1X37A

Structure of bacillus subtilis lon protease ssd domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
AGYTEIEKLEIVKDHLLPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAAICRKAAKAIVAEERKRITVTEKNLQDFIGKRIFRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent protease La 1
publication title Structural basis and DNA binding property of SSD domain of Bacillus subtilis Lon protease
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 20
structure length 95
sequence length 95
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1x37A00
5DYGA 4WW0A 1NSFA 1G4AE 1OFHA 4FCWA 1HT2E 2DVWB 4LJ6A 3CF2A 3EIHA 4A3VB 1W5SA 2CHQA 4QOSA 5EP2A 4FWGA 4EIWA 1LV7A 2QBYA 2ZAOA 2HCBA 4LGMA 2QZ4A 2R65A 3PXGA 4I81A 3HU3A 5EP1A 3SC3A 4LRTA 4L16A 1QVRA 2DHRA 1C1KA 4FWDA 1IXSB 1S3SA 1HQYE 1UM8A 1IY0A 1IM2A 3ZH9B 3M6AA 5EP4A 3EIEA 1JQJC 3U5ZB 2FNAA 4GITA 2ZANA 4D81A 4JN6A 1X37A 1SXJC 1IY2A 1J7KA 1QZMA 5FTMA 4LJ4A 4Z8XA 5EXPA 2CEAA 5FTKA 2C9OA 3KW6A 2C96A 5FTJA 1OFIA 2C99A 1KSFX 1OJLA 2V6ZM 4QHTA 3VFDA 1DO0A 4LJ5A 1D2NA 1G3IA 2QPAA 3HU1A 2ZAMA 3VLFB 1XXHB 2CHVA 5EQTA 4L4UA 1DO2A 1L8QA 2KRKA 2QP9X 2VIIA 2DZNB 1W5TA 2CE7A 3AJIB 4LRSA 1SXJA 2XSZD 4LJ9A 1E32A 2RKOA 3KDSE 3B9PA 2R62A 1E94E 2C9CA 4KO8A 3WHKA 3D8BA 2CHGA 1HT1E 3GLIA 2QBYB 1HQCA 3GLHA 2QENA 5C18A 2BJWA 4KODA 3BOSA 3GLGA 2C98A 3UK6A 4LCBA 4QNRA 4FD2A 3DZDA 3M0EA 3GLFA 1SXJB 5JI3E 3WHLA 2Z4SA 1NVMA 1JR3A 3HU2A 4I4LA 3R8FA 1NJFA 4LJ8A 3U60B 1IXRC 2X8AA 4ZPXA 1IQPA 3GLFB 2BJVA 5JI2E 3HWSA 3SYKA 3CF0A 2Z4RA 4KLNA 4QNMA 3K1JA 5C1BA 5DYIA 1KYIA 4LY6A 3SYLA 3PFIA 4LJAA 4D80A 1IN5A 3H4MA 5EXSA 1XWIA 1NJGA 1NY6A 2DZOB 1SXJD 5EXTA 4QHSA 4L15A 5FTNA 4FCVA 3PVSA 3U61B 1R7RA 1IN6A 1FNNA 4D82A 1IY1A 2DWZB 1NY5A 1IN8A 1R6BX 4LJ7A 1XXHA 4LZZA 2V1UA 4FWHA 1G41A 5FTLA 3GLIB 1IN7A 3GLHB 1IN4A 5EP3A 3GLGB 5EXXA 4FW9A 3MHVC 4FCTA 1IXZA 1SXJE 1JR3D 2XSZA
chains in the Genus database with same CATH superfamily
3J27B 4WP2A 1NHGC 1OFHA 4FCWA 4LG2A 2EO2A 4AKHA 4B7FA 1Z5CA 3CF2A 3GRYA 4ANRA 3KSJA 2CHQA 4QOSA 3SHGB 2KNVA 2XFTA 2DENA 1MN3A 1T6OA 4NRWA 1HNWM 3GLIE 4X62M 3I51A 3RGSA 2B3TA 3KS8A 1QAOA 3FUVA 2UUCM 4LF9M 1KFVA 3AOEC 4L8RC 3U6MA 2X4AA 1NV9A 2VDBB 3C3EA 3EIEA 2UUAM 4IIWA 3U5ZB 3FTEA 3FYCA 4NOOB 2ZANA 2CV2A 4Z6YA 2JUJA 3ZC7B 4JN6A 1X37A 2BWBA 5FSWA 1QZMA 2DWMA 1F4IA 3KOXE 3KP0E 4LJ4A 5FTKA 2VQFM 3KW6A 5FTJA 1PJJA 4ITQA 2C99A 1PJTA 4PCZA 2V6ZM 1OIPA 2KZSA 3VFDA 1XNRM 1D0MA 2FOIC 3IECA 4LJ5A 4IBIA 2QCUA 2EUCA 4DV6M 3E9SA 4JI8M 2JY5A 1HR0M 5KPRA 2CRUA 2J7NA 3B74A 3KOYE 1WHCA 1G8PA 3L28A 3KXEC 3U6PA 5ITQA 2XSZD 4LJ9A 3GLFE 2DXIA 1IBKM 5E26A 1N77A 2R45A 3SATA 4OVZA 4AI6A 4GIPA 3QYEA 3PNVA 2MROB 5L8RF 2C9CA 4IJFA 5KQDA 2UUBM 4JI1M 3WHKA 3D8BA 5ITYA 3T1YM 4IBGA 1Q02A 2AHMA 4AZFA 3B7QA 4JI2M 5E6JA 4G4OA 1QAMA 3SASA 2DKLA 3GRRA 1SXJB 4L6V6 3K2LA 1NVMA 1JR3A 1TH2A 1V92A 3QAUA 3SMSA 2F5SA 1TH4A 2KEBA 3BBZA 3JR4A 3FTFA 3U6SA 4DUYM 1AIPC 2JA2A 8CATA 4L78A 1IQPA 3FUTA 5JI2E 2I7PA 3I4VA 3HJ8A 4NL4H 1MX0A 3HWSA 3SYKA 4QNMA 4AQYM 2HKJA 2DAGA 1ZQ9A 4I8OA 1KYIA 4LY6A 5KQ8A 3FUXA 3PFIA 2KHHA 4LJAA 5ITTA 2FS1A 4G3OA 3VKGA 2Y20A 3H4MA 2XZFA 2BNKA 2JY6B 2ZBKB 1XWIA 2G5GX 2D7EA 4R7GA 4JV5M 2QHOB 3K9OA 1T43A 3TQSA 3AOGA 5GKNA 4FCVA 2DNAA 1R7RA 4PDIA 3HJQA 4D82A 1IY1A 1H6UA 2FH0A 4OVZB 5LMNM 4LF5M 4LJ7A 3U6CA 1ZAEA 4HLQA 4X64M 5ITXA 2HL7A 2P5TA 2V1UA 2KXEA 1G41A 5EJCA 1OIZA 3FYDA 4KHPM 3KSXA 2M5ZA 3IHPA 3TWLA 3GPPA 4DBGB 2N35A 2L7HA 4FCTA 3FRIA 1IXZA 4MGKE 1K82A 1JR3D 3LVWA 1IBMM 5DYGA 3A45A 1N75A 1G4AE 5KO3A 4RF1A 1QUTA 1HT2E 4JI6M 2O5RA 1GL6A 1C7YA 5IZ7D 3EIHA 3VK7A 1W5SA 4GC5A 3F92A 4FWGA 2NQ8C 3AOEA 2W82A 4B7GA 2ZAOA 2QBYA 4XGIA 1YLAA 4YHHM 4I81A 3HU3A 5EP1A 4AKGA 1WGNA 2WSFF 4M0DA 3TPZA 3GPXA 3HY5A 3M6AA 4GMQA 2JNHA 4GHLA 2BWEA 3LMMA 1G71A 5IWAM 4S12A 1Q3CA 1GKIA 2R18A 3FRHA 4GITA 1JR3E 1QYRA 2O01F 1TF0B 3TL4X 3HKPA 4AKIA 3HGIA 1EIJA 2ERCA 1IY2A 3DA1A 1J7KA 1HNXM 7CATA 5ITRA 1PJSA 2I7NA 5KPZA 1PJIA 1NHWC 