2LHGA

Gb98-t25i solution structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKELVDAGIAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational tipping points for switching protein folds and functions.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords GB98
total genus 17
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2lhgA00
1PRBA 2MH8A 2J5YA 1TF0B 2JWSA 1GABA 2KDLA 2LHGA 2VDBB 2LHCA 1GJSA 2FS1A 1GJTA 2N35A
chains in the Genus database with same CATH superfamily
2R0IA 1YSYA 2L09A 1TR8A 2CHVA 1PM5A 3C9PA 2DWZB 3TL4X 3U6PA 1Q02A 2LHCA 1WJ7A 3E4RA 1MJGM 4DV7M 2FE8A 1QQWA 5KO3A 2C5RA 3CF6E 5FSWA 3U60B 1TDZA 4GHLA 4AKIA 1GLNA 2ZAMA 2GNOA 5E6JA 5EP2A 1N77A 3GLGA 3SATA 4OU7A 3C58A 3SMPA 3VDUA 3GLHA 4MH0E 2ZM6M 4B7HA 1QZMA 5EP4A 3TPZA 5IZ7D 4KHPM 1V33A 3HY5A 3ZC7B 1D2NA 4DV1M 1FJGM 1C1KA 5BPVA 2G8LA 3FRIA 2L2DA 4MGZE 3K1JA 3FUUA 4M9ZA 2J5YA 3IECA 4CISA 1QAMA 1TF0B 3RE8A 4I5SA 2CE7A 3LW5F 1HNZM 3CF2A 1R6BX 2DWNA 1PJQA 1IY1A 4FCWA 3UMMA 4GKJM 2RGHA 2XZUA 3A42A 4HEOA 5FTKA 2XF3A 3D8BA 2A5YB 5ITUA 2QPAA 1WHCA 3R8FA 2EUCA 1OAOC 2LTUA 4GRIA 4LJAA 4P16A 2KHHA 3F92A 5JI2E 1Z59A 3U6MA 2XLJA 5ITQA 1XXHA 3W0FA 1K82A 1SXJB 4GEWA 2HHHM 1ZMWA 1TH4A 4L4UA 2DWLA 2X49A 3D8LA 4G4RA 5KQDA 3PVSA 3KOXE 1IBMM 4OX9M 1DGHA 4CIZA 4X64M 4GMQA 3SYLA 4I8OA 3J80S 3CTWB 2V6ZM 3KFUG 3LCVB 4JI7M 3VK7A 2R44A 2X4AA 3GLHE 3CGWA 1KSFX 3KOZE 5EXPA 4W5WA 4LFCM 2JY8A 4LGYA 2BWBA 4B08A 4B3SM 1JR3D 3VKHA 3FD9A 2CWBA 3VFDA 5ITRA 1GO5A 2XH9A 2R4EA 1OIZA 4G4QA 2C9CA 3KS8A 2LVOC 5DNYA 3QAUA 1L2BA 1NV9A 1WGNA 1SG9A 3B7NA 1HJPA 3MK6A 1L8QA 2OQ4A 1G71A 3RGPA 2QHOB 4F1IA 3AOEC 3GO8A 4BBAA 4G4NA 1XWIA 1JR3E 2CV0A 3HHYA 1OFIA 4AQYM 2QNJA 3T6PA 4AI6A 2KRUA 4L16A 3W68A 3KSJA 2OOBA 2O25A 1DO0A 3KP1E 4JXJA 4QHTA 1TTEA 3OTOM 2Z3XA 1L1ZA 3PNVA 3T38A 3L25A 4MM3B 1VG5A 2HKJA 4IBDA 3DOAA 5ITTA 3FTFA 2KRKA 3MJ5A 3T1YM 1GL6A 4AKGA 3GPUA 2P5TA 2N35A 1J09A 1E32A 3B7ZA 3K2LA 4WURA 3SFZA 2R45A 5ITXE 4JI6M 1GL7A 1NV8A 4YY3M 2KXEA 4WW0A 1XNRM 2BJWA 4OW0A 1G3IA 2C96A 2ZBKB 2C9OA 2D7EA 2DAGA 3GRUA 3GLIE 1G59A 1L1TA 