1X37A

Structure of bacillus subtilis lon protease ssd domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
AGYTEIEKLEIVKDHLLPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAAICRKAAKAIVAEERKRITVTEKNLQDFIGKRIFRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis and DNA binding property of SSD domain of Bacillus subtilis Lon protease
rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords ATP-dependent protease La 1
total genus 20
structure length 95
sequence length 95
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1x37A00
2QZ4A 3GLGB 3GLIA 5DYGA 3UK6A 2Z4SA 3CF0A 5JI3E 4FW9A 3KDSE 5DYIA 1IN6A 4FCWA 1SXJA 4FD2A 3SYKA 5EXPA 1NVMA 1IM2A 1G4AE 4KLNA 1XXHB 1OFHA 2R65A 1LV7A 4L4UA 3PVSA 4QNMA 2CE7A 1NJFA 2QBYB 1R7RA 2CEAA 2DWZB 1IN7A 1NY5A 1IY2A 1UM8A 1OJLA 3K1JA 3KW6A 5FTKA 1IN8A 3B9PA 2QPAA 3M0EA 2C99A 3HU1A 2CHQA 2VIIA 3R8FA 3DZDA 1OFIA 3PXGA 4GITA 1L8QA 3D8BA 3GLFA 3GLIB 3ZH9B 3PFIA 5FTJA 2C98A 4D81A 1S3SA 2X8AA 1IN5A 1W5TA 4Z8XA 4LY6A 1X37A 1HQYE 1J7KA 1QVRA 2Z4RA 5C1BA 3HU2A 4FWDA 1IQPA 1NSFA 3M6AA 3VFDA 1IXRC 4LRTA 1IXSB 3U61B 1E32A 2QENA 4ZPXA 5FTNA 2XSZD 1HT2E 3EIEA 1E94E 4LCBA 2CHGA 4KODA 2RKOA 1HQCA 1SXJE 2BJWA 1DO0A 4JN6A 4LJAA 3U60B 1JR3A 3VLFB 2V1UA 4EIWA 4D80A 1G41A 4LJ6A 3SYLA 1QZMA 3EIHA 2KRKA 3CF2A 1IN4A 4D82A 2HCBA 4LGMA 4LJ9A 4QHTA 4I81A 4LZZA 5EQTA 4FWHA 3GLFB 2ZAMA 2CHVA 3GLHA 2ZANA 2DZNB 3WHKA 3GLGA 2DZOB 2DHRA 1XWIA 1IY1A 2QBYA 2C9CA 4FCTA 4LRSA 1W5SA 3MHVC 4I4LA 5EXSA 1D2NA 4L15A 4L16A 3BOSA 1SXJB 1IY0A 3H4MA 5EXTA 5FTMA 3HWSA 4LJ5A 5EXXA 1SXJC 3WHLA 1KSFX 3AJIB 4KO8A 1JQJC 4LJ7A 3SC3A 1FNNA 5EP3A 1XXHA 2FNAA 5C18A 5FTLA 1NY6A 4WW0A 1DO2A 1C1KA 4QHSA 2BJVA 2ZAOA 2C9OA 4LJ4A 1R6BX 1JR3D 4FWGA 1HT1E 5JI2E 4A3VB 2DVWB 3U5ZB 5EP1A 5EP4A 1NJGA 4QNRA 4FCVA 4LJ8A 1G3IA 2R62A 2QP9X 2C96A 2XSZA 3GLHB 1SXJD 5EP2A 1KYIA 2V6ZM 4QOSA 1IXZA 3HU3A
chains in the Genus database with same CATH superfamily
2JNHA 2LTUA 4JI5M 3GLIA 1HJPA 5DYGA 2KHHA 3HJQA 2VQEM 1AIPC 2QHOB 1E9SA 2WSEF 2R4JA 2F5NA 2CV0A 3I01M 4AZFA 4PCZA 2DAEA 4FCWA 2OPFA 2F5OA 4R7GA 1OAIA 4MGIE 2FS1A 2DNAA 5EXPA 3F92A 1N33M 2CP8A 5E6JA 1XMOM 1TTEA 4KLNA 3I04M 4GC5A 4DR4M 4L4UA 1L2BA 3PVSA 4IBBA 1IBKM 1GL7A 2CE7A 2KNZA 2QBYB 1R7RA 1Z6TA 1T6OA 4B3MM 4CGYB 1UFZA 3TQSA 2B3TA 1QAMA 2QNJA 3GLHE 1OAOC 4G3OA 3KVWA 2OQ4A 3KFUG 2K47A 4Y28F 1IN8A 4AQYM 4JI0M 3A46A 3HY5A 2CHQA 5ITRA 4RKUF 4JI2M 2MH8A 1OFIA 2RGHA 4GITA 2I7PA 4P16A 3D8BA 2F5QA 3GLIB 3ZH9B 4WP2A 1NHGC 4IBKA 4D81A 3UJNA 1WIVA 2JA2A 1ZV1A 3J2PB 1GJTA 2LBCA 3PNVA 1IN5A 4NSRA 1PJTA 4AW4A 3CGWA 1IXSA 1X37A 2CWBA 5KQDA 5BR8M 5BPVA 1J09A 1TDZA 1G8PA 4GEWA 3SARA 1DGFA 1QVRA 2Z4RA 5C1BA 2CV1A 4B3SM 4WURA 1WXQA 1IQPA 3FD9A 3I4YA 4DR2M 1N77A 2HKJA 3M6AA 3VFDA 4DV0M 4LF9M 4GIPA 5FTNA 3MJ5A 1HT2E 4R71A 1E94E 3DFZA 4B3TM 1GVNA 4M0WA 2Y21A 3TWLA 2DAKA 1R2YA 2RKOA 2QCUA 4LZJA 3RGPA 2UXBM 3FUVA 3HHYA 3KOWE 1H6UA 1G59A 2DWLA 3C9PA 5LMNM 1XC8A 1JR3A 1Q02A 3QWLA 1PM5A 4X66M 1F4IA 4LJ6A 2EKFA 1MN3A 4DV6M 3A98B 4IBIA 2KRKA 2VF8A 2EUCA 2XFTA 3HHZA 5IWAM 5EQTA 4I81A 4LZZA 4GHAA 2R0IA 1QQWA 2ERCA 3GLHA 4LGYA 3W67A 4NXNM 2L6OA 1EFUB 2D7GA 1OQYA 3K92A 3GPXA 3FE3A 1GLNA 2C9CA 2O25A 3DA1A 4I4LA 3HHXA 1K82A 3E21A 1SXJB 4CISA 5FTMA 3RFWA 3U6SA 2K0BX 1SXJC 2KNAA 1KSFX 1ZMVA 2CUZA 2GNOA 2Y0QA 3AJIB 3HJSA 4KO8A 1XXHA 2JXNA 5FTLA 4YY3M 4LF4M 3C3DA 4W5WA 1DO2A 1P3QQ 4GHLA 3GQ5A 4QHSA 1IBLM 3JAMS 3QYBA 4DR1M 3I51A 2C9OA 4II7A 4ANRA 1N36M 2LVAA 2L2DA 4B08A 4REZA 1HT1E 3PNYA 2DVWB 2F5SA 2GQFA 4B7FA 1NHWC 2JY6B 3B7NA 3SHFA 3T1HM 1C7YA 4JI1M 4LFAM 3LQQA 3U6OA 2XSZA 1DV0A 3U6MA 1SXJD 3VKHA 2FFJA 2V6ZM 2UUAM 3HU3A 3UK6A 4DV3M 1K3WA 3Q8XA 3C3EA 2J5YA 3AOEA 3KS8A 1VDDA 3KDSE 1TR8A 2LH0A 1QAOA 2WSCF 5KQ8A 3HHWA 1L1ZA 3KSJA 5ITUA 3H4JA 3AKZA 3U6LA 4M9XA 5DFLA 1IM2A 1G4AE 4PDIA 3LVWA 1XXHB 1OFHA 2LNHC 1NNJA 1QDTA 3KSXA 1IBMM 2XLJA 2UU9M 2HHHM 1ZQ9A 1TH2A 2DWZB 2YR0A 5E26A 3UZUA 1T3TA 2E5LM 4CIZA 2DWNA 3K1JA 4DR3M 4DV2M 