1QUSA 1KSFX 2CFOA 1NNUC 2H1RA 3ZCBB 5IREB 1G3IA 2F4VM 3E46A 3MMPA 1VDLA 3J7BA 4P17A 4DR2M 1HNZM 3A46A 5EQTA 4HEOA 4L4UA 1DO2A 3CTWB 3E21A 4XBOA 4DUZM 1R2ZA 5H37D 3GLHE 3SAWA 2DZNB 1GABA 1ZMUA 1XMQM 2CE7A 3T1HM 3GQ3A 1J09A 1SXJA 3T15A 1E32A 2L6OA 2FE8A 4DV5M 4GKKM 2QQ8A 3K8ZA 3KDSE 2XLJA 4LGYA 2RRUA 3W0FA 1JB0F 4DV2M 1LTMA 2JWSA 4R3DA 2JY7A 4KO8A 2Z3XA 1XC8A 4B08A 2CHGA 2KRUA 3SAUA 2HHHM 2QBYB 4DR4M 3U6OA 2A5YB 2XFSA 2BJWA 4KODA 5C18A 1VG5A 4NSOB 1L2BA 2DWNA 3DZDA 2HAKA 2WSEF 1A5TA 3WHLA 2DAKA 2Z4SA 1AUAA 5IT9S 4FVMA 1ZMVA 4IBJA 4G4QA 4DV1M 1NJFA 4XK8F 2R6FA 4PD2A 2XGNA 1TGUA 2X8AA 4DV0M 1N33M 2YR0A 4MGHA 2BJVA 1J5EM 4RNAA 3HHZA 2CV0A 4NXNM 3FUUA 2XZUA 1DGBA 1K3WA 2R4JA 1TR8A 4P16A 4KLNA 4AG6A 2FFJA 1I94M 3K1JA 5C1BA 3DOAA 3U6EA 2EA0A 2K47A 4G4NA 2EJSA 3SYLA 3KOZE 4D80A 2LHGA 3FE3A 4B3RM 2D7HA 2EKKA 2F5OA 2DAIA 2DZOB 3SBJA 1SXJD 2LTUA 3L2AA 5FTNA 3LVVA 1QDTA 3NBIA 4LF7M 4CHTB 1FNNA 2UXDM 4LFAM 1XNQM 2F5NA 1L2DA 1XXHA 3KFUG 2C5RA 2Z7JA 5F3WA 1WJ7A 3GQ5A 2X49A 1L1TA 4DR7M 1ZV1A 4DV4M 4JI5M 4CIZA 5EXXA 3IG5A 3LQQA 3MHVC 2KZUA 1Z5BA 3T38A 3OTOM 1SXJE 3FTCA 4WW0A 2MH8A 2DZLA 4LJ6A 4JYAM 3RFWA 4GH9A 2YFQA 4A3VB 4LF8M 3U6QA 2YNMD 4AG5A 2OOAA 1LV7A 4EIWA 4LFBM 3TE6A 1N32M 3PXGA 2R65A 3SC3A 3LCVB 1QVRA 2DHRA 4FWDA 1S3SA 1UM8A 4LZJA 1IY0A 1IM2A 1GJTA 3RE8A 4DR6M 3D8LA 4OU7A 3J81S 5EP4A 3B7NA 1YUBA 5DFLA 2FNAA 4GC9A 2LHCA 2YQZA 3AV0A 1VEKA 3U60A 3VK8A 1N34M 2KNZA 1R2YA 3UMMA 4Z8XA 2C9OA 4B3SM 1V33A 3B7ZA 2M60A 4NRVA 4TUWA 4IBBA 3U6DA 1OJLA 2JXNA 4QHTA 3PNYA 1DO0A 1QQWA 3FUWA 3NBXX 2OQ4A 4B3TM 4GHAA 2JY8A 4JI0M 4I5SA 2UU9M 2QPAA 3HU1A 2ZAMA 3VLFB 2F5PA 4IBKA 1XXHB 2CHVA 3FTDA 3GP1A 2L2DA 2L7IA 1WR1B 4OX9M 1L8QA 2KRKA 1Q3BA 2LWXA 2QP9X 1QZEA 2H5XA 1Z5AA 4RF0A 3ILKA 4DV7M 3VDPA 4M9SA 2LVQD 1W5TA 3DFZA 3AKZA 4LRSA 2LNHC 2L4EA 4LF4M 3HHXA 2RKOA 3BXWA 3B9PA 3JR5A 2OPFA 3SARA 3THGA 1E94E 2KA6B 2EKFA 4GRIA 1DGGA 2VQEM 1N36M 1IBLM 2R0IA 1D0LA 1L2CA 1HQCA 2QENA 4YY3M 3GLGA 3BOSA 2C98A 3T6PA 1VQ1A 3UK6A 1EE8A 2DAMA 4HL4A 4LCBA 4QNRA 3GLFA 1GL7A 3J7AS 5JI3E 4B7HA 1HJPA 3GPYA 1GLNA 1GO5A 4IJEA 3V76A 2GNOA 3R8FA 3GRUA 4LJ8A 1WGLA 4BLCA 3U60B 4AW4A 4JXJA 2MJ5B 1CUKA 3TWMA 1IXSA 1IFYA 3A98B 3GQ4A 4MM3B 5LMUM 2KNAA 3CF0A 2Y21A 1EFUB 1QDRA 2MGWA 2Z4RA 4MH0E 1VEJA 4CISA 1Z6TA 5DYIA 3CF6E 4PT5A 3U6LA 5ITXE 2V1CA 1K3XA 3R9XB 1YSYA 3FKEA 2ZTCA 3GO8A 3KOWE 4MGYE 5EXSA 1NJGA 3GPUA 4DV3M 1FJGM 1OAOC 1V34A 4NXMM 5EXTA 4IBDA 4QOZC 4L15A 1OQYA 3U61B 4UN2B 1QANA 1NV8A 3Q8XA 3CGWA 1RU3A 1IN6A 2F5QA 3QWLA 3HHYA 1DV0A 1OAIA 3IG8A 4BB9A 4JI4M 2R44A 2CWBA 1DGFA 3M7GA 1UFZA 2KDLA 4RKUF 3LQRA 4G6ZA 4FWHA 2Y0QA 1E9RA 3GRVA 5FTLA 4OW0A 1PM5A 2LBCA 3GLGB 2KW0A 3JAMS 5FLXS 2J5YA 4FW9A 3K9PA 3GLFB 3SAVA 2MR9A 1NSFA 4IBFA 3I4YA 2GQFA 1VEGA 2Z8YM 3VDUA 2DVWB 4CJ6A 4F1IA 1VDDA 3B89A 2ZM6M 1TDZA 3AL0C 5EP2A 4MGIE 2D7GA 3I01M 2G3QA 3W67A 1NNJA 2HCBA 4LGMA 2DAEA 2QZ4A 4PDGA 4MB7A 1PJQA 3UZUA 4LRTA 1GVNA 1XHBA 4L16A 1C1KA 1SG9A 3RGPA 1IXSB 3GLGE 1HQYE 1XMOM 3ZH9B 2VF7A 3VKHA 2XF3A 2JP7A 1JQJC 2LH0A 3LCUA 2OO9A 4D81A 1SXJC 2K6BA 5BPVA 4GKJM 3L27A 1DGHA 2JZ0A 5FTMA 4M9XA 5EXPA 2CEAA 2XEPA 4F2LA 2C96A 1OFIA 1I4WA 1Z59A 1MJGM 3HX3A 4Q7JA 4R71A 1TTEA 2O25A 3LW5F 3UGJA 4M0WA 5ITUA 2LVOC 2DWLA 2E5LM 2LVPC 4DR3M 3SHFA 2CV1A 1D2NA 3FD9A 5A2QS 3SMPA 1G59A 4X66M 3E4RA 4X65M 3MJ5A 3J80S 1R5LA 2XH9A 2VIIA 1TH3A 2QSFX 2UXCM 3A42A 3AJIB 4M9ZA 3C3DA 4CGYB 4B3MM 3KVWA 3K92A 2R46A 2QNJA 3KS4A 3J2PB 1TDHA 3QYBA 1T3TA 3W68A 4BBAA 3HJSA 1OKSA 2J7OA 4W5WA 2R62A 2LXEA 4KT0F 4JI7M 2CUZA 2JZ1A 1Q39A 3GLIA 1HT1E 2WZJA 3GLHA 4MGZE 4IBEA 3W0LB 1WIVA 3AFHA 2LVNC 4FD2A 1GJSA 4G4RA 3M0EA 4JI3M 1NO1A 4WURA 3C58A 3Q8GA 3NWLA 1N78A 3L29A 5DNYA 3HU2A 4LFCM 1ZMWA 3H4JA 3ZQJA 4I4LA 2Y0TA 4NSRA 5BR8M 1IXRC 3SFZA 1WXQA 1DGHB 2LVAA 4GEWA 2VF8A 4ZPXA 1ORYB 3U61A 4Y28F 3KP1E 2HWJA 1E9SA 3I04M 2CP8A 2RGOA 5KPTA 2DHYA 3L25A 1QAQA 2G8LA 1XB2B 1PRBA 2K9DA 4DR5M 4DR1M 2DI0A 3U5ZA 1XXHE 1Y8GA 4IBCA 1D0KA 1IN5A 4K0KM 1OTRA 3TWKA 1L1ZA 1R4GA 1NY6A 4QHSA 3MK6A 2L4FA 3PVSA 4II7A 1YE9A 1MU5A 2RGHA 1BVSA 2DWZB 1NY5A 1IN8A 1R6BX 4LZZA 2L09A 2OOBA 2Q2EB 4NC6A 3UJNA 2ZTDA 3HZJA 2UXBM 4REZA 3HHWA 3GLIB 1IN7A 2WSCF 1IN4A 1PGYA 3GLHB 5EP3A 2R4EA 3C9PA 4LF6M 1P3QQ 2APLA 3L26A 2K0BX 2XSZA
