1ORYB

Flagellar export chaperone in complex with its cognate binding partner
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
b'NVDFAKEMTEFTKYQIRMQSGVAMLAQANALPQLVLQLLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flagellar protein FliS
publication title Similar modes of polypeptide recognition by export chaperones in flagellar biosynthesis and type III secretion
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Chaperone
total genus 14
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2003-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.410 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1oryB00
1ORYB
chains in the Genus database with same CATH superfamily
2D7EA 1WIVA 4I5SA 1S3SA 5L8RF 3DZDA 3JAMS 2C5RA 1TR8A 2JZ1A 4AG5A 3IG8A 4XK8F 2QSFX 4MM3B 4LFAM 3U61A 1T6OA 1QAQA 5DYGA 1JR3A 1ZMWA 2DAGA 3HU1A 1HQYE 1D0KA 4LG2A 1DV0A 3QWLA 3FTDA 3LVWA 5KQDA 1MU5A 1OJLA 2KRUA 3MJ5A 4OW0A 8CATA 3VKHA 4LFCM 2P5TA 3FD9A 3FUWA 2RGHA 5EXTA 3SC3A 4YY3M 1XNQM 1MX0A 4B3SM 2KNVA 3EIHA 4AI6A 2KNZA 4DR7M 4LGYA 2HCBA 2H1RA 3GRUA 3L27A 5FTMA 2UUAM 3Q8GA 1GLNA 3IHPA 3HJQA 1L8QA 5DFLA 3H4JA 2DHYA 3KOZE 4LJ6A 4DV3M 4G4OA 3L2AA 3M0EA 1GJSA 4MGKE 5BR8M 4LCBA 4DV4M 4LF8M 4I4LA 3CF6E 1L1TA 2J5YA 2DENA 2K0BX 3A45A 5EXXA 1KFVA 2BJWA 4IBKA 2V1UA 3GLIA 3FE3A 2CV2A 2LTUA 4JV5M 1W5SA 4JI0M 1YE9A 2KRKA 3J80S 3HKPA 2DHRA 3U6OA 3GLGA 4BB9A 3SAUA 1XWIA 1PJQA 2DAMA 2LVAA 2ZTDA 1NNUC 3PNVA 1IN5A 1VEJA 5KPZA 4IBBA 4IJFA 5LMNM 1IN8A 1OTRA 4LF6M 2WSCF 3T15A 3T6PA 1TF0B 1GO5A 1XHBA 1VG5A 1D2NA 2DZOB 3SATA 4RF1A 3LMMA 1HNXM 1P3QQ 5KQ8A 3U5ZB 4NC6A 4NOOB 2LVPC 1HNZM 4IJEA 1NJFA 4HEOA 4IBFA 4MH0E 1QZEA 3K8ZA 4DV2M 2Y0TA 2K6BA 3SAVA 1HJPA 3AV0A 3KOWE 1FJGM 4B3RM 1OFHA 1N33M 1XC8A 3LCUA 2F5PA 2QP9X 1DGHA 3GRVA 4D80A 2UXDM 3PVSA 4KT0F 3U61B 3NBIA 4QOZC 2LH0A 2L4EA 4GRIA 1WGLA 4L6V6 3GLFA 4LZZA 2VQEM 2LHGA 4B3MM 4FCVA 5EXSA 1NV9A 4PCZA 4GMQA 3U6PA 1T43A 4OU7A 3J2PB 5A2QS 2DWNA 2EKFA 4FWGA 4GC5A 2X49A 1L2DA 2KZSA 1W5TA 1SXJA 2APLA 2XF3A 3FUVA 1G59A 1IBLM 2XH9A 4DUYM 2R62A 4MB7A 2VDBB 3QYEA 1EIJA 3GQ3A 4JI2M 2MGWA 3HZJA 1TDHA 4XGIA 2XZFA 2JY6B 1XXHE 2ZANA 4LJ8A 1XMQM 2WSEF 3UJNA 5KPTA 1MN3A 5ITUA 3AOEA 1F4IA 2FNAA 1R5LA 4D82A 1J09A 2CUZA 3I51A 3GLIB 1K82A 2QQ8A 4DBGB 2HL7A 1JQJC 3U6QA 3GLGB 2JWSA 3T1HM 1QAOA 2WSFF 2DZLA 3QYBA 1XB2B 3TWLA 1Q02A 2EO2A 2EUCA 1GL6A 4B7FA 1WR1B 1PRBA 2CHQA 4YHHM 2OPFA 4GHLA 1J7KA 4FWDA 3KP0E 4MGIE 4R7GA 2BWEA 3VK8A 2HAKA 4L16A 4REZA 2A5YB 3WHKA 1JR3D 3CF2A 3DA1A 2L7IA 3FKEA 4GHAA 1K3XA 2XFTA 3I4VA 3L29A 4CIZA 5C18A 3GLHA 2M60A 2Z4SA 5FSWA 1WJ7A 5FTKA 3HWSA 3HHYA 3CF0A 2DWMA 4LGMA 4CJ6A 5ITXA 2CWBA 4LFBM 1DGHB 3GPPA 3GPXA 4I81A 3SBJA 3TPZA 4IBCA 2LXEA 3B7ZA 3GLFB 1SXJC 3H4MA 4IBJA 2CHGA 1TH3A 2J7OA 4RNAA 4XBOA 2Z3XA 2MH8A 2CHVA 4AQYM 3SYKA 2LVNC 4W5WA 3VDUA 1OAIA 2QENA 2G8LA 3J7AS 5IWAM 4DR1M 4B08A 2OO9A 1N78A 1SXJB 3I4YA 4M9XA 1V33A 3AOEC 3MHVC 3BBZA 1TTEA 2L2DA 3PNYA 4LZJA 1HR0M 1QUTA 1DO0A 4LF5M 4OVZB 1QDRA 2XZUA 1IXSA 5ITRA 1QUSA 2H5XA 4JI5M 2XGNA 4CGYB 1IFYA 2RKOA 4L8RC 2HHHM 1Z6TA 3C3DA 4B7GA 4FCTA 4JN6A 1PGYA 3J27B 1Z5AA 2KZUA 3JR5A 2QCUA 4Y28F 4DR4M 1PJTA 2V6ZM 3BOSA 4HL4A 4I8OA 3D8BA 2I7PA 1NY6A 4NSRA 1GVNA 3VLFB 3SYLA 5KPRA 1AIPC 1DGBA 1EFUB 2JXNA 4DR2M 3K92A 1GKIA 2F5SA 2GQFA 1GABA 4IBEA 1VQ1A 3W0FA 2XFSA 3GO8A 2Y21A 2EA0A 3ZC7B 1QAMA 1TH2A 1E32A 3GP1A 1ORYB 2C98A 3M7GA 2EJSA 5FTLA 2OOBA 4KHPM 3GLHB 2EKKA 2QHOB 4JI1M 2W82A 1QZMA 3KVWA 1OFIA 2OQ4A 2Z7JA 4Q7JA 4LJAA 1G4AE 3L25A 1QVRA 3FRHA 4IBIA 4KO8A 3UK6A 1VEKA 2R4EA 3U60A 4Z8XA 