1X37A

Structure of bacillus subtilis lon protease ssd domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
AGYTEIEKLEIVKDHLLPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAAICRKAAKAIVAEERKRITVTEKNLQDFIGKRIFRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP-dependent protease La 1
publication title Structural basis and DNA binding property of SSD domain of Bacillus subtilis Lon protease
rcsb
source organism Bacillus subtilis
total genus 20
structure length 95
sequence length 95
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1x37A00
2QBYB 1IXRC 4LCBA 4QOSA 1IXSB 1NY6A 4LRSA 2QZ4A 1L8QA 1NJGA 4Z8XA 3GLFA 4LGMA 1QZMA 2Z4RA 3GLHB 4JN6A 1DO0A 4LJ7A 3SYKA 5EP2A 4D80A 1KYIA 2CHVA 1DO2A 2C9CA 4QHTA 4QNRA 1IN6A 1NSFA 5EXPA 2QP9X 4D82A 4D81A 3D8BA 2XSZA 4I4LA 1XXHA 3CF0A 5EXSA 2R62A 2DZOB 5FTKA 1SXJA 1IN4A 2C9OA 3VFDA 3GLFB 2CEAA 3B9PA 3MHVC 3KW6A 5EXTA 5FTMA 3PXGA 1J7KA 1IM2A 2DVWB 1JR3D 1XXHB 1G3IA 3EIEA 1SXJC 1OJLA 2C99A 3GLGB 1D2NA 1HT2E 1R7RA 5EP1A 4FWHA 4QNMA 5EP4A 4LJ5A 3R8FA 1OFHA 5DYIA 3GLIA 3UK6A 2DZNB 2CHQA 4KODA 3K1JA 1E32A 2QPAA 1HT1E 2DWZB 2KRKA 1KSFX 2CHGA 1QVRA 3EIHA 3HU1A 3SYLA 1HQCA 4LRTA 1IXZA 4LJ4A 5FTJA 3WHKA 3BOSA 5EQTA 1G41A 5EXXA 4L16A 1S3SA 4L15A 3ZH9B 4EIWA 3H4MA 4LZZA 1NY5A 4LY6A 4KLNA 1NJFA 2Z4SA 1X37A 2VIIA 2ZAMA 2CE7A 5DYGA 2X8AA 1IY2A 1FNNA 1SXJE 4L4UA 4A3VB 4FCTA 4FWGA 3U60B 5C18A 4WW0A 1SXJB 2RKOA 1IY0A 2BJVA 1IN8A 3GLHA 2ZANA 3M6AA 2C96A 5JI2E 4FCVA 2XSZD 3VLFB 1IN5A 1JQJC 2R65A 1NVMA 3AJIB 4ZPXA 5C1BA 5JI3E 2V1UA 1UM8A 2ZAOA 1XWIA 3U5ZB 1SXJD 3CF2A 3SC3A 3WHLA 3PFIA 1HQYE 1IQPA 2HCBA 1C1KA 4LJ8A 3HU3A 3HU2A 3PVSA 5FTLA 3U61B 1JR3A 2QBYA 1G4AE 1E94E 1R6BX 4LJ6A 3M0EA 2C98A 4QHSA 1IN7A 1IY1A 3GLIB 1OFIA 5FTNA 4FWDA 4FW9A 2BJWA 1W5SA 2DHRA 4GITA 3DZDA 4LJ9A 4FD2A 1W5TA 4FCWA 4LJAA 1LV7A 4KO8A 3GLGA 3HWSA 4I81A 3KDSE 5EP3A 2FNAA 2QENA 2V6ZM
chains in the Genus database with same CATH superfamily
1WHCA 4DV5M 2JXNA 2L4EA 2QBYB 1SG9A 3L25A 2JZ1A 4GC5A 4G4OA 1IXSB 2R18A 4IBJA 1QZEA 4NRWA 4DR1M 2FH0A 3LVVA 2EKKA 1VDLA 1NJGA 2H5XA 2XFTA 2DENA 4Z8XA 3GLFA 1QZMA 2Z4RA 2I7NA 3GLHB 3LW5F 2RRUA 2DHYA 4GMQA 2JY5A 3MMPA 4NSRA 3R9XB 1OAOC 5EP2A 4QNRA 4D82A 2OPFA 1IN6A 2L7IA 1VEGA 2XSZA 4MB7A 4MH0E 1PGYA 4NL4H 3K92A 2KXEA 2OOAA 5ITQA 1SXJA 4B3RM 3ILKA 5IT9S 1DGGA 1VG5A 3VFDA 1WJ7A 3HHWA 1OKSA 2KZUA 4JI1M 3GQ3A 1TDZA 4AKHA 2KDLA 3IG5A 5IREB 4MGHA 3T15A 4QNMA 4G4RA 3R8FA 3U6PA 4S12A 2R4JA 3B74A 5EP3A 1DV0A 2DAEA 1GL6A 2BWEA 3NWLA 2DZNB 3UK6A 2CHQA 3U6SA 1K3XA 5ITTA 3RGPA 2KRKA 2Y0TA 4PDIA 1V34A 2ZTCA 4XBOA 3EIHA 3SHGB 3FYCA 3SYLA 4DBGB 5BR8M 2KRUA 1IXZA 2JZ0A 4LJ4A 3GO8A 4DV0M 3U6MA 2XH9A 4JV5M 1QUSA 3KVWA 2ERCA 4KHPM 3U5ZA 3FUWA 3SMSA 2DWMA 4L15A 1S3SA 3FUXA 4JI0M 4IJEA 3HZJA 1G59A 3KOYE 2KNAA 1XB2B 2O5RA 1X37A 2VIIA 2OQ4A 3C58A 2ZAMA 3VKGA 3LMMA 2D7HA 1QAMA 2KZSA 5DYGA 3HHZA 4JI4M 1IY2A 1DGFA 1FNNA 4PCZA 3I4VA 4FCTA 3FUUA 3W67A 1N75A 1PRBA 3KOXE 2RKOA 2BJVA 4P17A 5JI2E 4LF9M 1N33M 3FTCA 3C3EA 3HKPA 1IN5A 1JQJC 4NXMM 5C1BA 4M0DA 2UUCM 3KS8A 2W82A 2LHCA 4OX9M 2VDBB 3CF2A 2FOIC 1QAOA 1TH2A 5F3WA 4OVZB 3NBXX 3A45A 3T6PA 2R0IA 2KEBA 3VK7A 4G4QA 1JB0F 4LJ8A 3U61B 2LBCA 1K82A 1R2YA 4MGIE 1Z5BA 1E94E 2L6OA 4QHSA 2C98A 2LWXA 1IN7A 2Z8YM 1IY1A 1R5LA 3LCVB 1OFIA 3SMPA 4FW9A 3KSJA 1L1ZA 2MROB 1VDDA 2UXDM 1WR1B 1DGBA 2DHRA 2K6BA 4LJ9A 1Z5CA 4M9SA 2F5OA 2XGNA 4G3OA 4HL4A 2YQZA 3SASA 1HNXM 3TE6A 3TQSA 2FNAA 5KQDA 1JR3E 5EJCA 3I51A 4X64M 2J5YA 4LFBM 1Q02A 3AOGA 3HHXA 4LCBA 2ZTDA 3L2AA 2HHHM 1Q3CA 1QAQA 4QOSA 1OIZA 4OU7A 4LRSA 2QZ4A 2UU9M 3UGJA 5ITUA 4XGIA 3GPXA 4OW0A 3GLHE 1Z5AA 3PNVA 4B08A 4LF8M 4JN6A 3H4JA 4WP2A 1L2CA 3E21A 3Q8GA 4LJ7A 1XNRM 4YHHM 1KYIA 2VF7A 2RGHA 4NC6A 1NSFA 1N34M 1HNZM 2QP9X 2CV0A 4D81A 3T38A 2L2DA 3D8BA 3T1YM 3B7QA 2XZFA 2A5YB 1XXHA 4YY3M 5EXSA 1ZMWA 4IBCA 4M9XA 2LVAA 4X66M 1WGLA 4X65M 1J5EM 4ANRA 2EKFA 4IBIA 1QQWA 3KFUG 3RE8A 2DKLA 3GLFB 1Y8GA 4JI5M 4NXNM 1PJSA 1QANA 2CEAA 3B9PA 