4LFAM

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lfaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lfaM02
1MU5A 4DR6M 4X65M 5A2QS 3A42A 1HNZM 3TWKA 1XNQM 4NRWA 4GKKM 5IT9S 3J80S 2UUBM 4DV0M 4JI1M 4LF6M 4LF7M 1KFVA 4DV3M 4PD2A 1NNJA 4JI4M 1FJGM 3TWLA 2E5LM 4B3TM 4NXMM 4DR4M 5ITXE 5ITRA 5LMNM 3SAUA 1R2YA 4LF4M 4JV5M 1PJJA 4X62M 3C58A 3U6EA 4DV4M 4AQYM 2OPFA 1L1ZA 4JI6M 2EA0A 1XMQM 4JI3M 3JR4A 4OX9M 4DUZM 4DV5M 2VQFM 3JR5A 3GPYA 4G4OA 3U6CA 2Q2EB 3U6DA 4JI2M 1J5EM 5ITYA 3GQ5A 1N36M 3GQ4A 1K82A 1L2BA 1N34M 1TDZA 5ITUA 3GO8A 3SAVA 1IBLM 2F5NA 4PDIA 3JAMS 4YHHM 3VK7A 3W0FA 4LFCM 2F5OA 4KHPM 5ITTA 2UXCM 1EE8A 1PM5A 1Z5CA 4B3RM 1N32M 3A45A 4JI8M 4X64M 1XMOM 1L1TA 1HR0M 4NRVA 2ZBKB 2F5QA 4JI7M 4G4NA 1K3WA 4DV6M 5ITQA 2UUAM 1Z59A 4LF9M 4NXNM 4LFBM 1TDHA 2ZM6M 4CISA 2UXDM 4G4QA 3SAWA 4JYAM 5IWAM 4X66M 4JI0M 3SBJA 4DR2M 2F5SA 3SATA 1Q3CA 3DOAA 3TWMA 3A46A 4LFAM 2UXBM 1Q39A 1IBKM 2UUCM 4DV1M 1Z5AA 2UU9M 1L2CA 4DR7M 1XC8A 1Z5BA 3J7AS 2HHHM 5ITXA 3SASA 3U6PA 3T1YM 4DR3M 1PJIA 4DR1M 4GKJM 2XZFA 4LF8M 1MX0A 4LF5M 1IBMM 5FLXS 3U6QA 1L2DA 3GQ3A 3SARA 2F4VM 1R2ZA 1K3XA 3VK8A 1I94M 3GPXA 4DR5M 4JI5M 4MB7A 4DUYM 3U6OA 1HNXM 2VQEM 5LMUM 5BR8M 2XZUA 4YY3M 4DV2M 2F5PA 1HNWM 2HKJA 1XNRM 4K0KM 3U6SA 2OQ4A 3T1HM 3U6MA 4PCZA 1Q3BA 3GPPA 3GPUA 3U6LA 4B3MM 3GP1A 4DV7M 4G4RA 4ITQA 4PDGA 1N33M 3OTOM 4B3SM 3J81S
chains in the Genus database with same CATH superfamily
1IY2A 1HQCA 2MR9A 4JXJA 3UK6A 1D0MA 2APLA 3A98B 3K1JA 4RF0A 4W5WA 4X65M 5A2QS 1UFZA 1WIVA 2G3QA 2OO9A 2V6ZM 3GRUA 3AOGA 3FYDA 3HY5A 3KXEC 1JR3A 4M9ZA 4LJ4A 1OIPA 1QYRA 3THGA 2CV2A 2UUBM 4LF6M 2DNAA 1KFVA 3RE8A 1FJGM 3TWLA 1VEKA 5DYIA 5LMNM 3HHZA 1IXSB 2W82A 3KP1E 4WP2A 2R4EA 3GLGE 1MN3A 4GITA 3TL4X 3U6EA 4DV4M 5C18A 1L1ZA 2EO2A 4II7A 2DAIA 1XMQM 4JI6M 2XEPA 2CV0A 1TR8A 4LRSA 4JI3M 1CUKA 1GKIA 4IIWA 2YNMD 3JR4A 3NBIA 4DUZM 4I8OA 4DV5M 3B7QA 2BJVA 2DAMA 4FWDA 1VDDA 1GJSA 1HJPA 2Q2EB 2RRUA 3KVWA 1XXHB 2J7OA 3U6DA 3VKHA 1J5EM 1DGBA 1K82A 4RKUF 5ITUA 3SAVA 1YUBA 2HCBA 2LNHC 4OVZB 3LW5F 4PDIA 2UXCM 2A5YB 4YHHM 3H4JA 1HQYE 2CFOA 4B7HA 1WHCA 4R3DA 4QNMA 1QUSA 7CATA 3GLGA 3ZH9B 1R7RA 2QP9X 1NNUC 3K92A 2ZBKB 2ZTDA 2WSCF 4XK8F 2JY7A 4FD2A 4AG5A 1K3WA 1KYIA 3T15A 4NXNM 2AHMA 3HJSA 1OJLA 1TDHA 4LFBM 3HU1A 2DZNB 2KNVA 3I04M 3MJ5A 3U5ZA 4Y28F 3SMPA 1QVRA 2J5YA 4UN2B 3U61B 2F5SA 4JI0M 4L16A 4L15A 3VDPA 4GEWA 4NOOB 5KPZA 4ANRA 2KW0A 3B74A 1Q39A 1XHBA 2NQ8C 1V33A 3C9PA 1L2CA 3VDUA 3Q8XA 3GLGB 1XC8A 1JR3D 2C9OA 3I51A 1VEGA 3T1YM 4LJ6A 3FYCA 2V1UA 5E6JA 3FTFA 3SYLA 2O25A 1TH4A 1J09A 2L7HA 4I5SA 3DA1A 4IBCA 4GKJM 3D8LA 2CHGA 4LF5M 1G71A 2I7NA 3U5ZB 1S3SA 3CF6E 3SHFA 1L2DA 3SARA 2C5RA 1NHWC 1SXJD 1QAMA 2DWMA 2QNJA 2ERCA 4IBEA 4DR5M 1OFHA 1PJQA 1OFIA 2D7HA 2LWXA 4KT0F 5FSWA 2JNHA 1ORYB 1QZMA 2EKKA 4MB7A 2EUCA 2VQEM 2R65A 5LMUM 4YY3M 1QAOA 4AKHA 3PNYA 3KDSE 3MK6A 1HNWM 2HKJA 4G3OA 1GL6A 2JA2A 1W5TA 3U6MA 4QNRA 1YSYA 3GPPA 3KS4A 5EP2A 1IM2A 2JY5A 3GPUA 3SC3A 3U6LA 4B3MM 3GP1A 1EFUB 1XWIA 3HJ8A 1QZEA 3FE3A 3HJQA 4IBGA 4BB9A 1N33M 4ZPXA 2QZ4A 3KOWE 1MU5A 1HT1E 2JY8A 3T38A 3E9SA 4GC5A 1HNZM 1LTMA 3TWKA 4BLCA 4B7FA 1XNQM 4NRWA 3QAUA 4GKKM 5FTLA 3L26A 2XFSA 2R44A 3J80S 3RGPA 4DV0M 4JI1M 2YQZA 4LF7M 1F4IA 4LJAA 4DV3M 3CTWB 4PD2A 4JI4M 2G5GX 4NXMM 4DR4M 4FWHA 2L6OA 3M7GA 2CEAA 1I4WA 1VEJA 4GRIA 1QAQA 2BJWA 4NL4H 3V76A 4B7GA 3C58A 2Y21A 4M9SA 5EP4A 4GH9A 2OPFA 2KNAA 3J27B 4F2LA 4AQYM 1QQWA 2Y20A 2JZ0A 3WHKA 5EXXA 1QANA 5EP3A 4MGKE 1SXJC 2CUZA 2DHYA 2RGHA 1VDLA 1ZMVA 3SMSA 1GJTA 3IG5A 1R5LA 1BVSA 3SHGB 4GHLA 3GQ5A 2D7EA 1G41A 1IQPA 1DGFA 2R45A 1XXHA 3GQ4A 1TDZA 3ILKA 1N34M 3IHPA 1IBLM 3B89A 2F5NA 5H37D 3FTCA 4KHPM 3W0FA 4LFCM 2R6FA 2KXEA 1PM5A 4D82A 4OVZA 3GLFE 1N32M 2WSFF 3A45A 1J7KA 3PVSA 3TPZA 4KLNA 2Z4RA 3FRIA 3NWLA 1XMOM 5EP1A 1L1TA 2BWEA 4NSRA 1HR0M 3HHYA 1ZQ9A 4L4UA 4G4NA 3AJIB 4CHTB 4Q7JA 4DV6M 5ITQA 3VLFB 4HL4A 2C99A 