1X37A

Structure of bacillus subtilis lon protease ssd domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
b'AGYTEIEKLEIVKDHLLPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAAICRKAAKAIVAEERKRITVTEKNLQDFIGKRIFRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent protease La 1
publication title Structural basis and DNA binding property of SSD domain of Bacillus subtilis Lon protease
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 20
structure length 95
sequence length 95
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1x37A00
3EIHA 4D81A 4KODA 2RKOA 1OJLA 2DWZB 5EP1A 2DHRA 2ZANA 3PVSA 3GLGB 1SXJA 4QNRA 4QHTA 3U61B 1IM2A 4LJ4A 1KYIA 4ZPXA 2CE7A 4D80A 3GLFB 1FNNA 1NJFA 1IN7A 1D2NA 4LJ9A 5FTLA 1IXZA 2CHQA 1JR3A 2XSZD 4LJ6A 3MHVC 4I81A 1NSFA 4LRTA 5JI3E 4FD2A 1DO2A 3DZDA 1OFIA 1W5SA 3K1JA 1NJGA 1IY0A 2V1UA 2X8AA 3PXGA 3VFDA 1LV7A 5DYGA 4LRSA 1JQJC 4LJAA 4D82A 2C98A 2ZAMA 2CHVA 2QENA 3VLFB 1IQPA 2XSZA 3HWSA 3GLIA 1IXSB 1IN8A 4QOSA 5EP4A 3CF0A 1C1KA 2BJWA 3GLHB 3H4MA 4FWHA 4LCBA 4FW9A 3HU1A 1E94E 1S3SA 4GITA 2QZ4A 2KRKA 3KW6A 1R6BX 1UM8A 2DVWB 4I4LA 3GLGA 5EP3A 1IY2A 5FTMA 2V6ZM 1IN5A 4FCTA 2DZOB 1W5TA 4LY6A 1KSFX 3GLFA 3CF2A 4A3VB 1QZMA 1XXHB 1HT1E 2C9OA 4WW0A 2QPAA 3HU3A 3R8FA 2QP9X 5FTKA 3M0EA 5EXSA 3PFIA 2DZNB 2Z4SA 1IN4A 1E32A 1IXRC 2HCBA 1L8QA 4EIWA 5EP2A 2FNAA 3WHKA 4FCVA 4LZZA 1SXJD 1G4AE 1QVRA 2QBYB 4L4UA 4LJ7A 3GLIB 2CHGA 3EIEA 1J7KA 1SXJB 3M6AA 4QNMA 1NVMA 2Z4RA 4LJ8A 4FWDA 3GLHA 1HQYE 5DYIA 5EQTA 2BJVA 3SC3A 3D8BA 4L16A 4Z8XA 3SYKA 1DO0A 2C99A 1X37A 2C9CA 2R62A 5C1BA 3UK6A 1G3IA 4KLNA 3KDSE 3U5ZB 4KO8A 1HT2E 4FWGA 2VIIA 3U60B 1XWIA 1SXJC 3AJIB 1IY1A 3BOSA 3SYLA 3ZH9B 4L15A 1OFHA 1XXHA 5EXTA 4JN6A 4QHSA 1HQCA 1NY5A 3HU2A 4FCWA 5FTNA 1SXJE 2ZAOA 2R65A 4LJ5A 1G41A 3WHLA 1R7RA 1JR3D 3B9PA 5C18A 1NY6A 1IN6A 2CEAA 4LGMA 5EXPA 5FTJA 5EXXA 2QBYA 5JI2E 2C96A
chains in the Genus database with same CATH superfamily
3EIHA 5IT9S 4KODA 1TGUA 2DWZB 5EP1A 4IBFA 4RF0A 4QHTA 1IM2A 1CUKA 2JUJA 3TL4X 4IBDA 5ITXE 2O25A 3C9PA 1FNNA 1DGHA 4XGIA 1D2NA 1IXZA 2UUCM 4IBIA 4Q7JA 2JY7A 2KDLA 4DUZM 1I4WA 4AQYM 1HJPA 1DO2A 2J7OA 3DZDA 1W5SA 3KVWA 4L8RC 3R9XB 3FUUA 1IY0A 5LMUM 4JI3M 1RU3A 1WIVA 4G3OA 3VFDA 2KZSA 1N32M 4LRSA 4LJAA 4D82A 1L2BA 2LVPC 3Q8GA 4JYAM 4QOZC 1K3WA 2K9DA 1G8PA 1MX0A 2VDBB 2XSZA 5H37D 4ANRA 4B08A 3GQ4A 4FVMA 1IN8A 5FLXS 5EP4A 4TUWA 1MJGM 3GLHB 2MR9A 3J81S 4FWHA 3KOZE 4JI4M 2JY5A 3TE6A 4JI6M 4FW9A 4LF4M 4GITA 2RGOA 3W0LB 2DAEA 2KRKA 2KRUA 2LXEA 2L4EA 4LZJA 1R6BX 2DVWB 3QAUA 4I4LA 2UUBM 3L2AA 4HEOA 1Z5AA 1AUAA 3GRUA 3U61A 4I5SA 2V6ZM 4CGYB 2N35A 2F5NA 1QAOA 2K47A 2UXCM 2A5YB 1KSFX 4LGYA 2BWEA 2G3QA 3B89A 2ZTDA 2Y0TA 3HU3A 3J7AS 2QP9X 2H1RA 2KW0A 4L6V6 3U6QA 3KOWE 4EIWA 2CUZA 2OOAA 4AKIA 4GC9A 3U6CA 4OW0A 2DWMA 2QBYB 2GNOA 1NV8A 1ORYB 2Y20A 1QUTA 2MROB 2L09A 2CHGA 3B7QA 4B3SM 1Q02A 1A5TA 4QNMA 1HR0M 2Z4RA 3PNYA 4LJ8A 2E5LM 3TQSA 3AFHA 4IBGA 2K6BA 1L1ZA 2Z8YM 4L78A 2C99A 3RGSA 4R3DA 1ZQ9A 5C1BA 2O5RA 4KLNA 1E9RA 2CFOA 4GC5A 2KA6B 4DBGB 3SAUA 1VEKA 3FUTA 4B7FA 2ZTCA 1SXJC 4IJEA 1IY1A 3BOSA 4JI0M 1N77A 3L28A 4LG2A 1TH3A 4II7A 1XXHA 4JN6A 4QHSA 1IBLM 2J7NA 3MJ5A 4JI2M 3TWMA 1BVSA 2R65A 3AOEA 3MK6A 1I94M 4DV3M 5ITYA 4MGZE 3LQQA 4PT5A 2F5OA 3FTFA 1IBKM 4GMQA 1IN6A 4IBEA 2R18A 4DV4M 4NXMM 1PJJA 4DV1M 4B7GA 2VF8A 1XNQM 2C96A 2R46A 3IHPA 1OJLA 2DKLA 4K0KM 2DHRA 3U6OA 3PVSA 1XB2B 3GLGB 4DR5M 3U6SA 1T43A 3A42A 1MN3A 4ZPXA 2DWLA 3C3DA 2CE7A 4WURA 3D8LA 1EFUB 2LWXA 3GLFB 1NJFA 4LJ9A 2CHQA 3QWLA 1JR3A 1GKIA 2WZJA 4M9XA 2LTUA 4NC6A 3UZUA 3IG8A 4G6ZA 4UN2B 4I8OA 1WR1B 4P16A 4LF9M 1KFVA 3K9OA 1OFIA 3E9SA 3K1JA 3U6LA 4MGHA 3KFUG 3SMPA 3Q8XA 3U5ZA 1GJTA 3U60A 3FTCA 5DYGA 3UGJA 1PRBA 4DV6M 4DR6M 1JQJC 1YE9A 2EKKA 1H6UA 1YUBA 2G5GX 2JY6B 1TTEA 2ZBKB 1SG9A 3J2PB 1DGFA 3L29A 5KO3A 5L8RF 3FTDA 4P17A 1VG5A 1QDTA 3HHZA 3GLIA 1IXSB 3VDPA 2C5RA 2CWBA 2BJWA 3CF0A 2OQ4A 1QDRA 3C3EA 4LF5M 3THGA 1Z6TA 2DHYA 1Z5CA 1VEJA 4LCBA 