4JI5M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji5M02
5A2QS 4AQYM 3U6OA 4JI5M 2UUCM 2F5SA 1HNXM 3GPPA 4LFAM 4CISA 4JV5M 1R2ZA 2UXBM 3SATA 1Z5AA 3T1HM 4JYAM 3J81S 4LF4M 4DR7M 3T1YM 2UU9M 4OX9M 2F5QA 4G4RA 1MX0A 4JI0M 3TWKA 3SAVA 3U6LA 3A45A 1HNZM 4LF7M 4GKKM 4LFCM 3GQ4A 3GQ5A 1KFVA 3SAWA 4DV0M 1TDHA 1FJGM 1HR0M 5ITYA 2VQEM 5ITQA 2ZM6M 3TWMA 1XC8A 4DUZM 4LF5M 4X64M 4B3MM 4DR5M 4NRVA 4JI3M 4NXNM 4PCZA 1XNQM 3VK7A 2XZFA 4JI1M 2HHHM 4DR6M 1L2CA 1I94M 5BR8M 3U6PA 4X65M 1L1TA 1N33M 4DV5M 3SAUA 3SARA 1XMOM 3GQ3A 3GPYA 4DUYM 2HKJA 4DV2M 4B3RM 5IT9S 5ITXA 2F5OA 1TDZA 3TWLA 4B3TM 2UXCM 2F4VM 5FLXS 1K3XA 3C58A 2VQFM 4LF9M 3J7AS 5ITTA 3W0FA 2E5LM 4G4QA 3JR5A 3OTOM 4DV4M 1PJIA 3GP1A 1N32M 1N34M 5ITRA 4YHHM 3SBJA 2Q2EB 4JI4M 3SASA 3GO8A 4PD2A 4DR3M 4PDIA 5LMUM 3J80S 5ITUA 3U6CA 4X66M 1IBMM 4LFBM 1MU5A 4KHPM 1K82A 4JI7M 3U6EA 5LMNM 4G4OA 2ZBKB 4YY3M 2F5NA 4LF8M 3GPXA 1XMQM 1Q3BA 1NNJA 2UUBM 1PM5A 4K0KM 1L2BA 4DV3M 2UXDM 2OPFA 4DV1M 3GPUA 3DOAA 3JAMS 4GKJM 1PJJA 4NRWA 4NXMM 1Z59A 2F5PA 2XZUA 2UUAM 1J5EM 4ITQA 3JR4A 2EA0A 3U6SA 3A42A 1Z5BA 3U6MA 4JI6M 1IBLM 4B3SM 3VK8A 2OQ4A 4JI2M 1L1ZA 4DR4M 1EE8A 4MB7A 4G4NA 4PDGA 4DR2M 5ITXE 1L2DA 4DV7M 1IBKM 4LF6M 1XNRM 1Q3CA 4X62M 1HNWM 1R2YA 1Q39A 1N36M 3U6QA 4DR1M 4DV6M 1Z5CA 3U6DA 5IWAM 4JI8M 1K3WA 3A46A
chains in the Genus database with same CATH superfamily
1IN8A 1TF0B 4IBCA 5EP4A 1GJTA 3IG8A 1XXHE 3U61B 2XF3A 3V76A 2J7OA 3B9PA 4HLQA 2QENA 3B7QA 3PFIA 1E94E 3T1HM 2MROB 1JR3A 3HJSA 2Z4SA 1NVMA 2ZAOA 2LWXA 2M5ZA 2ZTDA 1G41A 2JP7A 3D8BA 2L6OA 4LJ9A 3I04M 3QAUA 2W82A 2FOIC 2HL7A 3FUXA 3SAVA 4GKKM 2CV2A 2QPAA 3KSJA 2JZ1A 1IXSB 1HT1E 3C3EA 2B3TA 1GVNA 2BNKA 2KA6B 1F4IA 1AUAA 3UZUA 2LVPC 4LFCM 1UM8A 1EIJA 1MN3A 3E21A 3HU3A 1IN7A 3KOZE 3HHZA 4G6ZA 2ZM6M 3TWMA 4LF5M 1VEGA 3A98B 3IHPA 4PCZA 3C9PA 1SXJE 1ZAEA 3ILKA 4JI1M 1QUTA 4DR6M 1GKIA 4MGHA 1YUBA 2X8AA 3TQSA 4M9SA 1WGNA 3Q8GA 1GO5A 3LCUA 2RGOA 3QYEA 3H4MA 1E32A 2XSZD 3SMSA 2ZANA 2DZLA 4DUYM 1QAMA 2XEPA 1PJTA 1V34A 5EP3A 2C9OA 5FTNA 2FH0A 1ZV1A 5DYIA 1C7YA 2LH0A 4Y28F 2N35A 4IBIA 4M0WA 5FTJA 1QVRA 3TWLA 5JI3E 4LJ7A 2CV0A 4L78A 1OIPA 1K3XA 2F4VM 4MGZE 3J7AS 2UXCM 2Z3XA 3HWSA 1QANA 1T6OA 2DWLA 2P5TA 4LJ6A 3KW6A 3OTOM 3KS4A 4P17A 1PJIA 1QYRA 5EP1A 4Q7JA 4BLCA 3U5ZA 1N32M 5ITRA 1QDRA 3SASA 2BWEA 1CUKA 4DR3M 3HY5A 4CJ6A 3U6CA 4LRSA 4X66M 2FFJA 1IBMM 4QNMA 1MU5A 2QSFX 3NBXX 1IY2A 5EXXA 3U6EA 2ZBKB 4QNRA 1Y8GA 4LF8M 3HX3A 1C1KA 1Q3BA 1Z6TA 3FRHA 2FS1A 5KPTA 3K9PA 2R4EA 1GLNA 4G3OA 5KQDA 2YNMD 2C99A 4IBFA 4DV1M 2CUZA 1D0LA 4BBAA 3TE6A 3DOAA 4KLNA 3JAMS 1LV7A 4LY6A 2DHRA 1DGGA 3HHYA 3SFZA 4REZA 2XSZA 4GKJM 1J5EM 4ITQA 4FCWA 2G8LA 3TPZA 1LTMA 4EIWA 2YR0A 1XB2B 2KDLA 4PT5A 1Z5BA 2L2DA 4JI6M 2KZSA 4LRTA 4L4UA 5DFLA 1IBLM 2KZUA 4F2LA 2MJ5B 4MH0E 1EE8A 3KP0E 4DV7M 3KXEC 2V1UA 4LF6M 3PNYA 4CGYB 1R2YA 1G8PA 4LZZA 2O5RA 3EIHA 3GLHA 1JR3D 2EUCA 4RF0A 3GLGA 1W5SA 5EXTA 7CATA 3AL0C 2KNZA 3CF0A 3L26A 1VEJA 5F3WA 4IBKA 2HAKA 1NY5A 1X37A 4FCVA 3VDPA 3SHGB 1BVSA 3HU2A 2C96A 3PNVA 4JYAM 3KS8A 3AOEA 3T1YM 4DR7M 2CEAA 2F5QA 2DAKA 3CTWB 3KSXA 1VEKA 4NSOB 3W0LB 2DENA 2DKLA 3U6LA 1N78A 4OVZB 1JB0F 3GLIB 1S3SA 3HHXA 2R46A 4L6V6 3DZDA 3C3DA 3U61A 3HJQA 4OU7A 2OOAA 3BOSA 1FJGM 4A3VB 3FUUA 2V1CA 1XC8A 1VDDA 4RKUF 4DUZM 1E9RA 2O25A 3Q8XA 1T3TA 3VKGA 4NRVA 1GABA 2XZFA 1OFHA 2HHHM 5KPRA 1I94M 1OKSA 3B89A 3U6PA 2MH8A 1XXHB 3GRRA 1L1TA 1DO2A 2X4AA 3VFDA 1SG9A 3HZJA 3T6PA 4DV5M 2C9CA 3SAUA 1QQWA 2R44A 2VF7A 3FYDA 1G3IA 5L8RF 3GQ3A 2BJVA 1IXSA 3W67A 1WIVA 3GRUA 4B3RM 5IT9S 5ITXA 3E46A 3FUTA 4R7GA 3HU1A 2DWNA 3EIEA 1G4AE 4KODA 1H6UA 4AG6A 2CHGA 2CHQA 1VDLA 2MGWA 3C58A 1NV9A 1IQPA 4LF9M 3M6AA 3SYLA 3L2AA 1JR3E 2L4FA 5EQTA 3IECA 3RGSA 1G59A 3LCVB 3GP1A 2AHMA 1KYIA 4LJ5A 1N34M 1TH4A 2K47A 2K9DA 2K0BX 4YHHM 3SBJA 2Q2EB 2Z8YM 3GLFA 3FUWA 4JI4M 1DGHA 4PD2A 1Q02A 3ZCBB 4PDIA 3K1JA 1IN4A 2V6ZM 2R0IA 3AFHA 