1E9SA 2Z8YM 3KOZE 2R62A 3UJNA 4IBIA 5L8RF 2CV1A 3LVWA 4CISA 2DZLA 4Z6YA 3MHVC 4JYAM 5IWAM 2KNZA 2QCUA 4X66M 2Z3XA 3DOAA 2CRUA 3B7ZA 1V92A 2DKLA 3SFZA 1NV9A 4AKGA 3U61A 4AI6A 1IBKM 2UUCM 1Z5AA 2KDLA 2O01F 3FUXA 3K2LA 3UZUA 4AKIA 3FTDA 3QYEA 2K0BX 3ZQJA 1NV8A 3TE6A 3GLHE 4NC6A 2RKOA 1OKSA 2B3TA 2HWJA 3U6PA 1TTEA 1DO0A 2WZJA 4L6V6 2CP8A 3KSXA 1DGHB 3K8ZA 1G8PA 5DFLA 2OOBA 3PFIA 4LF8M 1IN8A 4IBFA 4FVMA 5FLXS 2LHCA 3QYBA 1LV7A 4I4LA 3GQ3A 2XSZA 3QWLA 2L09A 5KPRA 1I94M 1X37A 4NSOB 5EXPA 4OU7A 3U6OA 2XZUA 4DV2M 1IXRC 5JI3E 3D8BA 4R71A 1OTRA 1DO2A 1YE9A 2KHHA 3E46A 4CGYB 8CATA 2OQ4A 2MH8A 3AKZA 2JP7A 2I7PA 2LH0A 3DZDA 4F1IA 4G4RA 4OW0A 4LJ5A 2O5RA 4P16A 3E4RA 3EIEA 3J81S 3C3EA 1T6OA 4XGIA 4DR6M 4LJ7A 4WW0A 1TGUA 1T3TA 1D0LA 4FCWA 3R9XB 4LZJA 4M9XA 1WGNA 2QBYB 1G4AE 1NJFA 3K9OA 2JUJA 3HX3A 4AZFA 1OAIA 4PT5A 4QOSA 2E5LM 2L4FA 2JXNA 3R8FA 4B3TM 5ITXE 1R2YA 2DAKA 1E94E 1RU3A 2KA6B 2ZAMA 4X62M 2K47A 3FTEA 3LCVB 2EA0A 4M0DA 3LQRA 4REZA 4IJFA 5EXTA 2ZAOA 2VQFM 5DNYA 1PRBA 1VQ1A 2H5XA 3GPYA 4P17A 4CIZA 4IJEA 3H4MA 2DVWB 4D80A 3NBXX 4B08A 3CF0A 3HU3A 2X49A 4JI2M 5JI2E 3M0EA 3ZCBB 2DWLA 2C98A 2V1CA 3GO8A 4QOZC 2XSZD 2DI0A 3IG8A 4S12A 3F92A 1L8QA 3AOEA 1IY0A 1NHGC 1NVMA 3HGIA 3LCUA 1KSFX 2M5ZA 4I81A 3ZC7B 3VK7A 4XBOA 4LG2A 1ZAEA 2KZSA 3KP0E 4RF1A 4B3RM 4JI8M 4RNAA 3L27A 4LZZA 3J7BA 4MGYE 4X64M 2G8LA 4NRVA 4MGIE 2F5QA 3GRVA 4JI7M 2UUAM 1IFYA 4LJ9A 4GHAA 3AV0A 5FTNA 2ZM6M 1G59A 1A5TA 2UXDM 3SAWA 2Y0QA 3SATA 2CE7A 3VFDA 4DR2M 5KO3A 1IN6A 2ZTCA 4MH0E 1JR3E 3I01M 1QDRA 5DYGA 3TWMA 3WHLA 2UXBM 1N75A 2CHVA 3KOXE 3AFHA 3HWSA 3BXWA 2DXIA 4LY6A 5EQTA 1Z5BA 2GNOA 2HAKA 4FCTA 4D81A 3SASA 1QUTA 3L29A 2KRUA 2LVPC 3EIHA 3W0LB 4QHTA 1PJSA 2J7NA 3LVVA 5EXSA 4JN6A 2FS1A 4DR1M 5IZ7D 1SXJE 1DV0A 1GO5A 2FNAA 2XZFA 3SYKA 3UMMA 1MX0A 1DGHA 1GL7A 4Z8XA 2XLJA 2L2DA 2MJ5B 4CJ6A 4DBGB 2QHOB 3U6QA 1WJ7A 1TH3A 3U60A 5KQ8A 3GRYA 5KQDA 1R2ZA 1K3XA 4BBAA 3VK8A 3PNVA 3RFWA 3W68A 2LHGA 1ZMWA 4FCVA 5EJCA 4DUYM 5BR8M 4KODA 4WURA 4EIWA 1PGYA 3GLFA 2DWNA 1XNRM 2RGOA 4LJ8A 2YR0A 3DFZA 1Y8GA 2K9DA 2LVAA 1Q3BA 2JWSA 1SXJA 4ITQA 3J2PB 4R7GA 2P5TA 3B9PA 3C3DA 4MGZE 4L78A 1IN7A 4PDGA 3U60B 2R18A 4B3SM 2BWBA 4HLQA 3TQSA 3BBZA 3IECA 2R4JA 2QPAA 2LXEA 2QSFX 3HZJA 2VIIA 3Q8GA 2R0IA 3A42A 1H6UA 2K6BA 1NSFA 1ZMUA 2DHRA 2DAGA 4L8RC 4AG6A 2X8AA 2MGWA 4LGYA 3KFUG 1WR1B 2LBCA 2QBYA 3UGJA 3GLFB 1NNJA 4MM3B 1QDTA 5ITRA 4LF4M 3SAUA 3AL0C 3FRHA 4JV5M 3GLHA 1PJJA 1SXJB 2YFQA 4LRTA 4M0WA 3W67A 5C1BA 1R6BX 4G6ZA 2H1RA 2LVNC 4FW9A 4OX9M 1WXQA 2EJSA 1DGGA 2M60A 4KO8A 2VF8A 1NY5A 3JR5A 3U6CA 2XH9A 4G4OA 5IT9S 3HHXA 1E9RA 1V34A 2Z7JA 4LCBA 1GABA 2KEBA 2KRKA 2XGNA 1UM8A 5ITYA 3FUVA 1N36M 4IBJA 4LGMA 2LVQD 1IN5A 1L2BA 3CF2A 2OOAA 4IBKA 1HT2E 2C96A 2CWBA 5FTMA 5BPVA 2FE8A 3JAMS 1SG9A 2HL7A 3B7NA 5IREB 2DAEA 3FKEA 1EE8A 3KSJA 5ITTA 1Z5CA 3E21A 2F5OA 3GLHB 1D2NA 1NJGA 3AOEC 5FTKA 3LMMA 1FNNA 2DZOB 3M6AA 1OIZA 1VG5A 1R4GA 3GLIE 1AUAA 2DENA 2QQ8A 1GLNA 3I4VA 3FUUA 1JQJC 1D0KA 2R46A 1Z59A 4LF9M 2QENA 2FOIC 2XF3A 3BOSA 3GRRA 1YLAA 1Q02A 4GC9A 4FWGA 1ZV1A 4HEOA 5KPTA 3KS8A 4GMQA 4G4QA 3L25A 3LQQA 3MMPA 2L4EA 3RGSA 1G3IA 3SBJA 1Q3CA 1EIJA 3HU2A 1N78A 3A46A 4LFAM 2Y0TA 3HKPA 4DV1M 1MJGM 2UU9M 1NY6A 4QHSA 3K9PA 3FUTA 4DR7M 2FFJA 4MGHA 2C9CA 3J7AS 2HHHM 2VDBB 2GQFA 2Z4SA 5ITXA 1C7YA 5FTJA 2FH0A 3VKGA 1AIPC 4DR3M 3KOYE 1E32A 3GLIA 1PJIA 1IXZA 2N35A 2MROB 5F3WA 2JY6B 3FUWA 1IBMM 3KW6A 1IN4A 3CGWA 2DWZB 2BNKA 2F4VM 1OQYA 1OAOC 2D7GA 1C1KA 2L7IA 3GPXA 4JI5M 1PJTA 1XXHE 2VF7A 4TUWA 3PXGA 2LTUA 2EKFA 2ZANA 1HNXM 4GIPA 2CHQA 2LVOC 2KZUA 1N77A 5E26A 2F5PA 5GKNA 1IY1A 2XFTA 4K0KM 1Z6TA 1GVNA 3FD9A 3GLIB 3U6SA 3T1HM 2WSEF 1JB0F 2JZ1A 1IXSA 1NO1A 4PCZA 1XB2B 3T6PA 3L28A 3I4YA 1W5SA 4IBDA 4AW4A 4DV7M 1TF0B 2X4AA 1TH2A 1WGLA 4A3VB 3OTOM 3HHWA 3L2AA 1T43A 1P3QQ 4IBBA
chains in the Genus database with same CATH topology
