4LFAM

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lfaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lfaM02
3GQ4A 4GKJM 2ZBKB 1L1ZA 4DR2M 1I94M 5LMUM 2HKJA 4X66M 3J80S 3OTOM 3SAWA 2XZUA 3GQ5A 1XNQM 2UUBM 1HNWM 1Z5BA 2XZFA 4DUYM 1MU5A 1L2BA 1Q39A 4X65M 3U6OA 1HNZM 3GPYA 1N33M 5IWAM 3J81S 4DR7M 3TWKA 2UXBM 4DV5M 4NXMM 1R2ZA 3VK8A 4JYAM 1L2DA 3U6CA 2EA0A 1HR0M 3T1HM 3JR4A 4LF9M 1J5EM 4X64M 5ITTA 2F5OA 1K82A 4DV4M 1IBKM 2ZM6M 3SAVA 3U6LA 3A46A 2F5NA 4LF7M 4DR1M 3VK7A 4JI7M 5A2QS 4K0KM 1HNXM 2UUCM 2OQ4A 1TDHA 4DV6M 2UXDM 4LFBM 2UXCM 2UUAM 4KHPM 4PDGA 4B3RM 3J7AS 3U6MA 1N32M 1R2YA 2OPFA 5ITQA 4LF6M 4DR4M 4G4NA 5ITXE 4LF8M 1IBMM 4JV5M 4X62M 2VQFM 1Q3BA 3U6EA 4G4OA 2F5PA 1XC8A 1PJIA 4DV2M 3GPXA 4OX9M 1Z5CA 4PDIA 1N36M 2VQEM 1NNJA 4JI3M 4JI4M 3SASA 4B3MM 4LFCM 5ITYA 4MB7A 4NRVA 2UU9M 3U6PA 4DV3M 5ITRA 4JI1M 3SARA 3U6QA 4DV0M 1K3WA 3JAMS 3GP1A 4JI2M 1XMOM 5LMNM 3SAUA 2F5QA 4LFAM 3C58A 3W0FA 1PJJA 5ITUA 4DR3M 4JI0M 1Z5AA 4PCZA 2Q2EB 4JI6M 4B3SM 1Z59A 1K3XA 1XNRM 4B3TM 2HHHM 4NXNM 3A42A 4LF4M 1Q3CA 5FLXS 4DR5M 1KFVA 4JI8M 4DV7M 5BR8M 3GO8A 3U6SA 1FJGM 4NRWA 3GQ3A 1N34M 3GPPA 1L1TA 3DOAA 3U6DA 4LF5M 1TDZA 3T1YM 4DUZM 3SBJA 3TWMA 3JR5A 4GKKM 4JI5M 1IBLM 4DR6M 1MX0A 3TWLA 4DV1M 1EE8A 4CISA 4YHHM 5ITXA 4AQYM 4ITQA 1L2CA 3A45A 4PD2A 2F5SA 2F4VM 5IT9S 4G4QA 1XMQM 3GPUA 3SATA 4YY3M 4G4RA 1PM5A 2E5LM
chains in the Genus database with same CATH superfamily
1XWIA 2KZUA 3FRIA 2VIIA 3I4YA 5EXPA 2ZBKB 3L29A 4WURA 4L6V6 2ERCA 3AOEC 4AW4A 8CATA 2HL7A 2KW0A 1DGHB 1Y8GA 4CGYB 2Y20A 5KO3A 3GLFE 1D2NA 1UM8A 1YLAA 3CF6E 3HY5A 3IG8A 3K92A 4GMQA 1MJGM 4L78A 1XXHE 3KFUG 4UN2B 4NXMM 3VK8A 1VQ1A 2DAIA 3KXEC 3QAUA 4WP2A 4QOSA 1EFUB 1HT2E 3T1HM 4LF9M 3KS8A 1KSFX 1J5EM 2MROB 2DVWB 3PFIA 4CJ6A 3UJNA 2P5TA 2MH8A 5EXTA 1OIZA 3A98B 4Q7JA 2XSZD 3R9XB 3BBZA 2QSFX 2EO2A 4Z6YA 3VK7A 4GC9A 2XLJA 1WGNA 1GL6A 4EIWA 1DO2A 1T3TA 3B9PA 4DV6M 1NSFA 2QHOB 4BB9A 4KHPM 1N32M 3UGJA 1HQYE 1R2YA 3L26A 3GLHE 1OFHA 2KNAA 4IBBA 2G3QA 2DI0A 4TUWA 2KRUA 4XBOA 1KYIA 4I5SA 3VDUA 2EUCA 3U6EA 2QBYA 2O25A 3GPXA 2KZSA 3TQSA 3VKHA 3UMMA 4Y28F 3R8FA 1E9RA 2L6OA 1AUAA 5IZ7D 2KNVA 4ANRA 4LJ4A 3FE3A 3GRVA 4NSRA 3AOEA 4QHTA 3GRYA 3DFZA 5JI2E 4DV3M 5ITRA 3SARA 1ZMVA 3CF2A 4AKIA 1J7KA 1K3WA 1G71A 4XK8F 3I51A 2Z8YM 4GH9A 3SMSA 5LMNM 3SAUA 3FUTA 3KS4A 3LQQA 1TH2A 1DGBA 1GLNA 1OKSA 2MR9A 4LRTA 1IXZA 2R18A 4II7A 4PCZA 4JI6M 4B3SM 3TE6A 4AZFA 5EJCA 3J2PB 2Z7JA 4OU7A 5DYIA 2KA6B 3SC3A 5KPRA 1KFVA 2C98A 4DV7M 3ILKA 2KNZA 4A3VB 1G8PA 2GQFA 2LHCA 2LXEA 1FJGM 4LY6A 4L15A 3PVSA 3Q8GA 2M5ZA 1GL7A 1XHBA 2DAEA 3K2LA 3K9OA 3U6DA 4M0DA 3SMPA 2XSZA 1TF0B 3GLFA 3T1YM 2XFTA 2R0IA 3SYKA 4JI5M 4FCTA 1XXHA 4DR6M 1MX0A 3FYCA 5EXXA 4DV1M 1H6UA 2G8LA 2XFSA 2DWMA 5KPTA 1L2CA 3A45A 4IIWA 5DFLA 5FSWA 3ZCBB 2R44A 4MM3B 1QAQA 4RF0A 2XH9A 2AHMA 5H37D 1NHGC 1P3QQ 2C96A 3Q8XA 2XZUA 2H1RA 3E21A 3J80S 3OTOM 4LG2A 3GLIE 1WXQA 1XNQM 1QUTA 4AI6A 4QOZC 2R65A 3KOYE 1HNWM 2XZFA 4DUYM 1G3IA 1MU5A 4FWGA 4M9XA 4X65M 2BWBA 4NL4H 1DV0A 1NHWC 3AJIB 3H4MA 3K9PA 3W0LB 3J81S 4DR7M 3TWKA 4DV5M 3HU2A 1HQCA 2LNHC 3U60B 3GRRA 4BBAA 4NSOB 3CF0A 3E4RA 4IBKA 2EA0A 2GNOA 4GC5A 1HR0M 3JR4A 4IBIA 4D81A 3B7NA 1YUBA 4X64M 1VEGA 1TGUA 3MMPA 1PJTA 2QP9X 4DV4M 3GLGB 4FVMA 1NY5A 1RU3A 1R7RA 3GRUA 1NNUC 4XGIA 1BVSA 4GEWA 4AG5A 4K0KM 2QQ8A 1HNXM 1I4WA 1NY6A 4BLCA 2OQ4A 1DGFA 2UXDM 4B7FA 4MGYE 1X37A 4LJAA 2JY8A 2UUAM 5DNYA 3KVWA 4PDGA 3U61A 3J7AS 3U6MA 1OQYA 3KSXA 4OVZA 4IBFA 2OPFA 4LF6M 1VEJA 4LF8M 1IXSB 4IBCA 3BXWA 3EIHA 1QZMA 5E6JA 2OO9A 4IJFA 4G4OA 2VDBB 1XC8A 2F5PA 1QAOA 2BWEA 4DV2M 4OX9M 1Z5CA 3HU3A 1L8QA 4PDIA 2CWBA 2R62A 3V76A 1N36M 3DA1A 2LVNC 1NNJA 3K8ZA 2MGWA 5KQDA 1OIPA 3SASA 1IN8A 1SXJE 4R3DA 4B3MM 4LFCM 4ZPXA 4I4LA 5E26A 5ITYA 1GVNA 2JY6B 4L4UA 2V1UA 1W5TA 3BOSA 3U6QA 2YR0A 3E46A 4DV0M 1G4AE 4JI2M 3B89A 3KDSE 4GHAA 3KW6A 1QZEA 2F5QA 1ZMWA 1NO1A 3F92A 2LHGA 