4AG6A 4IBIA 2FNAA 1OAIA 4REZA 5DYIA 1W5SA 4GITA 1K3WA 2JA2A 1WGLA 4QOZC 2J7OA 4IBKA 4DV2M 2CRUA 3AJIB 4Z8XA 2W82A 3SAVA 2UUBM 1QDRA 1SXJC 2HWJA 1OTRA 2JWSA 2LBCA 3LQQA 4LGMA 8CATA 1Z5AA 4AZFA 4DV6M 4ZPXA 1EE8A 3V76A 2QSFX 3B74A 1A5TA 4LFAM 1GABA 3W67A 4PCZA 1IXSA 3KDSE 4MB7A 4L78A 3KP0E 3IHPA 2CP8A 2KZSA 3GQ4A 2JY6B 4IBBA 2F5OA 2UXDM 4QNRA 1IN4A 3FUVA 2G5GX 3L29A 3LQRA 2H1RA 3U6EA 3GLFA 2Z8YM 3HU1A 3WHKA 3SAUA 2GQFA 4QOSA 2DKLA 4EIWA 3HWSA 3HHWA 2LVQD 3FYCA 1D0MA 1L2DA 5FTNA 4LF7M 1IXRC 2XGNA 2F5NA 1XMOM 1XMQM 1PRBA 2LVPC 1F4IA 1QUSA 2BJVA 1HT1E 3T1HM 4AG5A 3SAWA 5DFLA 4DR4M 1NNUC 3SC3A 4MGYE 2YFQA 4M9SA 5KPTA 2KA6B 7CATA 2NQ8C 4IJEA 5ITXA 4B7GA 3VKGA 4DR2M 1PJIA 2L7IA 3E21A 3DA1A 4CGYB 2RKOA 3GPYA 1SXJE 2QBYB 2EKFA 2KEBA 2LVNC 1QYRA 2WSCF 4ANRA 3K9OA 2M5ZA 2R6FA 1Y8GA 2L4EA 3L27A 4II7A 4M0DA 4MGIE 5EP1A 2BWEA 4DV3M 4UN2B 3TWLA 4XBOA 3FE3A 2DVWB 1V92A 1QANA 2LNHC 2OPFA 2JY5A 4NXNM 1QZEA 2MH8A 1Q3BA 5IT9S 1NSFA 1NJFA 1R5LA 3UGJA 2XFTA 4AKHA 4LG2A 1XB2B 4DV0M 4PDGA 4I4LA 3AKZA 3GLGB 4L8RC 2XSZA 2ZTDA 3FUWA 3I4VA 3VDPA 1IQPA 2LH0A 3SASA 2I7NA 4LZJA 4RNAA 1VDDA 1VEJA 2Z4RA 1IY2A 2KZUA 4LRSA 1IBKM 2K0BX 3H4JA 4Q7JA 3HJ8A 4PT5A 4KODA 4B7FA 3U61A 3RGSA 1S3SA 1DGGA 3TWKA 1H6UA 5H37D 2KNVA 3E9SA 4LY6A 3BBZA 3ILKA 2Y0TA 2CV1A 3ZQJA 2OOAA 3B89A 4LF4M 4NSOB 4DV5M 3K8ZA 2DAIA 3L2AA 5JI3E 1G41A 2VDBB 5KQ8A 1N34M 2VIIA 2O01F 3PNYA 4AW4A 2K9DA 1UFZA 1IN5A 3QWLA 5IWAM 1RU3A 1NNJA 3AFHA 1R7RA 5LMNM 4FD2A 4OVZB 3GP1A 4IBJA 3SHGB 1YE9A 3KOWE 2WSFF 4GIPA 1ORYB 1Z5BA 1KFVA 1T3TA 4LJ9A 1HT2E 3AL0C 4PD2A 3TQSA 1HQCA 4FWHA 2CHQA 1NHGC 1D0KA 4D80A 1XHBA 1L2CA 3HJQA 3KOYE 3E46A 4R71A 5FLXS 1XXHE 1NO1A 1LV7A 2KW0A 4B3RM 4JN6A 1W5TA 4WP2A 2QQ8A 3J81S 1R2YA 3M6AA 5FTMA 4B3MM 4GC9A 4JI5M 3KSXA 4LCBA 2DXIA 2JP7A 2V1CA 3DZDA 4LJ4A 4LJ8A 2DWMA 3SMSA 2LVAA 4X65M 3TE6A 4IBFA 2L4FA 2K6BA 2R46A 4LJ5A 4BLCA 4NRWA 1EIJA 2UXCM 1NY5A 2F5SA 5GKNA 2MGWA 4LZZA 2JUJA 1KYIA 3HX3A 4JI1M 3KW6A 1OQYA 2APLA 5EJCA 4JI3M 3AV0A 3KS4A 4L15A 3JAMS 2MR9A 1XNQM 1J5EM 3FTDA 3GLIA 3U6CA 2DZOB 1PGYA 4FCTA 2H5XA 3KVWA 4P17A 