2LHGA

Gb98-t25i solution structure
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
56
structure length
56
Chain Sequence
TTYKLILNLKQAKEEAIKELVDAGIAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords GB98
publication title Mutational tipping points for switching protein folds and functions.
pubmed doi rcsb
source organism Artificial gene
total genus 17
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2011-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 2lhgA00
2FS1A 2LHGA 2LHCA 1PRBA 2J5YA 2MH8A 1GJTA 2N35A 1TF0B 2VDBB 1GABA 1GJSA 2KDLA 2JWSA
chains in the Genus database with same CATH superfamily
4IBFA 1PRBA 1TH3A 4DUZM 5FTLA 3VK7A 2UU9M 1WJ7A 4R7GA 4JI1M 3AFHA 1PJTA 4X62M 2FOIC 3SHGB 4F2LA 1KFVA 5FTKA 2MH8A 2JY5A 1SXJE 3HJ8A 4QHTA 4BLCA 2EO2A 4NSRA 5KPZA 2LNHC 5KQDA 4LJ9A 1UFZA 3HHWA 3MJ5A 2R0IA 3U6SA 3IECA 3FE3A 2L6OA 1DO0A 4CISA 1XXHB 3LMMA 2H5XA 2HHHM 4K0KM 1DGHA 1K3WA 1QZEA 3KS8A 3TWMA 1VDLA 2VQEM 2DWNA 1SXJD 4OU7A 1HJPA 3HGIA 1NV8A 4M0WA 2WSEF 1HT1E 2LH0A 2XZFA 1D0KA 1T43A 2P5TA 5EQTA 3LQQA 2QHOB 2LWXA 3HJSA 4RF0A 3LCUA 3L27A 1IY0A 4AKIA 4FD2A 3OTOM 1EIJA 5ITXE 3L25A 2WSCF 3B74A 7CATA 2HAKA 4CHTB 4AG5A 3KOWE 1T3TA 2M5ZA 4X66M 3JR4A 3KDSE 2DVWB 1X37A 3H4MA 3T1HM 2CEAA 1G4AE 1IXSB 3W0LB 3HU3A 4OX9M 1E32A 3B9PA 2CP8A 4M9SA 5FTNA 4GITA 2QENA 1NV9A 3I04M 2UXDM 3HY5A 2ERCA 4DR1M 4UN2B 5FTJA 2DKLA 4L16A 1C7YA 2C96A 1XXHA 4QHSA 2K6BA 2D7HA 4DBGB 3HU2A 4D81A 1HQYE 3BBZA 3L26A 4JV5M 4HLQA 2ZAMA 3VDPA 5EXXA 3SC3A 4JI2M 2DZLA 3B7ZA 1NHGC 2XFSA 4GMQA 2Y21A 1NJFA 1Q39A 3V76A 5LMUM 1MX0A 2NQ8C 3GLGE 2LHCA 5ITQA 3SAUA 1IBMM 3HHYA 4NXMM 2YFQA 1DV0A 2VIIA 3QYBA 1KYIA 2C99A 3FRHA 3FUTA 3WHLA 3FTDA 3A42A 1L1TA 3VKHA 1YSYA 3SMSA 4G4RA 4IBKA 2QQ8A 4LFCM 3U6QA 4MB7A 4AI6A 1BVSA 1XB2B 3GLHE 2LTUA 1GKIA 2BNKA 3CGWA 2CHVA 3PVSA 2CV0A 4LF8M 4CGYB 3J7AS 4X65M 5A2QS 3GRRA 1QVRA 5ITTA 2W82A 2C9OA 3I01M 1IXSA 3U6DA 4XBOA 1OQYA 2Z3XA 2DENA 1IBKM 1DGGA 2F5PA 1XNRM 4B3RM 2CFOA 4WW0A 1VEJA 4IJFA 5ITRA 3K9PA 2LVQD 3ZH9B 1HNZM 3PNVA 3LW5F 4G6ZA 2L09A 3SBJA 2F5NA 5FSWA 4FWHA 2HWJA 1TH2A 