1VG5A 2F5PA 2YNMD 1Z59A 3GLGE 3SASA 2RRUA 2HL7A 2V1CA 3B9PA 2EA0A 1FJGM 2C99A 2JZ0A 2W82A 1PRBA 2VIIA 4P17A 1TGUA 1K3XA 3PXGA 2FE8A 1VDLA 1PJQA 3LMMA 1QANA 4ITQA 2YQZA 4RF0A 2C98A 1XHBA 3ZCBB 3Q8GA 4MGHA 1S3SA 2X8AA 2M60A 1W5TA 2YFQA 3BXWA 4BB9A 4LY6A 4IBEA 1J5EM 2G5GX 2K6BA 2MJ5B 4G4NA 1SG9A 2OOAA 3KOYE 3E46A 3GO8A 4NC6A 4XBOA 1PJSA 1OKSA 1T43A 1QZEA 1NSFA 4IJFA 1IXRC 2KZUA 4LRTA 5GKNA 1E32A 2QENA 4ZPXA 3FTCA 4DBGB 3SAUA 1KFVA 1Y8GA 4M9SA 1LTMA 4G4RA 4B7GA 2JP7A 3J80S 3K9PA 5FSWA 4LG2A 2UUBM 1N34M 4X62M 1GKIA 5ITXA 3LQRA 4I5SA 4EIWA 2JY5A 4D80A 3VK8A 4R3DA 4DR5M 4YHHM 2XF3A 3ZQJA 4D82A 1IN4A 2HCBA 1JR3E 3L28A 3FUWA 4FWHA 4DUYM 2ZM6M 2DKLA 1TDHA 1G71A 2ZANA 4GC9A 3WHKA 4JI8M 4L8RC 3GLGA 2O5RA 2DHRA 4PT5A 1XWIA 1IY1A 2QBYA 4NL4H 4LF5M 1R2ZA 3B89A 1D2NA 3HZJA 4L15A 4OVZA 4OX9M 4FVMA 3BOSA 4L16A 3H4MA 3L29A 5EXTA 3T6PA 2XZFA 3JR5A 5EXXA 2LVPC 2BWBA 3BBZA 3L27A 4AG6A 2X4AA 5C18A 1TH3A 3AOEC 4WW0A 5KO3A 3HKPA 1L2CA 3A45A 1XXHE 2JY7A 3GLFE 2L7HA 2LWXA 3SFZA 1WGLA 2A5YB 3AL0C 2AHMA 2XEPA 1OTRA 3B74A 2QSFX 1GABA 3HJ8A 1XNRM 4MM3B 2L7IA 3VK7A 3QAUA 4OW0A 4A3VB 1MX0A 3GQ3A 3NBXX 5EP1A 1XMQM 4KHPM 4OU7A 2BNKA 4QNRA 4RF1A 3VDPA 2X49A 3LCUA 4K0KM 2ZTDA 2EO2A 2L4EA 2LHGA 1KYIA 5ITXE 4QOSA 5L8RF 3VDUA 3NWLA 2KNVA 2L09A 4JI6M 5JI3E 4X65M 4FW9A 3U6CA 5DYIA 1HNXM 4GMQA 4OVZB 3AOGA 4LF6M 1SXJA 4DV5M 4FD2A 3SAVA 1YLAA 2G3QA 3LW5F 2I7NA 1LV7A 1ZMUA 5FLXS 5KPTA 1IFYA 5H37D 1NJFA 2G8LA 1OIPA 2CEAA 3KOZE 1I94M 1IN7A 1NV9A 2J7NA 3IG8A 3GRVA 3KW6A 5FTKA 2QQ8A 3MK6A 3TL4X 2MROB 4JYAM 2Z8YM 1L1TA 3GP1A 1JB0F 1DGBA 2JWSA 2LVOC 3GLFA 2VF7A 3AFHA 3PFIA 5FTJA 3GPPA 3DOAA 1HNZM 3T1YM 4BBAA 1Q3CA 2ZTCA 5KPZA 3ILKA 2KEBA 3HGIA 4F2LA 3U6DA 4IBCA 3GRYA 3B7ZA 3J7BA 3SATA 1HQYE 1XNQM 3W68A 1Z5BA 1J7KA 1BVSA 4LFCM 3HU2A 3M7GA 4FWDA 4DUZM 5KPRA 3KXEC 1N78A 2EJSA 4XGIA 3SBJA 4LF8M 3U61B 1AUAA 2DWMA 3J7AS 4DR6M 3JR4A 1TF0B 2APLA 2NQ8C 3WHLA 4JI4M 2H1RA 3T38A 2CV2A 5F3WA 2CHGA 2F4VM 4G4OA 4KODA 4NXMM 2VDBB 2BWEA 2R45A 3FUTA 4Z6YA 3ZC7B 1EE8A 1SXJE 2VQFM 4GKJM 4AKHA 3FTDA 2Y20A 4M9ZA 2XFSA 2KRUA 4LJAA 4NRVA 2LXEA 2JZ1A 3CF2A 3SAWA 4HL4A 3TPZA 2KDLA 4JI7M 2DAMA 4LGMA 4LJ9A 1GL6A 2JY8A 3K8ZA 3U60A 3U5ZA 2LHCA 2CHVA 4AG5A 4CJ6A 1QUSA 2J7OA 3QYEA 4RNAA 4DV1M 1HR0M 2DI0A 3KS4A 4FCTA 4LRSA 7CATA 1WHCA 3FKEA 5EXSA 1N75A 2HWJA 3GRRA 4IJEA 1A5TA 3GRUA 3SC3A 1JQJC 4LJ7A 2N35A 3FYCA 4B7HA 1NY6A 4LFBM 4IBGA 4IBJA 4X64M 1D0LA 2CRUA 3FRHA 2BJVA 3CF6E 4IBFA 1Z5CA 4NOOB 4LJ4A 1R6BX 2K9DA 4XK8F 1YUBA 4FWGA 3U6QA 2DENA 3MMPA 1V33A 3HX3A 3I4VA 4LF7M 1WJ7A 4KT0F 3GPYA 1VEGA 1GJSA 4CHTB 4AKIA 4DV7M 4L6V6 4GKKM 2C5RA 4LJ8A 3FTFA 4HLQA 3FYDA 1G3IA 1L2DA 2C96A 5EP2A 1DO0A 1MJGM 3CTWB 2D7HA 2KA6B 3NBIA 2QZ4A 2UXCM 1RU3A 4I8OA 3GLGB 4G4QA 3GPUA 1NV8A 3W0LB 2Z4SA 4S12A 4F1IA 3SMPA 2KXEA 3CF0A 3AV0A 1IN6A 1OIZA 4IIWA 2DHYA 3W0FA 4IBDA 4PDGA 4AI6A 3B7QA 1VEKA 3UGJA 3SYKA 1NVMA 4DR7M 5ITQA 1GO5A 1QUTA 3U6PA 3TWKA 2R65A 3FRIA 4QNMA 2DAGA 5IT9S 5ITYA 3K9OA 4BLCA 3U61A 4AKGA 1ZMWA 3GQ4A 2R4EA 2L4FA 1NY5A 1IY2A 1UM8A 1OJLA 1PGYA 3SMSA 2MR9A 2R44A 1PJJA 2DAIA 1D0KA 1QYRA 2QPAA 3M0EA 3HU1A 4JI3M 3R8FA 5IREB 3RE8A 3DZDA 3FUXA 4HEOA 1ORYB 3U6EA 1VEJA 3J81S 1E9RA 1L8QA 1QAQA 2KZSA 1WR1B 3FUUA 3LCVB 4MGYE 4L78A 4QOZC 2EKKA 4MH0E 2H5XA 4Z8XA 2M5ZA 1HNWM 2HAKA 2Y0TA 4Q7JA 8CATA 4TUWA 2UUCM 1V34A 2ZBKB 2RGOA 3KOXE 2FH0A 3TWMA 1EIJA 5LMUM 3A42A 2CFOA 1V92A 3IG5A 3V76A 2O01F 1IXSB 2XSZD 4NRWA 3D8LA 2R6FA 3EIEA 4LCBA 3OTOM 1HQCA 3R9XB 5A2QS 1R4GA 2BJWA 1TH4A 1YE9A 2LVQD 4GH9A 1DGGA 4JN6A 3U60B 2P5TA 3VLFB 2V1UA 4JV5M 2R46A 4B3RM 1G41A 2KW0A 1XB2B 1I4WA 3SYLA 3GLIE 1QZMA 3EIHA 1ZAEA 4M0DA 1DGHA 1NNUC 4QHTA 2WSFF 2OOBA 3L2AA 3GLFB 1NO1A 2ZAMA 3J27B 4MB7A 2Q2EB 3KP0E 4NSOB 3TE6A 2FOIC 3T15A 1PJIA 2DZNB 3UMMA 2DZOB 1QDRA 5ITTA 3K2LA 3C58A 1Z5AA 1W5SA 3MHVC 2OO9A 3LVVA 4MGZE 4JXJA 5IZ7D 5DNYA 2XGNA 2Z7JA 1IY0A 3E4RA 4PD2A 2Z3XA 3HWSA 1WGNA 4LJ5A 5EJCA 1Q39A 4UN2B 2DXIA 3VKGA 2R18A 2MGWA 1FNNA 5EP3A 2FNAA 3IHPA 3FTEA 2DZLA 1C1KA 1D0MA 2XH9A 1VQ1A 2ZAOA 1DGHB 4DV4M 4MGKE 1MU5A 1JR3D 1YSYA 3L26A 2UXDM 1Q3BA 1R5LA 2JUJA 3KP1E 5JI2E 3U5ZB 1CUKA 3E9SA 5EP4A 1NJGA 4GRIA 3SHGB 2LVNC 3RGSA 3L25A 2D7EA 4FCVA 2WZJA 1N32M 3IECA 2R62A 3THGA 2QP9X 3GLHB 2XZUA 4G6ZA 1IXZA