2HWJA 2KRKA 4D81A 3GLFB 4FVMA 1SXJB 2I7PA 1DGHB 4GMQA 3WHKA 1QUSA 2KRUA 2LVNC 2LVOC 2Z7JA 4IBEA 3PVSA 4MGIE 4I5SA 2QHOB 2DAGA 3GRYA 3I51A 4GC9A 4CIZA 3RFWA 2L7IA 4IBDA 3RGPA 3F92A 5EJCA 4NRWA 1A5TA 5FSWA 3R9XB 3JR4A 5H37D 2CE7A 3A42A 3FE3A 4LGYA 3ZH9B 1D0KA 2QCUA 4DBGB 3U6SA 4GIPA 4B3SM 1IXRC 5DYGA 1DGFA 1QDTA 2KW0A 2XLJA 2JZ0A 4B7FA 1L1ZA 1IY1A 3K2LA 4G4NA 1L2DA 3M0EA 2EKFA 2Z4RA 1QAOA 1HNWM 4QOSA 4AKHA 2LVQD 3U6QA 3NBIA 5C18A 4DV6M 2DXIA 2DWZB 2NQ8C 3U6DA 1G71A 4NC6A 2QP9X 2YFQA 1GJSA 3A46A 2R62A 1TTEA 3L25A 2Y20A 5A2QS 3U6OA 4JI5M 1AIPC 2ZAMA 2UUCM 3GPPA 5FTKA 4LFAM 3KDSE 2WZJA 2DWMA 1V92A 1R2ZA 3I4VA 2KNAA 4CISA 2UXBM 3SATA 5GKNA 4BB9A 1N75A 1WGLA 2RGHA 5KPZA 1NJGA 3J81S 4LF4M 1PGYA 4LG2A 4MGKE 3FRIA 4OX9M 2DNAA 2VIIA 4UN2B 3NWLA 2QZ4A 3CF2A 4I81A 1MX0A 4JI0M 3FYCA 4WP2A 3K92A 4GH9A 3A45A 3R8FA 2D7GA 1OIZA 4GRIA 3GQ5A 4D82A 3GQ4A 1TGUA 3LQQA 5IREB 3SC3A 4DV0M 1HT2E 5EXSA 1OTRA 1OJLA 2LXEA 3AOEC 4LGMA 3THGA 1DGBA 1NJFA 4RF1A 1TDHA 2BWBA 5BPVA 2VQEM 5ITQA 1WR1B 3KOYE 4X64M 2DAEA 4B3MM 4TUWA 4Z8XA 2DAIA 4NXNM 3AV0A 2DAMA 1L8QA 4LJAA 3VKHA 1ZMWA 1L2CA 2FNAA 5BR8M 2KEBA 1NO1A 1GL7A 2CFOA 3AJIB 1N33M 1QZEA 2G3QA 2JNHA 2WSCF 4OVZA 4IBBA 4WW0A 3GLIA 3SARA 2DHYA 2L09A 4B7GA 3GLHE 4D80A 1ZMUA 1XMOM 4L16A 1QZMA 3U60B 3GLGE 3WHLA 4DV2M 4IJFA 2F5OA 1NHGC 1HJPA 4GHLA 4B3TM 5FLXS 2LHCA 4I4LA 2OO9A 3PXGA 5ITTA 2APLA 2XFSA 3W0FA 1PJSA 1D0MA 2ZTCA 4OW0A 2LTUA 2RKOA 3H4JA 3UMMA 3SHFA 1XXHA 4F1IA 1I4WA 1XWIA 2O01F 4LJ8A 4HEOA 1IN5A 5FTLA 3K8ZA 5LMUM 1T43A 2M60A 3LQRA 1YLAA 3FTFA 2JY5A 3LW5F 4KT0F 4W5WA 1HQYE 3J7BA 4G4OA 4YY3M 2F5NA 3MK6A 1W5TA 1MJGM 4JXJA 2C5RA 3GPXA 1XMQM 4L8RC 1FNNA 1NNJA 3KOWE 1N77A 1PM5A 2UUBM 4K0KM 1L2BA 4DV3M 3QYBA 3MJ5A 2UXDM 2DZNB 2YQZA 4MGYE 2R65A 2QBYB 3LMMA 3FUVA 5E6JA 2JY7A 3L29A 5FTMA 1PJJA 4L15A 2UUAM 4NXMM 1VQ1A 3E9SA 1WJ7A 2EA0A 2R45A 2CRUA 4FW9A 2Y0QA 4II7A 4QHTA 3U6MA 3B7ZA 3UK6A 4QOZC 1OAOC 2HCBA 4IBGA 3E4RA 1SXJA 3TL4X 2DVWB 2CWBA 1D2NA 1NSFA 2G5GX 5KO3A 4RNAA 4MB7A 4XGIA 2EJSA 3L28A 4AW4A 4PDGA 5ITXE 4DR2M 2C98A 1Q3CA 1WXQA 4I8OA 4X62M 2JXNA 1YSYA 2FE8A 3D8LA 2LHGA 2XGNA 3FD9A 3T38A 3VDUA 1N36M 3BBZA 4NSRA 4JI8M 4R3DA 5JI2E 1K3WA 2BJWA 1OFIA 1IBKM 2Y21A 3CGWA 2LNHC 4MM3B 2R4JA 2VF8A 4AQYM 4GHAA 2F5SA 4B7HA 1OAIA 2CP8A 1HNXM 4LCBA 1WHCA 2H1RA 3GLFE 4KO8A 1R6BX 4JV5M 3M7GA 2DI0A 4Z6YA 4ANRA 1Z5AA 4M9XA 2EO2A 3HHWA 1ZMVA 2JUJA 1YE9A 3FKEA 2UU9M 1J7KA 4S12A 3IG5A 3KFUG 3B7NA 2WSEF 1NV8A 2JY6B 3GRVA 4G4RA 3I4YA 1KFVA 2QNJA 1UFZA 3TWKA 1HNZM 4LF7M 2GQFA 2J7NA 1TH3A 3SAWA 4AI6A 1V33A 3UGJA 1HQCA 3UJNA 1R5LA 1RU3A 1XHBA 1QAQA 2OOBA 3HKPA 3HGIA 1HR0M 5ITYA 4GEWA 5EP2A 4DR5M 4NL4H 1J09A 3FTDA 4JI3M 3ZC7B 1XNQM 3VK7A 1NHWC 3L27A 4FWHA 5IZ7D 1NY6A 3QWLA 3ZQJA 4LZJA 8CATA 1EFUB 1R4GA 5DNYA 1VG5A 3BXWA 4X65M 3U5ZB 4AKGA 4IBJA 3LVWA 3AKZA 1E9SA 2H5XA 1IFYA 3AOGA 4FD2A 5EXPA 4CHTB 2X49A 3DFZA 3GPYA 2A5YB 1IY0A 2HKJA 2D7EA 1KSFX 4FWGA 1TDZA 2D7HA 4WURA 3SMPA 4R71A 2JY8A 2WSFF 3T15A 3KOXE 2VQFM 4GITA 3LVVA 4XK8F 3HJ8A 4XBOA 2E5LM 2L4EA 4G4QA 3FTEA 2KXEA 3KVWA 3JR5A 4DV4M 1OQYA 5E26A 4AKIA 1PRBA 3J27B 4QHSA 2ERCA 1TR8A 2CV1A 4GC5A 3W68A 1PJQA 3I01M 1IM2A 3GO8A 3RE8A 4FCTA 3J80S 5ITUA 3J2PB 3U60A 1R7RA 2JA2A 4LFBM 2L7HA 3FTCA 2EKKA 2JWSA 4B08A 4KHPM 1K82A 4JI7M 5LMNM 2QQ8A 4M9ZA 3VLFB 4HL4A 2R18A 1IXZA 2Y0TA 4AG5A 5C1BA 2KNVA 1GL6A 2R6FA 4NOOB 1ORYB 4IIWA 1SXJD 2CHVA 2K6BA 3GLHB 3GPUA 2OPFA 3KP1E 1IN6A 2MR9A 2GNOA 3GLGB 1ZQ9A 2LVAA 1Z59A 1TH2A 2DZOB 2XZUA 2F5PA 2I7NA 2KHHA 3DA1A 1P3QQ 1NNUC 3B74A 5KQ8A 3GLIE 3VK8A 3MMPA 4AZFA 3SYKA 4ZPXA 2OQ4A 4JI2M 2J5YA 4DR4M 1XNRM 2XH9A 3MHVC 4P16A 2RRUA 4FWDA 2VDBB 4IJEA 1Q39A 1JQJC 1DO0A 4M0DA 4JN6A 4DR1M 2XFTA 2QBYA 1Z5CA 5IWAM 3CF6E 1SXJC 1DV0A 2LBCA 3K9OA 4LJ4A
chains in the Genus database with same CATH topology