1GL6A 3SMSA 3CGWA 4DR1M 2QZ4A 1LTMA 1TR8A 3C58A 3KW6A 3SHGB 1TDZA 1YSYA 2H5XA 5FSWA 2DENA 1IY2A 5FTMA 3K2LA 2JXNA 1IN5A 1Q3BA 4R71A 2JA2A 2I7PA 3FUVA 4LY6A 4AW4A 1IFYA 4AG5A 3DFZA 5ITQA 2HL7A 4B3RM 3I01M 1GVNA 1TDHA 1VQ1A 1QAQA 3MMPA 1QZMA 2C9OA 1HNWM 3HJSA 3U6MA 3R8FA 5EJCA 3GLGE 4LFBM 5FTKA 2YR0A 3J7BA 3NBIA 3T15A 5GKNA 1IN4A 3GLFE 2CRUA 2HAKA 1J09A 4MGIE 2OO9A 4FCVA 3GPYA 3SFZA 1TF0B 2LH0A 1IBMM 4DV7M 3U6EA 3HKPA 2MH8A 4G4RA 2EKFA 4IBCA 3FD9A 3GLIB 2WSEF 3EIEA 3U6PA 3BBZA 2FE8A 1YLAA 1FJGM 1PGYA 1D0KA 2HWJA 2WSCF 1DGHB 3UJNA 2XFSA 3E4RA 3SC3A 3QYBA 4AKGA 7CATA 4PDIA 2DZLA 2LVOC 2R4JA 2C9CA 2R62A 3A45A 3LQRA 1G3IA 4GRIA 4CHTB 1OAIA 2BNKA 4DV0M 2VIIA 4MM3B 2EA0A 4GEWA 4Y28F 2BWBA 4G4QA 3SYLA 1HNZM 4L15A 1GJSA 2Z7JA 1OFHA 3HGIA 2WSFF 5EXTA 1K3XA 4FCWA 3VKHA 1NHGC 2D7EA 1QQWA 5ITTA 1NNUC 1E9SA 2L6OA 4RKUF 4Z6YA 3W0FA 3WHLA 4AZFA 3GRYA 2CV1A 1R4GA 4JI5M 4KHPM 1TH4A 3FYDA 1VEGA 1NY6A 2M60A 1OIZA 3DOAA 3RE8A 4XBOA 5ITXA 3SATA 4LGMA 4G4NA 5EXPA 1K82A 1L1TA 5EXXA 3JAMS 1KYIA 1D0MA 3LW5F 2DAIA 3CTWB 3KXEC 2APLA 2RKOA 4RNAA 1WGLA 2ZANA 1VDLA 1ZMVA 4S12A 1SXJA 4QNRA 3AKZA 2XZFA 3U61B 4OX9M 2UXBM 4LJ4A 1Z59A 1N36M 3T1YM 3VDUA 2R45A 3K9PA 4JXJA 3HJQA 5E26A 3ZC7B 3FE3A 1IN7A 2FS1A 1NNJA 3OTOM 2DAMA 4NRWA 3MHVC 2FFJA 1NHWC 1NSFA 4LRTA 2B3TA 1QUSA 4M0WA 4B7HA 1WXQA 1Z5BA 3GLIE 4DR7M 1N33M 3AOGA 4X65M 4FD2A 4F2LA 3GPPA 4AG6A 2XH9A 3V76A 3PXGA 2YQZA 3FUXA 3JR4A 5DNYA 1R2ZA 3I04M 2R44A 3SARA 4GH9A 4LFCM 3H4JA 2C98A 4LFAM 4AI6A 1IQPA 2P5TA 3HWSA 1OQYA 4NOOB 4QOSA 4GKJM 4NSOB 2KNVA 2MJ5B 3HY5A 4DUYM 1XHBA 3FRIA 3H4MA 3T38A 2F5QA 3HHWA 1S3SA 1ZMUA 1ZV1A 2YNMD 5KPTA 4JI8M 3VKGA 3FTEA 3NWLA 1WJ7A 2JY8A 3GP1A 2F4VM 4PCZA 3T6PA 1QAMA 1XNRM 4FCTA 3AL0C 1W5TA 2F5SA 2MGWA 4PD2A 2CP8A 2CV2A 1F4IA 3GRVA 1WHCA 4A3VB 1XXHB 4WW0A 2QPAA 2G8LA 2Q2EB 3KS8A 3TWKA 1N78A 2KZUA 1T6OA 2JP7A 4GKKM 2R0IA 5IWAM 5EXSA 4LF8M 2DZNB 2LHCA 3B74A 3HZJA 3TPZA 4LF6M 2Z4SA 2UXDM 1E32A 2I7NA 4WP2A 1L8QA 2OOBA 2XLJA 2X49A 4LZZA 3FYCA 4F1IA 2R4EA 1G4AE 1OAOC 3VK7A 4NXNM 3I4VA 3ILKA 4IBJA 2D7HA 3GRRA 2KNAA 2VF7A 5BR8M 3M6AA 2J5YA 3HHXA 4FWDA 5KQDA 3GO8A 3GLHA 4HLQA 2LHGA 3B7ZA 3A46A 4NL4H 1AIPC 2FOIC 2BJVA 5EQTA 1ZMWA 3D8BA 2XFTA 4JV5M 1T3TA 1V33A 1DO0A 4OVZA 5IZ7D 1J5EM 3TWLA 5A2QS 3FRHA 1L2CA 1GLNA 2CV0A 3UK6A 3ZQJA 4NRVA 3KDSE 1GABA 1PJIA 4M9ZA 3U5ZB 2JZ1A 1HT2E 2UUAM 2K0BX 5ITUA 3U60B 4M0DA 1Q39A 1XWIA 3AJIB 3JR5A 1NV9A 4HL4A 2VQEM 3K8ZA 2KHHA 2L7IA 2LVAA 1OKSA 3RGPA 2RGHA 1OIPA 1SXJE 1N34M 3GPXA 4DR2M 3SAVA 2EO2A 1G59A 3KSJA 1G41A 4YHHM 3T1HM 2YFQA 4DV5M 2QCUA 1HNXM 3LCVB 4GHLA 5C18A 2HHHM 3BXWA 3DA1A 4JI1M 1P3QQ 5KQ8A 1TH2A 2LNHC 1XXHE 2EUCA 2KEBA 5FTJA 4M9SA 2OPFA 3GPUA 2QBYA 4ITQA 1NO1A 2JWSA 2L4FA 4D81A 3GQ3A 2XGNA 3W67A 5IREB 1DGBA 4D80A 2KXEA 1PJQA 3IECA 3L27A 4MGYE 3SBJA 1V92A 4IJFA 5FTLA 2XF3A 4JI7M 2XSZD 4OVZB 4LJ6A 4I81A 1V34A 2LVNC 3ZCBB 2DXIA 1WGNA 3KSXA 5JI3E 2DAKA 3J80S 5BPVA 3NBXX 4BB9A 1NJGA 2XEPA 3FUWA 1DV0A 4X66M 4DR4M 2Y21A 3J27B 2V1UA 2UU9M 2X8AA 4NSRA 1OTRA 1XMQM 4OU7A 1JR3E 1JB0F 1LV7A 4IBBA 1GL7A 3E46A 3L26A 1N75A 4GHAA 4CJ6A 1PJTA 3CF6E 2QSFX 2CHVA 2QENA 2ZAMA 3VLFB 1GO5A 4AKHA 3KP0E 5E6JA 1G71A 2RRUA 1C1KA 2L7HA 3KP1E 4XK8F 2O01F 3QYEA 2R6FA 2LBCA 3HU1A 1E94E 1PM5A 4BBAA 4YY3M 3LVVA 4IIWA 4KT0F 1UM8A 2X4AA 3FKEA 3F92A 2HKJA 3GLGA 2QQ8A 5EP3A 3LVWA 3W68A 4CIZA 2DAGA 2F5PA 2DZOB 1VDDA 2AHMA 3LMMA 3GLFA 1Y8GA 3CF2A 2NQ8C 4MGKE 1D0LA 3KOYE 1XC8A 2QHOB 3A98B 3HHYA 1EE8A 1HT1E 1QZEA 1R2YA 3AV0A 1L2DA 2EJSA 4X64M 4BLCA 4PDGA 2Z3XA 4W5WA 2DWNA 3KS4A 3U6DA 2LVQD 3HX3A 3M0EA 3PFIA 2FH0A 3GLHE 1PJSA 5DFLA 4B3MM 1IXRC 3SAWA 3IG5A 2GQFA 2HCBA 3B7NA 1XMOM 5EP2A 2FNAA 3WHKA 3GQ5A 1Q3CA 1SXJD 1QVRA 1QANA 2V1CA 3I51A 5KPRA 1ZAEA 2Y0QA 4L4UA 4LJ7A 1QYRA 2JNHA 1J7KA 3SASA 4B3TM 1SXJB 1MU5A 1IXSA 1NVMA 2JZ0A 3HJ8A 4R7GA 3AOEC 2L2DA 4DR3M 2XZUA 1HQYE 5DYIA 1DGGA 1EIJA 4L16A 3SYKA 4Z8XA 2QNJA 4DV2M 3SHFA 1X37A 4CISA 3LCUA 2DI0A 4GIPA 5ITRA 3L25A 3K92A 8CATA 3PNVA 4LF7M 4KO8A 4FWGA 5KPZA 3UMMA 2W82A 3KOXE 3RFWA 4G4OA 3VK8A 3ZH9B 1C7YA 5LMNM 5F3WA 1HQCA 1NY5A 2ERCA 3HU2A 5FTNA 4MH0E 2ZAOA 4LJ5A 4IBKA 2M5ZA 2KNZA 1R5LA 1R7RA 1JR3D 1UFZA 3E21A 4X62M 3B9PA 2VQFM 2DNAA 2ZM6M 2CEAA 4RF1A 4REZA 2D7GA 3M7GA 3I4YA 4MB7A 5JI2E
