1WGNA

Solution structure of uba domain of human ubiquitin associated protein 1 (ubap1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
63
structure length
63
Chain Sequence
GSSGSSGAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENIEQILDYLFAHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin associated protein
publication title Solution Structure of UBA domain of Human Ubiquitin Associated Protein 1 (UBAP1)
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 13
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wgnA00
2QSFX 2JZ0A 3FRHA 1VEJA 2DAIA 3K9OA 2DHYA 4R71A 1C7YA 2LBCA 2L2DA 2DENA 4HEOA 2JY7A 3T6PA 1WGLA 2DAGA 1ZMUA 1V92A 2LVQD 1DO0A 1BVSA 2CWBA 1G41A 1F4IA 2LVNC 2LVOC 2DAKA 1WIVA 1VQ1A 4GEWA 1JR3E 1Q02A 2LVAA 1DO2A 1A5TA 1ZMVA 2ZTDA 2R0IA 1IFYA 1UFZA 1GO5A 1VEGA 2DAMA 2WZJA 2HAKA 2DZLA 2JUJA 1WGNA 2L4EA 1CUKA 3F92A 1DV0A 1NV9A 2BWBA 1R4GA 3GLFE 2O25A 2MJ5B 5JI2E 1HT1E 1VDLA 1E94E 4F2LA 1VG5A 2DI0A 2JZ1A 2K9DA 3IECA 2OOAA 2EKKA 2EJSA 3H4JA 2MROB 2L4FA 1ZMWA 1T43A 4G3OA 1OAIA 1SG9A 2K0BX 3IHPA 3FE3A 2ZTCA 4WP2A 3LCVB 2KHHA 2KNAA 1YLAA 2MGWA 3B89A 3BBZA 1IM2A 1G4AE 1OTRA 2JY5A 3E46A 4DBGB 1IXSA 3GLGE 2KNZA 1MN3A 1OQYA 1P3QQ 3E21A 1TR8A 1OKSA 2B3TA 2LVPC 2JP7A 2MR9A 4UN2B 1KYIA 1PGYA 5DFLA 3FRIA 1T6OA 1XXHE 1QZEA 2JY6B 2DNAA 1WR1B 1NV8A 2DKLA 3LCUA 2H5XA 2OOBA 2JY8A 3GLHE 3K9PA 1HT2E 2KNVA 1HQYE 2LTUA 1XB2B 1EFUB 2CP8A 3GLIE 1HJPA 1WHCA 1AIPC 1ZV1A 2OO9A 3MMPA 2DAEA 1VEKA 2G3QA 2HWJA 2QNJA 2JNHA 2QHOB 2RRUA 1TTEA 1WJ7A 2BWEA 1G3IA 2EKFA 1Y8GA 4Q7JA 4F1IA
chains in the Genus database with same CATH superfamily
3AOEC 3HU1A 4FVMA 1KSFX 4EIWA 2L7IA 5EXSA 3C9PA 1J09A 1QUTA 3B7NA 1R7RA 4D81A 3TL4X 2R46A 1IN5A 2X8AA 3TWMA 1I94M 2DAIA 4FWGA 1J5EM 5E6JA 1K3WA 1OAOC 4IIWA 3SMPA 3KXEC 2CFOA 4HLQA 1C7YA 1WXQA 4LF6M 2DVWB 1PRBA 4NRWA 4FD2A 3GQ5A 4OW0A 4HEOA 1D0LA 1TDZA 5E26A 3T6PA 1WGLA 3BOSA 4IBIA 2A5YB 5FTLA 2N35A 1F4IA 1G71A 3VFDA 3TWLA 5LMNM 4AQYM 3E4RA 1LV7A 2ERCA 2DAKA 2KZUA 4GEWA 1JR3E 4YHHM 1FJGM 5ITUA 1N78A 3J80S 1OIZA 2HL7A 3LVVA 2ZTDA 2CV1A 2R0IA 2XZFA 4NSRA 2C98A 3GRRA 3L29A 3T38A 2HAKA 4QNMA 4JI7M 1NHGC 3WHLA 3QYBA 3VK8A 5EP4A 3IG5A 2KDLA 2V1UA 3FUTA 1IBLM 1CUKA 2XSZA 3F92A 1GL6A 4MM3B 5ITTA 2GQFA 2ZAOA 5FTJA 1E9RA 3KP1E 4G4NA 3GLFE 2QBYA 3J2PB 5DNYA 1QAMA 4FW9A 2APLA 4R3DA 4JI3M 3D8LA 1HNZM 3Q8XA 2DI0A 4LGMA 3J27B 3IECA 5ITQA 2OOAA 1GKIA 4GH9A 4GKKM 2R45A 3PFIA 3M7GA 2YNMD 3H4JA 2FS1A 2RGOA 2K0BX 4REZA 3FTEA 2KNAA 2C9CA 1YLAA 4IBKA 4QOSA 2YQZA 1W5SA 3BBZA 4LJ8A 1G4AE 2ZANA 2UXBM 1OIPA 3BXWA 1IXSB 4LJ9A 1HNXM 2KNZA 1NJGA 3UJNA 1MN3A 1L1TA 2BJVA 2XFSA 1ZAEA 2Y0QA 3GLGA 3HJ8A 4QHTA 3U61B 2H1RA 2LVPC 