1QYRA 4DV1M 5DYIA 1VEGA 2VDBB 4OW0A 3B89A 3RFWA 1IM2A 4LRSA 2FS1A 3GLFE 1QUTA 2BJWA 4AKHA 1D2NA 2CUZA 3ZC7B 2C5RA 5KO3A 2DXIA 1J5EM 3MHVC 2KXEA 4OVZA 4AZFA 4DR6M 2Y0TA 3L28A 4NRVA 4L78A 1DO2A 3PNYA 4LCBA 3CF6E 3HX3A 3LVVA 3I51A 3LVWA 3VLFB 4DV6M 5C18A 2J5YA 4XGIA 4CJ6A 4P16A 1ZMWA 1YLAA 4JI6M 3U6OA 4DV0M 1GL6A 1GLNA 8CATA 1TH4A 2Z7JA 1QAOA 4JN6A 2XEPA 3A98B 2VQFM 5F3WA 2XF3A 3GPUA 1H6UA 1XWIA 3GLIE 5EJCA 5IWAM 4DR5M 4B3MM 1TDZA 1IN8A 1IN6A 2R46A 3C9PA 1XHBA 3T1YM 4B7HA 2EUCA 1GO5A 2FE8A 2MR9A 3CTWB 4IBBA 3VDUA 2G8LA 1IQPA 2ZBKB 4LJ5A 2KRKA 4LG2A 3K2LA 3KS4A 3J27B 3T38A 1ZMUA 3RE8A 3FUXA 3TPZA 4WP2A 2KZSA 4JI7M 1D0LA 3FUUA 2RKOA 1MJGM 5EXPA 3LCVB 1Q3CA 1Z5BA 2MJ5B 4X64M 3SATA 1NVMA 3E9SA 2L4EA 4KO8A 3TE6A 2UUCM 4B7FA 4GHLA 4CIZA 2Z8YM 2KHHA 4BB9A 2QNJA 2Z4SA 3KOXE 3U5ZB 4NXNM 3AOEA 1NSFA 1N34M 4YY3M 1Z5CA 4DV7M 4I8OA 1G8PA 1NNUC 2X8AA 3L29A 4MGZE 3U61A 1ZAEA 4GEWA 2I7PA 4KT0F 4PT5A 3U60B 2ZAOA 3H4JA 4PD2A 1OTRA 4DR2M 2HKJA 1ZMVA 2K9DA 2R18A 5C1BA 1TR8A 1MU5A 2KRUA 1HNWM 1W5SA 1G41A 1WGNA 2BWBA 4MGKE 3E46A 3JAMS 5IT9S 2QPAA 4IBGA 2DWLA 4LGMA 3MK6A 1R2YA 1N75A 3R9XB 2CHGA 3THGA 1I4WA 4TUWA 4M9ZA 4R3DA 4G4QA 1HT2E 2Y20A 2R44A 1SXJB 5E6JA 2L7HA 1N77A 1CUKA 1OFHA 2KEBA 4M9XA 4NL4H 4QNMA 5KPTA 4LF4M 1GJTA 4B08A 4LGYA 1QAMA 4LFBM 4Q7JA 1TF0B 3FTFA 3L2AA 4P17A 1Q02A 2JNHA 1QDTA 3U6EA 2F4VM 2F5OA 1ORYB 4WURA 4NC6A 4IBDA 2I7NA 1MN3A 2RGHA 2CWBA 1JQJC 1OAIA 2APLA 3C3EA 5JI3E 2L7IA 3U5ZA 3DZDA 4DV2M 1L2CA 2KNAA 4JI5M 2MGWA 1JR3A 2V1CA 2D7EA 2XSZA 3HU1A 4RNAA 4GKKM 4D80A 3HJQA 1J09A 5E26A 1HR0M 4MM3B 2LVAA 4EIWA 3KXEC 3U60A 3DOAA 5DFLA 1W5TA 5FTMA 1R6BX 1OIZA 5KQ8A 4ITQA 4HEOA 4GHAA 5LMNM 1TDHA 3K9OA 1VDDA 1V33A 3AKZA 2QP9X 3TWLA 4FWDA 2F5QA 4RF1A 3SMPA 3IG5A 1PM5A 3AOGA 2WZJA 4Z8XA 1IN7A 2C9CA 5EXSA 4AG6A 2GNOA 2HL7A 2JY6B 3ZQJA 4DR7M 1TTEA 1WHCA 3B7NA 5BR8M 1SXJA 2QCUA 5IZ7D 1NY5A 2L2DA 1R5LA 4DV3M 4Z6YA 2GQFA 1QQWA 4DV4M 3B7QA 2V1UA 3DA1A 4IBJA 1C1KA 1V34A 2X4AA 1YUBA 3GO8A 3M6AA 3RGSA 1QZMA 4L4UA 1QANA 4F1IA 1PJIA 4AKGA 4GRIA 5FLXS 2DZOB 1NHWC 2CV2A 3W68A 3GLGB 4FVMA 2JXNA 1VEKA 3U6MA 4GKJM 