chains in the Genus database with same CATH topology
3EIHA 5IT9S 4KODA 1TGUA 2DWZB 5EP1A 4IBFA 4RF0A 4QHTA 1IM2A 3TL4X 4IBDA 5ITXE 1FNNA 1DGHA 4XGIA 1D2NA 1IXZA 2UUCM 4IBIA 4DUZM 1I4WA 4AQYM 1DO2A 2J7OA 3DZDA 1W5SA 3KVWA 4L8RC 3R9XB 3FUUA 1IY0A 5LMUM 4JI3M 3VFDA 2KZSA 1N32M 4LRSA 4LJAA 4D82A 1L2BA 4JYAM 4QOZC 1K3WA 1G8PA 1MX0A 2XSZA 5H37D 4B08A 3GQ4A 4FVMA 1IN8A 5FLXS 5EP4A 4TUWA 3GLHB 3J81S 4FWHA 3KOZE 4JI4M 3TE6A 4JI6M 4FW9A 4LF4M 4GITA 2RGOA 3W0LB 2KRKA 2KRUA 2LXEA 4LZJA 1R6BX 2DVWB 3QAUA 4I4LA 2UUBM 3L2AA 1Z5AA 3GRUA 3U61A 4I5SA 2V6ZM 4CGYB 2F5NA 1QAOA 2K47A 2UXCM 2A5YB 1KSFX 4LGYA 2Y0TA 3HU3A 3J7AS 2QP9X 2H1RA 2KW0A 3U6QA 3KOWE 4EIWA 2CUZA 4AKIA 4GC9A 3U6CA 4OW0A 2DWMA 2QBYB 1ORYB 2Y20A 2L09A 2CHGA 4B3SM 4QNMA 1HR0M 2Z4RA 3PNYA 4LJ8A 2E5LM 3TQSA 3AFHA 4IBGA 1L1ZA 4L78A 2C99A 3RGSA 4R3DA 1ZQ9A 5C1BA 2O5RA 4KLNA 1E9RA 2CFOA 4GC5A 2KA6B 3SAUA 4B7FA 3FUTA 1SXJC 4IJEA 1IY1A 3BOSA 4JI0M 1N77A 3L28A 4LG2A 1TH3A 4II7A 1XXHA 4JN6A 4QHSA 1IBLM 2J7NA 3MJ5A 4JI2M 3TWMA 3AOEA 2R65A 3MK6A 1I94M 4DV3M 5ITYA 4MGZE 3LQQA 4PT5A 2F5OA 3FTFA 1IBKM 4GMQA 1IN6A 4IBEA 2R18A 4DV4M 4NXMM 1PJJA 4DV1M 4B7GA 2C96A 2R46A 1OJLA 4K0KM 2DHRA 3U6OA 3PVSA 3GLGB 4DR5M 3U6SA 3A42A 4ZPXA 2DWLA 2CE7A 4WURA 3D8LA 2LWXA 3GLFB 1NJFA 4LJ9A 2CHQA 3QWLA 1JR3A 1GKIA 4M9XA 3UZUA 3IG8A 4G6ZA 4I8OA 4P16A 4LF9M 1KFVA 1OFIA 3E9SA 3K1JA 3U6LA 4MGHA 3KFUG 3SMPA 3Q8XA 3U5ZA 3U60A 3FTCA 5DYGA 3UGJA 4DV6M 4DR6M 1JQJC 1YE9A 2ZBKB 1H6UA 1YUBA 2G5GX 3L29A 3J2PB 4AW4A 1DGFA 5KO3A 3FTDA 3HHZA 3GLIA 1IXSB 3VDPA 2C5RA 3CF0A 2BJWA 2OQ4A 4LF5M 3THGA 1Z6TA 4LCBA 1Z5CA 1GL6A 3SMSA 4DR1M 2QZ4A 3C58A 3KW6A 3SHGB 1TDZA 1YSYA 5FSWA 1IY2A 5FTMA 3K2LA 1IN5A 1Q3BA 3FUVA 2I7PA 2JA2A 4LY6A 4AG5A 3DFZA 5ITQA 2HL7A 4B3RM 1GVNA 1TDHA 1QAQA 1QZMA 2C9OA 1HNWM 3HJSA 3U6MA 3R8FA 5EJCA 4LFBM 5FTKA 2YR0A 3J7BA 3NBIA 3T15A 5GKNA 1IN4A 1J09A 4MGIE 4FCVA 3GPYA 3SFZA 2LH0A 1IBMM 4DV7M 3U6EA 3HKPA 4G4RA 4IBCA 3FD9A 3GLIB 3EIEA 3U6PA 2FE8A 1FJGM 1DGHB 3UJNA 2XFSA 3E4RA 3SC3A 4AKGA 7CATA 4PDIA 2R4JA 2C9CA 2R62A 3A45A 3LQRA 1G3IA 4GRIA 4CHTB 2BNKA 4DV0M 2VIIA 4MM3B 2EA0A 4G4QA 3SYLA 1HNZM 4L15A 2Z7JA 1OFHA 3HGIA 5EXTA 1K3XA 4FCWA 1NHGC 2D7EA 1QQWA 5ITTA 1NNUC 1E9SA 2L6OA 4Z6YA 3W0FA 3WHLA 4AZFA 3GRYA 2CV1A 4JI5M 4KHPM 1TH4A 3FYDA 3DOAA 1NY6A 2M60A 3RE8A 5ITXA 4XBOA 3SATA 4LGMA 4G4NA 5EXPA 1K82A 1L1TA 5EXXA 3JAMS 1KYIA 4NXNM 3CTWB 3KXEC 4RNAA 2RKOA 2UXBM 4S12A 2ZANA 3AKZA 4OX9M 1SXJA 4QNRA 2XZFA 3U61B 4LJ4A 1Z59A 1N36M 3T1YM 3VDUA 2R45A 3ZC7B 4JXJA 3HJQA 5E26A 1NNJA 1IN7A 3OTOM 4NRWA 3MHVC 2FFJA 1NHWC 1NSFA 4LRTA 4M0WA 4B7HA 4DR7M 1N33M 1WXQA 1Z5BA 3VKHA 3AOGA 4X65M 4FD2A 3GPPA 4AG6A 2XH9A 3PXGA 2YQZA 3FUXA 3JR4A 5DNYA 1R2ZA 3SARA 4GH9A 4LFCM 2C98A 4LFAM 4AI6A 1IQPA 2P5TA 3HWSA 4NOOB 4QOSA 4GKJM 4NSOB 4DUYM 1XHBA 3H4MA 3T38A 2F5QA 3HHWA 1S3SA 2YNMD 5KPTA 4JI8M 3VKGA 3FTEA 3NWLA 3GP1A 2F4VM 4PCZA 1QAMA 1XNRM 4FCTA 3AL0C 1W5TA 2F5SA 4PD2A 2CV2A 3GRVA 4A3VB 1XXHB 4WW0A 2QPAA 2G8LA 2Q2EB 3KS8A 3TWKA 1N78A 2KZUA 4GKKM 5IWAM 5EXSA 4LF8M 2DZNB 3TPZA 4LF6M 2Z4SA 2UXDM 1E32A 2I7NA 1L8QA 2XLJA 2X49A 4LZZA 3FYCA 2R4EA 1G4AE 3VK7A 3I4VA 3ILKA 4IBJA 2D7HA 3GRRA 5BR8M 3M6AA 3HHXA 4FWDA 5KQDA 3GO8A 3GLHA 4HLQA 3A46A 4NL4H 2FOIC 5EQTA 2BJVA 4JV5M 3D8BA 2XFTA 1T3TA 4OVZA 1DO0A 5IZ7D 1J5EM 3TWLA 5A2QS 1L2CA 1GLNA 2CV0A 3UK6A 4NRVA 3KDSE 1PJIA 4M9ZA 3U5ZB 2UUAM 1HT2E 5ITUA 3U60B 4M0DA 1Q39A 1XWIA 3AJIB 3JR5A 4HL4A 2VQEM 3K8ZA 2L7IA 3RGPA 2RGHA 1SXJE 1N34M 3GPXA 4DR2M 3SAVA 2EO2A 1G59A 3KSJA 1G41A 4YHHM 3T1HM 2YFQA 4DV5M 2QCUA 1HNXM 4GHLA 5C18A 2HHHM 3DA1A 4JI1M 5KQ8A 1TH2A 2LNHC 2EUCA 2KEBA 5FTJA 4M9SA 2OPFA 3GPUA 2QBYA 4ITQA 4D81A 3GQ3A 2XGNA 5IREB 1DGBA 