1DGGA 2HCBA 2RGHA 2KXEA 3DZDA 1PJJA 1NJFA 3NBXX 4JI0M 4GHLA 4IBGA 4KT0F 1SXJD 1WR1B 2Q2EB 1Z59A 2YFQA 1XNRM 4IBJA 1W5SA 2L7HA 2HHHM 3A42A 3GLFB 2FNAA 2QZ4A 4KODA 3RE8A 3VDPA 3NBIA 3AKZA 1XXHB 3FD9A 4GIPA 5BR8M 2FE8A 1SXJC 2LVAA 3I04M 3M0EA 3UZUA 1YE9A 3FTEA 3GLIA 2CRUA 2JZ0A 3GQ3A 3HWSA 7CATA 1L1TA 1ZAEA 1OAOC 1WJ7A 2OOBA 4NOOB 4LF5M 3IG5A 4LCBA 3RFWA 1TR8A 2BJWA 2EKKA 4I8OA 3T15A 3QYEA 4DUZM 3WHKA 3JR5A 3QWLA 5L8RF 3T6PA 2ZAMA 3VLFB 1E94E 2X49A 3TL4X 2YNMD 3TWLA 4P16A 4W5WA 1IBLM 4MH0E 5FTMA 5ITXA 1NV9A 2BNKA 4LJ9A 1OJLA 4FCVA 2Y0TA 3FRHA 1FNNA 1DGHA 4G4QA 3U5ZA 2KDLA 2O5RA 3AL0C 4YY3M 3HHYA 3MK6A 2UXBM 4AKGA 3MHVC 1QUSA 5FTLA 4GKJM 1I94M 5FTNA 2DZLA 2DAKA 3FKEA 4IJEA 5LMUM 3SAWA 1LV7A 3GLHB 3GQ5A 1GKIA 2UUBM 4Z8XA 4D80A 2CEAA 3AFHA 4G6ZA 2JP7A 3HKPA 2WSFF 3U6OA 1WHCA 3GPYA 2DZOB 2NQ8C 1N33M 2DNAA 3VFDA 4QNMA 1VDDA 3MJ5A 1CUKA 4LGMA 2JWSA 1IM2A 1L2DA 2CP8A 3I01M 3PXGA 4B7GA 3EIEA 3HJ8A 2ZTCA 2VF7A 3FTFA 1C1KA 5EP4A 2F5OA 3I4VA 1K82A 1N78A 2CV0A 2ZM6M 1Q02A 2N35A 2YQZA 1IXRC 3VKGA 3HGIA 3UK6A 3HHXA 3A46A 2F5NA 3LQRA 2MJ5B 1SXJA 3LMMA 5A2QS 1GJSA 1D0LA 2DWNA 3C9PA 3HJQA 2UUCM 1TDHA 2J5YA 3M7GA 2W82A 1C7YA 1GABA 1PJSA 4LFBM 2UXCM 3IHPA 1DO0A 4B3RM 2FH0A 2KHHA 2Z4SA 4M9SA 5F3WA 4L16A 3L28A 4G4NA 5ITXE 1IBMM 2LWXA 4JV5M 3SYLA 3D8BA 4RF1A 4JXJA 1JR3E 2DAMA 2R6FA 3B7ZA 2VQEM 1F4IA 3C3EA 4OW0A 1MN3A 2XEPA 3SHFA 4JI4M 3KOXE 2LVQD 4IBEA 2JY7A 2EJSA 4MB7A 4NRVA 3L25A 1WGLA 5C1BA 3U6PA 1R6BX 1VEKA 2QCUA 2WSEF 2ZANA 2Y21A 2QBYB 2FFJA 4JI1M 2B3TA 2CUZA 4QHSA 3J7BA 1JR3D 4JN6A 2LBCA 1IN4A 1QANA 1T6OA 3SHGB 4B7HA 3C58A 1YSYA 2K47A 5ITUA 3GLIB 2CFOA 2RGOA 2QNJA 3B7QA 2CV2A 4AKHA 2WSCF 3C3DA 3LVWA 1IN5A 3CTWB 3J27B 1G41A 1T43A 2WZJA 4LF4M 5IREB 3LVVA 1Q3CA 1TTEA 5FLXS 1G59A 4R7GA 5EQTA 4REZA 1VG5A 2LTUA 4CIZA 2D7HA 2QENA 1ZMUA 2C99A 2L2DA 2Z4RA 2C9OA 2I7PA 3FTCA 4MGIE 3W67A 3ZH9B 3GO8A 3U6SA 2DZNB 4NRWA 3E9SA 4MGHA 1AIPC 3RGSA 4PT5A 3U5ZB 2DWZB 2JA2A 1QVRA 4HL4A 1IY2A 4LZJA 1A5TA 3TWMA 4GKKM 3FUUA 1R5LA 1EE8A 1EIJA 2HAKA 4KO8A 4ITQA 4WW0A 1QAMA 1LTMA 2F4VM 5IT9S 3HHWA 3RGPA 2R46A 3GPUA 4I81A 1PJQA 1XMQM 3SATA 4G4RA 1PM5A 2E5LM 4HEOA 3K1JA 3GQ4A 4DBGB 4DR2M 1L1ZA 2HKJA 1V34A 4X66M 3FUWA 3U60A 2LH0A 1Z6TA 3CGWA 5KPZA 1JQJC 1ORYB 1Z5BA 2JUJA 1L2BA 1Q39A 4L8RC 1S3SA 3HJSA 1HNZM 3M6AA 4FWHA 3KSJA 2X4AA 4MGKE 2CHGA 5IWAM 3AOGA 2L09A 1OAIA 2X8AA 3GLGA 1R2ZA 4LJ7A 4JYAM 2FOIC 1GO5A 3HHZA 1IFYA 1SXJB 3U6CA 1SG9A 1ZV1A 4F1IA 3L2AA 4GITA 2LVPC 3WHLA 5ITTA 1ZQ9A 4D82A 4HLQA 1JR3A 1QDTA 4CHTB 1IBKM 1IY0A 1IN6A 2XF3A 3SAVA 3U6LA 1NJGA 4LJ6A 1OFIA 1QQWA 2D7GA 2DAGA 2DKLA 4F2LA 5BPVA 1IN7A 4LF7M 2I7NA 4DR1M 3KOZE 1IXSA 2OOAA 5FTKA 4JI7M 2DWLA 3T38A 1OTRA 4LGYA 4R71A 4M9ZA 4FWDA 2EKFA 5KQ8A 5EXSA 3B74A 5EP1A 2R4JA 3AV0A 3FUVA 5ITQA 2O01F 4IBDA 3FTDA 2JY5A 2G5GX 4DR4M 2L4FA 2Y0QA 1TH3A 2ZTDA 4LRSA 4X62M 1TH4A 2VQFM 1D0MA 1Q3BA 3PNVA 2R45A 1PJIA 2H5XA 1E9SA 1N75A 1XB2B 4GRIA 3W68A 1HJPA 4JI3M 3HX3A 2K9DA 3U61B 5C18A 4OVZB 2XGNA 1R4GA 4LZZA 2RRUA 2UU9M 4G3OA 3H4JA 3HU1A 3LCVB 1JB0F 4QNRA 4RNAA 2J7OA 3JAMS 1N77A 2Z3XA 5EP3A 3ZC7B 3GP1A 2DXIA 3L27A 1XMOM 1QYRA 1UFZA 4S12A 4LJ5A 2QPAA 4LFAM 3GLGE 1VDLA 3W0FA 1QDRA 1GJTA 2CHQA 3HZJA 4FCWA 3THGA 2APLA 4DR3M 1IY1A 2JZ1A 2V6ZM 1Z5AA 2JXNA 3LCUA 4FD2A 2CHVA 3TPZA 1K3XA 4M0WA 2LVOC 3PNYA 4B3TM 1IQPA 2DHYA 2C5RA 4NXNM 1HT1E 5DYGA 2KEBA 2D7EA 2BJVA 1WIVA 4DR5M 3KP1E 4JI8M 5EP2A 2C9CA 1E32A 1NVMA 3LW5F 4P17A 2DHRA 2DENA 1PRBA 1J09A 1N34M 2V1CA 2KRKA 2VF8A 3GPPA 2L4EA 2JNHA 2CV1A 1V92A 1D0KA 3ZQJA 2HWJA 4FW9A 3IECA 3FUXA 5JI3E 3DOAA 1V33A 2FS1A 3D8LA 1TDZA 5GKNA 5FTJA 4B08A 2J7NA 2ZAOA 3KP0E 4LJ8A 3SBJA 2M60A 4RKUF 4NC6A 2K6BA 3KOWE 2R4EA 3NWLA 4AG6A 3GLHA 1NV8A 4CISA 2CE7A 4YHHM 2K0BX 4KLNA 4AQYM 4MGZE 1PGYA 2L7IA 2RKOA 3FYDA 3QYBA 4PD2A 2F5SA 3SFZA 2A5YB
chains in the Genus database with same CATH topology