chains in the Genus database with same CATH topology
3J27B 1NHGC 1OFHA 4FCWA 4LG2A 2EO2A 4AKHA 4B7FA 1Z5CA 3CF2A 3GRYA 3KSJA 2CHQA 4QOSA 3SHGB 2XFTA 1HNWM 4NRWA 4X62M 3I51A 3RGSA 3KS8A 1QAOA 3FUVA 2UUCM 4LF9M 1KFVA 3AOEC 4L8RC 3U6MA 2X4AA 2UUAM 3EIEA 3U5ZB 3FTEA 3FYCA 4NOOB 2ZANA 2CV2A 4Z6YA 3ZC7B 4JN6A 1X37A 5FSWA 1QZMA 2DWMA 3KOXE 3KP0E 4LJ4A 5FTKA 2VQFM 3KW6A 5FTJA 1PJJA 4ITQA 2C99A 4PCZA 2V6ZM 3VFDA 2KZSA 1XNRM 2FOIC 4LJ5A 4IBIA 2QCUA 2EUCA 4DV6M 3E9SA 4JI8M 1HR0M 5KPRA 2J7NA 3KOYE 1G8PA 3L28A 3KXEC 3U6PA 5ITQA 2XSZD 4LJ9A 2DXIA 1IBKM 5E26A 1N77A 2R45A 3SATA 4OVZA 4GIPA 3PNVA 4JI1M 2C9CA 4IJFA 5KQDA 2UUBM 3WHKA 3D8BA 5ITYA 3T1YM 4IBGA 2AHMA 4AZFA 4JI2M 5E6JA 4G4OA 1QAMA 3SASA 3GRRA 1SXJB 3K2LA 1NVMA 1JR3A 1TH2A 3QAUA 3SMSA 2F5SA 1TH4A 2KEBA 3JR4A 3FTFA 3U6SA 4DUYM 2JA2A 8CATA 4L78A 1IQPA 3FUTA 5JI2E 2I7PA 3I4VA 3HJ8A 4NL4H 1MX0A 3HWSA 3SYKA 4QNMA 4AQYM 2HKJA 1ZQ9A 4I8OA 1KYIA 4LY6A 5KQ8A 3FUXA 3PFIA 4LJAA 5ITTA 3VKGA 2Y20A 3H4MA 2XZFA 2BNKA 2ZBKB 1XWIA 2G5GX 2D7EA 4R7GA 4JV5M 3TQSA 3AOGA 5GKNA 4FCVA 1R7RA 4PDIA 3HJQA 4D82A 1IY1A 1H6UA 4OVZB 5LMNM 4LF5M 4LJ7A 3U6CA 1ZAEA 4HLQA 4X64M 5ITXA 2HL7A 2P5TA 2V1UA 2KXEA 1G41A 5EJCA 4KHPM 3FYDA 3KSXA 2M5ZA 3TWLA 3GPPA 2L7HA 4FCTA 4MGKE 1IXZA 1K82A 1IBMM 1JR3D 3LVWA 4AI6A 5DYGA 3A45A 1N75A 1G4AE 5KO3A 4RF1A 4JI6M 1HT2E 2O5RA 1GL6A 5IZ7D 3EIHA 3VK7A 1W5SA 4GC5A 4FWGA 2NQ8C 3AOEA 2W82A 4B7GA 2ZAOA 2QBYA 4XGIA 4YHHM 4I81A 3HU3A 5EP1A 4AKGA 4M0DA 3GPXA 3TPZA 3M6AA 4GMQA 4GHLA 3LMMA 5IWAM 4S12A 1Q3CA 1GKIA 2R18A 4GITA 1QYRA 3TL4X 4AKIA 3HKPA 3HGIA 2ERCA 1IY2A 3DA1A 1J7KA 1HNXM 7CATA 5ITRA 5KPZA 2I7NA 1PJIA 1NHWC 1KSFX 2CFOA 1NNUC 2H1RA 3ZCBB 5IREB 1G3IA 2F4VM 4DR2M 3J7BA 1HNZM 3A46A 5EQTA 4L4UA 1DO2A 3CTWB 4XBOA 4DUZM 1R2ZA 5H37D 3SAWA 2DZNB 1XMQM 2CE7A 3T1HM 3GQ3A 1J09A 1SXJA 3T15A 1E32A 2L6OA 2FE8A 4DV5M 4GKKM 3K8ZA 3KDSE 2XLJA 4LGYA 3W0FA 4DV2M 4R3DA 1XC8A 4KO8A 2Z3XA 4B08A 2CHGA 2KRUA 3SAUA 2HHHM 2QBYB 4DR4M 3U6OA 2A5YB 2XFSA 2BJWA 4KODA 5C18A 4NSOB 1L2BA 2DWNA 3DZDA 3WHLA 2Z4SA 5IT9S 4FVMA 4IBJA 4G4QA 4DV1M 1NJFA 4PD2A 2XGNA 1TGUA 2X8AA 4DV0M 1N33M 2YR0A 4MGHA 2BJVA 1J5EM 4RNAA 3HHZA 2CV0A 4NXNM 3FUUA 2XZUA 1DGBA 1K3WA 2R4JA 4P16A 4KLNA 4AG6A 2FFJA 1I94M 3K1JA 5C1BA 3DOAA 3U6EA 2EA0A 2K47A 4G4NA 3SYLA 3KOZE 4D80A 4B3RM 2D7HA 2F5OA 3SBJA 2DZOB 1SXJD 3L2AA 5FTNA 3LVVA 3NBIA 4LF7M 4CHTB 1FNNA 2UXDM 4LFAM 1XNQM 2F5NA 1L2DA 1XXHA 3KFUG 2C5RA 2Z7JA 5F3WA 3GQ5A 2X49A 1L1TA 4DR7M 4DV4M 4JI5M 5EXXA 3IG5A 3LQQA 3MHVC 2KZUA 1Z5BA 3T38A 3OTOM 1SXJE 3FTCA 4WW0A 4LJ6A 4JYAM 3RFWA 4GH9A 2YFQA 4A3VB 4LF8M 3U6QA 2YNMD 4AG5A 4EIWA 1LV7A 4LFBM 1N32M 3TE6A 3PXGA 2R65A 3SC3A 1QVRA 2DHRA 4FWDA 1S3SA 1UM8A 4LZJA 1IY0A 1IM2A 3RE8A 4DR6M 3D8LA 4OU7A 3J81S 5EP4A 1YUBA 2FNAA 4GC9A 2YQZA 3AV0A 3U60A 3VK8A 1N34M 1R2YA 3UMMA 4Z8XA 2C9OA 4B3SM 4TUWA 4NRVA 2M60A 4IBBA 3U6DA 1OJLA 4QHTA 3PNYA 1DO0A 1QQWA 3FUWA 2OQ4A 4B3TM 4GHAA 4JI0M 4I5SA 2UU9M 2QPAA 3HU1A 2ZAMA 3VLFB 2F5PA 4IBKA 1XXHB 2CHVA 3FTDA 3GP1A 2L7IA 4OX9M 1L8QA 2KRKA 1Q3BA 2LWXA 2QP9X 1Z5AA 4RF0A 3ILKA 4DV7M 3VDPA 4M9SA 1W5TA 3DFZA 3AKZA 4LRSA 2LNHC 4LF4M 3HHXA 2RKOA 3B9PA 3JR5A 2OPFA 3SARA 3THGA 1E94E 2KA6B 4GRIA 1DGGA 2VQEM 1N36M 1IBLM 1L2CA 1HQCA 2QENA 4YY3M 3GLGA 3BOSA 2C98A 3UK6A 1EE8A 4HL4A 4LCBA 4QNRA 3GLFA 1GL7A 3J7AS 5JI3E 4B7HA 3GPYA 1GLNA 4IJEA 3R8FA 3GRUA 4LJ8A 4BLCA 3U60B 4AW4A 4JXJA 3TWMA 3A98B 3GQ4A 4MM3B 5LMUM 3CF0A 2Y21A 2Z4RA 4MH0E 4CISA 1Z6TA 5DYIA 3CF6E 4PT5A 3U6LA 5ITXE 2V1CA 1K3XA 3R9XB 1YSYA 3FKEA 3GO8A 3KOWE 4MGYE 5EXSA 1NJGA 3GPUA 4DV3M 1FJGM 4NXMM 5EXTA 4IBDA 4QOZC 4L15A 3U61B 1QANA 3Q8XA 2F5QA 1IN6A 3QWLA 3HHYA 3IG8A 4BB9A 4JI4M 1DGFA 3M7GA 3LQRA 4G6ZA 