4LFAM

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lfaM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lfaM02
3C58A 4KHPM 4PDIA 3GQ3A 3TWKA 4JI1M 4JI8M 3GQ5A 1MX0A 3U6SA 4K0KM 4CISA 2XZUA 3U6EA 3VK7A 1EE8A 4AQYM 1N36M 3SAVA 4G4QA 2F5NA 3U6DA 1Q3CA 5ITXA 3GPPA 3SARA 4OX9M 1XMQM 2F5SA 1K82A 5IWAM 1KFVA 4JI4M 2XZFA 4LF5M 4GKKM 3TWLA 4DR1M 4JV5M 3SASA 4LF6M 1Z5CA 4DV1M 3SBJA 1IBMM 1Z59A 4DR3M 3SATA 4JI7M 5LMNM 1R2YA 5ITYA 2VQFM 1IBKM 4DV2M 1N33M 4JI5M 4DR4M 1N32M 3W0FA 4LFBM 4DR6M 1K3WA 2UU9M 4YY3M 2EA0A 2UUCM 4DV5M 1K3XA 4NXNM 3GQ4A 4YHHM 3A46A 3U6QA 4GKJM 3T1YM 4JYAM 5LMUM 4DV7M 5ITUA 4NRVA 3U6OA 2OPFA 1HNZM 3J80S 1Z5AA 4PCZA 2F5QA 1TDZA 4DV4M 1PJIA 2UXDM 4NXMM 3VK8A 3GPXA 3GPYA 1L1TA 1XMOM 3DOAA 4PDGA 3J81S 4ITQA 3U6MA 3JAMS 2ZBKB 1N34M 3J7AS 5ITTA 1PM5A 4JI6M 2VQEM 1MU5A 4X66M 1L2DA 1HNXM 3U6CA 4DUYM 4G4NA 1J5EM 1L1ZA 4G4OA 5ITXE 2E5LM 3JR5A 1PJJA 4B3SM 4DV6M 2UXCM 2UXBM 2UUBM 2UUAM 4MB7A 1HNWM 1I94M 1L2BA 1TDHA 2HHHM 3A45A 3JR4A 1IBLM 4NRWA 4B3RM 4B3MM 1Z5BA 4X62M 2ZM6M 3T1HM 4JI3M 3GPUA 3GP1A 1NNJA 2F5OA 2OQ4A 5BR8M 5IT9S 4LF8M 4DV3M 5ITRA 2F5PA 1Q39A 1L2CA 4DR5M 4X64M 4LFCM 2Q2EB 5FLXS 1XC8A 1HR0M 4LF7M 3U6PA 4JI0M 3GO8A 3OTOM 3TWMA 4DV0M 5A2QS 3U6LA 3A42A 4LF4M 4X65M 2F4VM 1FJGM 2HKJA 4DR7M 4DR2M 4LF9M 4B3TM 4LFAM 4PD2A 4G4RA 4JI2M 3SAWA 1R2ZA 1Q3BA 5ITQA 4DUZM 1XNQM 1XNRM 3SAUA
chains in the Genus database with same CATH superfamily
5FTMA 2M60A 3CF0A 2AHMA 1AIPC 1J09A 2EUCA 1TGUA 3GQ5A 3NWLA 2XFSA 3CGWA 4L8RC 5KQDA 1OKSA 1G41A 2I7PA 3FRHA 3D8BA 1JQJC 4IBGA 2DAGA 2XH9A 3CF6E 2DAMA 1NHGC 3SAVA 4Z6YA 2CHGA 3U6DA 1QZEA 3LCUA 2L2DA 2C5RA 5GKNA 3QYEA 3MHVC 1XMQM 2VDBB 1GVNA 3M0EA 2XZFA 2HAKA 4LJ7A 2R45A 2L7HA 4JV5M 5KQ8A 4M9XA 4P16A 1WR1B 2WSCF 4FWHA 4DV1M 2JY6B 3AOEC 2XGNA 3I4YA 1XXHA 4OW0A 4D80A 3GLIB 1D0LA 1Q02A 1XWIA 3SYKA 2DXIA 3FYCA 1TTEA 3LCVB 3KDSE 3LQRA 5ITYA 1T3TA 2DAEA 3L28A 4IJEA 3K9PA 4DV2M 4LRTA 1IBKM 4JI5M 3VKGA 3W0FA 4PT5A 3FYDA 5KPRA 4YY3M 1IN6A 1RU3A 1YE9A 4M0WA 2EA0A 2UUCM 1R7RA 1H6UA 3TQSA 3FD9A 2V6ZM 3GQ4A 3A46A 3U6QA 1PJSA 4HEOA 1X37A 3AJIB 5LMUM 4DV7M 3HJQA 3E9SA 2R4JA 1IXSA 1HQCA 4NRVA 2FH0A 5KPZA 5ITUA 2OPFA 1HNZM 4AKHA 1ZAEA 4IBFA 4RNAA 3J80S 1GLNA 4Q7JA 2F5QA 4DV4M 1OFIA 8CATA 2HWJA 4P17A 2ERCA 1OIZA 1LTMA 3IHPA 5FTLA 3GPXA 1L1TA 4QNRA 4G3OA 1SG9A 1ZMUA 4QHSA 3SMPA 3U6MA 3HU3A 1OJLA 2KA6B 3U61A 3PFIA 2ZBKB 1A5TA 1TF0B 1JB0F 3L25A 1OIPA 3E4RA 1DGHB 2G8LA 1GL6A 4LJ9A 4CJ6A 3VFDA 1HNXM 3KOZE 4I5SA 1VEGA 2E5LM 1PJQA 5EP2A 4GHLA 3U60B 5DYIA 2JZ0A 2UXCM 4QNMA 3L27A 1F4IA 1GJTA 1NO1A 2BJWA 2LVNC 4IBEA 5DYGA 3R9XB 4FCWA 4MB7A 1TH4A 1R5LA 2EJSA 2HL7A 3TPZA 1I94M 3DZDA 3VKHA 1TDHA 1E94E 2CE7A 2QQ8A 4BB9A 3A45A 4LZJA 1DV0A 1MN3A 4RKUF 3B7NA 1NSFA 2F5OA 2KXEA 2QCUA 3E21A 1R4GA 5IZ7D 1IY0A 4LF8M 3L2AA 2XSZA 1Q39A 4OVZA 2RGHA 2DZLA 3LVWA 3WHLA 2JY7A 1NV8A 1L2CA 1QDTA 1NNUC 2I7NA 1HR0M 3SHGB 2KZSA 4LF7M 2CHQA 2K0BX 3U6OA 3OTOM 2R44A 1N77A 1C1KA 2XEPA 3K8ZA 3TWMA 2X8AA 5C18A 2OOAA 1WXQA 4DR2M 2EO2A 4LFAM 5C1BA 1VDLA 4JI2M 3SAWA 1TR8A 2DI0A 5ITQA 3GLFB 1XNRM 1NY5A 2GNOA 4PDIA 3GQ3A 3TWKA 3C3EA 3W68A 3U5ZA 2KNZA 3GLGB 3LQQA 3J2PB 1G59A 2QBYB 4CISA 3UGJA 2RRUA 3U6EA 3BBZA 1OQYA 1EE8A 4AQYM 3KS8A 3HKPA 3UZUA 3M6AA 1IN5A 4G4QA 1VEKA 5EXTA 1W5SA 2LVAA 3LW5F 4IBIA 2C96A 2F5SA 1LV7A 1WGNA 2KNVA 4II7A 3RGPA 5IWAM 1WIVA 1KFVA 3Q8XA 1GJSA 1G71A 4R7GA 4LF5M 3J27B 4GKKM 2DZOB 4I8OA 4L78A 3MK6A 2JY8A 1NJGA 4RF0A 1Z5CA 4LF6M 3FUTA 3PNVA 3AKZA 4JI7M 1IQPA 3FUUA 1R2YA 3AFHA 3SHFA 4AG5A 2KRUA 3B9PA 3GRYA 2BJVA 4IIWA 4WP2A 4KT0F 4B7HA 2VQFM 4IBKA 3UMMA 1V92A 3KOWE 4DR4M 2LWXA 4LFBM 1IY2A 2DAIA 2LXEA 2Z4RA 2CWBA 2CUZA 3ZH9B 1IXZA 4GH9A 4JYAM 2Y20A 1GKIA 3HX3A 4LJ8A 3HHWA 2JNHA 3D8LA 4R3DA 3QWLA 1BVSA 3MJ5A 2DWNA 2KHHA 4NL4H 2MH8A 1ZMVA 3HY5A 2CRUA 1IN7A 1XXHB 2QSFX 4FW9A 4WW0A 4IBDA 2UXDM 1QAOA 5EXPA 3SC3A 3L29A 4QOSA 1V34A 3ZCBB 3GPYA 