3SHFA 1IN6A 2EO2A 3T15A 2Q2EB 1R4GA 5KPZA 2CV2A 1N33M 3I01M 2CEAA 1OJLA 1UM8A 4IBCA 4XGIA 2LHGA 3FRHA 2E5LM 2DHRA 1K3XA 1EFUB 1HNXM 2F4VM 2C98A 2CHGA 4B3TM 2FFJA 3U6DA 1N78A 1WIVA 1JQJC 4IBEA 2DZNB 1R2ZA 3J7AS 2Z7JA 1Z6TA 3K92A 2R65A 1VDLA 3EIHA 1AIPC 2UU9M 1YLAA 4LF5M 3K9PA 2DAKA 3HJSA 2CUZA 2LWXA 3M7GA 2XFSA 2ZAOA 2CFOA 4X62M 3PFIA 2ZTCA 4DBGB 1IFYA 3B9PA 3GLFB 4MGHA 3A46A 1SXJA 3MMPA 5FTLA 2EA0A 2QP9X 4LF6M 1ZMUA 1ZV1A 3I4YA 2KDLA 4L6V6 1PJSA 5EP3A 3HU2A 2VQFM 2M60A 1WR1B 1WXQA 2YNMD 1GKIA 2OO9A 4GKKM 1ZAEA 1SXJD 2JNHA 1ZQ9A 3NWLA 2Y20A 1BVSA 4DR5M 2UUAM 1TDHA 3IG5A 1PJTA 2MJ5B 1T6OA 1IXSB 1DO2A 3VLFB 4RKUF 4DR7M 1JB0F 5EQTA 4KT0F 3A98B 1JR3A 4FW9A 4RF0A 1NHWC 5EXSA 3GRVA 2R18A 3GLHB 4IBGA 1QVRA 1HR0M 1NVMA 1TGUA 5IREB 3Q8XA 3LVVA 5LMUM 1MX0A 2HAKA 2QBYA 4K0KM 4GC5A 4YHHM 1GVNA 1QDTA 5L8RF 2UUCM 4DR6M 4JI4M 3SYKA 2UXBM 2DENA 3Q8GA 2HCBA 2J7NA 4MGKE 1I94M 4TUWA 3J2PB 5KPRA 2QENA 1FNNA 4JV5M 5E26A 3AOGA 2KNAA 3QYEA 3THGA 3AOEA 4QHSA 3U5ZB 1VEGA 2QCUA 2V1UA 4LJ7A 4NL4H 1N75A 4XK8F 4ITQA 3FUTA 4M9XA 4DUYM 3J7BA 1QAQA 2FOIC 2YR0A 2F5QA 3B7QA 5C18A 5FTJA 1Q3CA 2MROB 1Q39A 1YUBA 3HHZA 2DAEA 4I81A 2FH0A 2RGOA 2EJSA 3KXEC 1QUTA 2Z4SA 1I4WA 5A2QS 2I7PA 1N32M 2ERCA 1G8PA 4KO8A 1N36M 4S12A 1E9RA 3GRYA 3U6OA 3BOSA 2F5PA 3RFWA 3VK8A 3R9XB 2JXNA 4LJ6A 1OKSA 3GLGE 2QZ4A 1OFHA 2FS1A 4JI0M 4QNMA 1GJTA 3UK6A 4A3VB 3U6LA 1PJJA 2VF7A 3JR4A 2X8AA 1MN3A 4CHTB 3NBXX 1OIPA 1DGBA 4D82A 3U61B 3BXWA 1IBLM 3FTEA 2K47A 3C3DA 3FTCA 1C7YA 1D0LA 4Z6YA 4X66M 1P3QQ 2L6OA 4PDIA 1GJSA 3UJNA 3U5ZA 1VQ1A 4R7GA 2DNAA 4JYAM 3ZCBB 4RF1A 3GQ5A 2B3TA 1IXZA 1NJGA 1TH3A 1LTMA 1CUKA 2Y0QA 3EIEA 1J7KA 2KNZA 3L28A 3LMMA 5BR8M 4JI2M 2C99A 2WZJA 1HQYE 1TH2A 2R62A 3TWMA 2D7HA 4LRTA 4DR3M 1NY6A 1IN8A 3FUXA 4NSRA 3U6QA 1QAOA 4OVZA 4G4OA 4HL4A 4GHAA 2BNKA 3NBIA 4JI8M 2DHYA 3GPXA 3MHVC 1T43A 5DYGA 1IY0A 1HNWM 4IJFA 4BB9A 4G6ZA 3U60A 1G4AE 3DFZA 3SARA 4F2LA 4GH9A 4CJ6A 3IG8A 1X37A 3W0LB 4R3DA 2YQZA 3ZH9B 1MU5A 2XEPA 3HGIA 1Z5CA 3HZJA 4NXMM 1DGFA 3I51A 1XXHB 4NC6A 3M0EA 4KLNA 2XZFA 4FVMA 4DV4M 2O5RA 2Y21A 3JR5A 3I04M 