4FWHA 2Y0QA 1E9RA 3GRVA 5FTLA 4OW0A 1PM5A 3GLGB 2KW0A 3JAMS 5FLXS 4FW9A 3GLFB 3SAVA 1NSFA 4IBFA 3I4YA 3VDUA 2DVWB 2ZM6M 1VDDA 1TDZA 3AL0C 5EP2A 4MGIE 2D7GA 1NNJA 2HCBA 4LGMA 2QZ4A 4PDGA 4MB7A 3UZUA 4LRTA 1GVNA 1XHBA 4L16A 1C1KA 3RGPA 1XMOM 1IXSB 1HQYE 3ZH9B 3VKHA 2XF3A 1JQJC 2LH0A 4D81A 1SXJC 5BPVA 4GKJM 3L27A 1DGHA 5FTMA 4M9XA 5EXPA 2CEAA 2XEPA 2C96A 1OFIA 1I4WA 1Z59A 3UGJA 4M0WA 5ITUA 2DWLA 2E5LM 4DR3M 2CV1A 3SHFA 1D2NA 3FD9A 5A2QS 3SMPA 1G59A 4X66M 3E4RA 4X65M 3MJ5A 3J80S 2XH9A 2VIIA 1TH3A 2UXCM 3A42A 3AJIB 4M9ZA 4CGYB 4B3MM 3KVWA 3K92A 2R46A 3KS4A 3J2PB 1TDHA 1T3TA 4BBAA 3HJSA 2J7OA 4W5WA 2R62A 2LXEA 4JI7M 2CUZA 1Q39A 3GLIA 1HT1E 3GLHA 4MGZE 4IBEA 3W0LB 3AFHA 4FD2A 4G4RA 3M0EA 4JI3M 4WURA 3C58A 3NWLA 1N78A 3L29A 5DNYA 3HU2A 4LFCM 4I4LA 2Y0TA 4NSRA 5BR8M 1IXRC 3SFZA 1WXQA 1DGHB 4ZPXA 1ORYB 3U61A 3KP1E 1E9SA 2RGOA 5KPTA 3L25A 1QAQA 2G8LA 4DR5M 4DR1M 3U5ZA 4IBCA 1IN5A 4K0KM 3TWKA 1L1ZA 1NY6A 4QHSA 3MK6A 3PVSA 4II7A 1YE9A 1MU5A 2RGHA 2DWZB 1NY5A 1IN8A 1R6BX 4LZZA 2L09A 2Q2EB 3UJNA 2UXBM 4REZA 3HHWA 3GLIB 1IN7A 3GLHB 1IN4A 5EP3A 2R4EA 4LF6M 4IIWA 3L26A 2XSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYG A;  4WW0 A;  1NSF A;  1G4A E;  1OFH A;  4FCW A;  1HT2 E;  2DVW B;  4LJ6 A;  3CF2 A;  3EIH A;  4A3V B;  1W5S A;  2CHQ A;  4QOS A;  5EP2 A;  4FWG A;  4EIW A;  1LV7 A;  2QBY A;  2ZAO A;  2HCB A;  4LGM A;  2QZ4 A;  2R65 A;  3PXG A;  4I81 A;  3HU3 A;  5EP1 A;  3SC3 A;  4LRT A;  4L16 A;  1QVR A;  2DHR A;  1C1K A;  4FWD A;  1IXS B;  1S3S A;  1HQY E;  1UM8 A;  1IY0 A;  1IM2 A;  3ZH9 B;  3M6A A;  5EP4 A;  3EIE A;  1JQJ C;  3U5Z B;  2FNA A;  4GIT A;  2ZAN A;  4D81 A;  4JN6 A;  1X37 A;  1SXJ C;  1IY2 A;  1J7K A;  1QZM A;  5FTM A;  4LJ4 A;  4Z8X A;  5EXP A;  2CEA A;  5FTK A;  2C9O A;  3KW6 A;  2C96 A;  5FTJ A;  1OFI A;  2C99 A;  1KSF X;  1OJL A;  2V6Z M;  4QHT A;  3VFD A;  1DO0 A;  4LJ5 A;  1D2N A;  1G3I A;  2QPA A;  3HU1 A;  2ZAM A;  3VLF B;  1XXH B;  2CHV A;  5EQT A;  4L4U A;  1DO2 A;  1L8Q A;  2KRK A;  2QP9 X;  2VII A;  2DZN B;  1W5T A;  2CE7 A;  3AJI B;  4LRS A;  1SXJ A;  2XSZ D;  4LJ9 A;  1E32 A;  2RKO A;  3KDS E;  3B9P A;  2R62 A;  1E94 E;  2C9C A;  4KO8 A;  3WHK A;  3D8B A;  2CHG A;  1HT1 E;  3GLI A;  2QBY B;  1HQC A;  3GLH A;  2QEN A;  5C18 A;  2BJW A;  4KOD A;  3BOS A;  3GLG A;  2C98 A;  3UK6 A;  4LCB A;  4QNR A;  4FD2 A;  3DZD A;  3M0E A;  3GLF A;  1SXJ B;  5JI3 E;  3WHL A;  2Z4S A;  1NVM A;  1JR3 A;  3HU2 A;  4I4L A;  3R8F A;  1NJF A;  4LJ8 A;  3U60 B;  1IXR C;  2X8A A;  4ZPX A;  1IQP A;  3GLF B;  2BJV A;  5JI2 E;  3HWS A;  3SYK A;  3CF0 A;  2Z4R A;  4KLN A;  4QNM A;  3K1J A;  5C1B A;  5DYI A;  1KYI A;  4LY6 A;  3SYL A;  3PFI A;  4LJA A;  4D80 A;  1IN5 A;  3H4M A;  5EXS A;  1XWI A;  1NJG A;  1NY6 A;  2DZO B;  1SXJ D;  5EXT A;  4QHS A;  4L15 A;  5FTN A;  4FCV A;  3PVS A;  3U61 B;  1R7R A;  1IN6 A;  1FNN A;  4D82 A;  1IY1 A;  2DWZ B;  1NY5 A;  1IN8 A;  1R6B X;  4LJ7 A;  1XXH A;  4LZZ A;  2V1U A;  4FWH A;  1G41 A;  5FTL A;  3GLI B;  1IN7 A;  3GLH B;  1IN4 A;  5EP3 A;  3GLG B;  5EXX A;  4FW9 A;  3MHV C;  4FCT A;  1IXZ A;  1SXJ E;  1JR3 D;  2XSZ A; 
#chains in the Genus database with same CATH topology
 3J27 B;  4WP2 A;  1NHG C;  1OFH A;  4FCW A;  4LG2 A;  2EO2 A;  4AKH A;  4B7F A;  1Z5C A;  3CF2 A;  3GRY A;  4ANR A;  3KSJ A;  2CHQ A;  4QOS A;  3SHG B;  2KNV A;  2XFT A;  2DEN A;  1MN3 A;  1T6O A;  4NRW A;  1HNW M;  3GLI E;  4X62 M;  3I51 A;  3RGS A;  2B3T A;  3KS8 A;  1QAO A;  3FUV A;  2UUC M;  4LF9 M;  1KFV A;  3AOE C;  4L8R C;  3U6M A;  2X4A A;  1NV9 A;  2VDB B;  3C3E A;  3EIE A;  2UUA M;  4IIW A;  3U5Z B;  3FTE A;  3FYC A;  4NOO B;  2ZAN A;  2CV2 A;  4Z6Y A;  2JUJ A;  3ZC7 B;  4JN6 A;  1X37 A;  2BWB A;  5FSW A;  1QZM A;  2DWM A;  1F4I A;  3KOX E;  3KP0 E;  4LJ4 A;  5FTK A;  2VQF M;  3KW6 A;  5FTJ A;  1PJJ A;  4ITQ A;  2C99 A;  1PJT A;  4PCZ A;  2V6Z M;  1OIP A;  2KZS A;  3VFD A;  1XNR M;  1D0M A;  2FOI C;  3IEC