1XWIA 2KZUA 5EXPA 2VIIA 3I4YA 2ZBKB 3L29A 4WURA 2ERCA 3AOEC 4AW4A 8CATA 2HL7A 2KW0A 1DGHB 4CGYB 2Y20A 5KO3A 1D2NA 1UM8A 3CF6E 3IG8A 3K92A 4GMQA 4L78A 3KFUG 4NXMM 3VK8A 3KXEC 3QAUA 4QOSA 1HT2E 3T1HM 4LF9M 3KS8A 1KSFX 1J5EM 2DVWB 3PFIA 3UJNA 2P5TA 5EXTA 3A98B 2XSZD 3R9XB 2EO2A 4Z6YA 3VK7A 4GC9A 2XLJA 1GL6A 4EIWA 1DO2A 1T3TA 3B9PA 4DV6M 1NSFA 4BB9A 4KHPM 1N32M 3UGJA 1HQYE 1R2YA 3L26A 1OFHA 4IBBA 4TUWA 2KRUA 4XBOA 1KYIA 4I5SA 3VDUA 2EUCA 3U6EA 2QBYA 3GPXA 2KZSA 3TQSA 3VKHA 3UMMA 3R8FA 1E9RA 2L6OA 5IZ7D 4LJ4A 3GRVA 4NSRA 3AOEA 4QHTA 3GRYA 3DFZA 5JI2E 4DV3M 5ITRA 3SARA 4AKIA 3CF2A 1J7KA 1K3WA 3I51A 4GH9A 3SMSA 5LMNM 3SAUA 3FUTA 3KS4A 3LQQA 1TH2A 1DGBA 1GLNA 4LRTA 1IXZA 2R18A 4II7A 4PCZA 4JI6M 4B3SM 3TE6A 4AZFA 5EJCA 3J2PB 2Z7JA 4OU7A 5DYIA 2KA6B 3SC3A 5KPRA 1KFVA 2C98A 4DV7M 3ILKA 4A3VB 1G8PA 2LXEA 1FJGM 4LY6A 4L15A 3PVSA 2M5ZA 1GL7A 1XHBA 3K2LA 3U6DA 4M0DA 3SMPA 2XSZA 3GLFA 3T1YM 2XFTA 3SYKA 4JI5M 4FCTA 1XXHA 4DR6M 1MX0A 3FYCA 5EXXA 4DV1M 1H6UA 2G8LA 2XFSA 2DWMA 5KPTA 1L2CA 3A45A 4IIWA 5FSWA 3ZCBB 4MM3B 1QAQA 4RF0A 2XH9A 2AHMA 5H37D 1NHGC 2C96A 3Q8XA 2XZUA 2H1RA 3J80S 3OTOM 4LG2A 1WXQA 1XNQM 4AI6A 4QOZC 2R65A 3KOYE 1HNWM 2XZFA 4DUYM 1G3IA 1MU5A 4FWGA 4M9XA 4X65M 4NL4H 1NHWC 3AJIB 3H4MA 3W0LB 3J81S 4DR7M 3TWKA 4DV5M 3HU2A 1HQCA 2LNHC 3U60B 3GRRA 4BBAA 4NSOB 3CF0A 3E4RA 4IBKA 2EA0A 4GC5A 1HR0M 3JR4A 4IBIA 4D81A 1YUBA 4X64M 1TGUA 2QP9X 4DV4M 3GLGB 4FVMA 1NY5A 1R7RA 3GRUA 1NNUC 4XGIA 4AG5A 4K0KM 1HNXM 1I4WA 1NY6A 4BLCA 2OQ4A 1DGFA 2UXDM 4B7FA 4MGYE 1X37A 4LJAA 2UUAM 5DNYA 3KVWA 4PDGA 3U61A 3J7AS 3U6MA 3KSXA 4OVZA 4IBFA 2OPFA 4LF6M 4LF8M 1IXSB 4IBCA 3EIHA 1QZMA 5E6JA 4IJFA 4G4OA 2F5PA 1XC8A 1QAOA 4DV2M 4OX9M 1Z5CA 3HU3A 1L8QA 4PDIA 1N36M 2R62A 3DA1A 1NNJA 3K8ZA 5KQDA 3SASA 1IN8A 1SXJE 4R3DA 4B3MM 4LFCM 4ZPXA 4I4LA 5E26A 5ITYA 1GVNA 4L4UA 2V1UA 1W5TA 3BOSA 3U6QA 2YR0A 4DV0M 1G4AE 4JI2M 4GHAA 3KDSE 3KW6A 2F5QA 1DGGA 2HCBA 2RGHA 2KXEA 3DZDA 1PJJA 1NJFA 4JI0M 4GHLA 4IBGA 1SXJD 2Q2EB 1Z59A 2YFQA 1XNRM 4IBJA 1W5SA 2L7HA 2HHHM 3A42A 3GLFB 2FNAA 2QZ4A 4KODA 3RE8A 3VDPA 3NBIA 3AKZA 1XXHB 3FD9A 4GIPA 5BR8M 2FE8A 1SXJC 3M0EA 3UZUA 1YE9A 3FTEA 3GLIA 3GQ3A 3HWSA 7CATA 1L1TA 1ZAEA 4NOOB 4LF5M 3IG5A 4LCBA 3RFWA 2BJWA 3T15A 4I8OA 4DUZM 3WHKA 3JR5A 3QWLA 2ZAMA 3VLFB 1E94E 2X49A 3TL4X 2YNMD 3TWLA 4P16A 4W5WA 1IBLM 4MH0E 5FTMA 5ITXA 2BNKA 4LJ9A 1OJLA 4FCVA 2Y0TA 1FNNA 1DGHA 4G4QA 3U5ZA 2O5RA 3AL0C 4YY3M 3HHYA 3MK6A 2UXBM 4AKGA 3MHVC 5FTLA 4GKJM 1I94M 5FTNA 4IJEA 3FKEA 5LMUM 3SAWA 1LV7A 3GLHB 3GQ5A 1GKIA 2UUBM 4Z8XA 4D80A 2CEAA 3AFHA 4G6ZA 3HKPA 3U6OA 3GPYA 2DZOB 2NQ8C 1N33M 3VFDA 4QNMA 1VDDA 3MJ5A 4LGMA 1IM2A 1L2DA 3PXGA 4B7GA 3EIEA 3HJ8A 3FTFA 1C1KA 5EP4A 2F5OA 3I4VA 1K82A 1N78A 2CV0A 2ZM6M 2YQZA 1IXRC 3VKGA 3HGIA 3UK6A 3HHXA 3A46A 2F5NA 3LQRA 1SXJA 3LMMA 5A2QS 2DWNA 3HJQA 2UUCM 1TDHA 3M7GA 2W82A 4LFBM 2UXCM 1DO0A 4B3RM 2Z4SA 4M9SA 5F3WA 4L16A 3L28A 4G4NA 5ITXE 1IBMM 2LWXA 4JV5M 3SYLA 3D8BA 4RF1A 4JXJA 2VQEM 4OW0A 2XEPA 3SHFA 4JI4M 3KOXE 4IBEA 4MB7A 4NRVA 3L25A 5C1BA 3U6PA 1R6BX 2QCUA 2ZANA 2Y21A 2QBYB 2FFJA 4JI1M 2CUZA 4QHSA 3J7BA 1JR3D 4JN6A 1IN4A 1QANA 3SHGB 4B7HA 3C58A 1YSYA 2K47A 5ITUA 3GLIB 2CFOA 2RGOA 2CV2A 4AKHA 3LVWA 1IN5A 3CTWB 3J27B 1G41A 4LF4M 5IREB 3LVVA 1Q3CA 5FLXS 1G59A 4R7GA 5EQTA 4REZA 2D7HA 2QENA 2Z4RA 2C99A 3ZH9B 2C9OA 2I7PA 3FTCA 4MGIE 3GO8A 3U6SA 2DZNB 4NRWA 3E9SA 4MGHA 3RGSA 4PT5A 3U5ZB 2DWZB 2JA2A 1QVRA 4HL4A 1IY2A 4LZJA 3TWMA 4GKKM 3FUUA 1EE8A 4KO8A 4ITQA 4WW0A 1QAMA 2F4VM 5IT9S 3HHWA 3RGPA 2R46A 3GPUA 4I81A 1XMQM 3SATA 4G4RA 1PM5A 2E5LM 3K1JA 3GQ4A 1L1ZA 4DR2M 2HKJA 4X66M 3FUWA 3U60A 2LH0A 1Z6TA 5KPZA 1JQJC 1ORYB 1Z5BA 1L2BA 1Q39A 4L8RC 1S3SA 3HJSA 1HNZM 3M6AA 4FWHA 3KSJA 2X4AA 4MGKE 2CHGA 5IWAM 3AOGA 2L09A 2X8AA 3GLGA 1R2ZA 4LJ7A 4JYAM 2FOIC 3HHZA 1SXJB 3U6CA 3L2AA 4GITA 3WHLA 5ITTA 1ZQ9A 4D82A 4HLQA 1JR3A 4CHTB 1IBKM 1IY0A 1IN6A 2XF3A 3SAVA 3U6LA 1NJGA 4LJ6A 1OFIA 1QQWA 