4PD2A 3ZQJA 4DR7M 4DR6M 3KW6A 4AI6A 4DV2M 4UN2B 3GQ5A 3GRVA 1GL7A 1JR3D 2QSFX 3PNYA 4AQYM 1SXJC 7CATA 1OJLA 3J81S 3DOAA 1H6UA 3QYEA 5E6JA 2D7EA 4LF4M 4W5WA 1TTEA 3JAMS 5EP1A 4ITQA 1XMOM 3SARA 4GHAA 4IBKA 3NBIA 3GLIA 3C3DA 1AUAA 5L8RF 2JUJA 3K1JA 3THGA 2QPAA 3U60A 2DWZB 2KHHA 3T1HM 1PM5A 4GKJM 3VK8A 4B3MM 1YSYA 1WGNA 1NV8A 1HJPA 5FTJA 4F1IA 3SHFA 3M7GA 2LVQD 3AFHA 3ZH9B 3A46A 2DXIA 1YLAA 2LHGA 3TWLA 1NJFA 2Z4SA 3B7ZA 4L8RC 1IXSA 1G71A 3DA1A 4BLCA 1ZMUA 3FD9A 5C18A 1ZMVA 3BXWA 1IN8A 3GLHA 2ZANA 1Q39A 2KNVA 4GEWA 2R65A 3K9OA 4AZFA 1D0KA 2JNHA 5ITRA 3HJ8A 1XWIA 3U5ZB 1Q3BA 5ITXE 3SC3A 2WSCF 4CIZA 3PFIA 5A2QS 2LVNC 1R2ZA 1UFZA 3HJQA 4IIWA 3HGIA 4R71A 2DAKA 2G5GX 1Z59A 1Z6TA 2D7GA 4IBGA 1OQYA 3AOEA 4AG5A 1IBKM 4P16A 1ORYB 2EJSA 3PVSA 3HU2A 4M9ZA 4LGYA 4JYAM 2XLJA 3KOWE 1V33A 4I8OA 3KSXA 3MJ5A 1NNUC 5DFLA 4CGYB 3KP0E 1DGHA 2APLA 5BPVA 3GPUA 3U6LA 2WSEF 1N77A 2DWLA 5IZ7D 4JI2M 3K9PA 2BJWA 2JY6B 2HL7A 2GQFA 2DNAA 3AV0A 3FTFA 4LJAA 1OTRA 4KO8A 3B7NA 3FUVA 3U6QA 4LG2A 3HWSA 2MJ5B 1I4WA 3FE3A 2FFJA 3KOZE 4Q7JA 3JR4A 4CHTB 4PDGA 1IXRC 4PT5A 1VEJA 4JXJA 1CUKA 2CV2A 4HLQA 5IWAM 1BVSA 1XHBA 1D0MA 5E26A 3C9PA 1NV9A 2KW0A 3A42A 3Q8XA 3V76A 2CP8A 3GLGE 1GKIA 2OO9A 1TF0B 3L27A 4R7GA 1DO0A 1NHWC 3SYKA 4D80A 3GRYA 2CHVA 1DO2A 1T6OA 2C9CA 3GRRA 3I4YA 2HAKA 1PJTA 2Z7JA 3U6DA 4B3SM 2F4VM 2DWNA 4I4LA 2XEPA 4GC9A 1MN3A 3CF0A 3GPYA 4MGYE 3LQRA 4I5SA 5H37D 4K0KM 4DV3M 2DZOB 3SFZA 1PJJA 4NSOB 4KT0F 4DUYM 3E4RA 1IN4A 4RNAA 3GLFE 2CFOA 2F5SA 2R4EA 4DR3M 5KO3A 2K0BX 2F5PA 4B7GA 1YE9A 5ITXA 1F4IA 5EXTA 3PXGA 1J7KA 2LH0A 4IBEA 2DVWB 2G8LA 1TGUA 2K9DA 3HY5A 1LTMA 1TH4A 1XXHB 1G3IA 2R44A 3CF6E 3EIEA 3HJSA 4LF7M 3GRUA 2C99A 3GLGB 4FWHA 1OIPA 2Y21A 2C5RA 1GJTA 4B7FA 1OFHA 4CJ6A 3TL4X 3UMMA 4GKKM 4DR4M 2DZLA 2HKJA 2R46A 3J80S 4WURA 1AIPC 1HT1E 2LTUA 1VQ1A 2JY8A 1KSFX 3TWMA 3HU1A 2VQFM 1HQCA 4IJFA 3RFWA 2Q2EB 4LRTA 2VF8A 3WHKA 2DAIA 2CUZA 3FKEA 2KNZA 4L16A 4IBBA 1VEKA 3F92A 4EIWA 3LQQA 1NY5A 1C7YA 3I04M 4KLNA 3HHYA 3D8LA 3KP1E 3TPZA 2DAGA 4LFCM 2YNMD 4IBFA 1QDTA 2CWBA 5LMUM 4A3VB 3U60B 4FWGA 2QHOB 4REZA 1SXJB 2X4AA 4B3TM 1IY0A 2L7HA 3M6AA 3VLFB 2XSZD 1NVMA 1N36M 4AG6A 2V1UA 1T3TA 3GPPA 1GLNA 1UM8A 2ZAOA 1IBMM 2X49A 3E9SA 3RGSA 1SXJD 3WHLA 4AW4A 1HQYE 4BB9A 3CGWA 2JA2A 4LFAM 1GJSA 1IQPA 1NO1A 2HCBA 1N78A 4G4NA 8CATA 2YR0A 2EA0A 3CTWB 1D0LA 4JI3M 4XK8F 1JR3A 2QBYA 4BBAA 5FLXS 1G4AE 1R6BX 1PJIA 4TUWA 2LVPC 2J7NA 1N32M 4B7HA 3W68A 5FTNA 3ZC7B 4JI8M 4FWDA 3UJNA 1W5SA 3FRIA 4GITA 3DZDA 1IFYA 4FD2A 1W5TA 1MJGM 2Y0QA 4FCWA 1E9SA 1QDRA 3DFZA 3AOEC 5KPTA 5GKNA 4R3DA 2UUAM 2CRUA 3KDSE 3W0FA 1EIJA 4DUZM 2LVOC 2QENA 1L2BA 1OAIA 3SAVA 2B3TA 2F5QA 1PJQA 5LMNM 3U6CA 1XNQM 3FYDA 3SAWA 1DGHB 1NY6A 1WIVA 1TDHA 3TWKA 2N35A 1L8QA 3QYBA 1J09A 3KXEC 4LZJA 3VDUA 4LGMA 2R6FA 3U6EA 2XZUA 1QUTA 5EXPA 4QHTA 1XMQM 3FTEA 2AHMA 4RKUF 4LF5M 3GQ4A 1GABA 1R4GA 3ZCBB 3SATA 3LVWA 2R62A 2XFSA 2K47A 2XF3A 1G8PA 2J7OA 5FTKA 4MGKE 1A5TA 2C9OA 3IHPA 2KA6B 3J7AS 2G3QA 2GNOA 2QQ8A 4M0WA 2WZJA 2V1CA 2ZBKB 3MHVC 3GP1A 1MX0A 2CV1A 1HNWM 5FTMA 4AKGA 1XC8A 4L78A 1XXHE 1IM2A 2O01F 1YUBA 4GH9A 4DR5M 2MR9A 1I94M 2UXBM 5DNYA 2WSFF 3I01M 1D2NA 1ZV1A 1HT2E 3FUTA 4MM3B 3UZUA 5KPZA 1R7RA 3HX3A 3JR5A 4DV7M 1NHGC 5EP4A 1E9RA 4LJ5A 1WXQA 2YFQA 4DV6M 5DYIA 1L1TA 4KODA 1E32A 4HEOA 2BNKA 2H1RA 3SBJA 2CHGA 5FSWA 1QVRA 2FE8A 2OOBA 1QYRA 3L29A 2JWSA 3QWLA 4JI7M 4MGZE 2ZM6M 2LNHC 3BBZA 1T43A 2P5TA 2L09A 3BOSA 5EQTA 4F2LA 1G41A 4DR2M 5EXXA 2UUBM 1FJGM 2I7PA 3H4MA 4LZZA 3FRHA 3J7BA 2JY7A 4LY6A 4OVZA 3GLIE 3E46A 1IBLM 3VKHA 2CE7A 1KFVA 3QAUA 2JP7A 2Y20A 2O25A 1K3WA 2X8AA 4L4UA 2LXEA 1SXJE 2MH8A 3L26A 2UXCM 5ITYA 2QCUA 3K8ZA 4WW0A 3U61A 3W0LB 4GRIA 3VDPA 1RU3A 2MGWA 2C96A 3FTDA 4FCVA 4ZPXA 3AJIB 5JI3E 3KS4A 2M5ZA 4GIPA 4Y28F 4GHLA 4DV4M 2Z3XA 3A98B 4G6ZA 4X62M 4CISA 1P3QQ 3J2PB 1ZAEA 1MU5A 1ZQ9A 1V92A 4FVMA 4DV1M 4NOOB 4NRVA 1GVNA 4QOZC 1TR8A 3IECA 3U6OA 5KQ8A 3K2LA 2E5LM 1C1KA 3B89A 3LCUA 1GO5A 2DI0A 1EFUB 1EE8A 3L28A 4RF0A 1NNJA 3HU3A 5FTLA 2F5NA 3OTOM 4L6V6 2BWBA 3AL0C 2QNJA 4LJ6A 3M0EA 2RGOA 4JI6M 3GLIB 3AKZA 2HWJA 3SAUA 2R45A 2DAMA 2EO2A 4II7A 4RF1A 1L2DA 4Z6YA 4AKIA 4IBDA 2FS1A 3J27B 1TH3A 5KPRA 2NQ8C 1LV7A 3MK6A 3GLGA 2M60A 3IG8A 4LF6M 4I81A 2EUCA 2VQEM 1HR0M 2L4FA 2V6ZM
