4LFAM

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lfaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lfaM02
4JI3M 2F5SA 2ZBKB 1L2CA 4DR1M 4JV5M 3JR5A 3SATA 4X65M 4DR3M 3U6LA 1N32M 1IBKM 4X64M 4X62M 2ZM6M 4JI5M 1XNRM 5ITQA 5LMNM 4DV0M 1Z5CA 4LF9M 3SBJA 5ITRA 4JI6M 3U6SA 2HKJA 4DR2M 4B3RM 2XZFA 4LFCM 4CISA 3J81S 5IT9S 3GP1A 4KHPM 5A2QS 2VQEM 4NXNM 3U6MA 3U6CA 2UU9M 5LMUM 2UXDM 3VK8A 1MX0A 1TDZA 4JI1M 4G4RA 4DV6M 4JI7M 3SARA 4OX9M 1TDHA 3DOAA 3GPPA 1HR0M 4GKJM 2UXCM 3U6DA 4G4OA 4DR4M 2F5OA 1L2DA 4DV2M 1PJJA 5FLXS 3VK7A 3GQ4A 4DV4M 1XMOM 2VQFM 1FJGM 3A45A 4DR5M 2F5QA 4B3SM 4K0KM 1K3XA 4NRVA 4ITQA 1Z5AA 4NXMM 3TWMA 4B3MM 2F5PA 4LF7M 4DUYM 1Z59A 4G4NA 3T1YM 1K3WA 3GPUA 1N36M 2F5NA 1XC8A 2XZUA 2HHHM 4AQYM 4DV7M 3GQ3A 4MB7A 1KFVA 3JR4A 4JI4M 1PJIA 2OQ4A 4LF6M 1Z5BA 5ITUA 4JI2M 1K82A 3T1HM 3U6EA 3U6PA 1HNXM 5ITYA 5ITXE 2F4VM 4YHHM 1XMQM 3J80S 5IWAM 2EA0A 4DV5M 3J7AS 4JYAM 3W0FA 4JI0M 5ITTA 3GO8A 4DUZM 4PDGA 3SASA 3OTOM 4YY3M 4DV1M 5ITXA 2UUBM 4PDIA 4LF5M 2Q2EB 1L1TA 1IBLM 4PCZA 4DR7M 3A46A 2UUAM 1I94M 2UXBM 4DR6M 1R2YA 4LF8M 4LFAM 3C58A 1NNJA 1HNZM 3A42A 3JAMS 2UUCM 3SAWA 1R2ZA 1MU5A 1Q39A 4JI8M 3SAUA 4PD2A 2E5LM 4G4QA 1L2BA 3GPYA 4NRWA 1Q3CA 1J5EM 1PM5A 4LFBM 1L1ZA 1HNWM 5BR8M 1N33M 4B3TM 1N34M 1EE8A 4X66M 3GPXA 3U6QA 3TWLA 1IBMM 1XNQM 3GQ5A 4GKKM 3U6OA 3TWKA 3SAVA 2OPFA 1Q3BA 4LF4M 4DV3M
chains in the Genus database with same CATH superfamily
1L2CA 3GLGB 3PNYA 1IXSA 1WGNA 5EJCA 4NSOB 1D0LA 1NVMA 1XXHE 4UN2B 3SATA 3KFUG 3U6LA 2YR0A 3K2LA 3DZDA 2H1RA 2DHRA 2X49A 2ZANA 2XEPA 2OOAA 2DZLA 1QYRA 3W67A 4G6ZA 1IN6A 4JI6M 2V1UA 3K8ZA 2DAKA 4OU7A 4DR2M 4Y28F 3U60B 4NOOB 4KHPM 2DWNA 4IBEA 5A2QS 2VQEM 4R3DA 5LMUM 2UXDM 3C3EA 3VK8A 1MX0A 1C1KA 3I4YA 3WHLA 1DGGA 2DVWB 1TDZA 4JI1M 3CTWB 3HJQA 2JY5A 3SARA 3DOAA 1IXSB 1HR0M 2UXCM 4OVZA 3VDUA 5FTLA 5F3WA 3FD9A 4G4OA 4KO8A 4DV2M 5E26A 2JWSA 3KVWA 4AKGA 1G3IA 1VDLA 1TF0B 2JP7A 3L27A 5KPZA 2BNKA 4DR5M 4AKIA 3CF0A 1IM2A 4K0KM 7CATA 4AW4A 1XXHA 2GNOA 3SFZA 4P16A 2X4AA 4RNAA 3HZJA 4G4NA 3E9SA 3KOWE 1QUSA 2CFOA 2WZJA 4MGZE 1N36M 1PGYA 2F5NA 2D7EA 3AJIB 5DYIA 2LH0A 2L2DA 5DFLA 1HJPA 4AQYM 2M5ZA 2ZAMA 2C5RA 3GQ3A 1S3SA 3B74A 1JR3A 3JR4A 3I04M 1PJIA 1TH2A 3GLIB 1DV0A 2WSFF 5KO3A 1NV9A 1OFIA 3SYLA 5E6JA 3MHVC 1IFYA 2LVAA 1MN3A 1XMQM 2HAKA 2EA0A 3J7AS 4JI0M 2A5YB 1QAMA 1VEJA 3KOYE 5EP1A 1CUKA 2KNAA 2C9CA 1WJ7A 4GH9A 4DBGB 3BXWA 3KXEC 3W0LB 3SHFA 3SASA 4QNMA 4Z8XA 4NSRA 4DV1M 2XGNA 2DAGA 2WSEF 4IJEA 4AG6A 4PDIA 4B08A 2UUBM 1H6UA 4GHLA 4AKHA 1WR1B 1QZEA 1XXHB 2UXBM 1R2YA 1NNJA 4D81A 4RF0A 4AI6A 3UK6A 4L16A 2UUCM 3SAWA 4I4LA 1R4GA 4LJ9A 2OO9A 1Q39A 4AG5A 2DWMA 4CJ6A 4JI8M 1E9RA 3PVSA 4PD2A 4LRSA 4EIWA 3HHZA 3LVWA 2G5GX 2KA6B 4GITA 1WXQA 4BLCA 3C3DA 1SXJB 1QANA 2XLJA 3GLFB 2KNZA 3I4VA 1PM5A 1C7YA 1L1ZA 1X37A 3DA1A 1DGBA 1EE8A 3K1JA 1DO0A 4IBKA 3TQSA 5KQ8A 1XNQM 1NO1A 2J7NA 3KOZE 4FCTA 2DI0A 3SAVA 1V33A 3VKGA 1Q3BA 8CATA 1QZMA 1D0MA 4LF4M 3R9XB 3L25A 1GABA 4M9ZA 4LJ7A 2G8LA 3E21A 3QAUA 4DR1M 4IIWA 2B3TA 2K47A 4M9SA 3JR5A 2XH9A 1G8PA 2C96A 1IBKM 5FTNA 1D0KA 4JI5M 1XNRM 3AL0C 2LVNC 3GRYA 4LG2A 3NBXX 2I7PA 4LCBA 2LVQD 4LF9M 4KODA 3IG8A 3SHGB 5ITRA 3U6SA 3RGPA 4I8OA 2R44A 2CV2A 3KSJA 2XZFA 4B3RM 1D2NA 4MM3B 2R46A 4LJ8A 4NXNM 2K6BA 1LTMA 3U6CA 2J5YA 2MH8A 2MJ5B 4FW9A 5EQTA 1EIJA 3D8BA 4Q7JA 1G41A 2Y21A 1W5TA 1KSFX 4OX9M 1TH4A 2KNVA 3FUUA 2LXEA 3B7ZA 1QUTA 4DR4M 3T15A 3TE6A 2YQZA 1G4AE 5FLXS 1OTRA 3GQ4A 1VEGA 4DV4M 2K9DA 1MJGM 1VQ1A 1GJTA 2W82A 3B7QA 3T38A 1XMOM 2Y0TA 2F5QA 3HU3A 1PJSA 5KPTA 4FD2A 1Z5AA 2FFJA 2AHMA 2QPAA 4GIPA 1IN5A 4S12A 3TWMA 2F5PA 4DUYM 2EKKA 4XGIA 2P5TA 3T1YM 1ZV1A 3GPUA 4LY6A 3V76A 4QOSA 2KZUA 3UZUA 3HJSA 1PJTA 1R6BX 1ZAEA 1LV7A 2XF3A 3I51A 1KFVA 1WIVA 4IBBA 4IBJA 4FWHA 3U60A 3HGIA 3M7GA 4GC9A 2HWJA 2OQ4A 4LF6M 4L4UA 3MJ5A 5ITUA 4LRTA 4JI2M 3KP0E 3U6EA 3CF2A 2QCUA 3IG5A 3Q8GA 3KW6A 2VIIA 2DENA 2F4VM 