4JI5M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji5M02
4G4OA 2E5LM 4PDIA 1EE8A 4DV2M 4JI7M 2Q2EB 2XZFA 5IWAM 3U6EA 3U6LA 3TWLA 2VQEM 4DUYM 1TDZA 2UXCM 1Z5CA 3GO8A 4X64M 4DV4M 2UUBM 4DR5M 1N33M 4DUZM 4JI2M 4JI0M 3W0FA 3T1YM 3JAMS 3U6MA 1XMOM 1Q3CA 1L2CA 5LMUM 4JI3M 4LF8M 4DV7M 3GPXA 4DV0M 4B3RM 4PD2A 4DR3M 2F5PA 2F5OA 4GKKM 3T1HM 1L1ZA 1IBMM 4JI4M 5FLXS 4DV5M 1I94M 4NRVA 2OPFA 1IBLM 4B3SM 3C58A 4X65M 4G4QA 1J5EM 3J7AS 4B3MM 2UU9M 3A45A 4DR6M 2UXDM 3VK8A 4JYAM 2ZBKB 4DR1M 5A2QS 4CISA 5LMNM 1PJJA 1K3XA 2F4VM 3U6QA 1TDHA 1MU5A 3GP1A 3JR5A 4YHHM 1HNZM 3SBJA 1Z5BA 1XNQM 3SATA 5ITYA 4PCZA 1NNJA 1Q39A 1L2BA 3TWMA 1XMQM 4KHPM 1XC8A 1KFVA 2F5QA 2ZM6M 5IT9S 4LF4M 1XNRM 2UUCM 1R2YA 1L2DA 5ITRA 1N32M 2HHHM 4LFBM 2F5NA 3GPPA 4K0KM 5ITTA 4AQYM 1MX0A 3GPUA 3DOAA 3SAWA 3GQ3A 3GPYA 4DV1M 4G4RA 4X66M 4G4NA 3SAUA 1HNXM 1K3WA 3U6PA 4LF7M 4JI5M 5ITXA 1Z5AA 4DR7M 2HKJA 3A46A 4NXNM 3SAVA 3U6CA 4JV5M 4LFCM 4YY3M 4DV6M 1N36M 2VQFM 4GKJM 1PJIA 3GQ4A 2EA0A 1Z59A 4LFAM 1K82A 4NXMM 4X62M 2F5SA 1FJGM 4PDGA 4MB7A 4LF9M 2OQ4A 2XZUA 1HR0M 5ITQA 3J81S 3TWKA 2UXBM 4DR2M 4NRWA 4DV3M 3A42A 3OTOM 3SARA 1HNWM 4LF5M 1Q3BA 5ITXE 1R2ZA 1N34M 3U6OA 3GQ5A 3U6SA 4JI6M 2UUAM 1IBKM 5ITUA 1L1TA 3JR4A 3SASA 3VK7A 4ITQA 4LF6M 4JI1M 4B3TM 3J80S 4OX9M 3U6DA 4DR4M 5BR8M 1PM5A 4JI8M
chains in the Genus database with same CATH superfamily
3L26A 4AG6A 2KDLA 4AKGA 1GL6A 5IT9S 3C3DA 4KO8A 2DAGA 3U6LA 1TDZA 4M0WA 1NVMA 3M6AA 5EP3A 1QUTA 3TWLA 2VQEM 4DUYM 4X64M 2UXCM 3RGSA 2UUBM 4Z8XA 4JI2M 2CFOA 2QCUA 2JZ1A 4F1IA 3U6MA 4I81A 2R6FA 4DBGB 3TL4X 1V33A 3FTCA 4JI3M 2K0BX 3D8LA 4KLNA 4GH9A 2H1RA 4CGYB 3B7NA 3LMMA 1W5SA 2KNZA 3T1HM 4BB9A 3K92A 3MHVC 1IBMM 5DYGA 3TE6A 1UM8A 3FYDA 4NRVA 3GRVA 3DA1A 4G4QA 2KNAA 1VEKA 2LBCA 1VDDA 1X37A 3H4JA 3HJQA 3HU1A 1OIZA 1Q02A 3K1JA 2CRUA 3LW5F 3R9XB 2X49A 4LJ6A 1R4GA 4WW0A 5EXPA 4NSOB 4R7GA 1KSFX 2CHQA 1SG9A 1OAOC 1XWIA 1A5TA 2ZBKB 2K47A 3BBZA 3FRIA 1WGNA 3L29A 3I01M 1WHCA 2HWJA 2FE8A 4IBEA 1K3XA 3NBXX 2Z3XA 4LY6A 3GLFB 1NV9A 2QQ8A 2RGHA 4NOOB 4RF0A 4B7HA 1LV7A 1G4AE 2RGOA 2ZTCA 2KEBA 4YHHM 1DGGA 2DAEA 2DKLA 4Y28F 2CHVA 1NNJA 1Q39A 1ZMWA 3FYCA 1L2BA 3AOEA 4KHPM 5C1BA 3B9PA 2ZAMA 5EXTA 5FTMA 1NSFA 2GNOA 3HJ8A 2ZAOA 4LF4M 2CV0A 2JWSA 4IBBA 1SXJA 3T38A 3GLHB 4Z6YA 3MMPA 2L6OA 4LJ7A 2F5NA 3SHFA 2ERCA 2I7PA 4BLCA 4CHTB 4K0KM 1E32A 1WXQA 1YSYA 3W67A 5JI3E 2QSFX 2O01F 2X4AA 3DFZA 4HEOA 3GLGE 3SAWA 1HJPA 3LCVB 3V76A 3GPYA 4BBAA 1IN5A 2QP9X 4MGIE 1HNXM 1R6BX 2JY7A 1F4IA 1QDRA 1TH4A 1WIVA 5ITXA 4LJ9A 2EJSA 4AKHA 2EKKA 5E6JA 2DWLA 2XSZA 2VDBB 3KOWE 4FCTA 4IJFA 3U60B 5DYIA 3KFUG 4A3VB 2D7EA 2VQFM 5EP2A 1NJFA 4LGYA 2CV2A 1T43A 4LFAM 3SYLA 3K9OA 2XH9A 5L8RF 3A98B 3HZJA 4LF9M 2CEAA 4QNMA 3CGWA 2OQ4A 5ITQA 1PRBA 1NO1A 3FTDA 1JR3A 4DR2M 2DAIA 3J27B 4LJ8A 4DV3M 1TF0B 2I7NA 3A42A 5IREB 4M9SA 4LZZA 1GJTA 3AV0A 1R2ZA 1N34M 3U6OA 1NJGA 4JI6M 1R7RA 4IBFA 2X8AA 2LNHC 3JR4A 3W0LB 3SMSA 2QZ4A 4LF6M 2DAKA 1OIPA 2FNAA 3GLFA 3BXWA 2FH0A 1TH3A 3UK6A 4JI8M 4G4OA 3QYEA 4B7GA 4FWHA 3L2AA 4PDIA 1EE8A 4DV2M 2ZANA 1S3SA 1XXHB 4JI7M 1BVSA 1GO5A 1D0LA 1DGHB 2L09A 2R46A 3EIHA 3T6PA 1N33M 1QZMA 4DUZM 4GITA 2DENA 1XB2B 3GLHA 1YUBA 1OFHA 1J7KA 2M60A 3UJNA 3C9PA 3K9PA 2QBYA 1AUAA 3QWLA 1EIJA 5GKNA 3CF2A 4HL4A 4OW0A 4LRSA 1TGUA 4KODA 4TUWA 2GQFA 3T15A 2F5OA 2QHOB 3B89A 3UMMA 2J5YA 1D0MA 1GJSA 2XFTA 4CJ6A 4JI4M 1QAQA 1QYRA 4DV5M 4FCVA 3GLIB 2BWBA 1ZQ9A 2OPFA 2R4JA 4B7FA 1IBLM 4B3SM 3HGIA 4OVZB 2CV1A 2RKOA 3J7AS 2JY5A 2JZ0A 4B3MM 5FTNA 4GHAA 3U60A 1Z6TA 3A45A 2UU9M 4DR6M 2W82A 2Y0QA 1P3QQ 3VK8A 1SXJD 2J7NA 4DR1M 4P17A 4CISA 5EXXA 1QVRA 4MGZE 5KO3A 3LCUA 3GRUA 2DNAA 1WJ7A 3U6QA 3GP1A 1MU5A 1QAMA 2C98A 3SBJA 2FOIC 3FUXA 2JA2A 3UGJA 3KW6A 3TWMA 4AZFA 2JXNA 4KT0F 4WP2A 2ZM6M 4CIZA 1G8PA 4G3OA 1GLNA 3RFWA 2C9CA 2XSZD 4B08A 1L2DA 2L4EA 3AKZA 4MM3B 3GPPA 2QNJA 4IIWA 1VEJA 4M9ZA 3U61B 4D81A 3B7QA 3W68A 1MX0A 