4LFAM

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lfaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lfaM02
3U6MA 1PJIA 4LF7M 3U6QA 1IBLM 1HNZM 3U6PA 1PJJA 2ZBKB 4JI8M 5BR8M 4LF8M 2HKJA 2UUBM 1K82A 4LFAM 5ITXE 3GQ5A 3TWLA 3U6CA 2UU9M 4JI1M 3GPPA 3U6OA 4DUYM 2F5SA 5ITUA 4DR1M 3DOAA 3TWKA 1HR0M 4JI4M 1N32M 2EA0A 3U6LA 2OQ4A 2F4VM 4B3RM 4JI0M 1EE8A 4YY3M 1KFVA 4PDIA 2XZUA 1Q39A 1L2DA 3U6SA 1XNRM 4K0KM 4DV7M 4DR3M 2E5LM 3SAWA 4DR2M 5LMUM 4DR6M 2UXBM 1HNWM 4MB7A 4B3SM 4GKKM 1K3WA 1Z5BA 1NNJA 1TDZA 1N36M 3GPUA 4LF4M 2UUCM 1Q3CA 4JI5M 3T1YM 2OPFA 4LF9M 3J80S 1L2CA 4B3TM 5ITXA 1TDHA 1HNXM 3OTOM 3A45A 4LFCM 2F5PA 2F5NA 3SBJA 3GP1A 3W0FA 1Z59A 5IT9S 4X64M 1PM5A 4NXMM 4LFBM 3GQ4A 5ITQA 3GO8A 4DR4M 4X62M 4KHPM 1N33M 3A46A 2XZFA 3GPYA 1K3XA 4AQYM 1Z5CA 4LF5M 1R2ZA 4ITQA 3SASA 4OX9M 1FJGM 3A42A 4YHHM 1L1ZA 1L1TA 4DV0M 2VQEM 3GQ3A 4DV3M 5ITTA 3C58A 4JI3M 4DV1M 5A2QS 3U6DA 4JI2M 4DV6M 4JI7M 1Q3BA 4DR5M 3JAMS 3J81S 1XMOM 1L2BA 4DV2M 4DV5M 1IBKM 4NXNM 1N34M 2HHHM 4NRVA 2UXDM 4G4RA 2F5OA 1XC8A 5IWAM 4JV5M 5ITRA 1MU5A 3JR5A 3VK7A 4JYAM 4X65M 4DV4M 1Z5AA 1J5EM 2F5QA 2UXCM 3J7AS 1R2YA 4X66M 4B3MM 4PDGA 4CISA 4PD2A 3JR4A 3T1HM 1XNQM 3VK8A 4G4QA 2VQFM 4G4OA 2Q2EB 4G4NA 3SATA 1I94M 3SARA 3SAVA 4JI6M 4GKJM 4DR7M 1MX0A 3SAUA 3GPXA 1IBMM 4LF6M 1XMQM 5ITYA 2ZM6M 3TWMA 3U6EA 5FLXS 4NRWA 4PCZA 2UUAM 5LMNM 4DUZM
chains in the Genus database with same CATH superfamily
2O5RA 3RGPA 2DNAA 1NV8A 3UJNA 2KZUA 3R8FA 2EO2A 4KODA 4IBGA 1GABA 1S3SA 1OTRA 2QSFX 1AIPC 3J27B 2CE7A 3B74A 2JP7A 2P5TA 2HKJA 4LF8M 7CATA 3QWLA 4KO8A 1VQ1A 2ZAOA 4KT0F 5EQTA 4DUYM 3FTCA 2L7IA 2KNZA 3TWKA 3M6AA 4MGZE 2C5RA 1N32M 2RGHA 2G5GX 2EA0A 2Z3XA 2OOBA 1NJFA 2JXNA 2YFQA 1E9RA 4JN6A 3HJ8A 2XZUA 2LWXA 2YNMD 3K92A 4F2LA 1YLAA 1G59A 2CV2A 2HCBA 3FUTA 2R0IA 4I81A 1XNRM 2MJ5B 4DR3M 1SXJE 5DNYA 2D7GA 3LQRA 2CEAA 1UFZA 4DR6M 3AOGA 1AUAA 1L8QA 2UXBM 4MB7A 1HT1E 2JNHA 1JR3A 4IBKA 2G8LA 3ILKA 4L15A 4IBBA 1K3WA 1XWIA 1NNJA 4LF4M 1YUBA 1Z6TA 4GEWA 2DKLA 5E6JA 3T1YM 2OPFA 2EKFA 3GRUA 3J80S 5GKNA 3HU3A 5EXTA 3BBZA 5ITXA 2DVWB 4G3OA 1HNXM 4LFCM 2F5PA 1VEGA 5F3WA 3SBJA 2XGNA 3B7NA 2DWMA 1G8PA 2XH9A 1NY5A 3UK6A 2DAMA 4DR4M 1QUTA 3LW5F 4QNMA 1DV0A 2K6BA 1N33M 1BVSA 4HLQA 3KW6A 3GPYA 1FJGM 3M0EA 1WXQA 4RF0A 4ITQA 3SASA 1N75A 4YHHM 2LXEA 1L1ZA 1L1TA 2R4JA 5C1BA 2L4EA 3KP1E 2VQEM 4KLNA 3LVWA 4WP2A 3TL4X 3L28A 3PFIA 3U61B 4AKHA 1YSYA 4NL4H 1IN7A 3GLHA 4JI2M 4JI7M 4DV6M 1IBKM 1XXHB 2CUZA 4XK8F 1N77A 4OU7A 1VDDA 4IBCA 4RF1A 2CHGA 3FYDA 4IJFA 2J7NA 1E9SA 3FTEA 2FS1A 2F5OA 2R18A 4JV5M 4EIWA 5ITRA 3IHPA 3MK6A 2FOIC 2W82A 2RRUA 1I4WA 3KSXA 1IFYA 2QNJA 3TPZA 2F5QA 2LVOC 2UXCM 2KZSA 1R2YA 2EUCA 2R44A 3FTDA 5FTNA 1JB0F 1PRBA 4PDGA 2I7NA 2KA6B 2D7EA 1NHWC 3JR4A 3KS8A 3KSJA 2L7HA 3T1HM 2FE8A 5EXPA 5IZ7D 3KS4A 3L26A 3A98B 4G4QA 1SXJB 2DAKA 2VQFM 3LQQA 4G4OA 3NBXX 3U5ZA 5EXSA 1I94M 3FTFA 3THGA 3GLGA 3SAUA 1XMQM 3HKPA 3TWMA 1NJGA 2X4AA 4LJ9A 2YQZA 1H6UA 1ZMVA 5KPRA 2QQ8A 3KOYE 3WHKA 1DO0A 1DGFA 1XXHE 3EIEA 1QZEA 2Z4RA 1WGLA 1NHGC 2NQ8C 1IQPA 3MJ5A 5JI2E 3FYCA 1HT2E 5BR8M 3CF6E 1JR3E 2Z7JA 1TH4A 1SXJD 1TR8A 1MN3A 1SXJC 5ITXE 3GQ5A 2L6OA 4JI1M 2CV1A 1GVNA 2KRUA 3T15A 3U6OA 3B7QA 2L09A 1DGGA 2R4EA 3KOZE 3WHLA 1OAOC 2F5SA 2AHMA 5ITUA 4PT5A 1DO2A 4LRSA 3CF0A 3FUUA 2HAKA 3GLHE 4II7A 4JI4M 1G4AE 5FTMA 4CIZA 3B9PA 4WURA 3HHZA 3VKHA 3D8BA 1YE9A 2J7OA 3ZH9B 2K9DA 4B3RM 4YY3M 2ZTDA 1D2NA 4M9SA 1OKSA 3DZDA 4M0DA 4QNRA 2CP8A 3U61A 3C3EA 5FTJA 3I4VA 3HHXA 4IBJA 1KSFX 2BWBA 3C9PA 4M0WA 4CJ6A 2E5LM 4M9ZA 3SAWA 1EIJA 2Y0TA 2B3TA 1DGBA 1P3QQ 2KHHA 3LVVA 2JY6B 4HEOA 4D81A 4QOZC 1F4IA 1VEKA 5KQDA 2KXEA 5FSWA 3L2AA 4GKKM 3U60B 4A3VB 1MJGM 2C9OA 3GPUA 2BJWA 4FCVA 4FWGA 4HL4A 4NSOB 1IY2A 3K1JA 4LJ8A 3MHVC 1L2CA 3L29A 4AKGA 3OTOM 2XFTA 2F5NA 3E4RA 3GP1A 1PJSA 3AOEA 1TGUA 3ZCBB 1PM5A 3PVSA 2ZANA 3U5ZB 1QYRA 3SHFA 3GO8A 2C99A 4OW0A 1ZV1A 2XSZD 3GLGB 