4X65M 1SXJD 1V92A 2XSZA 3K1JA 1WGNA 2FOIC 2LVOC 2QZ4A 2D7GA 4BLCA 2KHHA 4P17A 7CATA 3L26A 4F2LA 1ZAEA 2I7NA 3GRYA 1R6BX 1NNJA 3ZH9B 2F5NA 2F4VM 1GJTA 1G71A 2L6OA 3K2LA 4M9SA 4AG6A 2UUCM 3UGJA 4WP2A 2OOAA 4JI8M 4GKJM 4B7HA 4M0DA 4DUZM 2WZJA 4IIWA 1IQPA 4NRWA 3HU3A 2DKLA 2XEPA 3GRRA 3LW5F 1IN6A 4NSOB 4P16A 5ITTA 1R2ZA 1OIZA 1IXZA 3SASA 1DGFA 1IN7A 2CFOA 4MGYE 1KYIA 1XXHA 1ZQ9A 2E5LM 1LTMA 2UXBM 3CTWB 1E9RA 2KEBA 2K9DA 3KS4A 4HLQA 2F5OA 3A98B 4LF7M 1V34A 1L2CA 2JY8A 1N36M 3THGA 2O01F 3ZQJA 3GQ4A 4NXMM 4GITA 1XNRM 1ZMVA 3HHZA 4AKGA 4QNRA 2B3TA 1WXQA 1ZMUA 3GPUA 3W0LB 3I04M 1IM2A 1YUBA 2F5QA 2HKJA 3VDPA 2JY5A 3W68A 3FYDA 5EP3A 4LJ7A 1QDTA 2CRUA 3HHWA 4AKIA 3D8LA 4JI6M 4DR6M 4NXNM 3FUUA 2HWJA 3E4RA 1N77A 3U6DA 1IXRC 2L09A 4LJ9A 3U6LA 1J5EM 4IBGA 3SMSA 1NY5A 3QAUA 4LRSA 1Q39A 1NSFA 2JP7A 2MR9A 3FUXA 1I4WA 4IBDA 3J81S 1IN4A 4OX9M 1L2BA 2X4AA 2ZM6M 2DNAA 3B9PA 5E26A 2KXEA 2DVWB 3CGWA 1L1ZA 4LRTA 2QNJA 2K47A 1N34M 4PD2A 4WURA 3LQQA 1NHWC 4ANRA 5EQTA 3SAWA 1UM8A 3FRIA 1HQCA 2JUJA 3TQSA 3L28A 3KSXA 5EJCA 1NVMA 3U6EA 1LV7A 2DI0A 4II7A 4LY6A 5EP4A 4AZFA 3VK7A 2UXCM 4DV0M 4JXJA 5LMUM 4DV6M 5C1BA 3SARA 5IREB 2DAIA 3VKGA 3KW6A 2VIIA 4X62M 2C99A 4DR5M 2LVQD 3LQRA 3HX3A 2M5ZA 3Q8XA 1Z5CA 1IBMM 4KODA 1TH4A 3KOYE 3KS8A 4LJ4A 1D0LA 2UUBM 1XXHB 4PDIA 1Z5BA 2YR0A 2Z8YM 1Q3CA 2X8AA 3FYCA 1N75A 3PFIA 3FTEA 2G5GX 2RRUA 4DR3M 1Y8GA 2DWZB 4QHSA 2JNHA 2C9CA 4GIPA 4RF0A 4G4RA 2BWBA 3HU2A 4EIWA 3U6SA 1C7YA 2QBYA 4RKUF 3TL4X 3UMMA 3U5ZA 2YNMD 3DFZA 3I01M 2JZ0A 4GKKM 3SHFA 1Q3BA 3HGIA 2R0IA 2Y0QA 4B3TM 2GNOA 2DAEA 2R46A 4FWHA 5JI3E 1K3WA 2ERCA 4FVMA 5IT9S 2CEAA 4R71A 3PXGA 2UU9M 2Q2EB 2FFJA 1G41A 3IG5A 4ITQA 3M6AA 3VFDA 2XSZD 1Z59A 5IZ7D 1OKSA 1KSFX 2ZAMA 4PT5A 3SMPA 1PJSA 3FUTA 4CHTB 3B7QA 5FLXS 1YSYA 3KXEC 3KDSE 4PDGA 2L4FA 4A3VB 2MROB 2KW0A 2FS1A 4S12A 1A5TA 2D7HA 1N32M 1JR3E 3B7NA 3TWKA 2R44A 3ILKA 3AJIB 3E9SA 4D81A 3AL0C 4G3OA 5EP2A 4NL4H 3MMPA 2DAKA 2R6FA 4GC9A 3KFUG 1NJGA 4K0KM 4DV7M 3F92A 4LF9M 2KDLA 3C3EA 3DOAA 1NHGC 1DO2A 1TGUA 2DXIA 1QANA 4MGHA 4FW9A 2JA2A 3SFZA 1PJJA 2L7HA 3U6MA 1TDZA 1IY0A 2NQ8C 3E21A 4QNMA 3T1YM 3R9XB 1E94E 1FNNA 2C9OA 2V1CA 4LJ5A 3BXWA 3NBXX 3B89A 3UZUA 2ZBKB 3AOGA 4G6ZA 2LWXA 1QQWA 4QOSA 5ITYA 3GLIE 2LHCA 2Y20A 2LNHC 1AUAA 1ZV1A 3ZCBB 3W67A 3KOXE 5F3WA 1OAOC 4NRVA 4FCWA 3V76A 1YLAA 4R3DA 3SHGB 2CP8A 3GLGE 1X37A 3HHXA 1OQYA 2CV0A 2AHMA 3JR4A 5EP1A 1IXSB 2KNAA 1HNWM 5FTJA 4UN2B 2C96A 1VEGA 4M0WA 2QBYB 2YQZA 5GKNA 3OTOM 3GQ5A 1PJIA 1IY2A 4L78A 3EIEA 4Z6YA 3K9PA 4GH9A 4JI7M 1IBKM 2VQFM 2R45A 2BJVA 4DV1M 3HJSA 1OIPA 2FE8A 4L15A 3RE8A 3FTFA 1MJGM 4WW0A 4JI3M 3RFWA 4ZPXA 4M9ZA 2Z4RA 3GLFE 4JYAM 4L4UA 3GPYA 2KA6B 4AW4A 4TUWA 1EE8A 3IECA 2CE7A 4F1IA 3LVVA 4DV5M 2DZNB 2VF8A 4QHTA 4OVZA 4KLNA 4X64M 1IY1A 2MJ5B 4LF4M 3RGSA 4G4NA 1SXJE 3T38A 3HJ8A 3KSJA 1G8PA 5BPVA 3A46A 1XMOM 3U60B 3E46A 3AKZA 2ZTCA 3C58A 3RGPA 3NWLA 1DGGA 3HY5A 1RU3A 2R18A 1SG9A 3WHLA 2O5RA 1H6UA 1VDDA 4G4QA 5KO3A 4CISA 5H37D 5DYIA 2VF7A 3MK6A 1HT1E 2R65A 2JY7A 4FD2A 1CUKA 1R7RA 2G3QA 3J7BA 4X66M 3U6CA 1I94M 3K9OA 1NV8A 1NO1A 1D0MA 2LBCA 2R4JA 5E6JA 4MGZE 1G3IA 3AFHA 1UFZA 1GL7A 3B74A 3FTCA 5ITQA 1T3TA 4JI4M 2FH0A 1PM5A 1R4GA 1VDLA 5FTNA 2O25A 2DWLA 3A42A 3TE6A 1QYRA 2ZAOA 2XLJA 1C1KA 2N35A 1BVSA 5EXPA 1E9SA 3GLHE 1R2YA 1JB0F 2QPAA 3C9PA 2RGOA 3KP1E 2J7NA 4GEWA 2YFQA 3TWMA 5JI2E 2BNKA 3R8FA 5DNYA 4BBAA 1WHCA 2CV1A 5ITXE 1HT2E 3LCVB 4AKHA
chains in the Genus database with same CATH topology
