4JI5M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji5M02
3GO8A 5ITTA 1KFVA 2E5LM 4DV5M 3U6LA 1XNRM 3GPYA 4JI6M 1PJJA 1K82A 3U6QA 4ITQA 4LF4M 4LF7M 4MB7A 2UU9M 4CISA 3GPPA 1IBLM 3TWKA 1N33M 4K0KM 3A46A 4DV1M 1Q3CA 1IBMM 3GQ5A 1K3XA 3SASA 1XNQM 5BR8M 1HR0M 3J7AS 1Q39A 4LFCM 3U6OA 5A2QS 4G4OA 4JI0M 4NXMM 1FJGM 3JAMS 1N32M 4DR4M 2UXCM 3SARA 3A45A 3U6DA 4YY3M 4JI8M 4KHPM 3T1YM 4B3SM 4NRWA 4B3RM 5ITRA 1IBKM 2UXDM 4PDIA 4DR5M 3U6SA 3SBJA 3SAVA 1TDHA 2Q2EB 3U6MA 4DV0M 3VK8A 1PJIA 2UXBM 2EA0A 1L1TA 2XZUA 4JV5M 4LFAM 1MU5A 2OQ4A 1R2ZA 2HHHM 5ITXE 1HNZM 1Z5CA 4JI4M 1HNXM 1XMQM 4GKKM 2F5SA 4DUZM 4JYAM 1XMOM 2ZBKB 4G4NA 4DR2M 4X64M 5FLXS 4NXNM 2ZM6M 4LF5M 4X65M 1J5EM 4YHHM 3J80S 4JI7M 3JR4A 3U6CA 4LF9M 4G4QA 1N34M 1N36M 4JI2M 4NRVA 2UUAM 4DV4M 5LMNM 4X66M 3GQ3A 1XC8A 4JI1M 3SAUA 3J81S 3GP1A 1L1ZA 4LF6M 2F5NA 4B3MM 3A42A 4DR1M 1L2BA 4AQYM 1L2CA 4DV2M 4JI5M 4LF8M 2F5OA 5ITUA 3SAWA 1NNJA 1K3WA 3GPUA 3U6EA 3VK7A 1EE8A 4LFBM 3C58A 5LMUM 3TWMA 2VQEM 1Z5AA 2XZFA 3GPXA 3U6PA 1HNWM 1MX0A 1PM5A 4GKJM 3OTOM 3GQ4A 5IWAM 1TDZA 4DV6M 4DR6M 3T1HM 1I94M 3TWLA 4PCZA 3JR5A 4OX9M 3W0FA 5ITXA 4DR7M 3SATA 1L2DA 4PD2A 3DOAA 4JI3M 5ITYA 1Z59A 1Q3BA 2OPFA 2F5PA 4G4RA 2UUBM 4DV7M 4DUYM 2HKJA 4X62M 1R2YA 4B3TM 5IT9S 1Z5BA 5ITQA 4DR3M 2VQFM 4DV3M 2F5QA 4PDGA 2F4VM 2UUCM
chains in the Genus database with same CATH superfamily
1KFVA 4CHTB 1SXJE 4NC6A 4IBCA 1V92A 3FTEA 2CV0A 3H4JA 3FE3A 4PT5A 4FVMA 4ITQA 2V6ZM 4XGIA 1IXSB 4GC9A 1NHWC 3KOZE 1I4WA 3UZUA 1IBLM 4G6ZA 3TE6A 3LCVB 4GHLA 1R7RA 2ZANA 1JQJC 4MM3B 2RGHA 3HHXA 3KSXA 5KQ8A 3C3EA 3HGIA 2DAGA 4REZA 3HU3A 3GRVA 3VKGA 1VQ1A 1XNQM 2DHYA 3IHPA 3NBXX 4MGKE 5EQTA 3J7AS 3PVSA 4AZFA 3FTFA 1FJGM 3T38A 3B9PA 4F2LA 3SARA 4KODA 3U6DA 1ZQ9A 1UFZA 3T1YM 3TPZA 4NRWA 1IBKM 2XH9A 3LVWA 1WGLA 1QAQA 2MGWA 3Q8GA 3GLHE 2VIIA 3QYEA 4R71A 1HT1E 1UM8A 1JR3D 3HJSA 4CJ6A 5C1BA 1N77A 2Q2EB 2YFQA 1QZMA 5L8RF 4LJ9A 1IY0A 2QCUA 2A5YB 2R18A 4KT0F 1GKIA 3AOEC 3CF0A 3I01M 2EA0A 2K9DA 2XZUA 1L1TA 1DGGA 1MU5A 2Z4SA 2HWJA 2KW0A 5JI2E 2YR0A 5ITXE 2L09A 1HNZM 1Z5CA 2MH8A 3D8BA 2QP9X 1V34A 2DHRA 3ZCBB 4FW9A 2DZLA 2FE8A 1G8PA 2CE7A 3SC3A 1XMOM 1F4IA 1J7KA 2KRUA 1MJGM 4LF5M 1G4AE 4AKGA 1NVMA 1XB2B 2ZTDA 1SXJC 1IY2A 4LF9M 3L28A 1H6UA 1N34M 1N36M 4I81A 1Y8GA 2Y20A 4LZZA 2JUJA 1W5SA 3W67A 3GLFB 3HX3A 4BB9A 3J81S 2G5GX 1L1ZA 4B3MM 4HLQA 3K2LA 1QDTA 4DR1M 1QUSA 2DWMA 2Z3XA 4DV2M 4LF8M 5ITUA 1TR8A 1NNJA 1GVNA 1GJTA 1VEJA 4WURA 2M60A 1K3WA 1DGFA 1D0MA 2LVQD 1EE8A 2KRKA 5FTLA 2JWSA 2WSEF 3CTWB 3GLHA 2XZFA 2BWBA 2V1CA 4L78A 4Y28F 4L8RC 3GQ4A 2LBCA 5IWAM 1TDZA 4CIZA 1AIPC 4QOSA 1NJGA 2K6BA 2DWZB 4HEOA 1I94M 4CGYB 3UMMA 3E4RA 4OX9M 5F3WA 4GITA 2CHQA 1G3IA 3R8FA 2LVAA 4D82A 1OFHA 1S3SA 4PD2A 2EO2A 2CUZA 1WR1B 1D0KA 3FTDA 4JI3M 4L6V6 5ITYA 3HKPA 3UGJA 3AKZA 2QZ4A 2F5PA 2KHHA 2CV2A 2J7NA 2HKJA 2EJSA 1N78A 4AI6A 2DAMA 4LGYA 4B3TM 3I51A 3HY5A 2KXEA 5IT9S 4DR3M 2VQFM 2RRUA 1IM2A 2VDBB 3GRUA 2F5QA 2QPAA 3QYBA 3E21A 1NSFA 1QZEA 4AKIA 1XWIA 2EKKA 1WGNA 5EP2A 3U61B 2JNHA 1C7YA 4DV5M 3U6LA 1PJTA 1R4GA 3LCUA 3GPYA 3E46A 1IN8A 2BWEA 2G8LA 4LF4M 4LF7M 3HHYA 1IN6A 1NHGC 3HHWA 1NY5A 1BVSA 3TWKA 3KP1E 2DNAA 3I4YA 1Q3CA 2DENA 4I8OA 3MK6A 2GNOA 1XXHB 2LNHC 2KNAA 1WIVA 3TL4X 3SASA 1HR0M 2FFJA 1G59A 1HQYE 1Q39A 3K8ZA 4LFCM 1P3QQ 4IBJA 2DAIA 4G4OA 1GJSA 3VFDA 2R0IA 5JI3E 4DR4M 3KFUG 2UXCM 3IECA 2L2DA 4KHPM 4B3SM 2QHOB 1VEGA 4IBBA 1NNUC 1D0LA 4LJ5A 4Z6YA 2FH0A 1X37A 2BJVA 4RKUF 4IBDA 1OAIA 4FCVA 1ZMUA 1ZMWA 3H4MA 1VDDA 1OFIA 2I7NA 1GL7A 4IJEA 1PJIA 2UXBM 1C1KA 3EIEA 3AJIB 4JV5M 4AKHA 3PNYA 2EUCA 2OQ4A 5C18A 2NQ8C 3HU1A 1E9RA 1SXJB 3CF6E 1R2ZA 4B08A 1WHCA 4A3VB 1VG5A 1A5TA 2G3QA 3LQRA 4XK8F 2JP7A 4GKKM 3ZC7B 3T15A 3L27A 2F5SA 2FOIC 3ILKA 4QNRA 2LVPC 4DUZM 2ZBKB 3MJ5A 4G4NA 4RF0A 4JYAM 3W0LB 3W68A 2XSZD 4NXNM 2C96A 2ZM6M 3J80S 4MGZE 4JI7M 5EP3A 4IBEA 1HQCA 2CHVA 4X66M 3GQ3A 4LRTA 1T43A 3GLGB 