chains in the Genus database with same CATH topology
4DV5M 2QBYB 3L25A 4GC5A 4G4OA 1IXSB 2R18A 4IBJA 4NRWA 4DR1M 3LVVA 1NJGA 2XFTA 4Z8XA 3GLFA 1QZMA 2Z4RA 2I7NA 3GLHB 4GMQA 4NSRA 3R9XB 5EP2A 4QNRA 4D82A 2OPFA 1IN6A 2L7IA 2XSZA 4MB7A 4MH0E 4NL4H 3K92A 2KXEA 5ITQA 1SXJA 4B3RM 3ILKA 5IT9S 1DGGA 3VFDA 3HHWA 2KZUA 4JI1M 3GQ3A 1TDZA 4AKHA 3IG5A 5IREB 4MGHA 3T15A 4QNMA 4G4RA 3R8FA 3U6PA 4S12A 2R4JA 3NWLA 1GL6A 3UK6A 3U6SA 2DZNB 1K3XA 2CHQA 5ITTA 3RGPA 2KRKA 2Y0TA 4PDIA 4XBOA 3EIHA 3SHGB 3FYCA 3SYLA 5BR8M 2KRUA 1IXZA 3U6MA 4LJ4A 3GO8A 4DV0M 4JV5M 2XH9A 3KVWA 2ERCA 4KHPM 3U5ZA 3FUWA 3SMSA 2DWMA 4L15A 1S3SA 3FUXA 4JI0M 4IJEA 1G59A 3KOYE 2O5RA 1X37A 2VIIA 2OQ4A 3C58A 2ZAMA 3VKGA 3LMMA 2D7HA 1QAMA 2KZSA 5DYGA 3HHZA 4JI4M 1IY2A 1DGFA 1FNNA 4PCZA 3I4VA 4FCTA 3FUUA 1N75A 3KOXE 2RKOA 2BJVA 5JI2E 4LF9M 1N33M 3FTCA 3HKPA 1IN5A 1JQJC 4NXMM 5C1BA 4M0DA 2UUCM 3KS8A 2W82A 4OX9M 3CF2A 2FOIC 1QAOA 1TH2A 5F3WA 4OVZB 3A45A 3VK7A 2KEBA 4G4QA 4LJ8A 3U61B 1K82A 1R2YA 4MGIE 1Z5BA 1E94E 2L6OA 4QHSA 2C98A 2LWXA 1IN7A 1IY1A 1OFIA 3SMPA 4FW9A 3KSJA 1L1ZA 1VDDA 2UXDM 1DGBA 2DHRA 4LJ9A 1Z5CA 4M9SA 2F5OA 2XGNA 4HL4A 2YQZA 3SASA 1HNXM 3TE6A 3TQSA 2FNAA 5KQDA 5EJCA 3I51A 4X64M 4LFBM 3AOGA 3HHXA 4LCBA 3L2AA 2HHHM 1Q3CA 1QAQA 4QOSA 4OU7A 4LRSA 2QZ4A 2UU9M 3UGJA 5ITUA 4XGIA 3GPXA 4OW0A 3PNVA 1Z5AA 4B08A 4LF8M 4JN6A 1L2CA 4LJ7A 1XNRM 4YHHM 1KYIA 2RGHA 1N34M 1NSFA 1HNZM 2CV0A 2QP9X 4D81A 3T38A 3D8BA 3T1YM 2XZFA 2A5YB 1XXHA 4YY3M 5EXSA 4IBCA 4M9XA 4X66M 4X65M 1J5EM 4IBIA 1QQWA 3KFUG 3RE8A 3GLFB 4JI5M 4NXNM 1QANA 2CEAA 3B9PA 4PD2A 4DR7M 4DR6M 3KW6A 4AI6A 4DV2M 3GQ5A 3GRVA 1GL7A 1JR3D 3PNYA 4AQYM 1SXJC 7CATA 1OJLA 3J81S 3DOAA 1H6UA 4LF4M 5E6JA 2D7EA 4W5WA 3JAMS 4ITQA 5EP1A 1XMOM 3SARA 4GHAA 4IBKA 3NBIA 3GLIA 3K1JA 3THGA 2QPAA 3U60A 2DWZB 3T1HM 1PM5A 4GKJM 3VK8A 4B3MM 1YSYA 5FTJA 3SHFA 3M7GA 3AFHA 3ZH9B 3A46A 2DXIA 3TWLA 1NJFA 2Z4SA 4L8RC 3DA1A 4BLCA 3FD9A 5C18A 1IN8A 3GLHA 2ZANA 1Q39A 2R65A 4AZFA 5ITRA 3HJ8A 1XWIA 3U5ZB 1Q3BA 5ITXE 3SC3A 5A2QS 3PFIA 1R2ZA 3HJQA 4IIWA 3HGIA 2G5GX 1Z59A 1Z6TA 2D7GA 4IBGA 3AOEA 4AG5A 1IBKM 4P16A 1ORYB 3PVSA 3HU2A 4M9ZA 4LGYA 4JYAM 2XLJA 3KOWE 4I8OA 4CGYB 3KSXA 3MJ5A 1NNUC 5BPVA 3U6LA 3KP0E 1DGHA 2DWLA 4JI2M 3GPUA 1N77A 3J7AS 5IZ7D 2BJWA 2HL7A 3AV0A 3FTFA 4LJAA 4KO8A 3FUVA 3U6QA 4LG2A 3HWSA 1I4WA 3KOZE 2FFJA 3JR4A 4CHTB 4PDGA 1IXRC 4PT5A 4JXJA 2CV2A 4HLQA 5IWAM 1XHBA 5E26A 2KW0A 3A42A 3Q8XA 1GKIA 3L27A 4R7GA 1DO0A 1NHWC 3SYKA 4D80A 3GRYA 2CHVA 1DO2A 2C9CA 3GRRA 3I4YA 2Z7JA 3U6DA 2F4VM 4B3SM 2DWNA 4I4LA 2XEPA 4GC9A 3CF0A 3GPYA 4MGYE 3LQRA 4I5SA 5H37D 4K0KM 4DV3M 2DZOB 3SFZA 1PJJA 4NSOB 4DUYM 3E4RA 1IN4A 4RNAA 2CFOA 2F5SA 2R4EA 5KO3A 2F5PA 4B7GA 1YE9A 5ITXA 5EXTA 3PXGA 1J7KA 2LH0A 4IBEA 2DVWB 2G8LA 1TGUA 3OTOM 4GKKM 3VKHA 1TH4A 1XXHB 1G3IA 3CF6E 3EIEA 3HJSA 4LF7M 3GRUA 2C99A 3GLGB 4FWHA 2Y21A 2C5RA 4B7FA 1OFHA 3TL4X 3UMMA 4DR4M 2HKJA 2R46A 3J80S 4WURA 1HT1E 1KSFX 3TWMA 3HU1A 2VQFM 1HQCA 4IJFA 3RFWA 2Q2EB 4LRTA 3WHKA 2CUZA 3FKEA 4L16A 4IBBA 4EIWA 3LQQA 1NY5A 4KLNA 3HHYA 3D8LA 3KP1E 3TPZA 4LFCM 2YNMD 4IBFA 5LMUM 4A3VB 3U60B 4FWGA 4REZA 1SXJB 2X4AA 4B3TM 1IY0A 2L7HA 3M6AA 3VLFB 2XSZD 1NVMA 1N36M 4AG6A 2V1UA 1T3TA 3GPPA 1GLNA 1UM8A 2ZAOA 1IBMM 2X49A 3E9SA 3RGSA 1SXJD 3WHLA 4AW4A 1HQYE 4BB9A 2JA2A 4LFAM 1IQPA 2HCBA 1N78A 4G4NA 8CATA 2YR0A 2EA0A 3CTWB 4JI3M 1JR3A 2QBYA 4BBAA 5FLXS 1G4AE 1R6BX 1PJIA 4TUWA 2J7NA 1N32M 4B7HA 5FTNA 3ZC7B 4JI8M 4FWDA 3UJNA 1W5SA 4GITA 3DZDA 4FD2A 1W5TA 2Y0QA 4FCWA 5KPTA 1E9SA 3DFZA 3AOEC 5GKNA 4R3DA 2UUAM 3KDSE 3W0FA 4DUZM 1L2BA 2QENA 3SAVA 2F5QA 3U6CA 5LMNM 1XNQM 3FYDA 3SAWA 1DGHB 1NY6A 1TDHA 3TWKA 1L8QA 1J09A 3KXEC 4LZJA 3VDUA 4LGMA 3U6EA 2XZUA 