2X49A 1XNRM 2UXCM 2F5SA 2XGNA 1IBMM 3FTDA 4GHAA 3M0EA 3RFWA 4YY3M 3PNYA 3U60A 3RGPA 1NV8A 1R6BX 2CHGA 2H5XA 1DGBA 1XXHB 3GLHE 1HT2E 2JXNA 3CTWB 1H6UA 4ANRA 1Q3CA 1TH4A 2VF8A 1XB2B 2I7NA 1GL7A 1GJSA 2BJWA 3T15A 1IQPA 1NJFA 1IY1A 2VIIA 1W5TA 3GPPA 1SXJE 2NQ8C 5FTNA 2G8LA 3EIHA 4DR2M 3AKZA 2Z4RA 2JNHA 2QHOB 1ORYB 2MH8A 3U6LA 3SMSA 4IBEA 1SXJD 1TDHA 1R2ZA 3LW5F 1TTEA 3V76A 1D2NA 1XHBA 2KRUA 2RGHA 2LHGA 2Y21A 4NRVA 4PT5A 1Y8GA 5JI2E 2DHRA 2QSFX 4WURA 2D7GA 2V1CA 4B7GA 3SASA 2JZ0A 3FRHA 2QENA 3KOXE 8CATA 1G59A 3HZJA 1K3XA 3I4YA 5EXTA 1QDTA 2LXEA 2LBCA 4DR5M 2L2DA 3AV0A 2OPFA 2UXDM 3CF2A 3TWKA 3JAMS 4GRIA 5KQ8A 3CF6E 1J7KA 3HU3A 4LJ6A 1OFHA 4GITA 2DAGA 1V92A 2LVQD 3CF0A 3SAVA 3SBJA 4LY6A 4R7GA 4FCVA 1MJGM 2LVNC 2LVOC 2R4EA 3B7ZA 1N34M 3TPZA 4B3SM 4LCBA 4L16A 3U5ZA 2FOIC 2Y0TA 4I5SA 2KXEA 3VDPA 3GQ3A 4JYAM 3GP1A 4JI2M 3SAUA 1UFZA 2DAMA 4PDGA 5A2QS 4P17A 2Z8YM 2F4VM 4RF0A 4G6ZA 4DR7M 3KOZE 3GO8A 3U6OA 3HJQA 3HKPA 3GRYA 1QDRA 2JA2A 4D80A 3H4MA 3J7BA 5DYGA 2QBYB 3FTCA 2DZNB 1QVRA 1HT1E 3QYEA 4RF1A 1N77A 3KS4A 1GJTA 2FFJA 4FCTA 2Z3XA 1E94E 1NSFA 3JR4A 4OVZA 4DV6M 1MX0A 1UM8A 3KSJA 4FWHA 2RKOA 3PVSA 2EJSA 4X66M 1ZMWA 1T43A 4G3OA 1JR3D 3TQSA 5JI3E 1L2CA 5DYIA 4AKHA 2ZTCA 4WP2A 5KPRA 2E5LM 2KHHA 2CUZA 2MGWA 4L78A 3B89A 2FE8A 2DWZB 4XGIA 3MHVC 4IBGA 2QQ8A 4LF4M 1N33M 2CHVA 5IZ7D 1SXJA 2CE7A 4MGKE 1DGGA 3GLGB 3LQQA 3HJSA 2D7EA 1R5LA 1Z6TA 3U6SA 4LF9M 1OKSA 4HL4A 4ZPXA 3ZQJA 4NXMM 3I4VA 2HHHM 1NO1A 4KLNA 4LRSA 1PGYA 3FUWA 1DGFA 3FRIA 1T6OA 2VQEM 1XXHE 1QZEA 2JY6B 3L28A 2DNAA 3LQRA 4G4OA 3U60B 3QAUA 4XBOA 4LJ5A 2XF3A 4DV7M 3AFHA 1L2BA 1RU3A 4JI5M 2KNVA 3FUUA 1ZQ9A 4WW0A 2LTUA 3DZDA 3RE8A 1QQWA 3JR5A 2CP8A 2DWLA 3IG8A 3LMMA 1Z5BA 4GMQA 4OU7A 3VKGA 5EXPA 3GLIE 1HJPA 1AIPC 5KQDA 4DR4M 2M60A 2DAEA 4TUWA 1VEKA 2CEAA 4DR1M 4JN6A 4JI8M 3SHGB 1YSYA 2QNJA 3AOEA 3A46A 1IN4A 2RRUA 2W82A 3VDUA 4IBDA 3W68A 1GABA 4DV1M 4AW4A 3U6PA 4AKIA 3L25A 1IN6A 3D8BA 3FTFA 2O5RA 4KO8A 3ILKA 3EIEA 3RGSA 2LH0A 4S12A 3A42A 3DOAA 2K47A 4Z6YA 1G3IA 2XLJA 1WGNA 4JI4M 4LZZA 4Q7JA 4F1IA 3THGA 3GPXA 3J81S 4CIZA 4KHPM 4JI6M 3A98B 5KPTA 2DWMA 1XC8A 4MGHA 2F5QA 2ZAMA 3K9OA 1TGUA 1NNUC 2DHYA 4R71A 5C1BA 3U6CA 1GLNA 1L8QA 3HY5A 3KSXA 3PXGA 5ITRA 3AL0C 1KFVA 2DENA 1K82A 3HU2A 1PJTA 3AOGA 5GKNA 2OQ4A 4LF5M 3KW6A 3QWLA 2O01F 3NBIA 4LJ7A 4LRTA 3SYLA 1ZMUA 4LZJA 3U6DA 1BVSA 1NVMA 2CWBA 5FTKA 5FLXS 1YUBA 3GLFB 3SAWA 1IBKM 1Z5CA 2D7HA 4Y28F 5KPZA 1IY0A 3SC3A 3C3DA 2M5ZA 2CV2A 1V33A 1XNQM 1VQ1A 3U5ZB 1OFIA 2WSEF 4RKUF 2LVAA 3ZC7B 2R65A 3B7QA 2VDBB 4LFCM 1JR3A 2WSFF 3W0FA 1ZMVA 2R62A 3UGJA 2XEPA 1JQJC 4L6V6 4I8OA 3NWLA 1IFYA 1HR0M 1VEGA 2P5TA 2QP9X 2AHMA 2DZLA 4GC9A 3WHKA 2JUJA 2L6OA 2YFQA 4IJEA 