5EXXA 1XC8A 4LFBM 1AUAA 2DAMA 4LF8M 3PXGA 4DUZM 2JY7A 2VF8A 3UZUA 3FKEA 3L26A 3GLIB 1E9SA 4M0WA 2ZANA 4FCVA 2L7HA 3QYBA 3GPPA 1VEKA 2DZLA 5C1BA 3H4MA 2JZ0A 2LXEA 2D7GA 3FYDA 4NRVA 3WHLA 5ITYA 1DV0A 2G3QA 3A45A 1E94E 1DGHB 2WSEF 3C3EA 2RRUA 2HL7A 3HKPA 4Y28F 3U6SA 1IN7A 3HU3A 4LF9M 2AHMA 2JZ1A 1ZMVA 4FWGA 4G3OA 2EKKA 5EXTA 3SBJA 1IM2A 3GQ3A 3GLFE 5F3WA 4NOOB 2XSZD 2R4JA 4IIWA 2VQEM 3GRRA 4HLQA 3HHXA 1V34A 4FWDA 3CF0A 3J27B 3LVWA 3LCUA 4D81A 4DR1M 2DI0A
chains in the Genus database with same CATH topology
1PRBA 2MH8A 2J5YA 1TF0B 2JWSA 1GABA 2KDLA 2LHGA 2VDBB 2LHCA 1GJSA 2FS1A 1GJTA 2N35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRB A;  2MH8 A;  2J5Y A;  1TF0 B;  2JWS A;  1GAB A;  2KDL A;  2LHG A;  2VDB B;  2LHC A;  1GJS A;  2FS1 A;  1GJT A;  2N35 A; 
#chains in the Genus database with same CATH topology
 2R0I A;  1YSY A;  2L09 A;  1TR8 A;  2CHV A;  1PM5 A;  3C9P A;  2DWZ B;  3TL4 X;  3U6P A;  1Q02 A;  2LHC A;  1WJ7 A;  3E4R A;  1MJG M;  4DV7 M;  2FE8 A;  1QQW A;  5KO3 A;  2C5R A;  3CF6 E;  5FSW A;  3U60 B;  1TDZ A;  4GHL A;  4AKI A;  1GLN A;  2ZAM A;  2GNO A;  5E6J A;  5EP2 A;  1N77 A;  3GLG A;  3SAT A;  4OU7 A;  3C58 A;  3SMP A;  3VDU A;  3GLH A;  4MH0 E;  2ZM6 M;  4B7H A;  1QZM A;  5EP4 A;  3TPZ A;  5IZ7 D;  4KHP M;  1V33 A;  3HY5 A;  3ZC7 B;  1D2N A;  4DV1 M;  1FJG M;  1C1K A;  5BPV A;  2G8L A;  3FRI A;  2L2D A;  4MGZ E;  3K1J A;  3FUU A;  4M9Z A;  2J5Y A;  3IEC A;  4CIS A;  1QAM A;  1TF0 B;  3RE8 A;  4I5S A;  2CE7 A;  3LW5 F;  1HNZ M;  3CF2 A;  1R6B X;  2DWN A;  1PJQ A;  1IY1 A;  4FCW A;  3UMM A;  4GKJ M;  2RGH A;  2XZU A;  3A42 A;  4HEO A;  5FTK A;  2XF3 A;  3D8B A;  2A5Y B;  5ITU A;  2QPA A;  1WHC A;  3R8F A;  2EUC A;  1OAO C;  2LTU A;  4GRI A;  4LJA A;  4P16 A;  2KHH A;  3F92 A;  5JI2 E;  1Z59 A;  3U6M A;  2XLJ A;  5ITQ A;  1XXH A;  3W0F A;  1K82 A;  1SXJ B;  4GEW A;  2HHH M;  1ZMW A;  1TH4 A;  4L4U A;  2DWL A;  2X49 A;  3D8L A;  4G4R A;  5KQD A;  3PVS A;  3KOX E;  1IBM M;  4OX9 M;  1DGH A;  4CIZ A;  4X64 M;  4GMQ A;  3SYL A;  4I8O A;  3J80 S;  3CTW