5EXPA 4QHTA 1XMQM 3FTEA 2AHMA 4LF5M 3GQ4A 3ZCBB 3SATA 3LVWA 2R62A 2XFSA 2K47A 2XF3A 1G8PA 2J7OA 5FTKA 4MGKE 2C9OA 2KA6B 4M0WA 2V1CA 2ZBKB 3MHVC 3GP1A 1MX0A 2CV1A 1HNWM 5FTMA 4AKGA 1XC8A 4L78A 1IM2A 1YUBA 4GH9A 4DR5M 1I94M 2UXBM 5DNYA 4DR3M 1D2NA 3UZUA 1HT2E 3FUTA 4MM3B 5KPZA 1R7RA 3JR5A 4DV7M 1NHGC 5EP4A 1E9RA 4LJ5A 1WXQA 2YFQA 4DV6M 5DYIA 1L1TA 4KODA 1E32A 2BNKA 2H1RA 3SBJA 2CHGA 5FSWA 1QVRA 2FE8A 1QYRA 3L29A 3QWLA 4JI7M 4MGZE 2ZM6M 2LNHC 2P5TA 2L09A 3BOSA 5EQTA 4DR2M 1G41A 2UUBM 5EXXA 1FJGM 2I7PA 3H4MA 4LZZA 1IBLM 3J7BA 4OVZA 4LY6A 2CE7A 1KFVA 3QAUA 2Y20A 1K3WA 2X8AA 4L4UA 2LXEA 1SXJE 3L26A 2UXCM 5ITYA 2QCUA 3K8ZA 4WW0A 3U61A 3W0LB 4GRIA 3VDPA 3FTDA 2C96A 4FCVA 4ZPXA 3AJIB 5JI3E 3KS4A 2M5ZA 4GIPA 4GHLA 4DV4M 2Z3XA 3A98B 4G6ZA 4X62M 4CISA 3J2PB 1ZAEA 1MU5A 1ZQ9A 4FVMA 4DV1M 4NOOB 4NRVA 1GVNA 4QOZC 3U6OA 5KQ8A 3K2LA 2E5LM 1C1KA 1EE8A 3L28A 4RF0A 1NNJA 3HU3A 5FTLA 2F5NA 3AL0C 4LJ6A 3M0EA 2RGOA 4JI6M 3GLIB 3AKZA 3SAUA 2R45A 2EO2A 4II7A 4RF1A 1L2DA 4Z6YA 4AKIA 4IBDA 3J27B 1TH3A 5KPRA 2NQ8C 1LV7A 3MK6A 3GLGA 2M60A 3IG8A 4LF6M 4I81A 2EUCA 2VQEM 1HR0M 5EP3A 2V6ZM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QBY B;  1IXR C;  4LCB A;  4QOS A;  1IXS B;  1NY6 A;  4LRS A;  2QZ4 A;  1L8Q A;  1NJG A;  4Z8X A;  3GLF A;  4LGM A;  1QZM A;  2Z4R A;  3GLH B;  4JN6 A;  1DO0 A;  4LJ7 A;  3SYK A;  5EP2 A;  4D80 A;  1KYI A;  2CHV A;  1DO2 A;  2C9C A;  4QHT A;  4QNR A;  1IN6 A;  1NSF A;  5EXP A;  2QP9 X;  4D82 A;  4D81 A;  3D8B A;  2XSZ A;  4I4L A;  1XXH A;  3CF0 A;  5EXS A;  2R62 A;  2DZO B;  5FTK A;  1SXJ A;  1IN4 A;  2C9O A;  3VFD A;  3GLF B;  2CEA A;  3B9P A;  3MHV C;  3KW6 A;  5EXT A;  5FTM A;  3PXG A;  1J7K A;  1IM2 A;  2DVW B;  1JR3 D;  1XXH B;  1G3I A;  3EIE A;  1SXJ C;  1OJL A;  2C99 A;  3GLG B;  1D2N A;  1HT2 E;  1R7R A;  5EP1 A;  4FWH A;  4QNM A;  5EP4 A;  4LJ5 A;  3R8F A;  1OFH A;  5DYI A;  3GLI A;  3UK6 A;  2DZN B;  2CHQ A;  4KOD A;  3K1J A;  1E32 A;  2QPA A;  1HT1 E;  2DWZ B;  2KRK A;  1KSF X;  2CHG A;  1QVR A;  3EIH A;  3HU1 A;  3SYL A;  1HQC A;  4LRT A;  1IXZ A;  4LJ4 A;  5FTJ A;  3WHK A;  3BOS A;  5EQT A;  1G41 A;  5EXX A;  4L16 A;  1S3S A;  4L15 A;  3ZH9 B;  4EIW A;  3H4M A;  4LZZ A;  1NY5 A;  4LY6 A;  4KLN A;  1NJF A;  2Z4S A;  1X37 A;  2VII A;  2ZAM A;  2CE7 A;  5DYG A;  2X8A A;  1IY2 A;  1FNN A;  1SXJ E;  4L4U A;  4A3V B;  4FCT A;  4FWG A;  3U60 B;  5C18 A;  4WW0 A;  1SXJ B;  2RKO A;  1IY0 A;  2BJV A;  1IN8 A;  3GLH A;  2ZAN A;  3M6A A;  2C96 A;  5JI2 E;  4FCV A;  2XSZ D;  3VLF B;  1IN5 A;  1JQJ C;  2R65 A;  1NVM A;  3AJI B;  4ZPX A;  5C1B A;  5JI3 E;  2V1U A;  1UM8 A;  2ZAO A;  1XWI A;  3U5Z B;  1SXJ D;  3CF2 A;  3SC3 A;  3WHL A;  3PFI A;  1HQY E;  1IQP A;  2HCB A;  1C1K A;  4LJ8 A;  3HU3 A;  3HU2 A;  3PVS A;  5FTL A;  3U61 B;  1JR3 A;  2QBY A;  1G4A E;  1E94 E;  1R6B X;  4LJ6 A;  3M0E A;  2C98 A;  4QHS A;  1IN7 A;  1IY1 A;  3GLI B;  1OFI A;  5FTN A;  4FWD A;  4FW9 A;  2BJW A;  1W5S A;  2DHR A;  4GIT A;  3DZD A;  4LJ9 A;  4FD2 A;  1W5T A;  4FCW A;  4LJA A;  1LV7 A;  4KO8 A;  3GLG A;  3HWS A;  4I81 A;  3KDS E;  5EP3 A;  2FNA A;  2QEN A;  2V6Z M; 
#chains in the Genus database with same CATH topology
 1WHC A;  4DV5 M;  2JXN A;  2L4E A;  2QBY B;  1SG9 A;  3L25 A;  2JZ1 A;  4GC5 A;  4G4O A;  1IXS B;  2R18 A;  4IBJ A;  1QZE A;  4NRW A;  4DR1 M;  2FH0 A;  3LVV A;  2EKK A;  1VDL A;  1NJG A;  2H5X A;  2XFT A;  2DEN A;  4Z8X A;  3GLF A;  1QZM A;  2Z4R A;  2I7N A;  3GLH B;  3LW5 F;  2RRU A;  2DHY A;  4GMQ A;  2JY5 A;  3MMP A;  4NSR A;  3R9X B;  1OAO C;  5EP2 A;  4QNR A;  4D82 A;  2OPF A;  1IN6 A;  2L7I A;  1VEG A;  2XSZ A;  4MB7 A;  4MH0 E;  1PGY A;  4NL4 H;  3K92 A;  2KXE A;  2OOA A;  5ITQ A;  1SXJ A;  4B3R M;  3ILK A;  5IT9 S;  1DGG A;  1VG5 A;  3VFD A;  1WJ7 A;  3HHW A;  1OKS A;  2KZU A;  4JI1 M;  3GQ3 A;  1TDZ A;  4AKH A;  2KDL A;  3IG5 A;  5IRE B;  4MGH A;  3T15 A;  4QNM A;  4G4R A;  3R8F A;  3U6P A;  4S12 A;  