chains in the Genus database with same CATH topology
4JI5M 3GLIA 5DYGA 3HJQA 2VQEM 1E9SA 2R4JA 2F5NA 2CV0A 4AZFA 4PCZA 2F5OA 4FCWA 2OPFA 4R7GA 4MGIE 5EXPA 1N33M 1XMOM 5E6JA 4KLNA 4GC5A 4DR4M 4L4UA 1L2BA 3PVSA 4IBBA 1IBKM 1GL7A 2CE7A 2QBYB 1R7RA 1Z6TA 4B3MM 4CGYB 3TQSA 1QAMA 3KVWA 2OQ4A 3KFUG 2K47A 1IN8A 4AQYM 4JI0M 3A46A 2CHQA 5ITRA 4JI2M 1OFIA 2RGHA 4GITA 2I7PA 4P16A 3D8BA 2F5QA 3GLIB 3ZH9B 1NHGC 4IBKA 4D81A 3UJNA 2JA2A 3J2PB 3PNVA 1IN5A 4NSRA 4AW4A 5KQDA 1X37A 5BR8M 5BPVA 1J09A 1TDZA 1G8PA 3SARA 1DGFA 1QVRA 2Z4RA 5C1BA 2CV1A 4B3SM 4WURA 1WXQA 1IQPA 3FD9A 3I4YA 4DR2M 1N77A 2HKJA 3M6AA 3VFDA 4DV0M 4LF9M 4GIPA 5FTNA 3MJ5A 1HT2E 1E94E 3DFZA 4B3TM 1GVNA 4M0WA 2Y21A 3TWLA 1R2YA 2RKOA 2QCUA 4LZJA 3RGPA 2UXBM 3FUVA 3HHYA 3KOWE 1H6UA 1G59A 2DWLA 5LMNM 1XC8A 1JR3A 1PM5A 3QWLA 4X66M 4LJ6A 4DV6M 3A98B 4IBIA 2KRKA 3HHZA 2EUCA 2XFTA 5IWAM 5EQTA 4I81A 4LZZA 4GHAA 1QQWA 2ERCA 3GLHA 4LGYA 4NXNM 2L6OA 2D7GA 3K92A 3GPXA 1GLNA 2C9CA 3DA1A 4I4LA 3HHXA 1K82A 1SXJB 4CISA 5FTMA 3RFWA 3U6SA 1SXJC 3WHLA 1KSFX 3AJIB 2CUZA 4KO8A 2Y0QA 3HJSA 5FTLA 1XXHA 4YY3M 4LF4M 4W5WA 1DO2A 4GHLA 3GQ5A 4QHSA 1IBLM 3JAMS 4DR1M 3I51A 2C9OA 4II7A 1N36M 4B08A 4REZA 1HT1E 3PNYA 2DVWB 2F5SA 4B7FA 1NHWC 3SHFA 3T1HM 4JI1M 4LFAM 3LQQA 3U6OA 2XSZA 3VKHA 3U6MA 1SXJD 2V6ZM 2FFJA 2UUAM 3HU3A 3UK6A 4DV3M 1K3WA 3Q8XA 3AOEA 3KS8A 1VDDA 3KDSE 2LH0A 1QAOA 5KQ8A 3HHWA 1L1ZA 3KSJA 5ITUA 3AKZA 3U6LA 1IXZA 4M9XA 1IM2A 1G4AE 4PDIA 3LVWA 1XXHB 1OFHA 2LNHC 1NNJA 4LF5M 3KSXA 1IBMM 2XLJA 2UU9M 2HHHM 1ZQ9A 1TH2A 2DWZB 2YR0A 5E26A 3UZUA 1T3TA 2E5LM 2DWNA 3K1JA 4DR3M 4DV2M 2F5PA 2YNMD 1Z59A 3SASA 1FJGM 2HL7A 2V1CA 3B9PA 2EA0A 2C99A 2W82A 2VIIA 1TGUA 1K3XA 3PXGA 2FE8A 3LMMA 1QANA 4ITQA 2YQZA 4RF0A 2C98A 1XHBA 3ZCBB 4MGHA 1S3SA 2X8AA 2M60A 1W5TA 2YFQA 4BB9A 4LY6A 4IBEA 1J5EM 2G5GX 4G4NA 3KOYE 3GO8A 4XBOA 1NSFA 4IJFA 1IXRC 2KZUA 4LRTA 5GKNA 1E32A 2QENA 4ZPXA 3FTCA 3SAUA 1KFVA 4M9SA 4G4RA 4B7GA 3J80S 5FSWA 4LG2A 2UUBM 1N34M 4X62M 1GKIA 5ITXA 3LQRA 4I5SA 4EIWA 3VK8A 4D80A 4R3DA 4DR5M 4YHHM 2XF3A 4D82A 1IN4A 2HCBA 3L28A 3FUWA 4FWHA 4DUYM 2ZM6M 1TDHA 2ZANA 4GC9A 3WHKA 4JI8M 4L8RC 3GLGA 2O5RA 2DHRA 4PT5A 1XWIA 1IY1A 2QBYA 4NL4H 1R2ZA 4OX9M 1D2NA 4L15A 4OVZA 4FVMA 3BOSA 4L16A 3H4MA 3L29A 5EXTA 2XZFA 3JR5A 5EXXA 3L27A 4AG6A 2X4AA 5C18A 1TH3A 3AOEC 4WW0A 5KO3A 3HKPA 1L2CA 3A45A 2L7HA 2LWXA 3SFZA 3AL0C 2A5YB 2AHMA 2XEPA 3HJ8A 1XNRM 4MM3B 2L7IA 3VK7A 3QAUA 4OW0A 4A3VB 1MX0A 3GQ3A 5EP1A 1XMQM 4KHPM 4OU7A 2BNKA 4QNRA 4RF1A 3VDPA 2X49A 4K0KM 2EO2A 1KYIA 5ITXE 4QOSA 3VDUA 3NWLA 2L09A 4JI6M 5JI3E 4X65M 4FW9A 3U6CA 5DYIA 1HNXM 4GMQA 4OVZB 3AOGA 4LF6M 1SXJA 4DV5M 4FD2A 3SAVA 2I7NA 1LV7A 5FLXS 5KPTA 5H37D 1NJFA 2CEAA 2G8LA 3KOZE 1I94M 1IN7A 2J7NA 3IG8A 3GRVA 3KW6A 5FTKA 3MK6A 3TL4X 4JYAM 1L1TA 3GP1A 1DGBA 3GLFA 3AFHA 3PFIA 5FTJA 3GPPA 3DOAA 1HNZM 3T1YM 4BBAA 1Q3CA 5KPZA 3ILKA 2KEBA 3HGIA 3U6DA 4IBCA 3J7BA 3SATA 1XNQM 1HQYE 1Z5BA 1J7KA 4LFCM 3HU2A 3M7GA 4FWDA 4DUZM 5KPRA 3KXEC 1N78A 4XGIA 3SBJA 4LF8M 3U61B 2DWMA 3J7AS 4DR6M 3JR4A 2NQ8C 4JI4M 2H1RA 3T38A 2CV2A 5F3WA 2CHGA 2F4VM 4G4OA 4KODA 4NXMM 2R45A 3FUTA 4Z6YA 4AKHA 3ZC7B 1EE8A 1SXJE 2VQFM 4GKJM 3FTDA 2Y20A 4M9ZA 2XFSA 2KRUA 4LJAA 4NRVA 2LXEA 3CF2A 3SAWA 4HL4A 3TPZA 4JI7M 4LGMA 4LJ9A 1GL6A 3K8ZA 3U60A 3U5ZA 2CHVA 4AG5A 2J7OA 4RNAA 4DV1M 1HR0M 3KS4A 4FCTA 4LRSA 7CATA 3FKEA 5EXSA 1N75A 3GRRA 4IJEA 3GRUA 3SC3A 1JQJC 4LJ7A 3FYCA 4B7HA 1NY6A 4LFBM 4IBGA 4IBJA 4X64M 2BJVA 3CF6E 4IBFA 1Z5CA 4NOOB 4LJ4A 1R6BX 3U6QA 1YUBA 4FWGA 3I4VA 4LF7M 3GPYA 4CHTB 4AKIA 4DV7M 4GKKM 2C5RA 4LJ8A 3FTFA 4HLQA 3FYDA 1G3IA 1L2DA 2C96A 5EP2A 1DO0A 3CTWB 2D7HA 2KA6B 3NBIA 2QZ4A 2UXCM 4I8OA 4G4QA 3GLGB 3GPUA 3W0LB 2Z4SA 4S12A 