4GEWA 5IREB 1L2CA 3FRIA 2F5OA 2I7PA 3PXGA 1OTRA 1G71A 4OW0A 2LVOC 1LTMA 5KO3A 2DKLA 3KVWA 3VLFB 3TWMA 2ERCA 2EKFA 5EXSA 3TQSA 1OJLA 3THGA 3LQQA 3SHFA 3GLHB 1YE9A 3J7BA 1QVRA 4JXJA 4P17A 1PM5A 4GKJM 1TTEA 4II7A 3VDPA 1IN5A 4B7FA 2JY8A 2RKOA 5E26A 1IXZA 5IZ7D 3B7QA 3TWLA 3KS8A 1FNNA 3CF2A 5ITXA 1L2DA 4I4LA 4FD2A 3MMPA 3SYLA 2DAEA 2QSFX 2OOBA 4LJAA 3KW6A 1Z59A 1DV0A 1Q3BA 4OVZB 1IN7A 3KS4A 1QQWA 3EIHA 2QENA 3T6PA 3FD9A 4DV7M 1E32A 1V33A 1EFUB 2QBYA 3J27B 3FYDA 2L6OA 5KPZA 1L8QA 1Z5BA 2XFSA 3IG5A 4GC5A 3M7GA 1DGHA 1IFYA 2D7GA 5KPTA 3UK6A 1LV7A 4TUWA 2XF3A 3GLGE 2UUCM 1DGBA 3RFWA 1TF0B 3GO8A 2CFOA 2LH0A 5ITTA 2YQZA 1D2NA 4LY6A 3K92A 1YLAA 1RU3A 4RF1A 1K82A 3U6QA 1OIPA 4KLNA 4LGMA 4MB7A 1NO1A 2O01F 3WHLA 4K0KM 3A46A 1ZV1A 2JZ0A 4DV1M 1VEKA 2R45A 3C9PA 1IBMM 2Z8YM 4M9ZA 2X49A 1XXHA 2R6FA 5BR8M 1R5LA 3FKEA 4MGIE 4AW4A 1NV8A 3HHZA 3ZH9B 3VDUA 4BLCA 3K1JA 1TH4A 2JZ1A 1XXHE 4FWGA 3KXEC 3KOYE 4FCTA 2Y0QA 1XHBA 3F92A 4GHAA 2OOAA 3DZDA 4W5WA 2KNZA 2H5XA 2CV1A 4OVZA 2LHCA 4DR5M 3U6SA 3FUWA 4QHSA 4S12A 3SAVA 4DR7M 1TDHA 1IXRC 1T6OA 2XEPA 3U6MA 1JB0F 3VK8A 4IBIA 4M9XA 3FUUA 2LXEA 4IBFA 4L4UA 1PGYA 3AV0A 2JY5A 3I4VA 1EIJA 2WSCF 5EP1A 4JI4M 4Q7JA 2C99A 3HJ8A 4NOOB 2CRUA 3ZQJA 3HZJA 3KP0E 1QDRA 1IXSA 2HL7A 3FTCA 4DR2M 1QANA 3NWLA 5FLXS 4OU7A 1G41A 1J5EM 3NBIA 3QWLA 4YHHM 3JR4A 4MH0E 3RGPA 4F1IA 3U6CA 3SMSA 4JI2M 2C9OA 2DI0A 2L7IA 4NRVA 5FTNA 5LMNM 2UUAM 1TH3A 4QOZC 2JY6B 2F5NA 2KA6B 3AFHA 2GQFA 3FUTA 4LCBA 2H1RA 2D7EA 1L2BA 4LJ7A 4AG6A 3U61A 4IBGA 1QAOA 3L2AA 5FTJA 4RNAA 3M6AA 3GPUA 3U6EA 4QNMA 3VK7A 2KNVA 2R62A 4NSOB 5E6JA 3C58A 5LMUM 4LFBM 3GPXA 4WW0A 1HNWM 3B7NA 2QNJA 3L26A 5KPRA 3DA1A 3OTOM 4GMQA 2KEBA 2R46A 5EJCA 2LVNC 3VKHA 4DV6M 4DR6M 3FYCA 4BBAA 4PCZA 3JR5A 3I04M 3W0FA 4ANRA 4B7GA 2LWXA 1IN4A 3AOGA 3IG8A 4IIWA 4M0DA 2DWNA 2ZAOA 2DZNB 4L15A 1E9SA 3DOAA 3GRRA 4LJ6A 4WP2A 4FCWA 2X8AA 2OPFA 2C9CA 2L4EA 2DAKA 3K9OA 3KSJA 2MJ5B 4X62M 3GLIA 3U5ZB 3HWSA 5BPVA 1IY1A 1OKSA 3L29A 2V1UA 1NJFA 4QHTA 2KZUA 3HJQA 4ZPXA 2C98A 2JY7A 2ZAMA 4DV3M 2XGNA 2KDLA 4I5SA 4MGYE 1WJ7A 1QYRA 2HAKA 2E5LM 3LMMA 3QAUA 1IQPA 1TH2A 1XNRM 1CUKA 4IBKA 4JI6M 2L4FA 4MGHA 1PJJA 3M0EA 3RGSA 1VDLA 2CHGA 4GH9A 2UU9M 1HJPA 2M5ZA 4CISA 1JR3A 4M9SA 1ZAEA 1TGUA 3SMPA 3GPPA 1N33M 3BBZA 1OQYA 2HCBA 2W82A 2L7HA 3GQ5A 1PJSA 1K3XA 3CGWA 3K9PA 4LG2A 4IJFA 4UN2B 5A2QS 3GLFE 3U6OA 4LJ4A 3U60A 4JI0M 4NXMM 1N32M 1QAMA 3DFZA 3JAMS 3UJNA 2XFTA 3A45A 2KZSA 2X4AA 3Q8XA 4GIPA 4YY3M 2K0BX 2DXIA 4JI8M 3HU2A 2ZTCA 3FRHA 4DBGB 4B3RM 2N35A 1SG9A 5ITRA 2UXDM 3SHGB 2LTUA 4JN6A 1DO0A 4PDIA 5KQDA 2WSFF 3PNVA 2CWBA 2MR9A 4KO8A 2JXNA 4LZJA 2FS1A 3V76A 2OO9A 3SBJA 3U60B 1Z6TA 2CEAA 3B89A 3LVVA 5DYIA 1T3TA 2CP8A 2BNKA 2D7HA 1YSYA 4EIWA 3MHVC 5DNYA 4DV0M 2R4EA 1SXJD 2Z7JA 3L25A 4LFAM 2FNAA 1DO2A 4NL4H 4D80A 2HHHM 1W5TA 4D81A 3FUXA 3GLIB 8CATA 3U5ZA 3KOXE 4P16A 3B74A 1HNXM 1XMQM 2LHGA 4X64M 1Q02A 3RE8A 1SXJA 3GLGA 4X65M 3FUVA 1ZMVA 2R4JA 5EXPA 2DZOB 1NY6A 3E9SA 4G4QA 4XBOA 4L16A 1J09A 1YUBA 5FTMA 2APLA 2J5YA 4Z8XA 1DGHB 5FSWA 4G3OA 2XLJA 2DVWB 5DFLA 4DV4M 1XC8A 4JI1M 1HT2E 3SAUA 1QUTA 4FWDA 3GP1A 1KYIA 3GLFA 4LF6M 3GRYA 1AUAA 3A42A 4AQYM 1PJQA 5EXXA 4JI5M 4R7GA 1N75A 3B7ZA 3SAWA 2R65A 1ORYB 1NV9A 2QQ8A 3KOWE 2P5TA 2Y0TA 3LW5F 1JR3E 2RGOA 2R44A 4FWHA 4AG5A 4R3DA 5EP4A 2VQEM 1Z5AA 3AL0C 2O25A 2JA2A 3U6PA 2MROB 2VF8A 1MX0A 1R6BX 2C5RA 2WZJA 5FTKA 3D8LA 4NSRA 5EXTA 4M0WA 1E94E 3SYKA 2XSZA 3T1HM 2QBYB 2K47A 1GO5A 1PRBA 5DYGA 3KDSE 1MN3A 1KSFX 2VF7A 3PFIA 3WHKA 7CATA 3SATA 1GL6A 1GABA 2J7OA 3GLIE 2Z4RA 1GLNA 3BOSA 2DWLA 4G4RA 5H37D 2UUBM 5GKNA 3AOEA 4HL4A 3SFZA 4DUYM 3J2PB 3BXWA 1WXQA 3A98B 4B7HA 3C3DA 2AHMA 4LRSA 1R2YA 5ITQA 1OIZA 2BJWA 2B3TA 3R9XB 4PDGA 2F4VM 4LJ8A 2Y21A 1OAOC 2O5RA 4GRIA 2YNMD
chains in the Genus database with same CATH topology