2D7EA 4I5SA 1S3SA 3DZDA 3JAMS 2C5RA 4AG5A 3IG8A 4LFAM 4MM3B 3U61A 1QAQA 5DYGA 1JR3A 3HU1A 1HQYE 4LG2A 3QWLA 3FTDA 3LVWA 5KQDA 1MU5A 1OJLA 2KRUA 3MJ5A 4OW0A 8CATA 3VKHA 4LFCM 2P5TA 3FD9A 3FUWA 2RGHA 5EXTA 3SC3A 4YY3M 1XNQM 1MX0A 4B3SM 3EIHA 4AI6A 4DR7M 4LGYA 2HCBA 2H1RA 3GRUA 3L27A 5FTMA 2UUAM 1GLNA 3HJQA 1L8QA 3KOZE 4LJ6A 4DV3M 4G4OA 3L2AA 3M0EA 4MGKE 5BR8M 4LCBA 4DV4M 4LF8M 4I4LA 3CF6E 1L1TA 3A45A 5EXXA 1KFVA 2BJWA 4IBKA 2V1UA 3GLIA 2CV2A 4JV5M 1W5SA 4JI0M 1YE9A 2KRKA 3J80S 3HKPA 2DHRA 3U6OA 3GLGA 4BB9A 3SAUA 1XWIA 1NNUC 3PNVA 1IN5A 5KPZA 4IBBA 4IJFA 5LMNM 1IN8A 4LF6M 3T15A 1XHBA 3SATA 1D2NA 2DZOB 4RF1A 3LMMA 1HNXM 5KQ8A 3U5ZB 4NOOB 1HNZM 4IJEA 1NJFA 4IBFA 4MH0E 3K8ZA 4DV2M 2Y0TA 3SAVA 4B3RM 1N33M 3AV0A 3KOWE 1FJGM 1OFHA 1XC8A 2F5PA 2QP9X 1DGHA 3GRVA 4D80A 2UXDM 3PVSA 3U61B 3NBIA 4QOZC 2LH0A 3GLFA 4GRIA 4LZZA 2VQEM 4B3MM 4FCVA 5EXSA 4PCZA 4GMQA 3U6PA 4OU7A 3J2PB 5A2QS 2DWNA 4FWGA 4GC5A 2X49A 1L2DA 2KZSA 1W5TA 1SXJA 2XF3A 3FUVA 1G59A 1IBLM 2XH9A 4DUYM 2R62A 4MB7A 3GQ3A 4JI2M 2XZFA 1TDHA 4XGIA 1XMQM 2ZANA 4LJ8A 3UJNA 5KPTA 5ITUA 3AOEA 2FNAA 4D82A 3GLIB 1J09A 2CUZA 3I51A 1K82A 2HL7A 1JQJC 3U6QA 3GLGB 3T1HM 1QAOA 3TWLA 2EO2A 2EUCA 1GL6A 4B7FA 2OPFA 2CHQA 4YHHM 1J7KA 4FWDA 3KP0E 4MGIE 4R7GA 3VK8A 4L16A 4REZA 2A5YB 3WHKA 1JR3D 3CF2A 3DA1A 2L7IA 3FKEA 4GHAA 1K3XA 2XFTA 3I4VA 3L29A 5C18A 3GLHA 2M60A 2Z4SA 5FSWA 5FTKA 3HWSA 3HHYA 3CF0A 2DWMA 4LGMA 5ITXA 4LFBM 1DGHB 3GPPA 3GPXA 4I81A 3SBJA 3TPZA 4IBCA 2LXEA 3GLFB 1SXJC 3H4MA 4IBJA 2CHGA 1TH3A 2J7OA 4RNAA 4XBOA 2Z3XA 2CHVA 4AQYM 3SYKA 4W5WA 3VDUA 2QENA 2G8LA 3J7AS 5IWAM 4DR1M 4B08A 1N78A 1SXJB 3I4YA 4M9XA 3AOEC 3MHVC 4LZJA 1HR0M 3PNYA 4LF5M 1DO0A 4OVZB 2XZUA 5ITRA 4JI5M 2XGNA 4CGYB 2RKOA 4L8RC 2HHHM 1Z6TA 4B7GA 4FCTA 4JN6A 3J27B 1Z5AA 2KZUA 3JR5A 2QCUA 4DR4M 3BOSA 2V6ZM 4HL4A 4I8OA 3D8BA 2I7PA 1NY6A 4NSRA 1GVNA 3VLFB 3SYLA 5KPRA 1DGBA 4DR2M 3K92A 1GKIA 2F5SA 4IBEA 3W0FA 2XFSA 3GO8A 2Y21A 2EA0A 3ZC7B 1QAMA 1TH2A 1E32A 3GP1A 1ORYB 2C98A 3M7GA 5FTLA 4KHPM 3GLHB 4JI1M 2W82A 1QZMA 3KVWA 1OFIA 2OQ4A 2Z7JA 4LJAA 1G4AE 3L25A 1QVRA 4IBIA 4KO8A 3UK6A 2R4EA 3U60A 4Z8XA 4X65M 1SXJD 2XSZA 3K1JA 2FOIC 2QZ4A 2D7GA 4BLCA 7CATA 3L26A 1ZAEA 2I7NA 3GRYA 1R6BX 1NNJA 3ZH9B 2F5NA 2F4VM 2L6OA 4GHLA 3K2LA 4M9SA 4AG6A 2UUCM 3UGJA 4JI8M 4GKJM 4B7HA 4M0DA 4DUZM 4IIWA 1IQPA 4NRWA 3HU3A 3GRRA 2XEPA 4P16A 1R2ZA 1IN6A 4NSOB 5ITTA 3SASA 1IXZA 1DGFA 1IN7A 2CFOA 4MGYE 1KYIA 1XXHA 1ZQ9A 2E5LM 2UXBM 3CTWB 1E9RA 2KEBA 3KS4A 4HLQA 2F5OA 3A98B 4LF7M 1L2CA 1N36M 3THGA 3GQ4A 4NXMM 1XNRM 4GITA 3HHZA 4AKGA 4QNRA 1WXQA 3GPUA 3W0LB 1IM2A 1YUBA 2F5QA 2HKJA 3VDPA 3FYDA 5EP3A 4LJ7A 4AKIA 3HHWA 3D8LA 4JI6M 4DR6M 4NXNM 3FUUA 3E4RA 1N77A 3U6DA 1IXRC 2L09A 4LJ9A 3U6LA 1J5EM 4IBGA 3SMSA 1NY5A 3QAUA 4LRSA 1Q39A 1NSFA 3FUXA 1I4WA 4IBDA 3J81S 1IN4A 4OX9M 1L2BA 2X4AA 2ZM6M 3B9PA 5E26A 2KXEA 2DVWB 1L1ZA 4LRTA 2K47A 1N34M 4PD2A 4WURA 3LQQA 1NHWC 5EQTA 3SAWA 1UM8A 1HQCA 3TQSA 3L28A 3KSXA 5EJCA 1NVMA 3U6EA 1LV7A 4II7A 4LY6A 5EP4A 4AZFA 3VK7A 2UXCM 4DV0M 4JXJA 5LMUM 4DV6M 5C1BA 3SARA 5IREB 3VKGA 3KW6A 2VIIA 4X62M 2C99A 4DR5M 3LQRA 2M5ZA 3Q8XA 1Z5CA 1IBMM 4KODA 1TH4A 3KOYE 3KS8A 4LJ4A 2UUBM 1XXHB 4PDIA 1Z5BA 2YR0A 3FTEA 1Q3CA 2X8AA 3FYCA 1N75A 3PFIA 2G5GX 4DR3M 2DWZB 4QHSA 2C9CA 4GIPA 4RF0A 4G4RA 3HU2A 3U6SA 4EIWA 2QBYA 3UMMA 3TL4X 3U5ZA 2YNMD 3DFZA 4GKKM 3SHFA 1Q3BA 3HGIA 2Y0QA 4B3TM 2R46A 4FWHA 1K3WA 5JI3E 5IT9S 2ERCA 4FVMA 2CEAA 3PXGA 2UU9M 2Q2EB 2FFJA 1G41A 3IG5A 4ITQA 3M6AA 3VFDA 2XSZD 1Z59A 5IZ7D 1KSFX 2ZAMA 4PT5A 3SMPA 3FUTA 4CHTB 5FLXS 1YSYA 3KXEC 3KDSE 4PDGA 4A3VB 2KW0A 4S12A 2D7HA 1N32M 3TWKA 3ILKA 3AJIB 3E9SA 4D81A 3AL0C 5EP2A 4NL4H 4GC9A 