3R8FA 2F5NA 4X62M 1DV0A 4QHSA 4DR3M 4XK8F 3FYDA 1NHWC 7CATA 4L4UA 2BWBA 1IXRC 1QYRA 1R4GA 3C58A 2J7NA 2KEBA 2MJ5B 3ZH9B 2F5OA 2DWNA 3L26A 3GLFA 4CISA 1R2YA 4OVZB 2XFTA 2JZ1A 4W5WA 3LVWA 3M6AA 5IT9S 5C18A 3W67A 2C5RA 4JXJA 2Q2EB 3L27A 3SATA 2EKKA 3KFUG 2MROB 2L4FA 1JB0F 1Z59A 2Z4SA 1SG9A 2QPAA 3ZCBB 4NSOB 4CHTB 4A3VB 3VKHA 1DGHA 3T1YM 2R18A 2LHCA 1OTRA 2KRKA 1QUSA 3MK6A 4M9XA 4DBGB 3GLIA 3GLGE 2CV0A 4MB7A 1E32A 3FKEA 3I04M 1SXJB 3UMMA 4GC5A 1OQYA 1PJIA 4JI0M 4B08A 2Y20A 1C1KA 1S3SA 4CJ6A 2B3TA 3U6EA 2V6ZM 5EJCA 5IWAM 1N32M 4G4QA 2UUBM 4UN2B 2JWSA 4DV2M 1XMOM 2UUAM 1KYIA 3HHZA 2ZM6M 1L2DA 1NY6A 2GNOA 3Q8GA 5EP3A 3GQ4A 4X65M 4LGYA 3FUVA 1WR1B 1L1ZA 2XH9A 2DKLA 3KS8A 5ITYA 5BR8M 2OOBA 3K9PA 1E9SA 2QZ4A 4LFBM 3FYCA 4MGYE 1OJLA 4GIPA 1EFUB 2K6BA 3GLHA 3OTOM 4LJ4A 4PDIA 2XZUA 4AZFA 3B9PA 1TH3A 3GPUA 1ZV1A 4DV5M 3MMPA 2WSCF 2G3QA 3U6QA 3GRUA 4AG5A 3VLFB 3KDSE 2VQFM 4I4LA 5FTMA 2FH0A 3HWSA 2BWEA 4IBJA 3NBXX 1Q3BA 5H37D 2EKFA 2L09A 3TE6A 3UZUA 1PJQA 3SYKA 4IBFA 3K2LA 1QANA 4DUYM 4MGZE 1VEJA 1QZMA 5EQTA 2QCUA 2EO2A 1XMQM 5ITXE 3KP0E 4II7A 4B7HA 1PM5A 3K1JA 1AUAA 1G8PA 3AJIB 4K0KM 2FNAA 3KOYE 2J5YA 4NXNM 4BLCA 2JY7A 5EXXA 3A45A 3T1HM 1IXZA 2KA6B 4DUZM 1TH2A 4GKJM 1DO0A 1G41A 4BBAA 5IREB 3B74A 1VDDA 4MH0E 2UU9M 4B3RM 4AI6A 4M9SA 2R4JA 1EIJA 1NY5A 4PCZA 1WIVA 3FUXA 4OX9M 4KT0F 1Q02A 4DV0M 4NOOB 2C9OA 2F5PA 4Z8XA 5EP1A 2KZSA 2EA0A 1DO2A 1A5TA 3GPYA 5F3WA 2LNHC 2CRUA 1PJSA 2X4AA 4LFAM 1GO5A 4QNRA 3UK6A 2WZJA 3MJ5A 1IY2A 4LG2A 1IN8A 2BNKA 4BB9A 1QAOA 2UUCM 2C96A 3I01M 2L4EA 1XWIA 4L15A 1NV9A 1I4WA 2DZOB 3HX3A 3HHYA 1FNNA 4AG6A 4JI1M 2O25A 5LMUM 1X37A 4DV3M 2HKJA 2I7PA 3GRVA 4L8RC 1VDLA 4GHLA 1Z5AA 4F2LA 1EE8A 1VG5A 4IBBA 4LJAA 2K9DA 3L2AA 4G4RA 3U6MA 1N36M 4B3TM 4IJFA 4FWDA 2CHQA 3KVWA 4KODA 4DR6M 4M9ZA 3SARA 2VF7A 4LF8M 2HCBA 1OAIA 2R44A 4M0WA 4RNAA 3CGWA 3IHPA 3K8ZA 3FE3A 1HNWM 3LCVB 4PD2A 3VK7A 4DV4M 1NNJA 4JV5M 1DGHB 2EUCA 1IM2A 1TF0B 2Z7JA 1D0KA 2JY5A 1IN7A 4P16A 5KO3A 5L8RF 3GLIB 3E46A 4ITQA 1IXSA 2XSZD 1YE9A 3W0LB 4CGYB 2ZBKB 1T3TA 4NL4H 2L7HA 1P3QQ 3E21A 3I51A 1QAQA 1TR8A 4M0DA 1GVNA 3U61A 2C99A 3DFZA 2G5GX 3SFZA 2R6FA 2DXIA 2JP7A 2MR9A 4X64M 4QOZC 3C3EA 4I81A 4NC6A 3FD9A 5DFLA 1SXJC 3LCUA 3J7AS 3PNVA 1MU5A 4LF7M 2JY8A 1XXHA 4FCWA 5EP2A 3K92A 1N75A 3SHFA 1V34A 1HQYE 2J7OA 3GLHB 3R9XB 2KW0A 5FSWA 2YR0A 1WHCA 2OO9A 5ITXA 4B3MM 1Q39A 2LWXA 1LTMA 2HWJA 3HHWA 4IBCA 1HQCA 1PJJA 3KOWE 4D82A 3DA1A 4AKGA 1WJ7A 3HHXA 5BPVA 3E9SA 4B7FA 4MGIE 3HGIA 1D0MA
chains in the Genus database with same CATH topology