1KFVA 4CHTB 1SXJE 4IBCA 3FTEA 2CV0A 4PT5A 4FVMA 4ITQA 2V6ZM 4XGIA 1IXSB 4GC9A 1NHWC 3KOZE 1I4WA 3UZUA 1IBLM 4G6ZA 3TE6A 4GHLA 1R7RA 2ZANA 1JQJC 4MM3B 2RGHA 3HHXA 3KSXA 5KQ8A 3HGIA 4REZA 3HU3A 3GRVA 3VKGA 1XNQM 4MGKE 5EQTA 3J7AS 3PVSA 4AZFA 3FTFA 1FJGM 3T38A 3B9PA 3SARA 4KODA 3U6DA 1ZQ9A 3T1YM 3TPZA 4NRWA 1IBKM 2XH9A 3LVWA 1QAQA 2VIIA 3HJSA 1HT1E 1UM8A 1JR3D 5C1BA 1N77A 2Q2EB 2YFQA 1QZMA 4LJ9A 1IY0A 2QCUA 2A5YB 2R18A 1GKIA 3AOEC 3CF0A 2EA0A 2XZUA 1L1TA 1DGGA 1MU5A 2Z4SA 2KW0A 5JI2E 2YR0A 5ITXE 2L09A 1HNZM 1Z5CA 3D8BA 2QP9X 2DHRA 3ZCBB 4FW9A 2FE8A 1G8PA 2CE7A 3SC3A 1XMOM 1J7KA 2KRUA 4LF5M 1G4AE 4AKGA 1NVMA 1SXJC 1IY2A 4LF9M 3L28A 1H6UA 1N34M 1N36M 4I81A 2Y20A 4LZZA 1W5SA 3GLFB 4BB9A 3J81S 2G5GX 1L1ZA 4B3MM 4HLQA 3K2LA 4DR1M 2DWMA 2Z3XA 4DV2M 4LF8M 5ITUA 1NNJA 1GVNA 4WURA 2M60A 1K3WA 1DGFA 1EE8A 2KRKA 5FTLA 2XZFA 3CTWB 3GLHA 2V1CA 4L78A 4L8RC 3GQ4A 5IWAM 1TDZA 4QOSA 1NJGA 2DWZB 1I94M 4CGYB 3UMMA 3E4RA 4OX9M 5F3WA 4GITA 2CHQA 1G3IA 3R8FA 4D82A 1OFHA 1S3SA 4PD2A 2EO2A 2CUZA 3FTDA 4JI3M 5ITYA 3UGJA 3HKPA 3AKZA 2QZ4A 2F5PA 2CV2A 2J7NA 2HKJA 1N78A 4AI6A 4LGYA 4B3TM 3I51A 5IT9S 2KXEA 4DR3M 2VQFM 1IM2A 3GRUA 2F5QA 2QPAA 1NSFA 4AKIA 1XWIA 3U61B 5EP2A 4DV5M 3U6LA 3GPYA 1IN8A 2G8LA 4LF4M 4LF7M 3HHYA 1IN6A 1NHGC 3HHWA 1NY5A 3TWKA 3KP1E 3I4YA 1Q3CA 4I8OA 3MK6A 1XXHB 2LNHC 3TL4X 3SASA 1HR0M 2FFJA 1G59A 1HQYE 1Q39A 3K8ZA 4LFCM 4IBJA 4G4OA 3VFDA 5JI3E 4DR4M 3KFUG 2UXCM 4KHPM 4B3SM 4Z6YA 4IBBA 1NNUC 4LJ5A 1X37A 2BJVA 4IBDA 4FCVA 3H4MA 1VDDA 1OFIA 2I7NA 1GL7A 4IJEA 1PJIA 2UXBM 1C1KA 3EIEA 3AJIB 4JV5M 4AKHA 3PNYA 2EUCA 2OQ4A 5C18A 2NQ8C 3HU1A 1E9RA 1SXJB 3CF6E 1R2ZA 4B08A 4A3VB 3LQRA 4GKKM 3ZC7B 3T15A 3L27A 2F5SA 2FOIC 3ILKA 4QNRA 4DUZM 4JYAM 2ZBKB 3MJ5A 4G4NA 4RF0A 3W0LB 2XSZD 4NXNM 2C96A 2ZM6M 3J80S 4MGZE 4JI7M 5EP3A 4IBEA 1HQCA 2CHVA 4X66M 3GQ3A 4LRTA 3GLGB 5IREB 1L2CA 2F5OA 2I7PA 3PXGA 4OW0A 5KO3A 3KVWA 3VLFB 3TWMA 2ERCA 3TQSA 5EXSA 1OJLA 3THGA 3LQQA 3SHFA 3GLHB 1YE9A 3J7BA 1QVRA 4JXJA 1PM5A 4GKJM 4II7A 3VDPA 1IN5A 4B7FA 2RKOA 5E26A 1IXZA 5IZ7D 3TWLA 3KS8A 1FNNA 3CF2A 5ITXA 1L2DA 4I4LA 4FD2A 3SYLA 4LJAA 3KW6A 1Z59A 1Q3BA 4OVZB 1IN7A 3KS4A 1QQWA 3EIHA 2QENA 4DV7M 3FD9A 1E32A 2QBYA 3J27B 3FYDA 2L6OA 5KPZA 4GC5A 1L8QA 1Z5BA 2XFSA 3IG5A 3M7GA 1DGHA 2D7GA 5KPTA 3UK6A 1LV7A 4TUWA 2XF3A 2UUCM 1DGBA 3RFWA 3GO8A 2CFOA 2LH0A 5ITTA 2YQZA 1D2NA 4LY6A 3K92A 4RF1A 1K82A 3U6QA 4KLNA 4LGMA 4MB7A 3WHLA 4K0KM 3A46A 4DV1M 2R45A 1IBMM 4M9ZA 2X49A 1XXHA 5BR8M 3FKEA 4MGIE 4AW4A 3HHZA 3ZH9B 3VDUA 4BLCA 3K1JA 1TH4A 4FWGA 3KXEC 3KOYE 4FCTA 2Y0QA 1XHBA 4GHAA 3DZDA 4W5WA 2CV1A 4OVZA 4DR5M 3U6SA 3FUWA 4QHSA 4S12A 3SAVA 1TDHA 1IXRC 2XEPA 3U6MA 3VK8A 4IBIA 4M9XA 3FUUA 2LXEA 4IBFA 4L4UA 3AV0A 3I4VA 5EP1A 4JI4M 2C99A 3HJ8A 4NOOB 3KP0E 2HL7A 3FTCA 4DR2M 1QANA 3NWLA 5FLXS 4OU7A 1G41A 1J5EM 3NBIA 3QWLA 4YHHM 3JR4A 4MH0E 3RGPA 3U6CA 3SMSA 4JI2M 2C9OA 4NRVA 2L7IA 2UUAM 5FTNA 5LMNM 1TH3A 4QOZC 2F5NA 2KA6B 3AFHA 3FUTA 4LCBA 2H1RA 2D7EA 1L2BA 4LJ7A 4AG6A 3U61A 4IBGA 1QAOA 3L2AA 5FTJA 4RNAA 3M6AA 3GPUA 3U6EA 4QNMA 3VK7A 4NSOB 2R62A 5E6JA 3C58A 5LMUM 4LFBM 3GPXA 4WW0A 1HNWM 3L26A 5KPRA 3DA1A 3OTOM 4GMQA 2KEBA 2R46A 5EJCA 3VKHA 4DV6M 4DR6M 3FYCA 4BBAA 4PCZA 3JR5A 3W0FA 4B7GA 2LWXA 1IN4A 3AOGA 3IG8A 4IIWA 4M0DA 2ZAOA 2DZNB 4L15A 1E9SA 3DOAA 3GRRA 4LJ6A 4FCWA 2X8AA 2OPFA 2C9CA 3KSJA 4X62M 3GLIA 3U5ZB 3HWSA 5BPVA 1IY1A 3L29A 2V1UA 1NJFA 4QHTA 2KZUA 3HJQA 4ZPXA 2C98A 2ZAMA 4DV3M 2XGNA 4I5SA 4MGYE 1QYRA 2E5LM 3LMMA 3QAUA 1IQPA 1TH2A 1XNRM 4IBKA 4JI6M 1PJJA 4MGHA 3M0EA 3RGSA 2CHGA 4GH9A 2UU9M 4CISA 2M5ZA 1JR3A 4M9SA 1ZAEA 1TGUA 3SMPA 3GPPA 1N33M 2HCBA 2W82A 2L7HA 3GQ5A 1K3XA 4LG2A 4IJFA 3U6OA 5A2QS 4LJ4A 3U60A 4JI0M 4NXMM 1N32M 1QAMA 3DFZA 3JAMS 3UJNA 2XFTA 3A45A 2KZSA 2X4AA 3Q8XA 4GIPA 4YY3M 2DXIA 4JI8M 3HU2A 4B3RM 5ITRA 2UXDM 3SHGB 4JN6A 1DO0A 4PDIA 5KQDA 4LZJA 3PNVA 4KO8A 3SBJA 3U60B 2DWNA 1Z6TA 2CEAA 3LVVA 5DYIA 1T3TA 4EIWA 2BNKA 2D7HA 1YSYA 5DNYA 3MHVC 4DV0M 2R4EA 