B;  2V6Z M;  3KFU G;  3LCV B;  4JI7 M;  3VK7 A;  2R44 A;  2X4A A;  3GLH E;  3CGW A;  1KSF X;  3KOZ E;  5EXP A;  4W5W A;  4LFC M;  2JY8 A;  4LGY A;  2BWB A;  4B08 A;  4B3S M;  1JR3 D;  3VKH A;  3FD9 A;  2CWB A;  3VFD A;  5ITR A;  1GO5 A;  2XH9 A;  2R4E A;  1OIZ A;  4G4Q A;  2C9C A;  3KS8 A;  2LVO C;  5DNY A;  3QAU A;  1L2B A;  1NV9 A;  1WGN A;  1SG9 A;  3B7N A;  1HJP A;  3MK6 A;  1L8Q A;  2OQ4 A;  1G71 A;  3RGP A;  2QHO B;  4F1I A;  3AOE C;  3GO8 A;  4BBA A;  4G4N A;  1XWI A;  1JR3 E;  2CV0 A;  3HHY A;  1OFI A;  4AQY M;  2QNJ A;  3T6P A;  4AI6 A;  2KRU A;  4L16 A;  3W68 A;  3KSJ A;  2OOB A;  2O25 A;  1DO0 A;  3KP1 E;  4JXJ A;  4QHT A;  1TTE A;  3OTO M;  2Z3X A;  1L1Z A;  3PNV A;  3T38 A;  3L25 A;  4MM3 B;  1VG5 A;  2HKJ A;  4IBD A;  3DOA A;  5ITT A;  3FTF A;  2KRK A;  3MJ5 A;  3T1Y M;  1GL6 A;  4AKG A;  3GPU A;  2P5T A;  2N35 A;  1J09 A;  1E32 A;  3B7Z A;  3K2L A;  4WUR A;  3SFZ A;  2R45 A;  5ITX E;  4JI6 M;  1GL7 A;  1NV8 A;  4YY3 M;  2KXE A;  4WW0 A;  1XNR M;  2BJW A;  4OW0 A;  1G3I A;  2C96 A;  2ZBK B;  2C9O A;  2D7E A;  2DAG A;  3GRU A;  3GLI E;  1G59 A;  1L1T A;  4AG6 A;  4IBI A;  2FNA A;  1OAI A;  4REZ A;  5DYI A;  1W5S A;  4GIT A;  1K3W A;  2JA2 A;  1WGL A;  4QOZ C;  2J7O A;  4IBK A;  4DV2 M;  2CRU A;  3AJI B;  4Z8X A;  2W82 A;  3SAV A;  2UUB M;  1QDR A;  1SXJ C;  2HWJ A;  1OTR A;  2JWS A;  2LBC A;  3LQQ A;  4LGM A;  8CAT A;  1Z5A A;  4AZF A;  4DV6 M;  4ZPX A;  1EE8 A;  3V76 A;  2QSF X;  3B74 A;  1A5T A;  4LFA M;  1GAB A;  3W67 A;  4PCZ A;  1IXS A;  3KDS E;  4MB7 A;  4L78 A;  3KP0 E;  3IHP A;  2CP8 A;  2KZS A;  3GQ4 A;  2JY6 B;  4IBB A;  2F5O A;  2UXD M;  4QNR A;  1IN4 A;  3FUV A;  2G5G X;  3L29 A;  3LQR A;  2H1R A;  3U6E A;  3GLF A;  2Z8Y M;  3HU1 A;  3WHK A;  3SAU A;  2GQF A;  4QOS A;  2DKL A;  4EIW A;  3HWS A;  3HHW A;  2LVQ D;  3FYC A;  1D0M A;  1L2D A;  5FTN A;  4LF7 M;  1IXR C;  2XGN A;  2F5N A;  1XMO M;  1XMQ M;  1PRB A;  2LVP C;  1F4I A;  1QUS A;  2BJV A;  1HT1 E;  3T1H M;  4AG5 A;  3SAW A;  5DFL A;  4DR4 M;  1NNU C;  3SC3 A;  4MGY E;  2YFQ A;  4M9S