2V1UA 1UFZA 1OJLA 1AIPC 1D0KA 3NWLA 3I4VA 1XXHA 4DV1M 3B7ZA 4RF1A 1JR3D 4G4NA 5FTJA 1DGHA 2CP8A 1E9RA 3SAUA 1N77A 1K3WA 4LF7M 2DZOB 3MK6A 3QAUA 3J7BA 2WZJA 1Z5AA 3L28A 2HKJA 1NV8A 3A46A 1SXJE 4L4UA 2LTUA 2CWBA 3THGA 3I51A 4LJ5A 2YQZA 4ZPXA 4YY3M 3E21A 2OOAA 4UN2B 4GEWA 1PJSA 2LXEA 2DWNA 3HKPA 2OO9A 1Z59A 4PDGA 4MB7A 4LG2A 1HR0M 2FFJA 3GLIA 2BWEA 1IY1A 1IXSB 3J81S 3IECA 4OVZA 4Q7JA 2O25A 5C18A 3SARA 4NSRA 2R65A 2VIIA 4LF5M 1OKSA 5ITXE 1NHGC 4GIPA 2DZLA 3U6SA 2UUAM 2APLA 3SASA 2LHGA 4P16A 1VG5A 4NC6A 2Z8YM 3VK7A 3AOGA 4JI1M 3J80S 2HAKA 4OX9M 5KPZA 3HX3A 1ZV1A 1NY6A 4XGIA 4DR4M 1DV0A 2KRUA 5BPVA 4D80A 2K9DA 3SHGB 5DNYA 2DWMA 5F3WA 1JR3E 2DI0A 4XBOA 1ZAEA 2KXEA 4IBIA 4GC9A 1Z5CA 3KP1E 3GRRA 4DV4M 4DR5M 3KOXE 2L4FA 3NBIA 3VLFB 4JI0M 3SFZA 3T1YM 4F2LA 4IBDA 2KRKA 2KZSA 3E9SA 1GVNA 1Q3CA 1QAOA 1ZMVA 2XFSA 5LMUM 5KQ8A 3U61A 1L2CA 4LF8M 3LQQA 4DV7M 3GLFE 5FTLA 3GPXA 3FRHA 2F5PA 4DR3M 4FCWA 2MGWA 4GKKM 2NQ8C 1H6UA 2J7OA 2BJVA 3FUUA 1QUSA 2LVQD 5EQTA 8CATA 4L8RC 4W5WA 1TR8A 1IQPA 3DZDA 1TH2A 2V6ZM 1NY5A 4FWGA 4X65M 3C58A 1YE9A 1OQYA 2DVWB 4I4LA 3LVVA 2N35A 3GRYA 3GLHE 2UXDM 1E9SA 4I5SA 2DHYA 2L7HA 2L2DA 2DXIA 4JYAM 3HJSA 5A2QS 5H37D 1WGLA 5FSWA 1R5LA 4L16A 3SC3A 1IXSA 2BNKA 4LZJA 2H5XA 2CHGA 3JR5A 2QENA 1IN7A 3HHWA 4QHTA 4AKIA 2R62A 1Z5BA 3SATA 5ITYA 2P5TA 4OU7A 1N78A 2R18A 4FW9A 1Y8GA 1XC8A 1PJQA 1HQYE 2UUCM 1XNRM 5EXSA 4MGHA 3AJIB 3KS8A 1IFYA 3KOZE 4QOSA 4GRIA 2HHHM 2Y20A 3FTEA 4JXJA 1IN6A 3KSXA 3SYKA 4AQYM 3D8BA 2QPAA 4LRTA 3KDSE 3K8ZA 3GPUA 4MH0E 3DOAA 3FUTA 3AFHA 3GQ3A 2LVPC 2R4EA 2DHRA 3ZH9B 2WSCF 3PNVA 3J2PB 4QHSA 3U6PA 2C96A 1E94E 3M0EA 1G41A 5IZ7D 3PVSA 3C3EA 2WSEF 2Y21A 5DFLA 1L8QA 4DR7M 1IXZA 2YR0A 4NXNM 4R71A 3U6CA 3SAVA 1N36M 2KA6B 2D7HA 3LVWA 3VDPA 3R8FA 5KPTA 4QOZC 1V34A 3CF6E 4GKJM 1DO0A 1PJIA 3GQ4A 4NXMM 4FD2A 4II7A 3Q8XA 3HHZA 3VKGA 1XXHE 2XZUA 3ZCBB 4IJEA 3VFDA 3TWKA 2UXBM 3KXEC 3GLGB 2MH8A 4NRWA 3OTOM 4FVMA 1HNWM 2L7IA 2DZNB 1Q3BA 3FUWA 2MJ5B 1G3IA 3HHXA 3GQ5A 3RGPA 2KNVA 1G59A 3LQRA 2RRUA 1IM2A 1IBKM 5ITUA 3FTFA 1L1TA 4QNRA 1HT2E 2C99A 3HY5A 2V1CA 3AL0C 2YNMD 4IBCA 4R3DA 5EP1A 4MGKE 4B3TM 3PFIA 3U6DA 1DGBA 2LVNC 5BR8M 2XEPA 1PM5A 1PJTA 2E5LM 3GLIE 2ZTDA 4LJAA 1ORYB 2Q2EB 3MJ5A 2XZFA 3VKHA 5IWAM 3U6EA 3L27A 3GO8A 3HWSA 3M7GA 5KQDA 3W0FA 3IG5A 1G71A 1HQCA 2EO2A 2KHHA 1IN4A 2Z7JA 3AOEC 3I04M 3JAMS 4M0DA 3U5ZB 1XMOM 3RE8A 1J5EM 2K6BA 2MR9A 3WHKA 3Q8GA 3PNYA 1SXJC 4L78A 3KSJA 2KW0A 1NHWC 4L6V6 4DV0M 4MGYE 2B3TA 4PD2A 4B3RM 4FWDA 1NNUC 1DGFA 2CE7A 2G5GX 1L1ZA 3HHYA 3FUVA 2JY8A 2EUCA 5FLXS 4L15A 4AW4A 1I94M 7CATA 3KVWA 1EFUB 2M5ZA 4EIWA 2LVAA 3I4YA 3E46A 1JB0F 2LVOC 5EP4A 3FE3A 2O5RA 4LGMA 3TPZA 4ANRA 5EJCA 5E26A 4REZA 2HL7A 2KZUA 4IBKA 5LMNM 1PJJA 4GC5A 1I4WA 1JQJC 3HU3A 4PT5A 3BOSA 3IG8A 3SMPA 2LWXA 1QDTA 2F4VM 1V92A 3FKEA 1TDHA 3GLGA 1HNZM 1YLAA 2CUZA 1PGYA 2MROB 3VDUA 1XNQM 3HU2A 2JNHA 2C5RA 1OTRA 4PCZA 2XLJA 4G6ZA 4GHLA 3ZQJA 2QBYB 3IHPA 2C9OA 1WR1B 1IXRC 1XMQM 1KFVA 1GL7A 1W5TA 4AG5A 1T6OA 2VF7A 3KOYE 2F5QA 1J09A 1QZEA 2WSFF 1MN3A 2R45A 4LCBA 3ZC7B 1R2YA 4AI6A 4HLQA 1KYIA 3WHLA 5ITRA 1N32M 1DO2A 3TQSA 4LFBM 1ZMUA 4RNAA 1C1KA 4NL4H 4S12A 5ITTA 1GKIA 2G3QA 3E4RA 3EIEA 3FD9A 4G4RA 1VEGA 1OAIA 4X66M 2Y0TA 4RKUF 3CF0A 3CTWB 2JP7A 2HCBA 3PXGA 4M9XA 1QQWA 1XHBA 2LHCA 4IBJA 4JI5M 1N75A 2VF8A 3H4MA 2FS1A 1MJGM 3K2LA 3U5ZA 2Z4SA 1CUKA 4GMQA 1IN8A 4WURA 4JV5M 1QANA 4LFCM 4DV6M 2G8LA 1TTEA 2D7GA 1IY2A 2XGNA 2BJWA 3KS4A 2EA0A 1RU3A 1K82A 3QYBA 4X62M 2F5SA 1FJGM 3B74A 2AHMA 2YFQA 4XK8F 1LTMA 2JUJA 1T3TA 2LH0A 1FNNA 2JY6B 1VQ1A 2A5YB 2DAMA 2XF3A 1GABA 1HT1E 4JN6A 3F92A 4I8OA 3L25A 1VDLA 4IBGA 1C7YA 3KP0E 4LJ4A 5JI2E 3ILKA 5FTKA 1IY0A 5KPRA 1OFIA 1D2NA 2R0IA 4D82A 4ITQA 2OOBA 1SXJB 3UZUA 2Z4RA 2EKFA 2R44A 2DWZB
chains in the Genus database with same CATH topology