1DGFA 1QVRA 2R0IA 4L6V6 4XBOA 1IY2A 2RGHA 1P3QQ 1A5TA 1QAOA 2OOBA 3E4RA 3ZC7B 1WGLA 4R7GA 1Z6TA 2R62A 4DUZM 2CHQA 1TR8A 1NHWC 4NL4H 3GLFE 3GLGA 4PDGA 1W5SA 3KS4A 1GL6A 2KDLA 1RU3A 2Z3XA 3BOSA 5ITXA 3SYKA 5C18A 1AIPC 2ZTCA 3A46A 2CWBA 3TL4X 1E32A 4HL4A 1PRBA 4IBFA 4WW0A 4DR6M 3UMMA 4LF8M 2QENA 3VDPA 3A42A 4WURA 1SXJA 1NY6A 4QOZC 4II7A 1NHGC 1QDRA 1G59A 4RKUF 1DO2A 4IBDA 3HWSA 2R45A 5FTJA 4G4QA 1OJLA 3LMMA 4LGMA 1Y8GA 1ZMUA 4AZFA 3GLIE 1L2BA 2JY7A 3QYEA 1QAQA 1SXJD 2LHGA 5EXSA 1E94E 1XB2B 4LFBM 1DGHA 1N33M 3IECA 4B3TM 3GPXA 4X66M 3FRHA 2Z7JA 2JZ1A 4GKKM 1GJSA 3U6OA 3SC3A 3MMPA 3W68A 4CHTB 2OPFA 2KRUA 1Q3CA 2L4FA 3KSXA 3U5ZB 1T3TA 2CHVA 2CUZA 3J7BA 1IXZA 3DFZA 4JV5M 1R5LA 1GKIA 4LZJA 4DR3M 3ZH9B 2N35A 3B89A 4L15A 1GVNA 4MGHA 4DV0M 1IN4A 1Z5CA 3GLHB 3L26A 3CF6E 1NY5A 1OQYA 5EP4A 3RGSA 2DNAA 3FYCA 2CHGA 2DAIA 3AOGA 4IBIA 4R71A 5KPRA 3SBJA 3SMSA 3C9PA 5EXPA 1V34A 3HHYA 2DXIA 4LJAA 2D7GA 1NJGA 4LFCM 5GKNA 4CISA 2HL7A 3J81S 5IT9S 2FNAA 4I81A 3U6MA 3GLHA 1PJQA 4GEWA 4CIZA 2QBYA 4IBCA 2QP9X 2LTUA 1JR3D 2R6FA 3AOEA 3LQQA 3K9OA 3M6AA 3K92A 4DV6M 2JXNA 1ORYB 1IN8A 4GKJM 2G3QA 2I7NA 3U5ZA 2EKFA 2ZAOA 1L2DA 2F5OA 1GO5A 4L78A 1PJJA 2EJSA 2C99A 3H4JA 1HQYE 3HU2A 1GLNA 2NQ8C 1DGHB 2RRUA 2VQFM 1FJGM 3A45A 1SXJC 1YE9A 1K3XA 1NNUC 1ZMVA 3FKEA 4NRVA 3RE8A 1XHBA 4ITQA 2R4EA 4REZA 4NXMM 1TTEA 4Z6YA 3HU1A 2QQ8A 4B3MM 3M0EA 1Z59A 2LNHC 2H5XA 3J27B 2KRKA 4GRIA 1K3WA 1N78A 3NWLA 1N77A 3VFDA 1AUAA 1BVSA 2LVPC 2HHHM 2EUCA 3A98B 3L2AA 2XFSA 4L8RC 4A3VB 2KW0A 1SXJE 2QZ4A 1IN7A 3PNVA 2QHOB 4BBAA 1Z5BA 2J7OA 2YFQA 1OIZA 2APLA 1N75A 3U6PA 1HNXM 3FTDA 4FCWA 4WP2A 5JI3E 1VEKA 5IREB 3EIHA 5ITXE 1G71A 3NBIA 3HY5A 4F1IA 4JYAM 2DAEA 2K0BX 2VDBB 3UJNA 2MGWA 2O25A 3RFWA 2LVOC 5L8RF 1GL7A 2QNJA 3B9PA 4KLNA 2R18A 3OTOM 3B7NA 4YY3M 1J7KA 4LF5M 2Q2EB 2BJWA 2M60A 2JUJA 3GRUA 4KT0F 5EXTA 3KOXE 2CRUA 3GRRA 1HT1E 3IHPA 2EO2A 3MK6A 4IBGA 4LFAM 4BB9A 5IZ7D 4LJ6A 1HNZM 4CGYB 3E46A 3LVVA 3AKZA 4M0DA 2L7HA 5EP2A 1MU5A 2O5RA 2L7IA 3EIEA 1ZMWA 3SAUA 3GRVA 2Y0QA 1ZQ9A 4LJ4A 3GLHE 4FCVA 3L28A 3GPYA 4NRWA 2CEAA 4LGYA 5EXXA 2XFTA 2Z4SA 4GC5A 3ZQJA 5FTKA 1V92A 1N34M 3AV0A 4OW0A 1Q02A 4TUWA 2DAMA 3GQ5A 3VLFB 2CE7A 3TWKA 2VF8A 3J2PB 4IJFA 3W0FA 4DV3M 2VF7A 4JI3M 2JY8A 2ZBKB 3I01M 4OVZB 4ANRA 2F5SA 3HHWA 4B7FA 2GQFA 2L09A 2WSCF 4LJ5A 4X65M 1N32M 2Z4RA 4X64M 4X62M 4QNRA 2BWBA 2ZM6M 5ITQA 5LMNM 1YLAA 1YSYA 3K9PA 1QDTA 3CGWA 3FTEA 1HT2E 1IXRC 2FOIC 1NV8A 2LBCA 5H37D 4MGYE 4HLQA 4W5WA 3R8FA 1HQCA 2HKJA 2JZ0A 4RF1A 1TH3A 2JY6B 4GHAA 3GP1A 1T6OA 1VG5A 2LWXA 2R4JA 5JI2E 2CV1A 1OKSA 2JNHA 3LQRA 2UU9M 3FTFA 4GMQA 2KXEA 2XSZD 1TGUA 4F2LA 1F4IA 3PXGA 2DWZB 4G4RA 2RGOA 4JI7M 2O01F 1TDHA 3GPPA 1L8QA 3FUXA 3VKHA 2DHYA 2CV0A 1SG9A 3U6DA 2C9OA 2D7HA 2FE8A 4I5SA 2XSZA 3HHXA 4G3OA 3VK7A 3U61A 4P17A 5BPVA 1KYIA 2BJVA 1VDDA 2L6OA 4B3SM 4M9XA 1IY0A 3GLFA 3GLGE 1JB0F 2DZOB 2HCBA 4PT5A 1EFUB 4QHSA 5KQDA 4LF7M 2MROB 1IY1A 1QQWA 2KHHA 2KZSA 2V1CA 2Y20A 3QYBA 2MR9A 4NC6A 5FTMA 3FRIA 1XC8A 3ZCBB 3L29A 2QBYB 2XZUA 1NSFA 3Q8XA 5DYGA 4DV7M 4MB7A 1FNNA 5EP3A 2V6ZM 4JI4M 5C1BA 1JQJC 3HX3A 1OIPA 2LHCA 3THGA 1UM8A 4D80A 1K82A 3T1HM 4B7HA 3KS8A 2DZNB 3KP1E 3KDSE 3FTCA 2BWEA 1E9SA 5ITYA 4JN6A 4YHHM 1OAOC 3J80S 5IWAM 4DV5M 3GLIA 2ERCA 3SMPA 5ITTA 4FVMA 3HJ8A 3GO8A 2JA2A 2RKOA 1XWIA 3H4MA 3FE3A 3FUTA 4FWGA 4LZZA 1WHCA 2Z8YM 3HKPA 3LCVB 4M0WA 4MH0E 1IQPA 2QSFX 4DR7M 2ZTDA 1L1TA 4PCZA 1IBLM 2FS1A 4MGKE 3WHKA 2UUAM 1I94M 4XK8F 2R65A 2L4EA 5DNYA 3ILKA 3C58A 4FWDA 1I4WA 3JAMS 4HEOA 3AFHA 2X8AA 3AOEC 1JR3E 3D8LA 1R2ZA 4JXJA 2DWLA 2KEBA 4B7GA 1NJFA 3LCUA 1YUBA 3UGJA 2YNMD 2DKLA 3FYDA 3TPZA 3FUWA 3LW5F 1J5EM 2FH0A 4D82A 1HNWM 1OFHA 5BR8M 3PFIA 5FSWA 3T6PA 4ZPXA 1R7RA 4QHTA 2CP8A 3TWLA 3U6QA 1UFZA 4MGIE 3U61B 1IBMM 2C98A 3FUVA 1J09A 1OAIA 3QWLA 1T43A 2E5LM 3F92A 3BBZA
chains in the Genus database with same CATH topology