A;  4LJ5 A;  4IBI A;  2QCU A;  2EUC A;  4DV6 M;  3E9S A;  4JI8 M;  2JY5 A;  1HR0 M;  5KPR A;  2CRU A;  2J7N A;  3B74 A;  3KOY E;  1WHC A;  1G8P A;  3L28 A;  3KXE C;  3U6P A;  5ITQ A;  2XSZ D;  4LJ9 A;  3GLF E;  2DXI A;  1IBK M;  5E26 A;  1N77 A;  2R45 A;  3SAT A;  4OVZ A;  4AI6 A;  4GIP A;  3QYE A;  3PNV A;  2MRO B;  5L8R F;  2C9C A;  4IJF A;  5KQD A;  2UUB M;  4JI1 M;  3WHK A;  3D8B A;  5ITY A;  3T1Y M;  4IBG A;  1Q02 A;  2AHM A;  4AZF A;  3B7Q A;  4JI2 M;  5E6J A;  4G4O A;  1QAM A;  3SAS A;  2DKL A;  3GRR A;  1SXJ B;  4L6V 6;  3K2L A;  1NVM A;  1JR3 A;  1TH2 A;  1V92 A;  3QAU A;  3SMS A;  2F5S A;  1TH4 A;  2KEB A;  3BBZ A;  3JR4 A;  3FTF A;  3U6S A;  4DUY M;  1AIP C;  2JA2 A;  8CAT A;  4L78 A;  1IQP A;  3FUT A;  5JI2 E;  2I7P A;  3I4V A;  3HJ8 A;  4NL4 H;  1MX0 A;  3HWS A;  3SYK A;  4QNM A;  4AQY M;  2HKJ A;  2DAG A;  1ZQ9 A;  4I8O A;  1KYI A;  4LY6 A;  5KQ8 A;  3FUX A;  3PFI A;  2KHH A;  4LJA A;  5ITT A;  2FS1 A;  4G3O A;  3VKG A;  2Y20 A;  3H4M A;  2XZF A;  2BNK A;  2JY6 B;  2ZBK B;  1XWI A;  2G5G X;  2D7E A;  4R7G A;  4JV5 M;  2QHO B;  3K9O A;  1T43 A;  3TQS A;  3AOG A;  5GKN A;  4FCV A;  2DNA A;  1R7R A;  4PDI A;  3HJQ A;  4D82 A;  1IY1 A;  1H6U A;  2FH0 A;  4OVZ B;  5LMN M;  4LF5 M;  4LJ7 A;  3U6C A;  1ZAE A;  4HLQ A;  4X64 M;  5ITX A;  2HL7 A;  2P5T A;  2V1U A;  2KXE A;  1G41 A;  5EJC A;  1OIZ A;  3FYD A;  4KHP M;  3KSX A;  2M5Z A;  3IHP A;  3TWL A;  3GPP A;  4DBG B;  2N35 A;  2L7H A;  4FCT A;  3FRI A;  1IXZ A;  4MGK E;  1K82 A;  1JR3 D;  3LVW A;  1IBM M;  5DYG A;  3A45 A;  1N75 A;  1G4A E;  5KO3 A;  4RF1 A;  1QUT A;  1HT2 E;  4JI6 M;  2O5R A;  1GL6 A;  1C7Y A;  5IZ7 D;  3EIH A;  3VK7 A;  1W5S A;  4GC5 A;  3F92 A;  4FWG A;  2NQ8 C;  3AOE A;  2W82 A;  4B7G A;  2ZAO A;  2QBY A;  4XGI A;  1YLA A;  4YHH M;  4I81 A;  3HU3 A;  5EP1 A;  4AKG A;  1WGN A;  2WSF F;  4M0D A;  3TPZ A;  3GPX A;  3HY5 A;  3M6A A;  4GMQ A;  2JNH A;  4GHL A;  2BWE A;  3LMM A;  1G71 A;  5IWA M;  4S12 A;  1Q3C A;  1GKI A;  2R18 A;  3FRH A;  4GIT A;  1JR3 E;  1QYR A;  2O01 F;  1TF0 B;  3TL4 X;  3HKP A;  4AKI A;  3HGI A;  1EIJ A;  2ERC A;  1IY2 A;  3DA1 A;  1J7K A;  1HNX M;  7CAT A;  5ITR A;  1PJS A;  2I7N A;  5KPZ A;  1PJI A;  1NHW C;  1QUS A;  1KSF X;  2CFO A;  1NNU C;  2H1R A;  3ZCB B;  5IRE B;  1G3I A;  2F4V M;  3E46 A;  3MMP A;  1VDL A;  3J7B A;  4P17 A;  4DR2 M;  1HNZ M;  3A46 A;  5EQT A;  4HEO A;  4L4U A;  1DO2 A;  3CTW B;  3E21 A;  4XBO A;  4DUZ M;  1R2Z A;  5H37 D;  3GLH E;  3SAW A;  2DZN B;  1GAB A;  1ZMU A;  1XMQ M;  2CE7 A;  3T1H M;  3GQ3 A;  1J09 A;  1SXJ A;  3T15 A;  1E32 A;  2L6O A;  2FE8 A;  4DV5 M;  4GKK M;  2QQ8 A;  3K8Z A;  3KDS E;  2XLJ A;  4LGY A;  2RRU A;  3W0F A;  1JB0 F;  4DV2 M;  1LTM A;  2JWS A;  4R3D A;  2JY7 A;  4KO8 A;  2Z3X A;  1XC8 A;  4B08 A;  2CHG A;  2KRU A;  3SAU A;  2HHH M;  2QBY B;  4DR4 M;  3U6O A;  2A5Y B;  2XFS A;  2BJW A;  4KOD A;  5C18 A;  1VG5 A;  4NSO B;  1L2B A;  2DWN A;  3DZD A;  2HAK A;  2WSE F;  1A5T A;  3WHL A;  2DAK A;  2Z4S A;  1AUA A;  5IT9 S;  4FVM A;  1ZMV A;  4IBJ A;  4G4Q A;  4DV1 M;  1NJF A;  4XK8 F;  2R6F A;  4PD2 A;  2XGN A;  1TGU A;  2X8A A;  4DV0 M;  1N33 M;  2YR0 A;  4MGH A;  2BJV A;  1J5E M;  4RNA A;  3HHZ A;  2CV0 A;  4NXN M;  3FUU A;  2XZU A;  1DGB A;  1K3W A;  2R4J A;  1TR8 A;  4P16 A;  4KLN A;  4AG6 A;  2FFJ A;  1I94 M;  3K1J A;  5C1B A;  3DOA A;  3U6E A;  2EA0 A;  2K47 A;  4G4N A;  2EJS A;  3SYL A;  3KOZ E;  4D80 A;  2LHG A;  3FE3 A;  4B3R M;  2D7H A;  2EKK A;  2F5O A;  2DAI A;  2DZO B;  3SBJ A;  1SXJ D;  2LTU A;  3L2A A;  5FTN A;  3LVV A;  1QDT A;  3NBI A;  4LF7 M;  4CHT B;  1FNN A;  2UXD M;  4LFA M;  1XNQ M;  2F5N A;  1L2D A;  1XXH A;  3KFU G;  2C5R A;  2Z7J A;  5F3W A;  1WJ7 A;  3GQ5 A;  2X49 A;  1L1T A;  4DR7 M;  1ZV1 A;  4DV4 M;  4JI5 M;  4CIZ A;  5EXX A;  3IG5 A;  3LQQ A;  3MHV C;  2KZU A;  1Z5B A;  3T38 A;  3OTO M;  1SXJ E;  3FTC A;  4WW0 A;  2MH8 A;  2DZL A;  4LJ6 