1SXJD 2Z7JA 3L25A 4LFAM 2FNAA 1DO2A 4NL4H 4D80A 2HHHM 1W5TA 4D81A 3FUXA 3GLIB 8CATA 3U5ZA 3KOXE 4P16A 1HNXM 1XMQM 4X64M 3RE8A 1SXJA 3GLGA 4X65M 3FUVA 2R4JA 5EXPA 2DZOB 1NY6A 3E9SA 4G4QA 4XBOA 4L16A 1J09A 1YUBA 5FTMA 4Z8XA 5FSWA 2XLJA 1DGHB 4DV4M 2DVWB 1XC8A 4JI1M 1HT2E 3SAUA 4FWDA 3GP1A 1KYIA 3GLFA 4LF6M 3GRYA 3A42A 4AQYM 5EXXA 4JI5M 4R7GA 1N75A 3SAWA 2R65A 1ORYB 3KOWE 2P5TA 2Y0TA 2RGOA 4FWHA 4AG5A 4R3DA 5EP4A 2VQEM 1Z5AA 3AL0C 2JA2A 3U6PA 1MX0A 1R6BX 2C5RA 5FTKA 3D8LA 4NSRA 5EXTA 4M0WA 1E94E 3SYKA 2XSZA 3T1HM 2QBYB 2K47A 5DYGA 3KDSE 4DR7M 1KSFX 3PFIA 3WHKA 7CATA 3SATA 1GL6A 2J7OA 2Z4RA 1GLNA 3BOSA 2DWLA 4G4RA 5H37D 2UUBM 5GKNA 3AOEA 4HL4A 3SFZA 4DUYM 3J2PB 1WXQA 3A98B 4B7HA 4LRSA 2AHMA 1R2YA 5ITQA 2BJWA 3R9XB 4PDGA 2F4VM 4LJ8A 2Y21A 2O5RA 4GRIA 2YNMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GO8 A;  5ITT A;  1KFV A;  2E5L M;  4DV5 M;  3U6L A;  1XNR M;  3GPY A;  4JI6 M;  1PJJ A;  1K82 A;  3U6Q A;  4ITQ A;  4LF4 M;  4LF7 M;  4MB7 A;  2UU9 M;  4CIS A;  3GPP A;  1IBL M;  3TWK A;  1N33 M;  4K0K M;  3A46 A;  4DV1 M;  1Q3C A;  1IBM M;  3GQ5 A;  1K3X A;  3SAS A;  1XNQ M;  5BR8 M;  1HR0 M;  3J7A S;  1Q39 A;  4LFC M;  3U6O A;  5A2Q S;  4G4O A;  4JI0 M;  4NXM M;  1FJG M;  3JAM S;  1N32 M;  4DR4 M;  2UXC M;  3SAR A;  3A45 A;  3U6D A;  4YY3 M;  4JI8 M;  4KHP M;  3T1Y M;  4B3S M;  4NRW A;  4B3R M;  5ITR A;  1IBK M;  2UXD M;  4PDI A;  4DR5 M;  3U6S A;  3SBJ A;  3SAV A;  1TDH A;  2Q2E B;  3U6M A;  4DV0 M;  3VK8 A;  1PJI A;  2UXB M;  2EA0 A;  1L1T A;  2XZU A;  4JV5 M;  4LFA M;  1MU5 A;  2OQ4 A;  1R2Z A;  2HHH M;  5ITX E;  1HNZ M;  1Z5C A;  4JI4 M;  1HNX M;  1XMQ M;  4GKK M;  2F5S A;  4DUZ M;  4JYA M;  1XMO M;  2ZBK B;  4G4N A;  4DR2 M;  4X64 M;  5FLX S;  4NXN M;  2ZM6 M;  4LF5 M;  4X65 M;  1J5E M;  4YHH M;  3J80 S;  4JI7 M;  3JR4 A;  3U6C A;  4LF9 M;  4G4Q A;  1N34 M;  1N36 M;  4JI2 M;  4NRV A;  2UUA M;  4DV4 M;  5LMN M;  4X66 M;  3GQ3 A;  1XC8 A;  4JI1 M;  3SAU A;  3J81 S;  3GP1 A;  1L1Z A;  4LF6 M;  2F5N A;  4B3M M;  3A42 A;  4DR1 M;  1L2B A;  4AQY M;  1L2C A;  4DV2 M;  4JI5 M;  4LF8 M;  2F5O A;  5ITU A;  3SAW A;  1NNJ A;  1K3W A;  3GPU A;  3U6E A;  3VK7 A;  1EE8 A;  4LFB M;  3C58 A;  5LMU M;  3TWM A;  2VQE M;  1Z5A A;  2XZF A;  3GPX A;  3U6P A;  1HNW M;  1MX0 A;  1PM5 A;  4GKJ M;  3OTO M;  3GQ4 A;  5IWA M;  1TDZ A;  4DV6 M;  4DR6 M;  3T1H M;  1I94 M;  3TWL A;  4PCZ A;  3JR5 A;  4OX9 M;  3W0F A;  5ITX A;  4DR7 M;  3SAT A;  1L2D A;  4PD2 A;  3DOA A;  4JI3 M;  5ITY A;  1Z59 A;  1Q3B A;  2OPF A;  2F5P A;  4G4R A;  2UUB M;  4DV7 M;  4DUY M;  2HKJ A;  4X62 M;  1R2Y A;  4B3T M;  5IT9 S;  1Z5B A;  5ITQ A;  4DR3 M;  2VQF M;  4DV3 M;  2F5Q A;  4PDG A;  2F4V M;  2UUC M; 
#chains in the Genus database with same CATH topology
 1KFV A;  4CHT B;  1SXJ E;  4NC6 A;  4IBC A;  1V92 A;  3FTE A;  2CV0 A;  3H4J A;  3FE3 A;  4PT5 A;  4FVM A;  4ITQ A;  2V6Z M;  4XGI A;  1IXS B;  4GC9 A;  1NHW C;  3KOZ E;  1I4W A;  3UZU A;  1IBL M;  4G6Z A;  3TE6 A;  3LCV B;  4GHL A;  1R7R A;  2ZAN A;  1JQJ C;  4MM3 B;  2RGH A;  3HHX A;  3KSX A;  5KQ8 A;  3C3E A;  3HGI A;  2DAG A;  4REZ A;  3HU3 A;  3GRV A;  3VKG A;  1VQ1 A;  1XNQ M;  2DHY A;  3IHP A;  3NBX X;  4MGK E;  5EQT A;  3J7A S;  3PVS A;  4AZF A;  3FTF A;  1FJG M;  3T38 A;  3B9P A;  4F2L A;  3SAR A;  4KOD A;  3U6D A;  1ZQ9 A;  1UFZ A;  3T1Y M;  3TPZ A;  4NRW A;  1IBK M;  2XH9 A;  3LVW A;  1WGL A;  1QAQ A;  2MGW A;  3Q8G A;  3GLH E;  2VII A;  3QYE A;  4R71 A;  1HT1 E;  1UM8 A;  1JR3 D;  3HJS A;  4CJ6 A;  5C1B A;  1N77 A;  2Q2E B;  2YFQ A;  1QZM A;  5L8R F;  4LJ9 A;  1IY0 A;  2QCU A;  2A5Y B;  2R18 A;  4KT0 F;  1GKI A;  3AOE C;  3CF0 A;  3I01 M;  2EA0 A;  2K9D A;  2XZU A;  1L1T A;  1DGG A;  1MU5 A;  2Z4S A;  2HWJ A;  2KW0 A;  5JI2 E;  2YR0 A;  5ITX E;  2L09 A;  1HNZ M;  1Z5C A;  2MH8 A;  3D8B A;  2QP9 X;  1V34 A;  2DHR A;  