3SMPA 2KXEA 3CF0A 3AV0A 1IN6A 4IIWA 3W0FA 4IBDA 4PDGA 4AI6A 3UGJA 3SYKA 1NVMA 4DR7M 5ITQA 3U6PA 3TWKA 2R65A 4QNMA 5IT9S 5ITYA 4BLCA 3U61A 4AKGA 3GQ4A 2R4EA 1NY5A 3SMSA 1IY2A 1UM8A 1OJLA 1PJJA 1QYRA 2QPAA 3M0EA 3HU1A 4JI3M 3R8FA 5IREB 3RE8A 3DZDA 3FUXA 3U6EA 1ORYB 3J81S 1E9RA 1L8QA 1QAQA 2KZSA 3FUUA 4MGYE 4L78A 4QOZC 4MH0E 4Z8XA 2M5ZA 1HNWM 2Y0TA 8CATA 4TUWA 2UUCM 2ZBKB 3KOXE 2RGOA 3TWMA 5LMUM 3A42A 2CFOA 3IG5A 1IXSB 2XSZD 4NRWA 3D8LA 3EIEA 4LCBA 3OTOM 1HQCA 3R9XB 5A2QS 2BJWA 1TH4A 1YE9A 4GH9A 1DGGA 4JN6A 3U60B 2P5TA 3VLFB 2V1UA 4JV5M 2R46A 4B3RM 1G41A 2KW0A 1I4WA 3SYLA 1QZMA 3EIHA 1ZAEA 4M0DA 1DGHA 1NNUC 4QHTA 3L2AA 3GLFB 2ZAMA 3J27B 4MB7A 2Q2EB 3KP0E 4NSOB 3TE6A 2FOIC 3T15A 1PJIA 2DZNB 3UMMA 2DZOB 5ITTA 3K2LA 3C58A 1Z5AA 1W5SA 3MHVC 3LVVA 4MGZE 4JXJA 5IZ7D 5DNYA 2XGNA 2Z7JA 1IY0A 3E4RA 4PD2A 2Z3XA 3HWSA 4LJ5A 5EJCA 1Q39A 2DXIA 3VKGA 2R18A 1FNNA 5EP3A 2FNAA 3FTEA 1C1KA 2XH9A 2ZAOA 1DGHB 4DV4M 4MGKE 1MU5A 1JR3D 1YSYA 3L26A 2UXDM 1Q3BA 3KP1E 5JI2E 3U5ZB 3E9SA 5EP4A 1NJGA 4GRIA 3SHGB 3RGSA 3L25A 2D7EA 4FCVA 1N32M 2R62A 3THGA 2QP9X 3GLHB 2XZUA 4G6ZA 3GRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QZ4 A;  3GLG B;  3GLI A;  5DYG A;  3UK6 A;  2Z4S A;  3CF0 A;  5JI3 E;  4FW9 A;  3KDS E;  5DYI A;  1IN6 A;  4FCW A;  1SXJ A;  4FD2 A;  3SYK A;  5EXP A;  1NVM A;  1IM2 A;  1G4A E;  4KLN A;  1XXH B;  1OFH A;  2R65 A;  1LV7 A;  4L4U A;  3PVS A;  4QNM A;  2CE7 A;  1NJF A;  2QBY B;  1R7R A;  2CEA A;  2DWZ B;  1IN7 A;  1NY5 A;  1IY2 A;  1UM8 A;  1OJL A;  3K1J A;  3KW6 A;  5FTK A;  1IN8 A;  3B9P A;  2QPA A;  3M0E A;  2C99 A;  3HU1 A;  2CHQ A;  2VII A;  3R8F A;  3DZD A;  1OFI A;  3PXG A;  4GIT A;  1L8Q A;  3D8B A;  3GLF A;  3GLI B;  3ZH9 B;  3PFI A;  5FTJ A;  2C98 A;  4D81 A;  1S3S A;  2X8A A;  1IN5 A;  1W5T A;  4Z8X A;  4LY6 A;  1X37 A;  1HQY E;  1J7K A;  1QVR A;  2Z4R A;  5C1B A;  3HU2 A;  4FWD A;  1IQP A;  1NSF A;  3M6A A;  3VFD A;  1IXR C;  4LRT A;  1IXS B;  3U61 B;  1E32 A;  2QEN A;  4ZPX A;  5FTN A;  2XSZ D;  1HT2 E;  3EIE A;  1E94 E;  4LCB A;  2CHG A;  4KOD A;  2RKO A;  1HQC A;  1SXJ E;  2BJW A;  1DO0 A;  4JN6 A;  4LJA A;  3U60 B;  1JR3 A;  3VLF B;  2V1U A;  4EIW A;  4D80 A;  1G41 A;  4LJ6 A;  3SYL A;  1QZM A;  3EIH A;  2KRK A;  3CF2 A;  1IN4 A;  4D82 A;  2HCB A;  4LGM A;  4LJ9 A;  4QHT A;  4I81 A;  4LZZ A;  5EQT A;  4FWH A;  3GLF B;  2ZAM A;  2CHV A;  3GLH A;  2ZAN A;  2DZN B;  3WHK A;  3GLG A;  2DZO B;  2DHR A;  1XWI A;  1IY1 A;  2QBY A;  2C9C A;  4FCT A;  4LRS A;  1W5S A;  3MHV C;  4I4L A;  5EXS A;  1D2N A;  4L15 A;  4L16 A;  3BOS A;  1SXJ B;  1IY0 A;  3H4M A;  5EXT A;  5FTM A;  3HWS A;  4LJ5 A;  5EXX A;  1SXJ C;  3WHL A;  1KSF X;  3AJI B;  4KO8 A;  1JQJ C;  4LJ7 A;  3SC3 A;  1FNN A;  5EP3 A;  1XXH A;  2FNA A;  5C18 A;  5FTL A;  1NY6 A;  4WW0 A;  1DO2 A;  1C1K A;  4QHS A;  2BJV A;  2ZAO A;  2C9O A;  4LJ4 A;  1R6B X;  1JR3 D;  4FWG A;  1HT1 E;  5JI2 E;  4A3V B;  2DVW B;  3U5Z B;  5EP1 A;  5EP4 A;  1NJG A;  4QNR A;  4FCV A;  4LJ8 A;  1G3I A;  2R62 A;  2QP9 X;  2C96 A;  2XSZ A;  3GLH B;  1SXJ D;  5EP2 A;  1KYI A;  2V6Z M;  4QOS A;  1IXZ A;  3HU3 A; 
#chains in the Genus database with same CATH topology
 2JNH A;  2LTU A;  4JI5 M;  3GLI A;  1HJP A;  5DYG A;  2KHH A;  3HJQ A;  2VQE M;  1AIP C;  2QHO B;  1E9S A;  2WSE F;  2R4J A;  2F5N A;  2CV0 A;  3I01 M;  4AZF A;  4PCZ A;  2DAE A;  4FCW A;  2OPF A;  2F5O A;  4R7G A;  1OAI A;  4MGI E;  2FS1 A;  2DNA A;  5EXP A;  3F92 A;  1N33 M;  2CP8 A;  5E6J A;  1XMO M;  1TTE A;  4KLN A;  3I04 M;  4GC5 A;  4DR4 M;  4L4U A;  1L2B A;  3PVS A;  4IBB A;  1IBK M;  1GL7 A;  2CE7 A;  2KNZ A;  2QBY B;  1R7R A;  1Z6T A;  1T6O A;  4B3M M;  4CGY B;  1UFZ A;  3TQS A;  2B3T A;  1QAM A;  2QNJ A;  3GLH E;  1OAO C;  4G3O A;  3KVW A;  2OQ4 A;  3KFU G;  2K47 A;  4Y28 F;  1IN8 A;  4AQY M;  4JI0 M;  3A46 A;  3HY5 A;  2CHQ A;  5ITR A;  4RKU F;  4JI2 M;  2MH8 A;  1OFI A;  2RGH A;  4GIT A;  2I7P A;  4P16 