4D80A 2KXEA 4MGYE 3L27A 3SBJA 4JI7M 4IJFA 5FTLA 2XF3A 2XSZD 4OVZB 4LJ6A 4I81A 3ZCBB 2DXIA 3KSXA 5JI3E 3J80S 5BPVA 4BB9A 1NJGA 2XEPA 3FUWA 4X66M 4DR4M 2Y21A 3J27B 2V1UA 2UU9M 2X8AA 4NSRA 1XMQM 4OU7A 1LV7A 4IBBA 1GL7A 3L26A 1N75A 4GHAA 3CF6E 2ZAMA 2CHVA 2QENA 3VLFB 4AKHA 3KP0E 5E6JA 1C1KA 2L7HA 3KP1E 3HU1A 1E94E 1PM5A 4BBAA 4YY3M 3LVVA 4IIWA 1UM8A 2X4AA 3FKEA 2HKJA 3GLGA 5EP3A 3LVWA 2F5PA 2DZOB 1VDDA 2AHMA 3LMMA 3GLFA 3CF2A 2NQ8C 4MGKE 1XC8A 3KOYE 3A98B 3HHYA 1EE8A 1HT1E 1R2YA 3AV0A 1L2DA 2DWNA 4X64M 4BLCA 4PDGA 2Z3XA 4W5WA 1XNQM 3KS4A 3U6DA 3M0EA 3PFIA 4B3MM 1IXRC 3SAWA 3IG5A 2HCBA 1XMOM 5EP2A 2FNAA 3WHKA 3GQ5A 1Q3CA 1SXJD 1QVRA 1QANA 2V1CA 3I51A 5KPRA 1ZAEA 2Y0QA 4L4UA 4LJ7A 1QYRA 3SASA 1J7KA 4B3TM 1SXJB 1MU5A 1NVMA 3HJ8A 4R7GA 3AOEC 4DR3M 2XZUA 1HQYE 5DYIA 1DGGA 4L16A 3SYKA 4Z8XA 4DV2M 3SHFA 1X37A 4CISA 4GIPA 5ITRA 3L25A 3K92A 8CATA 3PNVA 4LF7M 4KO8A 4FWGA 5KPZA 3UMMA 2W82A 3KOXE 3RFWA 4G4OA 3VK8A 3ZH9B 5LMNM 5F3WA 1HQCA 1NY5A 2ERCA 3HU2A 5FTNA 4MH0E 2ZAOA 4LJ5A 4IBKA 2M5ZA 1R7RA 1JR3D 4X62M 3B9PA 2VQFM 2ZM6M 2CEAA 4RF1A 4REZA 2D7GA 3M7GA 3I4YA 4MB7A 5JI2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIH A;  4D81 A;  4KOD A;  2RKO A;  1OJL A;  2DWZ B;  5EP1 A;  2DHR A;  2ZAN A;  3PVS A;  3GLG B;  1SXJ A;  4QNR A;  4QHT A;  3U61 B;  1IM2 A;  4LJ4 A;  1KYI A;  4ZPX A;  2CE7 A;  4D80 A;  3GLF B;  1FNN A;  1NJF A;  1IN7 A;  1D2N A;  4LJ9 A;  5FTL A;  1IXZ A;  2CHQ A;  1JR3 A;  2XSZ D;  4LJ6 A;  3MHV C;  4I81 A;  1NSF A;  4LRT A;  5JI3 E;  4FD2 A;  1DO2 A;  3DZD A;  1OFI A;  1W5S A;  3K1J A;  1NJG A;  1IY0 A;  2V1U A;  2X8A A;  3PXG A;  3VFD A;  1LV7 A;  5DYG A;  4LRS A;  1JQJ C;  4LJA A;  4D82 A;  2C98 A;  2ZAM A;  2CHV A;  2QEN A;  3VLF B;  1IQP A;  2XSZ A;  3HWS A;  3GLI A;  1IXS B;  1IN8 A;  4QOS A;  5EP4 A;  3CF0 A;  1C1K A;  2BJW A;  3GLH B;  3H4M A;  4FWH A;  4LCB A;  4FW9 A;  3HU1 A;  1E94 E;  1S3S A;  4GIT A;  2QZ4 A;  2KRK A;  3KW6 A;  1R6B X;  1UM8 A;  2DVW B;  4I4L A;  3GLG A;  5EP3 A;  1IY2 A;  5FTM A;  2V6Z M;  1IN5 A;  4FCT A;  2DZO B;  1W5T A;  4LY6 A;  1KSF X;  3GLF A;  3CF2 A;  4A3V B;  1QZM A;  1XXH B;  1HT1 E;  2C9O A;  4WW0 A;  2QPA A;  3HU3 A;  3R8F A;  2QP9 X;  5FTK A;  3M0E A;  5EXS A;  3PFI A;  2DZN B;  2Z4S A;  1IN4 A;  1E32 A;  1IXR C;  2HCB A;  1L8Q A;  4EIW A;  5EP2 A;  2FNA A;  3WHK A;  4FCV A;  4LZZ A;  1SXJ D;  1G4A E;  1QVR A;  2QBY B;  4L4U A;  4LJ7 A;  3GLI B;  2CHG A;  3EIE A;  1J7K A;  1SXJ B;  3M6A A;  4QNM A;  1NVM A;  2Z4R A;  4LJ8 A;  4FWD A;  3GLH A;  1HQY E;  5DYI A;  5EQT A;  2BJV A;  3SC3 A;  3D8B A;  4L16 A;  4Z8X A;  3SYK A;  1DO0 A;  2C99 A;  1X37 A;  2C9C A;  2R62 A;  5C1B A;  3UK6 A;  1G3I A;  4KLN A;  3KDS E;  3U5Z B;  4KO8 A;  1HT2 E;  4FWG A;  2VII A;  3U60 B;  1XWI A;  1SXJ C;  3AJI B;  1IY1 A;  3BOS A;  3SYL A;  3ZH9 B;  4L15 A;  1OFH A;  1XXH A;  5EXT A;  4JN6 A;  4QHS A;  1HQC A;  1NY5 A;  3HU2 A;  4FCW A;  5FTN A;  1SXJ E;  2ZAO A;  2R65 A;  4LJ5 A;  1G41 A;  3WHL A;  1R7R A;  1JR3 D;  3B9P A;  5C18 A;  1NY6 A;  1IN6 A;  2CEA A;  4LGM A;  5EXP A;  5FTJ A;  5EXX A;  2QBY A;  5JI2 E;  2C96 A; 
#chains in the Genus database with same CATH topology
 3EIH A;  5IT9 S;  4KOD A;  1TGU A;  2DWZ B;  5EP1 A;  4IBF A;  4RF0 A;  4QHT A;  1IM2 A;  1CUK A;  2JUJ A;  3TL4 X;  4IBD A;  5ITX E;  2O25 A;  3C9P A;  1FNN A;  1DGH A;  4XGI A;  1D2N A;  1IXZ A;  2UUC M;  4IBI A;  4Q7J A;  2JY7 A;  2KDL A;  4DUZ M;  1I4W A;  4AQY M;  1HJP A;  1DO2 A;  2J7O A;  3DZD A;  1W5S A;  3KVW A;  4L8R C;  3R9X B;  3FUU A;  1IY0 A;  5LMU M;  4JI3 M;  1RU3 A;  1WIV A;  4G3O A;  3VFD A;  2KZS A;  1N32 M;  4LRS A;  4LJA A;  4D82 A;  1L2B A;  2LVP C;  3Q8G A;  4JYA M;  4QOZ C;  1K3W A;  2K9D A;  1G8P A;  1MX0 A;  2VDB B;  2XSZ A;  5H37 D;  4ANR A;  4B08 A;  3GQ4 A;  4FVM A;  1IN8 A;  5FLX S;  5EP4 A;  4TUW A;  1MJG M;  3GLH B;  2MR9 A;  3J81 S;  4FWH A;  3KOZ E;  4JI4 M;  2JY5 A;  3TE6 A;  4JI6 