1IY2A 1HQCA 4JXJA 3UK6A 3K1JA 3A98B 4RF0A 4W5WA 4X65M 5A2QS 3KXEC 2V6ZM 3GRUA 4QHTA 3R9XB 3AOGA 3FYDA 4M9ZA 3THGA 1JR3A 2CV2A 5IT9S 1QYRA 2UUBM 4LF6M 1KFVA 3RE8A 1FJGM 3TWLA 5DYIA 5LMNM 3HHZA 1IXSB 2W82A 3KP1E 2R4EA 4GITA 3TL4X 3U6EA 4DV4M 5C18A 1L1ZA 2EO2A 4II7A 4JI6M 1XMQM 2XEPA 2CV0A 4LRSA 4JI3M 3JR4A 1GKIA 4IIWA 2YNMD 3NBIA 4DUZM 4I8OA 4DV5M 2BJVA 4FWDA 1VDDA 2Q2EB 3KVWA 1XXHB 2J7OA 3U6DA 3VKHA 1J5EM 1DGBA 1K82A 5ITUA 3SAVA 1YUBA 2HCBA 2LNHC 4OVZB 4PDIA 2UXCM 2A5YB 4YHHM 1HQYE 2CFOA 4B7HA 4R3DA 4QNMA 7CATA 3GLGA 3ZH9B 1R7RA 2QP9X 1NNUC 3K92A 2ZBKB 4FD2A 4AG5A 1K3WA 1KYIA 3T15A 4NXNM 2AHMA 3HJSA 1OJLA 1TDHA 4LFBM 3HU1A 2DZNB 3MJ5A 3U5ZA 3SMPA 1QVRA 3U61B 2F5SA 4JI0M 4L16A 4L15A 3VDPA 4NOOB 5KPZA 2KW0A 1Q39A 1XHBA 2NQ8C 1L2CA 3VDUA 3Q8XA 3GLGB 1XC8A 1JR3D 2C9OA 3I51A 3T1YM 4LJ6A 3FYCA 2V1UA 5E6JA 3FTFA 3SYLA 1TH4A 1J09A 2L7HA 4I5SA 3DA1A 4IBCA 4GKJM 3D8LA 2CHGA 4LF5M 2I7NA 3U5ZB 1S3SA 3CF6E 3SHFA 1L2DA 3SARA 2C5RA 1NHWC 1SXJD 1QAMA 2DWMA 2ERCA 4IBEA 4DR5M 1OFHA 1OFIA 2D7HA 2LWXA 5FSWA 1ORYB 1QZMA 4MB7A 2EUCA 2VQEM 2R65A 5LMUM 4YY3M 1QAOA 4AKHA 3PNYA 3KDSE 3MK6A 1HNWM 2HKJA 1GL6A 2JA2A 1W5TA 3U6MA 4QNRA 1YSYA 3GPPA 3KS4A 5EP2A 1IM2A 3GPUA 3SC3A 3U6LA 4B3MM 3GP1A 1XWIA 3HJ8A 4IBGA 3HJQA 4BB9A 1N33M 4ZPXA 2QZ4A 3KOWE 1MU5A 1HT1E 3T38A 3E9SA 4GC5A 1HNZM 3TWKA 4BLCA 4B7FA 1XNQM 4NRWA 3QAUA 4GKKM 5FTLA 3L26A 2XFSA 3J80S 3RGPA 4DV0M 4JI1M 4LF7M 2YQZA 4LJAA 4DV3M 3CTWB 4PD2A 4JI4M 2G5GX 4NXMM 4DR4M 4FWHA 2L6OA 3M7GA 2CEAA 1I4WA 4GRIA 1QAQA 2BJWA 4NL4H 4B7GA 3C58A 2Y21A 4M9SA 5EP4A 4GH9A 2OPFA 3J27B 4AQYM 1QQWA 2Y20A 3WHKA 5EXXA 1QANA 5EP3A 4MGKE 1SXJC 2CUZA 2RGHA 3SMSA 3IG5A 3SHGB 4GHLA 3GQ5A 2D7EA 1G41A 1IQPA 1DGFA 2R45A 1XXHA 3GQ4A 1TDZA 3ILKA 1N34M 1IBLM 2F5NA 5H37D 3FTCA 4KHPM 3W0FA 4LFCM 2KXEA 1PM5A 4D82A 4OVZA 1N32M 3A45A 1J7KA 3PVSA 3TPZA 4KLNA 2Z4RA 1XMOM 3NWLA 1L1TA 5EP1A 1HR0M 4NSRA 3HHYA 1ZQ9A 4L4UA 4G4NA 3AJIB 4CHTB 4DV6M 5ITQA 3VLFB 4HL4A 2C99A 1E9SA 3KOZE 3UJNA 2R62A 2CV1A 4IBIA 3LVWA 4CISA 4Z6YA 3MHVC 4JYAM 5IWAM 2QCUA 4X66M 2Z3XA 3DOAA 3SFZA 4AKGA 3U61A 4AI6A 1IBKM 2UUCM 1Z5AA 3FUXA 3K2LA 3UZUA 4AKIA 3FTDA 3TE6A 3U6PA 2RKOA 1DO0A 3KSXA 1DGHB 3K8ZA 1G8PA 3PFIA 4LF8M 1IN8A 4IBFA 4FVMA 5FLXS 1LV7A 4I4LA 3GQ3A 2XSZA 3QWLA 2L09A 5KPRA 1I94M 1X37A 4NSOB 5EXPA 4OU7A 3U6OA 2XZUA 4DV2M 1IXRC 5JI3E 3D8BA 1DO2A 1YE9A 8CATA 4CGYB 2OQ4A 3AKZA 2I7PA 2LH0A 3DZDA 4G4RA 4OW0A 2O5RA 4P16A 3EIEA 3E4RA 3J81S 4XGIA 4DR6M 4LJ7A 4WW0A 1TGUA 1T3TA 4FCWA 4M9XA 2QBYB 1G4AE 1NJFA 4AZFA 4PT5A 4QOSA 2E5LM 3R8FA 4B3TM 5ITXE 1R2YA 1E94E 2KA6B 2ZAMA 4X62M 2K47A 3FTEA 2EA0A 4M0DA 3LQRA 4REZA 4IJFA 5EXTA 2ZAOA 2VQFM 5DNYA 3GPYA 4D80A 4IJEA 3H4MA 2DVWB 4B08A 3CF0A 3HU3A 2X49A 4JI2M 5JI2E 3M0EA 3ZCBB 2DWLA 2C98A 2V1CA 3GO8A 4QOZC 2XSZD 3IG8A 4S12A 3HGIA 1L8QA 3AOEA 1IY0A 1NHGC 1NVMA 4I81A 4LZJA 1KSFX 2M5ZA 3ZC7B 3VK7A 4XBOA 4LG2A 1ZAEA 2KZSA 3KP0E 4RF1A 4B3RM 4JI8M 4RNAA 3L27A 4LZZA 3J7BA 4MGYE 4X64M 2G8LA 4NRVA 4MGIE 2F5QA 3GRVA 4JI7M 2UUAM 4LJ9A 4GHAA 3AV0A 5FTNA 2ZM6M 1G59A 2UXDM 3SAWA 2Y0QA 3SATA 2CE7A 3VFDA 4DR2M 5KO3A 1IN6A 4MH0E 3TWMA 5DYGA 3WHLA 2UXBM 1N75A 2CHVA 3KOXE 3AFHA 3HWSA 2DXIA 4LY6A 5EQTA 1Z5BA 4FCTA 4D81A 3SASA 3L29A 2KRUA 3EIHA 3W0LB 2J7NA 3LVVA 5EXSA 4JN6A 4DR1M 5IZ7D 1SXJE 2FNAA 2XZFA 3SYKA 3UMMA 1MX0A 1DGHA 1GL7A 4Z8XA 2XLJA 3U6QA 3U60A 1TH3A 5KQ8A 3GRYA 5KQDA 1R2ZA 1K3XA 4BBAA 3VK8A 3PNVA 3RFWA 4FCVA 5EJCA 4DUYM 5BR8M 4KODA 4WURA 4EIWA 3GLFA 2DWNA 1XNRM 2RGOA 4LJ8A 2YR0A 3DFZA 1Q3BA 1SXJA 4ITQA 3J2PB 4R7GA 2P5TA 3B9PA 4MGZE 4PDGA 4L78A 1IN7A 3U60B 2R18A 4B3SM 4HLQA 3TQSA 2R4JA 2QPAA 2LXEA 2VIIA 3A42A 1H6UA 1NSFA 2DHRA 4L8RC 4AG6A 2X8AA 4LGYA 3KFUG 2QBYA 3UGJA 3GLFB 1NNJA 4MM3B 5ITRA 4LF4M 3SAUA 3AL0C 4JV5M 3GLHA 1PJJA 1SXJB 2YFQA 4LRTA 4M0WA 5C1BA 1R6BX 4G6ZA 2H1RA 4FW9A 4OX9M 1WXQA 1DGGA 2M60A 4KO8A 1NY5A 3JR5A 3U6CA 2XH9A 4G4OA 3HHXA 1E9RA 2Z7JA 4LCBA 2KEBA 2KRKA 2XGNA 