2LVNC 4AQYM 1K3XA 4S12A 1R2ZA 3A42A 4NSRA 1D0MA 4LGMA 2MGWA 1XHBA 5EP4A 3M7GA 1FNNA 3T6PA 4BLCA 4BB9A 1CUKA 1PJTA 3GQ3A 4GHAA 4L16A 3GLIB 3KP0E 1G41A 4RNAA 3GLFA 3HGIA 5DYIA 3BOSA 1VEJA 2JY5A 1E32A 2KDLA 3NBIA 4MGIE 2DAEA 4JI3M 1GL7A 3U6DA 1GO5A 1Q3BA 2FH0A 3E46A 2R6FA 3RGSA 3J81S 3LMMA 4DV5M 3C3DA 2ZTCA 4NXNM 1OIPA 1N34M 4NRVA 1TTEA 4IJEA 3Q8XA 1XC8A 4IBFA 1MU5A 2I7PA 1QVRA 4I8OA 4P16A 1QAQA 2GQFA 5DFLA 1J5EM 1EFUB 3KOXE 1WJ7A 4FCWA 2GNOA 3AKZA 1QUSA 2V1CA 2KRKA 3I01M 1IXRC 2LVQD 2V6ZM 2XFSA 3L27A 4GIPA 1G71A 3AL0C 5FTKA 2WSEF 3NWLA 2Q2EB 4G4NA 3AV0A 5E26A 1GJSA 4QHSA 3SAVA 3ZC7B 2R45A 4GC5A 3CGWA 3SMPA 4LCBA 1MX0A 4DR7M 1T6OA 2JY8A 4LF6M 3KVWA 2ZM6M 2WZJA 4LGYA 3FE3A 2KW0A 2VIIA 3GLFE 4R71A 5FLXS 1NNUC 2K0BX 1IN8A 4GRIA 4XBOA 4Y28F 3T38A 3FKEA 4LJAA 1WHCA 4AZFA 2JY7A 2XEPA 3U6MA 4ZPXA 1VDLA 2DWNA 1OAIA 3U6QA 3E21A 4FW9A 2CV0A 2QP9X 2JZ1A 2DZNB 1IN5A 2QHOB 2WSFF 4GH9A 4LFAM 2A5YB 1R5LA 1WGNA 1X37A 5EP2A 3TWLA 2JZ0A 4GHLA 4LJ7A 1IXZA 2FFJA 4AKIA 4FWDA 2DENA 3F92A 3AJIB 2CHQA 1WIVA 1HR0M 1IN4A 3ZQJA 1IY0A 3U6LA 2OQ4A 2V1UA 3CF2A 4QHTA 4WW0A 3H4JA 2F4VM 3GLIA 1KFVA 3SC3A 1OQYA 2CRUA 3GLFB 2OOAA 5KPTA 4I5SA 3FD9A 4XGIA 5IREB 1Q39A 1L2DA 4K0KM 3HU2A 5EJCA 4DV7M 2R46A 3B89A 4DR2M 5LMUM 1A5TA 3QYEA 1LV7A 2O01F 3E9SA 2J5YA 2D7HA 2RGOA 3FRIA 4LJ5A 3VFDA 4D80A 3HJSA 3FUWA 2LHGA 3HY5A 4Q7JA 3CTWB 2JWSA 3K2LA 4REZA 2Y21A 1NY6A 2JA2A 4LZZA 1N36M 2UUCM 1Q3CA 4JI5M 2DI0A 2C9CA 3EIHA 5EP1A 2DWLA 4LF9M 3K9PA 4Z6YA 1QDTA 1TDHA 1TF0B 2QBYB 1PGYA 4NC6A 2KNVA 1KYIA 4NXMM 1IY1A 1C7YA 4LFBM 3GLHB 2DXIA 1XXHA 2BWEA 2G3QA 4X62M 4UN2B 3RE8A 2XZFA 2LHCA 4OVZB 2LBCA 3K8ZA 4OX9M 3QAUA 3GRRA 4L4UA 4B7GA 1T3TA 1R6BX 2BJVA 2LTUA 1QAMA 2LH0A 3VKGA 1IXSB 1ORYB 2Y20A 4DV3M 1IN6A 4M9XA 2H5XA 3C58A 2M60A 2O25A 1QZMA 2XF3A 4FD2A 2X8AA 3BXWA 4DR5M 1HQYE 4FCTA 2OO9A 2Z8YM 2DAIA 2VF8A 3D8LA 1JQJC 4I4LA 5KO3A 1ZQ9A 2UXDM 1R7RA 4LRTA 4RKUF 2QZ4A 4G4RA 3DFZA 1DGHA 4GC9A 3Q8GA 2QCUA 4R3DA 5IWAM 1QQWA 3W67A 3R9XB 3SHGB 1W5SA 2X49A 1D0LA 1VG5A 3LCUA 1Z5AA 4MM3B 3IG5A 4X65M 4DV4M 3J7AS 4X66M 4LF7M 2DHYA 2HL7A 5DYGA 4PD2A 4CGYB 8CATA 4IBEA 3FRHA 2H1RA 3QYBA 3UZUA 1D0KA 2N35A 3MMPA 2XLJA 3VK8A 2VDBB 3B7ZA 2CFOA 2DAGA 3SATA 4R7GA 1HJPA 2DHRA 2DZLA 4F1IA 3SARA 4LG2A 3KFUG 4JI6M 3J2PB 1J7KA 3AOEC 1J09A 1G3IA 1V34A 2K47A 1PJQA 3TE6A 3U6EA 1OFHA 2Z4SA 1OJLA 4DBGB 4NRWA 2UUAM 3L25A 5LMNM 3IG8A 4BBAA 1PJIA 1SXJA 1NV9A 1SG9A 2DZOB 1HNZM 3U6PA 1PJJA 2MROB 2QBYA 2ZBKB 4JI8M 1Q02A 3HHWA 3RFWA 1T43A 1ZMUA 2UUBM 1K82A 3U6CA 2M5ZA 4B7FA 2UU9M 4IBIA 3K9OA 2LVAA 3GPPA 2MR9A 2JUJA 2KNAA 4OVZA 4B7HA 4DR1M 3DOAA 3DA1A 3VDUA 3VLFB 2QPAA 3HHYA 4B08A 2MH8A 3UGJA 3IECA 1IXSA 1TH3A 4JI0M 1EE8A 4QOSA 3GRYA 4PDIA 4D82A 3W0LB 4L6V6 3GLGE 5FTLA 3U6SA 4LY6A 1ZMWA 3I04M 1HQCA 2ERCA 4MGKE 1WR1B 4G6ZA 2L2DA 2KEBA 4MGHA 2BNKA 1HNWM 3SYLA 1DGHB 2XSZA 3HU1A 4ANRA 4B3SM 4FWHA 1C1KA 2R62A 4AG5A 1Z5BA 5L8RF 1TDZA 2Y0QA 4AG6A 2LNHC 2VF7A 3HX3A 4GMQA 4B3TM 3UMMA 5EXXA 5BPVA 3J7BA 3W68A 1XB2B 1NO1A 3A45A 1R4GA 3KOWE 3W0FA 1Z59A 5IT9S 4X64M 3V76A 2RKOA 1UM8A 2R65A 5ITQA 3GQ4A 4L8RC 2LVPC 5H37D 4LZJA 4KHPM 1V92A 4MGYE 3A46A 3U60A 4TUWA 4LF5M 1NSFA 1Z5CA 4CHTB 3GLIE 2C98A 3PNYA 4IIWA 4AI6A 2FNAA 1GL6A 2EKKA 4DV0M 1V33A 4P17A 1QANA 5C18A 1IM2A 5ITTA 1ZAEA 3LCVB 2ZAMA 1OFIA 5KQ8A 3I4YA 4L78A 3H4MA 3VDPA 4DV1M 5A2QS 2C96A 1N78A 4GITA 1XMOM 3JAMS 1Y8GA 1L2BA 4DV2M 1GKIA 5KPZA 1IBLM 4IBDA 2WSCF 2HHHM 3GRVA 1JR3D 2CHVA 3KDSE 4Z8XA 1E94E 2EJSA 1LTMA 3JR5A 3PNVA 3FUXA 3SMSA 3VK7A 4JYAM 1QAOA 1QDRA 5EP3A 2HWJA 2DWZB 4B3MM 3HZJA 4AW4A 4CISA 3HJQA 3I51A 3KXEC 1XNQM 2APLA 1RU3A 1TH2A 5JI3E 4MH0E 4NOOB 4LJ4A 2YR0A 4W5WA 4GKJM 3PXGA 4LJ6A 3GPXA 1OIZA 1IBMM 1GLNA 3AFHA 3HWSA 5ITYA 2QENA 3SYKA 4FVMA 2L4FA 1NVMA 1W5TA 2CWBA 3FUVA 3TQSA 4PCZA 1GJTA 3SFZA 4JXJA 4DUZM
chains in the Genus database with same CATH topology