1GABA 4II7A 4RKUF 2UUAM 3LQRA 2JY8A 3GRUA 3MMPA 3RGPA 2DHRA 2K0BX 2XZUA 1PJJA 1HNXM 1IY2A 2H1RA 2RRUA 2LVOC 3EIHA 3FUWA 4DR4M 5ITXA 2OOBA 2JWSA 3FD9A 1WGLA 2XFTA 3R8FA 2QBYB 3SAWA 1L8QA 1T6OA 3GQ5A 3J81S 2O25A 2VF8A 1K3XA 3GLHB 2UUBM 2OO9A 1E9RA 1G71A 3KW6A 1V92A 1PJQA 2KZUA 2R65A 3IG8A 4NSOB 5EP4A 4I5SA 1R4GA 4LFAM 4LF9M 1N32M 1XXHE 4KHPM 4LJ6A 2DAMA 1DGHB 1AUAA 1ZV1A 2DNAA 1G3IA 2KW0A 2XH9A 2R6FA 2LVPC 3QYEA 4FCWA 4MH0E 1I94M 3Q8XA 4FW9A 4LF7M 2X49A 3I4VA 1D0MA 3FTCA 3J2PB 3J7BA 2DAKA 3NWLA 4I81A 4IBIA 2CRUA 4LF5M 4B3TM 2KNZA 4MGIE 4A3VB 4QNRA 1IN5A 3SYLA 3F92A 1VQ1A 3J80S 3GQ3A 4AW4A 3SASA 3PFIA 3GLFB 4MGHA 3KP1E 2LVNC 3FUVA 3GLGA 1UM8A 2VF7A 3HZJA 2Y0QA 3VK8A 2YQZA 3CF2A 4IJEA 2R4JA 5EXTA 1PJSA 3HKPA 2KA6B 4B3SM 1LV7A 3KSXA 2O01F 1HQCA 1Z6TA 2QBYA 2JY7A 1JB0F 2WSFF 2DWZB 2BJVA 2CHQA 1IXRC 1KSFX 3GLHA 4GIPA 4QOSA 3TWKA 2QZ4A 3TL4X 2KDLA 5L8RF 3U6CA 3NBXX 2FFJA 1NO1A 2L4FA 1VG5A 1OJLA 3JR5A 2C98A 1J7KA 4FCVA 1NNJA 3GLIB 4IIWA 3SHFA 1E9SA 3CF0A 3GRVA 1IN4A 4XK8F 3SYKA 2EKFA 5DNYA 2BWEA 4JI4M 3UK6A 2JZ0A 3M7GA 2M60A 1XC8A 1NY6A 4LY6A 1EFUB 2YR0A 3GPXA 3QAUA 2D7GA 1DGFA 3KSJA 3KOZE 3AOEC 1YE9A 3NBIA 2DWMA 1Y8GA 5EP3A 3KVWA 2CE7A 3ZCBB 1WXQA 3DFZA 4L6V6 3GLFA 5ITUA 2ZTCA 2KNVA 4HL4A 5KPRA 3UZUA 3FTEA 2E5LM 4YHHM 1FJGM 4S12A 1OKSA 5ITYA 5H37D 1LTMA 1OIPA 4GH9A 4PDIA 4LF6M 2J7NA 2UXCM 2LXEA 3GQ4A 4G4NA 2F5SA 4JI8M 4NRWA 4QOZC 3EIEA 3U6PA 3KP0E 2J7OA 3UJNA 3BOSA 3T6PA 2OOAA 4DUYM 2B3TA 2CV1A 1ZQ9A 5EP2A 4LZJA 3AV0A 2DI0A 1Z5AA 4ZPXA 1L2DA 2FNAA 3T15A 4NOOB 4B7GA 1Q3BA 3GLIA 4LJ7A 2XLJA 4I4LA 3UMMA 2V6ZM 2G5GX 2R45A 4FWGA 2QSFX 4G3OA 4LJ4A 1P3QQ 3C58A 1RU3A 3W67A 2JP7A 4JI0M 2ZM6M 4PCZA 1Z59A 1FNNA 2ZANA 5IREB 2Z4RA 4OVZB 2UXBM 1QAQA 2DZNB 1AIPC 1IBLM 4L15A 4R71A 3QWLA 4LJ8A 2HCBA 1S3SA 4FCTA 3ILKA 2DAGA 3A46A 1DGBA 2Q2EB 2JA2A 2N35A 2O5RA 3K92A 4M0DA 3TQSA 3HWSA 4KODA 3GP1A 1IXZA 2YNMD 3FRIA 3Q8GA 4JXJA 3VFDA 2JUJA 3HHXA 4L8RC 2R4EA 1XMQM 1SG9A 1IFYA 4JYAM 2FH0A 4LJAA 5DYGA 1L2BA 3A45A 1N78A 1NJGA 3GRYA 1EE8A 4IBEA 1GJSA 2DAEA 3KFUG 2MROB 4GC9A 1E94E 4LZZA 4DV5M 4G4OA 3U6LA 1G59A 2ZTDA 