4L15A 2Z3XA 3K9OA 2Y21A 5JI3E 1SXJD 1SXJB 3KSJA 1HQYE 2M5ZA 3JAMS 3KOYE 4BBAA 3B89A 2KEBA 1VEJA 2QHOB 3I51A 2LVOC 3T15A 4JI6M 3QYBA 2JXNA 3PNYA 4DUYM 4G4NA 1J5EM 1L1ZA 5EP1A 4G4OA 1IXSB 4KODA 4B3SM 1IFYA 2QNJA 3KP0E 2XFTA 2CP8A 3K92A 2UXBM 2FS1A 2MJ5B 1IN8A 4F2LA 2UUBM 5EXXA 2R6FA 1GO5A 2K6BA 3HZJA 3H4MA 3PVSA 4GEWA 1T6OA 4MGYE 3JR4A 4L16A 1VQ1A 3ILKA 1NY6A 2DKLA 1MJGM 1JR3D 1ZQ9A 2FE8A 2O01F 2O25A 2VF7A 4JI3M 3GP1A 2ZM6M 5BR8M 2OQ4A 5IT9S 1UM8A 2LHGA 2J7NA 5ITRA 2F5PA 1ZV1A 4MM3B 3GLHB 5FTJA 3FUWA 4XBOA 2L7IA 4X64M 4KO8A 2Q2EB 1DO0A 2FNAA 2L4FA 3F92A 5EJCA 1G8PA 3U6PA 4MGHA 2LH0A 4DR7M 5A2QS 2F4VM 4QOZC 2CHVA 1XB2B 1GL7A 5EXSA 1T43A 1N75A 3DA1A 3HU2A 4Z8XA 1Y8GA 7CATA 3HU1A 4G4RA 5KPTA 3GRUA 2J5YA 4A3VB 3QAUA 2L09A 1XNQM 3KP1E 1NV9A 3T6PA 2DENA 3C58A 1NVMA 2ZAOA 1AUAA 3IECA 4F1IA 4JI1M 2FOIC 4IJFA 2R46A 3HHZA 2W82A 1QVRA 2RGOA 3PXGA 3GLGE 3IG8A 3V76A 4QHTA 2XZUA 2VIIA 2JP7A 4D82A 2F5NA 1DGHA 3GPPA 2ZANA 3SARA 1P3QQ 1WHCA 4OX9M 4G6ZA 3L26A 2YFQA 1WJ7A 1K82A 4JXJA 4LY6A 1J7KA 2XLJA 2KRKA 1S3SA 4LZZA 3TWLA 3W67A 4Y28F 2P5TA 3I04M 2JWSA 1OAIA 2JZ1A 3SASA 2G5GX 2EKFA 1IBMM 1Z59A 2MR9A 1TH2A 4DR3M 3GRVA 3KS4A 3IG5A 4B08A 3U5ZB 4IBCA 1WGLA 4AKGA 1N32M 1PJTA 1HT2E 2CFOA 2BWBA 2FFJA 3ZC7B 1K3WA 2YQZA 2H1RA 3FE3A 4NSOB 2DWMA 4DV5M 1K3XA 2NQ8C 4NXNM 2V1CA 3T1YM 4GHAA 4MGZE 4TUWA 1UFZA 5JI2E 3HHXA 5EP3A 2BNKA 2B3TA 4M9ZA 1Z5AA 4PCZA 2QP9X 3KW6A 1TH3A 3HHYA 5F3WA 4D81A 2G3QA 3B74A 4NXMM 1ORYB 1OFHA 1XXHE 1XMOM 2LHCA 1EIJA 2JUJA 3GLIE 3DOAA 4M0DA 1V33A 4PDGA 3A98B 3M7GA 3LVVA 1SXJE 4LJ4A 2WSFF 3NBIA 4XK8F 1DGFA 1PGYA 2DAKA 3Q8GA 2DWLA 4I81A 4B7FA 1G4AE 3I01M 1NHWC 2BWEA 1D2NA 1FNNA 2Y0QA 1MU5A 2R4EA 5EQTA 3ZQJA 4X66M 2V1UA 2CV0A 2ZAMA 3C3DA 2CEAA 5ITXE 3JR5A 2Z8YM 4LJ6A 1DO2A 1PJJA 1QDRA 3FTFA 3UJNA 3H4JA 3RFWA 3B7ZA 1HT1E 4S12A 5IREB 3R8FA 2KW0A 2Y0TA 3SYLA 3FTCA 1L2BA 5FSWA 4CIZA 1E32A 1R6BX 3KSXA 4DBGB 1KSFX 2HHHM 2YNMD 5E26A 4FCTA 1IBLM 3FTDA 5H37D 4NRWA 3KOXE 4MGKE 4X62M 2H5XA 3T1HM 4GC9A 1NNJA 4NC6A 4ZPXA 1JR3E 5BPVA 4DV3M 1QZMA 2APLA 4BLCA 3SFZA 2L6OA 4DR5M 1IN4A 4LFCM 2LVQD 3GLHE 5FLXS 1XC8A 1N78A 2R18A 3E46A 4JI0M 5FTKA 3KXEC 3CTWB 5L8RF 4FWDA 4KLNA 3A42A 4LF4M 4X65M 4R71A 1FJGM 2HKJA 2CV1A 4LF9M 4GC5A 4B3TM 1PRBA 3K2LA 4PD2A 2A5YB 2WSEF 1XHBA 3VLFB 1R2ZA 1Q3BA 3C9PA 2GQFA 4DUZM 2MGWA 3SAUA 2DVWB 4NSRA 3GLIA 3CF2A 4KHPM 1EFUB 4IBJA 2DWZB 4EIWA 4OU7A 1YLAA 2MROB 1MX0A 3U6SA 4JI8M 1SXJA 4FVMA 4K0KM 2D7EA 3B7QA 4MGIE 4REZA 1IXRC 2QENA 4LG2A 2R65A 3U61B 2L4EA 3VK7A 1N36M 1QAQA 3VDUA 4L6V6 3HJSA 5DFLA 2OO9A 4L4UA 1Q3CA 3K1JA 5ITXA 3KFUG 3MMPA 3J7BA 2K9DA 4HLQA 4JI4M 1KYIA 4DR1M 4AKIA 3GRRA 4WURA 4LGYA 3BOSA 2R62A 3SATA 4I4LA 4GIPA 3GLFE 1QANA 2HCBA 4AG6A 3WHKA 5DNYA 5LMNM 1JR3A 4LJAA 1GABA 1YSYA 1N33M 3THGA 1IY1A 4RF1A 2XSZD 2LBCA 1OTRA 3GLHA 4GMQA 4LRSA 4OVZB 3BXWA 1YUBA 2UU9M 4DR6M 1C7YA 3FTEA 2OOBA 4YHHM 2LNHC 4GKJM 2R0IA 2YR0A 3U60A 3FUVA 2CV2A 1HJPA 4B7GA 4FD2A 1TDZA 1D0MA 2DHRA 2WZJA 2DZNB 2VF8A 3KVWA 2JY5A 1PJIA 2DHYA 3AL0C 1E9SA 3VK8A 3LMMA 1OAOC 1I4WA 1QUSA 3AOEA 4W5WA 1W5TA 2D7GA 3FUXA 3J81S 4FWGA 4HL4A 1DGBA 2C9OA 4ITQA 1D0KA 3TL4X 2K47A 1N34M 3J7AS 4GITA 1NJFA 5ITTA 2Z7JA 2EKKA 1E9RA 4M9SA 1VG5A 2VQEM 1PM5A 1L2DA 3U6CA 3HGIA 1IM2A 4ANRA 3W0LB 2KDLA 4DV6M 5FTNA 1QAMA 1CUKA 2UUAM 1HNWM 1QYRA 3HWSA 4LCBA 4JN6A 2O5RA 4UN2B 3GLFA 1SXJC 2ZTDA 5EP4A 4AI6A 4FCVA 4B3RM 2LVPC 2C98A 4B3MM 1Z5BA 2RKOA 3DFZA 4LGMA 1VDDA 3GPUA 1QQWA 4NOOB 1G3IA 2D7HA 3GLGA 3FKEA 4CHTB 3RGSA 3AV0A 2QBYA 3NBXX 5KO3A 1ZMWA 4AZFA 2LTUA 4AW4A 3RE8A 2QZ4A 2QPAA 2C9CA 4XGIA 5E6JA 3I4VA 3SMSA 2DNAA 2Z4SA 1Z6TA 2JA2A 2KNAA 3EIEA 3AOGA 4LJ5A 3GO8A 1QUTA 2XF3A 4GRIA 4IBBA 3VDPA 2N35A 2X4AA 2KZUA 4DV0M 3U6LA 2ZTCA 3EIHA 2X49A 1L8QA 3TE6A 3FRIA 2C99A 3HJ8A 3T38A 3UK6A 2J7OA 4MH0E 4CGYB 3SBJA 1DGGA
chains in the Genus database with same CATH topology