2O5RA 3RGPA 3UJNA 2KZUA 3R8FA 2EO2A 4KODA 4IBGA 1S3SA 3J27B 2CE7A 2P5TA 4LF8M 2HKJA 7CATA 3QWLA 4KO8A 2ZAOA 5EQTA 4DUYM 3FTCA 2L7IA 3TWKA 3M6AA 4MGZE 2C5RA 1N32M 2RGHA 2G5GX 2EA0A 2Z3XA 1NJFA 2YFQA 1E9RA 4JN6A 3HJ8A 2XZUA 2LWXA 2YNMD 3K92A 1G59A 2CV2A 2HCBA 3FUTA 1XNRM 4I81A 4DR3M 1SXJE 5DNYA 2D7GA 3LQRA 2CEAA 4DR6M 2UXBM 3AOGA 1L8QA 4MB7A 1HT1E 1JR3A 4IBKA 2G8LA 3ILKA 4L15A 4IBBA 1K3WA 1XWIA 1NNJA 4LF4M 1YUBA 1Z6TA 5E6JA 3T1YM 2OPFA 3GRUA 3J80S 5GKNA 5EXTA 5ITXA 2DVWB 1HNXM 4LFCM 2F5PA 5F3WA 3SBJA 2XGNA 2DWMA 1G8PA 2XH9A 1NY5A 3UK6A 4DR4M 4QNMA 1N33M 4HLQA 3KW6A 3GPYA 1FJGM 3M0EA 1WXQA 4RF0A 4ITQA 3SASA 1N75A 4YHHM 2LXEA 1L1ZA 1L1TA 2R4JA 5C1BA 3KP1E 2VQEM 4KLNA 3LVWA 3TL4X 3L28A 3PFIA 3U61B 4AKHA 1YSYA 4NL4H 1IN7A 3GLHA 4JI2M 4JI7M 4DV6M 1IBKM 1XXHB 2CUZA 1N77A 4OU7A 1VDDA 4IBCA 4RF1A 2CHGA 3FYDA 4IJFA 2J7NA 1E9SA 3FTEA 2F5OA 2R18A 4JV5M 4EIWA 5ITRA 3MK6A 2FOIC 2W82A 1I4WA 3KSXA 3TPZA 2F5QA 2UXCM 2KZSA 1R2YA 2EUCA 3FTDA 5FTNA 4PDGA 2I7NA 2KA6B 2D7EA 1NHWC 3JR4A 3KS8A 3KSJA 2L7HA 3T1HM 2FE8A 5EXPA 5IZ7D 3KS4A 3L26A 3A98B 4G4QA 1SXJB 2VQFM 4G4OA 3LQQA 3U5ZA 5EXSA 1I94M 3FTFA 3THGA 3GLGA 3SAUA 1XMQM 3HKPA 3TWMA 2X4AA 1NJGA 4LJ9A 2YQZA 1H6UA 5KPRA 3KOYE 3WHKA 1DO0A 1DGFA 3EIEA 3HU3A 3MJ5A 2Z4RA 5BPVA 1NHGC 2NQ8C 1IQPA 5JI2E 3FYCA 1HT2E 5BR8M 3CF6E 2Z7JA 1TH4A 1SXJD 1SXJC 5ITXE 3GQ5A 2L6OA 4JI1M 2CV1A 1GVNA 2KRUA 3T15A 3U6OA 2L09A 1DGGA 2R4EA 3KOZE 3WHLA 2F5SA 2AHMA 5ITUA 4PT5A 1DO2A 4LRSA 3CF0A 3FUUA 4II7A 4JI4M 1G4AE 5FTMA 3B9PA 4WURA 3HHZA 3VKHA 3D8BA 1YE9A 2J7OA 3ZH9B 4B3RM 4YY3M 1D2NA 4M9SA 4QNRA 3DZDA 4M0DA 3U61A 5FTJA 3I4VA 3HHXA 4IBJA 1KSFX 4M0WA 2E5LM 4M9ZA 3SAWA 2Y0TA 3LVVA 1DGBA 4D81A 4QOZC 5KQDA 2KXEA 5FSWA 3L2AA 4GKKM 3U60B 4A3VB 2C9OA 3GPUA 2BJWA 4FCVA 4FWGA 4HL4A 4NSOB 1IY2A 3K1JA 4LJ8A 3MHVC 1L2CA 3L29A 4AKGA 3OTOM 2XFTA 2F5NA 3E4RA 3GP1A 3AOEA 1TGUA 3ZCBB 1PM5A 3PVSA 2ZANA 3U5ZB 1QYRA 3SHFA 3GO8A 2C99A 4OW0A 2XSZD 3GLGB 1K3XA 4AQYM 4S12A 1R2ZA 3A42A 4NSRA 4LGMA 5EP4A 4BB9A 1XHBA 3M7GA 1FNNA 4BLCA 3GQ3A 4GHAA 4L16A 3GLIB 3KP0E 1G41A 4RNAA 3GLFA 3HGIA 5DYIA 3BOSA 4JI3M 1E32A 4MGIE 3NBIA 3U6DA 1GL7A 1Q3BA 3RGSA 3J81S 3LMMA 4DV5M 4NXNM 1N34M 4NRVA 4IJEA 3Q8XA 1XC8A 4IBFA 1MU5A 2I7PA 1QVRA 4I8OA 4P16A 1QAQA 1J5EM 4FCWA 3KOXE 3AKZA 2V1CA 2KRKA 1IXRC 2V6ZM 2XFSA 3L27A 4GIPA 3AL0C 5FTKA 3NWLA 4G4NA 2Q2EB 3AV0A 5E26A 4QHSA 3SAVA 3ZC7B 2R45A 4GC5A 3SMPA 4LCBA 1MX0A 4DR7M 4LF6M 3KVWA 2ZM6M 4LGYA 2KW0A 2VIIA 5FLXS 1NNUC 1IN8A 4GRIA 4XBOA 3T38A 3FKEA 4LJAA 4AZFA 2XEPA 3U6MA 4ZPXA 2DWNA 4LF7M 3U6QA 2CV0A 4FW9A 2QP9X 2DZNB 1IN5A 4GH9A 4LFAM 2A5YB 5EP2A 1X37A 3TWLA 4GHLA 4LJ7A 1IXZA 2FFJA 4AKIA 4FWDA 3AJIB 2CHQA 1HR0M 1IN4A 1IY0A 3U6LA 2OQ4A 2V1UA 3CF2A 4QHTA 4WW0A 2F4VM 3GLIA 1KFVA 3SC3A 3GLFB 5KPTA 4I5SA 3FD9A 4XGIA 5IREB 1Q39A 1L2DA 4K0KM 3HU2A 5EJCA 4DV7M 2R46A 4DR2M 5LMUM 1LV7A 4LJ5A 3E9SA 2D7HA 2RGOA 3VFDA 4D80A 3HJSA 3FUWA 4REZA 3CTWB 3K2LA 1N36M 2Y21A 1NY6A 2JA2A 4LZZA 2UUCM 1Q3CA 4JI5M 5EP1A 2C9CA 3EIHA 2DWLA 4LF9M 4Z6YA 1TDHA 2QBYB 1KYIA 4NXMM 1IY1A 4LFBM 3GLHB 2DXIA 1XXHA 4X62M 3RE8A 2XZFA 4OVZB 3K8ZA 4OX9M 3QAUA 3GRRA 4L4UA 4B7GA 1T3TA 1R6BX 2BJVA 2LH0A 1QAMA 3VKGA 1IXSB 1ORYB 2Y20A 4DV3M 1IN6A 4M9XA 3C58A 2M60A 1QZMA 2XF3A 4FD2A 2X8AA 4DR5M 1HQYE 4FCTA 3D8LA 1JQJC 4I4LA 5KO3A 1ZQ9A 2UXDM 1R7RA 4LRTA 2QZ4A 4G4RA 3DFZA 1DGHA 4GC9A 2QCUA 4R3DA 5IWAM 1QQWA 3R9XB 3SHGB 1W5SA 2X49A 4X65M 4MM3B 1Z5AA 4DV4M 3IG5A 3J7AS 4X66M 2HL7A 5DYGA 4PD2A 4CGYB 8CATA 4IBEA 2H1RA 2XLJA 3UZUA 3VK8A 2CFOA 3SATA 4R7GA 2DHRA 4LG2A 3SARA 3KFUG 4JI6M 3J2PB 1J7KA 3AOEC 1J09A 1G3IA 2K47A 3TE6A 3U6EA 1OFHA 2Z4SA 1OJLA 4NRWA 2UUAM 3L25A 5LMNM 3IG8A 4BBAA 1PJIA 1SXJA 2DZOB 1HNZM 3U6PA 1PJJA 2QBYA 2ZBKB 4JI8M 3HHWA 3RFWA 2UUBM 1K82A 3U6CA 2M5ZA 4B7FA 2UU9M 4IBIA 3GPPA 4OVZA 4B7HA 4DR1M 3DOAA 3DA1A 3VDUA 3VLFB 2QPAA 3HHYA 4B08A 3UGJA 1TH3A 4JI0M 1EE8A 4QOSA 3GRYA 4PDIA 4D82A 3W0LB 5FTLA 3U6SA 