1IN8A 4IBCA 5EP4A 3IG8A 3U61B 2XF3A 2J7OA 3B9PA 4HLQA 2QENA 3PFIA 1E94E 3T1HM 3HJSA 1JR3A 2Z4SA 1NVMA 2ZAOA 2LWXA 2M5ZA 1G41A 3D8BA 2L6OA 4LJ9A 3QAUA 2W82A 2FOIC 2HL7A 3FUXA 3SAVA 4GKKM 2CV2A 2QPAA 3KSJA 1IXSB 1HT1E 1GVNA 2BNKA 2KA6B 3UZUA 4LFCM 1UM8A 2ZM6M 3TWMA 3HU3A 1IN7A 3KOZE 3HHZA 4G6ZA 4LF5M 3A98B 4PCZA 1SXJE 1ZAEA 3ILKA 4JI1M 4DR6M 1GKIA 4MGHA 1YUBA 2X8AA 3TQSA 4M9SA 2RGOA 3H4MA 1E32A 2XSZD 3SMSA 2ZANA 4DUYM 1QAMA 2XEPA 5EP3A 2C9OA 5FTNA 5DYIA 2LH0A 4IBIA 4M0WA 5FTJA 1QVRA 3TWLA 5JI3E 4LJ7A 2CV0A 4L78A 1K3XA 2F4VM 2UXCM 4MGZE 3J7AS 2Z3XA 3HWSA 1QANA 2DWLA 2P5TA 4LJ6A 3KW6A 3OTOM 3KS4A 1PJIA 1QYRA 5EP1A 4BLCA 3U5ZA 1N32M 5ITRA 3SASA 4DR3M 3U6CA 4LRSA 4X66M 2FFJA 1IBMM 4QNMA 1MU5A 1IY2A 5EXXA 3U6EA 2ZBKB 4QNRA 4LF8M 1C1KA 1Q3BA 1Z6TA 5KPTA 2R4EA 1GLNA 5KQDA 2YNMD 2C99A 4IBFA 4DV1M 2CUZA 4BBAA 3TE6A 3DOAA 4KLNA 3JAMS 1LV7A 4LY6A 2DHRA 1DGGA 3HHYA 3SFZA 4REZA 2XSZA 4GKJM 1J5EM 4ITQA 4FCWA 2G8LA 3TPZA 4EIWA 2YR0A 4PT5A 1Z5BA 4JI6M 2KZSA 4LRTA 4L4UA 1IBLM 2KZUA 4MH0E 1EE8A 3KP0E 4DV7M 3KXEC 2V1UA 4LF6M 3PNYA 4CGYB 1R2YA 1G8PA 4LZZA 2O5RA 3EIHA 3GLHA 1JR3D 2EUCA 4RF0A 3GLGA 1W5SA 5EXTA 7CATA 3AL0C 3CF0A 3L26A 5F3WA 4IBKA 1NY5A 1X37A 4FCVA 3VDPA 3SHGB 3HU2A 2C96A 3PNVA 4JYAM 3KS8A 3AOEA 3T1YM 4DR7M 2CEAA 2F5QA 3CTWB 3KSXA 4NSOB 3W0LB 3U6LA 1N78A 4OVZB 3GLIB 1S3SA 3HHXA 2R46A 3DZDA 3U61A 3HJQA 4OU7A 3BOSA 1FJGM 4A3VB 3FUUA 2V1CA 1XC8A 1VDDA 4DUZM 1E9RA 3Q8XA 1T3TA 3VKGA 4NRVA 2XZFA 1OFHA 2HHHM 5KPRA 1I94M 3U6PA 1XXHB 3GRRA 1L1TA 1DO2A 2X4AA 3VFDA 4DV5M 3SAUA 2C9CA 1QQWA 3FYDA 3GQ3A 1G3IA 2BJVA 3GRUA 4B3RM 5IT9S 5ITXA 3FUTA 4R7GA 3HU1A 2DWNA 3EIEA 1G4AE 4KODA 1H6UA 4AG6A 2CHGA 2CHQA 3C58A 4LF9M 1IQPA 3M6AA 3SYLA 3L2AA 5EQTA 3RGSA 1G59A 3GP1A 2AHMA 1KYIA 4LJ5A 1N34M 1TH4A 2K47A 4YHHM 3SBJA 2Q2EB 3GLFA 4JI4M 3FUWA 1DGHA 4PD2A 3ZCBB 4PDIA 3K1JA 1IN4A 2V6ZM 3AFHA 2KRKA 4D81A 3GLFB 4FVMA 1SXJB 2I7PA 1DGHB 4GMQA 3WHKA 2KRUA 2Z7JA 4IBEA 3PVSA 4MGIE 4I5SA 3I51A 3GRYA 4GC9A 3RFWA 2L7IA 4IBDA 3RGPA 5EJCA 4NRWA 5FSWA 3R9XB 3JR4A 5H37D 2CE7A 3A42A 4LGYA 3U6SA 3ZH9B 2QCUA 4GIPA 4B3SM 1IXRC 5DYGA 1DGFA 2KW0A 2XLJA 4B7FA 1L1ZA 1IY1A 3K2LA 4G4NA 1L2DA 3M0EA 2Z4RA 1HNWM 1QAOA 4QOSA 4AKHA 3U6QA 3NBIA 5C18A 4DV6M 2DXIA 2DWZB 2NQ8C 3U6DA 2QP9X 2YFQA 3A46A 2R62A 3L25A 2Y20A 5A2QS 3U6OA 4JI5M 2ZAMA 2UUCM 3GPPA 5FTKA 4LFAM 3KDSE 2DWMA 4CISA 1R2ZA 3I4VA 2UXBM 3SATA 5GKNA 4BB9A 1N75A 2RGHA 5KPZA 1NJGA 3J81S 4LF4M 4LG2A 4MGKE 4OX9M 2VIIA 3NWLA 2QZ4A 3CF2A 4I81A 1MX0A 4JI0M 3FYCA 3K92A 4GH9A 3A45A 3R8FA 2D7GA 4GRIA 3GQ4A 3GQ5A 4D82A 1KFVA 1TGUA 3LQQA 5IREB 3SC3A 4DV0M 1HT2E 5EXSA 3THGA 1OJLA 2LXEA 3AOEC 4LGMA 1DGBA 1NJFA 4RF1A 1TDHA 5BPVA 2VQEM 5ITQA 3KOYE 4X64M 4B3MM 4TUWA 4Z8XA 4NXNM 3AV0A 1L8QA 4LJAA 3VKHA 1L2CA 2FNAA 5BR8M 2KEBA 3AJIB 1GL7A 2CFOA 1N33M 4OVZA 4WW0A 4IBBA 3GLIA 3SARA 2L09A 4B7GA 4D80A 1XMOM 4L16A 1QZMA 3U60B 3WHLA 4DV2M 4IJFA 2F5OA 1NHGC 4GHLA 4B3TM 5FLXS 4I4LA 3PXGA 5ITTA 2XFSA 3W0FA 4OW0A 2RKOA 3UMMA 3SHFA 1XXHA 1I4WA 1XWIA 4LJ8A 1IN5A 5FTLA 3K8ZA 5LMUM 2M60A 3LQRA 3FTFA 4W5WA 1HQYE 3J7BA 4G4OA 4YY3M 2F5NA 3MK6A 1W5TA 4L8RC 4JXJA 2C5RA 3GPXA 1XMQM 1FNNA 1NNJA 3KOWE 1N77A 1PM5A 2UUBM 4K0KM 1L2BA 4DV3M 2UXDM 3MJ5A 2DZNB 2YQZA 4MGYE 2R65A 2QBYB 3LMMA 3FUVA 5E6JA 3L29A 5FTMA 1PJJA 4L15A 2UUAM 4NXMM 3E9SA 2EA0A 2R45A 4FW9A 2Y0QA 4II7A 4QHTA 3U6MA 3UK6A 4QOZC 2HCBA 4IBGA 3E4RA 1SXJA 3TL4X 2DVWB 1D2NA 1NSFA 2G5GX 5KO3A 4RNAA 4MB7A 4XGIA 4AW4A 3L28A 4PDGA 5ITXE 4DR2M 2C98A 1Q3CA 1WXQA 4I8OA 4X62M 1YSYA 2FE8A 3D8LA 3FD9A 2XGNA 3T38A 3VDUA 1N36M 4NSRA 4JI8M 4R3DA 5JI2E 1K3WA 2BJWA 1OFIA 1IBKM 2Y21A 2LNHC 4MM3B 2R4JA 4AQYM 4GHAA 2F5SA 4B7HA 1HNXM 4LCBA 2H1RA 4KO8A 1R6BX 4JV5M 3M7GA 4Z6YA 1Z5AA 4M9XA 2EO2A 3HHWA 3FKEA 1YE9A 2UU9M 1J7KA 4S12A 3IG5A 3KFUG 4G4RA 3GRVA 3I4YA 3TWKA 1HNZM 4LF7M 2J7NA 1TH3A 3SAWA 4AI6A 3UGJA 1HQCA 3UJNA 1XHBA 1QAQA 3HKPA 3HGIA 1HR0M 5ITYA 5EP2A 4DR5M 4NL4H 1J09A 3FTDA 4JI3M 3ZC7B 1XNQM 3VK7A 1NHWC 