A;  5KPT A;  2KA6 B;  7CAT A;  2NQ8 C;  4IJE A;  5ITX A;  4B7G A;  3VKG A;  4DR2 M;  1PJI A;  2L7I A;  3E21 A;  3DA1 A;  4CGY B;  2RKO A;  3GPY A;  1SXJ E;  2QBY B;  2EKF A;  2KEB A;  2LVN C;  1QYR A;  2WSC F;  4ANR A;  3K9O A;  2M5Z A;  2R6F A;  1Y8G A;  2L4E A;  3L27 A;  4II7 A;  4M0D A;  4MGI E;  5EP1 A;  2BWE A;  4DV3 M;  4UN2 B;  3TWL A;  4XBO A;  3FE3 A;  2DVW B;  1V92 A;  1QAN A;  2LNH C;  2OPF A;  2JY5 A;  4NXN M;  1QZE A;  2MH8 A;  1Q3B A;  5IT9 S;  1NSF A;  1NJF A;  1R5L A;  3UGJ A;  2XFT A;  4AKH A;  4LG2 A;  1XB2 B;  4DV0 M;  4PDG A;  4I4L A;  3AKZ A;  3GLG B;  4L8R C;  2XSZ A;  2ZTD A;  3FUW A;  3I4V A;  3VDP A;  1IQP A;  2LH0 A;  3SAS A;  2I7N A;  4LZJ A;  4RNA A;  1VDD A;  1VEJ A;  2Z4R A;  1IY2 A;  2KZU A;  4LRS A;  1IBK M;  2K0B X;  3H4J A;  4Q7J A;  3HJ8 A;  4PT5 A;  4KOD A;  4B7F A;  3U61 A;  3RGS A;  1S3S A;  1DGG A;  3TWK A;  1H6U A;  5H37 D;  2KNV A;  3E9S A;  4LY6 A;  3BBZ A;  3ILK A;  2Y0T A;  2CV1 A;  3ZQJ A;  2OOA A;  3B89 A;  4LF4 M;  4NSO B;  4DV5 M;  3K8Z A;  2DAI A;  3L2A A;  5JI3 E;  1G41 A;  2VDB B;  5KQ8 A;  1N34 M;  2VII A;  2O01 F;  3PNY A;  4AW4 A;  2K9D A;  1UFZ A;  1IN5 A;  3QWL A;  5IWA M;  1RU3 A;  1NNJ A;  3AFH A;  1R7R A;  5LMN M;  4FD2 A;  4OVZ B;  3GP1 A;  4IBJ A;  3SHG B;  1YE9 A;  3KOW E;  2WSF F;  4GIP A;  1ORY B;  1Z5B A;  1KFV A;  1T3T A;  4LJ9 A;  1HT2 E;  3AL0 C;  4PD2 A;  3TQS A;  1HQC A;  4FWH A;  2CHQ A;  1NHG C;  1D0K A;  4D80 A;  1XHB A;  1L2C A;  3HJQ A;  3KOY E;  3E46 A;  4R71 A;  5FLX S;  1XXH E;  1NO1 A;  1LV7 A;  2KW0 A;  4B3R M;  4JN6 A;  1W5T A;  4WP2 A;  2QQ8 A;  3J81 S;  1R2Y A;  3M6A A;  5FTM A;  4B3M M;  4GC9 A;  4JI5 M;  3KSX A;  4LCB A;  2DXI A;  2JP7 A;  2V1C A;  3DZD A;  4LJ4 A;  4LJ8 A;  2DWM A;  3SMS A;  2LVA A;  4X65 M;  3TE6 A;  4IBF A;  2L4F A;  2K6B A;  2R46 A;  4LJ5 A;  4BLC A;  4NRW A;  1EIJ A;  2UXC M;  1NY5 A;  2F5S A;  5GKN A;  2MGW A;  4LZZ A;  2JUJ A;  1KYI A;  3HX3 A;  4JI1 M;  3KW6 A;  1OQY A;  2APL A;  5EJC A;  4JI3 M;  3AV0 A;  3KS4 A;  4L15 A;  3JAM S;  2MR9 A;  1XNQ M;  1J5E