3L26A 4AG6A 4AKGA 1GL6A 4KO8A 3U6LA 1TDZA 4M0WA 1NVMA 3M6AA 5EP3A 3TWLA 2VQEM 4DUYM 2QBYA 4X64M 2UXCM 3RGSA 2UUBM 4Z8XA 4JI2M 2CFOA 2QCUA 3U6MA 4I81A 3TL4X 3FTCA 4JI3M 3D8LA 4KLNA 4GH9A 2H1RA 4CGYB 3LMMA 1W5SA 3T1HM 4BB9A 3K92A 3MHVC 1IBMM 5DYGA 3TE6A 1UM8A 3FYDA 4NRVA 3GRVA 3DA1A 4G4QA 3SHGB 1VDDA 1X37A 3HJQA 3K1JA 1J5EM 3HU1A 3R9XB 2X49A 4LJ6A 4WW0A 5EXPA 4NSOB 4R7GA 1KSFX 2CHQA 1XWIA 2ZBKB 2K47A 3L29A 1K3XA 4IBEA 2FE8A 2Z3XA 4LY6A 3GLFB 2RGHA 4NOOB 4B7HA 4RF0A 1LV7A 1G4AE 2RGOA 4YHHM 2KEBA 1DGGA 2CHVA 1NNJA 1Q39A 1L2BA 3FYCA 3AOEA 4KHPM 5C1BA 3B9PA 2ZAMA 5EXTA 5FTMA 1NSFA 3HJ8A 2ZAOA 4LF4M 2CV0A 4IBBA 1SXJA 3T38A 3GLHB 4Z6YA 2L6OA 4LJ7A 2F5NA 3SHFA 2ERCA 2I7PA 4BLCA 4CHTB 4K0KM 1E32A 1WXQA 1YSYA 5JI3E 3SAWA 2X4AA 3DFZA 3GPYA 4BBAA 1IN5A 2QP9X 4MGIE 1HNXM 1R6BX 1TH4A 5ITXA 4LJ9A 4AKHA 5E6JA 2DWLA 2XSZA 3KOWE 4FCTA 4IJFA 3U60B 3KFUG 5DYIA 4A3VB 2D7EA 2VQFM 5EP2A 1NJFA 4LGYA 2CV2A 4LFAM 3SYLA 2XH9A 3A98B 4LF9M 2CEAA 4QNMA 2OQ4A 5ITQA 3FTDA 1JR3A 4DR2M 4LJ8A 3J27B 4DV3M 3A42A 2I7NA 5IREB 4M9SA 4LZZA 3AV0A 1R2ZA 1N34M 3U6OA 1NJGA 4JI6M 1R7RA 4IBFA 2X8AA 2LNHC 3JR4A 3W0LB 3SMSA 2QZ4A 4LF6M 2FNAA 3GLFA 1TH3A 3UK6A 4JI8M 4G4OA 4B7GA 4FWHA 3L2AA 4PDIA 1EE8A 4DV2M 2ZANA 1S3SA 1XXHB 4JI7M 1DGHB 2L09A 2R46A 3EIHA 1N33M 1QZMA 4DUZM 4GITA 3GLHA 1YUBA 1OFHA 1J7KA 2M60A 3UJNA 3QWLA 5GKNA 3CF2A 4HL4A 4OW0A 4LRSA 1TGUA 4KODA 4TUWA 3T15A 2F5OA 3UMMA 2XFTA 4JI4M 1QYRA 1QAQA 4DV5M 4FCVA 3GLIB 1ZQ9A 2OPFA 2R4JA 4B7FA 1IBLM 4B3SM 3HGIA 4OVZB 2CV1A 2RKOA 3J7AS 4B3MM 5FTNA 4GHAA 3U60A 1Z6TA 3A45A 2UU9M 4DR6M 2W82A 2Y0QA 3VK8A 1SXJD 2J7NA 4DR1M 4CISA 5EXXA 1QVRA 4MGZE 5KO3A 3GRUA 3U6QA 3GP1A 1MU5A 1QAMA 2C98A 3SBJA 2FOIC 3FUXA 2JA2A 3UGJA 3KW6A 3TWMA 4AZFA 2ZM6M 1G8PA 1GLNA 3RFWA 2C9CA 2XSZD 4B08A 1L2DA 3AKZA 4MM3B 3GPPA 4IIWA 4M9ZA 3U61B 4D81A 1MX0A 2V1UA 1OJLA 3NWLA 3I4VA 1XXHA 4DV1M 4RF1A 1JR3D 4G4NA 5FTJA 1DGHA 3SAUA 1E9RA 1N77A 1K3WA 4LF7M 2DZOB 3MK6A 3QAUA 3J7BA 3L28A 1Z5AA 2HKJA 3A46A 1SXJE 4L4UA 3THGA 3I51A 4LJ5A 2YQZA 4ZPXA 4YY3M 2DWNA 2LXEA 3HKPA 1Z59A 4PDGA 4MB7A 4LG2A 1HR0M 2FFJA 3GLIA 1IY1A 1IXSB 3J81S 4OVZA 5C18A 3SARA 4NSRA 2R65A 2VIIA 4LF5M 5ITXE 1NHGC 4GIPA 3U6SA 2UUAM 3SASA 4P16A 3VK7A 3AOGA 4JI1M 3J80S 4OX9M 5KPZA 4XGIA 4DR4M 1NY6A 2KRUA 5BPVA 4D80A 2DWMA 5DNYA 5F3WA 4XBOA 1ZAEA 2KXEA 4IBIA 4GC9A 1Z5CA 3KP1E 3GRRA 4DV4M 4DR5M 3KOXE 3NBIA 3VLFB 4JI0M 3SFZA 3T1YM 4IBDA 2KRKA 2KZSA 3E9SA 1GVNA 1Q3CA 1QAOA 2XFSA 5LMUM 3U61A 5KQ8A 1L2CA 4LF8M 3LQQA 4DV7M 5FTLA 3GPXA 2F5PA 4DR3M 4FCWA 4GKKM 2NQ8C 1H6UA 2J7OA 2BJVA 3FUUA 5EQTA 4L8RC 8CATA 4W5WA 1IQPA 3DZDA 1TH2A 2V6ZM 1NY5A 4FWGA 4X65M 3C58A 1YE9A 2DVWB 4I4LA 3LVVA 3GRYA 2UXDM 1E9SA 4I5SA 2L7HA 2DXIA 4JYAM 3HJSA 5A2QS 5H37D 5FSWA 4L16A 3SC3A 4LZJA 2BNKA 2CHGA 3JR5A 2QENA 1IN7A 3HHWA 4QHTA 4AKIA 2R62A 1Z5BA 3SATA 5ITYA 2P5TA 4OU7A 1N78A 2R18A 4FW9A 1XC8A 1HQYE 2UUCM 1XNRM 5EXSA 4MGHA 3AJIB 3KS8A 3KOZE 4QOSA 4GRIA 2HHHM 2Y20A 3FTEA 4JXJA 1IN6A 3KSXA 3SYKA 4AQYM 3D8BA 2QPAA 4LRTA 3KDSE 3K8ZA 3GPUA 4MH0E 3DOAA 3FUTA 3AFHA 3GQ3A 2R4EA 2DHRA 3ZH9B 3PNVA 3J2PB 4QHSA 3U6PA 2C96A 1E94E 3M0EA 1G41A 5IZ7D 3PVSA 2Y21A 1L8QA 4DR7M 1IXZA 2YR0A 4NXNM 3SAVA 3U6CA 1N36M 2KA6B 2D7HA 3LVWA 3VDPA 3R8FA 5KPTA 4QOZC 3CF6E 4GKJM 1DO0A 1PJIA 3GQ4A 4NXMM 4FD2A 4II7A 3Q8XA 3HHZA 3VKGA 2XZUA 3ZCBB 4IJEA 3VFDA 3TWKA 2UXBM 3KXEC 3GLGB 4NRWA 3OTOM 4FVMA 1HNWM 2L7IA 2DZNB 1Q3BA 3FUWA 3HHXA 1G3IA 3GQ5A 3RGPA 1G59A 3LQRA 1IM2A 1IBKM 5ITUA 1L1TA 4QNRA 1HT2E 2C99A 2V1CA 3AL0C 2YNMD 4IBCA 4R3DA 5EP1A 4MGKE 4B3TM 3PFIA 3U6DA 1DGBA 5BR8M 2XEPA 1PM5A 2E5LM 4LJAA 1ORYB 2Q2EB 3MJ5A 2XZFA 3VKHA 5IWAM 3U6EA 3L27A 3GO8A 3HWSA 3M7GA 5KQDA 3W0FA 3IG5A 1HQCA 2EO2A 2Z7JA 1IN4A 3AOEC 3JAMS 4M0DA 3U5ZB 1XMOM 3RE8A 3WHKA 4L78A 3PNYA 1SXJC 3KSJA 2KW0A 1NHWC 4DV0M 4MGYE 4B3RM 4PD2A 4FWDA 1NNUC 1DGFA 2CE7A 2G5GX 1L1ZA 3HHYA 3FUVA 2EUCA 5FLXS 4L15A 4AW4A 1I94M 7CATA 3KVWA 2M5ZA 4EIWA 3I4YA 5EP4A 2O5RA 4LGMA 3TPZA 5EJCA 