3L27A 4FWHA 5IZ7D 1NY6A 3QWLA 4LZJA 8CATA 4X65M 5DNYA 4AKGA 3U5ZB 4IBJA 3LVWA 3AKZA 1E9SA 3AOGA 4FD2A 5EXPA 4CHTB 2X49A 3DFZA 3GPYA 2A5YB 1IY0A 2HKJA 2D7EA 1KSFX 4FWGA 1TDZA 2D7HA 4WURA 3SMPA 3T15A 3KOXE 2VQFM 4GITA 3LVVA 3HJ8A 4XBOA 2E5LM 4G4QA 3FTEA 2KXEA 3KVWA 3JR5A 4DV4M 5E26A 4AKIA 3J27B 4QHSA 2ERCA 2CV1A 4GC5A 3GO8A 1IM2A 3RE8A 4FCTA 3J80S 5ITUA 3J2PB 3U60A 1R7RA 2JA2A 4LFBM 2L7HA 3FTCA 4B08A 4KHPM 1K82A 4JI7M 5LMNM 4M9ZA 3VLFB 4AG5A 4HL4A 2R18A 1IXZA 2Y0TA 5C1BA 1GL6A 4NOOB 1ORYB 4IIWA 1SXJD 2CHVA 3GPUA 3GLHB 2OPFA 3KP1E 1IN6A 3GLGB 1ZQ9A 1Z59A 1TH2A 2DZOB 2XZUA 2F5PA 2I7NA 3DA1A 1NNUC 5KQ8A 3VK8A 4AZFA 3SYKA 4ZPXA 2OQ4A 4JI2M 4DR4M 1XNRM 2XH9A 3MHVC 4P16A 4FWDA 4IJEA 1Q39A 1JQJC 1DO0A 4M0DA 4JN6A 4DR1M 2XFTA 2QBYA 1Z5CA 5IWAM 3CF6E 1SXJC 4LJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q S;  4AQY M;  3U6O A;  4JI5 M;  2UUC M;  2F5S A;  1HNX M;  3GPP A;  4LFA M;  4CIS A;  4JV5 M;  1R2Z A;  2UXB M;  3SAT A;  1Z5A A;  3T1H M;  4JYA M;  3J81 S;  4LF4 M;  4DR7 M;  3T1Y M;  2UU9 M;  4OX9 M;  2F5Q A;  4G4R A;  1MX0 A;  4JI0 M;  3TWK A;  3SAV A;  3U6L A;  3A45 A;  1HNZ M;  4LF7 M;  4GKK M;  4LFC M;  3GQ4 A;  3GQ5 A;  1KFV A;  3SAW A;  4DV0 M;  1TDH A;  1FJG M;  1HR0 M;  5ITY A;  2VQE M;  5ITQ A;  2ZM6 M;  3TWM A;  1XC8 A;  4DUZ M;  4LF5 M;  4X64 M;  4B3M M;  4DR5 M;  4NRV A;  4JI3 M;  4NXN M;  4PCZ A;  1XNQ M;  3VK7 A;  2XZF A;  4JI1 M;  2HHH M;  4DR6 M;  1L2C A;  1I94 M;  5BR8 M;  3U6P A;  4X65 M;  1L1T A;  1N33 M;  4DV5 M;  3SAU A;  3SAR A;  1XMO M;  3GQ3 A;  3GPY A;  4DUY M;  2HKJ A;  4DV2 M;  4B3R M;  5IT9 S;  5ITX A;  2F5O A;  1TDZ A;  3TWL A;  4B3T M;  2UXC M;  2F4V M;  5FLX S;  1K3X A;  3C58 A;  2VQF M;  4LF9 M;  3J7A S;  5ITT A;  3W0F A;  2E5L M;  4G4Q A;  3JR5 A;  3OTO M;  4DV4 M;  1PJI A;  3GP1 A;  1N32 M;  1N34 M;  5ITR A;  4YHH M;  3SBJ A;  2Q2E B;  4JI4 M;  3SAS A;  3GO8 A;  4PD2 A;  4DR3 M;  4PDI A;  5LMU M;  3J80 S;  5ITU A;  3U6C A;  4X66 M;  1IBM M;  4LFB M;  1MU5 A;  4KHP M;  1K82 A;  4JI7 M;  3U6E A;  5LMN M;  4G4O A;  2ZBK B;  4YY3 M;  2F5N A;  4LF8 M;  3GPX A;  1XMQ M;  1Q3B A;  1NNJ A;  2UUB M;  1PM5 A;  4K0K M;  1L2B A;  4DV3 M;  2UXD M;  2OPF A;  4DV1 M;  3GPU A;  3DOA A;  3JAM S;  4GKJ M;  1PJJ A;  4NRW A;  4NXM M;  1Z59 A;  2F5P A;  2XZU A;  2UUA M;  1J5E M;  4ITQ A;  3JR4 A;  2EA0 A;  3U6S A;  3A42 A;  1Z5B A;  3U6M A;  4JI6 M;  1IBL M;  4B3S M;  3VK8 A;  2OQ4 A;  4JI2 M;  1L1Z A;  4DR4 M;  1EE8 A;  4MB7 A;  4G4N A;  4PDG A;  4DR2 M;  5ITX E;  1L2D A;  4DV7 M;  1IBK M;  4LF6 M;  1XNR M;  1Q3C A;  4X62 M;  1HNW M;  1R2Y A;  1Q39 A;  1N36 M;  3U6Q A;  4DR1 M;  4DV6 M;  1Z5C A;  3U6D A;  5IWA M;  4JI8 M;  1K3W A;  3A46 A; 
#chains in the Genus database with same CATH topology
 1IN8 A;  1TF0 B;  4IBC A;  5EP4 A;  1GJT A;  3IG8 A;  1XXH E;  3U61 B;  2XF3 A;  3V76 A;  2J7O A;  3B9P A;  4HLQ A;  2QEN A;  3B7Q A;  3PFI A;  1E94 E;  3T1H M;  2MRO B;  1JR3 A;  3HJS A;  2Z4S A;  1NVM A;  2ZAO A;  2LWX A;  2M5Z A;  2ZTD A;  1G41 A;  2JP7 A;  3D8B A;  2L6O A;  4LJ9 A;  3I04 M;  3QAU A;  2W82 A;  2FOI C;  2HL7 A;  3FUX A;  3SAV A;  4GKK M;  2CV2 A;  2QPA A;  3KSJ A;  2JZ1 A;  1IXS B;  1HT1 E;  3C3E A;  2B3T A;  1GVN A;  2BNK A;  2KA6 B;  1F4I A;  1AUA A;  3UZU A;  2LVP C;  4LFC M;  1UM8 A;  1EIJ A;  1MN3 A;  3E21 A;  3HU3 A;  1IN7 A;  3KOZ E;  3HHZ A;  4G6Z A;  2ZM6 M;  3TWM A;  4LF5 M;  1VEG A;  3A98 B;  3IHP A;  4PCZ A;  3C9P A;  1SXJ E;  1ZAE A;  3ILK A;  4JI1 M;  1QUT A;  4DR6 M;  1GKI A;  4MGH A;  1YUB A;  2X8A A;  3TQS A;  4M9S A;  1WGN A;  3Q8G A;  1GO5 A;  3LCU A;  2RGO A;  3QYE A;  3H4M A;  1E32 A;  2XSZ D;  3SMS A;  2ZAN A;  2DZL A;  4DUY M;  1QAM A;  2XEP A;  1PJT A;  1V34 A;  5EP3 A;  2C9O A;  5FTN A;  2FH0 A;  1ZV1 A;  5DYI A;  1C7Y A;  2LH0 A;  4Y28 F;  2N35 A;  4IBI A;  4M0W A;  5FTJ A;  1QVR A;  