3ZCB B;  4FW9 A;  2DZL A;  2FE8 A;  1G8P A;  2CE7 A;  3SC3 A;  1XMO M;  1F4I A;  1J7K A;  2KRU A;  1MJG M;  4LF5 M;  1G4A E;  4AKG A;  1NVM A;  1XB2 B;  2ZTD A;  1SXJ C;  1IY2 A;  4LF9 M;  3L28 A;  1H6U A;  1N34 M;  1N36 M;  4I81 A;  1Y8G A;  2Y20 A;  4LZZ A;  2JUJ A;  1W5S A;  3W67 A;  3GLF B;  3HX3 A;  4BB9 A;  3J81 S;  2G5G X;  1L1Z A;  4B3M M;  4HLQ A;  3K2L A;  1QDT A;  4DR1 M;  1QUS A;  2DWM A;  2Z3X A;  4DV2 M;  4LF8 M;  5ITU A;  1TR8 A;  1NNJ A;  1GVN A;  1GJT A;  1VEJ A;  4WUR A;  2M60 A;  1K3W A;  1DGF A;  1D0M A;  2LVQ D;  1EE8 A;  2KRK A;  5FTL A;  2JWS A;  2WSE F;  3CTW B;  3GLH A;  2XZF A;  2BWB A;  2V1C A;  4L78 A;  4Y28 F;  4L8R C;  3GQ4 A;  2LBC A;  5IWA M;  1TDZ A;  4CIZ A;  1AIP C;  4QOS A;  1NJG A;  2K6B A;  2DWZ B;  4HEO A;  1I94 M;  4CGY B;  3UMM A;  3E4R A;  4OX9 M;  5F3W A;  4GIT A;  2CHQ A;  1G3I A;  3R8F A;  2LVA A;  4D82 A;  1OFH A;  1S3S A;  4PD2 A;  2EO2 A;  2CUZ A;  1WR1 B;  1D0K A;  3FTD A;  4JI3 M;  4L6V 6;  5ITY A;  3HKP A;  3UGJ A;  3AKZ A;  2QZ4 A;  2F5P A;  2KHH A;  2CV2 A;  2J7N A;  2HKJ A;  2EJS A;  1N78 A;  4AI6 A;  2DAM A;  4LGY A;  4B3T M;  3I51 A;  3HY5 A;  2KXE A;  5IT9 S;  4DR3 M;  2VQF M;  2RRU A;  1IM2 A;  2VDB B;  3GRU A;  2F5Q A;  2QPA A;  3QYB A;  3E21 A;  1NSF A;  1QZE A;  4AKI A;  1XWI A;  2EKK A;  1WGN A;  5EP2 A;  3U61 B;  2JNH A;  1C7Y A;  4DV5 M;  3U6L A;  1PJT A;  1R4G A;  3LCU A;  3GPY A;  3E46 A;  1IN8 A;  2BWE A;  2G8L A;  4LF4 M;  4LF7 M;  3HHY A;  1IN6 A;  1NHG C;  3HHW A;  1NY5 A;  1BVS A;  3TWK A;  3KP1 E;  2DNA A;  3I4Y A;  1Q3C A;  2DEN A;  4I8O A;  3MK6 A;  2GNO A;  1XXH B;  2LNH C;  2KNA A;  1WIV A;  3TL4 X;  3SAS A;  1HR0 M;  2FFJ A;  1G59 A;  1HQY E;  1Q39 A;  3K8Z A;  4LFC M;  1P3Q Q;  4IBJ A;  2DAI A;  4G4O A;  1GJS A;  3VFD A;  2R0I A;  5JI3 E;  4DR4 M;  3KFU G;  2UXC M;  3IEC A;  2L2D A;  4KHP M;  4B3S M;  2QHO B;  1VEG A;  4IBB A;  1NNU C;  1D0L A;  4LJ5 A;  4Z6Y A;  2FH0 A;  1X37 A;  2BJV A;  4RKU F;  4IBD A;  1OAI A;  4FCV A;  1ZMU A;  1ZMW A;  3H4M A;  1VDD A;  1OFI A;  2I7N A;  1GL7 A;  4IJE A;  1PJI A;  2UXB M;  1C1K A;  3EIE A;  3AJI B;  4JV5 M;  4AKH A;  3PNY A;  2EUC A;  2OQ4 A;  5C18 A;  2NQ8 C;  3HU1 A;  1E9R A;  1SXJ B;  3CF6 E;  1R2Z A;  4B08 A;  1WHC A;  4A3V B;  1VG5 A;  1A5T A;  2G3Q A;  3LQR A;  4XK8 F;  2JP7 A;  4GKK M;  3ZC7 B;  3T15 A;  3L27 A;  2F5S A;  2FOI C;  3ILK A;  4QNR A;  2LVP C;  4DUZ M;  2ZBK B;  3MJ5 A;  4G4N A;  4RF0 A;  4JYA M;  3W0L B;  3W68 A;  2XSZ D;  4NXN M;  2C96 A;  2ZM6 M;  3J80 S;  4MGZ E;  4JI7 M;  5EP3 A;  4IBE A;  1HQC A;  2CHV A;  4X66 M;  3GQ3 A;  4LRT A;  1T43 A;  3GLG B;  4GEW A;  5IRE B;  1L2C A;  3FRI A;  2F5O A;  2I7P A;  3PXG A;  1OTR A;  1G71 A;  4OW0 A;  2LVO C;  1LTM A;  5KO3 A;  2DKL A;  3KVW A;  3VLF B;  3TWM A;  2ERC A;  2EKF A;  5EXS A;  3TQS A;  1OJL A;  3THG A;  3LQQ A;  3SHF A;  3GLH B;  1YE9 A;  3J7B A;  1QVR A;  4JXJ A;  4P17 A;  1PM5 A;  4GKJ M;  1TTE A;  4II7 A;  3VDP A;  1IN5 A;  4B7F A;  2JY8 A;  2RKO A;  5E26 A;  1IXZ A;  5IZ7 D;  3B7Q A;  3TWL A;  3KS8 A;  1FNN A;  3CF2 A;  5ITX A;  1L2D A;  4I4L A;  4FD2 A;  3MMP A;  3SYL A;  2DAE A;  2QSF X;  2OOB A;  4LJA A;  3KW6 A;  1Z59 A;  1DV0 A;  1Q3B A;  4OVZ B;  1IN7 A;  3KS4 A;  1QQW A;  3EIH A;  2QEN A;  3T6P A;  3FD9 A;  4DV7 M;  1E32 A;  1V33 A;  1EFU B;  2QBY A;  3J27 B;  3FYD A;  2L6O A;  5KPZ A;  1L8Q A;  1Z5B A;  2XFS A;  3IG5 A;  4GC5 A;  3M7G A;  1DGH A;  1IFY A;  2D7G A;  5KPT A;  3UK6 A;  1LV7 A;  4TUW A;  2XF3 A;  3GLG E;  2UUC M;  1DGB A;  3RFW A;  1TF0 B;  3GO8 A;  2CFO A;  2LH0 A;  5ITT A;  2YQZ A;  1D2N A;  4LY6 A;  3K92 A;  1YLA A;  1RU3 A;  4RF1 A;  1K82 A;  3U6Q A;  1OIP A;  4KLN A;  4LGM A;  4MB7 A;  1NO1 A;  2O01 F;  3WHL A;  4K0K M;  3A46 A;  1ZV1 A;  2JZ0 A;  4DV1 M;  1VEK A;  2R45 A;  3C9P A;  1IBM M;  2Z8Y M;  4M9Z A;  