2D7GA 4LF7M 5BPVA 1IN7A 2I7NA 4DR1M 3KOZE 5FTKA 4JI7M 2DWLA 3T38A 4LGYA 4M9ZA 4FWDA 5KQ8A 5EXSA 5EP1A 2R4JA 3AV0A 3FUVA 5ITQA 4DR4M 4IBDA 3FTDA 2G5GX 2Y0QA 1TH3A 4LRSA 4X62M 1TH4A 2VQFM 1Q3BA 3PNVA 2R45A 1PJIA 1E9SA 1N75A 4GRIA 4JI3M 3U61B 5C18A 4OVZB 2XGNA 4LZZA 2UU9M 3HU1A 4QNRA 4RNAA 2J7OA 3JAMS 1N77A 2Z3XA 5EP3A 3ZC7B 3GP1A 2DXIA 3L27A 1XMOM 1QYRA 4S12A 4LJ5A 2QPAA 4LFAM 3W0FA 2CHQA 4FCWA 3THGA 4DR3M 1IY1A 2V6ZM 4FD2A 1Z5AA 2CHVA 3TPZA 1K3XA 4M0WA 3PNYA 4B3TM 1IQPA 2C5RA 4NXNM 1HT1E 5DYGA 2KEBA 2D7EA 2BJVA 4DR5M 3KP1E 4JI8M 5EP2A 2C9CA 1E32A 1NVMA 2DHRA 1J09A 1N34M 2V1CA 2KRKA 3GPPA 2CV1A 4FW9A 3FUXA 5JI3E 3DOAA 3D8LA 1TDZA 5GKNA 5FTJA 4B08A 2J7NA 2ZAOA 3KP0E 4LJ8A 3SBJA 2M60A 3KOWE 2R4EA 3NWLA 4AG6A 3GLHA 4CISA 2CE7A 4YHHM 4KLNA 4AQYM 4MGZE 2L7IA 2RKOA 3FYDA 4PD2A 2F5SA 3SFZA 2A5YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ4 A;  4GKJ M;  2ZBK B;  1L1Z A;  4DR2 M;  1I94 M;  5LMU M;  2HKJ A;  4X66 M;  3J80 S;  3OTO M;  3SAW A;  2XZU A;  3GQ5 A;  1XNQ M;  2UUB M;  1HNW M;  1Z5B A;  2XZF A;  4DUY M;  1MU5 A;  1L2B A;  1Q39 A;  4X65 M;  3U6O A;  1HNZ M;  3GPY A;  1N33 M;  5IWA M;  3J81 S;  4DR7 M;  3TWK A;  2UXB M;  4DV5 M;  4NXM M;  1R2Z A;  3VK8 A;  4JYA M;  1L2D A;  3U6C A;  2EA0 A;  1HR0 M;  3T1H M;  3JR4 A;  4LF9 M;  1J5E M;  4X64 M;  5ITT A;  2F5O A;  1K82 A;  4DV4 M;  1IBK M;  2ZM6 M;  3SAV A;  3U6L A;  3A46 A;  2F5N A;  4LF7 M;  4DR1 M;  3VK7 A;  4JI7 M;  5A2Q S;  4K0K M;  1HNX M;  2UUC M;  2OQ4 A;  1TDH A;  4DV6 M;  2UXD M;  4LFB M;  2UXC M;  2UUA M;  4KHP M;  4PDG A;  4B3R M;  3J7A S;  3U6M A;  1N32 M;  1R2Y A;  2OPF A;  5ITQ A;  4LF6 M;  4DR4 M;  4G4N A;  5ITX E;  4LF8 M;  1IBM M;  4JV5 M;  4X62 M;  2VQF M;  1Q3B A;  3U6E A;  4G4O A;  2F5P A;  1XC8 A;  1PJI A;  4DV2 M;  3GPX A;  4OX9 M;  1Z5C A;  4PDI A;  1N36 M;  2VQE M;  1NNJ A;  4JI3 M;  4JI4 M;  3SAS A;  4B3M M;  4LFC M;  5ITY A;  4MB7 A;  4NRV A;  2UU9 M;  3U6P A;  4DV3 M;  5ITR A;  4JI1 M;  3SAR A;  3U6Q A;  4DV0 M;  1K3W A;  3JAM S;  3GP1 A;  4JI2 M;  1XMO M;  5LMN M;  3SAU A;  2F5Q A;  4LFA M;  3C58 A;  3W0F A;  1PJJ A;  5ITU A;  4DR3 M;  4JI0 M;  1Z5A A;  4PCZ A;  2Q2E B;  4JI6 M;  4B3S M;  1Z59 A;  1K3X A;  1XNR M;  4B3T M;  2HHH M;  4NXN M;  3A42 A;  4LF4 M;  1Q3C A;  5FLX S;  4DR5 M;  1KFV A;  4JI8 M;  4DV7 M;  5BR8 M;  3GO8 A;  3U6S A;  1FJG M;  4NRW A;  3GQ3 A;  1N34 M;  3GPP A;  1L1T A;  3DOA A;  3U6D A;  4LF5 M;  1TDZ A;  3T1Y M;  4DUZ M;  3SBJ A;  3TWM A;  3JR5 A;  4GKK M;  4JI5 M;  1IBL M;  4DR6 M;  1MX0 A;  3TWL A;  4DV1 M;  1EE8 A;  4CIS A;  4YHH M;  5ITX A;  4AQY M;  4ITQ A;  1L2C A;  3A45 A;  4PD2 A;  2F5S A;  2F4V M;  5IT9 S;  4G4Q A;  1XMQ M;  3GPU A;  3SAT A;  4YY3 M;  4G4R A;  1PM5 A;  2E5L M; 
#chains in the Genus database with same CATH topology
 1XWI A;  2KZU A;  3FRI A;  2VII A;  3I4Y A;  5EXP A;  2ZBK B;  3L29 A;  4WUR A;  4L6V 6;  2ERC A;  3AOE C;  4AW4 A;  8CAT A;  2HL7 A;  2KW0 A;  1DGH B;  1Y8G A;  4CGY B;  2Y20 A;  5KO3 A;  3GLF E;  1D2N A;  1UM8 A;  1YLA A;  3CF6 E;  3HY5 A;  3IG8 A;  3K92 A;  4GMQ A;  1MJG M;  4L78 A;  1XXH E;  3KFU G;  4UN2 B;  4NXM M;  3VK8 A;  1VQ1 A;  2DAI A;  3KXE C;  3QAU A;  4WP2 A;  4QOS A;  1EFU B;  1HT2 E;  3T1H M;  4LF9 M;  3KS8 A;  1KSF X;  1J5E M;  2MRO B;  2DVW B;  3PFI A;  4CJ6 A;  3UJN A;  2P5T A;  2MH8 A;  5EXT A;  1OIZ A;  3A98 B;  4Q7J A;  2XSZ D;  3R9X B;  3BBZ A;  2QSF X;  2EO2 A;  4Z6Y A;  3VK7 A;  4GC9 A;  2XLJ A;  1WGN A;  1GL6 A;  4EIW A;  1DO2 A;  1T3T A;  3B9P A;  4DV6 M;  1NSF A;  2QHO B;  4BB9 A;  4KHP M;  1N32 M;  3UGJ A;  1HQY E;  1R2Y A;  3L26 A;  3GLH E;  1OFH A;  2KNA A;  4IBB A;  2G3Q A;  2DI0 A;  4TUW A;  2KRU A;  4XBO A;  1KYI A;  4I5S A;  3VDU A;  2EUC A;  3U6E A;  2QBY A;  2O25 A;  3GPX A;  2KZS A;  3TQS A;  3VKH A;  3UMM A;  4Y28 F;  3R8F A;  1E9R A;  2L6O A;  1AUA A;  5IZ7 D;  