M;  4FW9 A;  4LF4 M;  4GIT A;  2RGO A;  3W0L B;  2DAE A;  2KRK A;  2KRU A;  2LXE A;  2L4E A;  4LZJ A;  1R6B X;  2DVW B;  3QAU A;  4I4L A;  2UUB M;  3L2A A;  4HEO A;  1Z5A A;  1AUA A;  3GRU A;  3U61 A;  4I5S A;  2V6Z M;  4CGY B;  2N35 A;  2F5N A;  1QAO A;  2K47 A;  2UXC M;  2A5Y B;  1KSF X;  4LGY A;  2BWE A;  2G3Q A;  3B89 A;  2ZTD A;  2Y0T A;  3HU3 A;  3J7A S;  2QP9 X;  2H1R A;  2KW0 A;  4L6V 6;  3U6Q A;  3KOW E;  4EIW A;  2CUZ A;  2OOA A;  4AKI A;  4GC9 A;  3U6C A;  4OW0 A;  2DWM A;  2QBY B;  2GNO A;  1NV8 A;  1ORY B;  2Y20 A;  1QUT A;  2MRO B;  2L09 A;  2CHG A;  3B7Q A;  4B3S M;  1Q02 A;  1A5T A;  4QNM A;  1HR0 M;  2Z4R A;  3PNY A;  4LJ8 A;  2E5L M;  3TQS A;  3AFH A;  4IBG A;  2K6B A;  1L1Z A;  2Z8Y M;  4L78 A;  2C99 A;  3RGS A;  4R3D A;  1ZQ9 A;  5C1B A;  2O5R A;  4KLN A;  1E9R A;  2CFO A;  4GC5 A;  2KA6 B;  4DBG B;  3SAU A;  1VEK A;  3FUT A;  4B7F A;  2ZTC A;  1SXJ C;  4IJE A;  1IY1 A;  3BOS A;  4JI0 M;  1N77 A;  3L28 A;  4LG2 A;  1TH3 A;  4II7 A;  1XXH A;  4JN6 A;  4QHS A;  1IBL M;  2J7N A;  3MJ5 A;  4JI2 M;  3TWM A;  1BVS A;  2R65 A;  3AOE A;  3MK6 A;  1I94 M;  4DV3 M;  5ITY A;  4MGZ E;  3LQQ A;  4PT5 A;  2F5O A;  3FTF A;  1IBK M;  4GMQ A;  1IN6 A;  4IBE A;  2R18 A;  4DV4 M;  4NXM M;  1PJJ A;  4DV1 M;  4B7G A;  2VF8 A;  1XNQ M;  2C96 A;  2R46 A;  3IHP A;  1OJL A;  2DKL A;  4K0K M;  2DHR A;  3U6O A;  3PVS A;  1XB2 B;  3GLG B;  4DR5 M;  3U6S A;  1T43 A;  3A42 A;  1MN3 A;  4ZPX A;  2DWL A;  3C3D A;  2CE7 A;  4WUR A;  3D8L A;  1EFU B;  2LWX A;  3GLF B;  1NJF A;  4LJ9 A;  2CHQ A;  3QWL A;  1JR3 A;  1GKI A;  2WZJ A;  4M9X A;  2LTU A;  4NC6 A;  3UZU A;  3IG8 A;  4G6Z A;  4UN2 B;  4I8O A;  1WR1 B;  4P16 A;  4LF9 M;  1KFV A;  3K9O A;  1OFI A;  3E9S A;  3K1J A;  3U6L A;  4MGH A;  3KFU G;  3SMP A;  3Q8X A;  3U5Z A;  1GJT A;  3U60 A;  3FTC A;  5DYG A;  3UGJ A;  1PRB A;  4DV6 M;  4DR6 M;  1JQJ C;  1YE9 A;  2EKK A;  1H6U A;  1YUB A;  2G5G X;  2JY6 B;  1TTE A;  2ZBK B;  1SG9 A;  3J2P B;  1DGF A;  3L29 A;  5KO3 A;  5L8R F;  3FTD A;  4P17 A;  1VG5 A;  1QDT A;  3HHZ A;  3GLI A;  1IXS B;  3VDP A;  2C5R A;  2CWB A;  2BJW A;  3CF0 A;  2OQ4 A;  1QDR A;  3C3E A;  4LF5 M;  3THG A;  1Z6T A;  2DHY A;  1Z5C A;  1VEJ A;  4LCB A;  1GL6 A;  3SMS A;  3CGW A;  4DR1 M;  2QZ4 A;  1LTM A;  1TR8 A;  3C58 A;  3KW6 A;  3SHG B;  1TDZ A;  1YSY A;  2H5X A;  5FSW A;  2DEN A;  1IY2 A;  5FTM A;  3K2L A;  2JXN A;  1IN5 A;  1Q3B A;  4R71 A;  2JA2 A;  2I7P A;  3FUV A;  4LY6 A;  4AW4 A;  1IFY A;  4AG5 A;  3DFZ A;  5ITQ A;  2HL7 A;  4B3R M;  3I01 M;  1GVN A;  1TDH A;  1VQ1 A;  1QAQ A;  3MMP A;  1QZM A;  2C9O A;  1HNW M;  3HJS A;  3U6M A;  3R8F A;  5EJC A;  3GLG E;  4LFB M;  5FTK A;  2YR0 A;  3J7B A;  3NBI A;  3T15 A;  5GKN A;  1IN4 A;  3GLF E;  2CRU A;  2HAK A;  1J09 A;  4MGI E;  2OO9 A;  4FCV A;  3GPY A;  3SFZ A;  1TF0 B;  2LH0 A;  1IBM M;  4DV7 M;  3U6E A;  3HKP A;  2MH8 A;  4G4R A;  2EKF A;  4IBC A;  3FD9 A;  3GLI B;  2WSE F;  3EIE A;  3U6P A;  3BBZ A;  2FE8 A;  1YLA A;  1FJG M;  1PGY A;  1D0K A;  2HWJ A;  2WSC F;  1DGH B;  3UJN A;  2XFS A;  3E4R A;  3SC3 A;  3QYB A;  4AKG A;  7CAT A;  4PDI A;  2DZL A;  2LVO C;  2R4J A;  2C9C A;  2R62 A;  3A45 A;  3LQR A;  1G3I A;  4GRI A;  4CHT B;  1OAI A;  2BNK A;  4DV0 M;  2VII A;  4MM3 B;  2EA0 A;  4GEW A;  4Y28 F;  2BWB A;  4G4Q A;  3SYL A;  1HNZ M;  4L15 A;  1GJS A;  2Z7J A;  1OFH A;  3HGI A;  2WSF F;  5EXT A;  1K3X A;  4FCW A;  3VKH A;  1NHG C;  2D7E A;  1QQW A;  5ITT A;  1NNU C;  1E9S A;  2L6O A;  4RKU F;  4Z6Y A;  3W0F A;  3WHL A;  4AZF A;  3GRY A;  2CV1 A;  1R4G A;  4JI5 M;  4KHP M;  1TH4 A;  3FYD A;  1VEG A;  1NY6 A;  2M60 A;  1OIZ A;  3DOA A;  3RE8 A;  4XBO A;  5ITX A;  3SAT A;  4LGM A;  4G4N A;  5EXP A;  1K82 A;  1L1T A;  5EXX A;  3JAM S;  1KYI A;  1D0M A;  3LW5 F;  2DAI A;  3CTW B;  3KXE C;  2APL A;  2RKO A;  4RNA A;  1WGL A;  2ZAN A;  1VDL A;  1ZMV A;  4S12 A;  1SXJ A;  4QNR A;  3AKZ A;  2XZF A;  3U61 