M;  3FTD A;  3GLI A;  3U6C A;  2DZO B;  1PGY A;  4FCT A;  2H5X A;  3KVW A;  4P17 A;  3SHF A;  1IN6 A;  2EO2 A;  3T15 A;  2Q2E B;  1R4G A;  5KPZ A;  2CV2 A;  1N33 M;  3I01 M;  2CEA A;  1OJL A;  1UM8 A;  4IBC A;  4XGI A;  2LHG A;  3FRH A;  2E5L M;  2DHR A;  1K3X A;  1EFU B;  1HNX M;  2F4V M;  2C98 A;  2CHG A;  4B3T M;  2FFJ A;  3U6D A;  1N78 A;  1WIV A;  1JQJ C;  4IBE A;  2DZN B;  1R2Z A;  3J7A S;  2Z7J A;  1Z6T A;  3K92 A;  2R65 A;  1VDL A;  3EIH A;  1AIP C;  2UU9 M;  1YLA A;  4LF5 M;  3K9P A;  2DAK A;  3HJS A;  2CUZ A;  2LWX A;  3M7G A;  2XFS A;  2ZAO A;  2CFO A;  4X62 M;  3PFI A;  2ZTC A;  4DBG B;  1IFY A;  3B9P A;  3GLF B;  4MGH A;  3A46 A;  1SXJ A;  3MMP A;  5FTL A;  2EA0 A;  2QP9 X;  4LF6 M;  1ZMU A;  1ZV1 A;  3I4Y A;  2KDL A;  4L6V 6;  1PJS A;  5EP3 A;  3HU2 A;  2VQF M;  2M60 A;  1WR1 B;  1WXQ A;  2YNM D;  1GKI A;  2OO9 A;  4GKK M;  1ZAE A;  1SXJ D;  2JNH A;  1ZQ9 A;  3NWL A;  2Y20 A;  1BVS A;  4DR5 M;  2UUA M;  1TDH A;  3IG5 A;  1PJT A;  2MJ5 B;  1T6O A;  1IXS B;  1DO2 A;  3VLF B;  4RKU F;  4DR7 M;  1JB0 F;  5EQT A;  4KT0 F;  3A98 B;  1JR3 A;  4FW9 A;  4RF0 A;  1NHW C;  5EXS A;  3GRV A;  2R18 A;  3GLH B;  4IBG A;  1QVR A;  1HR0 M;  1NVM A;  1TGU A;  5IRE B;  3Q8X A;  3LVV A;  5LMU M;  1MX0 A;  2HAK A;  2QBY A;  4K0K M;  4GC5 A;  4YHH M;  1GVN A;  1QDT A;  5L8R F;  2UUC M;  4DR6 M;  4JI4 M;  3SYK A;  2UXB M;  2DEN A;  3Q8G A;  2HCB A;  2J7N A;  4MGK E;  1I94 M;  4TUW A;  3J2P B;  5KPR A;  2QEN A;  1FNN A;  4JV5 M;  5E26 A;  3AOG A;  2KNA A;  3QYE A;  3THG A;  3AOE A;  4QHS A;  3U5Z B;  1VEG A;  2QCU A;  2V1U A;  4LJ7 A;  4NL4 H;  1N75 A;  4XK8 F;  4ITQ A;  3FUT A;  4M9X A;  4DUY M;  3J7B A;  1QAQ A;  2FOI C;  2YR0 A;  2F5Q A;  3B7Q A;  5C18 A;  5FTJ A;  1Q3C A;  2MRO B;  1Q39 A;  1YUB A;  3HHZ A;  2DAE A;  4I81 A;  2FH0 A;  2RGO A;  2EJS A;  3KXE C;  1QUT A;  2Z4S A;  1I4W A;  5A2Q S;  2I7P A;  1N32 M;  2ERC A;  1G8P A;  4KO8 A;  1N36 M;  4S12 A;  1E9R A;  3GRY A;  3U6O A;  3BOS A;  2F5P A;  3RFW A;  3VK8 A;  3R9X B;  2JXN A;  4LJ6 A;  1OKS A;  3GLG E;  2QZ4 