5FTMA 2M60A 3CF0A 2AHMA 1J09A 2EUCA 1TGUA 3GQ5A 3NWLA 2XFSA 4L8RC 5KQDA 1G41A 2I7PA 3D8BA 1JQJC 4IBGA 2XH9A 3CF6E 1NHGC 3SAVA 4Z6YA 2CHGA 3U6DA 2C5RA 5GKNA 3MHVC 1XMQM 3M0EA 1GVNA 2XZFA 4LJ7A 2R45A 2L7HA 4JV5M 5KQ8A 4M9XA 4P16A 4DV1M 4FWHA 3AOEC 2XGNA 3I4YA 1XXHA 4OW0A 4D80A 3GLIB 1XWIA 3SYKA 2DXIA 3FYCA 5ITYA 3KDSE 3LQRA 1T3TA 3L28A 4IJEA 4DV2M 1IBKM 4LRTA 3VKGA 4JI5M 3W0FA 4PT5A 3FYDA 5KPRA 4YY3M 1IN6A 1YE9A 4M0WA 2EA0A 2UUCM 1R7RA 1H6UA 3TQSA 3FD9A 2V6ZM 3GQ4A 3A46A 3U6QA 1X37A 3AJIB 5LMUM 4DV7M 3HJQA 3E9SA 2R4JA 1HQCA 4NRVA 5KPZA 5ITUA 2OPFA 1HNZM 4AKHA 1ZAEA 4IBFA 4RNAA 3J80S 1GLNA 2F5QA 4DV4M 1OFIA 8CATA 2ERCA 5FTLA 3GPXA 1L1TA 4QNRA 4QHSA 3SMPA 3U6MA 3HU3A 1OJLA 2KA6B 3U61A 3PFIA 2ZBKB 3L25A 3E4RA 1DGHB 2G8LA 1GL6A 4LJ9A 1HNXM 3VFDA 3KOZE 4I5SA 4GHLA 2E5LM 5EP2A 3U60B 5DYIA 2UXCM 4QNMA 3L27A 4IBEA 2BJWA 5DYGA 3R9XB 4FCWA 4MB7A 1TH4A 3TPZA 2HL7A 1I94M 3DZDA 3VKHA 1TDHA 1E94E 2CE7A 4BB9A 3A45A 4LZJA 1NSFA 2F5OA 2KXEA 2QCUA 5IZ7D 1IY0A 4LF8M 3L2AA 2XSZA 1Q39A 4OVZA 2RGHA 3LVWA 3WHLA 1L2CA 1NNUC 2I7NA 1HR0M 3SHGB 2KZSA 4LF7M 2CHQA 3U6OA 3OTOM 1N77A 1C1KA 2XEPA 3K8ZA 3TWMA 2X8AA 5C18A 1WXQA 4DR2M 2EO2A 4LFAM 5C1BA 4JI2M 3SAWA 5ITQA 3GLFB 1XNRM 1NY5A 4PDIA 3GQ3A 3TWKA 3U5ZA 3GLGB 3LQQA 3J2PB 1G59A 2QBYB 4CISA 3UGJA 3U6EA 1EE8A 4AQYM 3KS8A 3HKPA 3UZUA 3M6AA 1IN5A 4G4QA 5EXTA 1W5SA 4IBIA 2C96A 2F5SA 1LV7A 4II7A 3RGPA 5IWAM 1KFVA 3Q8XA 4R7GA 4LF5M 4GKKM 3J27B 2DZOB 4I8OA 4L78A 3MK6A 1NJGA 4RF0A 1Z5CA 4LF6M 3FUTA 3PNVA 3AKZA 4JI7M 1IQPA 3FUUA 1R2YA 3AFHA 3SHFA 4AG5A 2KRUA 3B9PA 3GRYA 2BJVA 4IIWA 4B7HA 2VQFM 4IBKA 3UMMA 3KOWE 4DR4M 2LWXA 4LFBM 1IY2A 2LXEA 2Z4RA 2CUZA 3ZH9B 1IXZA 4GH9A 4JYAM 2Y20A 1GKIA 4LJ8A 3HHWA 3D8LA 4R3DA 3QWLA 3MJ5A 2DWNA 4NL4H 1IN7A 1XXHB 4WW0A 4FW9A 4IBDA 2UXDM 1QAOA 5EXPA 3SC3A 3L29A 4QOSA 3ZCBB 3GPYA 2Z3XA 4L15A 2Y21A 5JI3E 1SXJD 1SXJB 3KSJA 1HQYE 2M5ZA 3JAMS 3KOYE 4BBAA 2KEBA 3I51A 3T15A 4JI6M 4DUYM 3PNYA 4G4NA 1J5EM 1L1ZA 5EP1A 4G4OA 1IXSB 4KODA 4B3SM 3KP0E 2UXBM 2XFTA 3K92A 1IN8A 2UUBM 5EXXA 3PVSA 3H4MA 4MGYE 3JR4A 4L16A 3ILKA 1NY6A 2FE8A 1JR3D 1ZQ9A 2ZM6M 4JI3M 5IT9S 3GP1A 2OQ4A 5BR8M 1UM8A 2J7NA 5ITRA 2F5PA 4MM3B 3GLHB 5FTJA 3FUWA 4XBOA 2L7IA 4X64M 4KO8A 2Q2EB 1DO0A 2FNAA 5EJCA 1G8PA 3U6PA 4MGHA 2LH0A 4DR7M 5A2QS 2F4VM 4QOZC 2CHVA 5EXSA 1GL7A 3HU2A 1N75A 3DA1A 4Z8XA 7CATA 3HU1A 4G4RA 5KPTA 3GRUA 4A3VB 3QAUA 2L09A 1XNQM 3KP1E 3C58A 1NVMA 2ZAOA 4JI1M 2FOIC 4IJFA 2R46A 3HHZA 2W82A 1QVRA 2RGOA 3PXGA 3IG8A 2XZUA 4QHTA 2VIIA 4D82A 2F5NA 1DGHA 3GPPA 2ZANA 3SARA 4OX9M 4G6ZA 3L26A 2YFQA 1K82A 4JXJA 4LY6A 1J7KA 2XLJA 2KRKA 1S3SA 4LZZA 3TWLA 2P5TA 3SASA 2G5GX 1IBMM 1Z59A 4DR3M 1TH2A 3GRVA 3KS4A 3IG5A 4B08A 3U5ZB 4IBCA 4AKGA 1N32M 1HT2E 2CFOA 3ZC7B 2FFJA 1K3WA 2YQZA 2H1RA 4NSOB 2DWMA 4DV5M 1K3XA 2NQ8C 4NXNM 2V1CA 3T1YM 4GHAA 4MGZE 4TUWA 5JI2E 3HHXA 5EP3A 2BNKA 4M9ZA 4PCZA 1Z5AA 2QP9X 3KW6A 1TH3A 3HHYA 5F3WA 4D81A 4NXMM 1ORYB 1OFHA 1XMOM 3DOAA 4M0DA 4PDGA 3A98B 3M7GA 3LVVA 1SXJE 4LJ4A 3NBIA 1DGFA 2DWLA 4I81A 4B7FA 1G4AE 1NHWC 1D2NA 1FNNA 2Y0QA 1MU5A 2R4EA 5EQTA 2V1UA 4X66M 2CV0A 2ZAMA 2CEAA 5ITXE 3JR5A 4LJ6A 1PJJA 1DO2A 3FTFA 3UJNA 3RFWA 1HT1E 4S12A 5IREB 3R8FA 2KW0A 2Y0TA 3SYLA 3FTCA 1L2BA 5FSWA 1E32A 1R6BX 3KSXA 1KSFX 2HHHM 2YNMD 5E26A 4FCTA 1IBLM 3FTDA 5H37D 4NRWA 3KOXE 4MGKE 4X62M 3T1HM 4GC9A 1NNJA 4ZPXA 5BPVA 4DV3M 1QZMA 4BLCA 3SFZA 2L6OA 4DR5M 1IN4A 4LFCM 5FLXS 1XC8A 1N78A 2R18A 4JI0M 5FTKA 3KXEC 3CTWB 4FWDA 4KLNA 3A42A 4LF4M 4X65M 1FJGM 2HKJA 2CV1A 4LF9M 4GC5A 4B3TM 3K2LA 4PD2A 2A5YB 1XHBA 3VLFB 1R2ZA 1Q3BA 4DUZM 3SAUA 2DVWB 4NSRA 3GLIA 3CF2A 4KHPM 4IBJA 2DWZB 4EIWA 4OU7A 4JI8M 1MX0A 3U6SA 1SXJA 4FVMA 4K0KM 2D7EA 4MGIE 4REZA 1IXRC 2QENA 4LG2A 2R65A 3U61B 3VK7A 1N36M 1QAQA 3VDUA 3HJSA 4L4UA 1Q3CA 3K1JA 5ITXA 3KFUG 3J7BA 4JI4M 4HLQA 1KYIA 4DR1M 4AKIA 3GRRA 4WURA 4LGYA 3BOSA 2R62A 3SATA 4I4LA 4GIPA 5LMNM 1QANA 2HCBA 4AG6A 3WHKA 5DNYA 1JR3A 4LJAA 1YSYA 