4LY6A 1HQCA 2ERCA 4MGKE 4G6ZA 2KEBA 4MGHA 2BNKA 1HNWM 3SYLA 1DGHB 2XSZA 3HU1A 4B3SM 4FWHA 1C1KA 2R62A 4AG5A 1Z5BA 1TDZA 2Y0QA 4AG6A 2LNHC 4GMQA 4B3TM 3UMMA 5EXXA 3J7BA 3A45A 3KOWE 3W0FA 1Z59A 5IT9S 4X64M 2RKOA 1UM8A 2R65A 5ITQA 3GQ4A 4L8RC 5H37D 4LZJA 4KHPM 4MGYE 3A46A 3U60A 4TUWA 4LF5M 1NSFA 1Z5CA 4CHTB 2C98A 3PNYA 4IIWA 4AI6A 2FNAA 1GL6A 4DV0M 1QANA 5C18A 1IM2A 5ITTA 1ZAEA 2ZAMA 1OFIA 5KQ8A 3I4YA 4L78A 3H4MA 3VDPA 4DV1M 5A2QS 2C96A 1N78A 4GITA 1XMOM 3JAMS 1L2BA 4DV2M 1GKIA 5KPZA 1IBLM 4IBDA 2HHHM 3GRVA 1JR3D 2CHVA 3KDSE 4Z8XA 1E94E 3JR5A 3PNVA 3FUXA 3SMSA 3VK7A 4JYAM 1QAOA 5EP3A 2DWZB 4B3MM 4AW4A 4CISA 3HJQA 3I51A 3KXEC 1XNQM 1TH2A 5JI3E 4MH0E 4NOOB 4LJ4A 2YR0A 4W5WA 4GKJM 3PXGA 4LJ6A 3GPXA 1IBMM 1GLNA 3AFHA 3HWSA 5ITYA 2QENA 3SYKA 4FVMA 1NVMA 1W5TA 3FUVA 3TQSA 4PCZA 3SFZA 4JXJA 4DUZM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6M A;  1PJI A;  4LF7 M;  3U6Q A;  1IBL M;  1HNZ M;  3U6P A;  1PJJ A;  2ZBK B;  4JI8 M;  5BR8 M;  4LF8 M;  2HKJ A;  2UUB M;  1K82 A;  4LFA M;  5ITX E;  3GQ5 A;  3TWL A;  3U6C A;  2UU9 M;  4JI1 M;  3GPP A;  3U6O A;  4DUY M;  2F5S A;  5ITU A;  4DR1 M;  3DOA A;  3TWK A;  1HR0 M;  4JI4 M;  1N32 M;  2EA0 A;  3U6L A;  2OQ4 A;  2F4V M;  4B3R M;  4JI0 M;  1EE8 A;  4YY3 M;  1KFV A;  4PDI A;  2XZU A;  1Q39 A;  1L2D A;  3U6S A;  1XNR M;  4K0K M;  4DV7 M;  4DR3 M;  2E5L M;  3SAW A;  4DR2 M;  5LMU M;  4DR6 M;  2UXB M;  1HNW M;  4MB7 A;  4B3S M;  4GKK M;  1K3W A;  1Z5B A;  1NNJ A;  1TDZ A;  1N36 M;  3GPU A;  4LF4 M;  2UUC M;  1Q3C A;  4JI5 M;  3T1Y M;  2OPF A;  4LF9 M;  3J80 S;  1L2C A;  4B3T M;  5ITX A;  1TDH A;  1HNX M;  3OTO M;  3A45 A;  4LFC M;  2F5P A;  2F5N A;  3SBJ A;  3GP1 A;  3W0F A;  1Z59 A;  5IT9 S;  4X64 M;  1PM5 A;  4NXM M;  4LFB M;  3GQ4 A;  5ITQ A;  3GO8 A;  4DR4 M;  4X62 M;  4KHP M;  1N33 M;  3A46 A;  2XZF A;  3GPY A;  1K3X A;  4AQY M;  1Z5C A;  4LF5 M;  1R2Z A;  4ITQ A;  3SAS A;  4OX9 M;  1FJG M;  3A42 A;  4YHH M;  1L1Z A;  1L1T A;  4DV0 M;  2VQE M;  3GQ3 A;  4DV3 M;  5ITT A;  3C58 A;  4JI3 M;  4DV1 M;  5A2Q S;  3U6D A;  4JI2 M;  4DV6 M;  4JI7 M;  1Q3B A;  4DR5 M;  3JAM S;  3J81 S;  1XMO M;  1L2B A;  4DV2 M;  4DV5 M;  1IBK M;  4NXN M;  1N34 M;  2HHH M;  4NRV A;  2UXD M;  4G4R A;  2F5O A;  1XC8 A;  5IWA M;  4JV5 M;  5ITR A;  1MU5 A;  3JR5 A;  3VK7 A;  4JYA M;  4X65 M;  4DV4 M;  1Z5A A;  1J5E M;  2F5Q A;  2UXC M;  3J7A S;  1R2Y A;  4X66 M;  4B3M M;  4PDG A;  4CIS A;  4PD2 A;  3JR4 A;  3T1H M;  1XNQ M;  3VK8 A;  4G4Q A;  2VQF M;  4G4O A;  2Q2E B;  4G4N A;  3SAT A;  1I94 M;  3SAR A;  3SAV A;  4JI6 M;  4GKJ M;  4DR7 M;  1MX0 A;  3SAU A;  3GPX A;  1IBM M;  4LF6 M;  1XMQ M;  5ITY A;  2ZM6 M;  3TWM A;  3U6E A;  5FLX S;  4NRW A;  4PCZ A;  2UUA M;  5LMN M;  4DUZ M; 
#chains in the Genus database with same CATH topology
 2O5R A;  3RGP A;  2DNA A;  1NV8 A;  3UJN A;  2KZU A;  3R8F A;  2EO2 A;  4KOD A;  4IBG A;  1GAB A;  1S3S A;  1OTR A;  2QSF X;  1AIP C;  3J27 B;  2CE7 A;  3B74 A;  2JP7 A;  2P5T A;  2HKJ A;  4LF8 M;  7CAT A;  3QWL A;  4KO8 A;  1VQ1 A;  2ZAO A;  4KT0 F;  5EQT A;  4DUY M;  3FTC A;  2L7I A;  2KNZ A;  3TWK A;  3M6A A;  4MGZ E;  2C5R A;  1N32 M;  2RGH A;  2G5G X;  2EA0 A;  2Z3X A;  2OOB A;  1NJF A;  2JXN A;  2YFQ A;  1E9R A;  4JN6 A;  3HJ8 A;  2XZU A;  2LWX A;  2YNM D;  3K92 A;  4F2L A;  1YLA A;  1G59 A;  2CV2 A;  2HCB A;  3FUT A;  2R0I A;  4I81 A;  1XNR M;  2MJ5 B;  4DR3 M;  1SXJ E;  5DNY A;  2D7G A;  3LQR A;  2CEA A;  1UFZ A;  4DR6 M;  3AOG A;  1AUA A;  1L8Q A;  2UXB M;  4MB7 A;  1HT1 E;  2JNH A;  1JR3 A;  4IBK A;  2G8L A;  3ILK A;  4L15 A;  4IBB A;  1K3W A;  1XWI A;  1NNJ A;  4LF4 M;  1YUB A;  1Z6T A;  4GEW A;  2DKL A;  5E6J A;  3T1Y M;  2OPF A;  2EKF A;  3GRU A;  3J80 S;  5GKN A;  3HU3 A;  5EXT A;  3BBZ A;  5ITX A;  2DVW B;  4G3O A;  1HNX M;  4LFC M;  2F5P A;  1VEG A;  5F3W A;  3SBJ A;  2XGN A;  3B7N A;  