1L2CA 3GLGB 3PNYA 5EJCA 4NSOB 1NVMA 3KFUG 3SATA 3U6LA 2YR0A 3K2LA 3DZDA 2H1RA 2DHRA 2X49A 2ZANA 2XEPA 1QYRA 4G6ZA 1IN6A 4JI6M 2V1UA 3K8ZA 4OU7A 4DR2M 3U60B 4NOOB 4KHPM 2DWNA 4IBEA 5A2QS 2VQEM 4R3DA 5LMUM 2UXDM 3VK8A 1C1KA 1MX0A 3I4YA 3WHLA 1DGGA 2DVWB 1TDZA 4JI1M 3CTWB 3HJQA 3SARA 3DOAA 1IXSB 1HR0M 2UXCM 4OVZA 3VDUA 5FTLA 5F3WA 3FD9A 4G4OA 4KO8A 4DV2M 5E26A 3KVWA 4AKGA 1G3IA 3L27A 5KPZA 2BNKA 4DR5M 4AKIA 3CF0A 1IM2A 4K0KM 7CATA 4AW4A 1XXHA 3SFZA 4P16A 2X4AA 4RNAA 4G4NA 3E9SA 3KOWE 2CFOA 4MGZE 1N36M 2F5NA 2D7EA 3AJIB 5DYIA 2LH0A 4AQYM 2C5RA 2M5ZA 2ZAMA 3GQ3A 1S3SA 1JR3A 3JR4A 1PJIA 1TH2A 3GLIB 5KO3A 1OFIA 3SYLA 5E6JA 3MHVC 1XMQM 2EA0A 3J7AS 4JI0M 2A5YB 1QAMA 3KOYE 5EP1A 2C9CA 4GH9A 3KXEC 3W0LB 3SHFA 3SASA 4QNMA 4Z8XA 4NSRA 4DV1M 2XGNA 4IJEA 4AG6A 4PDIA 2UUBM 4GHLA 4B08A 4AKHA 1H6UA 1XXHB 2UXBM 1R2YA 1NNJA 4D81A 4RF0A 4AI6A 3UK6A 4L16A 2UUCM 3SAWA 4I4LA 4LJ9A 1Q39A 4AG5A 2DWMA 4JI8M 1E9RA 3PVSA 4PD2A 4LRSA 4EIWA 3HHZA 3LVWA 2G5GX 2KA6B 4GITA 1WXQA 4BLCA 1SXJB 1QANA 2XLJA 3GLFB 3I4VA 1PM5A 1L1ZA 1X37A 3DA1A 1DGBA 1EE8A 3K1JA 1DO0A 4IBKA 3TQSA 5KQ8A 1XNQM 2J7NA 4FCTA 3KOZE 3SAVA 3VKGA 1Q3BA 8CATA 1QZMA 4LF4M 3R9XB 3L25A 4M9ZA 4LJ7A 2G8LA 3QAUA 4DR1M 4IIWA 2K47A 4M9SA 3JR5A 2XH9A 1G8PA 2C96A 1IBKM 5FTNA 4JI5M 1XNRM 3AL0C 4LG2A 3GRYA 2I7PA 4LCBA 4LF9M 4KODA 3IG8A 3SHGB 5ITRA 3U6SA 3RGPA 4I8OA 2CV2A 3KSJA 2XZFA 4B3RM 1D2NA 4MM3B 2R46A 4LJ8A 4NXNM 3U6CA 4FW9A 5EQTA 3D8BA 1G41A 2Y21A 1W5TA 1KSFX 4OX9M 1TH4A 3FUUA 2LXEA 4DR4M 3T15A 3TE6A 2YQZA 1G4AE 5FLXS 3GQ4A 4DV4M 2W82A 3T38A 1XMOM 2Y0TA 2F5QA 3HU3A 5KPTA 4FD2A 1Z5AA 2FFJA 2AHMA 2QPAA 4GIPA 1IN5A 4S12A 3TWMA 2F5PA 4DUYM 4XGIA 2P5TA 3T1YM 3GPUA 4LY6A 4QOSA 2KZUA 3UZUA 3HJSA 1R6BX 1ZAEA 1LV7A 2XF3A 3I51A 1KFVA 4IBBA 4IBJA 4FWHA 3U60A 3HGIA 3M7GA 4GC9A 2OQ4A 4LF6M 4L4UA 3MJ5A 5ITUA 4LRTA 4JI2M 3KP0E 3U6EA 3CF2A 2QCUA 3IG5A 3KW6A 2VIIA 2F4VM 1DGFA 1QVRA 4XBOA 1IY2A 2RGHA 3ZC7B 1QAOA 3E4RA 4R7GA 1Z6TA 2R62A 4DUZM 2CHQA 1NHWC 4NL4H 3GLGA 4PDGA 1W5SA 3KS4A 1GL6A 2Z3XA 3BOSA 5ITXA 3SYKA 5C18A 3A46A 3TL4X 1E32A 4HL4A 4IBFA 4WW0A 4DR6M 3UMMA 4LF8M 2QENA 3VDPA 3A42A 4WURA 1SXJA 1NY6A 4QOZC 4II7A 1NHGC 1G59A 1DO2A 4IBDA 3HWSA 2R45A 5FTJA 4G4QA 1OJLA 3LMMA 4LGMA 4AZFA 1L2BA 2E5LM 1QAQA 1SXJD 5EXSA 1E94E 4LFBM 1DGHA 1N33M 4B3TM 3GPXA 4X66M 2Z7JA 4GKKM 3U6OA 3SC3A 2OPFA 4CHTB 2KRUA 1Q3CA 3KSXA 3U5ZB 1T3TA 2CHVA 2CUZA 3J7BA 1IXZA 3DFZA 4JV5M 1GKIA 4LZJA 4DR3M 3ZH9B 4L15A 1GVNA 4MGHA 4DV0M 1IN4A 1Z5CA 3GLHB 3L26A 3CF6E 1NY5A 5EP4A 3RGSA 3FYCA 4IBIA 2CHGA 3AOGA 5KPRA 3SBJA 3SMSA 5EXPA 3HHYA 2DXIA 4LJAA 2D7GA 1NJGA 4LFCM 5GKNA 4CISA 2HL7A 3J81S 5IT9S 2FNAA 4I81A 3U6MA 3GLHA 2QBYA 4IBCA 2QP9X 1JR3D 3AOEA 3M6AA 3LQQA 3K92A 4DV6M 1ORYB 1IN8A 4GKJM 2I7NA 3U5ZA 2F5OA 2ZAOA 1L2DA 4L78A 1PJJA 2C99A 1HQYE 3HU2A 1GLNA 2NQ8C 1DGHB 2VQFM 1FJGM 3A45A 1SXJC 1YE9A 1K3XA 1NNUC 3FKEA 4NRVA 3RE8A 1XHBA 4ITQA 2R4EA 4REZA 4NXMM 4Z6YA 3HU1A 4B3MM 3M0EA 1Z59A 2LNHC 3J27B 2KRKA 4GRIA 1K3WA 1N78A 3NWLA 1N77A 3VFDA 2HHHM 2EUCA 3A98B 3L2AA 2XFSA 4L8RC 4A3VB 2KW0A 1SXJE 2QZ4A 1IN7A 3PNVA 4BBAA 1Z5BA 2J7OA 2YFQA 1N75A 3U6PA 1HNXM 3FTDA 4FCWA 5JI3E 5IREB 5ITXE 3EIHA 3NBIA 4JYAM 3UJNA 3RFWA 1GL7A 3B9PA 4KLNA 2R18A 3OTOM 4YY3M 1J7KA 4LF5M 2BJWA 2M60A 2Q2EB 3GRUA 5EXTA 3KOXE 3GRRA 1HT1E 2EO2A 3MK6A 4IBGA 4LFAM 4BB9A 5IZ7D 4LJ6A 1HNZM 4CGYB 3LVVA 3AKZA 4M0DA 2L7HA 5EP2A 1MU5A 2O5RA 2L7IA 3EIEA 3SAUA 3GRVA 2Y0QA 1ZQ9A 4LJ4A 4FCVA 3L28A 3GPYA 4NRWA 2CEAA 4LGYA 5EXXA 2XFTA 2Z4SA 4GC5A 5FTKA 1N34M 3AV0A 4OW0A 4TUWA 3GQ5A 3VLFB 2CE7A 3TWKA 3J2PB 4IJFA 3W0FA 4DV3M 4JI3M 4OVZB 2ZBKB 2F5SA 3HHWA 4B7FA 2L09A 4LJ5A 4X65M 1N32M 2Z4RA 4X64M 4X62M 4QNRA 2ZM6M 5ITQA 5LMNM 1YSYA 3FTEA 1HT2E 1IXRC 2FOIC 5H37D 4MGYE 4HLQA 4W5WA 3R8FA 1HQCA 2HKJA 4RF1A 4GHAA 1TH3A 3GP1A 2R4JA 2LWXA 5JI2E 2CV1A 3LQRA 2UU9M 3FTFA 4GMQA 2KXEA 2XSZD 1TGUA 3PXGA 2DWZB 4G4RA 2RGOA 4JI7M 1TDHA 3GPPA 1L8QA 3FUXA 3VKHA 