A;  4JYA M;  3RFW A;  4GH9 A;  2YFQ A;  4A3V B;  4LF8 M;  3U6Q A;  2YNM D;  4AG5 A;  2OOA A;  1LV7 A;  4EIW A;  4LFB M;  3TE6 A;  1N32 M;  3PXG A;  2R65 A;  3SC3 A;  3LCV B;  1QVR A;  2DHR A;  4FWD A;  1S3S A;  1UM8 A;  4LZJ A;  1IY0 A;  1IM2 A;  1GJT A;  3RE8 A;  4DR6 M;  3D8L A;  4OU7 A;  3J81 S;  5EP4 A;  3B7N A;  1YUB A;  5DFL A;  2FNA A;  4GC9 A;  2LHC A;  2YQZ A;  3AV0 A;  1VEK A;  3U60 A;  3VK8 A;  1N34 M;  2KNZ A;  1R2Y A;  3UMM A;  4Z8X A;  2C9O A;  4B3S M;  1V33 A;  3B7Z A;  2M60 A;  4NRV A;  4TUW A;  4IBB A;  3U6D A;  1OJL A;  2JXN A;  4QHT A;  3PNY A;  1DO0 A;  1QQW A;  3FUW A;  3NBX X;  2OQ4 A;  4B3T M;  4GHA A;  2JY8 A;  4JI0 M;  4I5S A;  2UU9 M;  2QPA A;  3HU1 A;  2ZAM A;  3VLF B;  2F5P A;  4IBK A;  1XXH B;  2CHV A;  3FTD A;  3GP1 A;  2L2D A;  2L7I A;  1WR1 B;  4OX9 M;  1L8Q A;  2KRK A;  1Q3B A;  2LWX A;  2QP9 X;  1QZE A;  2H5X A;  1Z5A A;  4RF0 A;  3ILK A;  4DV7 M;  3VDP A;  4M9S A;  2LVQ D;  1W5T A;  3DFZ A;  3AKZ A;  4LRS A;  2LNH C;  2L4E A;  4LF4 M;  3HHX A;  2RKO A;  3BXW A;  3B9P A;  3JR5 A;  2OPF A;  3SAR A;  3THG A;  1E94 E;  2KA6 B;  2EKF A;  4GRI A;  1DGG A;  2VQE M;  1N36 M;  1IBL M;  2R0I A;  1D0L A;  1L2C A;  1HQC A;  2QEN A;  4YY3 M;  3GLG A;  3BOS A;  2C98 A;  3T6P A;  1VQ1 A;  3UK6 A;  1EE8 A;  2DAM A;  4HL4 A;  4LCB A;  4QNR A;  3GLF A;  1GL7 A;  3J7A S;  5JI3 E;  4B7H A;  1HJP A;  3GPY A;  1GLN A;  1GO5 A;  4IJE A;  3V76 A;  2GNO A;  3R8F A;  3GRU A;  4LJ8 A;  1WGL A;  4BLC A;  3U60 B;  4AW4 A;  4JXJ A;  2MJ5 B;  1CUK A;  3TWM A;  1IXS A;  1IFY A;  3A98 B;  3GQ4 A;  4MM3 B;  5LMU M;  2KNA A;  3CF0 A;  2Y21 A;  1EFU B;  1QDR A;  2MGW A;  2Z4R A;  4MH0 E;  1VEJ A;  4CIS A;  1Z6T A;  5DYI A;  3CF6 E;  4PT5 A;  3U6L A;  5ITX E;  2V1C A;  1K3X A;  3R9X B;  1YSY A;  3FKE A;  2ZTC A;  3GO8 A;  3KOW E;  4MGY E;  5EXS A;  1NJG A;  3GPU A;  4DV3 M;  1FJG M;  1OAO C;  1V34 A;  4NXM M;  5EXT A;  4IBD A;  4QOZ C;  4L15 A;  1OQY A;  3U61 B;  4UN2 B;  1QAN A;  1NV8 A;  3Q8X A;  3CGW A;  1RU3 A;  1IN6 A;  2F5Q A;  3QWL A;  3HHY A;  1DV0 A;  1OAI A;  3IG8 A;  4BB9 A;  4JI4 M;  2R44 A;  2CWB A;  1DGF A;  3M7G A;  1UFZ A;  2KDL A;  4RKU F;  3LQR A;  4G6Z A;  4FWH A;  2Y0Q A;  1E9R A;  3GRV A;  5FTL A;  4OW0 A;  1PM5 A;  2LBC A;  3GLG B;  2KW0 A;  3JAM S;  5FLX S;  2J5Y A;  4FW9 A;  3K9P A;  3GLF B;  3SAV A;  2MR9 A;  1NSF A;  4IBF A;  3I4Y A;  2GQF A;  1VEG A;  2Z8Y M;  3VDU A;  2DVW B;  4CJ6 A;  4F1I A;  1VDD A;  3B89 A;  2ZM6 M;  1TDZ A;  3AL0 C;  5EP2 A;  4MGI E;  2D7G A;  3I01 M;  2G3Q A;  3W67 A;  1NNJ A;  2HCB A;  4LGM A;  2DAE A;  2QZ4 A;  4PDG A;  4MB7 A;  1PJQ A;  3UZU A;  4LRT A;  1GVN A;  1XHB A;  4L16 A;  1C1K A;  1SG9 A;  3RGP A;  1IXS B;  3GLG E;  1HQY E;  1XMO M;  3ZH9 B;  2VF7 A;  3VKH A;  2XF3 A;  2JP7 A;  1JQJ C;  2LH0 A;  3LCU A;  2OO9 A;  4D81 A;  1SXJ C;  2K6B A;  5BPV A;  4GKJ M;  3L27 A;  1DGH A;  2JZ0 A;  5FTM A;  4M9X A;  5EXP A;  2CEA A;  2XEP A;  4F2L A;  2C96 A;  1OFI A;  1I4W A;  1Z59 A;  1MJG M;  3HX3 A;  4Q7J A;  4R71 A;  1TTE A;  2O25 A;  3LW5 F;  3UGJ A;  4M0W A;  5ITU A;  2LVO C;  2DWL A;  2E5L M;  2LVP C;  4DR3 M;  3SHF A;  2CV1 A;  1D2N A;  3FD9 A;  5A2Q S;  3SMP A;  1G59 A;  4X66 M;  3E4R A;  4X65 M;  3MJ5 A;  3J80 S;  1R5L A;  2XH9 A;  2VII A;  1TH3 A;  2QSF X;  2UXC M;  3A42 A;  3AJI B;  4M9Z A;  3C3D A;  4CGY B;  4B3M M;  3KVW A;  3K92 A;  2R46 A;  2QNJ A;  3KS4 A;  3J2P B;  1TDH A;  3QYB A;  1T3T A;  3W68 A;  4BBA A;  3HJS A;  1OKS A;  2J7O A;  4W5W A;  2R62 A;  2LXE A;  4KT0 F;  4JI7 M;  2CUZ A;  2JZ1 A;  1Q39 A;  3GLI A;  1HT1 E;  2WZJ A;  3GLH A;  4MGZ E;  4IBE A;  3W0L B;  1WIV A;  3AFH A;  2LVN C;  4FD2 A;  1GJS A;  4G4R A;  3M0E A;  4JI3 M;  1NO1 A;  4WUR A;  3C58 A;  3Q8G A;  3NWL A;  1N78 A;  3L29 A;  5DNY A;  3HU2 A;  4LFC M;  1ZMW A;  3H4J A;  3ZQJ A;  4I4L A;  2Y0T A;  4NSR A;  5BR8 M;  1IXR C;  3SFZ A;  1WXQ A;  1DGH B;  2LVA A;  4GEW A;  2VF8 