2KNV A;  4ANR A;  4LJ4 A;  3FE3 A;  3GRV A;  4NSR A;  3AOE A;  4QHT A;  3GRY A;  3DFZ A;  5JI2 E;  4DV3 M;  5ITR A;  3SAR A;  1ZMV A;  3CF2 A;  4AKI A;  1J7K A;  1K3W A;  1G71 A;  4XK8 F;  3I51 A;  2Z8Y M;  4GH9 A;  3SMS A;  5LMN M;  3SAU A;  3FUT A;  3KS4 A;  3LQQ A;  1TH2 A;  1DGB A;  1GLN A;  1OKS A;  2MR9 A;  4LRT A;  1IXZ A;  2R18 A;  4II7 A;  4PCZ A;  4JI6 M;  4B3S M;  3TE6 A;  4AZF A;  5EJC A;  3J2P B;  2Z7J A;  4OU7 A;  5DYI A;  2KA6 B;  3SC3 A;  5KPR A;  1KFV A;  2C98 A;  4DV7 M;  3ILK A;  2KNZ A;  4A3V B;  1G8P A;  2GQF A;  2LHC A;  2LXE A;  1FJG M;  4LY6 A;  4L15 A;  3PVS A;  3Q8G A;  2M5Z A;  1GL7 A;  1XHB A;  2DAE A;  3K2L A;  3K9O A;  3U6D A;  4M0D A;  3SMP A;  2XSZ A;  1TF0 B;  3GLF A;  3T1Y M;  2XFT A;  2R0I A;  3SYK A;  4JI5 M;  4FCT A;  1XXH A;  4DR6 M;  1MX0 A;  3FYC A;  5EXX A;  4DV1 M;  1H6U A;  2G8L A;  2XFS A;  2DWM A;  5KPT A;  1L2C A;  3A45 A;  4IIW A;  5DFL A;  5FSW A;  3ZCB B;  2R44 A;  4MM3 B;  1QAQ A;  4RF0 A;  2XH9 A;  2AHM A;  5H37 D;  1NHG C;  1P3Q Q;  2C96 A;  3Q8X A;  2XZU A;  2H1R A;  3E21 A;  3J80 S;  3OTO M;  4LG2 A;  3GLI E;  1WXQ A;  1XNQ M;  1QUT A;  4AI6 A;  4QOZ C;  2R65 A;  3KOY E;  1HNW M;  2XZF A;  4DUY M;  1G3I A;  1MU5 A;  4FWG A;  4M9X A;  4X65 M;  2BWB A;  4NL4 H;  1DV0 A;  1NHW C;  3AJI B;  3H4M A;  3K9P A;  3W0L B;  3J81 S;  4DR7 M;  3TWK A;  4DV5 M;  3HU2 A;  1HQC A;  2LNH C;  3U60 B;  3GRR A;  4BBA A;  4NSO B;  3CF0 A;  3E4R A;  4IBK A;  2EA0 A;  2GNO A;  4GC5 A;  1HR0 M;  3JR4 A;  4IBI A;  4D81 A;  3B7N A;  1YUB A;  4X64 M;  1VEG A;  1TGU A;  3MMP A;  1PJT A;  2QP9 X;  4DV4 M;  3GLG B;  4FVM A;  1NY5 A;  1RU3 A;  1R7R A;  3GRU A;  1NNU C;  4XGI A;  1BVS A;  4GEW A;  4AG5 A;  4K0K M;  2QQ8 A;  1HNX M;  1I4W A;  1NY6 A;  4BLC A;  2OQ4 A;  1DGF A;  2UXD M;  4B7F A;  4MGY E;  1X37 A;  4LJA A;  2JY8 A;  2UUA M;  5DNY A;  3KVW A;  4PDG A;  3U61 A;  3J7A S;  3U6M A;  1OQY A;  3KSX A;  4OVZ A;  4IBF A;  2OPF A;  4LF6 M;  1VEJ A;  4LF8 M;  1IXS B;  4IBC A;  3BXW A;  3EIH A;  1QZM A;  5E6J A;  2OO9 A;  4IJF A;  4G4O A;  2VDB B;  1XC8 A;  2F5P A;  1QAO A;  2BWE A;  4DV2 M;  4OX9 M;  1Z5C A;  3HU3 A;  1L8Q A;  4PDI A;  2CWB A;  2R62 A;  3V76 A;  1N36 M;  3DA1 A;  2LVN C;  1NNJ A;  3K8Z A;  2MGW A;  5KQD A;  1OIP A;  3SAS A;  1IN8 A;  1SXJ E;  4R3D A;  4B3M M;  4LFC M;  4ZPX A;  4I4L A;  5E26 A;  5ITY A;  1GVN A;  2JY6 B;  4L4U A;  2V1U A;  1W5T A;  3BOS A;  3U6Q A;  2YR0 A;  3E46 A;  4DV0 M;  1G4A E;  4JI2 M;  3B89 A;  3KDS E;  4GHA A;  3KW6 A;  1QZE A;  2F5Q A;  1ZMW A;  1NO1 A;  3F92 A;  2LHG A;  1DGG A;  2HCB A;  2RGH A;  2KXE A;  3DZD A;  1PJJ A;  1NJF A;  3NBX X;  4JI0 M;  4GHL A;  4IBG A;  4KT0 F;  1SXJ D;  1WR1 B;  2Q2E B;  1Z59 A;  2YFQ A;  1XNR M;  4IBJ A;  1W5S A;  2L7H A;  2HHH M;  3A42 A;  3GLF B;  2FNA A;  2QZ4 A;  4KOD A;  3RE8 A;  3VDP A;  3NBI A;  3AKZ A;  1XXH B;  3FD9 A;  4GIP A;  5BR8 M;  2FE8 A;  1SXJ C;  2LVA A;  3I04 M;  3M0E A;  3UZU A;  1YE9 A;  3FTE A;  3GLI A;  2CRU A;  2JZ0 A;  3GQ3 A;  3HWS A;  7CAT A;  1L1T A;  1ZAE A;  1OAO C;  1WJ7 A;  2OOB A;  4NOO B;  4LF5 M;  3IG5 A;  4LCB A;  3RFW A;  1TR8 A;  2BJW A;  2EKK A;  4I8O A;  3T15 A;  3QYE A;  4DUZ M;  3WHK A;  3JR5 A;  3QWL A;  5L8R F;  3T6P A;  2ZAM A;  3VLF B;  1E94 E;  2X49 A;  3TL4 X;  2YNM D;  3TWL A;  4P16 A;  4W5W A;  1IBL M;  4MH0 E;  5FTM A;  5ITX A;  1NV9 A;  2BNK A;  4LJ9 A;  1OJL A;  4FCV A;  2Y0T A;  3FRH A;  1FNN A;  1DGH A;  4G4Q A;  3U5Z A;  2KDL A;  2O5R A;  3AL0 C;  4YY3 M;  3HHY A;  3MK6 A;  2UXB M;  4AKG A;  3MHV C;  1QUS A;  5FTL A;  4GKJ M;  1I94 M;  5FTN A;  2DZL A;  2DAK A;  3FKE A;  4IJE A;  5LMU M;  3SAW A;  1LV7 A;  3GLH B;  3GQ5 A;  1GKI A;  2UUB M;  4Z8X A;  4D80 A;  2CEA A;  3AFH A;  4G6Z A;  2JP7 A;  3HKP A;  2WSF F;  3U6O A;  1WHC A;  3GPY A;  2DZO B;  2NQ8 C;  1N33 M;  2DNA A;  3VFD A;  