3TWL A;  5JI3 E;  4LJ7 A;  2CV0 A;  4L78 A;  1OIP A;  1K3X A;  2F4V M;  4MGZ E;  3J7A S;  2UXC M;  2Z3X A;  3HWS A;  1QAN A;  1T6O A;  2DWL A;  2P5T A;  4LJ6 A;  3KW6 A;  3OTO M;  3KS4 A;  4P17 A;  1PJI A;  1QYR A;  5EP1 A;  4Q7J A;  4BLC A;  3U5Z A;  1N32 M;  5ITR A;  1QDR A;  3SAS A;  2BWE A;  1CUK A;  4DR3 M;  3HY5 A;  4CJ6 A;  3U6C A;  4LRS A;  4X66 M;  2FFJ A;  1IBM M;  4QNM A;  1MU5 A;  2QSF X;  3NBX X;  1IY2 A;  5EXX A;  3U6E A;  2ZBK B;  4QNR A;  1Y8G A;  4LF8 M;  3HX3 A;  1C1K A;  1Q3B A;  1Z6T A;  3FRH A;  2FS1 A;  5KPT A;  3K9P A;  2R4E A;  1GLN A;  4G3O A;  5KQD A;  2YNM D;  2C99 A;  4IBF A;  4DV1 M;  2CUZ A;  1D0L A;  4BBA A;  3TE6 A;  3DOA A;  4KLN A;  3JAM S;  1LV7 A;  4LY6 A;  2DHR A;  1DGG A;  3HHY A;  3SFZ A;  4REZ A;  2XSZ A;  4GKJ M;  1J5E M;  4ITQ A;  4FCW A;  2G8L A;  3TPZ A;  1LTM A;  4EIW A;  2YR0 A;  1XB2 B;  2KDL A;  4PT5 A;  1Z5B A;  2L2D A;  4JI6 M;  2KZS A;  4LRT A;  4L4U A;  5DFL A;  1IBL M;  2KZU A;  4F2L A;  2MJ5 B;  4MH0 E;  1EE8 A;  3KP0 E;  4DV7 M;  3KXE C;  2V1U A;  4LF6 M;  3PNY A;  4CGY B;  1R2Y A;  1G8P A;  4LZZ A;  2O5R A;  3EIH A;  3GLH A;  1JR3 D;  2EUC A;  4RF0 A;  3GLG A;  1W5S A;  5EXT A;  7CAT A;  3AL0 C;  2KNZ A;  3CF0 A;  3L26 A;  1VEJ A;  5F3W A;  4IBK A;  2HAK A;  1NY5 A;  1X37 A;  4FCV A;  3VDP A;  3SHG B;  1BVS A;  3HU2 A;  2C96 A;  3PNV A;  4JYA M;  3KS8 A;  3AOE A;  3T1Y M;  4DR7 M;  2CEA A;  2F5Q A;  2DAK A;  3CTW B;  3KSX A;  1VEK A;  4NSO B;  3W0L B;  2DEN A;  2DKL A;  3U6L A;  1N78 A;  4OVZ B;  1JB0 F;  3GLI B;  1S3S A;  3HHX A;  2R46 A;  4L6V 6;  3DZD A;  3C3D A;  3U61 A;  3HJQ A;  4OU7 A;  2OOA A;  3BOS A;  1FJG M;  4A3V B;  3FUU A;  2V1C A;  1XC8 A;  1VDD A;  4RKU F;  4DUZ M;  1E9R A;  2O25 A;  3Q8X A;  1T3T A;  3VKG A;  4NRV A;  1GAB A;  2XZF A;  1OFH A;  2HHH M;  5KPR A;  1I94 M;  1OKS A;  3B89 A;  3U6P A;  2MH8 A;  1XXH B;  3GRR A;  1L1T A;  1DO2 A;  2X4A A;  3VFD A;  1SG9 A;  3HZJ A;  3T6P A;  4DV5 M;  2C9C A;  3SAU A;  1QQW A;  2R44 A;  2VF7 A;  3FYD A;  1G3I A;  5L8R F;  3GQ3 A;  2BJV A;  1IXS A;  3W67 A;  1WIV A;  3GRU A;  4B3R M;  5IT9 S;  5ITX A;  3E46 A;  3FUT A;  4R7G A;  3HU1 A;  2DWN A;  3EIE A;  1G4A E;  4KOD A;  1H6U A;  4AG6 A;  2CHG A;  2CHQ A;  1VDL A;  2MGW A;  3C58 A;  1NV9 A;  1IQP A;  4LF9 M;  3M6A A;  3SYL A;  3L2A A;  1JR3 E;  2L4F A;  5EQT A;  3IEC A;  3RGS A;  1G59 A;  3LCV B;  3GP1 A;  2AHM A;  1KYI A;  4LJ5 A;  1N34 M;  1TH4 A;  2K47 A;  2K9D A;  2K0B X;  4YHH M;  3SBJ A;  2Q2E B;  2Z8Y M;  3GLF A;  3FUW A;  4JI4 M;  1DGH A;  4PD2 A;  1Q02 A;  3ZCB B;  4PDI A;  3K1J A;  1IN4 A;  2V6Z M;  2R0I A;  3AFH A;  2HWJ A;  2KRK A;  4D81 A;  3GLF B;  4FVM A;  1SXJ B;  2I7P A;  1DGH B;  4GMQ A;  3WHK A;  1QUS A;  2KRU A;  2LVN C;  2LVO C;  2Z7J A;  4IBE A;  3PVS A;  4MGI E;  4I5S A;  2QHO B;  2DAG A;  3GRY A;  3I51 A;  4GC9 A;  4CIZ A;  3RFW A;  2L7I A;  4IBD A;  3RGP A;  3F92 A;  5EJC A;  4NRW A;  1A5T A;  5FSW A;  3R9X B;  3JR4 A;  5H37 D;  2CE7 A;  3A42 A;  3FE3 A;  4LGY A;  3ZH9 B;  1D0K A;  2QCU A;  4DBG B;  3U6S A;  4GIP A;  4B3S M;  1IXR C;  5DYG A;  1DGF A;  1QDT A;  2KW0 A;  2XLJ A;  2JZ0 A;  4B7F A;  1L1Z A;  1IY1 A;  3K2L A;  4G4N A;  1L2D A;  3M0E A;  2EKF A;  2Z4R A;  1QAO A;  1HNW M;  4QOS A;  4AKH A;  2LVQ D;  3U6Q A;  3NBI A;  5C18 A;  4DV6 M;  2DXI A;  2DWZ B;  2NQ8 C;  3U6D A;  1G71 A;  4NC6 A;  2QP9 X;  2YFQ A;  1GJS A;  3A46 A;  2R62 A;  1TTE A;  3L25 A;  2Y20 A;  5A2Q S;  3U6O A;  4JI5 M;  1AIP C;  2ZAM A;  2UUC M;  3GPP A;  5FTK A;  4LFA M;  3KDS E;  2WZJ A;  2DWM A;  1V92 A;  1R2Z A;  3I4V A;  2KNA A;  4CIS A;  2UXB M;  3SAT A;  5GKN A;  4BB9 A;  1N75 A;  1WGL A;  2RGH A;  5KPZ A;  1NJG A;  3J81 S;  4LF4 M;  1PGY A;  4LG2 A;  4MGK E;  3FRI A;  4OX9 M;  2DNA A;  2VII A;  4UN2 B;  3NWL A;  2QZ4 A;  3CF2 A;  4I81 A;  1MX0 A;  4JI0 M;  3FYC