2CV0A 3U6DA 2C9OA 2D7HA 2FE8A 4I5SA 2XSZA 3HHXA 3VK7A 3U61A 5BPVA 1KYIA 2BJVA 1VDDA 2L6OA 4B3SM 4M9XA 1IY0A 3GLFA 2DZOB 2HCBA 4PT5A 4QHSA 5KQDA 4LF7M 1IY1A 1QQWA 2KZSA 2V1CA 2Y20A 5FTMA 1XC8A 3ZCBB 3L29A 2QBYB 2XZUA 1NSFA 3Q8XA 5DYGA 4DV7M 4MB7A 1FNNA 5EP3A 2V6ZM 4JI4M 5C1BA 1JQJC 3THGA 1UM8A 4D80A 1K82A 3T1HM 4B7HA 2DZNB 3KP1E 3KDSE 3FTCA 1E9SA 5ITYA 4JN6A 4YHHM 3J80S 5IWAM 4DV5M 3GLIA 2ERCA 3SMPA 5ITTA 4FVMA 3HJ8A 3GO8A 2JA2A 2RKOA 1XWIA 3H4MA 3FUTA 4FWGA 4LZZA 3HKPA 4M0WA 4MH0E 1IQPA 4DR7M 1L1TA 1IBLM 4PCZA 4MGKE 3WHKA 2UUAM 1I94M 2R65A 5DNYA 3ILKA 3C58A 4FWDA 1I4WA 3JAMS 3AFHA 2X8AA 3AOEC 3D8LA 1R2ZA 4JXJA 2DWLA 2KEBA 4B7GA 1NJFA 1YUBA 3UGJA 2YNMD 3FYDA 3TPZA 3FUWA 1J5EM 4D82A 1HNWM 1OFHA 5BR8M 3PFIA 5FSWA 4ZPXA 1R7RA 4QHTA 3U6QA 3TWLA 1IBMM 4MGIE 3U61B 2C98A 3FUVA 1J09A 3QWLA 3KS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 M;  2F5S A;  2ZBK B;  1L2C A;  4DR1 M;  4JV5 M;  3JR5 A;  3SAT A;  4X65 M;  4DR3 M;  3U6L A;  1N32 M;  1IBK M;  4X64 M;  4X62 M;  2ZM6 M;  4JI5 M;  1XNR M;  5ITQ A;  5LMN M;  4DV0 M;  1Z5C A;  4LF9 M;  3SBJ A;  5ITR A;  4JI6 M;  3U6S A;  2HKJ A;  4DR2 M;  4B3R M;  2XZF A;  4LFC M;  4CIS A;  3J81 S;  5IT9 S;  3GP1 A;  4KHP M;  5A2Q S;  2VQE M;  4NXN M;  3U6M A;  3U6C A;  2UU9 M;  5LMU M;  2UXD M;  3VK8 A;  1MX0 A;  1TDZ A;  4JI1 M;  4G4R A;  4DV6 M;  4JI7 M;  3SAR A;  4OX9 M;  1TDH A;  3DOA A;  3GPP A;  1HR0 M;  4GKJ M;  2UXC M;  3U6D A;  4G4O A;  4DR4 M;  2F5O A;  1L2D A;  4DV2 M;  1PJJ A;  5FLX S;  3VK7 A;  3GQ4 A;  4DV4 M;  1XMO M;  2VQF M;  1FJG M;  3A45 A;  4DR5 M;  2F5Q A;  4B3S M;  4K0K M;  1K3X A;  4NRV A;  4ITQ A;  1Z5A A;  4NXM M;  3TWM A;  4B3M M;  2F5P A;  4LF7 M;  4DUY M;  1Z59 A;  4G4N A;  3T1Y M;  1K3W A;  3GPU A;  1N36 M;  2F5N A;  1XC8 A;  2XZU A;  2HHH M;  4AQY M;  4DV7 M;  3GQ3 A;  4MB7 A;  1KFV A;  3JR4 A;  4JI4 M;  1PJI A;  2OQ4 A;  4LF6 M;  1Z5B A;  5ITU A;  4JI2 M;  1K82 A;  3T1H M;  3U6E A;  3U6P A;  1HNX M;  5ITY A;  5ITX E;  2F4V M;  4YHH M;  1XMQ M;  3J80 S;  5IWA M;  2EA0 A;  4DV5 M;  3J7A S;  4JYA M;  3W0F A;  4JI0 M;  5ITT A;  3GO8 A;  4DUZ M;  4PDG A;  3SAS A;  3OTO M;  4YY3 M;  4DV1 M;  5ITX A;  2UUB M;  4PDI A;  4LF5 M;  2Q2E B;  1L1T A;  1IBL M;  4PCZ A;  4DR7 M;  3A46 A;  2UUA M;  1I94 M;  2UXB M;  4DR6 M;  1R2Y A;  4LF8 M;  4LFA M;  3C58 A;  1NNJ A;  1HNZ M;  3A42 A;  3JAM S;  2UUC M;  3SAW A;  1R2Z A;  1MU5 A;  1Q39 A;  4JI8 M;  3SAU A;  4PD2 A;  2E5L M;  4G4Q A;  1L2B A;  3GPY A;  4NRW A;  1Q3C A;  1J5E M;  1PM5 A;  4LFB M;  1L1Z A;  1HNW M;  5BR8 M;  1N33 M;  4B3T M;  1N34 M;  1EE8 A;  4X66 M;  3GPX A;  3U6Q A;  3TWL A;  1IBM M;  1XNQ M;  3GQ5 A;  4GKK M;  3U6O A;  3TWK A;  3SAV A;  2OPF A;  1Q3B A;  4LF4 M;  4DV3 M; 
#chains in the Genus database with same CATH topology
 1L2C A;  3GLG B;  3PNY A;  1IXS A;  1WGN A;  5EJC A;  4NSO B;  1D0L A;  1NVM A;  1XXH E;  4UN2 B;  3SAT A;  3KFU G;  3U6L A;  2YR0 A;  3K2L A;  3DZD A;  2H1R A;  2DHR A;  2X49 A;  2ZAN A;  2XEP A;  2OOA A;  2DZL A;  1QYR A;  3W67 A;  4G6Z A;  1IN6 A;  4JI6 M;  2V1U A;  3K8Z A;  2DAK A;  4OU7 A;  4DR2 M;  4Y28 F;  3U60 B;  4NOO B;  4KHP M;  2DWN A;  4IBE A;  5A2Q S;  2VQE M;  4R3D A;  5LMU M;  2UXD M;  3C3E A;  3VK8 A;  1MX0 A;  1C1K A;  3I4Y A;  3WHL A;  1DGG A;  2DVW B;  1TDZ A;  4JI1 M;  3CTW B;  3HJQ A;  2JY5 A;  3SAR A;  3DOA A;  1IXS B;  1HR0 M;  2UXC M;  4OVZ A;  3VDU A;  5FTL A;  5F3W A;  3FD9 A;  4G4O A;  4KO8 A;  4DV2 M;  5E26 A;  2JWS A;  3KVW A;  4AKG A;  1G3I A;  1VDL A;  1TF0 B;  2JP7 A;  3L27 A;  5KPZ A;  2BNK A;  4DR5 M;  4AKI A;  3CF0 A;  1IM2 A;  4K0K M;  7CAT A;  4AW4 A;  1XXH A;  2GNO A;  3SFZ A;  4P16 A;  2X4A A;  4RNA A;  3HZJ A;  4G4N A;  3E9S A;  3KOW E;  1QUS A;  2CFO A;  2WZJ A;  4MGZ E;  1N36 M;  1PGY A;  2F5N A;  2D7E A;  3AJI B;  5DYI A;  2LH0 A;  2L2D A;  5DFL A;  1HJP A;  