4QNM A;  1VDD A;  3MJ5 A;  1CUK A;  4LGM A;  2JWS A;  1IM2 A;  1L2D A;  2CP8 A;  3I01 M;  3PXG A;  4B7G A;  3EIE A;  3HJ8 A;  2ZTC A;  2VF7 A;  3FTF A;  1C1K A;  5EP4 A;  2F5O A;  3I4V A;  1K82 A;  1N78 A;  2CV0 A;  2ZM6 M;  1Q02 A;  2N35 A;  2YQZ A;  1IXR C;  3VKG A;  3HGI A;  3UK6 A;  3HHX A;  3A46 A;  2F5N A;  3LQR A;  2MJ5 B;  1SXJ A;  3LMM A;  5A2Q S;  1GJS A;  1D0L A;  2DWN A;  3C9P A;  3HJQ A;  2UUC M;  1TDH A;  2J5Y A;  3M7G A;  2W82 A;  1C7Y A;  1GAB A;  1PJS A;  4LFB M;  2UXC M;  3IHP A;  1DO0 A;  4B3R M;  2FH0 A;  2KHH A;  2Z4S A;  4M9S A;  5F3W A;  4L16 A;  3L28 A;  4G4N A;  5ITX E;  1IBM M;  2LWX A;  4JV5 M;  3SYL A;  3D8B A;  4RF1 A;  4JXJ A;  1JR3 E;  2DAM A;  2R6F A;  3B7Z A;  2VQE M;  1F4I A;  3C3E A;  4OW0 A;  1MN3 A;  2XEP A;  3SHF A;  4JI4 M;  3KOX E;  2LVQ D;  4IBE A;  2JY7 A;  2EJS A;  4MB7 A;  4NRV A;  3L25 A;  1WGL A;  5C1B A;  3U6P A;  1R6B X;  1VEK A;  2QCU A;  2WSE F;  2ZAN A;  2Y21 A;  2QBY B;  2FFJ A;  4JI1 M;  2B3T A;  2CUZ A;  4QHS A;  3J7B A;  1JR3 D;  4JN6 A;  2LBC A;  1IN4 A;  1QAN A;  1T6O A;  3SHG B;  4B7H A;  3C58 A;  1YSY A;  2K47 A;  5ITU A;  3GLI B;  2CFO A;  2RGO A;  2QNJ A;  3B7Q A;  2CV2 A;  4AKH A;  2WSC F;  3C3D A;  3LVW A;  1IN5 A;  3CTW B;  3J27 B;  1G41 A;  1T43 A;  2WZJ A;  4LF4 M;  5IRE B;  3LVV A;  1Q3C A;  1TTE A;  5FLX S;  1G59 A;  4R7G A;  5EQT A;  4REZ A;  1VG5 A;  2LTU A;  4CIZ A;  2D7H A;  2QEN A;  1ZMU A;  2C99 A;  2L2D A;  2Z4R A;  2C9O A;  2I7P A;  3FTC A;  4MGI E;  3W67 A;  3ZH9 B;  3GO8 A;  3U6S A;  2DZN B;  4NRW A;  3E9S A;  4MGH A;  1AIP C;  3RGS A;  4PT5 A;  3U5Z B;  2DWZ B;  2JA2 A;  1QVR A;  4HL4 A;  1IY2 A;  4LZJ A;  1A5T A;  3TWM A;  4GKK M;  3FUU A;  1R5L A;  1EE8 A;  1EIJ A;  2HAK A;  4KO8 A;  4ITQ A;  4WW0 A;  1QAM A;  1LTM A;  2F4V M;  5IT9 S;  3HHW A;  3RGP A;  2R46 A;  3GPU A;  4I81 A;  1PJQ A;  1XMQ M;  3SAT A;  4G4R A;  1PM5 A;  2E5L M;  4HEO A;  3K1J A;  3GQ4 A;  4DBG B;  4DR2 M;  1L1Z A;  2HKJ A;  1V34 A;  4X66 M;  3FUW A;  3U60 A;  2LH0 A;  1Z6T A;  3CGW A;  5KPZ A;  1JQJ C;  1ORY B;  1Z5B A;  2JUJ A;  1L2B A;  1Q39 A;  4L8R C;  1S3S A;  3HJS A;  1HNZ M;  3M6A A;  4FWH A;  3KSJ A;  2X4A A;  4MGK E;  2CHG A;  5IWA M;  3AOG A;  2L09 A;  1OAI A;  2X8A A;  3GLG A;  1R2Z A;  4LJ7 A;  4JYA M;  2FOI C;  1GO5 A;  3HHZ A;  1IFY A;  1SXJ B;  3U6C A;  1SG9 A;  1ZV1 A;  4F1I A;  3L2A A;  4GIT A;  2LVP C;  3WHL A;  5ITT A;  1ZQ9 A;  4D82 A;  4HLQ A;  1JR3 A;  1QDT A;  4CHT B;  1IBK M;  1IY0 A;  1IN6 A;  2XF3 A;  3SAV A;  3U6L A;  1NJG A;  4LJ6 A;  1OFI A;  1QQW A;  2D7G A;  2DAG A;  2DKL A;  4F2L A;  5BPV A;  1IN7 A;  4LF7 M;  2I7N A;  4DR1 M;  3KOZ E;  1IXS A;  2OOA A;  5FTK A;  4JI7 M;  2DWL A;  3T38 A;  1OTR A;  4LGY A;  4R71 A;  4M9Z A;  4FWD A;  2EKF A;  5KQ8 A;  5EXS A;  3B74 A;  5EP1 A;  2R4J A;  3AV0 A;  3FUV A;  5ITQ A;  2O01 F;  4IBD A;  3FTD A;  2JY5 A;  2G5G X;  4DR4 M;  2L4F A;  2Y0Q A;  1TH3 A;  2ZTD A;  4LRS A;  4X62 M;  1TH4 A;  2VQF M;  1D0M A;  1Q3B A;  3PNV A;  2R45 A;  1PJI A;  2H5X A;  1E9S A;  1N75 A;  1XB2 B;  4GRI A;  3W68 A;  1HJP A;  4JI3 M;  3HX3 A;  2K9D A;  3U61 B;  5C18 A;  4OVZ B;  2XGN A;  1R4G A;  4LZZ A;  2RRU A;  2UU9 M;  4G3O A;  3H4J A;  3HU1 A;  3LCV B;  1JB0 F;  4QNR A;  4RNA A;  2J7O A;  3JAM S;  1N77 A;  2Z3X A;  5EP3 A;  3ZC7 B;  3GP1 A;  2DXI A;  3L27 A;  1XMO M;  1QYR A;  1UFZ A;  4S12 A;  4LJ5 A;  2QPA A;  4LFA M;  3GLG E;  1VDL A;  3W0F A;  1QDR A;  1GJT A;  2CHQ A;  3HZJ A;  4FCW A;  3THG A;  2APL A;  4DR3 M;  1IY1 A;  2JZ1 A;  2V6Z M;  1Z5A A;  2JXN A;  3LCU A;  4FD2 A;  2CHV A;  3TPZ A;  1K3X A;  4M0W A;  2LVO C;  3PNY A;  4B3T M;  1IQP A;  2DHY A;  2C5R A;  4NXN M;  1HT1 E;  5DYG A;  2KEB A;  2D7E A;  2BJV A;  1WIV A;  4DR5 M;  3KP1 E;  4JI8 M;  5EP2 A;  2C9C A;  1E32 A;  1NVM A;  3LW5 F;  4P17 A;  2DHR A;  2DEN A;  1PRB A;  1J09 A;  1N34 M;  2V1C A;  2KRK A;  2VF8 A;  3GPP A;  2L4E A;  2JNH A;  2CV1 A;  1V92 A;  1D0K A;  3ZQJ A;  2HWJ A;  4FW9 A;  3IEC A;  3FUX A;  5JI3 E;  3DOA A;  1V33 A;  2FS1 A;  3D8L A;  1TDZ A;  5GKN A;  5FTJ A;  4B08 A;  2J7N A;  2ZAO A;  3KP0 E;  4LJ8 A;  3SBJ A;  2M60 A;  4RKU F;  4NC6 A;  2K6B A;  3KOW E;  2R4E A;  3NWL A;  4AG6 A;  3GLH A;  1NV8 A;  4CIS A;  2CE7 A;  4YHH M;  2K0B X;  4KLN A;  4AQY M;  4MGZ E;  1PGY A;  2L7I A;  2RKO A;  3FYD A;  3QYB A;  4PD2 A;  2F5S A;  3SFZ A;  2A5Y B; 