A;  4WP2 A;  3K92 A;  4GH9 A;  3A45 A;  3R8F A;  2D7G A;  1OIZ A;  4GRI A;  3GQ5 A;  4D82 A;  3GQ4 A;  1TGU A;  3LQQ A;  5IRE B;  3SC3 A;  4DV0 M;  1HT2 E;  5EXS A;  1OTR A;  1OJL A;  2LXE A;  3AOE C;  4LGM A;  3THG A;  1DGB A;  1NJF A;  4RF1 A;  1TDH A;  2BWB A;  5BPV A;  2VQE M;  5ITQ A;  1WR1 B;  3KOY E;  4X64 M;  2DAE A;  4B3M M;  4TUW A;  4Z8X A;  2DAI A;  4NXN M;  3AV0 A;  2DAM A;  1L8Q A;  4LJA A;  3VKH A;  1ZMW A;  1L2C A;  2FNA A;  5BR8 M;  2KEB A;  1NO1 A;  1GL7 A;  2CFO A;  3AJI B;  1N33 M;  1QZE A;  2G3Q A;  2JNH A;  2WSC F;  4OVZ A;  4IBB A;  4WW0 A;  3GLI A;  3SAR A;  2DHY A;  2L09 A;  4B7G A;  3GLH E;  4D80 A;  1ZMU A;  1XMO M;  4L16 A;  1QZM A;  3U60 B;  3GLG E;  3WHL A;  4DV2 M;  4IJF A;  2F5O A;  1NHG C;  1HJP A;  4GHL A;  4B3T M;  5FLX S;  2LHC A;  4I4L A;  2OO9 A;  3PXG A;  5ITT A;  2APL A;  2XFS A;  3W0F A;  1PJS A;  1D0M A;  2ZTC A;  4OW0 A;  2LTU A;  2RKO A;  3H4J A;  3UMM A;  3SHF A;  1XXH A;  4F1I A;  1I4W A;  1XWI A;  2O01 F;  4LJ8 A;  4HEO A;  1IN5 A;  5FTL A;  3K8Z A;  5LMU M;  1T43 A;  2M60 A;  3LQR A;  1YLA A;  3FTF A;  2JY5 A;  3LW5 F;  4KT0 F;  4W5W A;  1HQY E;  3J7B A;  4G4O A;  4YY3 M;  2F5N A;  3MK6 A;  1W5T A;  1MJG M;  4JXJ A;  2C5R A;  3GPX A;  1XMQ M;  4L8R C;  1FNN A;  1NNJ A;  3KOW E;  1N77 A;  1PM5 A;  2UUB M;  4K0K M;  1L2B A;  4DV3 M;  3QYB A;  3MJ5 A;  2UXD M;  2DZN B;  2YQZ A;  4MGY E;  2R65 A;  2QBY B;  3LMM A;  3FUV A;  5E6J A;  2JY7 A;  3L29 A;  5FTM A;  1PJJ A;  4L15 A;  2UUA M;  4NXM M;  1VQ1 A;  3E9S A;  1WJ7 A;  2EA0 A;  2R45 A;  2CRU A;  4FW9 A;  2Y0Q A;  4II7 A;  4QHT A;  3U6M A;  3B7Z A;  3UK6 A;  4QOZ C;  1OAO C;  2HCB A;  4IBG A;  3E4R A;  1SXJ A;  3TL4 X;  2DVW B;  2CWB A;  1D2N A;  1NSF A;  2G5G X;  5KO3 A;  4RNA A;  4MB7 A;  4XGI A;  2EJS A;  3L28 A;  4AW4 A;  4PDG A;  5ITX E;  4DR2 M;  2C98 A;  1Q3C A;  1WXQ A;  4I8O A;  4X62 M;  2JXN A;  1YSY A;  2FE8 A;  3D8L A;  2LHG A;  2XGN A;  3FD9 A;  3T38 A;  3VDU A;  1N36 M;  3BBZ A;  4NSR A;  4JI8 M;  4R3D A;  5JI2 E;  1K3W A;  2BJW A;  1OFI A;  1IBK M;  2Y21 A;  3CGW A;  2LNH C;  4MM3 B;  2R4J A;  2VF8 A;  4AQY M;  4GHA A;  2F5S A;  4B7H A;  1OAI A;  2CP8 A;  1HNX M;  4LCB A;  1WHC A;  2H1R A;  3GLF E;  4KO8 A;  1R6B X;  4JV5 M;  3M7G A;  2DI0 A;  4Z6Y A;  4ANR A;  1Z5A A;  4M9X A;  2EO2 A;  3HHW A;  1ZMV A;  2JUJ A;  1YE9 A;  3FKE A;  2UU9 M;  1J7K A;  4S12 A;  3IG5 A;  3KFU G;  3B7N A;  2WSE F;  1NV8 A;  2JY6 B;  3GRV A;  4G4R A;  3I4Y A;  1KFV A;  2QNJ A;  1UFZ A;  3TWK A;  1HNZ M;  4LF7 M;  2GQF A;  2J7N A;  1TH3 A;  3SAW A;  4AI6 A;  1V33 A;  3UGJ A;  1HQC A;  3UJN A;  1R5L A;  1RU3 A;  1XHB A;  1QAQ A;  2OOB A;  3HKP A;  3HGI A;  1HR0 M;  5ITY A;  4GEW A;  5EP2 A;  4DR5 M;  4NL4 H;  1J09 A;  3FTD A;  4JI3 M;  3ZC7 B;  1XNQ M;  3VK7 A;  1NHW C;  3L27 A;  4FWH A;  5IZ7 D;  1NY6 A;  3QWL A;  3ZQJ A;  4LZJ A;  8CAT A;  1EFU B;  1R4G A;  5DNY A;  1VG5 A;  3BXW A;  4X65 M;  3U5Z B;  4AKG A;  4IBJ A;  3LVW A;  3AKZ A;  1E9S A;  2H5X A;  1IFY A;  3AOG A;  4FD2 A;  5EXP A;  4CHT B;  2X49 A;  3DFZ A;  3GPY A;  2A5Y B;  1IY0 A;  2HKJ A;  2D7E A;  1KSF X;  4FWG A;  1TDZ A;  2D7H A;  4WUR A;  3SMP A;  4R71 A;  2JY8 A;  2WSF F;  3T15 A;  3KOX E;  2VQF M;  4GIT A;  3LVV A;  4XK8 F;  3HJ8 A;  4XBO A;  2E5L M;  2L4E A;  4G4Q A;  3FTE A;  2KXE A;  3KVW A;  3JR5 A;  4DV4 M;  1OQY A;  5E26 A;  4AKI A;  1PRB A;  3J27 B;  4QHS A;  2ERC A;  1TR8 A;  2CV1 A;  4GC5 A;  3W68 A;  1PJQ A;  3I01 M;  1IM2 A;  3GO8 A;  3RE8 A;  4FCT A;  3J80 S;  5ITU A;  3J2P B;  3U60 A;  1R7R A;  2JA2 A;  4LFB M;  2L7H A;  3FTC A;  2EKK A;  2JWS A;  4B08 A;  4KHP M;  1K82 A;  4JI7 M;  5LMN M;  2QQ8 A;  4M9Z A;  3VLF B;  4HL4 A;  2R18 A;  1IXZ A;  2Y0T A;  4AG5 A;  5C1B A;  2KNV A;  1GL6 A;  2R6F A;  4NOO B;  1ORY B;  4IIW A;  1SXJ D;  2CHV A;  2K6B A;  3GLH B;  3GPU A;  2OPF A;  3KP1 E;  1IN6 A;  2MR9 A;  2GNO A;  3GLG B;  1ZQ9 A;  2LVA A;  1Z59 A;  1TH2 A;  2DZO B;  2XZU A;  2F5P A;  2I7N A;  2KHH A;  3DA1 A;  1P3Q Q;  1NNU C;  3B74 A;  5KQ8 A;  3GLI E;  3VK8 A;  3MMP A;  4AZF A;  3SYK A;  4ZPX A;  2OQ4 A;  4JI2 M;  2J5Y A;  4DR4 M;  1XNR M;  2XH9 A;  3MHV C;  4P16 A;  2RRU A;  4FWD A;  2VDB B;  4IJE A;  1Q39 A;  1JQJ C;  1DO0 A;  4M0D A;  4JN6 A;  4DR1 M;  2XFT A;  2QBY A;  1Z5C A;  5IWA M;  3CF6 E;  1SXJ C;  1DV0 A;  2LBC A;  3K9O A;  4LJ4 A; 