5E26A 4REZA 2HL7A 2KZUA 4IBKA 5LMNM 1PJJA 4GC5A 1I4WA 1JQJC 3HU3A 4PT5A 3BOSA 3IG8A 3SMPA 2LWXA 2F4VM 3FKEA 1TDHA 3GLGA 1HNZM 2CUZA 3VDUA 1XNQM 3HU2A 2C5RA 4PCZA 2XLJA 4G6ZA 4GHLA 2QBYB 2C9OA 1XMQM 1IXRC 1KFVA 1GL7A 1W5TA 4AG5A 3KOYE 2F5QA 3FTFA 5IT9S 1J09A 2R45A 4LCBA 3ZC7B 1R2YA 4AI6A 4HLQA 1KYIA 3WHLA 5ITRA 1N32M 1DO2A 3TQSA 4LFBM 4RNAA 1C1KA 4NL4H 4S12A 5ITTA 1GKIA 3E4RA 3EIEA 3FD9A 4G4RA 4X66M 2Y0TA 3CF0A 3CTWB 2HCBA 3PXGA 4M9XA 1QQWA 1XHBA 4JI5M 4IBJA 1N75A 3H4MA 3K2LA 3U5ZA 2Z4SA 4GMQA 1IN8A 4WURA 4JV5M 1QANA 4LFCM 4DV6M 2G8LA 2D7GA 1IY2A 2XGNA 2BJWA 3KS4A 2EA0A 1K82A 4X62M 2F5SA 1FJGM 2AHMA 2YFQA 1T3TA 2LH0A 1FNNA 2A5YB 2XF3A 1HT1E 4JN6A 4I8OA 3L25A 4IBGA 3KP0E 4LJ4A 5JI2E 3ILKA 5FTKA 1IY0A 5KPRA 1OFIA 1D2NA 4D82A 4ITQA 1SXJB 3UZUA 2Z4RA 2DWZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4O A;  2E5L M;  4PDI A;  1EE8 A;  4DV2 M;  4JI7 M;  2Q2E B;  2XZF A;  5IWA M;  3U6E A;  3U6L A;  3TWL A;  2VQE M;  4DUY M;  1TDZ A;  2UXC M;  1Z5C A;  3GO8 A;  4X64 M;  4DV4 M;  2UUB M;  4DR5 M;  1N33 M;  4DUZ M;  4JI2 M;  4JI0 M;  3W0F A;  3T1Y M;  3JAM S;  3U6M A;  1XMO M;  1Q3C A;  1L2C A;  5LMU M;  4JI3 M;  4LF8 M;  4DV7 M;  3GPX A;  4DV0 M;  4B3R M;  4PD2 A;  4DR3 M;  2F5P A;  2F5O A;  4GKK M;  3T1H M;  1L1Z A;  1IBM M;  4JI4 M;  5FLX S;  4DV5 M;  1I94 M;  4NRV A;  2OPF A;  1IBL M;  4B3S M;  3C58 A;  4X65 M;  4G4Q A;  1J5E M;  3J7A S;  4B3M M;  2UU9 M;  3A45 A;  4DR6 M;  2UXD M;  3VK8 A;  4JYA M;  2ZBK B;  4DR1 M;  5A2Q S;  4CIS A;  5LMN M;  1PJJ A;  1K3X A;  2F4V M;  3U6Q A;  1TDH A;  1MU5 A;  3GP1 A;  3JR5 A;  4YHH M;  1HNZ M;  3SBJ A;  1Z5B A;  1XNQ M;  3SAT A;  5ITY A;  4PCZ A;  1NNJ A;  1Q39 A;  1L2B A;  3TWM A;  1XMQ M;  4KHP M;  1XC8 A;  1KFV A;  2F5Q A;  2ZM6 M;  5IT9 S;  4LF4 M;  1XNR M;  2UUC M;  1R2Y A;  1L2D A;  5ITR A;  1N32 M;  2HHH M;  4LFB M;  2F5N A;  3GPP A;  4K0K M;  5ITT A;  4AQY M;  1MX0 A;  3GPU A;  3DOA A;  3SAW A;  3GQ3 A;  3GPY A;  4DV1 M;  4G4R A;  4X66 M;  4G4N A;  3SAU A;  1HNX M;  1K3W A;  3U6P A;  4LF7 M;  4JI5 M;  5ITX A;  1Z5A A;  4DR7 M;  2HKJ A;  3A46 A;  4NXN M;  3SAV A;  3U6C A;  4JV5 M;  4LFC M;  4YY3 M;  4DV6 M;  1N36 M;  2VQF M;  4GKJ M;  1PJI A;  3GQ4 A;  2EA0 A;  1Z59 A;  4LFA M;  1K82 A;  4NXM M;  4X62 M;  2F5S A;  1FJG M;  4PDG A;  4MB7 A;  4LF9 M;  2OQ4 A;  2XZU A;  1HR0 M;  5ITQ A;  3J81 S;  3TWK A;  2UXB M;  4DR2 M;  4NRW A;  4DV3 M;  3A42 A;  3OTO M;  3SAR A;  1HNW M;  4LF5 M;  1Q3B A;  5ITX E;  1R2Z A;  1N34 M;  3U6O A;  3GQ5 A;  3U6S A;  4JI6 M;  2UUA M;  1IBK M;  5ITU A;  1L1T A;  3JR4 A;  3SAS A;  3VK7 A;  4ITQ A;  4LF6 M;  4JI1 M;  4B3T M;  3J80 S;  4OX9 M;  3U6D A;  4DR4 M;  5BR8 M;  1PM5 A;  4JI8 M; 
#chains in the Genus database with same CATH topology
 3L26 A;  4AG6 A;  2KDL A;  4AKG A;  1GL6 A;  5IT9 S;  3C3D A;  4KO8 A;  2DAG A;  3U6L A;  1TDZ A;  4M0W A;  1NVM A;  3M6A A;  5EP3 A;  1QUT A;  3TWL A;  2VQE M;  4DUY M;  4X64 M;  2UXC M;  3RGS A;  2UUB M;  4Z8X A;  4JI2 M;  2CFO A;  2QCU A;  2JZ1 A;  4F1I A;  3U6M A;  4I81 A;  2R6F A;  4DBG B;  3TL4 X;  1V33 A;  3FTC A;  4JI3 M;  2K0B X;  3D8L A;  4KLN A;  4GH9 A;  2H1R A;  4CGY B;  3B7N A;  3LMM A;  1W5S A;  2KNZ A;  3T1H M;  4BB9 A;  3K92 A;  3MHV C;  1IBM M;  5DYG A;  3TE6 A;  1UM8 A;  3FYD A;  4NRV A;  3GRV A;  3DA1 A;  4G4Q A;  2KNA A;  1VEK A;  2LBC A;  1VDD A;  1X37 A;  3H4J A;  3HJQ A;  3HU1 A;  1OIZ A;  1Q02 A;  3K1J A;  2CRU A;  3LW5 F;  3R9X B;  2X49 A;  4LJ6 A;  1R4G A;  4WW0 A;  5EXP A;  4NSO B;  4R7G A;  1KSF X;  2CHQ A;  1SG9 A;  1OAO C;  1XWI A;  1A5T A;  2ZBK B;  2K47 A;  3BBZ A;  3FRI A;  1WGN A;  3L29 A;  3I01 M;  1WHC A;  2HWJ A;  2FE8 A;  4IBE A;  1K3X A;  3NBX X;  2Z3X A;  4LY6 A;  3GLF B;  1NV9 A;  2QQ8 A;  2RGH A;  4NOO B;  4RF0 A;  4B7H A;  1LV7 A;  1G4A E;  2RGO A;  2ZTC A;  2KEB A;  4YHH M;  1DGG A;  