#chains in the Genus database with same CATH homology
 1XWI A;  2KZU A;  5EXP A;  2VII A;  3I4Y A;  2ZBK B;  3L29 A;  4WUR A;  2ERC A;  3AOE C;  4AW4 A;  8CAT A;  2HL7 A;  2KW0 A;  1DGH B;  4CGY B;  2Y20 A;  5KO3 A;  1D2N A;  1UM8 A;  3CF6 E;  3IG8 A;  3K92 A;  4GMQ A;  4L78 A;  3KFU G;  4NXM M;  3VK8 A;  3KXE C;  3QAU A;  4QOS A;  1HT2 E;  3T1H M;  4LF9 M;  3KS8 A;  1KSF X;  1J5E M;  2DVW B;  3PFI A;  3UJN A;  2P5T A;  5EXT A;  3A98 B;  2XSZ D;  3R9X B;  2EO2 A;  4Z6Y A;  3VK7 A;  4GC9 A;  2XLJ A;  1GL6 A;  4EIW A;  1DO2 A;  1T3T A;  3B9P A;  4DV6 M;  1NSF A;  4BB9 A;  4KHP M;  1N32 M;  3UGJ A;  1HQY E;  1R2Y A;  3L26 A;  1OFH A;  4IBB A;  4TUW A;  2KRU A;  4XBO A;  1KYI A;  4I5S A;  3VDU A;  2EUC A;  3U6E A;  2QBY A;  3GPX A;  2KZS A;  3TQS A;  3VKH A;  3UMM A;  3R8F A;  1E9R A;  2L6O A;  5IZ7 D;  4LJ4 A;  3GRV A;  4NSR A;  3AOE A;  4QHT A;  3GRY A;  3DFZ A;  5JI2 E;  4DV3 M;  5ITR A;  3SAR A;  4AKI A;  3CF2 A;  1J7K A;  1K3W A;  3I51 A;  4GH9 A;  3SMS A;  5LMN M;  3SAU A;  3FUT A;  3KS4 A;  3LQQ A;  1TH2 A;  1DGB A;  1GLN A;  4LRT A;  1IXZ A;  2R18 A;  4II7 A;  4PCZ A;  4JI6 M;  4B3S M;  3TE6 A;  4AZF A;  5EJC A;  3J2P B;  2Z7J A;  4OU7 A;  5DYI A;  2KA6 B;  3SC3 A;  5KPR A;  1KFV A;  2C98 A;  4DV7 M;  3ILK A;  4A3V B;  1G8P A;  2LXE A;  1FJG M;  4LY6 A;  4L15 A;  3PVS A;  2M5Z A;  1GL7 A;  1XHB A;  3K2L A;  3U6D A;  4M0D A;  3SMP A;  2XSZ A;  3GLF A;  3T1Y M;  2XFT A;  3SYK A;  4JI5 M;  4FCT A;  1XXH A;  4DR6 M;  1MX0 A;  3FYC A;  5EXX A;  4DV1 M;  1H6U A;  2G8L A;  2XFS A;  2DWM A;  5KPT A;  1L2C A;  3A45 A;  4IIW A;  5FSW A;  3ZCB B;  4MM3 B;  1QAQ A;  4RF0 A;  2XH9 A;  2AHM A;  5H37 D;  1NHG C;  2C96 A;  3Q8X A;  2XZU A;  2H1R A;  3J80 S;  3OTO M;  4LG2 A;  1WXQ A;  1XNQ M;  4AI6 A;  4QOZ C;  2R65 A;  3KOY E;  1HNW M;  2XZF A;  4DUY M;  1G3I A;  1MU5 A;  4FWG A;  4M9X A;  4X65 M;  4NL4 H;  1NHW C;  3AJI B;  3H4M A;  3W0L B;  3J81 S;  4DR7 M;  3TWK A;  4DV5 M;  3HU2 A;  1HQC A;  2LNH C;  3U60 B;  3GRR A;  4BBA A;  4NSO B;  3CF0 A;  3E4R A;  4IBK A;  2EA0 A;  4GC5 A;  1HR0 M;  3JR4 A;  4IBI A;  4D81 A;  1YUB A;  4X64 M;  1TGU A;  2QP9 X;  4DV4 M;  3GLG B;  4FVM A;  1NY5 A;  1R7R A;  3GRU A;  1NNU C;  4XGI A;  4AG5 A;  4K0K M;  1HNX M;  1I4W A;  1NY6 A;  4BLC A;  2OQ4 A;  1DGF A;  2UXD M;  4B7F A;  4MGY E;  1X37 A;  4LJA A;  2UUA M;  5DNY A;  3KVW A;  4PDG A;  3U61 A;  3J7A S;  3U6M A;  3KSX A;  4OVZ A;  4IBF A;  2OPF A;  4LF6 M;  4LF8 M;  1IXS B;  4IBC A;  3EIH A;  1QZM A;  5E6J A;  4IJF A;  4G4O A;  2F5P A;  1XC8 A;  1QAO A;  4DV2 M;  4OX9 M;  1Z5C A;  3HU3 A;  1L8Q A;  4PDI A;  1N36 M;  2R62 A;  3DA1 A;  1NNJ A;  3K8Z A;  5KQD A;  3SAS A;  1IN8 A;  1SXJ E;  4R3D A;  4B3M M;  4LFC M;  4ZPX A;  4I4L A;  5E26 A;  5ITY A;  1GVN A;  4L4U A;  2V1U A;  1W5T A;  3BOS A;  3U6Q A;  2YR0 A;  4DV0 M;  1G4A E;  4JI2 M;  4GHA A;  3KDS E;  3KW6 A;  2F5Q A;  1DGG A;  2HCB A;  2RGH A;  2KXE A;  3DZD A;  1PJJ A;  1NJF A;  4JI0 M;  4GHL A;  4IBG A;  1SXJ D;  2Q2E B;  1Z59 A;  2YFQ A;  1XNR M;  4IBJ A;  1W5S A;  2L7H A;  2HHH M;  3A42 A;  3GLF B;  2FNA A;  2QZ4 A;  4KOD A;  3RE8 A;  3VDP A;  3NBI A;  3AKZ A;  1XXH B;  3FD9 A;  4GIP A;  5BR8 M;  2FE8 A;  1SXJ C;  3M0E A;  3UZU A;  1YE9 A;  3FTE A;  3GLI A;  3GQ3 A;  3HWS A;  7CAT A;  1L1T A;  1ZAE A;  4NOO