1N33M 3THGA 1IY1A 4RF1A 2XSZD 3GLHA 4GMQA 4LRSA 4DR6M 2UU9M 4OVZB 1YUBA 3FTEA 4YHHM 2LNHC 4GKJM 2YR0A 3U60A 3FUVA 2CV2A 4B7GA 4FD2A 1TDZA 2DHRA 2DZNB 3KVWA 1PJIA 3AL0C 1E9SA 3VK8A 3LMMA 1I4WA 3AOEA 4W5WA 1W5TA 2D7GA 3FUXA 3J81S 4FWGA 4HL4A 1DGBA 2C9OA 4ITQA 3TL4X 2K47A 1N34M 3J7AS 4GITA 1NJFA 5ITTA 2Z7JA 4M9SA 1E9RA 2VQEM 1PM5A 1L2DA 3U6CA 3HGIA 1IM2A 3W0LB 4DV6M 5FTNA 1QAMA 2UUAM 1HNWM 1QYRA 3HWSA 4LCBA 4JN6A 2O5RA 3GLFA 1SXJC 5EP4A 4AI6A 4FCVA 4B3RM 2C98A 4B3MM 1Z5BA 2RKOA 3DFZA 4LGMA 1VDDA 3GPUA 1QQWA 4NOOB 1G3IA 2D7HA 3GLGA 3FKEA 4CHTB 3RGSA 3AV0A 2QBYA 5KO3A 4AZFA 4AW4A 3RE8A 2QZ4A 2QPAA 2C9CA 4XGIA 5E6JA 3I4VA 3SMSA 2Z4SA 1Z6TA 2JA2A 4LJ5A 3EIEA 3AOGA 3GO8A 2XF3A 4GRIA 4IBBA 3VDPA 2X4AA 4DV0M 2KZUA 3U6LA 3EIHA 2X49A 1L8QA 3TE6A 2C99A 3HJ8A 3T38A 3UK6A 2J7OA 4MH0E 4CGYB 3SBJA 1DGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C58 A;  4KHP M;  4PDI A;  3GQ3 A;  3TWK A;  4JI1 M;  4JI8 M;  3GQ5 A;  1MX0 A;  3U6S A;  4K0K M;  4CIS A;  2XZU A;  3U6E A;  3VK7 A;  1EE8 A;  4AQY M;  1N36 M;  3SAV A;  4G4Q A;  2F5N A;  3U6D A;  1Q3C A;  5ITX A;  3GPP A;  3SAR A;  4OX9 M;  1XMQ M;  2F5S A;  1K82 A;  5IWA M;  1KFV A;  4JI4 M;  2XZF A;  4LF5 M;  4GKK M;  3TWL A;  4DR1 M;  4JV5 M;  3SAS A;  4LF6 M;  1Z5C A;  4DV1 M;  3SBJ A;  1IBM M;  1Z59 A;  4DR3 M;  3SAT A;  4JI7 M;  5LMN M;  1R2Y A;  5ITY A;  2VQF M;  1IBK M;  4DV2 M;  1N33 M;  4JI5 M;  4DR4 M;  1N32 M;  3W0F A;  4LFB M;  4DR6 M;  1K3W A;  2UU9 M;  4YY3 M;  2EA0 A;  2UUC M;  4DV5 M;  1K3X A;  4NXN M;  3GQ4 A;  4YHH M;  3A46 A;  3U6Q A;  4GKJ M;  3T1Y M;  4JYA M;  5LMU M;  4DV7 M;  5ITU A;  4NRV A;  3U6O A;  2OPF A;  1HNZ M;  3J80 S;  1Z5A A;  4PCZ A;  2F5Q A;  1TDZ A;  4DV4 M;  1PJI A;  2UXD M;  4NXM M;  3VK8 A;  3GPX A;  3GPY A;  1L1T A;  1XMO M;  3DOA A;  4PDG A;  3J81 S;  4ITQ A;  3U6M A;  3JAM S;  2ZBK B;  1N34 M;  3J7A S;  5ITT A;  1PM5 A;  4JI6 M;  2VQE M;  1MU5 A;  4X66 M;  1L2D A;  1HNX M;  3U6C A;  4DUY M;  4G4N A;  1J5E M;  1L1Z A;  4G4O A;  5ITX E;  2E5L M;  3JR5 A;  1PJJ A;  4B3S M;  4DV6 M;  2UXC M;  2UXB M;  2UUB M;  2UUA M;  4MB7 A;  1HNW M;  1I94 M;  1L2B A;  1TDH A;  2HHH M;  3A45 A;  3JR4 A;  1IBL M;  4NRW A;  4B3R M;  4B3M M;  1Z5B A;  4X62 M;  2ZM6 M;  3T1H M;  4JI3 M;  3GPU A;  3GP1 A;  1NNJ A;  2F5O A;  2OQ4 A;  5BR8 M;  5IT9 S;  4LF8 M;  4DV3 M;  5ITR A;  2F5P A;  1Q39 A;  1L2C A;  4DR5 M;  4X64 M;  4LFC M;  2Q2E B;  5FLX S;  1XC8 A;  1HR0 M;  4LF7 M;  3U6P A;  4JI0 M;  3GO8 A;  3OTO M;  3TWM A;  4DV0 M;  5A2Q S;  3U6L A;  3A42 A;  4LF4 M;  4X65 M;  2F4V M;  1FJG M;  2HKJ A;  4DR7 M;  4DR2 M;  4LF9 M;  4B3T M;  4LFA M;  4PD2 A;  4G4R A;  4JI2 M;  3SAW A;  1R2Z A;  1Q3B A;  5ITQ A;  4DUZ M;  1XNQ M;  1XNR M;  3SAU A; 
#chains in the Genus database with same CATH topology
 5FTM A;  2M60 A;  3CF0 A;  2AHM A;  1AIP C;  1J09 A;  2EUC A;  1TGU A;  3GQ5 A;  3NWL A;  2XFS A;  3CGW A;  4L8R C;  5KQD A;  1OKS A;  1G41 A;  2I7P A;  3FRH A;  3D8B A;  1JQJ C;  4IBG A;  2DAG A;  2XH9 A;  3CF6 E;  2DAM A;  1NHG C;  3SAV A;  4Z6Y A;  2CHG A;  3U6D A;  1QZE A;  3LCU A;  2L2D A;  2C5R A;  5GKN A;  3QYE A;  3MHV C;  1XMQ M;  2VDB B;  1GVN A;  3M0E A;  2XZF A;  2HAK A;  4LJ7 A;  2R45 A;  2L7H A;  4JV5 M;  5KQ8 A;  4M9X A;  4P16 A;  1WR1 B;  2WSC F;  4FWH A;  4DV1 M;  2JY6 B;  3AOE C;  2XGN A;  3I4Y A;  1XXH A;  4OW0 A;  4D80 A;  3GLI B;  1D0L A;  1Q02 A;  1XWI A;  3SYK A;  2DXI A;  3FYC A;  1TTE A;  3LCV B;  3KDS E;  3LQR A;  5ITY A;  1T3T A;  2DAE A;  3L28 A;  4IJE A;  3K9P A;  4DV2 M;  4LRT A;  1IBK M;  4JI5 M;  3VKG A;  3W0F A;  4PT5 A;  3FYD A;  5KPR A;  4YY3 M;  1IN6 A;  1RU3 A;  1YE9 A;  4M0W A;  2EA0 A;  2UUC M;  1R7R A;  1H6U A;  3TQS A;  3FD9 A;  2V6Z M;  3GQ4 A;  3A46 A;  3U6Q A;  1PJS A;  4HEO A;  1X37 A;  3AJI B;  5LMU M;  4DV7 M;  3HJQ A;  3E9S A;  2R4J A;  1IXS A;  1HQC