2QSFX 2JZ0A 3FRHA 1VEJA 2DAIA 3K9OA 2DHYA 4R71A 1C7YA 2LBCA 2L2DA 2DENA 4HEOA 2JY7A 3T6PA 1WGLA 2DAGA 1ZMUA 1V92A 2LVQD 1DO0A 1BVSA 2CWBA 1G41A 1F4IA 2LVNC 2LVOC 2DAKA 1WIVA 1VQ1A 4GEWA 1JR3E 1Q02A 2LVAA 1DO2A 1A5TA 1ZMVA 2ZTDA 2R0IA 1IFYA 1UFZA 1GO5A 1VEGA 2DAMA 2WZJA 2HAKA 2DZLA 2JUJA 1WGNA 2L4EA 1CUKA 3F92A 1DV0A 1NV9A 2BWBA 1R4GA 3GLFE 2O25A 2MJ5B 5JI2E 1HT1E 1VDLA 1E94E 4F2LA 1VG5A 2DI0A 2JZ1A 2K9DA 3IECA 2OOAA 2EKKA 2EJSA 3H4JA 2MROB 2L4FA 1ZMWA 1T43A 4G3OA 1OAIA 1SG9A 2K0BX 3IHPA 3FE3A 2ZTCA 4WP2A 3LCVB 2KHHA 2KNAA 1YLAA 2MGWA 3B89A 3BBZA 1IM2A 1G4AE 1OTRA 2JY5A 3E46A 4DBGB 1IXSA 3GLGE 2KNZA 1MN3A 1OQYA 1P3QQ 3E21A 1TR8A 1OKSA 2B3TA 2LVPC 2JP7A 2MR9A 4UN2B 1KYIA 1PGYA 5DFLA 3FRIA 1T6OA 1XXHE 1QZEA 2JY6B 2DNAA 1WR1B 1NV8A 2DKLA 3LCUA 2H5XA 2OOBA 2JY8A 3GLHE 3K9PA 1HT2E 2KNVA 1HQYE 2LTUA 1XB2B 1EFUB 2CP8A 3GLIE 1HJPA 1WHCA 1AIPC 1ZV1A 2OO9A 3MMPA 2DAEA 1VEKA 2G3QA 2HWJA 2QNJA 2JNHA 2QHOB 2RRUA 1TTEA 1WJ7A 2BWEA 1G3IA 2EKFA 1Y8GA 4Q7JA 4F1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSF X;  2JZ0 A;  3FRH A;  1VEJ A;  2DAI A;  3K9O A;  2DHY A;  4R71 A;  1C7Y A;  2LBC A;  2L2D A;  2DEN A;  4HEO A;  2JY7 A;  3T6P A;  1WGL A;  2DAG A;  1ZMU A;  1V92 A;  2LVQ D;  1DO0 A;  1BVS A;  2CWB A;  1G41 A;  1F4I A;  2LVN C;  2LVO C;  2DAK A;  1WIV A;  1VQ1 A;  4GEW A;  1JR3 E;  1Q02 A;  2LVA A;  1DO2 A;  1A5T A;  1ZMV A;  2ZTD A;  2R0I A;  1IFY A;  1UFZ A;  1GO5 A;  1VEG A;  2DAM A;  2WZJ A;  2HAK A;  2DZL A;  2JUJ A;  1WGN A;  2L4E A;  1CUK A;  3F92 A;  1DV0 A;  1NV9 A;  2BWB A;  1R4G A;  3GLF E;  2O25 A;  2MJ5 B;  5JI2 E;  1HT1 E;  1VDL A;  1E94 E;  4F2L A;  1VG5 A;  2DI0 A;  2JZ1 A;  2K9D A;  3IEC A;  2OOA A;  2EKK A;  2EJS A;  3H4J A;  2MRO B;  2L4F A;  1ZMW A;  1T43 A;  4G3O A;  1OAI A;  1SG9 A;  2K0B X;  3IHP A;  3FE3 A;  2ZTC A;  4WP2 A;  3LCV B;  2KHH A;  2KNA A;  1YLA A;  2MGW A;  3B89 A;  3BBZ A;  1IM2 A;  1G4A E;  1OTR A;  2JY5 A;  3E46 A;  4DBG B;  1IXS A;  3GLG E;  2KNZ A;  1MN3 A;  1OQY A;  1P3Q Q;  3E21 A;  1TR8 A;  1OKS A;  2B3T A;  2LVP C;  2JP7 A;  2MR9 A;  4UN2 B;  1KYI A;  1PGY A;  5DFL A;  3FRI A;  1T6O A;  1XXH E;  1QZE A;  2JY6 B;  2DNA A;  1WR1 B;  1NV8 A;  2DKL A;  3LCU A;  2H5X A;  2OOB A;  2JY8 A;  3GLH E;  3K9P A;  1HT2 E;  2KNV A;  1HQY E;  2LTU A;  1XB2 B;  1EFU B;  2CP8 A;  3GLI E;  1HJP A;  1WHC A;  1AIP C;  1ZV1 A;  2OO9 A;  3MMP A;  2DAE A;  1VEK A;  2G3Q A;  2HWJ A;  2QNJ A;  2JNH A;  2QHO B;  2RRU A;  1TTE A;  1WJ7 A;  2BWE A;  1G3I A;  2EKF A;  1Y8G A;  4Q7J A;  4F1I A; 
#chains in the Genus database with same CATH topology
