;  4GKK M;  2CHG A;  4LFB M;  1JB0 F;  4EIW A;  3I51 A;  1TGU A;  2QZ4 A;  4LJ9 A;  4R7G A;  3PXG A;  1IY0 A;  4X62 M;  1N33 M;  2C99 A;  3BBZ A;  1GJT A;  1G3I A;  4GEW A;  4YY3 M;  3LCU A;  2BWB A;  2CWB A;  1JR3 D;  4L8R C;  4I4L A;  4NOO B;  5FTN A;  2UUB M;  1GO5 A;  2FH0 A;  2CHV A;  3DOA A;  3I04 M;  2Z3X A;  1N78 A;  3SHF A;  3J7B A;  3HHZ A;  1P3Q Q;  1QDR A;  4ITQ A;  1OAO C;  1C7Y A;  4LF8 M;  4AKH A;  1XMQ M;  3TWM A;  3QYB A;  2KNV A;  3ZQJ A;  2EKF A;  1KSF X;  3U5Z A;  4DUZ M;  2Z4S A;  4NC6 A;  2JXN A;  3U6S A;  2BWE A;  4LZZ A;  5KPT A;  4DV4 M;  3KOW E;  4KLN A;  2QP9 X;  4DR1 M;  1NHW C;  1GJS A;  1WIV A;  1ZAE A;  2KXE A;  3UK6 A;  3DZD A;  5DFL A;  3GLF B;  2HL7 A;  4DV7 M;  3SAT A;  4LF4 M;  2DWM A;  2UXD M;  2FFJ A;  3SFZ A;  4DR6 M;  4NSO B;  3L2A A;  2ZM6 M;  4LY6 A;  2VF8 A;  4Q7J A;  1IXS B;  2R65 A;  5EP4 A;  1UFZ A;  1HJP A;  1D0M A;  3AOG A;  5KQD A;  3TWL A;  3GQ4 A;  1F4I A;  1NV9 A;  1GKI A;  1WR1 B;  4LCB A;  1IN5 A;  3GLI E;  1R7R A;  1SG9 A;  1IFY A;  2GQF A;  1QZE A;  3GLG B;  1GL7 A;  1QZM A;  2KEB A;  3HJQ A;  3HX3 A;  3T38 A;  3L26 A;  4AKG A;  1GVN A;  1IN7 A;  5JI2 E;  4GKJ M;  4A3V B;  1DGH A;  4DV3 M;  2WSF F;  2F5P A;  1VDL A;  3PVS A;  2W82 A;  4NSR A;  2XEP A;  2L4E A;  2JZ0 A;  5EXS A;  5ITR A;  4IBF A;  1Z59 A;  4GHL A;  3KP1 E;  1G71 A;  2C9C A;  1EIJ A;  4DR4 M;  1NY5 A;  1XNR M;  4X65 M;  1J7K A;  1PJS A;  4NL4 H;  1H6U A;  2LHC A;  1R4G A;  3AJI B;  3IHP A;  4PCZ A;  2UUC M;  4MGI E;  1T6O A;  1UM8 A;  2QBY B;  2DAI A;  2Y21 A;  2P5T A;  4MB7 A;  5E26 A;  1W5T A;  2J7N A;  4OVZ A;  4KHP M;  4FW9 A;  3FUT A;  2YQZ A;  1GL6 A;  2XF3 A;  3GRR A;  2K47 A;  2VDB B;  3M0E A;  3FUU A;  2HKJ A;  1QUS A;  4YHH M;  4JI4 M;  5KPR A;  1X37 A;  3FTC A;  3MJ5 A;  2Z4R A;  5DYG A;  3GRV A;  3SMP A;  4G4N A;  2C5R A;  2QHO B;  3SYL A;  3UGJ A;  2VQF M;  3U6C A;  3VDP A;  3JR4 A;  2CUZ A;  4QHT A;  3RE8 A;  4AG5 A;  3HWS A;  1ZQ9 A;  4XBO A;  4ANR A;  8CAT A;  1OAI A;  3V76 A;  2RKO A;  1L1Z A;  4F1I A;  1CUK A;  1TH3 A;  4IJE A;  3M7G A;  2OQ4 A;  3AKZ A;  3FTF A;  1E94 E;  3SYK A;  4LZJ A;  4LF5 M;  1IN4 A;  3VKG A;  3B7N A;  2J7O A;  4FWD A;  4GC5 A;  4KOD A;  4D80 A;  5ITQ A;  2DZO B;  3KXE C;  4QNM A;  5ITU A;  1LV7 A;  3PFI A;  2JA2 A;  5EXP A;  2YNM D;  4RF1 A;  2AHM A;  3H4M A;  4QOZ C;  1QAM A;  1MJG M;  4B7H A;  2R4J A;  2L4F A;  3A46 A;  1TH4 A;  3U6P A;  4GIT A;  2V1U A;  4RF0 A;  2CFO A;  3BXW A;  2F5N A;  2QCU A;  2BJV A;  3TWK A;  1E9S A;  2Y20 A;  3A42 A;  3JR5 A;  2DVW B;  1G41 A;  2Q2E B;  1DO2 A;  4OU7 A;  2DAK A;  2QEN A;  1PRB A;  3I4V A;  3W0F A;  4JI1 M;  2C98 A;  4BBA A;  3KS4 A;  4FVM A;  4M0W A;  4P17 A;  1XNQ M;  3IG8 A;  2EUC A;  2X8A A;  5FTM A;  1T43 A;  3CGW A;  5KO3 A;  1QUT A;  4PDG A;  1HNX M;  5L8R F;  2O01 F;  2KHH A;  3KW6 A;  2QPA A;  5BR8 M;  1QYR A;  4RNA A;  2F5O A;  3GLH E;  3T1Y M;  4FWG