2DAE A;  2DKL A;  4Y28 F;  2CHV A;  1NNJ A;  1Q39 A;  1ZMW A;  3FYC A;  1L2B A;  3AOE A;  4KHP M;  5C1B A;  3B9P A;  2ZAM A;  5EXT A;  5FTM A;  1NSF A;  2GNO A;  3HJ8 A;  2ZAO A;  4LF4 M;  2CV0 A;  2JWS A;  4IBB A;  1SXJ A;  3T38 A;  3GLH B;  4Z6Y A;  3MMP A;  2L6O A;  4LJ7 A;  2F5N A;  3SHF A;  2ERC A;  2I7P A;  4BLC A;  4CHT B;  4K0K M;  1E32 A;  1WXQ A;  1YSY A;  3W67 A;  5JI3 E;  2QSF X;  2O01 F;  2X4A A;  3DFZ A;  4HEO A;  3GLG E;  3SAW A;  1HJP A;  3LCV B;  3V76 A;  3GPY A;  4BBA A;  1IN5 A;  2QP9 X;  4MGI E;  1HNX M;  1R6B X;  2JY7 A;  1F4I A;  1QDR A;  1TH4 A;  1WIV A;  5ITX A;  4LJ9 A;  2EJS A;  4AKH A;  2EKK A;  5E6J A;  2DWL A;  2XSZ A;  2VDB B;  3KOW E;  4FCT A;  4IJF A;  3U60 B;  5DYI A;  3KFU G;  4A3V B;  2D7E A;  2VQF M;  5EP2 A;  1NJF A;  4LGY A;  2CV2 A;  1T43 A;  4LFA M;  3SYL A;  3K9O A;  2XH9 A;  5L8R F;  3A98 B;  3HZJ A;  4LF9 M;  2CEA A;  4QNM A;  3CGW A;  2OQ4 A;  5ITQ A;  1PRB A;  1NO1 A;  3FTD A;  1JR3 A;  4DR2 M;  2DAI A;  3J27 B;  4LJ8 A;  4DV3 M;  1TF0 B;  2I7N A;  3A42 A;  5IRE B;  4M9S A;  4LZZ A;  1GJT A;  3AV0 A;  1R2Z A;  1N34 M;  3U6O A;  1NJG A;  4JI6 M;  1R7R A;  4IBF A;  2X8A A;  2LNH C;  3JR4 A;  3W0L B;  3SMS A;  2QZ4 A;  4LF6 M;  2DAK A;  1OIP A;  2FNA A;  3GLF A;  3BXW A;  2FH0 A;  1TH3 A;  3UK6 A;  4JI8 M;  4G4O A;  3QYE A;  4B7G A;  4FWH A;  3L2A A;  4PDI A;  1EE8 A;  4DV2 M;  2ZAN A;  1S3S A;  1XXH B;  4JI7 M;  1BVS A;  1GO5 A;  1D0L A;  1DGH B;  2L09 A;  2R46 A;  3EIH A;  3T6P A;  1N33 M;  1QZM A;  4DUZ M;  4GIT A;  2DEN A;  1XB2 B;  3GLH A;  1YUB A;  1OFH A;  1J7K A;  2M60 A;  3UJN A;  3C9P A;  3K9P A;  2QBY A;  1AUA A;  3QWL A;  1EIJ A;  5GKN A;  3CF2 A;  4HL4 A;  4OW0 A;  4LRS A;  1TGU A;  4KOD A;  4TUW A;  2GQF A;  3T15 A;  2F5O A;  2QHO B;  3B89 A;  3UMM A;  2J5Y A;  1D0M A;  1GJS A;  2XFT A;  4CJ6 A;  4JI4 M;  1QAQ A;  1QYR A;  4DV5 M;  4FCV A;  3GLI B;  2BWB A;  1ZQ9 A;  2OPF A;  2R4J A;  4B7F A;  1IBL M;  4B3S M;  3HGI A;  4OVZ B;  2CV1 A;  2RKO A;  3J7A S;  2JY5 A;  2JZ0 A;  4B3M M;  5FTN A;  4GHA A;  3U60 A;  1Z6T A;  3A45 A;  2UU9 M;  4DR6 M;  2W82 A;  2Y0Q A;  1P3Q Q;  3VK8 A;  1SXJ D;  2J7N A;  4DR1 M;  4P17 A;  4CIS A;  5EXX A;  1QVR A;  4MGZ E;  5KO3 A;  3LCU A;  3GRU A;  2DNA A;  1WJ7 A;  3U6Q A;  3GP1 A;  1MU5 A;  1QAM A;  2C98 A;  3SBJ A;  2FOI C;  3FUX A;  2JA2 A;  3UGJ A;  3KW6 A;  3TWM A;  4AZF A;  2JXN A;  4KT0 F;  4WP2 A;  2ZM6 M;  4CIZ A;  1G8P A;  4G3O A;  1GLN A;  3RFW A;  2C9C A;  2XSZ D;  4B08 A;  1L2D A;  2L4E A;  3AKZ A;  4MM3 B;  3GPP A;  2QNJ A;  4IIW A;  1VEJ A;  4M9Z A;  3U61 B;  4D81 A;  3B7Q A;  3W68 A;  1MX0 A;  2V1U A;  1UFZ A;  1OJL A;  1AIP C;  1D0K A;  3NWL A;  3I4V A;  1XXH A;  4DV1 M;  3B7Z A;  4RF1 A;  1JR3 D;  4G4N A;  5FTJ A;  1DGH A;  2CP8 A;  1E9R A;  3SAU A;  1N77 A;  1K3W A;  4LF7 M;  2DZO B;  3MK6 A;  3QAU A;  3J7B A;  2WZJ A;  1Z5A A;  3L28 A;  2HKJ A;  1NV8 A;  3A46 A;  1SXJ E;  4L4U A;  2LTU A;  2CWB A;  3THG A;  3I51 A;  4LJ5 A;  2YQZ A;  4ZPX A;  4YY3 M;  3E21 A;  2OOA A;  4UN2 B;  4GEW A;  1PJS A;  2LXE A;  2DWN A;  3HKP A;  2OO9 A;  1Z59 A;  4PDG A;  4MB7 A;  4LG2 A;  1HR0 M;  2FFJ A;  3GLI A;  2BWE A;  1IY1 A;  1IXS B;  3J81 S;  3IEC A;  4OVZ A;  4Q7J A;  2O25 A;  5C18 A;  3SAR A;  4NSR A;  2R65 A;  2VII A;  4LF5 M;  1OKS A;  5ITX E;  1NHG C;  4GIP A;  2DZL A;  3U6S A;  2UUA M;  2APL A;  3SAS A;  2LHG A;  4P16 A;  1VG5 A;  4NC6 A;  2Z8Y M;  3VK7 A;  3AOG A;  4JI1 M;  3J80 S;  2HAK A;  4OX9 M;  5KPZ A;  3HX3 A;  1ZV1 A;  1NY6 A;  4XGI A;  4DR4 M;  1DV0 A;  2KRU A;  5BPV A;  4D80 A;  2K9D A;  3SHG B;  5DNY A;  2DWM A;  5F3W A;  1JR3 E;  2DI0 A;  4XBO A;  1ZAE A;  2KXE A;  4IBI A;  4GC9 A;  1Z5C A;  3KP1 E;  3GRR A;  4DV4 M;  4DR5 M;  3KOX E;  2L4F A;  3NBI A;  3VLF B;  4JI0 M;  3SFZ A;  3T1Y M;  4F2L A;  4IBD A;  2KRK A;  2KZS A;  