2X49 A;  1XXH A;  2R6F A;  5BR8 M;  1R5L A;  3FKE A;  4MGI E;  4AW4 A;  1NV8 A;  3HHZ A;  3ZH9 B;  3VDU A;  4BLC A;  3K1J A;  1TH4 A;  2JZ1 A;  1XXH E;  4FWG A;  3KXE C;  3KOY E;  4FCT A;  2Y0Q A;  1XHB A;  3F92 A;  4GHA A;  2OOA A;  3DZD A;  4W5W A;  2KNZ A;  2H5X A;  2CV1 A;  4OVZ A;  2LHC A;  4DR5 M;  3U6S A;  3FUW A;  4QHS A;  4S12 A;  3SAV A;  4DR7 M;  1TDH A;  1IXR C;  1T6O A;  2XEP A;  3U6M A;  1JB0 F;  3VK8 A;  4IBI A;  4M9X A;  3FUU A;  2LXE A;  4IBF A;  4L4U A;  1PGY A;  3AV0 A;  2JY5 A;  3I4V A;  1EIJ A;  2WSC F;  5EP1 A;  4JI4 M;  4Q7J A;  2C99 A;  3HJ8 A;  4NOO B;  2CRU A;  3ZQJ A;  3HZJ A;  3KP0 E;  1QDR A;  1IXS A;  2HL7 A;  3FTC A;  4DR2 M;  1QAN A;  3NWL A;  5FLX S;  4OU7 A;  1G41 A;  1J5E M;  3NBI A;  3QWL A;  4YHH M;  3JR4 A;  4MH0 E;  3RGP A;  4F1I A;  3U6C A;  3SMS A;  4JI2 M;  2C9O A;  2DI0 A;  2L7I A;  4NRV A;  5FTN A;  5LMN M;  2UUA M;  1TH3 A;  4QOZ C;  2JY6 B;  2F5N A;  2KA6 B;  3AFH A;  2GQF A;  3FUT A;  4LCB A;  2H1R A;  2D7E A;  1L2B A;  4LJ7 A;  4AG6 A;  3U61 A;  4IBG A;  1QAO A;  3L2A A;  5FTJ A;  4RNA A;  3M6A A;  3GPU A;  3U6E A;  4QNM A;  3VK7 A;  2KNV A;  2R62 A;  4NSO B;  5E6J A;  3C58 A;  5LMU M;  4LFB M;  3GPX A;  4WW0 A;  1HNW M;  3B7N A;  2QNJ A;  3L26 A;  5KPR A;  3DA1 A;  3OTO M;  4GMQ A;  2KEB A;  2R46 A;  5EJC A;  2LVN C;  3VKH A;  4DV6 M;  4DR6 M;  3FYC A;  4BBA A;  4PCZ A;  3JR5 A;  3I04 M;  3W0F A;  4ANR A;  4B7G A;  2LWX A;  1IN4 A;  3AOG A;  3IG8 A;  4IIW A;  4M0D A;  2DWN A;  2ZAO A;  2DZN B;  4L15 A;  1E9S A;  3DOA A;  3GRR A;  4LJ6 A;  4WP2 A;  4FCW A;  2X8A A;  2OPF A;  2C9C A;  2L4E A;  2DAK A;  3K9O A;  3KSJ A;  2MJ5 B;  4X62 M;  3GLI A;  3U5Z B;  3HWS A;  5BPV A;  1IY1 A;  1OKS A;  3L29 A;  2V1U A;  1NJF A;  4QHT A;  2KZU A;  3HJQ A;  4ZPX A;  2C98 A;  2JY7 A;  2ZAM A;  4DV3 M;  2XGN A;  2KDL A;  4I5S A;  4MGY E;  1WJ7 A;  1QYR A;  2HAK A;  2E5L M;  3LMM A;  3QAU A;  1IQP A;  1TH2 A;  1XNR M;  1CUK A;  4IBK A;  4JI6 M;  2L4F A;  4MGH A;  1PJJ A;  3M0E A;  3RGS A;  1VDL A;  2CHG A;  4GH9 A;  2UU9 M;  1HJP A;  2M5Z A;  4CIS A;  1JR3 A;  4M9S A;  1ZAE A;  1TGU A;  3SMP A;  3GPP A;  1N33 M;  3BBZ A;  1OQY A;  2HCB A;  2W82 A;  2L7H A;  3GQ5 A;  1PJS A;  1K3X A;  3CGW A;  3K9P A;  4LG2 A;  4IJF A;  4UN2 B;  5A2Q S;  3GLF E;  3U6O A;  4LJ4 A;  3U60 A;  4JI0 M;  4NXM M;  1N32 M;  1QAM A;  3DFZ A;  3JAM S;  3UJN A;  2XFT A;  3A45 A;  2KZS A;  2X4A A;  3Q8X A;  4GIP A;  4YY3 M;  2K0B X;  2DXI A;  4JI8 M;  3HU2 A;  2ZTC A;  3FRH A;  4DBG B;  4B3R M;  2N35 A;  1SG9 A;  5ITR A;  2UXD M;  3SHG B;  2LTU A;  4JN6 A;  1DO0 A;  4PDI A;  5KQD A;  2WSF F;  3PNV A;  2CWB A;  2MR9 A;  4KO8 A;  2JXN A;  4LZJ A;  2FS1 A;  3V76 A;  2OO9 A;  3SBJ A;  3U60 B;  1Z6T A;  2CEA A;  3B89 A;  3LVV A;  5DYI A;  1T3T A;  2CP8 A;  2BNK A;  2D7H A;  1YSY A;  4EIW A;  3MHV C;  5DNY A;  4DV0 M;  2R4E A;  1SXJ D;  2Z7J A;  3L25 A;  4LFA M;  2FNA A;  1DO2 A;  4NL4 H;  4D80 A;  2HHH M;  1W5T A;  4D81 A;  3FUX A;  3GLI B;  8CAT A;  3U5Z A;  3KOX E;  4P16 A;  3B74 A;  1HNX M;  1XMQ M;  2LHG A;  4X64 M;  1Q02 A;  3RE8 A;  1SXJ A;  3GLG A;  4X65 M;  3FUV A;  1ZMV A;  2R4J A;  5EXP A;  2DZO B;  1NY6 A;  3E9S A;  4G4Q A;  4XBO A;  4L16 A;  1J09 A;  1YUB A;  5FTM A;  2APL A;  2J5Y A;  4Z8X A;  1DGH B;  5FSW A;  4G3O A;  2XLJ A;  2DVW B;  5DFL A;  4DV4 M;  1XC8 A;  4JI1 M;  1HT2 E;  3SAU A;  1QUT A;  4FWD A;  3GP1 A;  1KYI A;  3GLF A;  4LF6 M;  3GRY A;  1AUA A;  3A42 A;  4AQY M;  1PJQ A;  5EXX A;  4JI5 M;  4R7G A;  1N75 A;  3B7Z A;  3SAW A;  2R65 A;  1ORY B;  1NV9 A;  2QQ8 A;  3KOW E;  2P5T A;  2Y0T A;  3LW5 F;  1JR3 E;  2RGO A;  2R44 A;  4FWH A;  4AG5 A;  4R3D A;  5EP4 A;  2VQE M;  1Z5A A;  3AL0 C;  2O25 A;  2JA2 A;  3U6P A;  2MRO B;  2VF8 A;  1MX0 A;  1R6B X;  2C5R A;  2WZJ A;  5FTK A;  3D8L A;  4NSR A;  5EXT A;  4M0W A;  1E94 E;  3SYK A;  2XSZ A;  3T1H M;  2QBY B;  2K47 A;  1GO5 A;  1PRB A;  5DYG A;  3KDS E;  1MN3 A;  1KSF X;  2VF7 A;  3PFI A;  3WHK A;  7CAT A;  3SAT A;  1GL6 A;  1GAB A;  2J7O A;  3GLI E;  2Z4R A;  1GLN A;  3BOS A;  2DWL A;  4G4R A;  5H37 D;  2UUB M;  5GKN A;  3AOE A;  4HL4 A;  3SFZ A;  4DUY M;  3J2P B;  3BXW A;  1WXQ A;  3A98 B;  4B7H A;  3C3D A;  2AHM A;  4LRS A;  1R2Y A;  5ITQ A;  1OIZ A;  2BJW A;  2B3T A;  3R9X B;  4PDG A;  2F4V M;  4LJ8 A;  2Y21 A;  1OAO C;  2O5R A;  4GRI A;  2YNM D; 