A;  3D8B A;  2F5Q A;  3GLI B;  3ZH9 B;  4WP2 A;  1NHG C;  4IBK A;  4D81 A;  3UJN A;  1WIV A;  2JA2 A;  1ZV1 A;  3J2P B;  1GJT A;  2LBC A;  3PNV A;  1IN5 A;  4NSR A;  1PJT A;  4AW4 A;  3CGW A;  1IXS A;  1X37 A;  2CWB A;  5KQD A;  5BR8 M;  5BPV A;  1J09 A;  1TDZ A;  1G8P A;  4GEW A;  3SAR A;  1DGF A;  1QVR A;  2Z4R A;  5C1B A;  2CV1 A;  4B3S M;  4WUR A;  1WXQ A;  1IQP A;  3FD9 A;  3I4Y A;  4DR2 M;  1N77 A;  2HKJ A;  3M6A A;  3VFD A;  4DV0 M;  4LF9 M;  4GIP A;  5FTN A;  3MJ5 A;  1HT2 E;  4R71 A;  1E94 E;  3DFZ A;  4B3T M;  1GVN A;  4M0W A;  2Y21 A;  3TWL A;  2DAK A;  1R2Y A;  2RKO A;  2QCU A;  4LZJ A;  3RGP A;  2UXB M;  3FUV A;  3HHY A;  3KOW E;  1H6U A;  1G59 A;  2DWL A;  3C9P A;  5LMN M;  1XC8 A;  1JR3 A;  1Q02 A;  3QWL A;  1PM5 A;  4X66 M;  1F4I A;  4LJ6 A;  2EKF A;  1MN3 A;  4DV6 M;  3A98 B;  4IBI A;  2KRK A;  2VF8 A;  2EUC A;  2XFT A;  3HHZ A;  5IWA M;  5EQT A;  4I81 A;  4LZZ A;  4GHA A;  2R0I A;  1QQW A;  2ERC A;  3GLH A;  4LGY A;  3W67 A;  4NXN M;  2L6O A;  1EFU B;  2D7G A;  1OQY A;  3K92 A;  3GPX A;  3FE3 A;  1GLN A;  2C9C A;  2O25 A;  3DA1 A;  4I4L A;  3HHX A;  1K82 A;  3E21 A;  1SXJ B;  4CIS A;  5FTM A;  3RFW A;  3U6S A;  2K0B X;  1SXJ C;  2KNA A;  1KSF X;  1ZMV A;  2CUZ A;  2GNO A;  2Y0Q A;  3AJI B;  3HJS A;  4KO8 A;  1XXH A;  2JXN A;  5FTL A;  4YY3 M;  4LF4 M;  3C3D A;  4W5W A;  1DO2 A;  1P3Q Q;  4GHL A;  3GQ5 A;  4QHS A;  1IBL M;  3JAM S;  3QYB A;  4DR1 M;  3I51 A;  2C9O A;  4II7 A;  4ANR A;  1N36 M;  2LVA A;  2L2D A;  4B08 A;  4REZ A;  1HT1 E;  3PNY A;  2DVW B;  2F5S A;  2GQF A;  4B7F A;  1NHW C;  2JY6 B;  3B7N A;  3SHF A;  3T1H M;  1C7Y A;  4JI1 M;  4LFA M;  3LQQ A;  3U6O A;  2XSZ A;  1DV0 A;  3U6M A;  1SXJ D;  3VKH A;  2FFJ A;  2V6Z M;  2UUA M;  3HU3 A;  3UK6 A;  4DV3 M;  1K3W A;  3Q8X A;  3C3E A;  2J5Y A;  3AOE A;  3KS8 A;  1VDD A;  3KDS E;  1TR8 A;  2LH0 A;  1QAO A;  2WSC F;  5KQ8 A;  3HHW A;  1L1Z A;  3KSJ A;  5ITU A;  3H4J A;  3AKZ A;  3U6L A;  4M9X A;  5DFL A;  1IM2 A;  1G4A E;  4PDI A;  3LVW A;  1XXH B;  1OFH A;  2LNH C;  1NNJ A;  1QDT A;  3KSX A;  1IBM M;  2XLJ A;  2UU9 M;  2HHH M;  1ZQ9 A;  1TH2 A;  2DWZ B;  2YR0 A;  5E26 A;  3UZU A;  1T3T A;  2E5L M;  4CIZ A;  2DWN A;  3K1J A;  4DR3 M;  4DV2 M;  1VG5 A;  2F5P A;  2YNM D;  1Z59 A;  3GLG E;  3SAS A;  2RRU A;  2HL7 A;  2V1C A;  3B9P A;  2EA0 A;  1FJG M;  2C99 A;  2JZ0 A;  2W82 A;  1PRB A;  2VII A;  4P17 A;  1TGU A;  1K3X A;  3PXG A;  2FE8 A;  1VDL A;  1PJQ A;  3LMM A;  1QAN A;  4ITQ A;  2YQZ A;  4RF0 A;  2C98 A;  1XHB A;  3ZCB B;  3Q8G A;  4MGH A;  1S3S A;  2X8A A;  2M60 A;  1W5T A;  2YFQ A;  3BXW A;  4BB9 A;  4LY6 A;  4IBE A;  1J5E M;  2G5G X;  2K6B A;  2MJ5 B;  4G4N A;  1SG9 A;  2OOA A;  3KOY E;  3E46 A;  3GO8 A;  4NC6 A;  4XBO A;  1PJS A;  1OKS A;  1T43 A;  1QZE A;  1NSF A;  4IJF A;  1IXR C;  2KZU A;  4LRT A;  5GKN A;  1E32 A;  2QEN A;  4ZPX A;  3FTC A;  4DBG B;  3SAU A;  1KFV A;  1Y8G A;  4M9S A;  1LTM A;  4G4R A;  4B7G A;  2JP7 A;  3J80 S;  3K9P A;  5FSW A;  4LG2 A;  2UUB M;  1N34 M;  4X62 M;  1GKI A;  5ITX A;  3LQR A;  4I5S A;  4EIW A;  2JY5 A;  4D80 A;  3VK8 A;  4R3D A;  4DR5 M;  4YHH M;  2XF3 A;  3ZQJ A;  4D82 A;  1IN4 A;  2HCB A;  1JR3 E;  3L28 A;  3FUW A;  4FWH A;  4DUY M;  2ZM6 M;  2DKL A;  1TDH A;  1G71 A;  2ZAN A;  4GC9 A;  3WHK A;  4JI8 M;  4L8R C;  3GLG A;  2O5R A;  2DHR A;  4PT5 A;  1XWI A;  1IY1 A;  2QBY A;  4NL4 H;  4LF5 M;  1R2Z A;  3B89 A;  1D2N A;  3HZJ A;  4L15 A;  4OVZ A;  4OX9 M;  4FVM A;  3BOS A;  4L16 A;  3H4M A;  3L29 A;  5EXT A;  3T6P A;  2XZF A;  3JR5 A;  5EXX A;  2LVP C;  2BWB A;  3BBZ A;  3L27 A;  4AG6 A;  2X4A A;  5C18 A;  1TH3 A;  3AOE C;  4WW0 A;  5KO3 A;  3HKP A;  1L2C A;  3A45 A;  1XXH E;  2JY7 A;  3GLF E;  2L7H A;  2LWX A;  3SFZ A;  1WGL A;  2A5Y B;  3AL0 C;  2AHM A;  2XEP A;  1OTR A;  3B74 A;  2QSF X;  1GAB A;  3HJ8 A;  1XNR M;  4MM3 B;  2L7I A;  3VK7 A;  3QAU A;  4OW0 A;  4A3V B;  1MX0 A;  3GQ3 A;  3NBX