A;  3FYC A;  1VEJ A;  4LGY A;  4IJF A;  1AUA A;  4DUY M;  1OFH A;  3E4R A;  3FKE A;  4G3O A;  3THG A;  1Q02 A;  2CP8 A;  3TE6 A;  1DGF A;  2XSZ D;  3B9P A;  4LJA A;  4QNR A;  4W5W A;  1A5T A;  3AV0 A;  2EO2 A;  1L8Q A;  1XC8 A;  2DHR A;  1TH2 A;  1L1T A;  1N34 M;  4IBE A;  1N32 M;  2WSC F;  1J5E M;  2JY5 A;  1IBK M;  4G4O A;  3NBI A;  2ZBK B;  3GLH A;  3C3E A;  5IZ7 D;  4GMQ A;  3HHY A;  5F3W A;  3GPX A;  2N35 A;  1WXQ A;  2EJS A;  5C18 A;  3J7A S;  5A2Q S;  2DZN B;  4KT0 F;  1YUB A;  4QHS A;  1KFV A;  2F4V M;  3C9P A;  3Q8X A;  2LH0 A;  2EA0 A;  4XK8 F;  2Z7J A;  2CV0 A;  2X4A A;  3LCV B;  3GRU A;  2FOI C;  4LF9 M;  2QSF X;  3MMP A;  4FD2 A;  2UUA M;  2C96 A;  2RGH A;  1D0K A;  2DXI A;  1DGB A;  1W5S A;  3CF0 A;  4M9S A;  5KPZ A;  2LVQ D;  3J80 S;  1HNW M;  3FRI A;  2K6B A;  4G6Z A;  1NNU C;  2YFQ A;  3LVW A;  3VKH A;  4M0D A;  2ZAM A;  1PJT A;  4HEO A;  4CIS A;  2F5S A;  2L6O A;  4DV0 M;  4LRS A;  1NVM A;  4M9Z A;  1L2D A;  3KP0 E;  1C1K A;  2JNH A;  1J09 A;  2QNJ A;  3HU1 A;  1K3W A;  2WZJ A;  3ZC7 B;  3FUX A;  3FTD A;  2V6Z M;  4IBD A;  1V33 A;  2BNK A;  1IBM M;  2FE8 A;  3AOE A;  4JI8 M;  2YR0 A;  3SAR A;  5E6J A;  2KNA A;  3FD9 A;  1R2Z A;  5EXT A;  1XXH E;  1ORY B;  3DFZ A;  1D2N A;  1Z5B A;  1QAN A;  3J2P B;  4B3S M;  4D82 A;  4JN6 A;  2LVA A; 
#chains in the Genus database with same CATH homology
 2KNZ A;  1OTR A;  1VG5 A;  1JR3 E;  1OAI A;  2OOB A;  4F1I A;  1CUK A;  1WGL A;  3K9O A;  2L2D A;  1G4A E;  1E94 E;  1WHC A;  1OKS A;  1ZMW A;  2K0B X;  2MGW A;  1BVS A;  4WP2 A;  1HQY E;  1HT2 E;  2DAG A;  3E21 A;  2L4F A;  2LVO C;  1HT1 E;  2MR9 A;  2DKL A;  3E46 A;  3T6P A;  1V92 A;  2RRU A;  1G41 A;  1TR8 A;  1ZMU A;  2ZTD A;  1DO2 A;  2OOA A;  2HAK A;  2DAK A;  2LBC A;  4F2L A;  2DI0 A;  1VQ1 A;  1ZV1 A;  3BBZ A;  3B89 A;  1G3I A;  4GEW A;  1XB2 B;  3LCU A;  2BWB A;  2CWB A;  2DEN A;  3GLG E;  3K9P A;  1EFU B;  1GO5 A;  1T43 A;  1P3Q Q;  2KHH A;  1C7Y A;  4R71 A;  1ZMV A;  2KNV A;  2EKF A;  2O25 A;  1MN3 A;  3GLH E;  2BWE A;  3F92 A;  1VEJ A;  2MRO B;  1WIV A;  2HWJ A;  5DFL A;  4DBG B;  4G3O A;  1Q02 A;  2CP8 A;  2LVP C;  3IEC A;  2JZ1 A;  1A5T A;  4Q7J A;  1DO0 A;  1UFZ A;  2JY5 A;  1HJP A;  2ZTC A;  1F4I A;  2DAE A;  1IXS A;  1NV9 A;  2LVN C;  1WR1 B;  2G3Q A;  3GLI E;  1SG9 A;  1IFY A;  1QZE A;  1PGY A;  2EJS A;  2DNA A;  3FE3 A;  3FRH A;  1WGN A;  5JI2 E;  1KYI A;  2JY7 A;  1VDL A;  2DHY A;  3GLF E;  3LCV B;  2JUJ A;  2L4E A;  2QSF X;  2JZ0 A;  2R0I A;  3MMP A;  2JY8 A;  1VEG A;  2DAM A;  4UN2 B;  2LVQ D;  2H5X A;  3FRI A;  1NV8 A;  2LTU A;  4HEO A;  1R4G A;  1VEK A;  3IHP A;  2JNH A;  1T6O A;  1Y8G A;  1WJ7 A;  2JY6 B;  2DAI A;  2QNJ A;  2JP7 A;  1AIP C;  2DZL A;  2WZJ A;  1TTE A;  1DV0 A;  1YLA A;  2KNA A;  2MJ5 B;  2QHO B;  1XXH E;  2EKK A;  2B3T A;  3H4J A;  1IM2 A;  1OQY A;  2K9D A;  2OO9 A;  2LVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...