3KFUG 1NJGA 4K0KM 4DV7M 4LF9M 3DOAA 2DXIA 1NHGC 1DO2A 1TGUA 1QANA 4MGHA 4FW9A 2JA2A 3SFZA 1PJJA 2L7HA 3U6MA 1TDZA 1IY0A 2NQ8C 4QNMA 3T1YM 3R9XB 1E94E 1FNNA 2C9OA 2V1CA 4LJ5A 3UZUA 2ZBKB 3AOGA 4G6ZA 2LWXA 1QQWA 4QOSA 5ITYA 2Y20A 2LNHC 3ZCBB 3KOXE 5F3WA 4NRVA 4FCWA 4R3DA 3SHGB 1X37A 3HHXA 2CV0A 2AHMA 3JR4A 5EP1A 1IXSB 1HNWM 5FTJA 2C96A 4M0WA 2QBYB 2YQZA 5GKNA 3OTOM 3GQ5A 1PJIA 1IY2A 4L78A 3EIEA 4Z6YA 4GH9A 4JI7M 1IBKM 2VQFM 2R45A 2BJVA 4DV1M 3HJSA 4L15A 2FE8A 3RE8A 3FTFA 4WW0A 4JI3M 3RFWA 4ZPXA 4M9ZA 2Z4RA 4JYAM 4TUWA 4L4UA 3GPYA 2KA6B 4AW4A 1EE8A 2CE7A 3LVVA 4DV5M 2DZNB 4QHTA 4OVZA 4KLNA 4X64M 1IY1A 4LF4M 3RGSA 4G4NA 1SXJE 3T38A 3HJ8A 3KSJA 1G8PA 5BPVA 3A46A 1XMOM 3U60B 3AKZA 3C58A 3RGPA 3NWLA 1DGGA 2R18A 3WHLA 2O5RA 1H6UA 1VDDA 4G4QA 5KO3A 4CISA 5H37D 5DYIA 3MK6A 1HT1E 2R65A 4FD2A 3J7BA 1R7RA 1I94M 3U6CA 4X66M 2R4JA 5E6JA 4MGZE 1G3IA 3AFHA 1GL7A 3FTCA 5ITQA 1T3TA 4JI4M 1PM5A 5FTNA 2DWLA 3A42A 3TE6A 1QYRA 2ZAOA 2XLJA 1C1KA 5EXPA 1E9SA 1R2YA 2QPAA 2RGOA 3KP1E 2J7NA 2YFQA 3TWMA 5JI2E 2BNKA 3R8FA 5DNYA 4BBAA 2CV1A 5ITXE 1HT2E 4AKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORY B; 
#chains in the Genus database with same CATH topology
 2D7E A;  1WIV A;  4I5S A;  1S3S A;  5L8R F;  3DZD A;  3JAM S;  2C5R A;  1TR8 A;  2JZ1 A;  4AG5 A;  3IG8 A;  4XK8 F;  2QSF X;  4MM3 B;  4LFA M;  3U61 A;  1T6O A;  1QAQ A;  5DYG A;  1JR3 A;  1ZMW A;  2DAG A;  3HU1 A;  1HQY E;  1D0K A;  4LG2 A;  1DV0 A;  3QWL A;  3FTD A;  3LVW A;  5KQD A;  1MU5 A;  1OJL A;  2KRU A;  3MJ5 A;  4OW0 A;  8CAT A;  3VKH A;  4LFC M;  2P5T A;  3FD9 A;  3FUW A;  2RGH A;  5EXT A;  3SC3 A;  4YY3 M;  1XNQ M;  1MX0 A;  4B3S M;  2KNV A;  3EIH A;  4AI6 A;  2KNZ A;  4DR7 M;  4LGY A;  2HCB A;  2H1R A;  3GRU A;  3L27 A;  5FTM A;  2UUA M;  3Q8G A;  1GLN A;  3IHP A;  3HJQ A;  1L8Q A;  5DFL A;  3H4J A;  2DHY A;  3KOZ E;  4LJ6 A;  4DV3 M;  4G4O A;  3L2A A;  3M0E A;  1GJS A;  4MGK E;  5BR8 M;  4LCB A;  4DV4 M;  4LF8 M;  4I4L A;  3CF6 E;  1L1T A;  2J5Y A;  2DEN A;  2K0B X;  3A45 A;  5EXX A;  1KFV A;  2BJW A;  4IBK A;  2V1U A;  3GLI A;  3FE3 A;  2CV2 A;  2LTU A;  4JV5 M;  1W5S A;  4JI0 M;  1YE9 A;  2KRK A;  3J80 S;  3HKP A;  2DHR A;  3U6O A;  3GLG A;  4BB9 A;  3SAU A;  1XWI A;  1PJQ A;  2DAM A;  2LVA A;  2ZTD A;  1NNU C;  3PNV A;  1IN5 A;  1VEJ A;  5KPZ A;  4IBB A;  4IJF A;  5LMN M;  1IN8 A;  1OTR A;  4LF6 M;  2WSC F;  3T15 A;  3T6P A;  1TF0 B;  1GO5 A;  1XHB A;  1VG5 A;  1D2N A;  2DZO B;  3SAT A;  4RF1 A;  3LMM A;  1HNX M;  1P3Q Q;  5KQ8 A;  3U5Z B;  4NC6 A;  4NOO B;  2LVP C;  1HNZ M;  4IJE A;  1NJF A;  4HEO A;  4IBF A;  4MH0 E;  1QZE A;  3K8Z A;  4DV2 M;  2Y0T A;  2K6B A;  3SAV A;  1HJP A;  3AV0 A;  3KOW E;  1FJG M;  4B3R M;  1OFH A;  1N33 M;  1XC8 A;  3LCU A;  2F5P A;  2QP9 X;  1DGH A;  3GRV A;  4D80 A;  2UXD M;  3PVS A;  4KT0 F;  3U61 B;  3NBI A;  4QOZ C;  2LH0 A;  2L4E A;  4GRI A;  1WGL A;  4L6V 6;  3GLF A;  4LZZ A;  2VQE M;  2LHG A;  4B3M M;  4FCV A;  5EXS A;  1NV9 A;  4PCZ A;  4GMQ A;  3U6P A;  1T43 A;  4OU7 A;  3J2P B;  5A2Q S;  2DWN A;  2EKF A;  4FWG A;  4GC5 A;  2X49 A;  1L2D A;  2KZS A;  1W5T A;  1SXJ A;  2APL A;  2XF3 A;  3FUV A;  1G59 A;  1IBL M;  2XH9 A;  4DUY M;  2R62 A;  4MB7 A;  2VDB B;  3QYE A;  1EIJ A;  3GQ3 A;  4JI2 M;  2MGW A;  3HZJ A;  1TDH A;  4XGI A;  2XZF A;  2JY6 B;  1XXH E;  2ZAN A;  4LJ8 A;  1XMQ M;  2WSE F;  3UJN A;  5KPT A;  1MN3 A;  5ITU A;  3AOE A;  1F4I A;  2FNA A;  1R5L A;  4D82 A;  1J09 A;  2CUZ A;  3I51 A;  3GLI B;  1K82 A;  2QQ8 A;  4DBG B;  2HL7 A;  1JQJ C;  3U6Q