B;  4OX9 M;  2UXB M;  4LJ4 A;  1Z59 A;  1N36 M;  3T1Y M;  3VDU A;  2R45 A;  3K9P A;  4JXJ A;  3HJQ A;  5E26 A;  3ZC7 B;  3FE3 A;  1IN7 A;  2FS1 A;  1NNJ A;  3OTO M;  2DAM A;  4NRW A;  3MHV C;  2FFJ A;  1NHW C;  1NSF A;  4LRT A;  2B3T A;  1QUS A;  4M0W A;  4B7H A;  1WXQ A;  1Z5B A;  3GLI E;  4DR7 M;  1N33 M;  3AOG A;  4X65 M;  4FD2 A;  4F2L A;  3GPP A;  4AG6 A;  2XH9 A;  3V76 A;  3PXG A;  2YQZ A;  3FUX A;  3JR4 A;  5DNY A;  1R2Z A;  3I04 M;  2R44 A;  3SAR A;  4GH9 A;  4LFC M;  3H4J A;  2C98 A;  4LFA M;  4AI6 A;  1IQP A;  2P5T A;  3HWS A;  1OQY A;  4NOO B;  4QOS A;  4GKJ M;  4NSO B;  2KNV A;  2MJ5 B;  3HY5 A;  4DUY M;  1XHB A;  3FRI A;  3H4M A;  3T38 A;  2F5Q A;  3HHW A;  1S3S A;  1ZMU A;  1ZV1 A;  2YNM D;  5KPT A;  4JI8 M;  3VKG A;  3FTE A;  3NWL A;  1WJ7 A;  2JY8 A;  3GP1 A;  2F4V M;  4PCZ A;  3T6P A;  1QAM A;  1XNR M;  4FCT A;  3AL0 C;  1W5T A;  2F5S A;  2MGW A;  4PD2 A;  2CP8 A;  2CV2 A;  1F4I A;  3GRV A;  1WHC A;  4A3V B;  1XXH B;  4WW0 A;  2QPA A;  2G8L A;  2Q2E B;  3KS8 A;  3TWK A;  1N78 A;  2KZU A;  1T6O A;  2JP7 A;  4GKK M;  2R0I A;  5IWA M;  5EXS A;  4LF8 M;  2DZN B;  2LHC A;  3B74 A;  3HZJ A;  3TPZ A;  4LF6 M;  2Z4S A;  2UXD M;  1E32 A;  2I7N A;  4WP2 A;  1L8Q A;  2OOB A;  2XLJ A;  2X49 A;  4LZZ A;  3FYC A;  4F1I A;  2R4E A;  1G4A E;  1OAO C;  3VK7 A;  4NXN M;  3I4V A;  3ILK A;  4IBJ A;  2D7H A;  3GRR A;  2KNA A;  2VF7 A;  5BR8 M;  3M6A A;  2J5Y A;  3HHX A;  4FWD A;  5KQD A;  3GO8 A;  3GLH A;  4HLQ A;  2LHG A;  3B7Z A;  3A46 A;  4NL4 H;  1AIP C;  2FOI C;  2BJV A;  5EQT A;  1ZMW A;  3D8B A;  2XFT A;  4JV5 M;  1T3T A;  1V33 A;  1DO0 A;  4OVZ A;  5IZ7 D;  1J5E M;  3TWL A;  5A2Q S;  3FRH A;  1L2C A;  1GLN A;  2CV0 A;  3UK6 A;  3ZQJ A;  4NRV A;  3KDS E;  1GAB A;  1PJI A;  4M9Z A;  3U5Z B;  2JZ1 A;  1HT2 E;  2UUA M;  2K0B X;  5ITU A;  3U60 B;  4M0D A;  1Q39 A;  1XWI A;  3AJI B;  3JR5 A;  1NV9 A;  4HL4 A;  2VQE M;  3K8Z A;  2KHH A;  2L7I A;  2LVA A;  1OKS A;  3RGP A;  2RGH A;  1OIP A;  1SXJ E;  1N34 M;  3GPX A;  4DR2 M;  3SAV A;  2EO2 A;  1G59 A;  3KSJ A;  1G41 A;  4YHH M;  3T1H M;  2YFQ A;  4DV5 M;  2QCU A;  1HNX M;  3LCV B;  4GHL A;  5C18 A;  2HHH M;  3BXW A;  3DA1 A;  4JI1 M;  1P3Q Q;  5KQ8 A;  1TH2 A;  2LNH C;  1XXH E;  2EUC A;  2KEB A;  5FTJ A;  4M9S A;  2OPF A;  3GPU A;  2QBY A;  4ITQ A;  1NO1 A;  2JWS A;  2L4F A;  4D81 A;  3GQ3 A;  2XGN A;  3W67 A;  5IRE B;  1DGB A;  4D80 A;  2KXE A;  1PJQ A;  3IEC A;  3L27 A;  4MGY E;  3SBJ A;  1V92 A;  4IJF A;  5FTL A;  2XF3 A;  4JI7 M;  2XSZ D;  4OVZ B;  4LJ6 A;  4I81 A;  1V34 A;  2LVN C;  3ZCB B;  2DXI A;  1WGN A;  3KSX A;  5JI3 E;  2DAK A;  3J80 S;  5BPV A;  3NBX X;  4BB9 A;  1NJG A;  2XEP A;  3FUW A;  1DV0 A;  4X66 M;  4DR4 M;  2Y21 A;  3J27 B;  2V1U A;  2UU9 M;  2X8A A;  4NSR A;  1OTR A;  1XMQ M;  4OU7 A;  1JR3 E;  1JB0 F;  1LV7 A;  4IBB A;  1GL7 A;  3E46 A;  3L26 A;  1N75 A;  4GHA A;  4CJ6 A;  1PJT A;  3CF6 E;  2QSF X;  2CHV A;  2QEN A;  2ZAM A;  3VLF B;  1GO5 A;  4AKH A;  3KP0 E;  5E6J A;  1G71 A;  2RRU A;  1C1K A;  2L7H A;  3KP1 E;  4XK8 F;  2O01 F;  3QYE A;  2R6F A;  2LBC A;  3HU1 A;  1E94 E;  1PM5 A;  4BBA A;  4YY3 M;  3LVV A;  4IIW A;  4KT0 F;  1UM8 A;  2X4A A;  3FKE A;  3F92 A;  2HKJ A;  3GLG A;  2QQ8 A;  5EP3 A;  3LVW A;  3W68 A;  4CIZ A;  2DAG A;  2F5P A;  2DZO B;  1VDD A;  2AHM A;  3LMM A;  3GLF A;  1Y8G A;  3CF2 A;  2NQ8 C;  4MGK E;  1D0L A;  3KOY E;  1XC8 A;  2QHO B;  3A98 B;  3HHY A;  1EE8 A;  1HT1 E;  1QZE A;  1R2Y A;  3AV0 A;  1L2D A;  2EJS A;  4X64 M;  4BLC A;  4PDG A;  2Z3X A;  4W5W A;  2DWN A;  3KS4 A;  3U6D A;  2LVQ D;  3HX3 A;  3M0E A;  3PFI A;  2FH0 A;  3GLH E;  1PJS A;  5DFL A;  4B3M M;  1IXR C;  3SAW A;  3IG5 A;  2GQF A;  2HCB A;  3B7N A;  1XMO M;  5EP2 A;  2FNA A;  3WHK A;  3GQ5 A;  1Q3C A;  1SXJ D;  1QVR A;  1QAN A;  2V1C A;  3I51 A;  5KPR A;  1ZAE A;  2Y0Q A;  4L4U A;  4LJ7 A;  1QYR A;  2JNH A;  1J7K A;  3SAS A;  4B3T M;  1SXJ B;  1MU5 