1UM8A 5ITYA 3FUVA 1N36M 4IBJA 4LGMA 1IN5A 1L2BA 3CF2A 4IBKA 1HT2E 2C96A 5FTMA 5BPVA 2FE8A 3JAMS 2HL7A 5IREB 2F5OA 3FKEA 3KSJA 1EE8A 5ITTA 1Z5CA 3GLHB 1D2NA 1NJGA 3AOEC 5FTKA 3LMMA 1FNNA 2DZOB 3M6AA 1GLNA 3I4VA 3FUUA 1JQJC 2R46A 1Z59A 4LF9M 2QENA 2FOIC 2XF3A 3BOSA 3GRRA 5KPTA 4GC9A 4FWGA 3KS8A 4GMQA 4G4QA 3L25A 3LQQA 3RGSA 1G3IA 3SBJA 1Q3CA 3HU2A 1N78A 3A46A 4LFAM 2Y0TA 3HKPA 4DV1M 2UU9M 1NY6A 4QHSA 3FUTA 4DR7M 2FFJA 4MGHA 2C9CA 3J7AS 2HHHM 5ITXA 2Z4SA 5FTJA 3VKGA 4DR3M 3KOYE 1E32A 3GLIA 1PJIA 1IXZA 5F3WA 1IBMM 3FUWA 3KW6A 1IN4A 2DWZB 2BNKA 2F4VM 2D7GA 1C1KA 2L7IA 3GPXA 4JI5M 4TUWA 3PXGA 2ZANA 1HNXM 4GIPA 2CHQA 2KZUA 1N77A 5E26A 2F5PA 5GKNA 1IY1A 2XFTA 4K0KM 1Z6TA 1GVNA 3FD9A 3GLIB 3U6SA 3T1HM 4PCZA 3L28A 3I4YA 1W5SA 4IBDA 4AW4A 4DV7M 2X4AA 1TH2A 4A3VB 3OTOM 3HHWA 3L2AA 4LJ4A 4LJ5A 4IBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MU5 A;  4DR6 M;  4X65 M;  5A2Q S;  3A42 A;  1HNZ M;  3TWK A;  1XNQ M;  4NRW A;  4GKK M;  5IT9 S;  3J80 S;  2UUB M;  4DV0 M;  4JI1 M;  4LF6 M;  4LF7 M;  1KFV A;  4DV3 M;  4PD2 A;  1NNJ A;  4JI4 M;  1FJG M;  3TWL A;  2E5L M;  4B3T M;  4NXM M;  4DR4 M;  5ITX E;  5ITR A;  5LMN M;  3SAU A;  1R2Y A;  4LF4 M;  4JV5 M;  1PJJ A;  4X62 M;  3C58 A;  3U6E A;  4DV4 M;  4AQY M;  2OPF A;  1L1Z A;  4JI6 M;  2EA0 A;  1XMQ M;  4JI3 M;  3JR4 A;  4OX9 M;  4DUZ M;  4DV5 M;  2VQF M;  3JR5 A;  3GPY A;  4G4O A;  3U6C A;  2Q2E B;  3U6D A;  4JI2 M;  1J5E M;  5ITY A;  3GQ5 A;  1N36 M;  3GQ4 A;  1K82 A;  1L2B A;  1N34 M;  1TDZ A;  5ITU A;  3GO8 A;  3SAV A;  1IBL M;  2F5N A;  4PDI A;  3JAM S;  4YHH M;  3VK7 A;  3W0F A;  4LFC M;  2F5O A;  4KHP M;  5ITT A;  2UXC M;  1EE8 A;  1PM5 A;  1Z5C A;  4B3R M;  1N32 M;  3A45 A;  4JI8 M;  4X64 M;  1XMO M;  1L1T A;  1HR0 M;  4NRV A;  2ZBK B;  2F5Q A;  4JI7 M;  4G4N A;  1K3W A;  4DV6 M;  5ITQ A;  2UUA M;  1Z59 A;  4LF9 M;  4NXN M;  4LFB M;  1TDH A;  2ZM6 M;  4CIS A;  2UXD M;  4G4Q A;  3SAW A;  4JYA M;  5IWA M;  4X66 M;  4JI0 M;  3SBJ A;  4DR2 M;  2F5S A;  3SAT A;  1Q3C A;  3DOA A;  3TWM A;  3A46 A;  4LFA M;  2UXB M;  1Q39 A;  1IBK M;  2UUC M;  4DV1 M;  1Z5A A;  2UU9 M;  1L2C A;  4DR7 M;  1XC8 A;  1Z5B A;  3J7A S;  2HHH M;  5ITX A;  3SAS A;  3U6P A;  3T1Y M;  4DR3 M;  1PJI A;  4DR1 M;  4GKJ M;  2XZF A;  4LF8 M;  1MX0 A;  4LF5 M;  1IBM M;  5FLX S;  3U6Q A;  1L2D A;  3GQ3 A;  3SAR A;  2F4V M;  1R2Z A;  1K3X A;  3VK8 A;  1I94 M;  3GPX A;  4DR5 M;  4JI5 M;  4MB7 A;  4DUY M;  3U6O A;  1HNX M;  2VQE M;  5LMU M;  5BR8 M;  2XZU A;  4YY3 M;  4DV2 M;  2F5P A;  1HNW M;  2HKJ A;  1XNR M;  4K0K M;  3U6S A;  2OQ4 A;  3T1H M;  3U6M A;  4PCZ A;  1Q3B A;  3GPP A;  3GPU A;  3U6L A;  4B3M M;  3GP1 A;  4DV7 M;  4G4R A;  4ITQ A;  4PDG A;  1N33 M;  3OTO M;  4B3S M;  3J81 S; 
#chains in the Genus database with same CATH topology
 1IY2 A;  1HQC A;  2MR9 A;  4JXJ A;  3UK6 A;  1D0M A;  2APL A;  3A98 B;  3K1J A;  4RF0 A;  4W5W A;  4X65 M;  5A2Q S;  1UFZ A;  1WIV A;  2G3Q A;  2OO9 A;  2V6Z M;  3GRU A;  3AOG A;  3FYD A;  3HY5 A;  3KXE C;  1JR3 A;  4M9Z A;  4LJ4 A;  1OIP A;  1QYR A;  3THG A;  2CV2 A;  2UUB M;  4LF6 M;  2DNA A;  1KFV A;  3RE8 A;  1FJG M;  3TWL A;  1VEK A;  5DYI A;  5LMN M;  3HHZ A;  1IXS B;  2W82 A;  3KP1 E;  4WP2 A;  2R4E A;  3GLG E;  1MN3 A;  4GIT A;  3TL4 X;  3U6E A;  4DV4 M;  5C18 A;  1L1Z A;  2EO2 A;  4II7 A;  2DAI A;  1XMQ M;  4JI6 M;  2XEP A;  2CV0 A;  1TR8 A;  4LRS A;  4JI3 M;  1CUK A;  1GKI A;  4IIW A;  2YNM D;  3JR4 A;  3NBI A;  4DUZ M;  4I8O A;  4DV5 M;  3B7Q A;  2BJV A;  2DAM A;  4FWD A;  1VDD A;  1GJS A;  1HJP A;  2Q2E B;  2RRU A;  3KVW A;  1XXH B;  2J7O A;  3U6D A;  3VKH A;  1J5E M;  1DGB A;  1K82 A;  4RKU F;  5ITU A;  3SAV A;  1YUB A;  2HCB A;  2LNH C;  4OVZ B;  3LW5 F;  4PDI A;  2UXC M;  2A5Y B;  4YHH M;  3H4J A;  1HQY E;  2CFO A;  4B7H A;  1WHC A;  4R3D A;  4QNM A;  1QUS A;  7CAT A;  3GLG A;  3ZH9 B;  