4AQY M;  2M5Z A;  2ZAM A;  2C5R A;  3GQ3 A;  1S3S A;  3B74 A;  1JR3 A;  3JR4 A;  3I04 M;  1PJI A;  1TH2 A;  3GLI B;  1DV0 A;  2WSF F;  5KO3 A;  1NV9 A;  1OFI A;  3SYL A;  5E6J A;  3MHV C;  1IFY A;  2LVA A;  1MN3 A;  1XMQ M;  2HAK A;  2EA0 A;  3J7A S;  4JI0 M;  2A5Y B;  1QAM A;  1VEJ A;  3KOY E;  5EP1 A;  1CUK A;  2KNA A;  2C9C A;  1WJ7 A;  4GH9 A;  4DBG B;  3BXW A;  3KXE C;  3W0L B;  3SHF A;  3SAS A;  4QNM A;  4Z8X A;  4NSR A;  4DV1 M;  2XGN A;  2DAG A;  2WSE F;  4IJE A;  4AG6 A;  4PDI A;  4B08 A;  2UUB M;  1H6U A;  4GHL A;  4AKH A;  1WR1 B;  1QZE A;  1XXH B;  2UXB M;  1R2Y A;  1NNJ A;  4D81 A;  4RF0 A;  4AI6 A;  3UK6 A;  4L16 A;  2UUC M;  3SAW A;  4I4L A;  1R4G A;  4LJ9 A;  2OO9 A;  1Q39 A;  4AG5 A;  2DWM A;  4CJ6 A;  4JI8 M;  1E9R A;  3PVS A;  4PD2 A;  4LRS A;  4EIW A;  3HHZ A;  3LVW A;  2G5G X;  2KA6 B;  4GIT A;  1WXQ A;  4BLC A;  3C3D A;  1SXJ B;  1QAN A;  2XLJ A;  3GLF B;  2KNZ A;  3I4V A;  1PM5 A;  1C7Y A;  1L1Z A;  1X37 A;  3DA1 A;  1DGB A;  1EE8 A;  3K1J A;  1DO0 A;  4IBK A;  3TQS A;  5KQ8 A;  1XNQ M;  1NO1 A;  2J7N A;  3KOZ E;  4FCT A;  2DI0 A;  3SAV A;  1V33 A;  3VKG A;  1Q3B A;  8CAT A;  1QZM A;  1D0M A;  4LF4 M;  3R9X B;  3L25 A;  1GAB A;  4M9Z A;  4LJ7 A;  2G8L A;  3E21 A;  3QAU A;  4DR1 M;  4IIW A;  2B3T A;  2K47 A;  4M9S A;  3JR5 A;  2XH9 A;  1G8P A;  2C96 A;  1IBK M;  5FTN A;  1D0K A;  4JI5 M;  1XNR M;  3AL0 C;  2LVN C;  3GRY A;  4LG2 A;  3NBX X;  2I7P A;  4LCB A;  2LVQ D;  4LF9 M;  4KOD A;  3IG8 A;  3SHG B;  5ITR A;  3U6S A;  3RGP A;  4I8O A;  2R44 A;  2CV2 A;  3KSJ A;  2XZF A;  4B3R M;  1D2N A;  4MM3 B;  2R46 A;  4LJ8 A;  4NXN M;  2K6B A;  1LTM A;  3U6C A;  2J5Y A;  2MH8 A;  2MJ5 B;  4FW9 A;  5EQT A;  1EIJ A;  3D8B A;  4Q7J A;  1G41 A;  2Y21 A;  1W5T A;  1KSF X;  4OX9 M;  1TH4 A;  2KNV A;  3FUU A;  2LXE A;  3B7Z A;  1QUT A;  4DR4 M;  3T15 A;  3TE6 A;  2YQZ A;  1G4A E;  5FLX S;  1OTR A;  3GQ4 A;  1VEG A;  4DV4 M;  2K9D A;  1MJG M;  1VQ1 A;  1GJT A;  2W82 A;  3B7Q A;  3T38 A;  1XMO M;  2Y0T A;  2F5Q A;  3HU3 A;  1PJS A;  5KPT A;  4FD2 A;  1Z5A A;  2FFJ A;  2AHM A;  2QPA A;  4GIP A;  1IN5 A;  4S12 A;  3TWM A;  2F5P A;  4DUY M;  2EKK A;  4XGI A;  2P5T A;  3T1Y M;  1ZV1 A;  3GPU A;  4LY6 A;  3V76 A;  4QOS A;  2KZU A;  3UZU A;  3HJS A;  1PJT A;  1R6B X;  1ZAE A;  1LV7 A;  2XF3 A;  3I51 A;  1KFV A;  1WIV A;  4IBB A;  4IBJ A;  4FWH A;  3U60 A;  3HGI A;  3M7G A;  4GC9 A;  2HWJ A;  2OQ4 A;  4LF6 M;  4L4U A;  3MJ5 A;  5ITU A;  4LRT A;  4JI2 M;  3KP0 E;  3U6E A;  3CF2 A;  2QCU A;  3IG5 A;  3Q8G A;  3KW6 A;  2VII A;  2DEN A;  2F4V M;  1DGF A;  1QVR A;  2R0I A;  4L6V 6;  4XBO A;  1IY2 A;  2RGH A;  1P3Q Q;  1A5T A;  1QAO A;  2OOB A;  3E4R A;  3ZC7 B;  1WGL A;  4R7G A;  1Z6T A;  2R62 A;  4DUZ M;  2CHQ A;  1TR8 A;  1NHW C;  4NL4 H;  3GLF E;  3GLG A;  4PDG A;  1W5S A;  3KS4 A;  1GL6 A;  2KDL A;  1RU3 A;  2Z3X A;  3BOS A;  5ITX A;  3SYK A;  5C18 A;  1AIP C;  2ZTC A;  3A46 A;  2CWB A;  3TL4 X;  1E32 A;  4HL4 A;  1PRB A;  4IBF A;  4WW0 A;  4DR6 M;  3UMM A;  4LF8 M;  2QEN A;  3VDP A;  3A42 A;  4WUR A;  1SXJ A;  1NY6 A;  4QOZ C;  4II7 A;  1NHG C;  1QDR A;  1G59 A;  4RKU F;  1DO2 A;  4IBD A;  3HWS A;  2R45 A;  5FTJ A;  4G4Q A;  1OJL A;  3LMM A;  4LGM A;  1Y8G A;  1ZMU A;  4AZF A;  3GLI E;  1L2B A;  2JY7 A;  3QYE A;  1QAQ A;  1SXJ D;  2LHG A;  5EXS A;  1E94 E;  1XB2 B;  4LFB M;  1DGH A;  1N33 M;  3IEC A;  4B3T M;  3GPX A;  4X66 M;  3FRH A;  2Z7J A;  2JZ1 A;  4GKK M;  1GJS A;  3U6O A;  3SC3 A;  3MMP A;  3W68 A;  4CHT B;  2OPF A;  2KRU A;  1Q3C A;  2L4F A;  3KSX A;  3U5Z B;  1T3T A;  2CHV A;  2CUZ A;  3J7B A;  1IXZ A;  3DFZ A;  4JV5 M;  1R5L A;  1GKI A;  4LZJ A;  4DR3 M;  3ZH9 B;  2N35 A;  3B89 A;  4L15 A;  1GVN A;  4MGH A;  4DV0 M;  1IN4 A;  1Z5C A;  3GLH B;  3L26 A;  3CF6 E;  1NY5 A;  1OQY A;  5EP4 A;  3RGS A;  2DNA A;  3FYC A;  2CHG A;  2DAI A;  