A;  4NRV A;  2FH0 A;  5KPZ A;  5ITU A;  2OPF A;  1HNZ M;  4AKH A;  1ZAE A;  4IBF A;  4RNA A;  3J80 S;  1GLN A;  4Q7J A;  2F5Q A;  4DV4 M;  1OFI A;  8CAT A;  2HWJ A;  4P17 A;  2ERC A;  1OIZ A;  1LTM A;  3IHP A;  5FTL A;  3GPX A;  1L1T A;  4QNR A;  4G3O A;  1SG9 A;  1ZMU A;  4QHS A;  3SMP A;  3U6M A;  3HU3 A;  1OJL A;  2KA6 B;  3U61 A;  3PFI A;  2ZBK B;  1A5T A;  1TF0 B;  1JB0 F;  3L25 A;  1OIP A;  3E4R A;  1DGH B;  2G8L A;  1GL6 A;  4LJ9 A;  4CJ6 A;  3VFD A;  1HNX M;  3KOZ E;  4I5S A;  1VEG A;  2E5L M;  1PJQ A;  5EP2 A;  4GHL A;  3U60 B;  5DYI A;  2JZ0 A;  2UXC M;  4QNM A;  3L27 A;  1F4I A;  1GJT A;  1NO1 A;  2BJW A;  2LVN C;  4IBE A;  5DYG A;  3R9X B;  4FCW A;  4MB7 A;  1TH4 A;  1R5L A;  2EJS A;  2HL7 A;  3TPZ A;  1I94 M;  3DZD A;  3VKH A;  1TDH A;  1E94 E;  2CE7 A;  2QQ8 A;  4BB9 A;  3A45 A;  4LZJ A;  1DV0 A;  1MN3 A;  4RKU F;  3B7N A;  1NSF A;  2F5O A;  2KXE A;  2QCU A;  3E21 A;  1R4G A;  5IZ7 D;  1IY0 A;  4LF8 M;  3L2A A;  2XSZ A;  1Q39 A;  4OVZ A;  2RGH A;  2DZL A;  3LVW A;  3WHL A;  2JY7 A;  1NV8 A;  1L2C A;  1QDT A;  1NNU C;  2I7N A;  1HR0 M;  3SHG B;  2KZS A;  4LF7 M;  2CHQ A;  2K0B X;  3U6O A;  3OTO M;  2R44 A;  1N77 A;  1C1K A;  2XEP A;  3K8Z A;  3TWM A;  2X8A A;  5C18 A;  2OOA A;  1WXQ A;  4DR2 M;  2EO2 A;  4LFA M;  5C1B A;  1VDL A;  4JI2 M;  3SAW A;  1TR8 A;  2DI0 A;  5ITQ A;  3GLF B;  1XNR M;  1NY5 A;  2GNO A;  4PDI A;  3GQ3 A;  3TWK A;  3C3E A;  3W68 A;  3U5Z A;  2KNZ A;  3GLG B;  3LQQ A;  3J2P B;  1G59 A;  2QBY B;  4CIS A;  3UGJ A;  2RRU A;  3U6E A;  3BBZ A;  1OQY A;  1EE8 A;  4AQY M;  3KS8 A;  3HKP A;  3UZU A;  3M6A A;  1IN5 A;  4G4Q A;  1VEK A;  5EXT A;  1W5S A;  2LVA A;  3LW5 F;  4IBI A;  2C96 A;  2F5S A;  1LV7 A;  1WGN A;  2KNV A;  4II7 A;  3RGP A;  5IWA M;  1WIV A;  1KFV A;  3Q8X A;  1GJS A;  1G71 A;  4R7G A;  4LF5 M;  3J27 B;  4GKK M;  2DZO B;  4I8O A;  4L78 A;  3MK6 A;  2JY8 A;  1NJG A;  4RF0 A;  1Z5C A;  4LF6 M;  3FUT A;  3PNV A;  3AKZ A;  4JI7 M;  1IQP A;  3FUU A;  1R2Y A;  3AFH A;  3SHF A;  4AG5 A;  2KRU A;  3B9P A;  3GRY A;  2BJV A;  4IIW A;  4WP2 A;  4KT0 F;  4B7H A;  2VQF M;  4IBK A;  3UMM A;  1V92 A;  3KOW E;  4DR4 M;  2LWX A;  4LFB M;  1IY2 A;  2DAI A;  2LXE A;  2Z4R A;  2CWB A;  2CUZ A;  3ZH9 B;  1IXZ A;  4GH9 A;  4JYA M;  2Y20 A;  1GKI A;  3HX3 A;  4LJ8 A;  3HHW A;  2JNH A;  3D8L A;  4R3D A;  3QWL A;  1BVS A;  3MJ5 A;  2DWN A;  2KHH A;  4NL4 H;  2MH8 A;  1ZMV A;  3HY5 A;  2CRU A;  1IN7 A;  1XXH B;  2QSF X;  4FW9 A;  4WW0 A;  4IBD A;  2UXD M;  1QAO A;  5EXP A;  3SC3 A;  3L29 A;  4QOS A;  1V34 A;  3ZCB B;  3GPY A;  4L15 A;  2Z3X A;  3K9O A;  2Y21 A;  5JI3 E;  1SXJ D;  1SXJ B;  3KSJ A;  1HQY E;  2M5Z A;  3JAM S;  3KOY E;  4BBA A;  3B89 A;  2KEB A;  1VEJ A;  2QHO B;  3I51 A;  2LVO C;  3T15 A;  4JI6 M;  3QYB A;  2JXN A;  3PNY A;  4DUY M;  4G4N A;  1J5E M;  1L1Z A;  5EP1 A;  4G4O A;  1IXS B;  4KOD A;  4B3S M;  1IFY A;  2QNJ A;  3KP0 E;  2XFT A;  2CP8 A;  3K92 A;  2UXB M;  2FS1 A;  2MJ5 B;  1IN8 A;  4F2L A;  2UUB M;  5EXX A;  2R6F A;  1GO5 A;  2K6B A;  3HZJ A;  3H4M A;  3PVS A;  4GEW A;  1T6O A;  4MGY E;  3JR4 A;  4L16 A;  1VQ1 A;  3ILK A;  1NY6 A;  2DKL A;  1MJG M;  1JR3 D;  1ZQ9 A;  2FE8 A;  2O01 F;  2O25 A;  2VF7 A;  4JI3 M;  3GP1 A;  2ZM6 M;  5BR8 M;  2OQ4 A;  5IT9 S;  1UM8 A;  2LHG A;  2J7N A;  5ITR A;  2F5P A;  1ZV1 A;  4MM3 B;  3GLH B;  5FTJ A;  3FUW A;  4XBO A;  2L7I A;  4X64 M;  4KO8 A;  2Q2E B;  1DO0 A;  2FNA A;  2L4F A;  3F92 A;  5EJC A;  1G8P A;  3U6P A;  4MGH A;  2LH0 A;  4DR7 M;  5A2Q S;  2F4V M;  4QOZ C;  2CHV A;  1XB2 B;  1GL7 A;  5EXS A;  1T43 A;  1N75 A;  3DA1 A;  3HU2 A;  4Z8X A;  1Y8G A;  7CAT A;  3HU1 A;  4G4R A;  5KPT A;  3GRU A;  2J5Y A;  4A3V B;  3QAU A;  2L09 A;  1XNQ M;  3KP1 E;  1NV9 A;  3T6P A;  2DEN A;  3C58 A;  1NVM A;  2ZAO A;  1AUA A;  3IEC A;  4F1I A;  4JI1 M;  2FOI C;  4IJF A;  2R46 