4W5WA 5EP1A 2LBCA 3PXGA 3FYDA 4GC5A 1OAOC 3HHZA 4Y28F 3C3DA 1SXJC 3IHPA 1PGYA 2RGOA 2EKKA 3W0FA 3GPPA 2EA0A 4ANRA 1L1ZA 4PDGA 1A5TA 1WR1B 1OFIA 3K8ZA 4D82A 1R2ZA 1IY1A 1XNQM 3AL0C 2DAIA 1F4IA 2XGNA 3GPYA 2A5YB 1R7RA 2K47A 3K1JA 2OPFA 5GKNA 3KOYE 2EJSA 3SFZA 4KLNA 3SARA 1QDRA 1TGUA 2DHYA 3D8LA 4IBCA 1XMOM 1N36M 3I4YA 1N33M 4DR3M 2AHMA 1JR3E 1QUSA 3U61B 1GVNA 3FKEA 3D8BA 3SAVA 2OQ4A 2R62A 3M0EA 5JI2E 3AJIB 2LHGA 3BXWA 2JZ1A 3VKGA 3E4RA 4REZA 4JI3M 1WIVA 3WHKA 4AQYM 1JR3D 4LRTA 4MGYE 2G3QA 3E21A 2XSZD 4BBAA 5BPVA 3UGJA 1K82A 3FYCA 1GL7A
chains in the Genus database with same CATH topology
2FS1A 2LHGA 2LHCA 1PRBA 2J5YA 2MH8A 1GJTA 2N35A 1TF0B 2VDBB 1GABA 1GJSA 2KDLA 2JWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FS1 A;  2LHG A;  2LHC A;  1PRB A;  2J5Y A;  2MH8 A;  1GJT A;  2N35 A;  1TF0 B;  2VDB B;  1GAB A;  1GJS A;  2KDL A;  2JWS A; 
#chains in the Genus database with same CATH topology
 4IBF A;  1PRB A;  1TH3 A;  4DUZ M;  5FTL A;  3VK7 A;  2UU9 M;  1WJ7 A;  4R7G A;  4JI1 M;  3AFH A;  1PJT A;  4X62 M;  2FOI C;  3SHG B;  4F2L A;  1KFV A;  5FTK A;  2MH8 A;  2JY5 A;  1SXJ E;  3HJ8 A;  4QHT A;  4BLC A;  2EO2 A;  4NSR A;  5KPZ A;  2LNH C;  5KQD A;  4LJ9 A;  1UFZ A;  3HHW A;  3MJ5 A;  2R0I A;  3U6S A;  3IEC A;  3FE3 A;  2L6O A;  1DO0 A;  4CIS A;  1XXH B;  3LMM A;  2H5X A;  2HHH M;  4K0K M;  1DGH A;  1K3W A;  1QZE A;  3KS8 A;  3TWM A;  1VDL A;  2VQE M;  2DWN A;  1SXJ D;  4OU7 A;  1HJP A;  3HGI A;  1NV8 A;  4M0W A;  2WSE F;  1HT1 E;  2LH0 A;  2XZF A;  1D0K A;  1T43 A;  2P5T A;  5EQT A;  3LQQ A;  2QHO B;  2LWX A;  3HJS A;  4RF0 A;  3LCU A;  3L27 A;  1IY0 A;  4AKI A;  4FD2 A;  3OTO M;  1EIJ A;  5ITX E;  3L25 A;  2WSC F;  3B74 A;  7CAT A;  2HAK A;  4CHT B;  4AG5 A;  3KOW E;  1T3T A;  2M5Z A;  4X66 M;  3JR4 A;  3KDS E;  2DVW B;  1X37 A;  3H4M A;  3T1H M;  2CEA A;  1G4A E;  1IXS B;  3W0L B;  3HU3 A;  4OX9 M;  1E32 A;  3B9P A;  2CP8 A;  4M9S A;  5FTN A;  4GIT A;  2QEN A;  1NV9 A;  3I04 M;  2UXD M;  3HY5 A;  2ERC A;  4DR1 M;  4UN2 B;  5FTJ A;  2DKL A;  4L16 A;  1C7Y A;  2C96 A;  1XXH A;  