1ORYB

Flagellar export chaperone in complex with its cognate binding partner
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
NVDFAKEMTEFTKYQIRMQSGVAMLAQANALPQLVLQLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flagellar protein FliS
publication title Similar modes of polypeptide recognition by export chaperones in flagellar biosynthesis and type III secretion
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Chaperone
total genus 14
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2003-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.410 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1oryB00
1ORYB
chains in the Genus database with same CATH superfamily
1SXJD 2J5YA 2CV1A 2JY7A 4OW0A 1QAOA 2JZ1A 3M0EA 3KDSE 2JY5A 1XMOM 3B89A 5JI3E 1T6OA 3CTWB 3GQ5A 1V34A 2FS1A 2OQ4A 3TPZA 1IBKM 3GLGE 3QAUA 1DO0A 3LVVA 3FKEA 3AKZA 5EQTA 1DGHB 3HWSA 3IG5A 2R4JA 3NWLA 1HQYE 3SAWA 3SC3A 1NY6A 3FRHA 3RFWA 2XZFA 1IN4A 1NNUC 1XXHB 1GJSA 1TH4A 1VDDA 4R3DA 1XNQM 1ZMVA 1IXRC 2DHRA 2WSEF 3FTFA 2XFTA 4MH0E 2R18A 1AUAA 1L2BA 2KRUA 5IREB 4JI6M 3GRYA 4DR4M 1TGUA 1HT2E 1R2YA 2QBYA 1VEGA 4OU7A 3U6OA 5ITXA 3HU2A 1EE8A 1IN5A 1J09A 3KP1E 3L2AA 3U6LA 2QQ8A 4L6V6 2LXEA 3L26A 4JXJA 4XK8F 3SFZA 1NVMA 2CV0A 4QNRA 1OAIA 4NC6A 2DZOB 3KXEC 4FCVA 2R62A 3E21A 2DHYA 4M9XA 4X66M 3U5ZB 1OIPA 2LHGA 2V1CA 5DYIA 5FTKA 3GLIB 1G59A 2KNAA 2KHHA 3LW5F 4LJ9A 4FD2A 2L09A 1R6BX 3H4JA 3LMMA 2B3TA 3LQRA 5EP3A 1WJ7A 1JR3E 3GO8A 3SBJA 3PFIA 2NQ8C 4X62M 4DV1M 4PDGA 1WHCA 4IBBA 1WGLA 3U6CA 3I4VA 1OTRA 2CUZA 2X49A 4WW0A 4II7A 5EXPA 4DV0M 3DA1A 1SXJC 2HHHM 3U60A 3HHXA 2CFOA 4DV7M 2VIIA 4JI0M 3HHZA 4IBJA 3E4RA 3GLHE 4G6ZA 1K82A 3QWLA 1IFYA 5E26A 1E9SA 4L8RC 1I4WA 4LF4M 4PD2A 2RGOA 3UK6A 2D7HA 4DV2M 3HZJA 3KSJA 3WHKA 2HCBA 4D82A 1JB0F 4IJFA 3HHYA 3B74A 2KZUA 3OTOM 4JN6A 5KPRA 4DV3M 3T38A 1L1ZA 2VF7A 2XH9A 3GLHA 4LF8M 3NBXX 1XMQM 4LZJA 3JAMS 3GP1A 3VK8A 3CGWA 2DI0A 3GPPA 3U6QA 2KNZA 3QYBA 2WZJA 3I01M 4KODA 4LGYA 4B7HA 4NL4H 1HQCA 1SXJB 2DNAA 4X65M 3W0FA 3SAVA 4GKKM 2QNJA 2F5OA 1DV0A 3TWLA 4NXMM 1FNNA 3MMPA 3FUWA 4F2LA 1Z5AA 1R5LA 4JV5M 4OVZA 2UXBM 4JI4M 1JR3D 1LV7A 3C3EA 2CE7A 5ITTA 4LFAM 3SMSA 4AW4A 3A46A 4IBIA 5GKNA 1K3XA 1NO1A 4Z6YA 3SYKA 1X37A 2DWZB 2O01F 4IJEA 1PJJA 2ZBKB 3ZQJA 1IN6A 3U61A 4M0DA 2BWBA 3KW6A 2JP7A 5DFLA 4L15A 1PJTA 2MROB 3K8ZA 2DWMA 3SHFA 3HHWA 2LH0A 