1R7R A;  2QP9 X;  1NNU C;  3K92 A;  2ZBK B;  2ZTD A;  2WSC F;  4XK8 F;  2JY7 A;  4FD2 A;  4AG5 A;  1K3W A;  1KYI A;  3T15 A;  4NXN M;  2AHM A;  3HJS A;  1OJL A;  1TDH A;  4LFB M;  3HU1 A;  2DZN B;  2KNV A;  3I04 M;  3MJ5 A;  3U5Z A;  4Y28 F;  3SMP A;  1QVR A;  2J5Y A;  4UN2 B;  3U61 B;  2F5S A;  4JI0 M;  4L16 A;  4L15 A;  3VDP A;  4GEW A;  4NOO B;  5KPZ A;  4ANR A;  2KW0 A;  3B74 A;  1Q39 A;  1XHB A;  2NQ8 C;  1V33 A;  3C9P A;  1L2C A;  3VDU A;  3Q8X A;  3GLG B;  1XC8 A;  1JR3 D;  2C9O A;  3I51 A;  1VEG A;  3T1Y M;  4LJ6 A;  3FYC A;  2V1U A;  5E6J A;  3FTF A;  3SYL A;  2O25 A;  1TH4 A;  1J09 A;  2L7H A;  4I5S A;  3DA1 A;  4IBC A;  4GKJ M;  3D8L A;  2CHG A;  4LF5 M;  1G71 A;  2I7N A;  3U5Z B;  1S3S A;  3CF6 E;  3SHF A;  1L2D A;  3SAR A;  2C5R A;  1NHW C;  1SXJ D;  1QAM A;  2DWM A;  2QNJ A;  2ERC A;  4IBE A;  4DR5 M;  1OFH A;  1PJQ A;  1OFI A;  2D7H A;  2LWX A;  4KT0 F;  5FSW A;  2JNH A;  1ORY B;  1QZM A;  2EKK A;  4MB7 A;  2EUC A;  2VQE M;  2R65 A;  5LMU M;  4YY3 M;  1QAO A;  4AKH A;  3PNY A;  3KDS E;  3MK6 A;  1HNW M;  2HKJ A;  4G3O A;  1GL6 A;  2JA2 A;  1W5T A;  3U6M A;  4QNR A;  1YSY A;  3GPP A;  3KS4 A;  5EP2 A;  1IM2 A;  2JY5 A;  3GPU A;  3SC3 A;  3U6L A;  4B3M M;  3GP1 A;  1EFU B;  1XWI A;  3HJ8 A;  1QZE A;  3FE3 A;  3HJQ A;  4IBG A;  4BB9 A;  1N33 M;  4ZPX A;  2QZ4 A;  3KOW E;  1MU5 A;  1HT1 E;  2JY8 A;  3T38 A;  3E9S A;  4GC5 A;  1HNZ M;  1LTM A;  3TWK A;  4BLC A;  4B7F A;  1XNQ M;  4NRW A;  3QAU A;  4GKK M;  5FTL A;  3L26 A;  2XFS A;  2R44 A;  3J80 S;  3RGP A;  4DV0 M;  4JI1 M;  2YQZ A;  4LF7 M;  1F4I A;  4LJA A;  4DV3 M;  3CTW B;  4PD2 A;  4JI4 M;  2G5G X;  4NXM M;  4DR4 M;  4FWH A;  2L6O A;  3M7G A;  2CEA A;  1I4W A;  1VEJ A;  4GRI A;  1QAQ A;  2BJW A;  4NL4 H;  3V76 A;  4B7G A;  3C58 A;  2Y21 A;  4M9S A;  5EP4 A;  4GH9 A;  2OPF A;  2KNA A;  3J27 B;  4F2L A;  4AQY M;  1QQW A;  2Y20 A;  2JZ0 A;  3WHK A;  5EXX A;  1QAN A;  5EP3 A;  4MGK E;  1SXJ C;  2CUZ A;  2DHY A;  2RGH A;  1VDL A;  1ZMV A;  3SMS A;  1GJT A;  3IG5 A;  1R5L A;  1BVS A;  3SHG B;  4GHL A;  3GQ5 A;  2D7E A;  1G41 A;  1IQP A;  1DGF A;  2R45 A;  1XXH A;  3GQ4 A;  1TDZ A;  3ILK A;  1N34 M;  3IHP A;  1IBL M;  3B89 A;  2F5N A;  5H37 D;  3FTC A;  4KHP M;  3W0F A;  4LFC M;  2R6F A;  2KXE A;  1PM5 A;  4D82 A;  4OVZ A;  3GLF E;  1N32 M;  2WSF F;  3A45 A;  1J7K A;  3PVS A;  3TPZ A;  4KLN A;  2Z4R A;  3FRI A;  3NWL A;  1XMO M;  5EP1 A;  1L1T A;  2BWE A;  4NSR A;  1HR0 M;  3HHY A;  1ZQ9 A;  4L4U A;  4G4N A;  3AJI B;  4CHT B;  4Q7J A;  4DV6 M;  5ITQ A;  3VLF B;  4HL4 A;  2C99 A;  1E9S A;  2Z8Y M;  3KOZ E;  2R62 A;  3UJN A;  4IBI A;  5L8R F;  2CV1 A;  3LVW A;  4CIS A;  2DZL A;  4Z6Y A;  3MHV C;  4JYA M;  5IWA M;  2KNZ A;  2QCU A;  4X66 M;  2Z3X A;  3DOA A;  2CRU A;  3B7Z A;  1V92 A;  2DKL A;  3SFZ A;  1NV9 A;  4AKG A;  3U61 A;  4AI6 A;  1IBK M;  2UUC M;  1Z5A A;  2KDL A;  2O01 F;  3FUX A;  3K2L A;  3UZU A;  4AKI A;  3FTD A;  3QYE A;  2K0B X;  3ZQJ A;  1NV8 A;  3TE6 A;  3GLH E;  4NC6 A;  2RKO A;  1OKS A;  2B3T A;  2HWJ A;  3U6P A;  1TTE A;  1DO0 A;  2WZJ A;  4L6V 6;  2CP8 A;  3KSX A;  1DGH B;  3K8Z A;  1G8P A;  5DFL A;  2OOB A;  3PFI A;  4LF8 M;  1IN8 A;  4IBF A;  4FVM A;  5FLX S;  2LHC A;  3QYB A;  1LV7 A;  4I4L A;  3GQ3 A;  2XSZ A;  3QWL A;  2L09 A;  5KPR A;  1I94 M;  1X37 A;  4NSO B;  5EXP A;  4OU7 A;  3U6O A;  2XZU A;  4DV2 M;  1IXR C;  5JI3 E;  3D8B A;  4R71 A;  1OTR A;  1DO2 A;  1YE9 A;  2KHH A;  3E46 A;  4CGY B;  8CAT A;  2OQ4 A;  2MH8 A;  3AKZ A;  2JP7 A;  2I7P A;  2LH0 A;  3DZD A;  4F1I A;  4G4R A;  4OW0 A;  4LJ5 A;  2O5R A;  4P16 A;  3E4R A;  3EIE A;  3J81 S;  3C3E A;  1T6O A;  4XGI A;  4DR6 M;  4LJ7 A;  4WW0 A;  1TGU A;  1T3T A;  1D0L A;  4FCW A;  3R9X B;  4LZJ A;  4M9X A;  1WGN A;  2QBY B;  1G4A E;  1NJF A;  3K9O A;  2JUJ A;  3HX3 A;  4AZF A;  1OAI A;  4PT5 A;  4QOS A;  