4QHS A;  2K6B A;  2D7H A;  4DBG B;  3HU2 A;  4D81 A;  1HQY E;  3BBZ A;  3L26 A;  4JV5 M;  4HLQ A;  2ZAM A;  3VDP A;  5EXX A;  3SC3 A;  4JI2 M;  2DZL A;  3B7Z A;  1NHG C;  2XFS A;  4GMQ A;  2Y21 A;  1NJF A;  1Q39 A;  3V76 A;  5LMU M;  1MX0 A;  2NQ8 C;  3GLG E;  2LHC A;  5ITQ A;  3SAU A;  1IBM M;  3HHY A;  4NXM M;  2YFQ A;  1DV0 A;  2VII A;  3QYB A;  1KYI A;  2C99 A;  3FRH A;  3FUT A;  3WHL A;  3FTD A;  3A42 A;  1L1T A;  3VKH A;  1YSY A;  3SMS A;  4G4R A;  4IBK A;  2QQ8 A;  4LFC M;  3U6Q A;  4MB7 A;  4AI6 A;  1BVS A;  1XB2 B;  3GLH E;  2LTU A;  1GKI A;  2BNK A;  3CGW A;  2CHV A;  3PVS A;  2CV0 A;  4LF8 M;  4CGY B;  3J7A S;  4X65 M;  5A2Q S;  3GRR A;  1QVR A;  5ITT A;  2W82 A;  2C9O A;  3I01 M;  1IXS A;  3U6D A;  4XBO A;  1OQY A;  2Z3X A;  2DEN A;  1IBK M;  1DGG A;  2F5P A;  1XNR M;  4B3R M;  2CFO A;  4WW0 A;  1VEJ A;  4IJF A;  5ITR A;  3K9P A;  2LVQ D;  3ZH9 B;  1HNZ M;  3PNV A;  3LW5 F;  4G6Z A;  2L09 A;  3SBJ A;  2F5N A;  5FSW A;  4FWH A;  2HWJ A;  1TH2 A;  1QYR A;  4DV1 M;  5DYI A;  1VEG A;  2VDB B;  4OW0 A;  3B89 A;  3RFW A;  1IM2 A;  4LRS A;  2FS1 A;  3GLF E;  1QUT A;  2BJW A;  4AKH A;  1D2N A;  2CUZ A;  3ZC7 B;  2C5R A;  5KO3 A;  2DXI A;  1J5E M;  3MHV C;  2KXE A;  4OVZ A;  4AZF A;  4DR6 M;  2Y0T A;  3L28 A;  4NRV A;  4L78 A;  1DO2 A;  3PNY A;  4LCB A;  3CF6 E;  3HX3 A;  3LVV A;  3I51 A;  3LVW A;  3VLF B;  4DV6 M;  5C18 A;  2J5Y A;  4XGI A;  4CJ6 A;  4P16 A;  1ZMW A;  1YLA A;  4JI6 M;  3U6O A;  4DV0 M;  1GL6 A;  1GLN A;  8CAT A;  1TH4 A;  2Z7J A;  1QAO A;  4JN6 A;  2XEP A;  3A98 B;  2VQF M;  5F3W A;  2XF3 A;  3GPU A;  1H6U A;  1XWI A;  3GLI E;  5EJC A;  5IWA M;  4DR5 M;  4B3M M;  1TDZ A;  1IN8 A;  1IN6 A;  2R46 A;  3C9P A;  1XHB A;  3T1Y M;  4B7H A;  2EUC A;  1GO5 A;  2FE8 A;  2MR9 A;  3CTW B;  4IBB A;  3VDU A;  2G8L A;  1IQP A;  2ZBK B;  4LJ5 A;  2KRK A;  4LG2 A;  3K2L A;  3KS4 A;  3J27 B;  3T38 A;  1ZMU A;  3RE8 A;  3FUX A;  3TPZ A;  4WP2 A;  2KZS A;  4JI7 M;  1D0L A;  3FUU A;  2RKO A;  1MJG M;  5EXP A;  3LCV B;  1Q3C A;  1Z5B A;  2MJ5 B;  4X64 M;  3SAT A;  1NVM A;  3E9S A;  