X;  5EP1 A;  1XMQ M;  4KHP M;  4OU7 A;  2BNK A;  4QNR A;  4RF1 A;  3VDP A;  2X49 A;  3LCU A;  4K0K M;  2ZTD A;  2EO2 A;  2L4E A;  2LHG A;  1KYI A;  5ITX E;  4QOS A;  5L8R F;  3VDU A;  3NWL A;  2KNV A;  2L09 A;  4JI6 M;  5JI3 E;  4X65 M;  4FW9 A;  3U6C A;  5DYI A;  1HNX M;  4GMQ A;  4OVZ B;  3AOG A;  4LF6 M;  1SXJ A;  4DV5 M;  4FD2 A;  3SAV A;  1YLA A;  2G3Q A;  3LW5 F;  2I7N A;  1LV7 A;  1ZMU A;  5FLX S;  5KPT A;  1IFY A;  5H37 D;  1NJF A;  2G8L A;  1OIP A;  2CEA A;  3KOZ E;  1I94 M;  1IN7 A;  1NV9 A;  2J7N A;  3IG8 A;  3GRV A;  3KW6 A;  5FTK A;  2QQ8 A;  3MK6 A;  3TL4 X;  2MRO B;  4JYA M;  2Z8Y M;  1L1T A;  3GP1 A;  1JB0 F;  1DGB A;  2JWS A;  2LVO C;  3GLF A;  2VF7 A;  3AFH A;  3PFI A;  5FTJ A;  3GPP A;  3DOA A;  1HNZ M;  3T1Y M;  4BBA A;  1Q3C A;  2ZTC A;  5KPZ A;  3ILK A;  2KEB A;  3HGI A;  4F2L A;  3U6D A;  4IBC A;  3GRY A;  3B7Z A;  3J7B A;  3SAT A;  1HQY E;  1XNQ M;  3W68 A;  1Z5B A;  1J7K A;  1BVS A;  4LFC M;  3HU2 A;  3M7G A;  4FWD A;  4DUZ M;  5KPR A;  3KXE C;  1N78 A;  2EJS A;  4XGI A;  3SBJ A;  4LF8 M;  3U61 B;  1AUA A;  2DWM A;  3J7A S;  4DR6 M;  3JR4 A;  1TF0 B;  2APL A;  2NQ8 C;  3WHL A;  4JI4 M;  2H1R A;  3T38 A;  2CV2 A;  5F3W A;  2CHG A;  2F4V M;  4G4O A;  4KOD A;  4NXM M;  2VDB B;  2BWE A;  2R45 A;  3FUT A;  4Z6Y A;  3ZC7 B;  1EE8 A;  1SXJ E;  2VQF M;  4GKJ M;  4AKH A;  3FTD A;  2Y20 A;  4M9Z A;  2XFS A;  2KRU A;  4LJA A;  4NRV A;  2LXE A;  2JZ1 A;  3CF2 A;  3SAW A;  4HL4 A;  3TPZ A;  2KDL A;  4JI7 M;  2DAM A;  4LGM A;  4LJ9 A;  1GL6 A;  2JY8 A;  3K8Z A;  3U60 A;  3U5Z A;  2LHC A;  2CHV A;  4AG5 A;  4CJ6 A;  1QUS A;  2J7O A;  3QYE A;  4RNA A;  4DV1 M;  1HR0 M;  2DI0 A;  3KS4 A;  4FCT A;  4LRS A;  7CAT A;  1WHC A;  3FKE A;  5EXS A;  1N75 A;  2HWJ A;  3GRR A;  4IJE A;  1A5T A;  3GRU A;  3SC3 A;  1JQJ C;  4LJ7 A;  2N35 A;  3FYC A;  4B7H A;  1NY6 A;  4LFB M;  4IBG A;  4IBJ A;  4X64 M;  1D0L A;  2CRU A;  3FRH A;  2BJV A;  3CF6 E;  4IBF A;  1Z5C A;  4NOO B;  4LJ4 A;  1R6B X;  2K9D A;  4XK8 F;  1YUB A;  4FWG A;  3U6Q A;  2DEN A;  3MMP A;  1V33 A;  3HX3 A;  3I4V A;  4LF7 M;  1WJ7 A;  4KT0 F;  3GPY A;  1VEG A;  1GJS A;  4CHT B;  4AKI A;  4DV7 M;  4L6V 6;  4GKK M;  2C5R A;  4LJ8 A;  3FTF A;  4HLQ A;  3FYD A;  1G3I A;  1L2D A;  2C96 A;  5EP2 A;  1DO0 A;  1MJG M;  3CTW B;  2D7H A;  2KA6 B;  3NBI A;  2QZ4 A;  2UXC M;  1RU3 A;  4I8O A;  3GLG B;  4G4Q A;  3GPU A;  1NV8 A;  3W0L B;  2Z4S A;  4S12 A;  4F1I A;  3SMP A;  2KXE A;  3CF0 A;  3AV0 A;  1IN6 A;  1OIZ A;  4IIW A;  2DHY A;  3W0F A;  4IBD A;  4PDG A;  4AI6 A;  3B7Q A;  1VEK A;  3UGJ A;  3SYK A;  1NVM A;  4DR7 M;  5ITQ A;  1GO5 A;  1QUT A;  3U6P A;  3TWK A;  2R65 A;  3FRI A;  4QNM A;  2DAG A;  5IT9 S;  5ITY A;  3K9O A;  4BLC A;  3U61 A;  4AKG A;  1ZMW A;  3GQ4 A;  2R4E A;  2L4F A;  1NY5 A;  1IY2 A;  1UM8 A;  1OJL A;  1PGY A;  3SMS A;  2MR9 A;  2R44 A;  1PJJ A;  2DAI A;  1D0K A;  1QYR A;  2QPA A;  3M0E A;  3HU1 A;  4JI3 M;  3R8F A;  5IRE B;  3RE8 A;  3DZD A;  3FUX A;  4HEO A;  1ORY B;  3U6E A;  1VEJ A;  3J81 S;  1E9R A;  1L8Q A;  1QAQ A;  2KZS A;  1WR1 B;  3FUU A;  3LCV B;  4MGY E;  4L78 A;  4QOZ C;  2EKK A;  4MH0 E;  2H5X A;  4Z8X A;  2M5Z A;  1HNW M;  2HAK A;  2Y0T A;  4Q7J A;  8CAT A;  4TUW A;  2UUC M;  1V34 A;  2ZBK B;  2RGO A;  3KOX E;  2FH0 A;  3TWM A;  1EIJ A;  5LMU M;  3A42 A;  2CFO A;  1V92 A;  3IG5 A;  3V76 A;  2O01 F;  1IXS B;  2XSZ D;  4NRW A;  3D8L A;  2R6F A;  3EIE A;  4LCB A;  3OTO M;  1HQC A;  3R9X B;  5A2Q S;  1R4G A;  2BJW A;  1TH4 A;  1YE9 A;  2LVQ D;  4GH9 A;  1DGG A;  4JN6 A;  3U60 B;  2P5T A;  3VLF B;  2V1U A;  4JV5 M;  2R46 A;  4B3R M;  1G41 A;  2KW0 A;  1XB2 B;  1I4W A;  3SYL A;  3GLI E;  1QZM A;  3EIH A;  1ZAE A;  4M0D A;  1DGH A;  1NNU C;  4QHT A;  2WSF F;  2OOB A;  3L2A A;  3GLF B;  1NO1 A;  2ZAM A;  3J27 B;  4MB7 A;  2Q2E B;  3KP0 E;  4NSO B;  3TE6 A;  2FOI C;  3T15 A;  1PJI A;  2DZN B;  3UMM A;  2DZO B;  1QDR A;  5ITT A;  3K2L