2DWM A;  1G8P A;  2XH9 A;  1NY5 A;  3UK6 A;  2DAM A;  4DR4 M;  1QUT A;  3LW5 F;  4QNM A;  1DV0 A;  2K6B A;  1N33 M;  1BVS A;  4HLQ A;  3KW6 A;  3GPY A;  1FJG M;  3M0E A;  1WXQ A;  4RF0 A;  4ITQ A;  3SAS A;  1N75 A;  4YHH M;  2LXE A;  1L1Z A;  1L1T A;  2R4J A;  5C1B A;  2L4E A;  3KP1 E;  2VQE M;  4KLN A;  3LVW A;  4WP2 A;  3TL4 X;  3L28 A;  3PFI A;  3U61 B;  4AKH A;  1YSY A;  4NL4 H;  1IN7 A;  3GLH A;  4JI2 M;  4JI7 M;  4DV6 M;  1IBK M;  1XXH B;  2CUZ A;  4XK8 F;  1N77 A;  4OU7 A;  1VDD A;  4IBC A;  4RF1 A;  2CHG A;  3FYD A;  4IJF A;  2J7N A;  1E9S A;  3FTE A;  2FS1 A;  2F5O A;  2R18 A;  4JV5 M;  4EIW A;  5ITR A;  3IHP A;  3MK6 A;  2FOI C;  2W82 A;  2RRU A;  1I4W A;  3KSX A;  1IFY A;  2QNJ A;  3TPZ A;  2F5Q A;  2LVO C;  2UXC M;  2KZS A;  1R2Y A;  2EUC A;  2R44 A;  3FTD A;  5FTN A;  1JB0 F;  1PRB A;  4PDG A;  2I7N A;  2KA6 B;  2D7E A;  1NHW C;  3JR4 A;  3KS8 A;  3KSJ A;  2L7H A;  3T1H M;  2FE8 A;  5EXP A;  5IZ7 D;  3KS4 A;  3L26 A;  3A98 B;  4G4Q A;  1SXJ B;  2DAK A;  2VQF M;  3LQQ A;  4G4O A;  3NBX X;  3U5Z A;  5EXS A;  1I94 M;  3FTF A;  3THG A;  3GLG A;  3SAU A;  1XMQ M;  3HKP A;  3TWM A;  1NJG A;  2X4A A;  4LJ9 A;  2YQZ A;  1H6U A;  1ZMV A;  5KPR A;  2QQ8 A;  3KOY E;  3WHK A;  1DO0 A;  1DGF A;  1XXH E;  3EIE A;  1QZE A;  2Z4R A;  1WGL A;  1NHG C;  2NQ8 C;  1IQP A;  3MJ5 A;  5JI2 E;  3FYC A;  1HT2 E;  5BR8 M;  3CF6 E;  1JR3 E;  2Z7J A;  1TH4 A;  1SXJ D;  1TR8 A;  1MN3 A;  1SXJ C;  5ITX E;  3GQ5 A;  2L6O A;  4JI1 M;  2CV1 A;  1GVN A;  2KRU A;  3T15 A;  3U6O A;  3B7Q A;  2L09 A;  1DGG A;  2R4E A;  3KOZ E;  3WHL A;  1OAO C;  2F5S A;  2AHM A;  5ITU A;  4PT5 A;  1DO2 A;  4LRS A;  3CF0 A;  3FUU A;  2HAK A;  3GLH E;  4II7 A;  4JI4 M;  1G4A E;  5FTM A;  4CIZ A;  3B9P A;  4WUR A;  3HHZ A;  3VKH A;  3D8B A;  1YE9 A;  2J7O A;  3ZH9 B;  2K9D A;  4B3R M;  4YY3 M;  2ZTD A;  1D2N A;  4M9S A;  1OKS A;  3DZD A;  4M0D A;  4QNR A;  2CP8 A;  3U61 A;  3C3E A;  5FTJ A;  3I4V A;  3HHX A;  4IBJ A;  1KSF X;  2BWB A;  3C9P A;  4M0W A;  4CJ6 A;  2E5L M;  4M9Z A;  3SAW A;  1EIJ A;  2Y0T A;  2B3T A;  1DGB A;  1P3Q Q;  2KHH A;  3LVV A;  2JY6 B;  4HEO A;  4D81 A;  4QOZ C;  1F4I A;  1VEK A;  5KQD A;  2KXE A;  5FSW A;  3L2A A;  4GKK M;  3U60 B;  4A3V B;  1MJG M;  2C9O A;  3GPU A;  2BJW A;  4FCV A;  4FWG A;  4HL4 A;  4NSO B;  1IY2 A;  3K1J A;  4LJ8 A;  3MHV C;  1L2C A;  3L29 A;  4AKG A;  3OTO M;  2XFT A;  2F5N A;  3E4R A;  3GP1 A;  1PJS A;  3AOE A;  1TGU A;  3ZCB B;  1PM5 A;  3PVS A;  2ZAN A;  3U5Z B;  1QYR A;  3SHF A;  3GO8 A;  2C99 A;  4OW0 A;  1ZV1 A;  2XSZ D;  3GLG B;  2LVN C;  4AQY M;  1K3X A;  4S12 A;  1R2Z A;  3A42 A;  4NSR A;  1D0M A;  4LGM A;  2MGW A;  1XHB A;  5EP4 A;  3M7G A;  1FNN A;  3T6P A;  4BLC A;  4BB9 A;  1CUK A;  1PJT A;  3GQ3 A;  4GHA A;  4L16 A;  3GLI B;  3KP0 E;  1G41 A;  4RNA A;  3GLF A;  3HGI A;  5DYI A;  3BOS A;  1VEJ A;  2JY5 A;  1E32 A;  2KDL A;  3NBI A;  4MGI E;  2DAE A;  4JI3 M;  1GL7 A;  3U6D A;  1GO5 A;  1Q3B A;  2FH0 A;  3E46 A;  2R6F A;  3RGS A;  3J81 S;  3LMM A;  4DV5 M;  3C3D A;  2ZTC A;  4NXN M;  1OIP A;  1N34 M;  4NRV A;  1TTE A;  4IJE A;  3Q8X A;  1XC8 A;  4IBF A;  1MU5 A;  2I7P A;  1QVR A;  4I8O A;  4P16 A;  1QAQ A;  2GQF A;  5DFL A;  1J5E M;  1EFU B;  3KOX E;  1WJ7 A;  4FCW A;  2GNO A;  3AKZ A;  1QUS A;  2V1C A;  2KRK A;  3I01 M;  1IXR C;  2LVQ D;  2V6Z M;  2XFS A;  3L27 A;  4GIP A;  1G71 A;  3AL0 C;  5FTK A;  2WSE F;  3NWL A;  2Q2E B;  4G4N A;  3AV0 A;  5E26 A;  1GJS A;  4QHS A;  3SAV A;  3ZC7 B;  2R45 A;  4GC5 A;  3CGW A;  3SMP A;  4LCB A;  1MX0 A;  4DR7 M;  1T6O A;  2JY8 A;  4LF6 M;  3KVW A;  2ZM6 M;  2WZJ A;  4LGY A;  3FE3 A;  2KW0 A;  2VII A;  3GLF E;  4R71 A;  5FLX S;  1NNU C;  2K0B X;  1IN8 A;  4GRI A;  4XBO A;  4Y28 F;  3T38 A;  3FKE A;  4LJA A;  1WHC A;  4AZF A;  2JY7 A;  2XEP A;  3U6M A;  4ZPX A;  1VDL A;  2DWN A;  1OAI A;  