A;  1IXS A;  1NVM A;  2JZ0 A;  3HJ8 A;  4R7G A;  3AOE C;  2L2D A;  4DR3 M;  2XZU A;  1HQY E;  5DYI A;  1DGG A;  1EIJ A;  4L16 A;  3SYK A;  4Z8X A;  2QNJ A;  4DV2 M;  3SHF A;  1X37 A;  4CIS A;  3LCU A;  2DI0 A;  4GIP A;  5ITR A;  3L25 A;  3K92 A;  8CAT A;  3PNV A;  4LF7 M;  4KO8 A;  4FWG A;  5KPZ A;  3UMM A;  2W82 A;  3KOX E;  3RFW A;  4G4O A;  3VK8 A;  3ZH9 B;  1C7Y A;  5LMN M;  5F3W A;  1HQC A;  1NY5 A;  2ERC A;  3HU2 A;  5FTN A;  4MH0 E;  2ZAO A;  4LJ5 A;  4IBK A;  2M5Z A;  2KNZ A;  1R5L A;  1R7R A;  1JR3 D;  1UFZ A;  3E21 A;  4X62 M;  3B9P A;  2VQF M;  2DNA A;  2ZM6 M;  2CEA A;  4RF1 A;  4REZ A;  2D7G A;  3M7G A;  3I4Y A;  4MB7 A;  5JI2 E; 
#chains in the Genus database with same CATH homology
 3EIH A;  5IT9 S;  4KOD A;  1TGU A;  2DWZ B;  5EP1 A;  4IBF A;  4RF0 A;  4QHT A;  1IM2 A;  3TL4 X;  4IBD A;  5ITX E;  1FNN A;  1DGH A;  4XGI A;  1D2N A;  1IXZ A;  2UUC M;  4IBI A;  4DUZ M;  1I4W A;  4AQY M;  1DO2 A;  2J7O A;  3DZD A;  1W5S A;  3KVW A;  4L8R C;  3R9X B;  3FUU A;  1IY0 A;  5LMU M;  4JI3 M;  3VFD A;  2KZS A;  1N32 M;  4LRS A;  4LJA A;  4D82 A;  1L2B A;  4JYA M;  4QOZ C;  1K3W A;  1G8P A;  1MX0 A;  2XSZ A;  5H37 D;  4B08 A;  3GQ4 A;  4FVM A;  1IN8 A;  5FLX S;  5EP4 A;  4TUW A;  3GLH B;  3J81 S;  4FWH A;  3KOZ E;  4JI4 M;  3TE6 A;  4JI6 M;  4FW9 A;  4LF4 M;  4GIT A;  2RGO A;  3W0L B;  2KRK A;  2KRU A;  2LXE A;  4LZJ A;  1R6B X;  2DVW B;  3QAU A;  4I4L A;  2UUB M;  3L2A A;  1Z5A A;  3GRU A;  3U61 A;  4I5S A;  2V6Z M;  4CGY B;  2F5N A;  1QAO A;  2K47 A;  2UXC M;  2A5Y B;  1KSF X;  4LGY A;  2Y0T A;  3HU3 A;  3J7A S;  2QP9 X;  2H1R A;  2KW0 A;  3U6Q A;  3KOW E;  4EIW A;  2CUZ A;  4AKI A;  4GC9 A;  3U6C A;  4OW0 A;  2DWM A;  2QBY B;  1ORY B;  2Y20 A;  2L09 A;  2CHG A;  4B3S M;  4QNM A;  1HR0 M;  2Z4R A;  3PNY A;  4LJ8 A;  2E5L M;  3TQS A;  3AFH A;  4IBG A;  1L1Z A;  4L78 A;  2C99 A;  3RGS A;  4R3D A;  1ZQ9 A;  5C1B A;  2O5R A;  4KLN A;  1E9R A;  2CFO A;  4GC5 A;  2KA6 B;  3SAU A;  4B7F A;  3FUT A;  1SXJ C;  4IJE A;  1IY1 A;  3BOS A;  4JI0 M;  1N77 A;  3L28 A;  4LG2 A;  1TH3 A;  4II7 A;  1XXH A;  4JN6 A;  4QHS A;  1IBL M;  2J7N A;  3MJ5 A;  4JI2 M;  3TWM A;  3AOE A;  2R65 A;  3MK6 A;  1I94 M;  4DV3 M;  5ITY A;  4MGZ E;  3LQQ A;  4PT5 A;  2F5O A;  3FTF A;  1IBK M;  4GMQ A;  1IN6 A;  4IBE A;  2R18 A;  4DV4 M;  4NXM M;  1PJJ A;  4DV1 M;  4B7G A;  2C96 A;  2R46 A;  1OJL A;  4K0K M;  2DHR A;  3U6O A;  3PVS A;  3GLG B;  4DR5 M;  3U6S A;  3A42 A;  4ZPX A;  2DWL A;  2CE7 A;  4WUR A;  3D8L A;  2LWX A;  3GLF B;  1NJF A;  4LJ9 A;  2CHQ A;  3QWL A;  1JR3 A;  1GKI A;  4M9X A;  3UZU A;  3IG8 A;  4G6Z A;  4I8O A;  4P16 A;  4LF9 M;  1KFV A;  1OFI A;  3E9S A;  3K1J A;  3U6L A;  4MGH A;  3KFU G;  3SMP A;  3Q8X A;  3U5Z A;  3U60 A;  3FTC A;  5DYG A;  3UGJ A;  4DV6 M;  4DR6 M;  1JQJ C;  1YE9 A;  2ZBK B;  1H6U A;  1YUB A;  2G5G X;  3L29 A;  3J2P B;  4AW4 A;  1DGF A;  5KO3 A;  3FTD A;  3HHZ A;  3GLI A;  1IXS B;  3VDP A;  2C5R A;  3CF0 A;  2BJW A;  2OQ4 A;  4LF5 M;  3THG A;  1Z6T A;  4LCB A;  1Z5C A;  1GL6 A;  3SMS A;  4DR1 M;  2QZ4 A;  3C58 A;  3KW6 A;  3SHG B;  1TDZ A;  1YSY A;  5FSW A;  1IY2 A;  5FTM A;  3K2L A;  1IN5 A;  1Q3B A;  3FUV A;  2I7P A;  2JA2 A;  4LY6 A;  4AG5 A;  3DFZ A;  5ITQ A;  2HL7 A;  4B3R M;  1GVN A;  1TDH A;  1QAQ A;  1QZM A;  2C9O A;  1HNW M;  3HJS A;  3U6M A;  3R8F A;  5EJC A;  4LFB M;  5FTK A;  2YR0 A;  3J7B A;  3NBI A;  3T15 A;  5GKN A;  1IN4 A;  1J09 A;  4MGI E;  4FCV A;  3GPY A;  3SFZ A;  2LH0 A;  1IBM M;  4DV7 M;  3U6E A;  3HKP A;  4G4R A;  4IBC A;  3FD9 A;  3GLI B;  3EIE A;  3U6P A;  2FE8 A;  1FJG M;  1DGH B;  3UJN A;  2XFS A;  3E4R A;  3SC3 A;  4AKG A;  7CAT A;  4PDI A;  2R4J A;  2C9C A;  2R62 A;  3A45 A;  3LQR A;  1G3I A;  4GRI A;  4CHT B;  2BNK A;  4DV0 M;  2VII A;  4MM3 B;  2EA0 A;  4G4Q A;  3SYL A;  1HNZ M;  4L15 A;  2Z7J A;  1OFH A;  3HGI A;  5EXT A;  1K3X A;  4FCW A;  1NHG C;  2D7E A;  1QQW A;  5ITT