A;  4ZPX A;  1ORY B;  3U61 A;  4Y28 F;  3KP1 E;  2HWJ A;  1E9S A;  3I04 M;  2CP8 A;  2RGO A;  5KPT A;  2DHY A;  3L25 A;  1QAQ A;  2G8L A;  1XB2 B;  1PRB A;  2K9D A;  4DR5 M;  4DR1 M;  2DI0 A;  3U5Z A;  1XXH E;  1Y8G A;  4IBC A;  1D0K A;  1IN5 A;  4K0K M;  1OTR A;  3TWK A;  1L1Z A;  1R4G A;  1NY6 A;  4QHS A;  3MK6 A;  2L4F A;  3PVS A;  4II7 A;  1YE9 A;  1MU5 A;  2RGH A;  1BVS A;  2DWZ B;  1NY5 A;  1IN8 A;  1R6B X;  4LZZ A;  2L09 A;  2OOB A;  2Q2E B;  4NC6 A;  3UJN A;  2ZTD A;  3HZJ A;  2UXB M;  4REZ A;  3HHW A;  3GLI B;  1IN7 A;  2WSC F;  1IN4 A;  1PGY A;  3GLH B;  5EP3 A;  2R4E A;  3C9P A;  4LF6 M;  1P3Q Q;  2APL A;  3L26 A;  2K0B X;  2XSZ A; 
#chains in the Genus database with same CATH homology
 3J27 B;  1NHG C;  1OFH A;  4FCW A;  4LG2 A;  2EO2 A;  4AKH A;  4B7F A;  1Z5C A;  3CF2 A;  3GRY A;  3KSJ A;  2CHQ A;  4QOS A;  3SHG B;  2XFT A;  1HNW M;  4NRW A;  4X62 M;  3I51 A;  3RGS A;  3KS8 A;  1QAO A;  3FUV A;  2UUC M;  4LF9 M;  1KFV A;  3AOE C;  4L8R C;  3U6M A;  2X4A A;  2UUA M;  3EIE A;  3U5Z B;  3FTE A;  3FYC A;  4NOO B;  2ZAN A;  2CV2 A;  4Z6Y A;  3ZC7 B;  4JN6 A;  1X37 A;  5FSW A;  1QZM A;  2DWM A;  3KOX E;  3KP0 E;  4LJ4 A;  5FTK A;  2VQF M;  3KW6 A;  5FTJ A;  1PJJ A;  4ITQ A;  2C99 A;  4PCZ A;  2V6Z M;  3VFD A;  2KZS A;  1XNR M;  2FOI C;  4LJ5 A;  4IBI A;  2QCU A;  2EUC A;  4DV6 M;  3E9S A;  4JI8 M;  1HR0 M;  5KPR A;  2J7N A;  3KOY E;  1G8P A;  3L28 A;  3KXE C;  3U6P A;  5ITQ A;  2XSZ D;  4LJ9 A;  2DXI A;  1IBK M;  5E26 A;  1N77 A;  2R45 A;  3SAT A;  4OVZ A;  4GIP A;  3PNV A;  4JI1 M;  2C9C A;  4IJF A;  5KQD A;  2UUB M;  3WHK A;  3D8B A;  5ITY A;  3T1Y M;  4IBG A;  2AHM A;  4AZF A;  4JI2 M;  5E6J A;  4G4O A;  1QAM A;  3SAS A;  3GRR A;  1SXJ B;  3K2L A;  1NVM A;  1JR3 A;  1TH2 A;  3QAU A;  3SMS A;  2F5S A;  1TH4 A;  2KEB A;  3JR4 A;  3FTF A;  3U6S A;  4DUY M;  2JA2 A;  8CAT A;  4L78 A;  1IQP A;  3FUT A;  5JI2 E;  2I7P A;  3I4V A;  3HJ8 A;  4NL4 H;  1MX0 A;  3HWS A;  3SYK A;  4QNM A;  4AQY M;  2HKJ A;  1ZQ9 A;  4I8O A;  1KYI A;  4LY6 A;  5KQ8 A;  3FUX A;  3PFI A;  4LJA A;  5ITT A;  3VKG A;  2Y20 A;  3H4M A;  2XZF A;  2BNK A;  2ZBK B;  1XWI A;  2G5G X;  2D7E A;  4R7G A;  4JV5 M;  3TQS A;  3AOG A;  5GKN A;  4FCV A;  1R7R A;  4PDI A;  3HJQ A;  4D82 A;  1IY1 A;  1H6U A;  4OVZ B;  5LMN M;  4LF5 M;  4LJ7 A;  3U6C A;  1ZAE A;  4HLQ A;  4X64 M;  5ITX A;  2HL7 A;  2P5T A;  2V1U A;  2KXE A;  1G41 A;  5EJC A;  4KHP M;  3FYD A;  3KSX A;  2M5Z A;  3TWL A;  3GPP A;  2L7H A;  4FCT A;  4MGK E;  1IXZ A;  1K82 A;  1IBM M;  1JR3 D;  3LVW A;  4AI6 A;  5DYG A;  3A45 A;  1N75 A;  1G4A E;  5KO3 A;  4RF1 A;  4JI6 M;  1HT2 E;  2O5R A;  1GL6 A;  5IZ7 D;  3EIH A;  3VK7 A;  1W5S A;  4GC5 A;  4FWG A;  2NQ8 C;  3AOE A;  2W82 A;  4B7G A;  2ZAO A;  2QBY A;  4XGI A;  4YHH M;  4I81 A;  3HU3 A;  5EP1 A;  4AKG A;  4M0D A;  3GPX A;  3TPZ A;  3M6A A;  4GMQ A;  4GHL A;  3LMM A;  5IWA M;  4S12 A;  1Q3C A;  1GKI A;  2R18 A;  4GIT A;  1QYR A;  3TL4 X;  4AKI A;  3HKP A;  3HGI A;  2ERC A;  1IY2 A;  3DA1 A;  1J7K A;  1HNX M;  7CAT A;  5ITR A;  5KPZ A;  2I7N A;  1PJI A;  1NHW C;  1KSF X;  2CFO A;  1NNU C;  2H1R A;  3ZCB B;  5IRE B;  1G3I A;  2F4V M;  4DR2 M;  3J7B A;  1HNZ M;  3A46 A;  5EQT A;  4L4U A;  1DO2 A;  3CTW B;  4XBO A;  4DUZ M;  1R2Z A;  5H37 D;  3SAW A;  2DZN B;  1XMQ M;  2CE7 A;  3T1H M;  3GQ3 A;  1J09 A;  1SXJ A;  3T15 A;  1E32 A;  2L6O A;  2FE8 A;  4DV5 M;  4GKK M;  3K8Z A;  3KDS E;  2XLJ A;  4LGY A;  3W0F A;  4DV2 M;  4R3D A;  1XC8 A;  4KO8 A;  2Z3X A;  4B08 A;  2CHG A;  2KRU A;  3SAU A;  2HHH M;  2QBY B;  4DR4 M;  3U6O A;  2A5Y B;  2XFS A;  2BJW A;  4KOD A;  5C18 A;  4NSO B;  1L2B A;  2DWN A;  3DZD A;  3WHL A;  2Z4S A;  5IT9 S;  4FVM A;  4IBJ A;  4G4Q A;  4DV1 M;  1NJF A;  4PD2 A;  2XGN A;  1TGU A;  2X8A A;  4DV0 M;  1N33 M;  2YR0 A;  4MGH A;  2BJV A;  1J5E M;  4RNA A;  3HHZ A;  2CV0 A;  4NXN M;  3FUU A;  2XZU A;  1DGB A;  1K3W A;  2R4J