A;  3GLG B;  2JWS A;  3T1H M;  1QAO A;  2WSF F;  2DZL A;  3QYB A;  1XB2 B;  3TWL A;  1Q02 A;  2EO2 A;  2EUC A;  1GL6 A;  4B7F A;  1WR1 B;  1PRB A;  2CHQ A;  4YHH M;  2OPF A;  4GHL A;  1J7K A;  4FWD A;  3KP0 E;  4MGI E;  4R7G A;  2BWE A;  3VK8 A;  2HAK A;  4L16 A;  4REZ A;  2A5Y B;  3WHK A;  1JR3 D;  3CF2 A;  3DA1 A;  2L7I A;  3FKE A;  4GHA A;  1K3X A;  2XFT A;  3I4V A;  3L29 A;  4CIZ A;  5C18 A;  3GLH A;  2M60 A;  2Z4S A;  5FSW A;  1WJ7 A;  5FTK A;  3HWS A;  3HHY A;  3CF0 A;  2DWM A;  4LGM A;  4CJ6 A;  5ITX A;  2CWB A;  4LFB M;  1DGH B;  3GPP A;  3GPX A;  4I81 A;  3SBJ A;  3TPZ A;  4IBC A;  2LXE A;  3B7Z A;  3GLF B;  1SXJ C;  3H4M A;  4IBJ A;  2CHG A;  1TH3 A;  2J7O A;  4RNA A;  4XBO A;  2Z3X A;  2MH8 A;  2CHV A;  4AQY M;  3SYK A;  2LVN C;  4W5W A;  3VDU A;  1OAI A;  2QEN A;  2G8L A;  3J7A S;  5IWA M;  4DR1 M;  4B08 A;  2OO9 A;  1N78 A;  1SXJ B;  3I4Y A;  4M9X A;  1V33 A;  3AOE C;  3MHV C;  3BBZ A;  1TTE A;  2L2D A;  3PNY A;  4LZJ A;  1HR0 M;  1QUT A;  1DO0 A;  4LF5 M;  4OVZ B;  1QDR A;  2XZU A;  1IXS A;  5ITR A;  1QUS A;  2H5X A;  4JI5 M;  2XGN A;  4CGY B;  1IFY A;  2RKO A;  4L8R C;  2HHH M;  1Z6T A;  3C3D A;  4B7G A;  4FCT A;  4JN6 A;  1PGY A;  3J27 B;  1Z5A A;  2KZU A;  3JR5 A;  2QCU A;  4Y28 F;  4DR4 M;  1PJT A;  2V6Z M;  3BOS A;  4HL4 A;  4I8O A;  3D8B A;  2I7P A;  1NY6 A;  4NSR A;  1GVN A;  3VLF B;  3SYL A;  5KPR A;  1AIP C;  1DGB A;  1EFU B;  2JXN A;  4DR2 M;  3K92 A;  1GKI A;  2F5S A;  2GQF A;  1GAB A;  4IBE A;  1VQ1 A;  3W0F A;  2XFS A;  3GO8 A;  2Y21 A;  2EA0 A;  3ZC7 B;  1QAM A;  1TH2 A;  1E32 A;  3GP1 A;  1ORY B;  2C98 A;  3M7G A;  2EJS A;  5FTL A;  2OOB A;  4KHP M;  3GLH B;  2EKK A;  2QHO B;  4JI1 M;  2W82 A;  1QZM A;  3KVW A;  1OFI A;  2OQ4 A;  2Z7J A;  4Q7J A;  4LJA A;  1G4A E;  3L25 A;  1QVR A;  3FRH A;  4IBI A;  4KO8 A;  3UK6 A;  1VEK A;  2R4E A;  3U60 A;  4Z8X A;  4X65 M;  1SXJ D;  1V92 A;  2XSZ A;  3K1J A;  1WGN A;  2FOI C;  2LVO C;  2QZ4 A;  2D7G A;  4BLC A;  2KHH A;  4P17 A;  7CAT A;  3L26 A;  4F2L A;  1ZAE A;  2I7N A;  3GRY A;  1R6B X;  1NNJ A;  3ZH9 B;  2F5N A;  2F4V M;  1GJT A;  1G71 A;  2L6O A;  3K2L A;  4M9S A;  4AG6 A;  2UUC M;  3UGJ A;  4WP2 A;  2OOA A;  4JI8 M;  4GKJ M;  4B7H A;  4M0D A;  4DUZ M;  2WZJ A;  4IIW A;  1IQP A;  4NRW A;  3HU3 A;  2DKL A;  2XEP A;  3GRR A;  3LW5 F;  1IN6 A;  4NSO B;  4P16 A;  5ITT A;  1R2Z A;  1OIZ A;  1IXZ A;  3SAS A;  1DGF A;  1IN7 A;  2CFO A;  4MGY E;  1KYI A;  1XXH A;  1ZQ9 A;  2E5L M;  1LTM A;  2UXB M;  3CTW B;  1E9R A;  2KEB A;  2K9D A;  3KS4 A;  4HLQ A;  2F5O A;  3A98 B;  4LF7 M;  1V34 A;  1L2C A;  2JY8 A;  1N36 M;  3THG A;  2O01 F;  3ZQJ A;  3GQ4 A;  4NXM M;  4GIT A;  1XNR M;  1ZMV A;  3HHZ A;  4AKG A;  4QNR A;  2B3T A;  1WXQ A;  1ZMU A;  3GPU A;  3W0L B;  3I04 M;  1IM2 A;  1YUB A;  2F5Q A;  2HKJ A;  3VDP A;  2JY5 A;  3W68 A;  3FYD A;  5EP3 A;  4LJ7 A;  1QDT A;  2CRU A;  3HHW A;  4AKI A;  3D8L A;  4JI6 M;  4DR6 M;  4NXN M;  3FUU A;  2HWJ A;  3E4R A;  1N77 A;  3U6D A;  1IXR C;  2L09 A;  4LJ9 A;  3U6L A;  1J5E M;  4IBG A;  3SMS A;  1NY5 A;  3QAU A;  4LRS A;  1Q39 A;  1NSF A;  2JP7 A;  2MR9 A;  3FUX A;  1I4W A;  4IBD A;  3J81 S;  1IN4 A;  4OX9 M;  1L2B A;  2X4A A;  2ZM6 M;  2DNA A;  3B9P A;  5E26 A;  2KXE A;  2DVW B;  3CGW A;  1L1Z A;  4LRT A;  2QNJ A;  2K47 A;  1N34 M;  4PD2 A;  4WUR A;  3LQQ A;  1NHW C;  4ANR A;  5EQT A;  3SAW A;  1UM8 A;  3FRI A;  1HQC A;  2JUJ A;  3TQS A;  3L28 A;  3KSX A;  5EJC A;  1NVM A;  3U6E A;  1LV7 A;  2DI0 A;  4II7 A;  4LY6 A;  5EP4 A;  4AZF A;  3VK7 