3U6Q A;  3E21 A;  4FW9 A;  2CV0 A;  2QP9 X;  2JZ1 A;  2DZN B;  1IN5 A;  2QHO B;  2WSF F;  4GH9 A;  4LFA M;  2A5Y B;  1R5L A;  1WGN A;  1X37 A;  5EP2 A;  3TWL A;  2JZ0 A;  4GHL A;  4LJ7 A;  1IXZ A;  2FFJ A;  4AKI A;  4FWD A;  2DEN A;  3F92 A;  3AJI B;  2CHQ A;  1WIV A;  1HR0 M;  1IN4 A;  3ZQJ A;  1IY0 A;  3U6L A;  2OQ4 A;  2V1U A;  3CF2 A;  4QHT A;  4WW0 A;  3H4J A;  2F4V M;  3GLI A;  1KFV A;  3SC3 A;  1OQY A;  2CRU A;  3GLF B;  2OOA A;  5KPT A;  4I5S A;  3FD9 A;  4XGI A;  5IRE B;  1Q39 A;  1L2D A;  4K0K M;  3HU2 A;  5EJC A;  4DV7 M;  2R46 A;  3B89 A;  4DR2 M;  5LMU M;  1A5T A;  3QYE A;  1LV7 A;  2O01 F;  3E9S A;  2J5Y A;  2D7H A;  2RGO A;  3FRI A;  4LJ5 A;  3VFD A;  4D80 A;  3HJS A;  3FUW A;  2LHG A;  3HY5 A;  4Q7J A;  3CTW B;  2JWS A;  3K2L A;  4REZ A;  2Y21 A;  1NY6 A;  2JA2 A;  4LZZ A;  1N36 M;  2UUC M;  1Q3C A;  4JI5 M;  2DI0 A;  2C9C A;  3EIH A;  5EP1 A;  2DWL A;  4LF9 M;  3K9P A;  4Z6Y A;  1QDT A;  1TDH A;  1TF0 B;  2QBY B;  1PGY A;  4NC6 A;  2KNV A;  1KYI A;  4NXM M;  1IY1 A;  1C7Y A;  4LFB M;  3GLH B;  2DXI A;  1XXH A;  2BWE A;  2G3Q A;  4X62 M;  4UN2 B;  3RE8 A;  2XZF A;  2LHC A;  4OVZ B;  2LBC A;  3K8Z A;  4OX9 M;  3QAU A;  3GRR A;  4L4U A;  4B7G A;  1T3T A;  1R6B X;  2BJV A;  2LTU A;  1QAM A;  2LH0 A;  3VKG A;  1IXS B;  1ORY B;  2Y20 A;  4DV3 M;  1IN6 A;  4M9X A;  2H5X A;  3C58 A;  2M60 A;  2O25 A;  1QZM A;  2XF3 A;  4FD2 A;  2X8A A;  3BXW A;  4DR5 M;  1HQY E;  4FCT A;  2OO9 A;  2Z8Y M;  2DAI A;  2VF8 A;  3D8L A;  1JQJ C;  4I4L A;  5KO3 A;  1ZQ9 A;  2UXD M;  1R7R A;  4LRT A;  4RKU F;  2QZ4 A;  4G4R A;  3DFZ A;  1DGH A;  4GC9 A;  3Q8G A;  2QCU A;  4R3D A;  5IWA M;  1QQW A;  3W67 A;  3R9X B;  3SHG B;  1W5S A;  2X49 A;  1D0L A;  1VG5 A;  3LCU A;  1Z5A A;  4MM3 B;  3IG5 A;  4X65 M;  4DV4 M;  3J7A S;  4X66 M;  4LF7 M;  2DHY A;  2HL7 A;  5DYG A;  4PD2 A;  4CGY B;  8CAT A;  4IBE A;  3FRH A;  2H1R A;  3QYB A;  3UZU A;  1D0K A;  2N35 A;  3MMP A;  2XLJ A;  3VK8 A;  2VDB B;  3B7Z A;  2CFO A;  2DAG A;  3SAT A;  4R7G A;  1HJP A;  2DHR A;  2DZL A;  4F1I A;  3SAR A;  4LG2 A;  3KFU G;  4JI6 M;  3J2P B;  1J7K A;  3AOE C;  1J09 A;  1G3I A;  1V34 A;  2K47 A;  1PJQ A;  3TE6 A;  3U6E A;  1OFH A;  2Z4S A;  1OJL A;  4DBG B;  4NRW A;  2UUA M;  3L25 A;  5LMN M;  3IG8 A;  4BBA A;  1PJI A;  1SXJ A;  1NV9 A;  1SG9 A;  2DZO B;  1HNZ M;  3U6P A;  1PJJ A;  2MRO B;  2QBY A;  2ZBK B;  4JI8 M;  1Q02 A;  3HHW A;  3RFW A;  1T43 A;  1ZMU A;  2UUB M;  1K82 A;  3U6C A;  2M5Z A;  4B7F A;  2UU9 M;  4IBI A;  3K9O A;  2LVA A;  3GPP A;  2MR9 A;  2JUJ A;  2KNA A;  4OVZ A;  4B7H A;  4DR1 M;  3DOA A;  3DA1 A;  3VDU A;  3VLF B;  2QPA A;  3HHY A;  4B08 A;  2MH8 A;  3UGJ A;  3IEC A;  1IXS A;  1TH3 A;  4JI0 M;  1EE8 A;  4QOS A;  3GRY A;  4PDI A;  4D82 A;  3W0L B;  4L6V 6;  3GLG E;  5FTL A;  3U6S A;  4LY6 A;  1ZMW A;  3I04 M;  1HQC A;  2ERC A;  4MGK E;  1WR1 B;  4G6Z A;  2L2D A;  2KEB A;  4MGH A;  2BNK A;  1HNW M;  3SYL A;  1DGH B;  2XSZ A;  3HU1 A;  4ANR A;  4B3S M;  4FWH A;  1C1K A;  2R62 A;  4AG5 A;  1Z5B A;  5L8R F;  1TDZ A;  2Y0Q A;  4AG6 A;  2LNH C;  2VF7 A;  3HX3 A;  4GMQ A;  4B3T M;  3UMM A;  5EXX A;  5BPV A;  3J7B A;  3W68 A;  1XB2 B;  1NO1 A;  3A45 A;  1R4G A;  3KOW E;  3W0F A;  1Z59 A;  5IT9 S;  4X64 M;  3V76 A;  2RKO A;  1UM8 A;  2R65 A;  5ITQ A;  3GQ4 A;  4L8R C;  2LVP C;  5H37 D;  4LZJ A;  4KHP M;  1V92 A;  4MGY E;  3A46 A;  3U60 A;  4TUW A;  4LF5 M;  1NSF A;  1Z5C A;  4CHT B;  3GLI E;  2C98 A;  3PNY A;  4IIW A;  4AI6 A;  2FNA A;  1GL6 A;  2EKK A;  4DV0 M;  1V33 A;  4P17 A;  1QAN A;  5C18 A;  1IM2 A;  5ITT A;  1ZAE A;  3LCV B;  2ZAM A;  1OFI A;  5KQ8 A;  3I4Y A;  4L78 A;  3H4M A;  3VDP A;  4DV1 M;  5A2Q S;  2C96 A;  1N78 A;  4GIT A;  1XMO M;  3JAM S;  1Y8G A;  1L2B A;  4DV2 M;  1GKI A;  5KPZ A;  1IBL M;  4IBD A;  2WSC F;  2HHH M;  3GRV A;  1JR3 D;  2CHV A;  3KDS E;  4Z8X A;  1E94 E;  2EJS A;  1LTM A;  3JR5 A;  3PNV A;  3FUX A;  3SMS A;  3VK7 A;  4JYA M;  1QAO A;  1QDR A;  5EP3 A;  2HWJ A;  2DWZ B;  4B3M M;  3HZJ A;  4AW4 A;  4CIS A;  3HJQ A;  3I51 A;  3KXE C;  1XNQ M;  2APL A;  1RU3 A;  1TH2 A;  5JI3 E;  4MH0 E;  4NOO B;  4LJ4 A;  2YR0 A;  4W5W A;  4GKJ M;  3PXG A;  4LJ6 A;  3GPX A;  1OIZ A;  1IBM M;  1GLN A;  3AFH A;  3HWS A;  5ITY A;  2QEN A;  3SYK A;  4FVM A;  2L4F A;  1NVM A;  1W5T A;  2CWB A;  3FUV A;  3TQS A;  4PCZ A;  1GJT A;  3SFZ A;  4JXJ A;  4DUZ M; 