#chains in the Genus database with same CATH homology
 1KFV A;  4CHT B;  1SXJ E;  4IBC A;  3FTE A;  2CV0 A;  4PT5 A;  4FVM A;  4ITQ A;  2V6Z M;  4XGI A;  1IXS B;  4GC9 A;  1NHW C;  3KOZ E;  1I4W A;  3UZU A;  1IBL M;  4G6Z A;  3TE6 A;  4GHL A;  1R7R A;  2ZAN A;  1JQJ C;  4MM3 B;  2RGH A;  3HHX A;  3KSX A;  5KQ8 A;  3HGI A;  4REZ A;  3HU3 A;  3GRV A;  3VKG A;  1XNQ M;  4MGK E;  5EQT A;  3J7A S;  3PVS A;  4AZF A;  3FTF A;  1FJG M;  3T38 A;  3B9P A;  3SAR A;  4KOD A;  3U6D A;  1ZQ9 A;  3T1Y M;  3TPZ A;  4NRW A;  1IBK M;  2XH9 A;  3LVW A;  1QAQ A;  2VII A;  3HJS A;  1HT1 E;  1UM8 A;  1JR3 D;  5C1B A;  1N77 A;  2Q2E B;  2YFQ A;  1QZM A;  4LJ9 A;  1IY0 A;  2QCU A;  2A5Y B;  2R18 A;  1GKI A;  3AOE C;  3CF0 A;  2EA0 A;  2XZU A;  1L1T A;  1DGG A;  1MU5 A;  2Z4S A;  2KW0 A;  5JI2 E;  2YR0 A;  5ITX E;  2L09 A;  1HNZ M;  1Z5C A;  3D8B A;  2QP9 X;  2DHR A;  3ZCB B;  4FW9 A;  2FE8 A;  1G8P A;  2CE7 A;  3SC3 A;  1XMO M;  1J7K A;  2KRU A;  4LF5 M;  1G4A E;  4AKG A;  1NVM A;  1SXJ C;  1IY2 A;  4LF9 M;  3L28 A;  1H6U A;  1N34 M;  1N36 M;  4I81 A;  2Y20 A;  4LZZ A;  1W5S A;  3GLF B;  4BB9 A;  3J81 S;  2G5G X;  1L1Z A;  4B3M M;  4HLQ A;  3K2L A;  4DR1 M;  2DWM A;  2Z3X A;  4DV2 M;  4LF8 M;  5ITU A;  1NNJ A;  1GVN A;  4WUR A;  2M60 A;  1K3W A;  1DGF A;  1EE8 A;  2KRK A;  5FTL A;  2XZF A;  3CTW B;  3GLH A;  2V1C A;  4L78 A;  4L8R C;  3GQ4 A;  5IWA M;  1TDZ A;  4QOS A;  1NJG A;  2DWZ B;  1I94 M;  4CGY B;  3UMM A;  3E4R A;  4OX9 M;  5F3W A;  4GIT A;  2CHQ A;  1G3I A;  3R8F A;  4D82 A;  1OFH A;  1S3S A;  4PD2 A;  2EO2 A;  2CUZ A;  3FTD A;  4JI3 M;  5ITY A;  3UGJ A;  3HKP A;  3AKZ A;  2QZ4 A;  2F5P A;  2CV2 A;  2J7N A;  2HKJ A;  1N78 A;  4AI6 A;  4LGY A;  4B3T M;  3I51 A;  5IT9 S;  2KXE A;  4DR3 M;  2VQF M;  1IM2 A;  3GRU A;  2F5Q A;  2QPA A;  1NSF A;  4AKI A;  1XWI A;  3U61 B;  5EP2 A;  4DV5 M;  3U6L A;  3GPY A;  1IN8 A;  2G8L A;  4LF4 M;  4LF7 M;  3HHY A;  1IN6 A;  1NHG C;  3HHW A;  1NY5 A;  3TWK A;  3KP1 E;  3I4Y A;  1Q3C A;  4I8O A;  3MK6 A;  1XXH B;  2LNH C;  3TL4 X;  3SAS A;  1HR0 M;  2FFJ A;  1G59 A;  1HQY E;  1Q39 A;  3K8Z A;  4LFC M;  4IBJ A;  4G4O A;  3VFD A;  5JI3 E;  4DR4 M;  3KFU G;  2UXC M;  4KHP M;  4B3S M;  4Z6Y A;  4IBB A;  1NNU C;  4LJ5 A;  1X37 A;  2BJV A;  4IBD A;  4FCV A;  3H4M A;  1VDD A;  1OFI A;  2I7N A;  1GL7 A;  4IJE A;  1PJI A;  2UXB M;  1C1K A;  3EIE A;  3AJI B;  4JV5 M;  4AKH A;  3PNY A;  2EUC A;  2OQ4 A;  5C18 A;  2NQ8 C;  3HU1 A;  1E9R A;  1SXJ B;  3CF6 E;  1R2Z A;  4B08 A;  4A3V B;  3LQR A;  4GKK M;  3ZC7 B;  3T15 A;  3L27 A;  2F5S A;  2FOI C;  3ILK A;  4QNR A;  4DUZ M;  4JYA M;  2ZBK B;  3MJ5 A;  4G4N A;  4RF0 A;  3W0L B;  2XSZ D;  4NXN M;  2C96 A;  2ZM6 M;  3J80 S;  4MGZ E;  4JI7 M;  5EP3 A;  4IBE A;  1HQC A;  2CHV A;  4X66 M;  3GQ3 A;  4LRT A;  3GLG B;  5IRE B;  1L2C A;  2F5O A;  2I7P A;  3PXG A;  4OW0 A;  5KO3 A;  3KVW A;  3VLF B;  3TWM A;  2ERC A;  3TQS A;  5EXS A;  1OJL A;  3THG A;  3LQQ A;  3SHF A;  3GLH B;  1YE9 A;  3J7B A;  1QVR A;  4JXJ A;  1PM5 A;  4GKJ M;  4II7 A;  3VDP A;  1IN5 A;  4B7F A;  2RKO A;  5E26 A;  1IXZ A;  5IZ7 D;  3TWL A;  3KS8 A;  1FNN A;  3CF2 A;  5ITX A;  1L2D A;  4I4L A;  4FD2 A;  3SYL A;  4LJA A;  3KW6 A;  1Z59 A;  1Q3B A;  4OVZ B;  1IN7 A;  3KS4 A;  1QQW A;  3EIH A;  2QEN A;  4DV7 M;  3FD9 A;  1E32 A;  2QBY A;  3J27 