A;  2UXC M;  4DV0 M;  4JXJ A;  5LMU M;  4DV6 M;  5C1B A;  3SAR A;  5IRE B;  2DAI A;  3VKG A;  3KW6 A;  2VII A;  4X62 M;  2C99 A;  4DR5 M;  2LVQ D;  3LQR A;  3HX3 A;  2M5Z A;  3Q8X A;  1Z5C A;  1IBM M;  4KOD A;  1TH4 A;  3KOY E;  3KS8 A;  4LJ4 A;  1D0L A;  2UUB M;  1XXH B;  4PDI A;  1Z5B A;  2YR0 A;  2Z8Y M;  1Q3C A;  2X8A A;  3FYC A;  1N75 A;  3PFI A;  3FTE A;  2G5G X;  2RRU A;  4DR3 M;  1Y8G A;  2DWZ B;  4QHS A;  2JNH A;  2C9C A;  4GIP A;  4RF0 A;  4G4R A;  2BWB A;  3HU2 A;  4EIW A;  3U6S A;  1C7Y A;  2QBY A;  4RKU F;  3TL4 X;  3UMM A;  3U5Z A;  2YNM D;  3DFZ A;  3I01 M;  2JZ0 A;  4GKK M;  3SHF A;  1Q3B A;  3HGI A;  2R0I A;  2Y0Q A;  4B3T M;  2GNO A;  2DAE A;  2R46 A;  4FWH A;  5JI3 E;  1K3W A;  2ERC A;  4FVM A;  5IT9 S;  2CEA A;  4R71 A;  3PXG A;  2UU9 M;  2Q2E B;  2FFJ A;  1G41 A;  3IG5 A;  4ITQ A;  3M6A A;  3VFD A;  2XSZ D;  1Z59 A;  5IZ7 D;  1OKS A;  1KSF X;  2ZAM A;  4PT5 A;  3SMP A;  1PJS A;  3FUT A;  4CHT B;  3B7Q A;  5FLX S;  1YSY A;  3KXE C;  3KDS E;  4PDG A;  2L4F A;  4A3V B;  2MRO B;  2KW0 A;  2FS1 A;  4S12 A;  1A5T A;  2D7H A;  1N32 M;  1JR3 E;  3B7N A;  3TWK A;  2R44 A;  3ILK A;  3AJI B;  3E9S A;  4D81 A;  3AL0 C;  4G3O A;  5EP2 A;  4NL4 H;  3MMP A;  2DAK A;  2R6F A;  4GC9 A;  3KFU G;  1NJG A;  4K0K M;  4DV7 M;  3F92 A;  4LF9 M;  2KDL A;  3C3E A;  3DOA A;  1NHG C;  1DO2 A;  1TGU A;  2DXI A;  1QAN A;  4MGH A;  4FW9 A;  2JA2 A;  3SFZ A;  1PJJ A;  2L7H A;  3U6M A;  1TDZ A;  1IY0 A;  2NQ8 C;  3E21 A;  4QNM A;  3T1Y M;  3R9X B;  1E94 E;  1FNN A;  2C9O A;  2V1C A;  4LJ5 A;  3BXW A;  3NBX X;  3B89 A;  3UZU A;  2ZBK B;  3AOG A;  4G6Z A;  2LWX A;  1QQW A;  4QOS A;  5ITY A;  3GLI E;  2LHC A;  2Y20 A;  2LNH C;  1AUA A;  1ZV1 A;  3ZCB B;  3W67 A;  3KOX E;  5F3W A;  1OAO C;  4NRV A;  4FCW A;  3V76 A;  1YLA A;  4R3D A;  3SHG B;  2CP8 A;  3GLG E;  1X37 A;  3HHX A;  1OQY A;  2CV0 A;  2AHM A;  3JR4 A;  5EP1 A;  1IXS B;  2KNA A;  1HNW M;  5FTJ A;  4UN2 B;  2C96 A;  1VEG A;  4M0W A;  2QBY B;  2YQZ A;  5GKN A;  3OTO M;  3GQ5 A;  1PJI A;  1IY2 A;  4L78 A;  3EIE A;  4Z6Y A;  3K9P A;  4GH9 A;  4JI7 M;  1IBK M;  2VQF M;  2R45 A;  2BJV A;  4DV1 M;  3HJS A;  1OIP A;  2FE8 A;  4L15 A;  3RE8 A;  3FTF A;  1MJG M;  4WW0 A;  4JI3 M;  3RFW A;  4ZPX A;  4M9Z A;  2Z4R A;  3GLF E;  4JYA M;  4L4U A;  3GPY A;  2KA6 B;  4AW4 A;  4TUW A;  1EE8 A;  3IEC A;  2CE7 A;  4F1I A;  3LVV A;  4DV5 M;  2DZN B;  2VF8 A;  4QHT A;  4OVZ A;  4KLN A;  4X64 M;  1IY1 A;  2MJ5 B;  4LF4 M;  3RGS A;  4G4N A;  1SXJ E;  3T38 A;  3HJ8 A;  3KSJ A;  1G8P A;  5BPV A;  3A46 A;  1XMO M;  3U60 B;  3E46 A;  3AKZ A;  2ZTC A;  3C58 A;  3RGP A;  3NWL A;  1DGG A;  3HY5 A;  1RU3 A;  2R18 A;  1SG9 A;  3WHL A;  2O5R A;  1H6U A;  1VDD A;  4G4Q A;  5KO3 A;  4CIS A;  5H37 D;  5DYI A;  2VF7 A;  3MK6 A;  1HT1 E;  2R65 A;  2JY7 A;  4FD2 A;  1CUK A;  1R7R A;  2G3Q A;  3J7B A;  4X66 M;  3U6C A;  1I94 M;  3K9O A;  1NV8 A;  1NO1 A;  1D0M A;  2LBC A;  2R4J A;  5E6J A;  4MGZ E;  1G3I A;  3AFH A;  1UFZ A;  1GL7 A;  3B74 A;  3FTC A;  5ITQ A;  1T3T A;  4JI4 M;  2FH0 A;  1PM5 A;  1R4G A;  1VDL A;  5FTN A;  2O25 A;  2DWL A;  3A42 A;  3TE6 A;  1QYR A;  2ZAO A;  2XLJ A;  1C1K A;  2N35 A;  1BVS A;  5EXP A;  1E9S A;  3GLH E;  1R2Y A;  1JB0 F;  2QPA A;  3C9P A;  2RGO A;  3KP1 E;  2J7N A;  4GEW A;  2YFQ A;  3TWM A;  5JI2 E;  2BNK A;  3R8F A;  5DNY A;  4BBA A;  1WHC A;  2CV1 A;  5ITX E;  1HT2 E;  3LCV B;  4AKH A; 
#chains in the Genus database with same CATH homology