3E9S A;  1GVN A;  1Q3C A;  1QAO A;  1ZMV A;  2XFS A;  5LMU M;  5KQ8 A;  3U61 A;  1L2C A;  4LF8 M;  3LQQ A;  4DV7 M;  3GLF E;  5FTL A;  3GPX A;  3FRH A;  2F5P A;  4DR3 M;  4FCW A;  2MGW A;  4GKK M;  2NQ8 C;  1H6U A;  2J7O A;  2BJV A;  3FUU A;  1QUS A;  2LVQ D;  5EQT A;  8CAT A;  4L8R C;  4W5W A;  1TR8 A;  1IQP A;  3DZD A;  1TH2 A;  2V6Z M;  1NY5 A;  4FWG A;  4X65 M;  3C58 A;  1YE9 A;  1OQY A;  2DVW B;  4I4L A;  3LVV A;  2N35 A;  3GRY A;  3GLH E;  2UXD M;  1E9S A;  4I5S A;  2DHY A;  2L7H A;  2L2D A;  2DXI A;  4JYA M;  3HJS A;  5A2Q S;  5H37 D;  1WGL A;  5FSW A;  1R5L A;  4L16 A;  3SC3 A;  1IXS A;  2BNK A;  4LZJ A;  2H5X A;  2CHG A;  3JR5 A;  2QEN A;  1IN7 A;  3HHW A;  4QHT A;  4AKI A;  2R62 A;  1Z5B A;  3SAT A;  5ITY A;  2P5T A;  4OU7 A;  1N78 A;  2R18 A;  4FW9 A;  1Y8G A;  1XC8 A;  1PJQ A;  1HQY E;  2UUC M;  1XNR M;  5EXS A;  4MGH A;  3AJI B;  3KS8 A;  1IFY A;  3KOZ E;  4QOS A;  4GRI A;  2HHH M;  2Y20 A;  3FTE A;  4JXJ A;  1IN6 A;  3KSX A;  3SYK A;  4AQY M;  3D8B A;  2QPA A;  4LRT A;  3KDS E;  3K8Z A;  3GPU A;  4MH0 E;  3DOA A;  3FUT A;  3AFH A;  3GQ3 A;  2LVP C;  2R4E A;  2DHR A;  3ZH9 B;  2WSC F;  3PNV A;  3J2P B;  4QHS A;  3U6P A;  2C96 A;  1E94 E;  3M0E A;  1G41 A;  5IZ7 D;  3PVS A;  3C3E A;  2WSE F;  2Y21 A;  5DFL A;  1L8Q A;  4DR7 M;  1IXZ A;  2YR0 A;  4NXN M;  4R71 A;  3U6C A;  3SAV A;  1N36 M;  2KA6 B;  2D7H A;  3LVW A;  3VDP A;  3R8F A;  5KPT A;  4QOZ C;  1V34 A;  3CF6 E;  4GKJ M;  1DO0 A;  1PJI A;  3GQ4 A;  4NXM M;  4FD2 A;  4II7 A;  3Q8X A;  3HHZ A;  3VKG A;  1XXH E;  2XZU A;  3ZCB B;  4IJE A;  3VFD A;  3TWK A;  2UXB M;  3KXE C;  3GLG B;  2MH8 A;  4NRW A;  3OTO M;  4FVM A;  1HNW M;  2L7I A;  2DZN B;  1Q3B A;  3FUW A;  2MJ5 B;  1G3I A;  3HHX A;  3GQ5 A;  3RGP A;  2KNV A;  1G59 A;  3LQR A;  2RRU A;  1IM2 A;  1IBK M;  5ITU A;  3FTF A;  1L1T A;  4QNR A;  1HT2 E;  2C99 A;  3HY5 A;  2V1C A;  3AL0 C;  2YNM D;  4IBC A;  4R3D A;  5EP1 A;  4MGK E;  4B3T M;  3PFI A;  3U6D A;  1DGB A;  2LVN C;  5BR8 M;  2XEP A;  1PM5 A;  1PJT A;  2E5L M;  3GLI E;  2ZTD A;  4LJA A;  1ORY B;  2Q2E B;  3MJ5 A;  2XZF A;  3VKH A;  5IWA M;  3U6E A;  3L27 A;  3GO8 A;  3HWS A;  3M7G A;  5KQD A;  3W0F A;  3IG5 A;  1G71 A;  1HQC A;  2EO2 A;  2KHH A;  1IN4 A;  2Z7J A;  3AOE C;  3I04 M;  3JAM S;  4M0D A;  3U5Z B;  1XMO M;  3RE8 A;  1J5E M;  2K6B A;  2MR9 A;  3WHK A;  3Q8G A;  3PNY A;  1SXJ C;  4L78 A;  3KSJ A;  2KW0 A;  1NHW C;  4L6V 6;  4DV0 M;  4MGY E;  2B3T A;  4PD2 A;  4B3R M;  4FWD A;  1NNU C;  1DGF A;  2CE7 A;  2G5G X;  1L1Z A;  3HHY A;  3FUV A;  2JY8 A;  2EUC A;  5FLX S;  4L15 A;  4AW4 A;  1I94 M;  7CAT A;  3KVW A;  1EFU B;  2M5Z A;  4EIW A;  2LVA A;  3I4Y A;  3E46 A;  1JB0 F;  2LVO C;  5EP4 A;  3FE3 A;  2O5R A;  4LGM A;  3TPZ A;  4ANR A;  5EJC A;  5E26 A;  4REZ A;  2HL7 A;  2KZU A;  4IBK A;  5LMN M;  1PJJ A;  4GC5 A;  1I4W A;  1JQJ C;  3HU3 A;  4PT5 A;  3BOS A;  3IG8 A;  3SMP A;  2LWX A;  1QDT A;  2F4V M;  1V92 A;  3FKE A;  1TDH A;  3GLG A;  1HNZ M;  1YLA A;  2CUZ A;  1PGY A;  2MRO B;  3VDU A;  1XNQ M;  3HU2 A;  2JNH A;  2C5R A;  1OTR A;  4PCZ A;  2XLJ A;  4G6Z A;  4GHL A;  3ZQJ A;  2QBY B;  3IHP A;  2C9O A;  1WR1 B;  1IXR C;  1XMQ M;  1KFV A;  1GL7 A;  1W5T A;  4AG5 A;  1T6O A;  2VF7 A;  3KOY E;  2F5Q A;  1J09 A;  1QZE A;  2WSF F;  1MN3 A;  2R45 A;  4LCB A;  3ZC7 B;  1R2Y A;  4AI6 A;  4HLQ A;  1KYI A;  3WHL A;  5ITR A;  1N32 M;  1DO2 A;  3TQS A;  4LFB M;  1ZMU A;  4RNA A;  1C1K A;  4NL4 H;  4S12 A;  5ITT A;  1GKI A;  2G3Q A;  3E4R A;  3EIE A;  3FD9 A;  4G4R A;  1VEG A;  1OAI A;  4X66 M;  2Y0T A;  4RKU F;  3CF0 A;  3CTW B;  2JP7 A;  2HCB A;  3PXG A;  4M9X A;  1QQW A;  1XHB A;  2LHC A;  4IBJ A;  4JI5 M;  1N75 A;  2VF8 A;  3H4M A;  2FS1 A;  1MJG M;  3K2L A;  3U5Z A;  2Z4S A;  1CUK A;  4GMQ A;  1IN8 A;  4WUR A;  4JV5 M;  1QAN A;  4LFC M;  4DV6 M;  2G8L A;  1TTE A;  2D7G A;  1IY2 A;  2XGN A;  2BJW A;  3KS4 A;  2EA0 A;  1RU3 A;  1K82 A;  3QYB A;  4X62 M;  2F5S A;  1FJG M;  3B74 A;  2AHM A;  2YFQ A;  4XK8 F;  1LTM A;  2JUJ A;  1T3T A;  2LH0 A;  1FNN A;  2JY6 B;  1VQ1 A;  2A5Y B;  2DAM A;  2XF3 A;  1GAB A;  1HT1 E;  4JN6 A;  3F92 A;  4I8O A;  3L25 A;  1VDL A;  4IBG A;  1C7Y A;  3KP0 E;  4LJ4 A;  5JI2 E;  3ILK A;  5FTK A;  1IY0 A;  5KPR A;  1OFI A;  1D2N A;  2R0I A;  4D82 A;  4ITQ A;  2OOB A;  1SXJ B;  3UZU A;  2Z4R A;  2EKF A;  2R44 A;  2DWZ B; 