A;  1NNU C;  1E9S A;  2L6O A;  4Z6Y A;  3W0F A;  3WHL A;  4AZF A;  3GRY A;  2CV1 A;  4JI5 M;  4KHP M;  1TH4 A;  3FYD A;  3DOA A;  1NY6 A;  2M60 A;  3RE8 A;  5ITX A;  4XBO A;  3SAT A;  4LGM A;  4G4N A;  5EXP A;  1K82 A;  1L1T A;  5EXX A;  3JAM S;  1KYI A;  4NXN M;  3CTW B;  3KXE C;  4RNA A;  2RKO A;  2UXB M;  4S12 A;  2ZAN A;  3AKZ A;  4OX9 M;  1SXJ A;  4QNR A;  2XZF A;  3U61 B;  4LJ4 A;  1Z59 A;  1N36 M;  3T1Y M;  3VDU A;  2R45 A;  3ZC7 B;  4JXJ A;  3HJQ A;  5E26 A;  1NNJ A;  1IN7 A;  3OTO M;  4NRW A;  3MHV C;  2FFJ A;  1NHW C;  1NSF A;  4LRT A;  4M0W A;  4B7H A;  4DR7 M;  1N33 M;  1WXQ A;  1Z5B A;  3VKH A;  3AOG A;  4X65 M;  4FD2 A;  3GPP A;  4AG6 A;  2XH9 A;  3PXG A;  2YQZ A;  3FUX A;  3JR4 A;  5DNY A;  1R2Z A;  3SAR A;  4GH9 A;  4LFC M;  2C98 A;  4LFA M;  4AI6 A;  1IQP A;  2P5T A;  3HWS A;  4NOO B;  4QOS A;  4GKJ M;  4NSO B;  4DUY M;  1XHB A;  3H4M A;  3T38 A;  2F5Q A;  3HHW A;  1S3S A;  2YNM D;  5KPT A;  4JI8 M;  3VKG A;  3FTE A;  3NWL A;  3GP1 A;  2F4V M;  4PCZ A;  1QAM A;  1XNR M;  4FCT A;  3AL0 C;  1W5T A;  2F5S A;  4PD2 A;  2CV2 A;  3GRV A;  4A3V B;  1XXH B;  4WW0 A;  2QPA A;  2G8L A;  2Q2E B;  3KS8 A;  3TWK A;  1N78 A;  2KZU A;  4GKK M;  5IWA M;  5EXS A;  4LF8 M;  2DZN B;  3TPZ A;  4LF6 M;  2Z4S A;  2UXD M;  1E32 A;  2I7N A;  1L8Q A;  2XLJ A;  2X49 A;  4LZZ A;  3FYC A;  2R4E A;  1G4A E;  3VK7 A;  3I4V A;  3ILK A;  4IBJ A;  2D7H A;  3GRR A;  5BR8 M;  3M6A A;  3HHX A;  4FWD A;  5KQD A;  3GO8 A;  3GLH A;  4HLQ A;  3A46 A;  4NL4 H;  2FOI C;  5EQT A;  2BJV A;  4JV5 M;  3D8B A;  2XFT A;  1T3T A;  4OVZ A;  1DO0 A;  5IZ7 D;  1J5E M;  3TWL A;  5A2Q S;  1L2C A;  1GLN A;  2CV0 A;  3UK6 A;  4NRV A;  3KDS E;  1PJI A;  4M9Z A;  3U5Z B;  2UUA M;  1HT2 E;  5ITU A;  3U60 B;  4M0D A;  1Q39 A;  1XWI A;  3AJI B;  3JR5 A;  4HL4 A;  2VQE M;  3K8Z A;  2L7I A;  3RGP A;  2RGH A;  1SXJ E;  1N34 M;  3GPX A;  4DR2 M;  3SAV A;  2EO2 A;  1G59 A;  3KSJ A;  1G41 A;  4YHH M;  3T1H M;  2YFQ A;  4DV5 M;  2QCU A;  1HNX M;  4GHL A;  5C18 A;  2HHH M;  3DA1 A;  4JI1 M;  5KQ8 A;  1TH2 A;  2LNH C;  2EUC A;  2KEB A;  5FTJ A;  4M9S A;  2OPF A;  3GPU A;  2QBY A;  4ITQ A;  4D81 A;  3GQ3 A;  2XGN A;  5IRE B;  1DGB A;  4D80 A;  2KXE A;  4MGY E;  3L27 A;  3SBJ A;  4JI7 M;  4IJF A;  5FTL A;  2XF3 A;  2XSZ D;  4OVZ B;  4LJ6 A;  4I81 A;  3ZCB B;  2DXI A;  3KSX A;  5JI3 E;  3J80 S;  5BPV A;  4BB9 A;  1NJG A;  2XEP A;  3FUW A;  4X66 M;  4DR4 M;  2Y21 A;  3J27 B;  2V1U A;  2UU9 M;  2X8A A;  4NSR A;  1XMQ M;  4OU7 A;  1LV7 A;  4IBB A;  1GL7 A;  3L26 A;  1N75 A;  4GHA A;  3CF6 E;  2ZAM A;  2CHV A;  2QEN A;  3VLF B;  4AKH A;  3KP0 E;  5E6J A;  1C1K A;  2L7H A;  3KP1 E;  3HU1 A;  1E94 E;  1PM5 A;  4BBA A;  4YY3 M;  3LVV A;  4IIW A;  1UM8 A;  2X4A A;  3FKE A;  2HKJ A;  3GLG A;  5EP3 A;  3LVW A;  2F5P A;  2DZO B;  1VDD A;  2AHM A;  3LMM A;  3GLF A;  3CF2 A;  2NQ8 C;  4MGK E;  1XC8 A;  3KOY E;  3A98 B;  3HHY A;  1EE8 A;  1HT1 E;  1R2Y A;  3AV0 A;  1L2D A;  2DWN A;  4X64 M;  4BLC A;  4PDG A;  2Z3X A;  4W5W A;  1XNQ M;  3KS4 A;  3U6D A;  3M0E A;  3PFI A;  4B3M M;  1IXR C;  3SAW A;  3IG5 A;  2HCB A;  1XMO M;  5EP2 A;  2FNA A;  3WHK A;  3GQ5 A;  1Q3C A;  1SXJ D;  1QVR A;  1QAN A;  2V1C A;  3I51 A;  5KPR A;  1ZAE A;  2Y0Q A;  4L4U A;  4LJ7 A;  1QYR A;  3SAS A;  1J7K A;  4B3T M;  1SXJ B;  1MU5 A;  1NVM A;  3HJ8 A;  4R7G A;  3AOE C;  4DR3 M;  2XZU A;  1HQY E;  5DYI A;  1DGG A;  4L16 A;  3SYK A;  4Z8X A;  4DV2 M;  3SHF A;  1X37 A;  4CIS A;  4GIP A;  5ITR A;  3L25 A;  3K92 A;  8CAT A;  3PNV A;  4LF7 M;  4KO8 A;  4FWG A;  5KPZ A;  3UMM A;  2W82 A;  3KOX E;  3RFW A;  4G4O A;  3VK8 A;  3ZH9 B;  5LMN M;  5F3W A;  1HQC A;  1NY5 A;  2ERC A;  3HU2 A;  5FTN A;  4MH0 E;  2ZAO A;  4LJ5 A;  4IBK A;  2M5Z A;  1R7R A;  1JR3 D;  4X62 M;  3B9P A;  2VQF M;  2ZM6 M;  2CEA A;  4RF1 A;  4REZ A;  2D7G A;  3M7G A;  3I4Y A;  4MB7 A;  5JI2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...