2R4J A;  3B74 A;  5EP3 A;  1DV0 A;  2DAE A;  1GL6 A;  2BWE A;  3NWL A;  2DZN B;  3UK6 A;  2CHQ A;  3U6S A;  1K3X A;  5ITT A;  3RGP A;  2KRK A;  2Y0T A;  4PDI A;  1V34 A;  2ZTC A;  4XBO A;  3EIH A;  3SHG B;  3FYC A;  3SYL A;  4DBG B;  5BR8 M;  2KRU A;  1IXZ A;  2JZ0 A;  4LJ4 A;  3GO8 A;  4DV0 M;  3U6M A;  2XH9 A;  4JV5 M;  1QUS A;  3KVW A;  2ERC A;  4KHP M;  3U5Z A;  3FUW A;  3SMS A;  2DWM A;  4L15 A;  1S3S A;  3FUX A;  4JI0 M;  4IJE A;  3HZJ A;  1G59 A;  3KOY E;  2KNA A;  1XB2 B;  2O5R A;  1X37 A;  2VII A;  2OQ4 A;  3C58 A;  2ZAM A;  3VKG A;  3LMM A;  2D7H A;  1QAM A;  2KZS A;  5DYG A;  3HHZ A;  4JI4 M;  1IY2 A;  1DGF A;  1FNN A;  4PCZ A;  3I4V A;  4FCT A;  3FUU A;  3W67 A;  1N75 A;  1PRB A;  3KOX E;  2RKO A;  2BJV A;  4P17 A;  5JI2 E;  4LF9 M;  1N33 M;  3FTC A;  3C3E A;  3HKP A;  1IN5 A;  1JQJ C;  4NXM M;  5C1B A;  4M0D A;  2UUC M;  3KS8 A;  2W82 A;  2LHC A;  4OX9 M;  2VDB B;  3CF2 A;  2FOI C;  1QAO A;  1TH2 A;  5F3W A;  4OVZ B;  3NBX X;  3A45 A;  3T6P A;  2R0I A;  2KEB A;  3VK7 A;  4G4Q A;  1JB0 F;  4LJ8 A;  3U61 B;  2LBC A;  1K82 A;  1R2Y A;  4MGI E;  1Z5B A;  1E94 E;  2L6O A;  4QHS A;  2C98 A;  2LWX A;  1IN7 A;  2Z8Y M;  1IY1 A;  1R5L A;  3LCV B;  1OFI A;  3SMP A;  4FW9 A;  3KSJ A;  1L1Z A;  2MRO B;  1VDD A;  2UXD M;  1WR1 B;  1DGB A;  2DHR A;  2K6B A;  4LJ9 A;  1Z5C A;  4M9S A;  2F5O A;  2XGN A;  4G3O A;  4HL4 A;  2YQZ A;  3SAS A;  1HNX M;  3TE6 A;  3TQS A;  2FNA A;  5KQD A;  1JR3 E;  5EJC A;  3I51 A;  4X64 M;  2J5Y A;  4LFB M;  1Q02 A;  3AOG A;  3HHX A;  4LCB A;  2ZTD A;  3L2A A;  2HHH M;  1Q3C A;  1QAQ A;  4QOS A;  1OIZ A;  4OU7 A;  4LRS A;  2QZ4 A;  2UU9 M;  3UGJ A;  5ITU A;  4XGI A;  3GPX A;  4OW0 A;  3GLH E;  1Z5A A;  3PNV A;  4B08 A;  4LF8 M;  4JN6 A;  3H4J A;  4WP2 A;  1L2C A;  3E21 A;  3Q8G A;  4LJ7 A;  1XNR M;  4YHH M;  1KYI A;  2VF7 A;  2RGH A;  4NC6 A;  1NSF A;  1N34 M;  1HNZ M;  2QP9 X;  2CV0 A;  4D81 A;  3T38 A;  2L2D A;  3D8B A;  3T1Y M;  3B7Q A;  2XZF A;  2A5Y B;  1XXH A;  4YY3 M;  5EXS A;  1ZMW A;  4IBC A;  4M9X A;  2LVA A;  4X66 M;  1WGL A;  4X65 M;  1J5E M;  4ANR A;  2EKF A;  4IBI A;  1QQW A;  3KFU G;  3RE8 A;  2DKL A;  3GLF B;  1Y8G A;  4JI5 M;  4NXN M;  1PJS A;  1QAN A;  2CEA A;  3B9P A;  4PD2 A;  3ZQJ A;  4DR7 M;  4DR6 M;  3KW6 A;  4AI6 A;  4DV2 M;  4UN2 B;  3GQ5 A;  3GRV A;  1GL7 A;  1JR3 D;  2QSF X;  3PNY A;  4AQY M;  1SXJ C;  7CAT A;  1OJL A;  3J81 S;  3DOA A;  1H6U A;  3QYE A;  5E6J A;  2D7E A;  4LF4 M;  4W5W A;  1TTE A;  3JAM S;  5EP1 A;  4ITQ A;  1XMO M;  3SAR A;  4GHA A;  4IBK A;  3NBI A;  3GLI A;  3C3D A;  1AUA A;  5L8R F;  2JUJ A;  3K1J A;  3THG A;  2QPA A;  3U60 A;  2DWZ B;  2KHH A;  3T1H M;  1PM5 A;  4GKJ M;  3VK8 A;  4B3M M;  1YSY A;  1WGN A;  1NV8 A;  1HJP A;  5FTJ A;  4F1I A;  3SHF A;  3M7G A;  2LVQ D;  3AFH A;  3ZH9 B;  3A46 A;  2DXI A;  1YLA A;  2LHG A;  3TWL A;  1NJF A;  2Z4S A;  3B7Z A;  4L8R C;  1IXS A;  1G71 A;  3DA1 A;  4BLC A;  1ZMU A;  3FD9 A;  5C18 A;  1ZMV A;  3BXW A;  1IN8 A;  3GLH A;  2ZAN A;  1Q39 A;  2KNV A;  4GEW A;  2R65 A;  3K9O A;  4AZF A;  1D0K A;  2JNH A;  5ITR A;  3HJ8 A;  1XWI A;  3U5Z B;  1Q3B A;  5ITX E;  3SC3 A;  2WSC F;  4CIZ A;  3PFI A;  5A2Q S;  2LVN C;  1R2Z A;  1UFZ A;  3HJQ A;  4IIW A;  3HGI A;  4R71 A;  2DAK A;  2G5G X;  1Z59 A;  1Z6T A;  2D7G A;  4IBG A;  1OQY A;  3AOE A;  4AG5 A;  1IBK M;  4P16 A;  1ORY B;  2EJS A;  3PVS A;  3HU2 A;  4M9Z A;  4LGY A;  4JYA M;  2XLJ A;  3KOW E;  1V33 A;  4I8O A;  3KSX A;  3MJ5 A;  1NNU C;  5DFL A;  4CGY B;  3KP0 E;  1DGH A;  2APL A;  5BPV A;  3GPU A;  3U6L A;  2WSE F;  1N77 A;  2DWL A;  5IZ7 D;  4JI2 M;  3K9P A;  2BJW A;  2JY6 B;  2HL7 A;  2GQF A;  2DNA A;  3AV0 A;  3FTF A;  4LJA A;  1OTR A;  4KO8 A;  3B7N A;  3FUV A;  3U6Q A;  4LG2 A;  3HWS A;  2MJ5 B;  1I4W A;  3FE3 A;  2FFJ A;  3KOZ E;  4Q7J A;  3JR4 A;  4CHT B;  4PDG A;  1IXR C;  4PT5 A;  1VEJ A;  4JXJ A;  1CUK A;  2CV2 A;  4HLQ A;  5IWA M;  1BVS A;  1XHB