B;  3FYD A;  2L6O A;  5KPZ A;  4GC5 A;  1L8Q A;  1Z5B A;  2XFS A;  3IG5 A;  3M7G A;  1DGH A;  2D7G A;  5KPT A;  3UK6 A;  1LV7 A;  4TUW A;  2XF3 A;  2UUC M;  1DGB A;  3RFW A;  3GO8 A;  2CFO A;  2LH0 A;  5ITT A;  2YQZ A;  1D2N A;  4LY6 A;  3K92 A;  4RF1 A;  1K82 A;  3U6Q A;  4KLN A;  4LGM A;  4MB7 A;  3WHL A;  4K0K M;  3A46 A;  4DV1 M;  2R45 A;  1IBM M;  4M9Z A;  2X49 A;  1XXH A;  5BR8 M;  3FKE A;  4MGI E;  4AW4 A;  3HHZ A;  3ZH9 B;  3VDU A;  4BLC A;  3K1J A;  1TH4 A;  4FWG A;  3KXE C;  3KOY E;  4FCT A;  2Y0Q A;  1XHB A;  4GHA A;  3DZD A;  4W5W A;  2CV1 A;  4OVZ A;  4DR5 M;  3U6S A;  3FUW A;  4QHS A;  4S12 A;  3SAV A;  1TDH A;  1IXR C;  2XEP A;  3U6M A;  3VK8 A;  4IBI A;  4M9X A;  3FUU A;  2LXE A;  4IBF A;  4L4U A;  3AV0 A;  3I4V A;  5EP1 A;  4JI4 M;  2C99 A;  3HJ8 A;  4NOO B;  3KP0 E;  2HL7 A;  3FTC A;  4DR2 M;  1QAN A;  3NWL A;  5FLX S;  4OU7 A;  1G41 A;  1J5E M;  3NBI A;  3QWL A;  4YHH M;  3JR4 A;  4MH0 E;  3RGP A;  3U6C A;  3SMS A;  4JI2 M;  2C9O A;  4NRV A;  2L7I A;  2UUA M;  5FTN A;  5LMN M;  1TH3 A;  4QOZ C;  2F5N A;  2KA6 B;  3AFH A;  3FUT A;  4LCB A;  2H1R A;  2D7E A;  1L2B A;  4LJ7 A;  4AG6 A;  3U61 A;  4IBG A;  1QAO A;  3L2A A;  5FTJ A;  4RNA A;  3M6A A;  3GPU A;  3U6E A;  4QNM A;  3VK7 A;  4NSO B;  2R62 A;  5E6J A;  3C58 A;  5LMU M;  4LFB M;  3GPX A;  4WW0 A;  1HNW M;  3L26 A;  5KPR A;  3DA1 A;  3OTO M;  4GMQ A;  2KEB A;  2R46 A;  5EJC A;  3VKH A;  4DV6 M;  4DR6 M;  3FYC A;  4BBA A;  4PCZ A;  3JR5 A;  3W0F A;  4B7G A;  2LWX A;  1IN4 A;  3AOG A;  3IG8 A;  4IIW A;  4M0D A;  2ZAO A;  2DZN B;  4L15 A;  1E9S A;  3DOA A;  3GRR A;  4LJ6 A;  4FCW A;  2X8A A;  2OPF A;  2C9C A;  3KSJ A;  4X62 M;  3GLI A;  3U5Z B;  3HWS A;  5BPV A;  1IY1 A;  3L29 A;  2V1U A;  1NJF A;  4QHT A;  2KZU A;  3HJQ A;  4ZPX A;  2C98 A;  2ZAM A;  4DV3 M;  2XGN A;  4I5S A;  4MGY E;  1QYR A;  2E5L M;  3LMM A;  3QAU A;  1IQP A;  1TH2 A;  1XNR M;  4IBK A;  4JI6 M;  1PJJ A;  4MGH A;  3M0E A;  3RGS A;  2CHG A;  4GH9 A;  2UU9 M;  4CIS A;  2M5Z A;  1JR3 A;  4M9S A;  1ZAE A;  1TGU A;  3SMP A;  3GPP A;  1N33 M;  2HCB A;  2W82 A;  2L7H A;  3GQ5 A;  1K3X A;  4LG2 A;  4IJF A;  3U6O A;  5A2Q S;  4LJ4 A;  3U60 A;  4JI0 M;  4NXM M;  1N32 M;  1QAM A;  3DFZ A;  3JAM S;  3UJN A;  2XFT A;  3A45 A;  2KZS A;  2X4A A;  3Q8X A;  4GIP A;  4YY3 M;  2DXI A;  4JI8 M;  3HU2 A;  4B3R M;  5ITR A;  2UXD M;  3SHG B;  4JN6 A;  1DO0 A;  4PDI A;  5KQD A;  4LZJ A;  3PNV A;  4KO8 A;  3SBJ A;  3U60 B;  2DWN A;  1Z6T A;  2CEA A;  3LVV A;  5DYI A;  1T3T A;  4EIW A;  2BNK A;  2D7H A;  1YSY A;  5DNY A;  3MHV C;  4DV0 M;  2R4E A;  1SXJ D;  2Z7J A;  3L25 A;  4LFA M;  2FNA A;  1DO2 A;  4NL4 H;  4D80 A;  2HHH M;  1W5T A;  4D81 A;  3FUX A;  3GLI B;  8CAT A;  3U5Z A;  3KOX E;  4P16 A;  1HNX M;  1XMQ M;  4X64 M;  3RE8 A;  1SXJ A;  3GLG A;  4X65 M;  3FUV A;  2R4J A;  5EXP A;  2DZO B;  1NY6 A;  3E9S A;  4G4Q A;  4XBO A;  4L16 A;  1J09 A;  1YUB A;  5FTM A;  4Z8X A;  5FSW A;  2XLJ A;  1DGH B;  4DV4 M;  2DVW B;  1XC8 A;  4JI1 M;  1HT2 E;  3SAU A;  4FWD A;  3GP1 A;  1KYI A;  3GLF A;  4LF6 M;  3GRY A;  3A42 A;  4AQY M;  5EXX A;  4JI5 M;  4R7G A;  1N75 A;  3SAW A;  2R65 A;  1ORY B;  3KOW E;  2P5T A;  2Y0T A;  2RGO A;  4FWH A;  4AG5 A;  4R3D A;  5EP4 A;  2VQE M;  1Z5A A;  3AL0 C;  2JA2 A;  3U6P A;  1MX0 A;  1R6B X;  2C5R A;  5FTK A;  3D8L A;  4NSR A;  5EXT A;  4M0W A;  1E94 E;  3SYK A;  2XSZ A;  3T1H M;  2QBY B;  2K47 A;  5DYG A;  3KDS E;  4DR7 M;  1KSF X;  3PFI A;  3WHK A;  7CAT A;  3SAT A;  1GL6 A;  2J7O A;  2Z4R A;  1GLN A;  3BOS A;  2DWL A;  4G4R A;  5H37 D;  2UUB M;  5GKN A;  3AOE A;  4HL4 A;  3SFZ A;  4DUY M;  3J2P B;  1WXQ A;  3A98 B;  4B7H A;  4LRS A;  2AHM A;  1R2Y A;  5ITQ A;  2BJW A;  3R9X B;  4PDG A;  2F4V M;  4LJ8 A;  2Y21 A;  2O5R A;  4GRI A;  2YNM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...