 2D7E A;  4I5S A;  1S3S A;  3DZD A;  3JAM S;  2C5R A;  4AG5 A;  3IG8 A;  4LFA M;  4MM3 B;  3U61 A;  1QAQ A;  5DYG A;  1JR3 A;  3HU1 A;  1HQY E;  4LG2 A;  3QWL A;  3FTD A;  3LVW A;  5KQD A;  1MU5 A;  1OJL A;  2KRU A;  3MJ5 A;  4OW0 A;  8CAT A;  3VKH A;  4LFC M;  2P5T A;  3FD9 A;  3FUW A;  2RGH A;  5EXT A;  3SC3 A;  4YY3 M;  1XNQ M;  1MX0 A;  4B3S M;  3EIH A;  4AI6 A;  4DR7 M;  4LGY A;  2HCB A;  2H1R A;  3GRU A;  3L27 A;  5FTM A;  2UUA M;  1GLN A;  3HJQ A;  1L8Q A;  3KOZ E;  4LJ6 A;  4DV3 M;  4G4O A;  3L2A A;  3M0E A;  4MGK E;  5BR8 M;  4LCB A;  4DV4 M;  4LF8 M;  4I4L A;  3CF6 E;  1L1T A;  3A45 A;  5EXX A;  1KFV A;  2BJW A;  4IBK A;  2V1U A;  3GLI A;  2CV2 A;  4JV5 M;  1W5S A;  4JI0 M;  1YE9 A;  2KRK A;  3J80 S;  3HKP A;  2DHR A;  3U6O A;  3GLG A;  4BB9 A;  3SAU A;  1XWI A;  1NNU C;  3PNV A;  1IN5 A;  5KPZ A;  4IBB A;  4IJF A;  5LMN M;  1IN8 A;  4LF6 M;  3T15 A;  1XHB A;  3SAT A;  1D2N A;  2DZO B;  4RF1 A;  3LMM A;  1HNX M;  5KQ8 A;  3U5Z B;  4NOO B;  1HNZ M;  4IJE A;  1NJF A;  4IBF A;  4MH0 E;  3K8Z A;  4DV2 M;  2Y0T A;  3SAV A;  4B3R M;  1N33 M;  3AV0 A;  3KOW E;  1FJG M;  1OFH A;  1XC8 A;  2F5P A;  2QP9 X;  1DGH A;  3GRV A;  4D80 A;  2UXD M;  3PVS A;  3U61 B;  3NBI A;  4QOZ C;  2LH0 A;  3GLF A;  4GRI A;  4LZZ A;  2VQE M;  4B3M M;  4FCV A;  5EXS A;  4PCZ A;  4GMQ A;  3U6P A;  4OU7 A;  3J2P B;  5A2Q S;  2DWN A;  4FWG A;  4GC5 A;  2X49 A;  1L2D A;  2KZS A;  1W5T A;  1SXJ A;  2XF3 A;  3FUV A;  1G59 A;  1IBL M;  2XH9 A;  4DUY M;  2R62 A;  4MB7 A;  3GQ3 A;  4JI2 M;  2XZF A;  1TDH A;  4XGI A;  1XMQ M;  2ZAN A;  4LJ8 A;  3UJN A;  5KPT A;  5ITU A;  3AOE A;  2FNA A;  4D82 A;  3GLI B;  1J09 A;  2CUZ A;  3I51 A;  1K82 A;  2HL7 A;  1JQJ C;  3U6Q A;  3GLG B;  3T1H M;  1QAO A;  3TWL A;  2EO2 A;  2EUC A;  1GL6 A;  4B7F A;  2OPF A;  2CHQ A;  4YHH M;  1J7K A;  4FWD A;  3KP0 E;  4MGI E;  4R7G A;  3VK8 A;  4L16 A;  4REZ A;  2A5Y B;  3WHK A;  1JR3 D;  3CF2 A;  3DA1 A;  2L7I A;  3FKE A;  4GHA A;  1K3X A;  2XFT A;  3I4V A;  3L29 A;  5C18 A;  3GLH A;  2M60 A;  2Z4S A;  5FSW A;  5FTK A;  3HWS A;  3HHY A;  3CF0 A;  2DWM A;  4LGM A;  5ITX A;  4LFB M;  1DGH B;  3GPP A;  3GPX A;  4I81 A;  3SBJ A;  3TPZ A;  4IBC A;  2LXE A;  3GLF B;  1SXJ C;  3H4M A;  4IBJ A;  2CHG A;  1TH3 A;  2J7O A;  4RNA A;  4XBO A;  2Z3X A;  2CHV A;  4AQY M;  3SYK A;  4W5W A;  3VDU A;  2QEN A;  2G8L A;  3J7A S;  5IWA M;  4DR1 M;  4B08 A;  1N78 A;  1SXJ B;  3I4Y A;  4M9X A;  3AOE C;  3MHV C;  4LZJ A;  1HR0 M;  3PNY A;  4LF5 M;  1DO0 A;  4OVZ B;  2XZU A;  5ITR A;  4JI5 M;  2XGN A;  4CGY B;  2RKO A;  4L8R C;  2HHH M;  1Z6T A;  4B7G A;  4FCT A;  4JN6 A;  3J27 B;  1Z5A A;  2KZU A;  3JR5 A;  2QCU A;  4DR4 M;  3BOS A;  2V6Z M;  4HL4 A;  4I8O A;  3D8B A;  2I7P A;  1NY6 A;  4NSR A;  1GVN A;  3VLF B;  3SYL A;  5KPR A;  1DGB A;  4DR2 M;  3K92 A;  1GKI A;  2F5S A;  4IBE A;  3W0F A;  2XFS A;  3GO8 A;  2Y21 A;  2EA0 A;  3ZC7 B;  1QAM A;  1TH2 A;  1E32 A;  3GP1 A;  1ORY B;  2C98 A;  3M7G A;  5FTL A;  4KHP M;  3GLH B;  4JI1 M;  2W82 A;  1QZM A;  3KVW A;  1OFI A;  2OQ4 A;  2Z7J A;  4LJA A;  1G4A E;  3L25 A;  1QVR A;  4IBI A;  4KO8 A;  3UK6 A;  2R4E A;  3U60 A;  4Z8X A;  4X65 M;  1SXJ D;  2XSZ A;  3K1J A;  2FOI C;  2QZ4 A;  2D7G A;  4BLC A;  7CAT A;  3L26 A;  1ZAE A;  2I7N A;  3GRY A;  1R6B X;  1NNJ A;  3ZH9 B;  2F5N A;  2F4V M;  2L6O A;  4GHL A;  3K2L A;  4M9S A;  4AG6 A;  2UUC M;  3UGJ A;  4JI8 M;  4GKJ M;  4B7H A;  4M0D A;  4DUZ M;  4IIW A;  1IQP A;  4NRW A;  3HU3 A;  3GRR A;  2XEP A;  4P16 A;  1R2Z A;  1IN6 A;  4NSO B;  5ITT A;  3SAS A;  1IXZ A;  1DGF A;  1IN7 