B;  4LF5 M;  3IG5 A;  4LCB A;  3RFW A;  2BJW A;  3T15 A;  4I8O A;  4DUZ M;  3WHK A;  3JR5 A;  3QWL A;  2ZAM A;  3VLF B;  1E94 E;  2X49 A;  3TL4 X;  2YNM D;  3TWL A;  4P16 A;  4W5W A;  1IBL M;  4MH0 E;  5FTM A;  5ITX A;  2BNK A;  4LJ9 A;  1OJL A;  4FCV A;  2Y0T A;  1FNN A;  1DGH A;  4G4Q A;  3U5Z A;  2O5R A;  3AL0 C;  4YY3 M;  3HHY A;  3MK6 A;  2UXB M;  4AKG A;  3MHV C;  5FTL A;  4GKJ M;  1I94 M;  5FTN A;  4IJE A;  3FKE A;  5LMU M;  3SAW A;  1LV7 A;  3GLH B;  3GQ5 A;  1GKI A;  2UUB M;  4Z8X A;  4D80 A;  2CEA A;  3AFH A;  4G6Z A;  3HKP A;  3U6O A;  3GPY A;  2DZO B;  2NQ8 C;  1N33 M;  3VFD A;  4QNM A;  1VDD A;  3MJ5 A;  4LGM A;  1IM2 A;  1L2D A;  3PXG A;  4B7G A;  3EIE A;  3HJ8 A;  3FTF A;  1C1K A;  5EP4 A;  2F5O A;  3I4V A;  1K82 A;  1N78 A;  2CV0 A;  2ZM6 M;  2YQZ A;  1IXR C;  3VKG A;  3HGI A;  3UK6 A;  3HHX A;  3A46 A;  2F5N A;  3LQR A;  1SXJ A;  3LMM A;  5A2Q S;  2DWN A;  3HJQ A;  2UUC M;  1TDH A;  3M7G A;  2W82 A;  4LFB M;  2UXC M;  1DO0 A;  4B3R M;  2Z4S A;  4M9S A;  5F3W A;  4L16 A;  3L28 A;  4G4N A;  5ITX E;  1IBM M;  2LWX A;  4JV5 M;  3SYL A;  3D8B A;  4RF1 A;  4JXJ A;  2VQE M;  4OW0 A;  2XEP A;  3SHF A;  4JI4 M;  3KOX E;  4IBE A;  4MB7 A;  4NRV A;  3L25 A;  5C1B A;  3U6P A;  1R6B X;  2QCU A;  2ZAN A;  2Y21 A;  2QBY B;  2FFJ A;  4JI1 M;  2CUZ A;  4QHS A;  3J7B A;  1JR3 D;  4JN6 A;  1IN4 A;  1QAN A;  3SHG B;  4B7H A;  3C58 A;  1YSY A;  2K47 A;  5ITU A;  3GLI B;  2CFO A;  2RGO A;  2CV2 A;  4AKH A;  3LVW A;  1IN5 A;  3CTW B;  3J27 B;  1G41 A;  4LF4 M;  5IRE B;  3LVV A;  1Q3C A;  5FLX S;  1G59 A;  4R7G A;  5EQT A;  4REZ A;  2D7H A;  2QEN A;  2Z4R A;  2C99 A;  3ZH9 B;  2C9O A;  2I7P A;  3FTC A;  4MGI E;  3GO8 A;  3U6S A;  2DZN B;  4NRW A;  3E9S A;  4MGH A;  3RGS A;  4PT5 A;  3U5Z B;  2DWZ B;  2JA2 A;  1QVR A;  4HL4 A;  1IY2 A;  4LZJ A;  3TWM A;  4GKK M;  3FUU A;  1EE8 A;  4KO8 A;  4ITQ A;  4WW0 A;  1QAM A;  2F4V M;  5IT9 S;  3HHW A;  3RGP A;  2R46 A;  3GPU A;  4I81 A;  1XMQ M;  3SAT A;  4G4R A;  1PM5 A;  2E5L M;  3K1J A;  3GQ4 A;  1L1Z A;  4DR2 M;  2HKJ A;  4X66 M;  3FUW A;  3U60 A;  2LH0 A;  1Z6T A;  5KPZ A;  1JQJ C;  1ORY B;  1Z5B A;  1L2B A;  1Q39 A;  4L8R C;  1S3S A;  3HJS A;  1HNZ M;  3M6A A;  4FWH A;  3KSJ A;  2X4A A;  4MGK E;  2CHG A;  5IWA M;  3AOG A;  2L09 A;  2X8A A;  3GLG A;  1R2Z A;  4LJ7 A;  4JYA M;  2FOI C;  3HHZ A;  1SXJ B;  3U6C A;  3L2A A;  4GIT A;  3WHL A;  5ITT A;  1ZQ9 A;  4D82 A;  4HLQ A;  1JR3 A;  4CHT B;  1IBK M;  1IY0 A;  1IN6 A;  2XF3 A;  3SAV A;  3U6L A;  1NJG A;  4LJ6 A;  1OFI A;  1QQW A;  2D7G A;  4LF7 M;  5BPV A;  1IN7 A;  2I7N A;  4DR1 M;  3KOZ E;  5FTK A;  4JI7 M;  2DWL A;  3T38 A;  4LGY A;  4M9Z A;  4FWD A;  5KQ8 A;  5EXS A;  5EP1 A;  2R4J A;  3AV0 A;  3FUV A;  5ITQ A;  4DR4 M;  4IBD A;  3FTD A;  2G5G X;  2Y0Q A;  1TH3 A;  4LRS A;  4X62 M;  1TH4 A;  2VQF M;  1Q3B A;  3PNV A;  2R45 A;  1PJI A;  1E9S A;  1N75 A;  4GRI A;  4JI3 M;  3U61 B;  5C18 A;  4OVZ B;  2XGN A;  4LZZ A;  2UU9 M;  3HU1 A;  4QNR A;  4RNA A;  2J7O A;  3JAM S;  1N77 A;  2Z3X A;  5EP3 A;  3ZC7 B;  3GP1 A;  2DXI A;  3L27 A;  1XMO M;  1QYR A;  4S12 A;  4LJ5 A;  2QPA A;  4LFA M;  3W0F A;  2CHQ A;  4FCW A;  3THG A;  4DR3 M;  1IY1 A;  2V6Z M;  4FD2 A;  1Z5A A;  2CHV A;  3TPZ A;  1K3X A;  4M0W A;  3PNY A;  4B3T M;  1IQP A;  2C5R A;  4NXN M;  1HT1 E;  5DYG A;  2KEB A;  2D7E A;  2BJV A;  4DR5 M;  3KP1 E;  4JI8 M;  5EP2 A;  2C9C A;  1E32 A;  1NVM A;  2DHR A;  1J09 A;  1N34 M;  2V1C A;  2KRK A;  3GPP A;  2CV1 A;  4FW9 A;  3FUX A;  5JI3 E;  3DOA A;  3D8L A;  1TDZ A;  5GKN A;  5FTJ A;  4B08 A;  2J7N A;  2ZAO A;  3KP0 E;  4LJ8 A;  3SBJ A;  2M60 A;  3KOW E;  2R4E A;  3NWL A;  4AG6 A;  3GLH A;  4CIS A;  2CE7 A;  4YHH M;  4KLN A;  4AQY M;  4MGZ E;  2L7I A;  2RKO A;  3FYD A;  4PD2 A;  2F5S A;  3SFZ A;  2A5Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...