A;  3HHZ A;  2W82 A;  1QVR A;  2RGO A;  3PXG A;  3GLG E;  3IG8 A;  3V76 A;  4QHT A;  2XZU A;  2VII A;  2JP7 A;  4D82 A;  2F5N A;  1DGH A;  3GPP A;  2ZAN A;  3SAR A;  1P3Q Q;  1WHC A;  4OX9 M;  4G6Z A;  3L26 A;  2YFQ A;  1WJ7 A;  1K82 A;  4JXJ A;  4LY6 A;  1J7K A;  2XLJ A;  2KRK A;  1S3S A;  4LZZ A;  3TWL A;  3W67 A;  4Y28 F;  2P5T A;  3I04 M;  2JWS A;  1OAI A;  2JZ1 A;  3SAS A;  2G5G X;  2EKF A;  1IBM M;  1Z59 A;  2MR9 A;  1TH2 A;  4DR3 M;  3GRV A;  3KS4 A;  3IG5 A;  4B08 A;  3U5Z B;  4IBC A;  1WGL A;  4AKG A;  1N32 M;  1PJT A;  1HT2 E;  2CFO A;  2BWB A;  2FFJ A;  3ZC7 B;  1K3W A;  2YQZ A;  2H1R A;  3FE3 A;  4NSO B;  2DWM A;  4DV5 M;  1K3X A;  2NQ8 C;  4NXN M;  2V1C A;  3T1Y M;  4GHA A;  4MGZ E;  4TUW A;  1UFZ A;  5JI2 E;  3HHX A;  5EP3 A;  2BNK A;  2B3T A;  4M9Z A;  1Z5A A;  4PCZ A;  2QP9 X;  3KW6 A;  1TH3 A;  3HHY A;  5F3W A;  4D81 A;  2G3Q A;  3B74 A;  4NXM M;  1ORY B;  1OFH A;  1XXH E;  1XMO M;  2LHC A;  1EIJ A;  2JUJ A;  3GLI E;  3DOA A;  4M0D A;  1V33 A;  4PDG A;  3A98 B;  3M7G A;  3LVV A;  1SXJ E;  4LJ4 A;  2WSF F;  3NBI A;  4XK8 F;  1DGF A;  1PGY A;  2DAK A;  3Q8G A;  2DWL A;  4I81 A;  4B7F A;  1G4A E;  3I01 M;  1NHW C;  2BWE A;  1D2N A;  1FNN A;  2Y0Q A;  1MU5 A;  2R4E A;  5EQT A;  3ZQJ A;  4X66 M;  2V1U A;  2CV0 A;  2ZAM A;  3C3D A;  2CEA A;  5ITX E;  3JR5 A;  2Z8Y M;  4LJ6 A;  1DO2 A;  1PJJ A;  1QDR A;  3FTF A;  3UJN A;  3H4J A;  3RFW A;  3B7Z A;  1HT1 E;  4S12 A;  5IRE B;  3R8F A;  2KW0 A;  2Y0T A;  3SYL A;  3FTC A;  1L2B A;  5FSW A;  4CIZ A;  1E32 A;  1R6B X;  3KSX A;  4DBG B;  1KSF X;  2HHH M;  2YNM D;  5E26 A;  4FCT A;  1IBL M;  3FTD A;  5H37 D;  4NRW A;  3KOX E;  4MGK E;  4X62 M;  2H5X A;  3T1H M;  4GC9 A;  1NNJ A;  4NC6 A;  4ZPX A;  1JR3 E;  5BPV A;  4DV3 M;  1QZM A;  2APL A;  4BLC A;  3SFZ A;  2L6O A;  4DR5 M;  1IN4 A;  4LFC M;  2LVQ D;  3GLH E;  5FLX S;  1XC8 A;  1N78 A;  2R18 A;  3E46 A;  4JI0 M;  5FTK A;  3KXE C;  3CTW B;  5L8R F;  4FWD A;  4KLN A;  3A42 A;  4LF4 M;  4X65 M;  4R71 A;  1FJG M;  2HKJ A;  2CV1 A;  4LF9 M;  4GC5 A;  4B3T M;  1PRB A;  3K2L A;  4PD2 A;  2A5Y B;  2WSE F;  1XHB A;  3VLF B;  1R2Z A;  1Q3B A;  3C9P A;  2GQF A;  4DUZ M;  2MGW A;  3SAU A;  2DVW B;  4NSR A;  3GLI A;  3CF2 A;  4KHP M;  1EFU B;  4IBJ A;  2DWZ B;  4EIW A;  4OU7 A;  1YLA A;  2MRO B;  1MX0 A;  3U6S A;  4JI8 M;  1SXJ A;  4FVM A;  4K0K M;  2D7E A;  3B7Q A;  4MGI E;  4REZ A;  1IXR C;  2QEN A;  4LG2 A;  2R65 A;  3U61 B;  2L4E A;  3VK7 A;  1N36 M;  1QAQ A;  3VDU A;  4L6V 6;  3HJS A;  5DFL A;  2OO9 A;  4L4U A;  1Q3C A;  3K1J A;  5ITX A;  3KFU G;  3MMP A;  3J7B A;  2K9D A;  4HLQ A;  4JI4 M;  1KYI A;  4DR1 M;  4AKI A;  3GRR A;  4WUR A;  4LGY A;  3BOS A;  2R62 A;  3SAT A;  4I4L A;  4GIP A;  3GLF E;  1QAN A;  2HCB A;  4AG6 A;  3WHK A;  5DNY A;  5LMN M;  1JR3 A;  4LJA A;  1GAB A;  1YSY A;  1N33 M;  3THG A;  1IY1 A;  4RF1 A;  2XSZ D;  2LBC A;  1OTR A;  3GLH A;  4GMQ A;  4LRS A;  4OVZ B;  3BXW A;  1YUB A;  2UU9 M;  4DR6 M;  1C7Y A;  3FTE A;  2OOB A;  4YHH M;  2LNH C;  4GKJ M;  2R0I A;  2YR0 A;  3U60 A;  3FUV A;  2CV2 A;  1HJP A;  4B7G A;  4FD2 A;  1TDZ A;  1D0M A;  2DHR A;  2WZJ A;  2DZN B;  2VF8 A;  3KVW A;  2JY5 A;  1PJI A;  2DHY A;  3AL0 C;  1E9S A;  3VK8 A;  3LMM A;  1OAO C;  1I4W A;  1QUS A;  3AOE A;  4W5W A;  1W5T A;  2D7G A;  3FUX A;  3J81 S;  4FWG A;  4HL4 A;  1DGB A;  2C9O A;  4ITQ A;  1D0K A;  3TL4 X;  2K47 A;  1N34 M;  3J7A S;  4GIT A;  1NJF A;  5ITT A;  2Z7J A;  2EKK A;  1E9R A;  4M9S A;  1VG5 A;  2VQE M;  1PM5 A;  1L2D A;  3U6C A;  3HGI A;  1IM2 A;  4ANR A;  3W0L B;  2KDL A;  4DV6 M;  5FTN A;  1QAM A;  1CUK A;  2UUA M;  1HNW M;  1QYR A;  3HWS A;  4LCB A;  4JN6 A;  2O5R A;  4UN2 B;  3GLF A;  1SXJ C;  2ZTD A;  5EP4 A;  4AI6 A;  4FCV A;  4B3R M;  2LVP C;  2C98 A;  4B3M M;  1Z5B A;  2RKO A;  3DFZ A;  4LGM A;  1VDD A;  3GPU A;  1QQW A;  4NOO B;  1G3I A;  2D7H A;  3GLG A;  3FKE A;  4CHT B;  3RGS A;  3AV0 A;  2QBY A;  3NBX X;  5KO3 A;  1ZMW A;  4AZF A;  2LTU A;  4AW4 A;  3RE8 A;  2QZ4 A;  2QPA A;  2C9C A;  4XGI A;  5E6J A;  3I4V A;  3SMS A;  2DNA A;  2Z4S A;  1Z6T A;  2JA2 A;  2KNA A;  3EIE A;  3AOG A;  4LJ5 A;  3GO8 A;  1QUT A;  2XF3 A;  4GRI A;  4IBB A;  3VDP A;  2N35 A;  2X4A A;  2KZU A;  4DV0 M;  3U6L A;  2ZTC A;  3EIH A;  2X49 A;  1L8Q A;  3TE6 A;  3FRI A;  2C99 A;  3HJ8 A;  3T38 A;  3UK6 A;  2J7O A;  4MH0 E;  4CGY B;  3SBJ A;  1DGG A; 