A;  2CFO A;  4MGY E;  1KYI A;  1XXH A;  1ZQ9 A;  2E5L M;  2UXB M;  3CTW B;  1E9R A;  2KEB A;  3KS4 A;  4HLQ A;  2F5O A;  3A98 B;  4LF7 M;  1L2C A;  1N36 M;  3THG A;  3GQ4 A;  4NXM M;  1XNR M;  4GIT A;  3HHZ A;  4AKG A;  4QNR A;  1WXQ A;  3GPU A;  3W0L B;  1IM2 A;  1YUB A;  2F5Q A;  2HKJ A;  3VDP A;  3FYD A;  5EP3 A;  4LJ7 A;  4AKI A;  3HHW A;  3D8L A;  4JI6 M;  4DR6 M;  4NXN M;  3FUU A;  3E4R A;  1N77 A;  3U6D A;  1IXR C;  2L09 A;  4LJ9 A;  3U6L A;  1J5E M;  4IBG A;  3SMS A;  1NY5 A;  3QAU A;  4LRS A;  1Q39 A;  1NSF A;  3FUX A;  1I4W A;  4IBD A;  3J81 S;  1IN4 A;  4OX9 M;  1L2B A;  2X4A A;  2ZM6 M;  3B9P A;  5E26 A;  2KXE A;  2DVW B;  1L1Z A;  4LRT A;  2K47 A;  1N34 M;  4PD2 A;  4WUR A;  3LQQ A;  1NHW C;  5EQT A;  3SAW A;  1UM8 A;  1HQC A;  3TQS A;  3L28 A;  3KSX A;  5EJC A;  1NVM A;  3U6E A;  1LV7 A;  4II7 A;  4LY6 A;  5EP4 A;  4AZF A;  3VK7 A;  2UXC M;  4DV0 M;  4JXJ A;  5LMU M;  4DV6 M;  5C1B A;  3SAR A;  5IRE B;  3VKG A;  3KW6 A;  2VII A;  4X62 M;  2C99 A;  4DR5 M;  3LQR A;  2M5Z A;  3Q8X A;  1Z5C A;  1IBM M;  4KOD A;  1TH4 A;  3KOY E;  3KS8 A;  4LJ4 A;  2UUB M;  1XXH B;  4PDI A;  1Z5B A;  2YR0 A;  3FTE A;  1Q3C A;  2X8A A;  3FYC A;  1N75 A;  3PFI A;  2G5G X;  4DR3 M;  2DWZ B;  4QHS A;  2C9C A;  4GIP A;  4RF0 A;  4G4R A;  3HU2 A;  3U6S A;  4EIW A;  2QBY A;  3UMM A;  3TL4 X;  3U5Z A;  2YNM D;  3DFZ A;  4GKK M;  3SHF A;  1Q3B A;  3HGI A;  2Y0Q A;  4B3T M;  2R46 A;  4FWH A;  1K3W A;  5JI3 E;  5IT9 S;  2ERC A;  4FVM A;  2CEA A;  3PXG A;  2UU9 M;  2Q2E B;  2FFJ A;  1G41 A;  3IG5 A;  4ITQ A;  3M6A A;  3VFD A;  2XSZ D;  1Z59 A;  5IZ7 D;  1KSF X;  2ZAM A;  4PT5 A;  3SMP A;  3FUT A;  4CHT B;  5FLX S;  1YSY A;  3KXE C;  3KDS E;  4PDG A;  4A3V B;  2KW0 A;  4S12 A;  2D7H A;  1N32 M;  3TWK A;  3ILK A;  3AJI B;  3E9S A;  4D81 A;  3AL0 C;  5EP2 A;  4NL4 H;  4GC9 A;  3KFU G;  1NJG A;  4K0K M;  4DV7 M;  4LF9 M;  3DOA A;  2DXI A;  1NHG C;  1DO2 A;  1TGU A;  1QAN A;  4MGH A;  4FW9 A;  2JA2 A;  3SFZ A;  1PJJ A;  2L7H A;  3U6M A;  1TDZ A;  1IY0 A;  2NQ8 C;  4QNM A;  3T1Y M;  3R9X B;  1E94 E;  1FNN A;  2C9O A;  2V1C A;  4LJ5 A;  3UZU A;  2ZBK B;  3AOG A;  4G6Z A;  2LWX A;  1QQW A;  4QOS A;  5ITY A;  2Y20 A;  2LNH C;  3ZCB B;  3KOX E;  5F3W A;  4NRV A;  4FCW A;  4R3D A;  3SHG B;  1X37 A;  3HHX A;  2CV0 A;  2AHM A;  3JR4 A;  5EP1 A;  1IXS B;  1HNW M;  5FTJ A;  2C96 A;  4M0W A;  2QBY B;  2YQZ A;  5GKN A;  3OTO M;  3GQ5 A;  1PJI A;  1IY2 A;  4L78 A;  3EIE A;  4Z6Y A;  4GH9 A;  4JI7 M;  1IBK M;  2VQF M;  2R45 A;  2BJV A;  4DV1 M;  3HJS A;  4L15 A;  2FE8 A;  3RE8 A;  3FTF A;  4WW0 A;  4JI3 M;  3RFW A;  4ZPX A;  4M9Z A;  2Z4R A;  4JYA M;  4TUW A;  4L4U A;  3GPY A;  2KA6 B;  4AW4 A;  1EE8 A;  2CE7 A;  3LVV A;  4DV5 M;  2DZN B;  4QHT A;  4OVZ A;  4KLN A;  4X64 M;  1IY1 A;  4LF4 M;  3RGS A;  4G4N A;  1SXJ E;  3T38 A;  3HJ8 A;  3KSJ A;  1G8P A;  5BPV A;  3A46 A;  1XMO M;  3U60 B;  3AKZ A;  3C58 A;  3RGP A;  3NWL A;  1DGG A;  2R18 A;  3WHL A;  2O5R A;  1H6U A;  1VDD A;  4G4Q A;  5KO3 A;  4CIS A;  5H37 D;  5DYI A;  3MK6 A;  1HT1 E;  2R65 A;  4FD2 A;  3J7B A;  1R7R A;  1I94 M;  3U6C A;  4X66 M;  2R4J A;  5E6J A;  4MGZ E;  1G3I A;  3AFH A;  1GL7 A;  3FTC A;  5ITQ A;  1T3T A;  4JI4 M;  1PM5 A;  5FTN A;  2DWL A;  3A42 A;  3TE6 A;  1QYR A;  2ZAO A;  2XLJ A;  1C1K A;  5EXP A;  1E9S A;  1R2Y A;  2QPA A;  2RGO A;  3KP1 E;  2J7N A;  2YFQ A;  3TWM A;  5JI2 E;  2BNK A;  3R8F A;  5DNY A;  4BBA A;  2CV1 A;  5ITX E;  1HT2 E;  4AKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...