2E5L M;  2L4F A;  2JXN A;  3R8F A;  4B3T M;  5ITX E;  1R2Y A;  2DAK A;  1E94 E;  1RU3 A;  2KA6 B;  2ZAM A;  4X62 M;  2K47 A;  3FTE A;  3LCV B;  2EA0 A;  4M0D A;  3LQR A;  4REZ A;  4IJF A;  5EXT A;  2ZAO A;  2VQF M;  5DNY A;  1PRB A;  1VQ1 A;  2H5X A;  3GPY A;  4P17 A;  4CIZ A;  4IJE A;  3H4M A;  2DVW B;  4D80 A;  3NBX X;  4B08 A;  3CF0 A;  3HU3 A;  2X49 A;  4JI2 M;  5JI2 E;  3M0E A;  3ZCB B;  2DWL A;  2C98 A;  2V1C A;  3GO8 A;  4QOZ C;  2XSZ D;  2DI0 A;  3IG8 A;  4S12 A;  3F92 A;  1L8Q A;  3AOE A;  1IY0 A;  1NHG C;  1NVM A;  3HGI A;  3LCU A;  1KSF X;  2M5Z A;  4I81 A;  3ZC7 B;  3VK7 A;  4XBO A;  4LG2 A;  1ZAE A;  2KZS A;  3KP0 E;  4RF1 A;  4B3R M;  4JI8 M;  4RNA A;  3L27 A;  4LZZ A;  3J7B A;  4MGY E;  4X64 M;  2G8L A;  4NRV A;  4MGI E;  2F5Q A;  3GRV A;  4JI7 M;  2UUA M;  1IFY A;  4LJ9 A;  4GHA A;  3AV0 A;  5FTN A;  2ZM6 M;  1G59 A;  1A5T A;  2UXD M;  3SAW A;  2Y0Q A;  3SAT A;  2CE7 A;  3VFD A;  4DR2 M;  5KO3 A;  1IN6 A;  2ZTC A;  4MH0 E;  1JR3 E;  3I01 M;  1QDR A;  5DYG A;  3TWM A;  3WHL A;  2UXB M;  1N75 A;  2CHV A;  3KOX E;  3AFH A;  3HWS A;  3BXW A;  2DXI A;  4LY6 A;  5EQT A;  1Z5B A;  2GNO A;  2HAK A;  4FCT A;  4D81 A;  3SAS A;  1QUT A;  3L29 A;  2KRU A;  2LVP C;  3EIH A;  3W0L B;  4QHT A;  1PJS A;  2J7N A;  3LVV A;  5EXS A;  4JN6 A;  2FS1 A;  4DR1 M;  5IZ7 D;  1SXJ E;  1DV0 A;  1GO5 A;  2FNA A;  2XZF A;  3SYK A;  3UMM A;  1MX0 A;  1DGH A;  1GL7 A;  4Z8X A;  2XLJ A;  2L2D A;  2MJ5 B;  4CJ6 A;  4DBG B;  2QHO B;  3U6Q A;  1WJ7 A;  1TH3 A;  3U60 A;  5KQ8 A;  3GRY A;  5KQD A;  1R2Z A;  1K3X A;  4BBA A;  3VK8 A;  3PNV A;  3RFW A;  3W68 A;  2LHG A;  1ZMW A;  4FCV A;  5EJC A;  4DUY M;  5BR8 M;  4KOD A;  4WUR A;  4EIW A;  1PGY A;  3GLF A;  2DWN A;  1XNR M;  2RGO A;  4LJ8 A;  2YR0 A;  3DFZ A;  1Y8G A;  2K9D A;  2LVA A;  1Q3B A;  2JWS A;  1SXJ A;  4ITQ A;  3J2P B;  4R7G A;  2P5T A;  3B9P A;  3C3D A;  4MGZ E;  4L78 A;  1IN7 A;  4PDG A;  3U60 B;  2R18 A;  4B3S M;  2BWB A;  4HLQ A;  3TQS A;  3BBZ A;  3IEC A;  2R4J A;  2QPA A;  2LXE A;  2QSF X;  3HZJ A;  2VII A;  3Q8G A;  2R0I A;  3A42 A;  1H6U A;  2K6B A;  1NSF A;  1ZMU A;  2DHR A;  2DAG A;  4L8R C;  4AG6 A;  2X8A A;  2MGW A;  4LGY A;  3KFU G;  1WR1 B;  2LBC A;  2QBY A;  3UGJ A;  3GLF B;  1NNJ A;  4MM3 B;  1QDT A;  5ITR A;  4LF4 M;  3SAU A;  3AL0 C;  3FRH A;  4JV5 M;  3GLH A;  1PJJ A;  1SXJ B;  2YFQ A;  4LRT A;  4M0W A;  3W67 A;  5C1B A;  1R6B X;  4G6Z A;  2H1R A;  2LVN C;  4FW9 A;  4OX9 M;  1WXQ A;  2EJS A;  1DGG A;  2M60 A;  4KO8 A;  2VF8 A;  1NY5 A;  3JR5 A;  3U6C A;  2XH9 A;  4G4O A;  5IT9 S;  3HHX A;  1E9R A;  1V34 A;  2Z7J A;  4LCB A;  1GAB A;  2KEB A;  2KRK A;  2XGN A;  1UM8 A;  5ITY A;  3FUV A;  1N36 M;  4IBJ A;  4LGM A;  2LVQ D;  1IN5 A;  1L2B A;  3CF2 A;  2OOA A;  4IBK A;  1HT2 E;  2C96 A;  2CWB A;  5FTM A;  5BPV A;  2FE8 A;  3JAM S;  1SG9 A;  2HL7 A;  3B7N A;  5IRE B;  2DAE A;  3FKE A;  1EE8 A;  3KSJ A;  5ITT A;  1Z5C A;  3E21 A;  2F5O A;  3GLH B;  1D2N A;  1NJG A;  3AOE C;  5FTK A;  3LMM A;  1FNN A;  2DZO B;  3M6A A;  1OIZ A;  1VG5 A;  1R4G A;  3GLI E;  1AUA A;  2DEN A;  2QQ8 A;  1GLN A;  3I4V A;  3FUU A;  1JQJ C;  1D0K A;  2R46 A;  1Z59 A;  4LF9 M;  2QEN A;  2FOI C;  2XF3 A;  3BOS A;  3GRR A;  1YLA A;  1Q02 A;  4GC9 A;  4FWG A;  1ZV1 A;  4HEO A;  5KPT A;  3KS8 A;  4GMQ A;  4G4Q A;  3L25 A;  3LQQ A;  3MMP A;  2L4E A;  3RGS A;  1G3I A;  3SBJ A;  1Q3C A;  1EIJ A;  3HU2 A;  1N78 A;  3A46 A;  4LFA M;  2Y0T A;  3HKP A;  4DV1 M;  1MJG M;  2UU9 M;  1NY6 A;  4QHS A;  3K9P A;  3FUT A;  4DR7 M;  2FFJ A;  4MGH A;  2C9C A;  3J7A S;  2HHH M;  2VDB B;  2GQF A;  2Z4S A;  5ITX A;  1C7Y A;  5FTJ A;  2FH0 A;  3VKG A;  1AIP C;  4DR3 M;  3KOY E;  1E32 A;  3GLI A;  1PJI A;  1IXZ A;  2N35 A;  2MRO B;  5F3W A;  2JY6 B;  3FUW A;  1IBM M;  3KW6 A;  1IN4 A;  3CGW A;  2DWZ B;  2BNK A;  2F4V M;  1OQY A;  1OAO C;  2D7G A;  1C1K A;  2L7I A;  3GPX A;  4JI5 M;  1PJT A;  1XXH E;  2VF7 A;  4TUW A;  3PXG A;  2LTU A;  2EKF A;  2ZAN A;  1HNX M;  4GIP A;  2CHQ A;  2LVO C;  2KZU A;  1N77 A;  5E26 A;  2F5P A;  5GKN A;  1IY1 A;  2XFT A;  4K0K M;  1Z6T A;  1GVN A;  3FD9 A;  3GLI B;  3U6S A;  3T1H M;  2WSE F;  1JB0 F;  2JZ1 A;  1IXS A;  1NO1 A;  4PCZ A;  1XB2 B;  3T6P A;  3L28 A;  3I4Y A;  1W5S A;  4IBD A;  4AW4 A;  4DV7 M;  1TF0 B;  2X4A A;  1TH2 A;  1WGL A;  4A3V B;  3OTO M;  3HHW A;  3L2A A;  1T43 A;  1P3Q Q;  4IBB A; 