A;  1D0M A;  5E26 A;  3C9P A;  1NV9 A;  2KW0 A;  3A42 A;  3Q8X A;  3V76 A;  2CP8 A;  3GLG E;  1GKI A;  2OO9 A;  1TF0 B;  3L27 A;  4R7G A;  1DO0 A;  1NHW C;  3SYK A;  4D80 A;  3GRY A;  2CHV A;  1DO2 A;  1T6O A;  2C9C A;  3GRR A;  3I4Y A;  2HAK A;  1PJT A;  2Z7J A;  3U6D A;  4B3S M;  2F4V M;  2DWN A;  4I4L A;  2XEP A;  4GC9 A;  1MN3 A;  3CF0 A;  3GPY A;  4MGY E;  3LQR A;  4I5S A;  5H37 D;  4K0K M;  4DV3 M;  2DZO B;  3SFZ A;  1PJJ A;  4NSO B;  4KT0 F;  4DUY M;  3E4R A;  1IN4 A;  4RNA A;  3GLF E;  2CFO A;  2F5S A;  2R4E A;  4DR3 M;  5KO3 A;  2K0B X;  2F5P A;  4B7G A;  1YE9 A;  5ITX A;  1F4I A;  5EXT A;  3PXG A;  1J7K A;  2LH0 A;  4IBE A;  2DVW B;  2G8L A;  1TGU A;  2K9D A;  3HY5 A;  1LTM A;  1TH4 A;  1XXH B;  1G3I A;  2R44 A;  3CF6 E;  3EIE A;  3HJS A;  4LF7 M;  3GRU A;  2C99 A;  3GLG B;  4FWH A;  1OIP A;  2Y21 A;  2C5R A;  1GJT A;  4B7F A;  1OFH A;  4CJ6 A;  3TL4 X;  3UMM A;  4GKK M;  4DR4 M;  2DZL A;  2HKJ A;  2R46 A;  3J80 S;  4WUR A;  1AIP C;  1HT1 E;  2LTU A;  1VQ1 A;  2JY8 A;  1KSF X;  3TWM A;  3HU1 A;  2VQF M;  1HQC A;  4IJF A;  3RFW A;  2Q2E B;  4LRT A;  2VF8 A;  3WHK A;  2DAI A;  2CUZ A;  3FKE A;  2KNZ A;  4L16 A;  4IBB A;  1VEK A;  3F92 A;  4EIW A;  3LQQ A;  1NY5 A;  1C7Y A;  3I04 M;  4KLN A;  3HHY A;  3D8L A;  3KP1 E;  3TPZ A;  2DAG A;  4LFC M;  2YNM D;  4IBF A;  1QDT A;  2CWB A;  5LMU M;  4A3V B;  3U60 B;  4FWG A;  2QHO B;  4REZ A;  1SXJ B;  2X4A A;  4B3T M;  1IY0 A;  2L7H A;  3M6A A;  3VLF B;  2XSZ D;  1NVM A;  1N36 M;  4AG6 A;  2V1U A;  1T3T A;  3GPP A;  1GLN A;  1UM8 A;  2ZAO A;  1IBM M;  2X49 A;  3E9S A;  3RGS A;  1SXJ D;  3WHL A;  4AW4 A;  1HQY E;  4BB9 A;  3CGW A;  2JA2 A;  4LFA M;  1GJS A;  1IQP A;  1NO1 A;  2HCB A;  1N78 A;  4G4N A;  8CAT A;  2YR0 A;  2EA0 A;  3CTW B;  1D0L A;  4JI3 M;  4XK8 F;  1JR3 A;  2QBY A;  4BBA A;  5FLX S;  1G4A E;  1R6B X;  1PJI A;  4TUW A;  2LVP C;  2J7N A;  1N32 M;  4B7H A;  3W68 A;  5FTN A;  3ZC7 B;  4JI8 M;  4FWD A;  3UJN A;  1W5S A;  3FRI A;  4GIT A;  3DZD A;  1IFY A;  4FD2 A;  1W5T A;  1MJG M;  2Y0Q A;  4FCW A;  1E9S A;  1QDR A;  3DFZ A;  3AOE C;  5KPT A;  5GKN A;  4R3D A;  2UUA M;  2CRU A;  3KDS E;  3W0F A;  1EIJ A;  4DUZ M;  2LVO C;  2QEN A;  1L2B A;  1OAI A;  3SAV A;  2B3T A;  2F5Q A;  1PJQ A;  5LMN M;  3U6C A;  1XNQ M;  3FYD A;  3SAW A;  1DGH B;  1NY6 A;  1WIV A;  1TDH A;  3TWK A;  2N35 A;  1L8Q A;  3QYB A;  1J09 A;  3KXE C;  4LZJ A;  3VDU A;  4LGM A;  2R6F A;  3U6E A;  2XZU A;  1QUT A;  5EXP A;  4QHT A;  1XMQ M;  3FTE A;  2AHM A;  4RKU F;  4LF5 M;  3GQ4 A;  1GAB A;  1R4G A;  3ZCB B;  3SAT A;  3LVW A;  2R62 A;  2XFS A;  2K47 A;  2XF3 A;  1G8P A;  2J7O A;  5FTK A;  4MGK E;  1A5T A;  2C9O A;  3IHP A;  2KA6 B;  3J7A S;  2G3Q A;  2GNO A;  2QQ8 A;  4M0W A;  2WZJ A;  2V1C A;  2ZBK B;  3MHV C;  3GP1 A;  1MX0 A;  2CV1 A;  1HNW M;  5FTM A;  4AKG A;  1XC8 A;  4L78 A;  1XXH E;  1IM2 A;  2O01 F;  1YUB A;  4GH9 A;  4DR5 M;  2MR9 A;  1I94 M;  2UXB M;  5DNY A;  2WSF F;  3I01 M;  1D2N A;  1ZV1 A;  1HT2 E;  3FUT A;  4MM3 B;  3UZU A;  5KPZ A;  1R7R A;  3HX3 A;  3JR5 A;  4DV7 M;  1NHG C;  5EP4 A;  1E9R A;  4LJ5 A;  1WXQ A;  2YFQ A;  4DV6 M;  5DYI A;  1L1T A;  4KOD A;  1E32 A;  4HEO A;  2BNK A;  2H1R A;  3SBJ A;  2CHG A;  5FSW A;  1QVR A;  2FE8 A;  2OOB A;  1QYR A;  3L29 A;  2JWS A;  3QWL A;  4JI7 M;  4MGZ E;  2ZM6 M;  2LNH C;  3BBZ A;  1T43 A;  2P5T A;  2L09 A;  3BOS A;  5EQT A;  4F2L A;  1G41 A;  4DR2 M;  5EXX A;  2UUB M;  1FJG M;  2I7P A;  3H4M A;  4LZZ A;  3FRH A;  3J7B A;  2JY7 A;  4LY6 A;  4OVZ A;  3GLI E;  3E46 A;  1IBL M;  3VKH A;  2CE7 A;  1KFV A;  3QAU A;  2JP7 A;  2Y20 A;  2O25 A;  1K3W A;  2X8A A;  4L4U A;  2LXE A;  1SXJ E;  2MH8 A;  3L26 A;  2UXC M;  5ITY A;  2QCU A;  3K8Z A;  4WW0 A;  3U61 A;  3W0L B;  4GRI A;  3VDP A;  1RU3 A;  2MGW A;  2C96 A;  3FTD A;  4FCV A;  4ZPX A;  3AJI B;  5JI3 E;  3KS4 A;  2M5Z A;  4GIP A;  4Y28 F;  4GHL A;  4DV4 M;  2Z3X A;  3A98 B;  4G6Z