#chains in the Genus database with same CATH homology
 1IN8 A;  4IBC A;  5EP4 A;  3IG8 A;  3U61 B;  2XF3 A;  2J7O A;  3B9P A;  4HLQ A;  2QEN A;  3PFI A;  1E94 E;  3T1H M;  3HJS A;  1JR3 A;  2Z4S A;  1NVM A;  2ZAO A;  2LWX A;  2M5Z A;  1G41 A;  3D8B A;  2L6O A;  4LJ9 A;  3QAU A;  2W82 A;  2FOI C;  2HL7 A;  3FUX A;  3SAV A;  4GKK M;  2CV2 A;  2QPA A;  3KSJ A;  1IXS B;  1HT1 E;  1GVN A;  2BNK A;  2KA6 B;  3UZU A;  4LFC M;  1UM8 A;  2ZM6 M;  3TWM A;  3HU3 A;  1IN7 A;  3KOZ E;  3HHZ A;  4G6Z A;  4LF5 M;  3A98 B;  4PCZ A;  1SXJ E;  1ZAE A;  3ILK A;  4JI1 M;  4DR6 M;  1GKI A;  4MGH A;  1YUB A;  2X8A A;  3TQS A;  4M9S A;  2RGO A;  3H4M A;  1E32 A;  2XSZ D;  3SMS A;  2ZAN A;  4DUY M;  1QAM A;  2XEP A;  5EP3 A;  2C9O A;  5FTN A;  5DYI A;  2LH0 A;  4IBI A;  4M0W A;  5FTJ A;  1QVR A;  3TWL A;  5JI3 E;  4LJ7 A;  2CV0 A;  4L78 A;  1K3X A;  2F4V M;  2UXC M;  4MGZ E;  3J7A S;  2Z3X A;  3HWS A;  1QAN A;  2DWL A;  2P5T A;  4LJ6 A;  3KW6 A;  3OTO M;  3KS4 A;  1PJI A;  1QYR A;  5EP1 A;  4BLC A;  3U5Z A;  1N32 M;  5ITR A;  3SAS A;  4DR3 M;  3U6C A;  4LRS A;  4X66 M;  2FFJ A;  1IBM M;  4QNM A;  1MU5 A;  1IY2 A;  5EXX A;  3U6E A;  2ZBK B;  4QNR A;  4LF8 M;  1C1K A;  1Q3B A;  1Z6T A;  5KPT A;  2R4E A;  1GLN A;  5KQD A;  2YNM D;  2C99 A;  4IBF A;  4DV1 M;  2CUZ A;  4BBA A;  3TE6 A;  3DOA A;  4KLN A;  3JAM S;  1LV7 A;  4LY6 A;  2DHR A;  1DGG A;  3HHY A;  3SFZ A;  4REZ A;  2XSZ A;  4GKJ M;  1J5E M;  4ITQ A;  4FCW A;  2G8L A;  3TPZ A;  4EIW A;  2YR0 A;  4PT5 A;  1Z5B A;  4JI6 M;  2KZS A;  4LRT A;  4L4U A;  1IBL M;  2KZU A;  4MH0 E;  1EE8 A;  3KP0 E;  4DV7 M;  3KXE C;  2V1U A;  4LF6 M;  3PNY A;  4CGY B;  1R2Y A;  1G8P A;  4LZZ A;  2O5R A;  3EIH A;  3GLH A;  1JR3 D;  2EUC A;  4RF0 A;  3GLG A;  1W5S A;  5EXT A;  7CAT A;  3AL0 C;  3CF0 A;  3L26 A;  5F3W A;  4IBK A;  1NY5 A;  1X37 A;  4FCV A;  3VDP A;  3SHG B;  3HU2 A;  2C96 A;  3PNV A;  4JYA M;  3KS8 A;  3AOE A;  3T1Y M;  4DR7 M;  2CEA A;  2F5Q A;  3CTW B;  3KSX A;  4NSO B;  3W0L B;  3U6L A;  1N78 A;  4OVZ B;  3GLI B;  1S3S A;  3HHX A;  2R46 A;  3DZD A;  3U61 A;  3HJQ A;  4OU7 A;  3BOS A;  1FJG M;  4A3V B;  3FUU A;  2V1C A;  1XC8 A;  1VDD A;  4DUZ M;  1E9R A;  3Q8X A;  1T3T A;  3VKG A;  4NRV A;  2XZF A;  1OFH A;  2HHH M;  5KPR A;  1I94 M;  3U6P A;  1XXH B;  3GRR A;  1L1T A;  1DO2 A;  2X4A A;  3VFD A;  4DV5 M;  3SAU A;  2C9C A;  1QQW A;  3FYD A;  3GQ3 A;  1G3I A;  2BJV A;  3GRU A;  4B3R M;  5IT9 S;  5ITX A;  3FUT A;  4R7G A;  3HU1 A;  2DWN A;  3EIE A;  1G4A E;  4KOD A;  1H6U A;  4AG6 A;  2CHG A;  2CHQ A;  3C58 A;  4LF9 M;  1IQP A;  3M6A A;  3SYL A;  3L2A A;  5EQT A;  3RGS A;  1G59 A;  3GP1 A;  2AHM A;  1KYI A;  4LJ5 A;  1N34 M;  1TH4 A;  2K47 A;  4YHH M;  3SBJ A;  2Q2E B;  3GLF A;  4JI4 M;  3FUW A;  1DGH A;  4PD2 A;  3ZCB B;  4PDI A;  3K1J A;  1IN4 A;  2V6Z M;  3AFH A;  2KRK A;  4D81 A;  3GLF B;  4FVM A;  1SXJ B;  2I7P A;  1DGH B;  4GMQ A;  3WHK A;  2KRU A;  2Z7J A;  4IBE A;  3PVS A;  4MGI E;  4I5S A;  3I51 A;  3GRY A;  4GC9 A;  3RFW A;  2L7I A;  4IBD A;  3RGP A;  5EJC A;  4NRW A;  5FSW A;  3R9X B;  3JR4 A;  5H37 D;  2CE7 A;  3A42 A;  4LGY A;  3U6S A;  3ZH9 B;  2QCU A;  4GIP A;  4B3S M;  1IXR C;  5DYG A;  1DGF A;  2KW0 A;  2XLJ A;  4B7F A;  1L1Z A;  1IY1 A;  3K2L A;  4G4N A;  1L2D A;  3M0E A;  2Z4R A;  1HNW M;  1QAO A;  4QOS A;  4AKH