#chains in the Genus database with same CATH homology
 1IY2 A;  1HQC A;  4JXJ A;  3UK6 A;  3K1J A;  3A98 B;  4RF0 A;  4W5W A;  4X65 M;  5A2Q S;  3KXE C;  2V6Z M;  3GRU A;  4QHT A;  3R9X B;  3AOG A;  3FYD A;  4M9Z A;  3THG A;  1JR3 A;  2CV2 A;  5IT9 S;  1QYR A;  2UUB M;  4LF6 M;  1KFV A;  3RE8 A;  1FJG M;  3TWL A;  5DYI A;  5LMN M;  3HHZ A;  1IXS B;  2W82 A;  3KP1 E;  2R4E A;  4GIT A;  3TL4 X;  3U6E A;  4DV4 M;  5C18 A;  1L1Z A;  2EO2 A;  4II7 A;  4JI6 M;  1XMQ M;  2XEP A;  2CV0 A;  4LRS A;  4JI3 M;  3JR4 A;  1GKI A;  4IIW A;  2YNM D;  3NBI A;  4DUZ M;  4I8O A;  4DV5 M;  2BJV A;  4FWD A;  1VDD A;  2Q2E B;  3KVW A;  1XXH B;  2J7O A;  3U6D A;  3VKH A;  1J5E M;  1DGB A;  1K82 A;  5ITU A;  3SAV A;  1YUB A;  2HCB A;  2LNH C;  4OVZ B;  4PDI A;  2UXC M;  2A5Y B;  4YHH M;  1HQY E;  2CFO A;  4B7H A;  4R3D A;  4QNM A;  7CAT A;  3GLG A;  3ZH9 B;  1R7R A;  2QP9 X;  1NNU C;  3K92 A;  2ZBK B;  4FD2 A;  4AG5 A;  1K3W A;  1KYI A;  3T15 A;  4NXN M;  2AHM A;  3HJS A;  1OJL A;  1TDH A;  4LFB M;  3HU1 A;  2DZN B;  3MJ5 A;  3U5Z A;  3SMP A;  1QVR A;  3U61 B;  2F5S A;  4JI0 M;  4L16 A;  4L15 A;  3VDP A;  4NOO B;  5KPZ A;  2KW0 A;  1Q39 A;  1XHB A;  2NQ8 C;  1L2C A;  3VDU A;  3Q8X A;  3GLG B;  1XC8 A;  1JR3 D;  2C9O A;  3I51 A;  3T1Y M;  4LJ6 A;  3FYC A;  2V1U A;  5E6J A;  3FTF A;  3SYL A;  1TH4 A;  1J09 A;  2L7H A;  4I5S A;  3DA1 A;  4IBC A;  4GKJ M;  3D8L A;  2CHG A;  4LF5 M;  2I7N A;  3U5Z B;  1S3S A;  3CF6 E;  3SHF A;  1L2D A;  3SAR A;  2C5R A;  1NHW C;  1SXJ D;  1QAM A;  2DWM A;  2ERC A;  4IBE A;  4DR5 M;  1OFH A;  1OFI A;  2D7H A;  2LWX A;  5FSW A;  1ORY B;  1QZM A;  4MB7 A;  2EUC A;  2VQE M;  2R65 A;  5LMU M;  4YY3 M;  1QAO A;  4AKH A;  3PNY A;  3KDS E;  3MK6 A;  1HNW M;  2HKJ A;  1GL6 A;  2JA2 A;  1W5T A;  3U6M A;  4QNR A;  1YSY A;  3GPP A;  3KS4 A;  5EP2 A;  1IM2 A;  3GPU A;  3SC3 A;  3U6L A;  4B3M M;  3GP1 A;  1XWI A;  3HJ8 A;  4IBG A;  3HJQ A;  4BB9 A;  1N33 M;  4ZPX A;  2QZ4 A;  3KOW E;  1MU5 A;  1HT1 E;  3T38 A;  3E9S A;  4GC5 A;  1HNZ M;  3TWK A;  4BLC A;  4B7F A;  1XNQ M;  4NRW A;  3QAU A;  4GKK M;  5FTL A;  3L26 A;  2XFS A;  3J80 S;  3RGP A;  4DV0 M;  4JI1 M;  4LF7 M;  2YQZ A;  4LJA A;  4DV3 M;  3CTW B;  4PD2 A;  4JI4 M;  2G5G X;  4NXM M;  4DR4 M;  4FWH A;  2L6O A;  3M7G A;  2CEA A;  1I4W A;  4GRI A;  1QAQ A;  2BJW A;  4NL4 H;  4B7G A;  3C58 A;  2Y21 A;  4M9S A;  5EP4 A;  4GH9 A;  2OPF A;  3J27 B;  4AQY M;  1QQW A;  2Y20 A;  3WHK A;  5EXX A;  1QAN A;  5EP3 A;  4MGK E;  1SXJ C;  2CUZ A;  2RGH A;  3SMS A;  3IG5 A;  3SHG B;  4GHL A;  3GQ5 A;  2D7E A;  1G41 A;  1IQP A;  1DGF A;  2R45 A;  1XXH A;  3GQ4 A;  1TDZ A;  3ILK A;  1N34 M;  1IBL M;  2F5N A;  5H37 D;  3FTC A;  4KHP M;  3W0F A;  4LFC M;  2KXE A;  1PM5 A;  4D82 A;  4OVZ A;  1N32 M;  3A45 A;  1J7K A;  3PVS A;  3TPZ A;  4KLN A;  2Z4R A;  1XMO M;  3NWL A;  1L1T A;  5EP1 A;  1HR0 M;  4NSR A;  3HHY A;  1ZQ9 A;  4L4U A;  4G4N A;  3AJI B;  4CHT B;  4DV6 M;  5ITQ A;  3VLF B;  4HL4 A;  2C99 A;  1E9S A;  3KOZ E;  3UJN A;  2R62 A;  2CV1 A;  4IBI A;  3LVW A;  4CIS A;  4Z6Y A;  3MHV C;  4JYA M;  5IWA M;  2QCU A;  4X66 M;  2Z3X A;  3DOA A;  3SFZ A;  4AKG A;  3U61 A;  4AI6 A;  1IBK M;  2UUC M;  1Z5A A;  3FUX A;  3K2L A;  3UZU A;  4AKI A;  3FTD A;  3TE6 A;  3U6P A;  2RKO A;  1DO0 A;  3KSX A;  1DGH B;  3K8Z A;  1G8P