2L4E A;  4KO8 A;  3TE6 A;  2UUC M;  4B7F A;  4GHL A;  4CIZ A;  2Z8Y M;  2KHH A;  4BB9 A;  2QNJ A;  2Z4S A;  3KOX E;  3U5Z B;  4NXN M;  3AOE A;  1NSF A;  1N34 M;  4YY3 M;  1Z5C A;  4DV7 M;  4I8O A;  1G8P A;  1NNU C;  2X8A A;  3L29 A;  4MGZ E;  3U61 A;  1ZAE A;  4GEW A;  2I7P A;  4KT0 F;  4PT5 A;  3U60 B;  2ZAO A;  3H4J A;  4PD2 A;  1OTR A;  4DR2 M;  2HKJ A;  1ZMV A;  2K9D A;  2R18 A;  5C1B A;  1TR8 A;  1MU5 A;  2KRU A;  1HNW M;  1W5S A;  1G41 A;  1WGN A;  2BWB A;  4MGK E;  3E46 A;  3JAM S;  5IT9 S;  2QPA A;  4IBG A;  2DWL A;  4LGM A;  3MK6 A;  1R2Y A;  1N75 A;  3R9X B;  2CHG A;  3THG A;  1I4W A;  4TUW A;  4M9Z A;  4R3D A;  4G4Q A;  1HT2 E;  2Y20 A;  2R44 A;  1SXJ B;  5E6J A;  2L7H A;  1N77 A;  1CUK A;  1OFH A;  2KEB A;  4M9X A;  4NL4 H;  4QNM A;  5KPT A;  4LF4 M;  1GJT A;  4B08 A;  4LGY A;  1QAM A;  4LFB M;  4Q7J A;  1TF0 B;  3FTF A;  3L2A A;  4P17 A;  1Q02 A;  2JNH A;  1QDT A;  3U6E A;  2F4V M;  2F5O A;  1ORY B;  4WUR A;  4NC6 A;  4IBD A;  2I7N A;  1MN3 A;  2RGH A;  2CWB A;  1JQJ C;  1OAI A;  2APL A;  3C3E A;  5JI3 E;  2L7I A;  3U5Z A;  3DZD A;  4DV2 M;  1L2C A;  2KNA A;  4JI5 M;  2MGW A;  1JR3 A;  2V1C A;  2D7E A;  2XSZ A;  3HU1 A;  4RNA A;  4GKK M;  4D80 A;  3HJQ A;  1J09 A;  5E26 A;  1HR0 M;  4MM3 B;  2LVA A;  4EIW A;  3KXE C;  3U60 A;  3DOA A;  5DFL A;  1W5T A;  5FTM A;  1R6B X;  1OIZ A;  5KQ8 A;  4ITQ A;  4HEO A;  4GHA A;  5LMN M;  1TDH A;  3K9O A;  1VDD A;  1V33 A;  3AKZ A;  2QP9 X;  3TWL A;  4FWD A;  2F5Q A;  4RF1 A;  3SMP A;  3IG5 A;  1PM5 A;  3AOG A;  2WZJ A;  4Z8X A;  1IN7 A;  2C9C A;  5EXS A;  4AG6 A;  2GNO A;  2HL7 A;  2JY6 B;  3ZQJ A;  4DR7 M;  1TTE A;  1WHC A;  3B7N A;  5BR8 M;  1SXJ A;  2QCU A;  5IZ7 D;  1NY5 A;  2L2D A;  1R5L A;  4DV3 M;  4Z6Y A;  2GQF A;  1QQW A;  4DV4 M;  3B7Q A;  2V1U A;  3DA1 A;  4IBJ A;  1C1K A;  1V34 A;  2X4A A;  1YUB A;  3GO8 A;  3M6A A;  3RGS A;  1QZM A;  4L4U A;  1QAN A;  4F1I A;  1PJI A;  4AKG A;  4GRI A;  5FLX S;  2DZO B;  1NHW C;  2CV2 A;  3W68 A;  3GLG B;  4FVM A;  2JXN A;  1VEK A;  3U6M A;  4GKJ M;  1GAB A;  4II7 A;  4RKU F;  2UUA M;  