A;  4P16 A;  4KLN A;  4AG6 A;  2FFJ A;  1I94 M;  3K1J A;  5C1B A;  3DOA A;  3U6E A;  2EA0 A;  2K47 A;  4G4N A;  3SYL A;  3KOZ E;  4D80 A;  4B3R M;  2D7H A;  2F5O A;  3SBJ A;  2DZO B;  1SXJ D;  3L2A A;  5FTN A;  3LVV A;  3NBI A;  4LF7 M;  4CHT B;  1FNN A;  2UXD M;  4LFA M;  1XNQ M;  2F5N A;  1L2D A;  1XXH A;  3KFU G;  2C5R A;  2Z7J A;  5F3W A;  3GQ5 A;  2X49 A;  1L1T A;  4DR7 M;  4DV4 M;  4JI5 M;  5EXX A;  3IG5 A;  3LQQ A;  3MHV C;  2KZU A;  1Z5B A;  3T38 A;  3OTO M;  1SXJ E;  3FTC A;  4WW0 A;  4LJ6 A;  4JYA M;  3RFW A;  4GH9 A;  2YFQ A;  4A3V B;  4LF8 M;  3U6Q A;  2YNM D;  4AG5 A;  4EIW A;  1LV7 A;  4LFB M;  1N32 M;  3TE6 A;  3PXG A;  2R65 A;  3SC3 A;  1QVR A;  2DHR A;  4FWD A;  1S3S A;  1UM8 A;  4LZJ A;  1IY0 A;  1IM2 A;  3RE8 A;  4DR6 M;  3D8L A;  4OU7 A;  3J81 S;  5EP4 A;  1YUB A;  2FNA A;  4GC9 A;  2YQZ A;  3AV0 A;  3U60 A;  3VK8 A;  1N34 M;  1R2Y A;  3UMM A;  4Z8X A;  2C9O A;  4B3S M;  4TUW A;  4NRV A;  2M60 A;  4IBB A;  3U6D A;  1OJL A;  4QHT A;  3PNY A;  1DO0 A;  1QQW A;  3FUW A;  2OQ4 A;  4B3T M;  4GHA A;  4JI0 M;  4I5S A;  2UU9 M;  2QPA A;  3HU1 A;  2ZAM A;  3VLF B;  2F5P A;  4IBK A;  1XXH B;  2CHV A;  3FTD A;  3GP1 A;  2L7I A;  4OX9 M;  1L8Q A;  2KRK A;  1Q3B A;  2LWX A;  2QP9 X;  1Z5A A;  4RF0 A;  3ILK A;  4DV7 M;  3VDP A;  4M9S A;  1W5T A;  3DFZ A;  3AKZ A;  4LRS A;  2LNH C;  4LF4 M;  3HHX A;  2RKO A;  3B9P A;  3JR5 A;  2OPF A;  3SAR A;  3THG A;  1E94 E;  2KA6 B;  4GRI A;  1DGG A;  2VQE M;  1N36 M;  1IBL M;  1L2C A;  1HQC A;  2QEN A;  4YY3 M;  3GLG A;  3BOS A;  2C98 A;  3UK6 A;  1EE8 A;  4HL4 A;  4LCB A;  4QNR A;  3GLF A;  1GL7 A;  3J7A S;  5JI3 E;  4B7H A;  3GPY A;  1GLN A;  4IJE A;  3R8F A;  3GRU A;  4LJ8 A;  4BLC A;  3U60 B;  4AW4 A;  4JXJ A;  3TWM A;  3A98 B;  3GQ4 A;  4MM3 B;  5LMU M;  3CF0 A;  2Y21 A;  2Z4R A;  4MH0 E;  4CIS A;  1Z6T A;  5DYI A;  3CF6 E;  4PT5 A;  3U6L A;  5ITX E;  2V1C A;  1K3X A;  3R9X B;  1YSY A;  3FKE A;  3GO8 A;  3KOW E;  4MGY E;  5EXS A;  1NJG A;  3GPU A;  4DV3 M;  1FJG M;  4NXM M;  5EXT A;  4IBD A;  4QOZ C;  4L15 A;  3U61 B;  1QAN A;  3Q8X A;  2F5Q A;  1IN6 A;  3QWL A;  3HHY A;  3IG8 A;  4BB9 A;  4JI4 M;  1DGF A;  3M7G A;  3LQR A;  4G6Z A;  4FWH A;  2Y0Q A;  1E9R A;  3GRV A;  5FTL A;  4OW0 A;  1PM5 A;  3GLG B;  2KW0 A;  3JAM S;  5FLX S;  4FW9 A;  3GLF B;  3SAV A;  1NSF A;  4IBF A;  3I4Y A;  3VDU A;  2DVW B;  2ZM6 M;  1VDD A;  1TDZ A;  3AL0 C;  5EP2 A;  4MGI E;  2D7G A;  1NNJ A;  2HCB A;  4LGM A;  2QZ4 A;  4PDG A;  4MB7 A;  3UZU A;  4LRT A;  1GVN A;  1XHB A;  4L16 A;  1C1K A;  3RGP A;  1XMO M;  1IXS B;  1HQY E;  3ZH9 B;  3VKH A;  2XF3 A;  1JQJ C;  2LH0 A;  4D81 A;  1SXJ C;  5BPV A;  4GKJ M;  3L27 A;  1DGH A;  5FTM A;  4M9X A;  5EXP A;  2CEA A;  2XEP A;  2C96 A;  1OFI A;  1I4W A;  1Z59 A;  3UGJ A;  4M0W A;  5ITU A;  2DWL A;  2E5L M;  4DR3 M;  2CV1 A;  3SHF A;  1D2N A;  3FD9 A;  5A2Q S;  3SMP A;  1G59 A;  4X66 M;  3E4R A;  4X65 M;  3MJ5 A;  3J80 S;  2XH9 A;  2VII A;  1TH3 A;  2UXC M;  3A42 A;  3AJI B;  4M9Z A;  4CGY B;  4B3M M;  3KVW A;  3K92 A;  2R46 A;  3KS4 A;  3J2P B;  1TDH A;  1T3T A;  4BBA A;  3HJS A;  2J7O A;  4W5W A;  2R62 A;  2LXE A;  4JI7 M;  2CUZ A;  1Q39 A;  3GLI A;  1HT1 E;  3GLH A;  4MGZ E;  4IBE A;  3W0L B;  3AFH A;  4FD2 A;  4G4R A;  3M0E A;  4JI3 M;  4WUR A;  3C58 A;  3NWL A;  1N78 A;  3L29 A;  5DNY A;  3HU2 A;  4LFC M;  4I4L A;  2Y0T A;  4NSR A;  5BR8 M;  1IXR C;  3SFZ A;  1WXQ A;  1DGH B;  4ZPX A;  1ORY B;  3U61 A;  3KP1 E;  1E9S A;  2RGO A;  5KPT A;  3L25 A;  1QAQ A;  2G8L A;  4DR5 M;  4DR1 M;  3U5Z A;  4IBC A;  1IN5 A;  4K0K M;  3TWK A;  1L1Z A;  1NY6 A;  4QHS A;  3MK6 A;  3PVS A;  4II7 A;  1YE9 A;  1MU5 A;  2RGH A;  2DWZ B;  1NY5 A;  1IN8 A;  1R6B X;  4LZZ A;  2L09 A;  2Q2E B;  3UJN A;  2UXB M;  4REZ A;  3HHW A;  3GLI B;  1IN7 A;  3GLH B;  1IN4 A;  5EP3 A;  2R4E A;  4LF6 M;  4IIW A;  3L26 A;  2XSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...