A;  3PFI A;  4LF8 M;  1IN8 A;  4IBF A;  4FVM A;  5FLX S;  1LV7 A;  4I4L A;  3GQ3 A;  2XSZ A;  3QWL A;  2L09 A;  5KPR A;  1I94 M;  1X37 A;  4NSO B;  5EXP A;  4OU7 A;  3U6O A;  2XZU A;  4DV2 M;  1IXR C;  5JI3 E;  3D8B A;  1DO2 A;  1YE9 A;  8CAT A;  4CGY B;  2OQ4 A;  3AKZ A;  2I7P A;  2LH0 A;  3DZD A;  4G4R A;  4OW0 A;  2O5R A;  4P16 A;  3EIE A;  3E4R A;  3J81 S;  4XGI A;  4DR6 M;  4LJ7 A;  4WW0 A;  1TGU A;  1T3T A;  4FCW A;  4M9X A;  2QBY B;  1G4A E;  1NJF A;  4AZF A;  4PT5 A;  4QOS A;  2E5L M;  3R8F A;  4B3T M;  5ITX E;  1R2Y A;  1E94 E;  2KA6 B;  2ZAM A;  4X62 M;  2K47 A;  3FTE A;  2EA0 A;  4M0D A;  3LQR A;  4REZ A;  4IJF A;  5EXT A;  2ZAO A;  2VQF M;  5DNY A;  3GPY A;  4D80 A;  4IJE A;  3H4M A;  2DVW B;  4B08 A;  3CF0 A;  3HU3 A;  2X49 A;  4JI2 M;  5JI2 E;  3M0E A;  3ZCB B;  2DWL A;  2C98 A;  2V1C A;  3GO8 A;  4QOZ C;  2XSZ D;  3IG8 A;  4S12 A;  3HGI A;  1L8Q A;  3AOE A;  1IY0 A;  1NHG C;  1NVM A;  4I81 A;  4LZJ A;  1KSF X;  2M5Z A;  3ZC7 B;  3VK7 A;  4XBO A;  4LG2 A;  1ZAE A;  2KZS A;  3KP0 E;  4RF1 A;  4B3R M;  4JI8 M;  4RNA A;  3L27 A;  4LZZ A;  3J7B A;  4MGY E;  4X64 M;  2G8L A;  4NRV A;  4MGI E;  2F5Q A;  3GRV A;  4JI7 M;  2UUA M;  4LJ9 A;  4GHA A;  3AV0 A;  5FTN A;  2ZM6 M;  1G59 A;  2UXD M;  3SAW A;  2Y0Q A;  3SAT A;  2CE7 A;  3VFD A;  4DR2 M;  5KO3 A;  1IN6 A;  4MH0 E;  3TWM A;  5DYG A;  3WHL A;  2UXB M;  1N75 A;  2CHV A;  3KOX E;  3AFH A;  3HWS A;  2DXI A;  4LY6 A;  5EQT A;  1Z5B A;  4FCT A;  4D81 A;  3SAS A;  3L29 A;  2KRU A;  3EIH A;  3W0L B;  2J7N A;  3LVV A;  5EXS A;  4JN6 A;  4DR1 M;  5IZ7 D;  1SXJ E;  2FNA A;  2XZF A;  3SYK A;  3UMM A;  1MX0 A;  1DGH A;  1GL7 A;  4Z8X A;  2XLJ A;  3U6Q A;  3U60 A;  1TH3 A;  5KQ8 A;  3GRY A;  5KQD A;  1R2Z A;  1K3X A;  4BBA A;  3VK8 A;  3PNV A;  3RFW A;  4FCV A;  5EJC A;  4DUY M;  5BR8 M;  4KOD A;  4WUR A;  4EIW A;  3GLF A;  2DWN A;  1XNR M;  2RGO A;  4LJ8 A;  2YR0 A;  3DFZ A;  1Q3B A;  1SXJ A;  4ITQ A;  3J2P B;  4R7G A;  2P5T A;  3B9P A;  4MGZ E;  4PDG A;  4L78 A;  1IN7 A;  3U60 B;  2R18 A;  4B3S M;  4HLQ A;  3TQS A;  2R4J A;  2QPA A;  2LXE A;  2VII A;  3A42 A;  1H6U A;  1NSF A;  2DHR A;  4L8R C;  4AG6 A;  2X8A A;  4LGY A;  3KFU G;  2QBY A;  3UGJ A;  3GLF B;  1NNJ A;  4MM3 B;  5ITR A;  4LF4 M;  3SAU A;  3AL0 C;  4JV5 M;  3GLH A;  1PJJ A;  1SXJ B;  2YFQ A;  4LRT A;  4M0W A;  5C1B A;  1R6B X;  4G6Z A;  2H1R A;  4FW9 A;  4OX9 M;  1WXQ A;  1DGG A;  2M60 A;  4KO8 A;  1NY5 A;  3JR5 A;  3U6C A;  2XH9 A;  4G4O A;  3HHX A;  1E9R A;  2Z7J A;  4LCB A;  2KEB A;  2KRK A;  2XGN A;  1UM8 A;  5ITY A;  3FUV A;  1N36 M;  4IBJ A;  4LGM A;  1IN5 A;  1L2B A;  3CF2 A;  4IBK A;  1HT2 E;  2C96 A;  5FTM A;  5BPV A;  2FE8 A;  3JAM S;  2HL7 A;  5IRE B;  2F5O A;  3FKE A;  3KSJ A;  1EE8 A;  5ITT A;  1Z5C A;  3GLH B;  1D2N A;  1NJG A;  3AOE C;  5FTK A;  3LMM A;  1FNN A;  2DZO B;  3M6A A;  1GLN A;  3I4V A;  3FUU A;  1JQJ C;  2R46 A;  1Z59 A;  4LF9 M;  2QEN A;  2FOI C;  2XF3 A;  3BOS A;  3GRR A;  5KPT A;  4GC9 A;  4FWG A;  3KS8 A;  4GMQ A;  4G4Q A;  3L25 A;  3LQQ A;  3RGS A;  1G3I A;  3SBJ A;  1Q3C A;  3HU2 A;  1N78 A;  3A46 A;  4LFA M;  2Y0T A;  3HKP A;  4DV1 M;  2UU9 M;  1NY6 A;  4QHS A;  3FUT A;  4DR7 M;  2FFJ A;  4MGH A;  2C9C A;  3J7A S;  2HHH M;  5ITX A;  2Z4S A;  5FTJ A;  3VKG A;  4DR3 M;  3KOY E;  1E32 A;  3GLI A;  1PJI A;  1IXZ A;  5F3W A;  1IBM M;  3FUW A;  3KW6 A;  1IN4 A;  2DWZ B;  2BNK A;  2F4V M;  2D7G A;  1C1K A;  2L7I A;  3GPX A;  4JI5 M;  4TUW A;  3PXG A;  2ZAN A;  1HNX M;  4GIP A;  2CHQ A;  2KZU A;  1N77 A;  5E26 A;  2F5P A;  5GKN A;  1IY1 A;  2XFT A;  4K0K M;  1Z6T A;  1GVN A;  3FD9 A;  3GLI B;  3U6S A;  3T1H M;  4PCZ A;  3L28 A;  3I4Y A;  1W5S A;  4IBD A;  4AW4 A;  4DV7 M;  2X4A A;  1TH2 A;  4A3V B;  3OTO M;  3HHW A;  3L2A A;  4LJ4 A;  4LJ5 A;  4IBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...