#chains in the Genus database with same CATH homology
 2O5R A;  3RGP A;  3UJN A;  2KZU A;  3R8F A;  2EO2 A;  4KOD A;  4IBG A;  1S3S A;  3J27 B;  2CE7 A;  2P5T A;  4LF8 M;  2HKJ A;  7CAT A;  3QWL A;  4KO8 A;  2ZAO A;  5EQT A;  4DUY M;  3FTC A;  2L7I A;  3TWK A;  3M6A A;  4MGZ E;  2C5R A;  1N32 M;  2RGH A;  2G5G X;  2EA0 A;  2Z3X A;  1NJF A;  2YFQ A;  1E9R A;  4JN6 A;  3HJ8 A;  2XZU A;  2LWX A;  2YNM D;  3K92 A;  1G59 A;  2CV2 A;  2HCB A;  3FUT A;  1XNR M;  4I81 A;  4DR3 M;  1SXJ E;  5DNY A;  2D7G A;  3LQR A;  2CEA A;  4DR6 M;  2UXB M;  3AOG A;  1L8Q A;  4MB7 A;  1HT1 E;  1JR3 A;  4IBK A;  2G8L A;  3ILK A;  4L15 A;  4IBB A;  1K3W A;  1XWI A;  1NNJ A;  4LF4 M;  1YUB A;  1Z6T A;  5E6J A;  3T1Y M;  2OPF A;  3GRU A;  3J80 S;  5GKN A;  5EXT A;  5ITX A;  2DVW B;  1HNX M;  4LFC M;  2F5P A;  5F3W A;  3SBJ A;  2XGN A;  2DWM A;  1G8P A;  2XH9 A;  1NY5 A;  3UK6 A;  4DR4 M;  4QNM A;  1N33 M;  4HLQ A;  3KW6 A;  3GPY A;  1FJG M;  3M0E A;  1WXQ A;  4RF0 A;  4ITQ A;  3SAS A;  1N75 A;  4YHH M;  2LXE A;  1L1Z A;  1L1T A;  2R4J A;  5C1B A;  3KP1 E;  2VQE M;  4KLN A;  3LVW A;  3TL4 X;  3L28 A;  3PFI A;  3U61 B;  4AKH A;  1YSY A;  4NL4 H;  1IN7 A;  3GLH A;  4JI2 M;  4JI7 M;  4DV6 M;  1IBK M;  1XXH B;  2CUZ A;  1N77 A;  4OU7 A;  1VDD A;  4IBC A;  4RF1 A;  2CHG A;  3FYD A;  4IJF A;  2J7N A;  1E9S A;  3FTE A;  2F5O A;  2R18 A;  4JV5 M;  4EIW A;  5ITR A;  3MK6 A;  2FOI C;  2W82 A;  1I4W A;  3KSX A;  3TPZ A;  2F5Q A;  2UXC M;  2KZS A;  1R2Y A;  2EUC A;  3FTD A;  5FTN A;  4PDG A;  2I7N A;  2KA6 B;  2D7E A;  1NHW C;  3JR4 A;  3KS8 A;  3KSJ A;  2L7H A;  3T1H M;  2FE8 A;  5EXP A;  5IZ7 D;  3KS4 A;  3L26 A;  3A98 B;  4G4Q A;  1SXJ B;  2VQF M;  4G4O A;  3LQQ A;  3U5Z A;  5EXS A;  1I94 M;  3FTF A;  3THG A;  3GLG A;  3SAU A;  1XMQ M;  3HKP A;  3TWM A;  2X4A A;  1NJG A;  4LJ9 A;  2YQZ A;  1H6U A;  5KPR A;  3KOY E;  3WHK A;  1DO0 A;  1DGF A;  3EIE A;  3HU3 A;  3MJ5 A;  2Z4R A;  5BPV A;  1NHG C;  2NQ8 C;  1IQP A;  5JI2 E;  3FYC A;  1HT2 E;  5BR8 M;  3CF6 E;  2Z7J A;  1TH4 A;  1SXJ D;  1SXJ C;  5ITX E;  3GQ5 A;  2L6O A;  4JI1 M;  2CV1 A;  1GVN A;  2KRU A;  3T15 A;  3U6O A;  2L09 A;  1DGG A;  2R4E A;  3KOZ E;  3WHL A;  2F5S A;  2AHM A;  5ITU A;  4PT5 A;  1DO2 A;  4LRS A;  3CF0 A;  3FUU A;  4II7 A;  4JI4 M;  1G4A E;  5FTM A;  3B9P A;  4WUR A;  3HHZ A;  3VKH A;  3D8B A;  1YE9 A;  2J7O A;  3ZH9 B;  4B3R M;  4YY3 M;  1D2N A;  4M9S A;  4QNR A;  3DZD A;  4M0D A;  3U61 A;  5FTJ A;  3I4V A;  3HHX A;  4IBJ A;  1KSF X;  4M0W A;  2E5L M;  4M9Z A;  3SAW A;  2Y0T A;  3LVV A;  1DGB A;  4D81 A;  4QOZ C;  5KQD A;  2KXE A;  5FSW A;  3L2A A;  4GKK M;  3U60 B;  4A3V B;  2C9O A;  3GPU A;  2BJW A;  4FCV A;  4FWG A;  4HL4 A;  4NSO B;  1IY2 A;  3K1J A;  4LJ8 A;  3MHV C;  1L2C A;  3L29 A;  4AKG A;  3OTO M;  2XFT A;  2F5N A;  3E4R A;  3GP1 A;  3AOE A;  1TGU A;  3ZCB B;  1PM5 A;  3PVS A;  2ZAN A;  3U5Z B;  1QYR A;  3SHF A;  3GO8 A;  2C99 A;  4OW0 A;  2XSZ D;  3GLG B;  1K3X A;  4AQY M;  4S12 A;  1R2Z A;  3A42 A;  4NSR A;  4LGM A;  5EP4 A;  4BB9 A;  1XHB A;  3M7G A;  1FNN A;  4BLC A;  3GQ3 A;  4GHA A;  4L16 A;  3GLI B;  3KP0 E;  1G41 A;  4RNA A;  3GLF A;  3HGI A;  5DYI A;  3BOS A;  4JI3 M;  1E32 A;  4MGI E;  3NBI A;  3U6D A;  1GL7 A;  1Q3B A;  3RGS A;  3J81 S;  3LMM A;  4DV5 M;  4NXN M;  1N34 M;  4NRV A;  4IJE