 3AOE C;  3HU1 A;  4FVM A;  1KSF X;  4EIW A;  2L7I A;  5EXS A;  3C9P A;  1J09 A;  1QUT A;  3B7N A;  1R7R A;  4D81 A;  3TL4 X;  2R46 A;  1IN5 A;  2X8A A;  3TWM A;  1I94 M;  2DAI A;  4FWG A;  1J5E M;  5E6J A;  1K3W A;  1OAO C;  4IIW A;  3SMP A;  3KXE C;  2CFO A;  4HLQ A;  1C7Y A;  1WXQ A;  4LF6 M;  2DVW B;  1PRB A;  4NRW A;  4FD2 A;  3GQ5 A;  4OW0 A;  4HEO A;  1D0L A;  1TDZ A;  5E26 A;  3T6P A;  1WGL A;  3BOS A;  4IBI A;  2A5Y B;  5FTL A;  2N35 A;  1F4I A;  1G71 A;  3VFD A;  3TWL A;  5LMN M;  4AQY M;  3E4R A;  1LV7 A;  2ERC A;  2DAK A;  2KZU A;  4GEW A;  1JR3 E;  4YHH M;  1FJG M;  5ITU A;  1N78 A;  3J80 S;  1OIZ A;  2HL7 A;  3LVV A;  2ZTD A;  2CV1 A;  2R0I A;  2XZF A;  4NSR A;  2C98 A;  3GRR A;  3L29 A;  3T38 A;  2HAK A;  4QNM A;  4JI7 M;  1NHG C;  3WHL A;  3QYB A;  3VK8 A;  5EP4 A;  3IG5 A;  2KDL A;  2V1U A;  3FUT A;  1IBL M;  1CUK A;  2XSZ A;  3F92 A;  1GL6 A;  4MM3 B;  5ITT A;  2GQF A;  2ZAO A;  5FTJ A;  1E9R A;  3KP1 E;  4G4N A;  3GLF E;  2QBY A;  3J2P B;  5DNY A;  1QAM A;  4FW9 A;  2APL A;  4R3D A;  4JI3 M;  3D8L A;  1HNZ M;  3Q8X A;  2DI0 A;  4LGM A;  3J27 B;  3IEC A;  5ITQ A;  2OOA A;  1GKI A;  4GH9 A;  4GKK M;  2R45 A;  3PFI A;  3M7G A;  2YNM D;  3H4J A;  2FS1 A;  2RGO A;  2K0B X;  4REZ A;  3FTE A;  2KNA A;  2C9C A;  1YLA A;  4IBK A;  4QOS A;  2YQZ A;  1W5S A;  3BBZ A;  4LJ8 A;  1G4A E;  2ZAN A;  2UXB M;  1OIP A;  3BXW A;  1IXS B;  4LJ9 A;  1HNX M;  2KNZ A;  1NJG A;  3UJN A;  1MN3 A;  1L1T A;  2BJV A;  2XFS A;  1ZAE A;  2Y0Q A;  3GLG A;  3HJ8 A;  4QHT A;  3U61 B;  2H1R A;  2LVP C;  2X49 A;  1XNR M;  2UXC M;  2F5S A;  2XGN A;  1IBM M;  3FTD A;  4GHA A;  3M0E A;  3RFW A;  4YY3 M;  3PNY A;  3U60 A;  3RGP A;  1NV8 A;  1R6B X;  2CHG A;  2H5X A;  1DGB A;  1XXH B;  3GLH E;  1HT2 E;  2JXN A;  3CTW B;  1H6U A;  4ANR A;  1Q3C A;  1TH4 A;  2VF8 A;  1XB2 B;  2I7N A;  1GL7 A;  1GJS A;  2BJW A;  3T15 A;  1IQP A;  1NJF A;  1IY1 A;  2VII A;  1W5T A;  3GPP A;  1SXJ E;  2NQ8 C;  5FTN A;  2G8L A;  3EIH A;  4DR2 M;  3AKZ A;  2Z4R A;  2JNH A;  2QHO B;  1ORY B;  2MH8 A;  3U6L A;  3SMS A;  4IBE A;  1SXJ D;  1TDH A;  1R2Z A;  3LW5 F;  1TTE A;  3V76 A;  1D2N A;  1XHB A;  2KRU A;  2RGH A;  2LHG A;  2Y21 A;  4NRV A;  4PT5 A;  1Y8G A;  5JI2 E;  2DHR A;  2QSF X;  4WUR A;  2D7G A;  2V1C A;  4B7G A;  3SAS A;  2JZ0 A;  3FRH A;  2QEN A;  3KOX E;  8CAT A;  1G59 A;  3HZJ A;  1K3X A;  3I4Y A;  5EXT A;  1QDT A;  2LXE A;  2LBC A;  4DR5 M;  2L2D A;  3AV0 A;  2OPF A;  2UXD M;  3CF2 A;  3TWK A;  3JAM S;  4GRI A;  5KQ8 A;  3CF6 E;  1J7K A;  3HU3 A;  4LJ6 A;  1OFH A;  4GIT A;  2DAG A;  1V92 A;  2LVQ D;  3CF0 A;  3SAV A;  3SBJ A;  4LY6 A;  4R7G A;  4FCV A;  1MJG M;  2LVN C;  2LVO C;  2R4E A;  3B7Z A;  1N34 M;  3TPZ A;  4B3S M;  4LCB A;  4L16 A;  3U5Z A;  2FOI C;  2Y0T A;  4I5S A;  2KXE A;  3VDP A;  3GQ3 A;  4JYA M;  3GP1 A;  4JI2 M;  3SAU A;  1UFZ A;  2DAM A;  