A;  4X62 M;  4CIS A;  1P3Q Q;  3J2P B;  1ZAE A;  1MU5 A;  1ZQ9 A;  1V92 A;  4FVM A;  4DV1 M;  4NOO B;  4NRV A;  1GVN A;  4QOZ C;  1TR8 A;  3IEC A;  3U6O A;  5KQ8 A;  3K2L A;  2E5L M;  1C1K A;  3B89 A;  3LCU A;  1GO5 A;  2DI0 A;  1EFU B;  1EE8 A;  3L28 A;  4RF0 A;  1NNJ A;  3HU3 A;  5FTL A;  2F5N A;  3OTO M;  4L6V 6;  2BWB A;  3AL0 C;  2QNJ A;  4LJ6 A;  3M0E A;  2RGO A;  4JI6 M;  3GLI B;  3AKZ A;  2HWJ A;  3SAU A;  2R45 A;  2DAM A;  2EO2 A;  4II7 A;  4RF1 A;  1L2D A;  4Z6Y A;  4AKI A;  4IBD A;  2FS1 A;  3J27 B;  1TH3 A;  5KPR A;  2NQ8 C;  1LV7 A;  3MK6 A;  3GLG A;  2M60 A;  3IG8 A;  4LF6 M;  4I81 A;  2EUC A;  2VQE M;  1HR0 M;  2L4F A;  2V6Z M; 
#chains in the Genus database with same CATH homology
 4DV5 M;  2QBY B;  3L25 A;  4GC5 A;  4G4O A;  1IXS B;  2R18 A;  4IBJ A;  4NRW A;  4DR1 M;  3LVV A;  1NJG A;  2XFT A;  4Z8X A;  3GLF A;  1QZM A;  2Z4R A;  2I7N A;  3GLH B;  4GMQ A;  4NSR A;  3R9X B;  5EP2 A;  4QNR A;  4D82 A;  2OPF A;  1IN6 A;  2L7I A;  2XSZ A;  4MB7 A;  4MH0 E;  4NL4 H;  3K92 A;  2KXE A;  5ITQ A;  1SXJ A;  4B3R M;  3ILK A;  5IT9 S;  1DGG A;  3VFD A;  3HHW A;  2KZU A;  4JI1 M;  3GQ3 A;  1TDZ A;  4AKH A;  3IG5 A;  5IRE B;  4MGH A;  3T15 A;  4QNM A;  4G4R A;  3R8F A;  3U6P A;  4S12 A;  2R4J A;  3NWL A;  1GL6 A;  3UK6 A;  3U6S A;  2DZN B;  1K3X A;  2CHQ A;  5ITT A;  3RGP A;  2KRK A;  2Y0T A;  4PDI A;  4XBO A;  3EIH A;  3SHG B;  3FYC A;  3SYL A;  5BR8 M;  2KRU A;  1IXZ A;  3U6M A;  4LJ4 A;  3GO8 A;  4DV0 M;  4JV5 M;  2XH9 A;  3KVW A;  2ERC A;  4KHP M;  3U5Z A;  3FUW A;  3SMS A;  2DWM A;  4L15 A;  1S3S A;  3FUX A;  4JI0 M;  4IJE A;  1G59 A;  3KOY E;  2O5R A;  1X37 A;  2VII A;  2OQ4 A;  3C58 A;  2ZAM A;  3VKG A;  3LMM A;  2D7H A;  1QAM A;  2KZS A;  5DYG A;  3HHZ A;  4JI4 M;  1IY2 A;  1DGF A;  1FNN A;  4PCZ A;  3I4V A;  4FCT A;  3FUU A;  1N75 A;  3KOX E;  2RKO A;  2BJV A;  5JI2 E;  4LF9 M;  1N33 M;  3FTC A;  3HKP A;  1IN5 A;  1JQJ C;  4NXM M;  5C1B A;  4M0D A;  2UUC M;  3KS8 A;  2W82 A;  4OX9 M;  3CF2 A;  2FOI C;  1QAO A;  1TH2 A;  5F3W A;  4OVZ B;  3A45 A;  3VK7 A;  2KEB A;  4G4Q A;  4LJ8 A;  3U61 B;  1K82 A;  1R2Y A;  4MGI E;  1Z5B A;  1E94 E;  2L6O A;  4QHS A;  2C98 A;  2LWX A;  1IN7 A;  1IY1 A;  1OFI A;  3SMP A;  4FW9 A;  3KSJ A;  1L1Z A;  1VDD A;  2UXD M;  1DGB A;  2DHR A;  4LJ9 A;  1Z5C A;  4M9S A;  2F5O A;  2XGN A;  4HL4 A;  2YQZ A;  3SAS A;  1HNX M;  3TE6 A;  3TQS A;  2FNA A;  5KQD A;  5EJC A;  3I51 A;  4X64 M;  4LFB M;  3AOG A;  3HHX A;  4LCB A;  3L2A A;  2HHH M;  1Q3C A;  1QAQ A;  4QOS A;  4OU7 A;  4LRS A;  2QZ4 A;  2UU9 M;  3UGJ A;  5ITU A;  4XGI A;  3GPX A;  4OW0 A;  3PNV A;  1Z5A A;  4B08 A;  4LF8 M;  4JN6 A;  1L2C A;  4LJ7 A;  1XNR M;  4YHH M;  1KYI A;  2RGH A;  1N34 M;  1NSF A;  1HNZ M;  2CV0 A;  2QP9 X;  4D81 A;  3T38 A;  3D8B A;  3T1Y M;  2XZF A;  2A5Y B;  1XXH A;  4YY3 M;  5EXS A;  4IBC A;  4M9X A;  4X66 M;  4X65 M;  1J5E M;  4IBI A;  1QQW A;  3KFU G;  3RE8 A;  3GLF B;  4JI5 M;  4NXN M;  1QAN A;  2CEA A;  3B9P A;  4PD2 A;  4DR7 M;  4DR6 M;  3KW6 A;  4AI6 A;  4DV2 M;  3GQ5 A;  3GRV A;  1GL7 A;  1JR3 D;  3PNY A;  4AQY M;  1SXJ C;  7CAT A;  1OJL A;  3J81 S;  3DOA A;  1H6U A;  4LF4 M;  5E6J A;  2D7E A;  4W5W A;  3JAM S;  4ITQ A;  5EP1 A;  1XMO M;  3SAR A;  4GHA A;  4IBK A;  3NBI A;  3GLI A;  3K1J A;  3THG A;  2QPA A;  3U60 A;  2DWZ B;  3T1H M;  1PM5 A;  4GKJ M;  3VK8 A;  4B3M M;  1YSY A;  5FTJ A;  3SHF A;  3M7G A;  3AFH A;  3ZH9 B;  3A46 A;  2DXI A;  3TWL A;  1NJF A;  2Z4S A;  4L8R C;  3DA1 A;  4BLC A;  3FD9 A;  5C18 A;  1IN8 A;  3GLH A;  2ZAN A;  1Q39 A;  2R65 A;  4AZF A;  5ITR A;  3HJ8 A;  1XWI A;  3U5Z B;  1Q3B A;  5ITX E;  3SC3 A;  5A2Q S;  3PFI A;  1R2Z A;  3HJQ A;  4IIW A;  3HGI A;  2G5G X;  1Z59 A;  1Z6T A;  2D7G A;  4IBG A;  3AOE A;  4AG5 A;  1IBK M;  4P16 A;  1ORY B;  3PVS A;  3HU2 A;  4M9Z A;  4LGY A;  4JYA M;  2XLJ A;  3KOW E;  4I8O A;  4CGY B;  3KSX A;  3MJ5 A;  1NNU C;  5BPV A;  3U6L A;  3KP0 E;  1DGH A;  2DWL A;  4JI2 M;  3GPU A;  1N77 A;  3J7A S;  5IZ7 D;  2BJW A;  2HL7 A;  3AV0 A;  3FTF A;  4LJA A;  4KO8 A;  3FUV A;  3U6Q A;  4LG2 A;  3HWS A;  1I4W A;  3KOZ E;  2FFJ A;  3JR4 A;  4CHT B;  4PDG A;  1IXR C;  4PT5 A;  4JXJ A;  2CV2 A;  4HLQ A;  5IWA M;  1XHB A;  5E26 A;  2KW0 A;  3A42 A;  3Q8X A;  1GKI A;  3L27 A;  4R7G A;  1DO0 A;  1NHW C;  3SYK A;  4D80 A;  3GRY A;  2CHV A;  1DO2 A;  2C9C A;  3GRR A;  3I4Y A;  2Z7J A;  3U6D A;  2F4V M;  4B3S M;  2DWN A;  4I4L A;  2XEP A;  4GC9 A;  3CF0 A;  3GPY A;  4MGY E;  3LQR A;  4I5S A;  5H37 D;  4K0K M;  4DV3 M;  2DZO B;  3SFZ A;  1PJJ A;  4NSO B;  4DUY M;  3E4R A;  1IN4 A;  4RNA A;  2CFO A;  2F5S A;  2R4E A;  5KO3 A;  2F5P A;  4B7G A;  1YE9 A;  5ITX A;  5EXT A;  3PXG A;  1J7K A;  2LH0 A;  4IBE A;  2DVW B;  2G8L A;  1TGU A;  3OTO M;  4GKK M;  3VKH A;  1TH4 A;  1XXH B;  1G3I A;  3CF6 E;  3EIE A;  3HJS A;  4LF7 M;  3GRU A;  2C99 A;  3GLG B;  4FWH A;  2Y21 A;  2C5R A;  4B7F A;  1OFH A;  3TL4 X;  3UMM A;  4DR4 M;  2HKJ A;  2R46 A;  3J80 S;  4WUR A;  1HT1 E;  1KSF X;  3TWM A;  3HU1 A;  2VQF M;  1HQC A;  4IJF A;  3RFW A;  2Q2E B;  4LRT A;  3WHK A;  2CUZ A;  3FKE A;  4L16 A;  4IBB A;  4EIW A;  3LQQ A;  1NY5 A;  4KLN A;  3HHY A;  3D8L A;  3KP1 E;  3TPZ A;  4LFC M;  2YNM D;  4IBF A;  5LMU M;  4A3V B;  3U60 B;  4FWG A;  4REZ A;  1SXJ B;  2X4A A;  4B3T M;  1IY0 A;  2L7H A;  3M6A A;  3VLF B;  2XSZ D;  1NVM A;  1N36 M;  4AG6 A;  2V1U A;  1T3T A;  3GPP A;  1GLN A;  1UM8 A;  2ZAO A;  1IBM M;  2X49 A;  3E9S A;  3RGS A;  1SXJ D;  3WHL A;  4AW4 A;  1HQY E;  4BB9 A;  2JA2 A;  4LFA M;  1IQP A;  2HCB A;  1N78 A;  4G4N A;  8CAT A;  2YR0 A;  2EA0 A;  3CTW B;  4JI3 M;  1JR3 A;  2QBY A;  4BBA A;  5FLX S;  1G4A E;  1R6B X;  1PJI A;  4TUW A;  2J7N A;  1N32 M;  4B7H A;  5FTN A;  3ZC7 B;  4JI8 M;  4FWD A;  3UJN A;  1W5S A;  4GIT A;  3DZD A;  4FD2 A;  1W5T A;  2Y0Q A;  4FCW A;  5KPT A;  1E9S A;  3DFZ A;  3AOE C;  5GKN A;  4R3D A;  2UUA M;  3KDS E;  3W0F A;  4DUZ M;  1L2B A;  2QEN A;  3SAV A;  2F5Q A;  3U6C A;  5LMN M;  1XNQ M;  3FYD A;  3SAW A;  1DGH B;  1NY6 A;  1TDH A;  3TWK A;  1L8Q A;  1J09 A;  3KXE C;  4LZJ A;  3VDU A;  4LGM A;  3U6E A;  2XZU A;  5EXP A;  4QHT A;  1XMQ M;  3FTE A;  2AHM A;  4LF5 M;  3GQ4 A;  3ZCB B;  3SAT A;  3LVW A;  2R62 A;  2XFS A;  2K47 A;  2XF3 A;  1G8P A;  2J7O A;  5FTK A;  4MGK E;  2C9O A;  2KA6 B;  4M0W A;  2V1C A;  2ZBK B;  3MHV C;  3GP1 A;  1MX0 A;  2CV1 A;  1HNW M;  5FTM A;  4AKG A;  1XC8 A;  4L78 A;  1IM2 A;  1YUB A;  4GH9 A;  4DR5 M;  1I94 M;  2UXB M;  5DNY A;  4DR3 M;  1D2N A;  3UZU A;  1HT2 E;  3FUT A;  4MM3 B;  5KPZ A;  1R7R A;  3JR5 A;  4DV7 M;  1NHG C;  5EP4 A;  1E9R A;  4LJ5 A;  1WXQ A;  2YFQ A;  4DV6 M;  5DYI A;  1L1T A;  4KOD A;  1E32 A;  2BNK A;  2H1R A;  3SBJ A;  2CHG A;  5FSW A;  1QVR A;  2FE8 A;  1QYR A;  3L29 A;  3QWL A;  4JI7 M;  4MGZ E;  2ZM6 M;  2LNH C;  2P5T A;  2L09 A;  3BOS A;  5EQT A;  4DR2 M;  1G41 A;  2UUB M;  5EXX A;  1FJG M;  2I7P A;  3H4M A;  4LZZ A;  1IBL M;  3J7B A;  4OVZ A;  4LY6 A;  2CE7 A;  1KFV A;  3QAU A;  2Y20 A;  1K3W A;  2X8A A;  4L4U A;  2LXE A;  1SXJ E;  3L26 A;  2UXC M;  5ITY A;  2QCU A;  3K8Z A;  4WW0 A;  3U61 A;  3W0L B;  4GRI A;  3VDP A;  3FTD A;  2C96 A;  4FCV A;  4ZPX A;  3AJI B;  5JI3 E;  3KS4 A;  2M5Z A;  4GIP A;  4GHL A;  4DV4 M;  2Z3X A;  3A98 B;  4G6Z A;  4X62 M;  4CIS A;  3J2P B;  1ZAE A;  1MU5 A;  1ZQ9 A;  4FVM A;  4DV1 M;  4NOO B;  4NRV A;  1GVN A;  4QOZ C;  3U6O A;  5KQ8 A;  3K2L A;  2E5L M;  1C1K A;  1EE8 A;  3L28 A;  4RF0 A;  1NNJ A;  3HU3 A;  5FTL A;  2F5N A;  3AL0 C;  4LJ6 A;  3M0E A;  2RGO A;  4JI6 M;  3GLI B;  3AKZ A;  3SAU A;  2R45 A;  2EO2 A;  4II7 A;  4RF1 A;  1L2D A;  4Z6Y A;  4AKI A;  4IBD A;  3J27 B;  1TH3 A;  5KPR A;  2NQ8 C;  1LV7 A;  3MK6 A;  3GLG A;  2M60 A;  3IG8 A;  4LF6 M;  4I81 A;  2EUC A;  2VQE M;  1HR0 M;  5EP3 A;  2V6Z M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...