#chains in the Genus database with same CATH homology
 5FTM A;  2M60 A;  3CF0 A;  2AHM A;  1J09 A;  2EUC A;  1TGU A;  3GQ5 A;  3NWL A;  2XFS A;  4L8R C;  5KQD A;  1G41 A;  2I7P A;  3D8B A;  1JQJ C;  4IBG A;  2XH9 A;  3CF6 E;  1NHG C;  3SAV A;  4Z6Y A;  2CHG A;  3U6D A;  2C5R A;  5GKN A;  3MHV C;  1XMQ M;  3M0E A;  1GVN A;  2XZF A;  4LJ7 A;  2R45 A;  2L7H A;  4JV5 M;  5KQ8 A;  4M9X A;  4P16 A;  4DV1 M;  4FWH A;  3AOE C;  2XGN A;  3I4Y A;  1XXH A;  4OW0 A;  4D80 A;  3GLI B;  1XWI A;  3SYK A;  2DXI A;  3FYC A;  5ITY A;  3KDS E;  3LQR A;  1T3T A;  3L28 A;  4IJE A;  4DV2 M;  1IBK M;  4LRT A;  3VKG A;  4JI5 M;  3W0F A;  4PT5 A;  3FYD A;  5KPR A;  4YY3 M;  1IN6 A;  1YE9 A;  4M0W A;  2EA0 A;  2UUC M;  1R7R A;  1H6U A;  3TQS A;  3FD9 A;  2V6Z M;  3GQ4 A;  3A46 A;  3U6Q A;  1X37 A;  3AJI B;  5LMU M;  4DV7 M;  3HJQ A;  3E9S A;  2R4J A;  1HQC A;  4NRV A;  5KPZ A;  5ITU A;  2OPF A;  1HNZ M;  4AKH A;  1ZAE A;  4IBF A;  4RNA A;  3J80 S;  1GLN A;  2F5Q A;  4DV4 M;  1OFI A;  8CAT A;  2ERC A;  5FTL A;  3GPX A;  1L1T A;  4QNR A;  4QHS A;  3SMP A;  3U6M A;  3HU3 A;  1OJL A;  2KA6 B;  3U61 A;  3PFI A;  2ZBK B;  3L25 A;  3E4R A;  1DGH B;  2G8L A;  1GL6 A;  4LJ9 A;  1HNX M;  3VFD A;  3KOZ E;  4I5S A;  4GHL A;  2E5L M;  5EP2 A;  3U60 B;  5DYI A;  2UXC M;  4QNM A;  3L27 A;  4IBE A;  2BJW A;  5DYG A;  3R9X B;  4FCW A;  4MB7 A;  1TH4 A;  3TPZ A;  2HL7 A;  1I94 M;  3DZD A;  3VKH A;  1TDH A;  1E94 E;  2CE7 A;  4BB9 A;  3A45 A;  4LZJ A;  1NSF A;  2F5O A;  2KXE A;  2QCU A;  5IZ7 D;  1IY0 A;  4LF8 M;  3L2A A;  2XSZ A;  1Q39 A;  4OVZ A;  2RGH A;  3LVW A;  3WHL A;  1L2C A;  1NNU C;  2I7N A;  1HR0 M;  3SHG B;  2KZS A;  4LF7 M;  2CHQ A;  3U6O A;  3OTO M;  1N77 A;  1C1K A;  2XEP A;  3K8Z A;  3TWM A;  2X8A A;  5C18 A;  1WXQ A;  4DR2 M;  2EO2 A;  4LFA M;  5C1B A;  4JI2 M;  3SAW A;  5ITQ A;  3GLF B;  1XNR M;  1NY5 A;  4PDI A;  3GQ3 A;  3TWK A;  3U5Z A;  3GLG B;  3LQQ A;  3J2P B;  1G59 A;  2QBY B;  4CIS A;  3UGJ A;  3U6E A;  1EE8 A;  4AQY M;  3KS8 A;  3HKP A;  3UZU A;  3M6A A;  1IN5 A;  4G4Q A;  5EXT A;  1W5S A;  4IBI A;  2C96 A;  2F5S A;  1LV7 A;  4II7 A;  3RGP A;  5IWA M;  1KFV A;  3Q8X A;  4R7G A;  4LF5 M;  4GKK M;  3J27 B;  2DZO B;  4I8O A;  4L78 A;  3MK6 A;  1NJG A;  4RF0 A;  1Z5C A;  4LF6 M;  3FUT A;  3PNV A;  3AKZ A;  4JI7 M;  1IQP A;  3FUU A;  1R2Y A;  3AFH A;  3SHF A;  4AG5 A;  2KRU A;  3B9P A;  3GRY A;  2BJV A;  4IIW A;  4B7H A;  2VQF M;  4IBK A;  3UMM A;  3KOW E;  4DR4 M;  2LWX A;  4LFB M;  1IY2 A;  2LXE A;  2Z4R A;  2CUZ A;  3ZH9 B;  1IXZ A;  4GH9 A;  4JYA M;  2Y20 A;  1GKI A;  4LJ8 A;  3HHW A;  3D8L A;  4R3D A;  3QWL A;  3MJ5 A;  2DWN A;  4NL4 H;  1IN7 A;  1XXH B;  4WW0 A;  4FW9 A;  4IBD A;  2UXD M;  1QAO A;  5EXP A;  3SC3 A;  3L29 A;  4QOS A;  3ZCB B;  3GPY A;  2Z3X A;  4L15 A;  2Y21 A;  5JI3 E;  1SXJ D;  1SXJ B;  3KSJ A;  1HQY E;  2M5Z A;  3JAM S;  3KOY E;  4BBA A;  2KEB A;  3I51 A;  3T15 A;  4JI6 M;  4DUY M;  3PNY A;  4G4N A;  1J5E M;  1L1Z A;  5EP1 A;  4G4O A;  1IXS B;  4KOD A;  4B3S M;  3KP0 E;  2UXB M;  2XFT A;  3K92 A;  1IN8 A;  2UUB M;  5EXX A;  3PVS A;  3H4M A;  4MGY E;  3JR4 A;  4L16 A;  3ILK A;  1NY6 A;  2FE8 A;  1JR3 D;  1ZQ9 A;  2ZM6 M;  4JI3 M;  5IT9 S;  3GP1 A;  2OQ4 A;  5BR8 M;  1UM8 A;  2J7N A;  5ITR A;  2F5P A;  4MM3 B;  3GLH B;  5FTJ A;  3FUW A;  4XBO