A;  3U6Q A;  3NBI A;  5C18 A;  4DV6 M;  2DXI A;  2DWZ B;  2NQ8 C;  3U6D A;  2QP9 X;  2YFQ A;  3A46 A;  2R62 A;  3L25 A;  2Y20 A;  5A2Q S;  3U6O A;  4JI5 M;  2ZAM A;  2UUC M;  3GPP A;  5FTK A;  4LFA M;  3KDS E;  2DWM A;  4CIS A;  1R2Z A;  3I4V A;  2UXB M;  3SAT A;  5GKN A;  4BB9 A;  1N75 A;  2RGH A;  5KPZ A;  1NJG A;  3J81 S;  4LF4 M;  4LG2 A;  4MGK E;  4OX9 M;  2VII A;  3NWL A;  2QZ4 A;  3CF2 A;  4I81 A;  1MX0 A;  4JI0 M;  3FYC A;  3K92 A;  4GH9 A;  3A45 A;  3R8F A;  2D7G A;  4GRI A;  3GQ4 A;  3GQ5 A;  4D82 A;  1KFV A;  1TGU A;  3LQQ A;  5IRE B;  3SC3 A;  4DV0 M;  1HT2 E;  5EXS A;  3THG A;  1OJL A;  2LXE A;  3AOE C;  4LGM A;  1DGB A;  1NJF A;  4RF1 A;  1TDH A;  5BPV A;  2VQE M;  5ITQ A;  3KOY E;  4X64 M;  4B3M M;  4TUW A;  4Z8X A;  4NXN M;  3AV0 A;  1L8Q A;  4LJA A;  3VKH A;  1L2C A;  2FNA A;  5BR8 M;  2KEB A;  3AJI B;  1GL7 A;  2CFO A;  1N33 M;  4OVZ A;  4WW0 A;  4IBB A;  3GLI A;  3SAR A;  2L09 A;  4B7G A;  4D80 A;  1XMO M;  4L16 A;  1QZM A;  3U60 B;  3WHL A;  4DV2 M;  4IJF A;  2F5O A;  1NHG C;  4GHL A;  4B3T M;  5FLX S;  4I4L A;  3PXG A;  5ITT A;  2XFS A;  3W0F A;  4OW0 A;  2RKO A;  3UMM A;  3SHF A;  1XXH A;  1I4W A;  1XWI A;  4LJ8 A;  1IN5 A;  5FTL A;  3K8Z A;  5LMU M;  2M60 A;  3LQR A;  3FTF A;  4W5W A;  1HQY E;  3J7B A;  4G4O A;  4YY3 M;  2F5N A;  3MK6 A;  1W5T A;  4L8R C;  4JXJ A;  2C5R A;  3GPX A;  1XMQ M;  1FNN A;  1NNJ A;  3KOW E;  1N77 A;  1PM5 A;  2UUB M;  4K0K M;  1L2B A;  4DV3 M;  2UXD M;  3MJ5 A;  2DZN B;  2YQZ A;  4MGY E;  2R65 A;  2QBY B;  3LMM A;  3FUV A;  5E6J A;  3L29 A;  5FTM A;  1PJJ A;  4L15 A;  2UUA M;  4NXM M;  3E9S A;  2EA0 A;  2R45 A;  4FW9 A;  2Y0Q A;  4II7 A;  4QHT A;  3U6M A;  3UK6 A;  4QOZ C;  2HCB A;  4IBG A;  3E4R A;  1SXJ A;  3TL4 X;  2DVW B;  1D2N A;  1NSF A;  2G5G X;  5KO3 A;  4RNA A;  4MB7 A;  4XGI A;  4AW4 A;  3L28 A;  4PDG A;  5ITX E;  4DR2 M;  2C98 A;  1Q3C A;  1WXQ A;  4I8O A;  4X62 M;  1YSY A;  2FE8 A;  3D8L A;  3FD9 A;  2XGN A;  3T38 A;  3VDU A;  1N36 M;  4NSR A;  4JI8 M;  4R3D A;  5JI2 E;  1K3W A;  2BJW A;  1OFI A;  1IBK M;  2Y21 A;  2LNH C;  4MM3 B;  2R4J A;  4AQY M;  4GHA A;  2F5S A;  4B7H A;  1HNX M;  4LCB A;  2H1R A;  4KO8 A;  1R6B X;  4JV5 M;  3M7G A;  4Z6Y A;  1Z5A A;  4M9X A;  2EO2 A;  3HHW A;  3FKE A;  1YE9 A;  2UU9 M;  1J7K A;  4S12 A;  3IG5 A;  3KFU G;  4G4R A;  3GRV A;  3I4Y A;  3TWK A;  1HNZ M;  4LF7 M;  2J7N A;  1TH3 A;  3SAW A;  4AI6 A;  3UGJ A;  1HQC A;  3UJN A;  1XHB A;  1QAQ A;  3HKP A;  3HGI A;  1HR0 M;  5ITY A;  5EP2 A;  4DR5 M;  4NL4 H;  1J09 A;  3FTD A;  4JI3 M;  3ZC7 B;  1XNQ M;  3VK7 A;  1NHW C;  3L27 A;  4FWH A;  5IZ7 D;  1NY6 A;  3QWL A;  4LZJ A;  8CAT A;  4X65 M;  5DNY A;  4AKG A;  3U5Z B;  4IBJ A;  3LVW A;  3AKZ A;  1E9S A;  3AOG A;  4FD2 A;  5EXP A;  4CHT B;  2X49 A;  3DFZ A;  3GPY A;  2A5Y B;  1IY0 A;  2HKJ A;  2D7E A;  1KSF X;  4FWG A;  1TDZ A;  2D7H A;  4WUR A;  3SMP A;  3T15 A;  3KOX E;  2VQF M;  4GIT A;  3LVV A;  3HJ8 A;  4XBO A;  2E5L M;  4G4Q A;  3FTE A;  2KXE A;  3KVW A;  3JR5 A;  4DV4 M;  5E26 A;  4AKI A;  3J27 B;  4QHS A;  2ERC A;  2CV1 A;  4GC5 A;  3GO8 A;  1IM2 A;  3RE8 A;  4FCT A;  3J80 S;  5ITU A;  3J2P B;  3U60 A;  1R7R A;  2JA2 A;  4LFB M;  2L7H A;  3FTC A;  4B08 A;  4KHP M;  1K82 A;  4JI7 M;  5LMN M;  4M9Z A;  3VLF B;  4AG5 A;  4HL4 A;  2R18 A;  1IXZ A;  2Y0T A;  5C1B A;  1GL6 A;  4NOO B;  1ORY B;  4IIW A;  1SXJ D;  2CHV A;  3GPU A;  3GLH B;  2OPF A;  3KP1 E;  1IN6 A;  3GLG B;  1ZQ9 A;  1Z59 A;  1TH2 A;  2DZO B;  2XZU A;  2F5P A;  2I7N A;  3DA1 A;  1NNU C;  5KQ8 A;  3VK8 A;  4AZF A;  3SYK A;  4ZPX A;  2OQ4 A;  4JI2 M;  4DR4 M;  1XNR M;  2XH9 A;  3MHV C;  4P16 A;  4FWD A;  4IJE A;  1Q39 A;  1JQJ C;  1DO0 A;  4M0D A;  4JN6 A;  4DR1 M;  2XFT A;  2QBY A;  1Z5C A;  5IWA M;  3CF6 E;  1SXJ C;  4LJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...