#chains in the Genus database with same CATH homology
 3L26 A;  4AG6 A;  4AKG A;  1GL6 A;  4KO8 A;  3U6L A;  1TDZ A;  4M0W A;  1NVM A;  3M6A A;  5EP3 A;  3TWL A;  2VQE M;  4DUY M;  2QBY A;  4X64 M;  2UXC M;  3RGS A;  2UUB M;  4Z8X A;  4JI2 M;  2CFO A;  2QCU A;  3U6M A;  4I81 A;  3TL4 X;  3FTC A;  4JI3 M;  3D8L A;  4KLN A;  4GH9 A;  2H1R A;  4CGY B;  3LMM A;  1W5S A;  3T1H M;  4BB9 A;  3K92 A;  3MHV C;  1IBM M;  5DYG A;  3TE6 A;  1UM8 A;  3FYD A;  4NRV A;  3GRV A;  3DA1 A;  4G4Q A;  3SHG B;  1VDD A;  1X37 A;  3HJQ A;  3K1J A;  1J5E M;  3HU1 A;  3R9X B;  2X49 A;  4LJ6 A;  4WW0 A;  5EXP A;  4NSO B;  4R7G A;  1KSF X;  2CHQ A;  1XWI A;  2ZBK B;  2K47 A;  3L29 A;  1K3X A;  4IBE A;  2FE8 A;  2Z3X A;  4LY6 A;  3GLF B;  2RGH A;  4NOO B;  4B7H A;  4RF0 A;  1LV7 A;  1G4A E;  2RGO A;  4YHH M;  2KEB A;  1DGG A;  2CHV A;  1NNJ A;  1Q39 A;  1L2B A;  3FYC A;  3AOE A;  4KHP M;  5C1B A;  3B9P A;  2ZAM A;  5EXT A;  5FTM A;  1NSF A;  3HJ8 A;  2ZAO A;  4LF4 M;  2CV0 A;  4IBB A;  1SXJ A;  3T38 A;  3GLH B;  4Z6Y A;  2L6O A;  4LJ7 A;  2F5N A;  3SHF A;  2ERC A;  2I7P A;  4BLC A;  4CHT B;  4K0K M;  1E32 A;  1WXQ A;  1YSY A;  5JI3 E;  3SAW A;  2X4A A;  3DFZ A;  3GPY A;  4BBA A;  1IN5 A;  2QP9 X;  4MGI E;  1HNX M;  1R6B X;  1TH4 A;  5ITX A;  4LJ9 A;  4AKH A;  5E6J A;  2DWL A;  2XSZ A;  3KOW E;  4FCT A;  4IJF A;  3U60 B;  3KFU G;  5DYI A;  4A3V B;  2D7E A;  2VQF M;  5EP2 A;  1NJF A;  4LGY A;  2CV2 A;  4LFA M;  3SYL A;  2XH9 A;  3A98 B;  4LF9 M;  2CEA A;  4QNM A;  2OQ4 A;  5ITQ A;  3FTD A;  1JR3 A;  4DR2 M;  4LJ8 A;  3J27 B;  4DV3 M;  3A42 A;  2I7N A;  5IRE B;  4M9S A;  4LZZ A;  3AV0 A;  1R2Z A;  1N34 M;  3U6O A;  1NJG A;  4JI6 M;  1R7R A;  4IBF A;  2X8A A;  2LNH C;  3JR4 A;  3W0L B;  3SMS A;  2QZ4 A;  4LF6 M;  2FNA A;  3GLF A;  1TH3 A;  3UK6 A;  4JI8 M;  4G4O A;  4B7G A;  4FWH A;  3L2A A;  4PDI A;  1EE8 A;  4DV2 M;  2ZAN A;  1S3S A;  1XXH B;  4JI7 M;  1DGH B;  2L09 A;  2R46 A;  3EIH A;  1N33 M;  1QZM A;  4DUZ M;  4GIT A;  3GLH A;  1YUB A;  1OFH A;  1J7K A;  2M60 A;  3UJN A;  3QWL A;  5GKN A;  3CF2 A;  4HL4 A;  4OW0 A;  4LRS A;  1TGU A;  4KOD A;  4TUW A;  3T15 A;  2F5O A;  3UMM A;  2XFT A;  4JI4 M;  1QYR A;  1QAQ A;  4DV5 M;  4FCV A;  3GLI B;  1ZQ9 A;  2OPF A;  2R4J A;  4B7F A;  1IBL M;  4B3S M;  3HGI A;  4OVZ B;  2CV1 A;  2RKO A;  3J7A S;  4B3M M;  5FTN A;  4GHA A;  3U60 A;  1Z6T A;  3A45 A;  2UU9 M;  4DR6 M;  2W82 A;  2Y0Q A;  3VK8 A;  1SXJ D;  2J7N A;  4DR1 M;  4CIS A;  5EXX A;  1QVR A;  4MGZ E;  5KO3 A;  3GRU A;  3U6Q A;  3GP1 A;  1MU5 A;  1QAM A;  2C98 A;  3SBJ A;  2FOI C;  3FUX A;  2JA2 A;  3UGJ A;  3KW6 A;  3TWM A;  4AZF A;  2ZM6 M;  1G8P A;  1GLN A;  3RFW A;  2C9C A;  2XSZ D;  4B08 A;  1L2D A;  3AKZ A;  4MM3 B;  3GPP A;  4IIW A;  4M9Z A;  3U61 B;  4D81 A;  1MX0 A;  2V1U A;  1OJL A;  3NWL A;  3I4V A;  1XXH A;  4DV1 M;  4RF1 A;  1JR3 D;  4G4N A;  5FTJ A;  1DGH A;  3SAU A;  1E9R A;  1N77 A;  1K3W A;  4LF7 M;  2DZO B;  3MK6 A;  3QAU A;  3J7B A;  3L28 A;  1Z5A A;  2HKJ A;  3A46 A;  1SXJ E;  4L4U A;  3THG A;  3I51 A;  4LJ5 A;  2YQZ A;  4ZPX A;  4YY3 M;  2DWN A;  2LXE A;  3HKP A;  1Z59 A;  4PDG A;  4MB7 A;  4LG2 A;  1HR0 M;  2FFJ A;  3GLI A;  1IY1 A;  1IXS B;  3J81 S;  4OVZ A;  5C18 A;  3SAR A;  4NSR A;  2R65 A;  2VII A;  4LF5 M;  5ITX E;  1NHG C;  4GIP A;  3U6S A;  2UUA M;  3SAS