3AOG A;  4IBI A;  4R71 A;  5KPR A;  3SBJ A;  3SMS A;  3C9P A;  5EXP A;  1V34 A;  3HHY A;  2DXI A;  4LJA A;  2D7G A;  1NJG A;  4LFC M;  5GKN A;  4CIS A;  2HL7 A;  3J81 S;  5IT9 S;  2FNA A;  4I81 A;  3U6M A;  3GLH A;  1PJQ A;  4GEW A;  4CIZ A;  2QBY A;  4IBC A;  2QP9 X;  2LTU A;  1JR3 D;  2R6F A;  3AOE A;  3LQQ A;  3K9O A;  3M6A A;  3K92 A;  4DV6 M;  2JXN A;  1ORY B;  1IN8 A;  4GKJ M;  2G3Q A;  2I7N A;  3U5Z A;  2EKF A;  2ZAO A;  1L2D A;  2F5O A;  1GO5 A;  4L78 A;  1PJJ A;  2EJS A;  2C99 A;  3H4J A;  1HQY E;  3HU2 A;  1GLN A;  2NQ8 C;  1DGH B;  2RRU A;  2VQF M;  1FJG M;  3A45 A;  1SXJ C;  1YE9 A;  1K3X A;  1NNU C;  1ZMV A;  3FKE A;  4NRV A;  3RE8 A;  1XHB A;  4ITQ A;  2R4E A;  4REZ A;  4NXM M;  1TTE A;  4Z6Y A;  3HU1 A;  2QQ8 A;  4B3M M;  3M0E A;  1Z59 A;  2LNH C;  2H5X A;  3J27 B;  2KRK A;  4GRI A;  1K3W A;  1N78 A;  3NWL A;  1N77 A;  3VFD A;  1AUA A;  1BVS A;  2LVP C;  2HHH M;  2EUC A;  3A98 B;  3L2A A;  2XFS A;  4L8R C;  4A3V B;  2KW0 A;  1SXJ E;  2QZ4 A;  1IN7 A;  3PNV A;  2QHO B;  4BBA A;  1Z5B A;  2J7O A;  2YFQ A;  1OIZ A;  2APL A;  1N75 A;  3U6P A;  1HNX M;  3FTD A;  4FCW A;  4WP2 A;  5JI3 E;  1VEK A;  5IRE B;  3EIH A;  5ITX E;  1G71 A;  3NBI A;  3HY5 A;  4F1I A;  4JYA M;  2DAE A;  2K0B X;  2VDB B;  3UJN A;  2MGW A;  2O25 A;  3RFW A;  2LVO C;  5L8R F;  1GL7 A;  2QNJ A;  3B9P A;  4KLN A;  2R18 A;  3OTO M;  3B7N A;  4YY3 M;  1J7K A;  4LF5 M;  2Q2E B;  2BJW A;  2M60 A;  2JUJ A;  3GRU A;  4KT0 F;  5EXT A;  3KOX E;  2CRU A;  3GRR A;  1HT1 E;  3IHP A;  2EO2 A;  3MK6 A;  4IBG A;  4LFA M;  4BB9 A;  5IZ7 D;  4LJ6 A;  1HNZ M;  4CGY B;  3E46 A;  3LVV A;  3AKZ A;  4M0D A;  2L7H A;  5EP2 A;  1MU5 A;  2O5R A;  2L7I A;  3EIE A;  1ZMW A;  3SAU A;  3GRV A;  2Y0Q A;  1ZQ9 A;  4LJ4 A;  3GLH E;  4FCV A;  3L28 A;  3GPY A;  4NRW A;  2CEA A;  4LGY A;  5EXX A;  2XFT A;  2Z4S A;  4GC5 A;  3ZQJ A;  5FTK A;  1V92 A;  1N34 M;  3AV0 A;  4OW0 A;  1Q02 A;  4TUW A;  2DAM A;  3GQ5 A;  3VLF B;  2CE7 A;  3TWK A;  2VF8 A;  3J2P B;  4IJF A;  3W0F A;  4DV3 M;  2VF7 A;  4JI3 M;  2JY8 A;  2ZBK B;  3I01 M;  4OVZ B;  4ANR A;  2F5S A;  3HHW A;  4B7F A;  2GQF A;  2L09 A;  2WSC F;  4LJ5 A;  4X65 M;  1N32 M;  2Z4R A;  4X64 M;  4X62 M;  4QNR A;  2BWB A;  2ZM6 M;  5ITQ A;  5LMN M;  1YLA A;  1YSY A;  3K9P A;  1QDT A;  3CGW A;  3FTE A;  1HT2 E;  1IXR C;  2FOI C;  1NV8 A;  2LBC A;  5H37 D;  4MGY E;  4HLQ A;  4W5W A;  3R8F A;  1HQC A;  2HKJ A;  2JZ0 A;  4RF1 A;  1TH3 A;  2JY6 B;  4GHA A;  3GP1 A;  1T6O A;  1VG5 A;  2LWX A;  2R4J A;  5JI2 E;  2CV1 A;  1OKS A;  2JNH A;  3LQR A;  2UU9 M;  3FTF A;  4GMQ A;  2KXE A;  2XSZ D;  1TGU A;  4F2L A;  1F4I A;  3PXG A;  2DWZ B;  4G4R A;  2RGO A;  4JI7 M;  2O01 F;  1TDH A;  3GPP A;  1L8Q A;  3FUX A;  3VKH A;  2DHY A;  2CV0 A;  1SG9 A;  3U6D A;  2C9O A;  2D7H A;  2FE8 A;  4I5S A;  2XSZ A;  3HHX A;  4G3O A;  3VK7 A;  3U61 A;  4P17 A;  5BPV A;  1KYI A;  2BJV A;  1VDD A;  2L6O A;  4B3S M;  4M9X A;  1IY0 A;  3GLF A;  3GLG E;  1JB0 F;  2DZO B;  2HCB A;  4PT5 A;  1EFU B;  4QHS A;  5KQD A;  4LF7 M;  2MRO B;  1IY1 A;  1QQW A;  2KHH A;  2KZS A;  2V1C A;  2Y20 A;  3QYB A;  2MR9 A;  4NC6 A;  5FTM A;  3FRI A;  1XC8 A;  3ZCB B;  3L29 A;  2QBY B;  2XZU A;  1NSF A;  3Q8X A;  5DYG A;  4DV7 M;  4MB7 A;  1FNN A;  5EP3 A;  2V6Z M;  4JI4 M;  5C1B A;  1JQJ C;  3HX3 A;  1OIP A;  2LHC A;  3THG A;  1UM8 A;  4D80 A;  1K82 A;  3T1H M;  4B7H A;  3KS8 A;  2DZN B;  3KP1 E;  3KDS E;  3FTC A;  2BWE A;  1E9S A;  5ITY A;  4JN6 A;  4YHH M;  1OAO C;  3J80 S;  5IWA M;  4DV5 M;  3GLI A;  2ERC A;  3SMP A;  5ITT A;  4FVM A;  3HJ8 A;  3GO8 A;  2JA2 A;  2RKO A;  1XWI A;  3H4M A;  3FE3 A;  3FUT A;  4FWG A;  4LZZ A;  1WHC A;  2Z8Y M;  3HKP A;  3LCV B;  4M0W A;  4MH0 E;  1IQP A;  2QSF X;  4DR7 M;  2ZTD A;  1L1T A;  4PCZ A;  1IBL M;  2FS1 A;  4MGK E;  3WHK A;  2UUA M;  1I94 M;  4XK8 F;  2R65 A;  2L4E A;  5DNY A;  3ILK A;  3C58 A;  4FWD A;  1I4W A;  3JAM S;  4HEO A;  3AFH A;  2X8A A;  3AOE C;  1JR3 E;  3D8L A;  1R2Z A;  4JXJ A;  2DWL A;  2KEB A;  4B7G A;  1NJF A;  3LCU A;  1YUB A;  3UGJ A;  2YNM D;  2DKL A;  3FYD A;  3TPZ A;  3FUW A;  3LW5 F;  1J5E M;  2FH0 A;  4D82 A;  1HNW M;  1OFH A;  5BR8 M;  3PFI A;  5FSW A;  3T6P A;  4ZPX A;  1R7R A;  4QHT A;  2CP8 A;  3TWL A;  3U6Q A;  1UFZ A;  4MGI E;  3U61 B;  1IBM M;  2C98 A;  3FUV A;  1J09 A;  1OAI A;  3QWL A;  1T43 A;  2E5L M;  3F92 A;  3BBZ A; 