A;  3C58 A;  1Z5A A;  1W5S A;  3MHV C;  2OO9 A;  3LVV A;  4MGZ E;  4JXJ A;  5IZ7 D;  5DNY A;  2XGN A;  2Z7J A;  1IY0 A;  3E4R A;  4PD2 A;  2Z3X A;  3HWS A;  1WGN A;  4LJ5 A;  5EJC A;  1Q39 A;  4UN2 B;  2DXI A;  3VKG A;  2R18 A;  2MGW A;  1FNN A;  5EP3 A;  2FNA A;  3IHP A;  3FTE A;  2DZL A;  1C1K A;  1D0M A;  2XH9 A;  1VQ1 A;  2ZAO A;  1DGH B;  4DV4 M;  4MGK E;  1MU5 A;  1JR3 D;  1YSY A;  3L26 A;  2UXD M;  1Q3B A;  1R5L A;  2JUJ A;  3KP1 E;  5JI2 E;  3U5Z B;  1CUK A;  3E9S A;  5EP4 A;  1NJG A;  4GRI A;  3SHG B;  2LVN C;  3RGS A;  3L25 A;  2D7E A;  4FCV A;  2WZJ A;  1N32 M;  3IEC A;  2R62 A;  3THG A;  2QP9 X;  3GLH B;  2XZU A;  4G6Z A;  1IXZ A; 
#chains in the Genus database with same CATH homology
 4JI5 M;  3GLI A;  5DYG A;  3HJQ A;  2VQE M;  1E9S A;  2R4J A;  2F5N A;  2CV0 A;  4AZF A;  4PCZ A;  2F5O A;  4FCW A;  2OPF A;  4R7G A;  4MGI E;  5EXP A;  1N33 M;  1XMO M;  5E6J A;  4KLN A;  4GC5 A;  4DR4 M;  4L4U A;  1L2B A;  3PVS A;  4IBB A;  1IBK M;  1GL7 A;  2CE7 A;  2QBY B;  1R7R A;  1Z6T A;  4B3M M;  4CGY B;  3TQS A;  1QAM A;  3KVW A;  2OQ4 A;  3KFU G;  2K47 A;  1IN8 A;  4AQY M;  4JI0 M;  3A46 A;  2CHQ A;  5ITR A;  4JI2 M;  1OFI A;  2RGH A;  4GIT A;  2I7P A;  4P16 A;  3D8B A;  2F5Q A;  3GLI B;  3ZH9 B;  1NHG C;  4IBK A;  4D81 A;  3UJN A;  2JA2 A;  3J2P B;  3PNV A;  1IN5 A;  4NSR A;  4AW4 A;  5KQD A;  1X37 A;  5BR8 M;  5BPV A;  1J09 A;  1TDZ A;  1G8P A;  3SAR A;  1DGF A;  1QVR A;  2Z4R A;  5C1B A;  2CV1 A;  4B3S M;  4WUR A;  1WXQ A;  1IQP A;  3FD9 A;  3I4Y A;  4DR2 M;  1N77 A;  2HKJ A;  3M6A A;  3VFD A;  4DV0 M;  4LF9 M;  4GIP A;  5FTN A;  3MJ5 A;  1HT2 E;  1E94 E;  3DFZ A;  4B3T M;  1GVN A;  4M0W A;  2Y21 A;  3TWL A;  1R2Y A;  2RKO A;  2QCU A;  4LZJ A;  3RGP A;  2UXB M;  3FUV A;  3HHY A;  3KOW E;  1H6U A;  1G59 A;  2DWL A;  5LMN M;  1XC8 A;  1JR3 A;  1PM5 A;  3QWL A;  4X66 M;  4LJ6 A;  4DV6 M;  3A98 B;  4IBI A;  2KRK A;  3HHZ A;  2EUC A;  2XFT A;  5IWA M;  5EQT A;  4I81 A;  4LZZ A;  4GHA A;  1QQW A;  2ERC A;  3GLH A;  4LGY A;  4NXN M;  2L6O A;  2D7G A;  3K92 A;  3GPX A;  1GLN A;  2C9C A;  3DA1 A;  4I4L A;  3HHX A;  1K82 A;  1SXJ B;  4CIS A;  5FTM A;  3RFW A;  3U6S A;  1SXJ C;  3WHL A;  1KSF X;  3AJI B;  2CUZ A;  4KO8 A;  2Y0Q A;  3HJS A;  5FTL A;  1XXH A;  4YY3 M;  4LF4 M;  4W5W A;  1DO2 A;  4GHL A;  3GQ5 A;  4QHS A;  1IBL M;  3JAM S;  4DR1 M;  3I51 A;  2C9O A;  4II7 A;  1N36 M;  4B08 A;  4REZ A;  1HT1 E;  3PNY A;  2DVW B;  2F5S A;  4B7F A;  1NHW C;  3SHF A;  3T1H M;  4JI1 M;  4LFA M;  3LQQ A;  3U6O A;  2XSZ A;  3VKH A;  3U6M A;  1SXJ D;  2V6Z M;  2FFJ A;  2UUA M;  3HU3 A;  3UK6 A;  4DV3 M;  1K3W A;  3Q8X A;  3AOE A;  3KS8 A;  1VDD A;  3KDS E;  2LH0 A;  1QAO A;  5KQ8 A;  3HHW A;  1L1Z A;  3KSJ A;  5ITU A;  3AKZ A;  3U6L A;  1IXZ A;  4M9X A;  1IM2 A;  1G4A E;  4PDI A;  3LVW A;  1XXH B;  1OFH A;  2LNH C;  1NNJ A;  4LF5 M;  3KSX A;  1IBM M;  2XLJ A;  2UU9 M;  2HHH M;  1ZQ9 A;  1TH2 A;  2DWZ B;  2YR0 A;  5E26 A;  3UZU A;  1T3T A;  2E5L M;  2DWN A;  3K1J A;  4DR3 M;  4DV2 M;  2F5P A;  2YNM D;  1Z59 A;  3SAS A;  1FJG M;  2HL7 A;  2V1C A;  3B9P A;  2EA0 A;  2C99 A;  2W82 A;  2VII A;  1TGU A;  1K3X A;  3PXG A;  2FE8 A;  3LMM A;  1QAN A;  4ITQ A;  2YQZ A;  4RF0 A;  2C98 A;  1XHB A;  3ZCB B;  4MGH A;  1S3S A;  2X8A A;  2M60 A;  1W5T A;  2YFQ A;  4BB9 A;  4LY6 A;  4IBE A;  1J5E M;  2G5G X;  4G4N A;  3KOY E;  3GO8 A;  4XBO A;  1NSF A;  4IJF A;  1IXR C;  2KZU A;  4LRT A;  5GKN A;  1E32 A;  2QEN A;  4ZPX A;  3FTC A;  3SAU A;  1KFV A;  4M9S A;  4G4R A;  4B7G A;  3J80 S;  5FSW A;  4LG2 A;  2UUB M;  1N34 M;  4X62 M;  1GKI A;  5ITX A;  3LQR A;  4I5S A;  4EIW A;  3VK8 A;  4D80 A;  4R3D A;  4DR5 M;  4YHH M;  2XF3 A;  4D82 A;  1IN4 A;  2HCB A;  3L28 A;  3FUW A;  4FWH A;  4DUY M;  2ZM6 M;  1TDH A;  2ZAN A;  4GC9 A;  3WHK A;  4JI8 M;  4L8R C;  3GLG A;  2O5R A;  2DHR A;  4PT5 A;  1XWI A;  1IY1 A;  2QBY A;  4NL4 H;  1R2Z A;  4OX9 M;  1D2N