3LQR A;  2JY8 A;  3GRU A;  3MMP A;  3RGP A;  2DHR A;  2K0B X;  2XZU A;  1PJJ A;  1HNX M;  1IY2 A;  2H1R A;  2RRU A;  2LVO C;  3EIH A;  3FUW A;  4DR4 M;  5ITX A;  2OOB A;  2JWS A;  3FD9 A;  1WGL A;  2XFT A;  3R8F A;  2QBY B;  3SAW A;  1L8Q A;  1T6O A;  3GQ5 A;  3J81 S;  2O25 A;  2VF8 A;  1K3X A;  3GLH B;  2UUB M;  2OO9 A;  1E9R A;  1G71 A;  3KW6 A;  1V92 A;  1PJQ A;  2KZU A;  2R65 A;  3IG8 A;  4NSO B;  5EP4 A;  4I5S A;  1R4G A;  4LFA M;  4LF9 M;  1N32 M;  1XXH E;  4KHP M;  4LJ6 A;  2DAM A;  1DGH B;  1AUA A;  1ZV1 A;  2DNA A;  1G3I A;  2KW0 A;  2XH9 A;  2R6F A;  2LVP C;  3QYE A;  4FCW A;  4MH0 E;  1I94 M;  3Q8X A;  4FW9 A;  4LF7 M;  2X49 A;  3I4V A;  1D0M A;  3FTC A;  3J2P B;  3J7B A;  2DAK A;  3NWL A;  4I81 A;  4IBI A;  2CRU A;  4LF5 M;  4B3T M;  2KNZ A;  4MGI E;  4A3V B;  4QNR A;  1IN5 A;  3SYL A;  3F92 A;  1VQ1 A;  3J80 S;  3GQ3 A;  4AW4 A;  3SAS A;  3PFI A;  3GLF B;  4MGH A;  3KP1 E;  2LVN C;  3FUV A;  3GLG A;  1UM8 A;  2VF7 A;  3HZJ A;  2Y0Q A;  3VK8 A;  2YQZ A;  3CF2 A;  4IJE A;  2R4J A;  5EXT A;  1PJS A;  3HKP A;  2KA6 B;  4B3S M;  1LV7 A;  3KSX A;  2O01 F;  1HQC A;  1Z6T A;  2QBY A;  2JY7 A;  1JB0 F;  2WSF F;  2DWZ B;  2BJV A;  2CHQ A;  1IXR C;  1KSF X;  3GLH A;  4GIP A;  4QOS A;  3TWK A;  2QZ4 A;  3TL4 X;  2KDL A;  5L8R F;  3U6C A;  3NBX X;  2FFJ A;  1NO1 A;  2L4F A;  1VG5 A;  1OJL A;  3JR5 A;  2C98 A;  1J7K A;  4FCV A;  1NNJ A;  3GLI B;  4IIW A;  3SHF A;  1E9S A;  3CF0 A;  3GRV A;  1IN4 A;  4XK8 F;  3SYK A;  2EKF A;  5DNY A;  2BWE A;  4JI4 M;  3UK6 A;  2JZ0 A;  3M7G A;  2M60 A;  1XC8 A;  1NY6 A;  4LY6 A;  1EFU B;  2YR0 A;  3GPX A;  3QAU A;  2D7G A;  1DGF A;  3KSJ A;  3KOZ E;  3AOE C;  1YE9 A;  3NBI A;  2DWM A;  1Y8G A;  5EP3 A;  3KVW A;  2CE7 A;  3ZCB B;  1WXQ A;  3DFZ A;  4L6V 6;  3GLF A;  5ITU A;  2ZTC A;  2KNV A;  4HL4 A;  5KPR A;  3UZU A;  3FTE A;  2E5L M;  4YHH M;  1FJG M;  4S12 A;  1OKS A;  5ITY A;  5H37 D;  1LTM A;  1OIP A;  4GH9 A;  4PDI A;  4LF6 M;  2J7N A;  2UXC M;  2LXE A;  3GQ4 A;  4G4N A;  2F5S A;  4JI8 M;  4NRW A;  4QOZ C;  3EIE A;  3U6P A;  3KP0 E;  2J7O