#chains in the Genus database with same CATH homology
 1L2C A;  3GLG B;  3PNY A;  5EJC A;  4NSO B;  1NVM A;  3KFU G;  3SAT A;  3U6L A;  2YR0 A;  3K2L A;  3DZD A;  2H1R A;  2DHR A;  2X49 A;  2ZAN A;  2XEP A;  1QYR A;  4G6Z A;  1IN6 A;  4JI6 M;  2V1U A;  3K8Z A;  4OU7 A;  4DR2 M;  3U60 B;  4NOO B;  4KHP M;  2DWN A;  4IBE A;  5A2Q S;  2VQE M;  4R3D A;  5LMU M;  2UXD M;  3VK8 A;  1C1K A;  1MX0 A;  3I4Y A;  3WHL A;  1DGG A;  2DVW B;  1TDZ A;  4JI1 M;  3CTW B;  3HJQ A;  3SAR A;  3DOA A;  1IXS B;  1HR0 M;  2UXC M;  4OVZ A;  3VDU A;  5FTL A;  5F3W A;  3FD9 A;  4G4O A;  4KO8 A;  4DV2 M;  5E26 A;  3KVW A;  4AKG A;  1G3I A;  3L27 A;  5KPZ A;  2BNK A;  4DR5 M;  4AKI A;  3CF0 A;  1IM2 A;  4K0K M;  7CAT A;  4AW4 A;  1XXH A;  3SFZ A;  4P16 A;  2X4A A;  4RNA A;  4G4N A;  3E9S A;  3KOW E;  2CFO A;  4MGZ E;  1N36 M;  2F5N A;  2D7E A;  3AJI B;  5DYI A;  2LH0 A;  4AQY M;  2C5R A;  2M5Z A;  2ZAM A;  3GQ3 A;  1S3S A;  1JR3 A;  3JR4 A;  1PJI A;  1TH2 A;  3GLI B;  5KO3 A;  1OFI A;  3SYL A;  5E6J A;  3MHV C;  1XMQ M;  2EA0 A;  3J7A S;  4JI0 M;  2A5Y B;  1QAM A;  3KOY E;  5EP1 A;  2C9C A;  4GH9 A;  3KXE C;  3W0L B;  3SHF A;  3SAS A;  4QNM A;  4Z8X A;  4NSR A;  4DV1 M;  2XGN A;  4IJE A;  4AG6 A;  4PDI A;  2UUB M;  4GHL A;  4B08 A;  4AKH A;  1H6U A;  1XXH B;  2UXB M;  1R2Y A;  1NNJ A;  4D81 A;  4RF0 A;  4AI6 A;  3UK6 A;  4L16 A;  2UUC M;  3SAW A;  4I4L A;  4LJ9 A;  1Q39 A;  4AG5 A;  2DWM A;  4JI8 M;  1E9R A;  3PVS A;  4PD2 A;  4LRS A;  4EIW A;  3HHZ A;  3LVW A;  2G5G X;  2KA6 B;  4GIT A;  1WXQ A;  4BLC A;  1SXJ B;  1QAN A;  2XLJ A;  3GLF B;  3I4V A;  1PM5 A;  1L1Z A;  1X37 A;  3DA1 A;  1DGB A;  1EE8 A;  3K1J A;  1DO0 A;  4IBK A;  3TQS A;  5KQ8 A;  1XNQ M;  2J7N A;  4FCT A;  3KOZ E;  3SAV A;  3VKG A;  1Q3B A;  8CAT A;  1QZM A;  4LF4 M;  3R9X B;  3L25 A;  4M9Z A;  4LJ7 A;  2G8L A;  3QAU A;  4DR1 M;  4IIW A;  2K47 A;  4M9S A;  3JR5 A;  2XH9 A;  1G8P A;  2C96 A;  1IBK M;  5FTN A;  4JI5 M;  1XNR M;  3AL0 C;  4LG2 A;  3GRY A;  2I7P A;  4LCB A;  4LF9 M;  4KOD A;  3IG8 A;  3SHG B;  5ITR A;  3U6S A;  3RGP A;  4I8O A;  2CV2 A;  3KSJ A;  2XZF A;  4B3R M;  1D2N A;  4MM3 B;  2R46 A;  4LJ8 A;  4NXN M;  3U6C A;  4FW9 A;  5EQT A;  3D8B A;  1G41 A;  2Y21 A;  1W5T A;  1KSF X;  4OX9 M;  1TH4 A;  3FUU A;  2LXE A;  4DR4 M;  3T15 A;  3TE6 A;  2YQZ A;  1G4A E;  5FLX S;  3GQ4 A;  4DV4 M;  2W82 A;  3T38 A;  1XMO M;  2Y0T A;  2F5Q A;  3HU3 A;  5KPT A;  4FD2 A;  1Z5A A;  2FFJ A;  2AHM A;  2QPA A;  4GIP A;  1IN5 A;  4S12 A;  3TWM A;  2F5P A;  4DUY M;  4XGI A;  2P5T A;  3T1Y M;  3GPU A;  4LY6 A;  4QOS A;  2KZU A;  3UZU A;  3HJS A;  1R6B X;  1ZAE A;  1LV7 A;  2XF3 A;  3I51 A;  1KFV A;  4IBB A;  4IBJ A;  4FWH A;  3U60 A;  3HGI A;  3M7G A;  4GC9 A;  2OQ4 A;  4LF6 M;  4L4U A;  3MJ5 A;  5ITU A;  4LRT A;  4JI2 M;  3KP0 E;  3U6E A;  3CF2 A;  2QCU A;  3IG5 A;  3KW6 A;  2VII A;  2F4V M;  1DGF A;  1QVR A;  4XBO A;  1IY2 A;  2RGH A;  3ZC7 B;  1QAO A;  3E4R A;  4R7G A;  1Z6T A;  2R62 A;  4DUZ M;  2CHQ A;  1NHW C;  4NL4 H;  3GLG A;  4PDG A;  1W5S A;  3KS4 A;  1GL6 A;  2Z3X A;  3BOS A;  5ITX A;  3SYK A;  5C18 A;  3A46 A;  3TL4 X;  1E32 A;  4HL4 A;  4IBF A;  4WW0 A;  4DR6 M;  3UMM A;  4LF8 M;  2QEN A;  3VDP A;  3A42 A;  4WUR A;  1SXJ A;  1NY6 A;  4QOZ C;  4II7 A;  1NHG C;  1G59 A;  1DO2 A;  4IBD A;  3HWS A;  2R45 