A;  2L7I A;  4X64 M;  4KO8 A;  2Q2E B;  1DO0 A;  2FNA A;  5EJC A;  1G8P A;  3U6P A;  4MGH A;  2LH0 A;  4DR7 M;  5A2Q S;  2F4V M;  4QOZ C;  2CHV A;  5EXS A;  1GL7 A;  3HU2 A;  1N75 A;  3DA1 A;  4Z8X A;  7CAT A;  3HU1 A;  4G4R A;  5KPT A;  3GRU A;  4A3V B;  3QAU A;  2L09 A;  1XNQ M;  3KP1 E;  3C58 A;  1NVM A;  2ZAO A;  4JI1 M;  2FOI C;  4IJF A;  2R46 A;  3HHZ A;  2W82 A;  1QVR A;  2RGO A;  3PXG A;  3IG8 A;  2XZU A;  4QHT A;  2VII A;  4D82 A;  2F5N A;  1DGH A;  3GPP A;  2ZAN A;  3SAR A;  4OX9 M;  4G6Z A;  3L26 A;  2YFQ A;  1K82 A;  4JXJ A;  4LY6 A;  1J7K A;  2XLJ A;  2KRK A;  1S3S A;  4LZZ A;  3TWL A;  2P5T A;  3SAS A;  2G5G X;  1IBM M;  1Z59 A;  4DR3 M;  1TH2 A;  3GRV A;  3KS4 A;  3IG5 A;  4B08 A;  3U5Z B;  4IBC A;  4AKG A;  1N32 M;  1HT2 E;  2CFO A;  3ZC7 B;  2FFJ A;  1K3W A;  2YQZ A;  2H1R A;  4NSO B;  2DWM A;  4DV5 M;  1K3X A;  2NQ8 C;  4NXN M;  2V1C A;  3T1Y M;  4GHA A;  4MGZ E;  4TUW A;  5JI2 E;  3HHX A;  5EP3 A;  2BNK A;  4M9Z A;  4PCZ A;  1Z5A A;  2QP9 X;  3KW6 A;  1TH3 A;  3HHY A;  5F3W A;  4D81 A;  4NXM M;  1ORY B;  1OFH A;  1XMO M;  3DOA A;  4M0D A;  4PDG A;  3A98 B;  3M7G A;  3LVV A;  1SXJ E;  4LJ4 A;  3NBI A;  1DGF A;  2DWL A;  4I81 A;  4B7F A;  1G4A E;  1NHW C;  1D2N A;  1FNN A;  2Y0Q A;  1MU5 A;  2R4E A;  5EQT A;  2V1U A;  4X66 M;  2CV0 A;  2ZAM A;  2CEA A;  5ITX E;  3JR5 A;  4LJ6 A;  1PJJ A;  1DO2 A;  3FTF A;  3UJN A;  3RFW A;  1HT1 E;  4S12 A;  5IRE B;  3R8F A;  2KW0 A;  2Y0T A;  3SYL A;  3FTC A;  1L2B A;  5FSW A;  1E32 A;  1R6B X;  3KSX A;  1KSF X;  2HHH M;  2YNM D;  5E26 A;  4FCT A;  1IBL M;  3FTD A;  5H37 D;  4NRW A;  3KOX E;  4MGK E;  4X62 M;  3T1H M;  4GC9 A;  1NNJ A;  4ZPX A;  5BPV A;  4DV3 M;  1QZM A;  4BLC A;  3SFZ A;  2L6O A;  4DR5 M;  1IN4 A;  4LFC M;  5FLX S;  1XC8 A;  1N78 A;  2R18 A;  4JI0 M;  5FTK A;  3KXE C;  3CTW B;  4FWD A;  4KLN A;  3A42 A;  4LF4 M;  4X65 M;  1FJG M;  2HKJ A;  2CV1 A;  4LF9 M;  4GC5 A;  4B3T M;  3K2L A;  4PD2 A;  2A5Y B;  1XHB A;  3VLF B;  1R2Z A;  1Q3B A;  4DUZ M;  3SAU A;  2DVW B;  4NSR A;  3GLI A;  3CF2 A;  4KHP M;  4IBJ A;  2DWZ B;  4EIW A;  4OU7 A;  4JI8 M;  1MX0 A;  3U6S A;  1SXJ A;  4FVM A;  4K0K M;  2D7E A;  4MGI E;  4REZ A;  1IXR C;  2QEN A;  4LG2 A;  2R65 A;  3U61 B;  3VK7 A;  1N36 M;  1QAQ A;  3VDU A;  3HJS A;  4L4U A;  1Q3C A;  3K1J A;  5ITX A;  3KFU G;  3J7B A;  4JI4 M;  4HLQ A;  1KYI A;  4DR1 M;  4AKI A;  3GRR A;  4WUR A;  4LGY A;  3BOS A;  2R62 A;  3SAT A;  4I4L A;  4GIP A;  5LMN M;  1QAN A;  2HCB A;  4AG6 A;  3WHK A;  5DNY A;  1JR3 A;  4LJA A;  1YSY A;  1N33 M;  3THG A;  1IY1 A;  4RF1 A;  2XSZ D;  3GLH A;  4GMQ A;  4LRS A;  4DR6 M;  2UU9 M;  4OVZ B;  1YUB A;  3FTE A;  4YHH M;  2LNH C;  4GKJ M;  2YR0 A;  3U60 A;  3FUV A;  2CV2 A;  4B7G A;  4FD2 A;  1TDZ A;  2DHR A;  2DZN B;  3KVW A;  1PJI A;  3AL0 C;  1E9S A;  3VK8 A;  3LMM A;  1I4W A;  3AOE A;  4W5W A;  1W5T A;  2D7G A;  3FUX A;  3J81 S;  4FWG A;  4HL4 A;  1DGB A;  2C9O A;  4ITQ A;  3TL4 X;  2K47 A;  1N34 M;  3J7A S;  4GIT A;  1NJF A;  5ITT A;  2Z7J A;  4M9S A;  1E9R A;  2VQE M;  1PM5 A;  1L2D A;  3U6C A;  3HGI A;  1IM2 A;  3W0L B;  4DV6 M;  5FTN A;  1QAM A;  2UUA M;  1HNW M;  1QYR A;  3HWS A;  4LCB A;  4JN6 A;  2O5R A;  3GLF A;  1SXJ C;  5EP4 A;  4AI6 A;  4FCV A;  4B3R M;  2C98 A;  4B3M M;  1Z5B A;  2RKO A;  3DFZ A;  4LGM A;  1VDD A;  3GPU A;  1QQW A;  4NOO B;  1G3I A;  2D7H A;  3GLG A;  3FKE A;  4CHT B;  3RGS A;  3AV0 A;  2QBY A;  5KO3 A;  4AZF A;  4AW4 A;  3RE8 A;  2QZ4 A;  2QPA A;  2C9C A;  4XGI A;  5E6J A;  3I4V A;  3SMS A;  2Z4S A;  1Z6T A;  2JA2 A;  4LJ5 A;  3EIE A;  3AOG A;  3GO8 A;  2XF3 A;  4GRI A;  4IBB A;  3VDP A;  2X4A A;  4DV0 M;  2KZU A;  3U6L A;  3EIH A;  2X49 A;  1L8Q A;  3TE6 A;  2C99 A;  3HJ8 A;  3T38 A;  3UK6 A;  2J7O A;  4MH0 E;  4CGY B;  3SBJ A;  1DGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...