4PDG A;  5A2Q S;  4P17 A;  2Z8Y M;  2F4V M;  4RF0 A;  4G6Z A;  4DR7 M;  3KOZ E;  3GO8 A;  3U6O A;  3HJQ A;  3HKP A;  3GRY A;  1QDR A;  2JA2 A;  4D80 A;  3H4M A;  3J7B A;  5DYG A;  2QBY B;  3FTC A;  2DZN B;  1QVR A;  1HT1 E;  3QYE A;  4RF1 A;  1N77 A;  3KS4 A;  1GJT A;  2FFJ A;  4FCT A;  2Z3X A;  1E94 E;  1NSF A;  3JR4 A;  4OVZ A;  4DV6 M;  1MX0 A;  1UM8 A;  3KSJ A;  4FWH A;  2RKO A;  3PVS A;  2EJS A;  4X66 M;  1ZMW A;  1T43 A;  4G3O A;  1JR3 D;  3TQS A;  5JI3 E;  1L2C A;  5DYI A;  4AKH A;  2ZTC A;  4WP2 A;  5KPR A;  2E5L M;  2KHH A;  2CUZ A;  2MGW A;  4L78 A;  3B89 A;  2FE8 A;  2DWZ B;  4XGI A;  3MHV C;  4IBG A;  2QQ8 A;  4LF4 M;  1N33 M;  2CHV A;  5IZ7 D;  1SXJ A;  2CE7 A;  4MGK E;  1DGG A;  3GLG B;  3LQQ A;  3HJS A;  2D7E A;  1R5L A;  1Z6T A;  3U6S A;  4LF9 M;  1OKS A;  4HL4 A;  4ZPX A;  3ZQJ A;  4NXM M;  3I4V A;  2HHH M;  1NO1 A;  4KLN A;  4LRS A;  1PGY A;  3FUW A;  1DGF A;  3FRI A;  1T6O A;  2VQE M;  1XXH E;  1QZE A;  2JY6 B;  3L28 A;  2DNA A;  3LQR A;  4G4O A;  3U60 B;  3QAU A;  4XBO A;  4LJ5 A;  2XF3 A;  4DV7 M;  3AFH A;  1L2B A;  1RU3 A;  4JI5 M;  2KNV A;  3FUU A;  1ZQ9 A;  4WW0 A;  2LTU A;  3DZD A;  3RE8 A;  1QQW A;  3JR5 A;  2CP8 A;  2DWL A;  3IG8 A;  3LMM A;  1Z5B A;  4GMQ A;  4OU7 A;  3VKG A;  5EXP A;  3GLI E;  1HJP A;  1AIP C;  5KQD A;  4DR4 M;  2M60 A;  2DAE A;  4TUW A;  1VEK A;  2CEA A;  4DR1 M;  4JN6 A;  4JI8 M;  3SHG B;  1YSY A;  2QNJ A;  3AOE A;  3A46 A;  1IN4 A;  2RRU A;  2W82 A;  3VDU A;  4IBD A;  3W68 A;  1GAB A;  4DV1 M;  4AW4 A;  3U6P A;  4AKI A;  3L25 A;  1IN6 A;  3D8B A;  3FTF A;  2O5R A;  4KO8 A;  3ILK A;  3EIE A;  3RGS A;  2LH0 A;  4S12 A;  3A42 A;  3DOA A;  2K47 A;  4Z6Y A;  1G3I A;  2XLJ A;  1WGN A;  4JI4 M;  4LZZ A;  4Q7J A;  4F1I A;  3THG A;  3GPX A;  3J81 S;  4CIZ A;  4KHP M;  4JI6 M;  3A98 B;  5KPT A;  2DWM A;  1XC8 A;  4MGH A;  2F5Q A;  2ZAM A;  3K9O A;  1TGU A;  1NNU C;  2DHY A;  4R71 A;  5C1B A;  3U6C A;  1GLN A;  1L8Q A;  3HY5 A;  3KSX A;  3PXG A;  5ITR A;  3AL0 C;  1KFV A;  2DEN A;  1K82 A;  3HU2 A;  1PJT A;  3AOG A;  5GKN A;  2OQ4 A;  4LF5 M;  3KW6 A;  3QWL A;  2O01 F;  3NBI A;  4LJ7 A;  4LRT A;  3SYL A;  1ZMU A;  4LZJ A;  3U6D A;  1BVS A;  1NVM A;  2CWB A;  5FTK A;  5FLX S;  1YUB A;  3GLF B;  3SAW A;  1IBK M;  1Z5C A;  2D7H A;  4Y28 F;  5KPZ A;  1IY0 A;  3SC3 A;  3C3D A;  2M5Z A;  2CV2 A;  1V33 A;  1XNQ M;  1VQ1 A;  3U5Z B;  1OFI A;  2WSE F;  4RKU F;  2LVA A;  3ZC7 B;  2R65 A;  3B7Q A;  2VDB B;  4LFC M;  1JR3 A;  2WSF F;  3W0F A;  1ZMV A;  2R62 A;  3UGJ A;  2XEP A;  1JQJ C;  4L6V 6;  4I8O A;  3NWL A;  1IFY A;  1HR0 M;  1VEG A;  2P5T A;  2QP9 X;  2AHM A;  2DZL A;  4GC9 A;  3WHK A;  2JUJ A;  2L6O A;  2YFQ A;  4IJE A;  3R8F A;  2F5N A;  4X62 M;  1DV0 A;  4QHS A;  4DR3 M;  4XK8 F;  3FYD A;  1NHW C;  7CAT A;  4L4U A;  2BWB A;  1IXR C;  1QYR A;  1R4G A;  3C58 A;  2J7N A;  2KEB A;  2MJ5 B;  3ZH9 B;  2F5O A;  2DWN A;  3L26 A;  3GLF A;  4CIS A;  1R2Y A;  4OVZ B;  2XFT A;  2JZ1 A;  4W5W A;  3LVW A;  3M6A A;  5IT9 S;  5C18 A;  3W67 A;  2C5R A;  4JXJ A;  2Q2E B;  3L27 A;  3SAT A;  2EKK A;  3KFU G;  2MRO B;  2L4F A;  1JB0 F;  1Z59 A;  2Z4S A;  1SG9 A;  2QPA A;  3ZCB B;  4NSO B;  4CHT B;  4A3V B;  3VKH A;  1DGH A;  3T1Y M;  2R18 A;  2LHC A;  1OTR A;  2KRK A;  1QUS A;  3MK6 A;  4M9X A;  4DBG B;  3GLI A;  3GLG E;  2CV0 A;  4MB7 A;  1E32 A;  3FKE A;  3I04 M;  1SXJ B;  3UMM A;  4GC5 A;  1OQY A;  1PJI A;  4JI0 M;  4B08 A;  2Y20 A;  1C1K A;  1S3S A;  4CJ6 A;  2B3T A;  3U6E A;  2V6Z M;  5EJC A;  5IWA M;  1N32 M;  4G4Q A;  2UUB M;  4UN2 B;  2JWS A;  4DV2 M;  1XMO M;  2UUA M;  1KYI A;  3HHZ A;  2ZM6 M;  1L2D A;  1NY6 A;  2GNO A;  3Q8G A;  5EP3 A;  3GQ4 A;  4X65 M;  4LGY A;  3FUV A;  1WR1 B;  1L1Z A;  2XH9 A;  2DKL A;  3KS8 A;  5ITY A;  5BR8 M;  2OOB A;  3K9P A;  1E9S A;  2QZ4 A;  4LFB M;  3FYC A;  4MGY E;  1OJL A;  4GIP A;  1EFU B;  2K6B A;  3GLH A;  3OTO M;  4LJ4 A;  4PDI A;  2XZU A;  4AZF A;  3B9P A;  1TH3 A;  3GPU A;  1ZV1 A;  4DV5 M;  3MMP A;  2WSC F;  2G3Q A;  3U6Q A;  3GRU A;  4AG5 A;  3VLF B;  3KDS E;  2VQF M;  4I4L A;  5FTM A;  2FH0 A;  3HWS A;  2BWE A;  4IBJ A;  3NBX X;  1Q3B A;  5H37 D;  2EKF A;  2L09 A;  3TE6 A;  3UZU A;  1PJQ A;  3SYK A;  4IBF A;  3K2L A;  1QAN A;  4DUY M;  4MGZ E;  1VEJ A;  1QZM A;  5EQT A;  2QCU A;  2EO2 A;  1XMQ M;  5ITX E;  3KP0 E;  4II7 A;  4B7H A;  1PM5 A;  3K1J A;  1AUA A;  1G8P A;  3AJI B;  4K0K M;  2FNA A;  3KOY E;  2J5Y A;  4NXN M;  4BLC A;  2JY7 A;  5EXX A;  3A45 A;  3T1H M;  1IXZ A;  2KA6 B;  4DUZ M;  1TH2 A;  4GKJ M;  1DO0 A;  1G41 A;  4BBA A;  5IRE B;  3B74 A;  1VDD A;  4MH0 E;  2UU9 M;  4B3R M;  4AI6 A;  4M9S A;  2R4J A;  1EIJ A;  1NY5 A;  4PCZ A;  1WIV A;  3FUX A;  4OX9 M;  4KT0 F;  1Q02 A;  4DV0 M;  4NOO B;  2C9O A;  2F5P A;  4Z8X A;  5EP1 A;  2KZS A;  2EA0 A;  1DO2 A;  1A5T A;  3GPY A;  5F3W A;  2LNH C;  2CRU A;  1PJS A;  2X4A A;  4LFA M;  1GO5 A;  4QNR A;  3UK6 A;  2WZJ A;  3MJ5 A;  1IY2 A;  4LG2 A;  1IN8 A;  2BNK A;  4BB9 A;  1QAO A;  2UUC M;  2C96 A;  3I01 M;  2L4E A;  1XWI A;  4L15 A;  1NV9 A;  1I4W A;  2DZO B;  3HX3 A;  3HHY A;  1FNN A;  4AG6 A;  4JI1 M;  2O25 A;  5LMU M;  1X37 A;  4DV3 M;  2HKJ A;  2I7P A;  3GRV A;  4L8R C;  1VDL A;  4GHL A;  1Z5A A;  4F2L A;  1EE8 A;  1VG5 A;  4IBB A;  4LJA A;  2K9D A;  3L2A A;  4G4R A;  3U6M A;  1N36 M;  4B3T M;  4IJF A;  4FWD A;  2CHQ A;  