A;  4P16 A;  3VK7 A;  3AOG A;  4JI1 M;  3J80 S;  4OX9 M;  5KPZ A;  4XGI A;  4DR4 M;  1NY6 A;  2KRU A;  5BPV A;  4D80 A;  2DWM A;  5DNY A;  5F3W A;  4XBO A;  1ZAE A;  2KXE A;  4IBI A;  4GC9 A;  1Z5C A;  3KP1 E;  3GRR A;  4DV4 M;  4DR5 M;  3KOX E;  3NBI A;  3VLF B;  4JI0 M;  3SFZ A;  3T1Y M;  4IBD A;  2KRK A;  2KZS A;  3E9S A;  1GVN A;  1Q3C A;  1QAO A;  2XFS A;  5LMU M;  3U61 A;  5KQ8 A;  1L2C A;  4LF8 M;  3LQQ A;  4DV7 M;  5FTL A;  3GPX A;  2F5P A;  4DR3 M;  4FCW A;  4GKK M;  2NQ8 C;  1H6U A;  2J7O A;  2BJV A;  3FUU A;  5EQT A;  4L8R C;  8CAT A;  4W5W A;  1IQP A;  3DZD A;  1TH2 A;  2V6Z M;  1NY5 A;  4FWG A;  4X65 M;  3C58 A;  1YE9 A;  2DVW B;  4I4L A;  3LVV A;  3GRY A;  2UXD M;  1E9S A;  4I5S A;  2L7H A;  2DXI A;  4JYA M;  3HJS A;  5A2Q S;  5H37 D;  5FSW A;  4L16 A;  3SC3 A;  4LZJ A;  2BNK A;  2CHG A;  3JR5 A;  2QEN A;  1IN7 A;  3HHW A;  4QHT A;  4AKI A;  2R62 A;  1Z5B A;  3SAT A;  5ITY A;  2P5T A;  4OU7 A;  1N78 A;  2R18 A;  4FW9 A;  1XC8 A;  1HQY E;  2UUC M;  1XNR M;  5EXS A;  4MGH A;  3AJI B;  3KS8 A;  3KOZ E;  4QOS A;  4GRI A;  2HHH M;  2Y20 A;  3FTE A;  4JXJ A;  1IN6 A;  3KSX A;  3SYK A;  4AQY M;  3D8B A;  2QPA A;  4LRT A;  3KDS E;  3K8Z A;  3GPU A;  4MH0 E;  3DOA A;  3FUT A;  3AFH A;  3GQ3 A;  2R4E A;  2DHR A;  3ZH9 B;  3PNV A;  3J2P B;  4QHS A;  3U6P A;  2C96 A;  1E94 E;  3M0E A;  1G41 A;  5IZ7 D;  3PVS A;  2Y21 A;  1L8Q A;  4DR7 M;  1IXZ A;  2YR0 A;  4NXN M;  3SAV A;  3U6C A;  1N36 M;  2KA6 B;  2D7H A;  3LVW A;  3VDP A;  3R8F A;  5KPT A;  4QOZ C;  3CF6 E;  4GKJ M;  1DO0 A;  1PJI A;  3GQ4 A;  4NXM M;  4FD2 A;  4II7 A;  3Q8X A;  3HHZ A;  3VKG A;  2XZU A;  3ZCB B;  4IJE A;  3VFD A;  3TWK A;  2UXB M;  3KXE C;  3GLG B;  4NRW A;  3OTO M;  4FVM A;  1HNW M;  2L7I A;  2DZN B;  1Q3B A;  3FUW A;  3HHX A;  1G3I A;  3GQ5 A;  3RGP A;  1G59 A;  3LQR A;  1IM2 A;  1IBK M;  5ITU A;  1L1T A;  4QNR A;  1HT2 E;  2C99 A;  2V1C A;  3AL0 C;  2YNM D;  4IBC A;  4R3D A;  5EP1 A;  4MGK E;  4B3T M;  3PFI A;  3U6D A;  1DGB A;  5BR8 M;  2XEP A;  1PM5 A;  2E5L M;  4LJA A;  1ORY B;  2Q2E B;  3MJ5 A;  2XZF A;  3VKH A;  5IWA M;  3U6E A;  3L27 A;  3GO8 A;  3HWS A;  3M7G A;  5KQD A;  3W0F A;  3IG5 A;  1HQC A;  2EO2 A;  2Z7J A;  1IN4 A;  3AOE C;  3JAM S;  4M0D A;  3U5Z B;  1XMO M;  3RE8 A;  3WHK A;  4L78 A;  3PNY A;  1SXJ C;  3KSJ A;  2KW0 A;  1NHW C;  4DV0 M;  4MGY E;  4B3R M;  4PD2 A;  4FWD A;  1NNU C;  1DGF A;  2CE7 A;  2G5G X;  1L1Z A;  3HHY A;  3FUV A;  2EUC A;  5FLX S;  4L15 A;  4AW4 A;  1I94 M;  7CAT A;  3KVW A;  2M5Z A;  4EIW A;  3I4Y A;  5EP4 A;  2O5R A;  4LGM A;  3TPZ A;  5EJC A;  5E26 A;  4REZ A;  2HL7 A;  2KZU A;  4IBK A;  5LMN M;  1PJJ A;  4GC5 A;  1I4W A;  1JQJ C;  3HU3 A;  4PT5 A;  3BOS A;  3IG8 A;  3SMP A;  2LWX A;  2F4V M;  3FKE A;  1TDH A;  3GLG A;  1HNZ M;  2CUZ A;  3VDU A;  1XNQ M;  3HU2 A;  2C5R A;  4PCZ A;  2XLJ A;  4G6Z A;  4GHL A;  2QBY B;  2C9O A;  1XMQ M;  1IXR C;  1KFV A;  1GL7 A;  1W5T A;  4AG5 A;  3KOY E;  2F5Q A;  3FTF A;  5IT9 S;  1J09 A;  2R45 A;  4LCB A;  3ZC7 B;  1R2Y A;  4AI6 A;  4HLQ A;  1KYI A;  3WHL A;  5ITR A;  1N32 M;  1DO2 A;  3TQS A;  4LFB M;  4RNA A;  1C1K A;  4NL4 H;  4S12 A;  5ITT A;  1GKI A;  3E4R A;  3EIE A;  3FD9 A;  4G4R A;  4X66 M;  2Y0T A;  3CF0 A;  3CTW B;  2HCB A;  3PXG A;  4M9X A;  1QQW A;  1XHB A;  4JI5 M;  4IBJ A;  1N75 A;  3H4M A;  3K2L A;  3U5Z A;  2Z4S A;  4GMQ A;  1IN8 A;  4WUR A;  4JV5 M;  1QAN A;  4LFC M;  4DV6 M;  2G8L A;  2D7G A;  1IY2 A;  2XGN A;  2BJW A;  3KS4 A;  2EA0 A;  1K82 A;  4X62 M;  2F5S A;  1FJG M;  2AHM A;  2YFQ A;  1T3T A;  2LH0 A;  1FNN A;  2A5Y B;  2XF3 A;  1HT1 E;  4JN6 A;  4I8O A;  3L25 A;  4IBG A;  3KP0 E;  4LJ4 A;  5JI2 E;  3ILK A;  5FTK A;  1IY0 A;  5KPR A;  1OFI A;  1D2N A;  4D82 A;  4ITQ A;  1SXJ B;  3UZU A;  2Z4R A;  2DWZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...