A;  3Q8X A;  1XC8 A;  4IBF A;  1MU5 A;  2I7P A;  1QVR A;  4I8O A;  4P16 A;  1QAQ A;  1J5E M;  4FCW A;  3KOX E;  3AKZ A;  2V1C A;  2KRK A;  1IXR C;  2V6Z M;  2XFS A;  3L27 A;  4GIP A;  3AL0 C;  5FTK A;  3NWL A;  4G4N A;  2Q2E B;  3AV0 A;  5E26 A;  4QHS A;  3SAV A;  3ZC7 B;  2R45 A;  4GC5 A;  3SMP A;  4LCB A;  1MX0 A;  4DR7 M;  4LF6 M;  3KVW A;  2ZM6 M;  4LGY A;  2KW0 A;  2VII A;  5FLX S;  1NNU C;  1IN8 A;  4GRI A;  4XBO A;  3T38 A;  3FKE A;  4LJA A;  4AZF A;  2XEP A;  3U6M A;  4ZPX A;  2DWN A;  4LF7 M;  3U6Q A;  2CV0 A;  4FW9 A;  2QP9 X;  2DZN B;  1IN5 A;  4GH9 A;  4LFA M;  2A5Y B;  5EP2 A;  1X37 A;  3TWL A;  4GHL A;  4LJ7 A;  1IXZ A;  2FFJ A;  4AKI A;  4FWD A;  3AJI B;  2CHQ A;  1HR0 M;  1IN4 A;  1IY0 A;  3U6L A;  2OQ4 A;  2V1U A;  3CF2 A;  4QHT A;  4WW0 A;  2F4V M;  3GLI A;  1KFV A;  3SC3 A;  3GLF B;  5KPT A;  4I5S A;  3FD9 A;  4XGI A;  5IRE B;  1Q39 A;  1L2D A;  4K0K M;  3HU2 A;  5EJC A;  4DV7 M;  2R46 A;  4DR2 M;  5LMU M;  1LV7 A;  4LJ5 A;  3E9S A;  2D7H A;  2RGO A;  3VFD A;  4D80 A;  3HJS A;  3FUW A;  4REZ A;  3CTW B;  3K2L A;  1N36 M;  2Y21 A;  1NY6 A;  2JA2 A;  4LZZ A;  2UUC M;  1Q3C A;  4JI5 M;  5EP1 A;  2C9C A;  3EIH A;  2DWL A;  4LF9 M;  4Z6Y A;  1TDH A;  2QBY B;  1KYI A;  4NXM M;  1IY1 A;  4LFB M;  3GLH B;  2DXI A;  1XXH A;  4X62 M;  3RE8 A;  2XZF A;  4OVZ B;  3K8Z A;  4OX9 M;  3QAU A;  3GRR A;  4L4U A;  4B7G A;  1T3T A;  1R6B X;  2BJV A;  2LH0 A;  1QAM A;  3VKG A;  1IXS B;  1ORY B;  2Y20 A;  4DV3 M;  1IN6 A;  4M9X A;  3C58 A;  2M60 A;  1QZM A;  2XF3 A;  4FD2 A;  2X8A A;  4DR5 M;  1HQY E;  4FCT A;  3D8L A;  1JQJ C;  4I4L A;  5KO3 A;  1ZQ9 A;  2UXD M;  1R7R A;  4LRT A;  2QZ4 A;  4G4R A;  3DFZ A;  1DGH A;  4GC9 A;  2QCU A;  4R3D A;  5IWA M;  1QQW A;  3R9X B;  3SHG B;  1W5S A;  2X49 A;  4X65 M;  4MM3 B;  1Z5A A;  4DV4 M;  3IG5 A;  3J7A S;  4X66 M;  2HL7 A;  5DYG A;  4PD2 A;  4CGY B;  8CAT A;  4IBE A;  2H1R A;  2XLJ A;  3UZU A;  3VK8 A;  2CFO A;  3SAT A;  4R7G A;  2DHR A;  4LG2 A;  3SAR A;  3KFU G;  4JI6 M;  3J2P B;  1J7K A;  3AOE C;  1J09 A;  1G3I A;  2K47 A;  3TE6 A;  3U6E A;  1OFH A;  2Z4S A;  1OJL A;  4NRW A;  2UUA M;  3L25 A;  5LMN M;  3IG8 A;  4BBA A;  1PJI A;  1SXJ A;  2DZO B;  1HNZ M;  3U6P A;  1PJJ A;  2QBY A;  2ZBK B;  4JI8 M;  3HHW A;  3RFW A;  2UUB M;  1K82 A;  3U6C A;  2M5Z A;  4B7F A;  2UU9 M;  4IBI A;  3GPP A;  4OVZ A;  4B7H A;  4DR1 M;  3DOA A;  3DA1 A;  3VDU A;  3VLF B;  2QPA A;  3HHY A;  4B08 A;  3UGJ A;  1TH3 A;  4JI0 M;  1EE8 A;  4QOS A;  3GRY A;  4PDI A;  4D82 A;  3W0L B;  5FTL A;  3U6S A;  4LY6 A;  1HQC A;  2ERC A;  4MGK E;  4G6Z A;  2KEB A;  4MGH A;  2BNK A;  1HNW M;  3SYL A;  1DGH B;  2XSZ A;  3HU1 A;  4B3S M;  4FWH A;  1C1K A;  2R62 A;  4AG5 A;  1Z5B A;  1TDZ A;  2Y0Q A;  4AG6 A;  2LNH C;  4GMQ A;  4B3T M;  3UMM A;  5EXX A;  3J7B A;  3A45 A;  3KOW E;  3W0F A;  1Z59 A;  5IT9 S;  4X64 M;  2RKO A;  1UM8 A;  2R65 A;  5ITQ A;  3GQ4 A;  4L8R C;  5H37 D;  4LZJ A;  4KHP M;  4MGY E;  3A46 A;  3U60 A;  4TUW A;  4LF5 M;  1NSF A;  1Z5C A;  4CHT B;  2C98 A;  3PNY A;  4IIW A;  4AI6 A;  2FNA A;  1GL6 A;  4DV0 M;  1QAN A;  5C18 A;  1IM2 A;  5ITT A;  1ZAE A;  2ZAM A;  1OFI A;  5KQ8 A;  3I4Y A;  4L78 A;  3H4M A;  3VDP A;  4DV1 M;  5A2Q S;  2C96 A;  1N78 A;  4GIT A;  1XMO M;  3JAM S;  1L2B A;  4DV2 M;  1GKI A;  5KPZ A;  1IBL M;  4IBD A;  2HHH M;  3GRV A;  1JR3 D;  2CHV A;  3KDS E;  4Z8X A;  1E94 E;  3JR5 A;  3PNV A;  3FUX A;  3SMS A;  3VK7 A;  4JYA M;  1QAO A;  5EP3 A;  2DWZ B;  4B3M M;  4AW4 A;  4CIS A;  3HJQ A;  3I51 A;  3KXE C;  1XNQ M;  1TH2 A;  5JI3 E;  4MH0 E;  4NOO B;  4LJ4 A;  2YR0 A;  4W5W A;  4GKJ M;  3PXG A;  4LJ6 A;  3GPX A;  1IBM M;  1GLN A;  3AFH A;  3HWS A;  5ITY A;  2QEN A;  3SYK A;  4FVM A;  1NVM A;  1W5T A;  3FUV A;  3TQS A;  4PCZ A;  3SFZ A;  4JXJ A;  4DUZ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...