A;  1OFH A;  2FS1 A;  4JI0 M;  4QNM A;  1GJT A;  3UK6 A;  4A3V B;  3U6L A;  1PJJ A;  2VF7 A;  3JR4 A;  2X8A A;  1MN3 A;  4CHT B;  3NBX X;  1OIP A;  1DGB A;  4D82 A;  3U61 B;  3BXW A;  1IBL M;  3FTE A;  2K47 A;  3C3D A;  3FTC A;  1C7Y A;  1D0L A;  4Z6Y A;  4X66 M;  1P3Q Q;  2L6O A;  4PDI A;  1GJS A;  3UJN A;  3U5Z A;  1VQ1 A;  4R7G A;  2DNA A;  4JYA M;  3ZCB B;  4RF1 A;  3GQ5 A;  2B3T A;  1IXZ A;  1NJG A;  1TH3 A;  1LTM A;  1CUK A;  2Y0Q A;  3EIE A;  1J7K A;  2KNZ A;  3L28 A;  3LMM A;  5BR8 M;  4JI2 M;  2C99 A;  2WZJ A;  1HQY E;  1TH2 A;  2R62 A;  3TWM A;  2D7H A;  4LRT A;  4DR3 M;  1NY6 A;  1IN8 A;  3FUX A;  4NSR A;  3U6Q A;  1QAO A;  4OVZ A;  4G4O A;  4HL4 A;  4GHA A;  2BNK A;  3NBI A;  4JI8 M;  2DHY A;  3GPX A;  3MHV C;  1T43 A;  5DYG A;  1IY0 A;  1HNW M;  4IJF A;  4BB9 A;  4G6Z A;  3U60 A;  1G4A E;  3DFZ A;  3SAR A;  4F2L A;  4GH9 A;  4CJ6 A;  3IG8 A;  1X37 A;  3W0L B;  4R3D A;  2YQZ A;  3ZH9 B;  1MU5 A;  2XEP A;  3HGI A;  1Z5C A;  3HZJ A;  4NXM M;  1DGF A;  3I51 A;  1XXH B;  4NC6 A;  3M0E A;  4KLN A;  2XZF A;  4FVM A;  4DV4 M;  2O5R A;  2Y21 A;  3JR5 A;  3I04 M;  5EXX A;  1XC8 A;  4LFB M;  1AUA A;  2DAM A;  4LF8 M;  3PXG A;  4DUZ M;  2JY7 A;  2VF8 A;  3UZU A;  3FKE A;  3L26 A;  3GLI B;  1E9S A;  4M0W A;  2ZAN A;  4FCV A;  2L7H A;  3QYB A;  3GPP A;  1VEK A;  2DZL A;  5C1B A;  3H4M A;  2JZ0 A;  2LXE A;  2D7G A;  3FYD A;  4NRV A;  3WHL A;  5ITY A;  1DV0 A;  2G3Q A;  3A45 A;  1E94 E;  1DGH B;  2WSE F;  3C3E A;  2RRU A;  2HL7 A;  3HKP A;  4Y28 F;  3U6S A;  1IN7 A;  3HU3 A;  4LF9 M;  2AHM A;  2JZ1 A;  1ZMV A;  4FWG A;  4G3O A;  2EKK A;  5EXT A;  3SBJ A;  1IM2 A;  3GQ3 A;  3GLF E;  5F3W A;  4NOO B;  2XSZ D;  2R4J A;  4IIW A;  2VQE M;  3GRR A;  4HLQ A;  3HHX A;  1V34 A;  4FWD A;  3CF0 A;  3J27 B;  3LVW A;  3LCU A;  4D81 A;  4DR1 M;  2DI0 A; 
#chains in the Genus database with same CATH homology
 1PRB A;  2MH8 A;  2J5Y A;  1TF0 B;  2JWS A;  1GAB A;  2KDL A;  2LHG A;  2VDB B;  2LHC A;  1GJS A;  2FS1 A;  1GJT A;  2N35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...