A;  5FTJ A;  4G4Q A;  1OJL A;  3LMM A;  4LGM A;  4AZF A;  1L2B A;  2E5L M;  1QAQ A;  1SXJ D;  5EXS A;  1E94 E;  4LFB M;  1DGH A;  1N33 M;  4B3T M;  3GPX A;  4X66 M;  2Z7J A;  4GKK M;  3U6O A;  3SC3 A;  2OPF A;  4CHT B;  2KRU A;  1Q3C A;  3KSX A;  3U5Z B;  1T3T A;  2CHV A;  2CUZ A;  3J7B A;  1IXZ A;  3DFZ A;  4JV5 M;  1GKI A;  4LZJ A;  4DR3 M;  3ZH9 B;  4L15 A;  1GVN A;  4MGH A;  4DV0 M;  1IN4 A;  1Z5C A;  3GLH B;  3L26 A;  3CF6 E;  1NY5 A;  5EP4 A;  3RGS A;  3FYC A;  4IBI A;  2CHG A;  3AOG A;  5KPR A;  3SBJ A;  3SMS A;  5EXP A;  3HHY A;  2DXI A;  4LJA A;  2D7G A;  1NJG A;  4LFC M;  5GKN A;  4CIS A;  2HL7 A;  3J81 S;  5IT9 S;  2FNA A;  4I81 A;  3U6M A;  3GLH A;  2QBY A;  4IBC A;  2QP9 X;  1JR3 D;  3AOE A;  3M6A A;  3LQQ A;  3K92 A;  4DV6 M;  1ORY B;  1IN8 A;  4GKJ M;  2I7N A;  3U5Z A;  2F5O A;  2ZAO A;  1L2D A;  4L78 A;  1PJJ A;  2C99 A;  1HQY E;  3HU2 A;  1GLN A;  2NQ8 C;  1DGH B;  2VQF M;  1FJG M;  3A45 A;  1SXJ C;  1YE9 A;  1K3X A;  1NNU C;  3FKE A;  4NRV A;  3RE8 A;  1XHB A;  4ITQ A;  2R4E A;  4REZ A;  4NXM M;  4Z6Y A;  3HU1 A;  4B3M M;  3M0E A;  1Z59 A;  2LNH C;  3J27 B;  2KRK A;  4GRI A;  1K3W A;  1N78 A;  3NWL A;  1N77 A;  3VFD A;  2HHH M;  2EUC A;  3A98 B;  3L2A A;  2XFS A;  4L8R C;  4A3V B;  2KW0 A;  1SXJ E;  2QZ4 A;  1IN7 A;  3PNV A;  4BBA A;  1Z5B A;  2J7O A;  2YFQ A;  1N75 A;  3U6P A;  1HNX M;  3FTD A;  4FCW A;  5JI3 E;  5IRE B;  5ITX E;  3EIH A;  3NBI A;  4JYA M;  3UJN A;  3RFW A;  1GL7 A;  3B9P A;  4KLN A;  2R18 A;  3OTO M;  4YY3 M;  1J7K A;  4LF5 M;  2BJW A;  2M60 A;  2Q2E B;  3GRU A;  5EXT A;  3KOX E;  3GRR A;  1HT1 E;  2EO2 A;  3MK6 A;  4IBG A;  4LFA M;  4BB9 A;  5IZ7 D;  4LJ6 A;  1HNZ M;  4CGY B;  3LVV A;  3AKZ A;  4M0D A;  2L7H A;  5EP2 A;  1MU5 A;  2O5R A;  2L7I A;  3EIE A;  3SAU A;  3GRV A;  2Y0Q A;  1ZQ9 A;  4LJ4 A;  4FCV A;  3L28 A;  3GPY A;  4NRW A;  2CEA A;  4LGY A;  5EXX A;  2XFT A;  2Z4S A;  4GC5 A;  5FTK A;  1N34 M;  3AV0 A;  4OW0 A;  4TUW A;  3GQ5 A;  3VLF B;  2CE7 A;  3TWK A;  3J2P B;  4IJF A;  3W0F A;  4DV3 M;  4JI3 M;  4OVZ B;  2ZBK B;  2F5S A;  3HHW A;  4B7F A;  2L09 A;  4LJ5 A;  4X65 M;  1N32 M;  2Z4R A;  4X64 M;  4X62 M;  4QNR A;  2ZM6 M;  5ITQ A;  5LMN M;  1YSY A;  3FTE A;  1HT2 E;  1IXR C;  2FOI C;  5H37 D;  4MGY E;  4HLQ A;  4W5W A;  3R8F A;  1HQC A;  2HKJ A;  4RF1 A;  4GHA A;  1TH3 A;  3GP1 A;  2R4J A;  2LWX A;  5JI2 E;  2CV1 A;  3LQR A;  2UU9 M;  3FTF A;  4GMQ A;  2KXE A;  2XSZ D;  1TGU A;  3PXG A;  2DWZ B;  4G4R A;  2RGO A;  4JI7 M;  1TDH A;  3GPP A;  1L8Q A;  3FUX A;  3VKH A;  2CV0 A;  3U6D A;  2C9O A;  2D7H A;  2FE8 A;  4I5S A;  2XSZ A;  3HHX A;  3VK7 A;  3U61 A;  5BPV A;  1KYI A;  2BJV A;  1VDD A;  2L6O A;  4B3S M;  4M9X A;  1IY0 A;  3GLF A;  2DZO B;  2HCB A;  4PT5 A;  4QHS A;  5KQD A;  4LF7 M;  1IY1 A;  1QQW A;  2KZS A;  2V1C A;  2Y20 A;  5FTM A;  1XC8 A;  3ZCB B;  3L29 A;  2QBY B;  2XZU A;  1NSF A;  3Q8X A;  5DYG A;  4DV7 M;  4MB7 A;  1FNN A;  5EP3 A;  2V6Z M;  4JI4 M;  5C1B A;  1JQJ C;  3THG A;  1UM8 A;  4D80 A;  1K82 A;  3T1H M;  4B7H A;  2DZN B;  3KP1 E;  3KDS E;  3FTC A;  1E9S A;  5ITY A;  4JN6 A;  4YHH M;  3J80 S;  5IWA M;  4DV5 M;  3GLI A;  2ERC A;  3SMP A;  5ITT A;  4FVM A;  3HJ8 A;  3GO8 A;  2JA2 A;  2RKO A;  1XWI A;  3H4M A;  3FUT A;  4FWG A;  4LZZ A;  3HKP A;  4M0W A;  4MH0 E;  1IQP A;  4DR7 M;  1L1T A;  1IBL M;  4PCZ A;  4MGK E;  3WHK A;  2UUA M;  1I94 M;  2R65 A;  5DNY A;  3ILK A;  3C58 A;  4FWD A;  1I4W A;  3JAM S;  3AFH A;  2X8A A;  3AOE C;  3D8L A;  1R2Z A;  4JXJ A;  2DWL A;  2KEB A;  4B7G A;  1NJF A;  1YUB A;  3UGJ A;  2YNM D;  3FYD A;  3TPZ A;  3FUW A;  1J5E M;  4D82 A;  1HNW M;  1OFH A;  5BR8 M;  3PFI A;  5FSW A;  4ZPX A;  1R7R A;  4QHT A;  3U6Q A;  3TWL A;  1IBM M;  4MGI E;  3U61 B;  2C98 A;  3FUV A;  1J09 A;  3QWL A;  3KS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...