3KVW A;  4KOD A;  4DR6 M;  4M9Z A;  3SAR A;  2VF7 A;  4LF8 M;  2HCB A;  1OAI A;  2R44 A;  4M0W A;  4RNA A;  3CGW A;  3IHP A;  3K8Z A;  3FE3 A;  1HNW M;  3LCV B;  4PD2 A;  3VK7 A;  4DV4 M;  1NNJ A;  4JV5 M;  1DGH B;  2EUC A;  1IM2 A;  1TF0 B;  2Z7J A;  1D0K A;  2JY5 A;  1IN7 A;  4P16 A;  5KO3 A;  5L8R F;  3GLI B;  3E46 A;  4ITQ A;  1IXS A;  2XSZ D;  1YE9 A;  3W0L B;  4CGY B;  2ZBK B;  1T3T A;  4NL4 H;  2L7H A;  1P3Q Q;  3E21 A;  3I51 A;  1QAQ A;  1TR8 A;  4M0D A;  1GVN A;  3U61 A;  2C99 A;  3DFZ A;  2G5G X;  3SFZ A;  2R6F A;  2DXI A;  2JP7 A;  2MR9 A;  4X64 M;  4QOZ C;  3C3E A;  4I81 A;  4NC6 A;  3FD9 A;  5DFL A;  1SXJ C;  3LCU A;  3J7A S;  3PNV A;  1MU5 A;  4LF7 M;  2JY8 A;  1XXH A;  4FCW A;  5EP2 A;  3K92 A;  1N75 A;  3SHF A;  1V34 A;  1HQY E;  2J7O A;  3GLH B;  3R9X B;  2KW0 A;  5FSW A;  2YR0 A;  1WHC A;  2OO9 A;  5ITX A;  4B3M M;  1Q39 A;  2LWX A;  1LTM A;  2HWJ A;  3HHW A;  4IBC A;  1HQC A;  1PJJ A;  3KOW E;  4D82 A;  3DA1 A;  4AKG A;  1WJ7 A;  3HHX A;  5BPV A;  3E9S A;  4B7F A;  4MGI E;  3HGI A;  1D0M A; 
#chains in the Genus database with same CATH homology
 2QSF X;  2JZ0 A;  3FRH A;  1VEJ A;  2DAI A;  3K9O A;  2DHY A;  4R71 A;  1C7Y A;  2LBC A;  2L2D A;  2DEN A;  4HEO A;  2JY7 A;  3T6P A;  1WGL A;  2DAG A;  1ZMU A;  1V92 A;  2LVQ D;  1DO0 A;  1BVS A;  2CWB A;  1G41 A;  1F4I A;  2LVN C;  2LVO C;  2DAK A;  1WIV A;  1VQ1 A;  4GEW A;  1JR3 E;  1Q02 A;  2LVA A;  1DO2 A;  1A5T A;  1ZMV A;  2ZTD A;  2R0I A;  1IFY A;  1UFZ A;  1GO5 A;  1VEG A;  2DAM A;  2WZJ A;  2HAK A;  2DZL A;  2JUJ A;  1WGN A;  2L4E A;  1CUK A;  3F92 A;  1DV0 A;  1NV9 A;  2BWB A;  1R4G A;  3GLF E;  2O25 A;  2MJ5 B;  5JI2 E;  1HT1 E;  1VDL A;  1E94 E;  4F2L A;  1VG5 A;  2DI0 A;  2JZ1 A;  2K9D A;  3IEC A;  2OOA A;  2EKK A;  2EJS A;  3H4J A;  2MRO B;  2L4F A;  1ZMW A;  1T43 A;  4G3O A;  1OAI A;  1SG9 A;  2K0B X;  3IHP A;  3FE3 A;  2ZTC A;  4WP2 A;  3LCV B;  2KHH A;  2KNA A;  1YLA A;  2MGW A;  3B89 A;  3BBZ A;  1IM2 A;  1G4A E;  1OTR A;  2JY5 A;  3E46 A;  4DBG B;  1IXS A;  3GLG E;  2KNZ A;  1MN3 A;  1OQY A;  1P3Q Q;  3E21 A;  1TR8 A;  1OKS A;  2B3T A;  2LVP C;  2JP7 A;  2MR9 A;  4UN2 B;  1KYI A;  1PGY A;  5DFL A;  3FRI A;  1T6O A;  1XXH E;  1QZE A;  2JY6 B;  2DNA A;  1WR1 B;  1NV8 A;  2DKL A;  3LCU A;  2H5X A;  2OOB A;  2JY8 A;  3GLH E;  3K9P A;  1HT2 E;  2KNV A;  1HQY E;  2LTU A;  1XB2 B;  1EFU B;  2CP8 A;  3GLI E;  1HJP A;  1WHC A;  1AIP C;  1ZV1 A;  2OO9 A;  3MMP A;  2DAE A;  1VEK A;  2G3Q A;  2HWJ A;  2QNJ A;  2JNH A;  2QHO B;  2RRU A;  1TTE A;  1WJ7 A;  2BWE A;  1G3I A;  2EKF A;  1Y8G A;  4Q7J A;  4F1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...