A;  4L15 A;  4OVZ A;  4FVM A;  3BOS A;  4L16 A;  3H4M A;  3L29 A;  5EXT A;  2XZF A;  3JR5 A;  5EXX A;  3L27 A;  4AG6 A;  2X4A A;  5C18 A;  1TH3 A;  3AOE C;  4WW0 A;  5KO3 A;  3HKP A;  1L2C A;  3A45 A;  2L7H A;  2LWX A;  3SFZ A;  3AL0 C;  2A5Y B;  2AHM A;  2XEP A;  3HJ8 A;  1XNR M;  4MM3 B;  2L7I A;  3VK7 A;  3QAU A;  4OW0 A;  4A3V B;  1MX0 A;  3GQ3 A;  5EP1 A;  1XMQ M;  4KHP M;  4OU7 A;  2BNK A;  4QNR A;  4RF1 A;  3VDP A;  2X49 A;  4K0K M;  2EO2 A;  1KYI A;  5ITX E;  4QOS A;  3VDU A;  3NWL A;  2L09 A;  4JI6 M;  5JI3 E;  4X65 M;  4FW9 A;  3U6C A;  5DYI A;  1HNX M;  4GMQ A;  4OVZ B;  3AOG A;  4LF6 M;  1SXJ A;  4DV5 M;  4FD2 A;  3SAV A;  2I7N A;  1LV7 A;  5FLX S;  5KPT A;  5H37 D;  1NJF A;  2CEA A;  2G8L A;  3KOZ E;  1I94 M;  1IN7 A;  2J7N A;  3IG8 A;  3GRV A;  3KW6 A;  5FTK A;  3MK6 A;  3TL4 X;  4JYA M;  1L1T A;  3GP1 A;  1DGB A;  3GLF A;  3AFH A;  3PFI A;  5FTJ A;  3GPP A;  3DOA A;  1HNZ M;  3T1Y M;  4BBA A;  1Q3C A;  5KPZ A;  3ILK A;  2KEB A;  3HGI A;  3U6D A;  4IBC A;  3J7B A;  3SAT A;  1XNQ M;  1HQY E;  1Z5B A;  1J7K A;  4LFC M;  3HU2 A;  3M7G A;  4FWD A;  4DUZ M;  5KPR A;  3KXE C;  1N78 A;  4XGI A;  3SBJ A;  4LF8 M;  3U61 B;  2DWM A;  3J7A S;  4DR6 M;  3JR4 A;  2NQ8 C;  4JI4 M;  2H1R A;  3T38 A;  2CV2 A;  5F3W A;  2CHG A;  2F4V M;  4G4O A;  4KOD A;  4NXM M;  2R45 A;  3FUT A;  4Z6Y A;  4AKH A;  3ZC7 B;  1EE8 A;  1SXJ E;  2VQF M;  4GKJ M;  3FTD A;  2Y20 A;  4M9Z A;  2XFS A;  2KRU A;  4LJA A;  4NRV A;  2LXE A;  3CF2 A;  3SAW A;  4HL4 A;  3TPZ A;  4JI7 M;  4LGM A;  4LJ9 A;  1GL6 A;  3K8Z A;  3U60 A;  3U5Z A;  2CHV A;  4AG5 A;  2J7O A;  4RNA A;  4DV1 M;  1HR0 M;  3KS4 A;  4FCT A;  4LRS A;  7CAT A;  3FKE A;  5EXS A;  1N75 A;  3GRR A;  4IJE A;  3GRU A;  3SC3 A;  1JQJ C;  4LJ7 A;  3FYC A;  4B7H A;  1NY6 A;  4LFB M;  4IBG A;  4IBJ A;  4X64 M;  2BJV A;  3CF6 E;  4IBF A;  1Z5C A;  4NOO B;  4LJ4 A;  1R6B X;  3U6Q A;  1YUB A;  4FWG A;  3I4V A;  4LF7 M;  3GPY A;  4CHT B;  4AKI A;  4DV7 M;  4GKK M;  2C5R A;  4LJ8 A;  3FTF A;  4HLQ A;  3FYD A;  1G3I A;  1L2D A;  2C96 A;  5EP2 A;  1DO0 A;  3CTW B;  2D7H A;  2KA6 B;  3NBI A;  2QZ4 A;  2UXC M;  4I8O A;  4G4Q A;  3GLG B;  3GPU A;  3W0L B;  2Z4S A;  4S12 A;  3SMP A;  2KXE A;  3CF0 A;  3AV0 A;  1IN6 A;  4IIW A;  3W0F A;  4IBD A;  4PDG A;  4AI6 A;  3UGJ A;  3SYK A;  1NVM A;  4DR7 M;  5ITQ A;  3U6P A;  3TWK A;  2R65 A;  4QNM A;  5IT9 S;  5ITY A;  4BLC A;  3U61 A;  4AKG A;  3GQ4 A;  2R4E A;  1NY5 A;  3SMS A;  1IY2 A;  1UM8 A;  1OJL A;  1PJJ A;  1QYR A;  2QPA A;  3M0E A;  3HU1 A;  4JI3 M;  3R8F A;  5IRE B;  3RE8 A;  3DZD A;  3FUX A;  3U6E A;  1ORY B;  3J81 S;  1E9R A;  1L8Q A;  1QAQ A;  2KZS A;  3FUU A;  4MGY E;  4L78 A;  4QOZ C;  4MH0 E;  4Z8X A;  2M5Z A;  1HNW M;  2Y0T A;  8CAT A;  4TUW A;  2UUC M;  2ZBK B;  3KOX E;  2RGO A;  3TWM A;  5LMU M;  3A42 A;  2CFO A;  3IG5 A;  1IXS B;  2XSZ D;  4NRW A;  3D8L A;  3EIE A;  4LCB A;  3OTO M;  1HQC A;  3R9X B;  5A2Q S;  2BJW A;  1TH4 A;  1YE9 A;  4GH9 A;  1DGG A;  4JN6 A;  3U60 B;  2P5T A;  3VLF B;  2V1U A;  4JV5 M;  2R46 A;  4B3R M;  1G41 A;  2KW0 A;  1I4W A;  3SYL A;  1QZM A;  3EIH A;  1ZAE A;  4M0D A;  1DGH A;  1NNU C;  4QHT A;  3L2A A;  3GLF B;  2ZAM A;  3J27 B;  4MB7 A;  2Q2E B;  3KP0 E;  4NSO B;  3TE6 A;  2FOI C;  3T15 A;  1PJI A;  2DZN B;  3UMM A;  2DZO B;  5ITT A;  3K2L A;  3C58 A;  1Z5A A;  1W5S A;  3MHV C;  3LVV A;  4MGZ E;  4JXJ A;  5IZ7 D;  5DNY A;  2XGN A;  2Z7J A;  1IY0 A;  3E4R A;  4PD2 A;  2Z3X A;  3HWS A;  4LJ5 A;  5EJC A;  1Q39 A;  2DXI A;  3VKG A;  2R18 A;  1FNN A;  5EP3 A;  2FNA A;  3FTE A;  1C1K A;  2XH9 A;  2ZAO A;  1DGH B;  4DV4 M;  4MGK E;  1MU5 A;  1JR3 D;  1YSY A;  3L26 A;  2UXD M;  1Q3B A;  3KP1 E;  5JI2 E;  3U5Z B;  3E9S A;  5EP4 A;  1NJG A;  4GRI A;  3SHG B;  3RGS A;  3L25 A;  2D7E A;  4FCV A;  1N32 M;  2R62 A;  3THG A;  2QP9 X;  3GLH B;  2XZU A;  4G6Z A;  3GRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...