A;  3UJN A;  3BOS A;  3T6P A;  2OOA A;  4DUY M;  2B3T A;  2CV1 A;  1ZQ9 A;  5EP2 A;  4LZJ A;  3AV0 A;  2DI0 A;  1Z5A A;  4ZPX A;  1L2D A;  2FNA A;  3T15 A;  4NOO B;  4B7G A;  1Q3B A;  3GLI A;  4LJ7 A;  2XLJ A;  4I4L A;  3UMM A;  2V6Z M;  2G5G X;  2R45 A;  4FWG A;  2QSF X;  4G3O A;  4LJ4 A;  1P3Q Q;  3C58 A;  1RU3 A;  3W67 A;  2JP7 A;  4JI0 M;  2ZM6 M;  4PCZ A;  1Z59 A;  1FNN A;  2ZAN A;  5IRE B;  2Z4R A;  4OVZ B;  2UXB M;  1QAQ A;  2DZN B;  1AIP C;  1IBL M;  4L15 A;  4R71 A;  3QWL A;  4LJ8 A;  2HCB A;  1S3S A;  4FCT A;  3ILK A;  2DAG A;  3A46 A;  1DGB A;  2Q2E B;  2JA2 A;  2N35 A;  2O5R A;  3K92 A;  4M0D A;  3TQS A;  3HWS A;  4KOD A;  3GP1 A;  1IXZ A;  2YNM D;  3FRI A;  3Q8G A;  4JXJ A;  3VFD A;  2JUJ A;  3HHX A;  4L8R C;  2R4E A;  1XMQ M;  1SG9 A;  1IFY A;  4JYA M;  2FH0 A;  4LJA A;  5DYG A;  1L2B A;  3A45 A;  1N78 A;  1NJG A;  3GRY A;  1EE8 A;  4IBE A;  1GJS A;  2DAE A;  3KFU G;  2MRO B;  4GC9 A;  1E94 E;  4LZZ A;  4DV5 M;  4G4O A;  3U6L A;  1G59 A;  2ZTD A;  4W5W A;  5EP1 A;  2LBC A;  3PXG A;  3FYD A;  4GC5 A;  1OAO C;  3HHZ A;  4Y28 F;  3C3D A;  1SXJ C;  3IHP A;  1PGY A;  2RGO A;  2EKK A;  3W0F A;  3GPP A;  2EA0 A;  4ANR A;  1L1Z A;  4PDG A;  1A5T A;  1WR1 B;  1OFI A;  3K8Z A;  4D82 A;  1R2Z A;  1IY1 A;  1XNQ M;  3AL0 C;  2DAI A;  1F4I A;  2XGN A;  3GPY A;  2A5Y B;  1R7R A;  2K47 A;  3K1J A;  2OPF A;  5GKN A;  3KOY E;  2EJS A;  3SFZ A;  4KLN A;  3SAR A;  1QDR A;  1TGU A;  2DHY A;  3D8L A;  4IBC A;  1XMO M;  1N36 M;  3I4Y A;  1N33 M;  4DR3 M;  2AHM A;  1JR3 E;  1QUS A;  3U61 B;  1GVN A;  3FKE A;  3D8B A;  3SAV A;  2OQ4 A;  2R62 A;  3M0E A;  5JI2 E;  3AJI B;  2LHG A;  3BXW A;  2JZ1 A;  3VKG A;  3E4R A;  4REZ A;  4JI3 M;  1WIV A;  3WHK A;  4AQY M;  1JR3 D;  4LRT A;  4MGY E;  2G3Q A;  3E21 A;  2XSZ D;  4BBA A;  5BPV A;  3UGJ A;  1K82 A;  3FYC A;  1GL7 A; 
#chains in the Genus database with same CATH homology
 2FS1 A;  2LHG A;  2LHC A;  1PRB A;  2J5Y A;  2MH8 A;  1GJT A;  2N35 A;  1TF0 B;  2VDB B;  1GAB A;  1GJS A;  2KDL A;  2JWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...