3K9PA 1L8QA 1IN7A 1RU3A 2XF3A 4AG6A 4B08A 8CATA 4G4NA 3U6PA 5F3WA 2F5SA 2G8LA 4L78A 1GL6A 1YSYA 1ZAEA 4NSRA 3UZUA 4DBGB 2KDLA 3T6PA 4B3SM 4EIWA 2LVPC 2CRUA 3W68A 5KPTA 1TDZA 1C7YA 4NRWA 1IXSB 2JNHA 2LTUA 3DZDA 2UXCM 4RNAA 4CJ6A 1KSFX 1N78A 2C99A 1ORYB 2K9DA 3UGJA 3HJ8A 1DGBA 1QYRA 1QDTA 2FNAA 4B7FA 1J7KA 2LHCA 4LZZA 3GLFA 2G5GX 5C1BA 3SATA 1UFZA 1V92A 4TUWA 3THGA 2C96A 3AOGA 2J7NA 3Q8GA 1GABA 5KQ8A 2Z4RA 4L4UA 2UUCM 2JXNA 4IBDA 3SARA 1XWIA 3PXGA 2I7PA 4MGKE 3GLGB 4G4OA 1NNJA 4IBFA 4GKJM 5EXTA 5ITXE 2DWLA 4D80A 2Z8YM 3L29A 3U6MA 3SHGB 4LRSA 4Y28F 3W67A 2ZM6M 3D8BA 3SASA 2LVNC 3PNVA 3T1HM 4A3VB 3FUUA 1GKIA 4MGYE 4ZPXA 3HJQA 4LRTA 4M9SA 3RGSA 4RF0A 4YY3M 1TR8A 1GO5A 3TL4X 5C18A 3AL0C 4LJAA 3R9XB 5FTMA 2FFJA 5EP2A 3V76A 4JI8M 1G41A 4FCTA 4NSOB 1N34M 4JI7M 3SMPA 3JR4A 4LF5M 3MHVC 1VEKA 2HKJA 1XXHE 4LG2A 5IZ7D 1Q3CA 2KZSA 3CF2A 3QYEA 4JYAM 1QUTA 1EFUB 4D81A 1OFIA 2F5PA 1OIZA 1E94E 3LCUA 1QUSA 1NY5A 4MB7A 3L25A 4DR6M 1ZV1A 2MH8A 3FTDA 5ITYA 5E6JA 1DGHA 4B7GA 3VK7A 3U60B 1G71A 3ZC7B 4QOZC 4IBGA 1WIVA 2R46A 3J2PB 4R7GA 4BB9A 1CUKA 1OAOC 1H6UA 4AQYM 1XXHA 2DAGA 2JZ0A 3FUTA 3VDUA 2N35A 5DYGA 3WHLA 4YHHM 2VQFM 4LFBM 2I7NA 4M0WA 2DENA 5FLXS 3CF0A 4GIPA 4FWHA 3VKHA 4LJ5A 2CWBA 2OOAA 1XNRM 4IBCA 3VKGA 4HL4A 3HU1A 3ZCBB 2Q2EB 1OKSA 4AKIA 1D0LA 3PVSA 3GLHB 3I4YA 3KP0E 2JA2A 3K2LA 4IBKA 4QHTA 4GRIA 4LGMA 5BR8M 3GQ4A 1IY0A 1MU5A 4R71A 2V6ZM 3U5ZA 3TQSA 3GLIA 1L2DA 1IM2A 2YNMD 3B7ZA 3M6AA 4DR1M 4K0KM 3HX3A 1UM8A 5EP1A 2RKOA 4DR2M 1N77A 1TH2A 2L7IA 3B7NA 4GC5A 5KPZA 2JUJA 3AV0A 3FUVA 3I51A 1PRBA 2QZ4A 3L27A 2QCUA 4I4LA 4IBEA 4G3OA 3AOEC 4DV4M 1WGNA 1WR1B 3B7QA 4ANRA 4LFCM 2VQEM 2F4VM 1F4IA 2MGWA 1R4GA 2K0BX 3A42A 2XZUA 5ITRA 2RGHA 4P17A 2XFSA 1PGYA 1PJQA 2XEPA 2ZTCA 1G8PA 2CHVA 4FWGA 1K3WA 1GL7A 1Z6TA 3MK6A 5JI2E 2MJ5B 1I94M 2QP9X 2VF8A 4I81A 1IQPA 3TE6A 4Q7JA 5LMNM 1N32M 1D0MA 2OPFA 1Q02A 4QHSA 3DOAA 2UUBM 2A5YB 2EKFA 1YLAA 2EKKA 3FYCA 2Y21A 4QOSA 3FTEA 2H1RA 1QZMA 1OQYA 1Q3BA 1LTMA 1MN3A 3GRVA 3W0LB 3SAUA 4LF6M 1HR0M 1AIPC 1QVRA 2OOBA 5A2QS 3VLFB 2C98A 4JI3M 1L2CA 4S12A 1G4AE 3KS8A 2OO9A 3KOXE 4AZFA 4Z8XA 1TDHA 3GLFE 2AHMA 2Z3XA 1SXJA 4XBOA 5KQDA 4DR3M 3HJSA 1VQ1A 4WURA 4XGIA 3VFDA 1XHBA 3TWKA 4I5SA 1IY1A 3NBIA 4GEWA 2BJWA 1SG9A 4BBAA 2DWNA 1HNZM 2LNHC 5EJCA 1R2ZA 4HEOA 2JY6B 3HY5A 5EXSA 4JI5M 4AI6A 2XLJA 2DZNB 2EUCA 1N75A 2YR0A 4KT0F 2HL7A 2QPAA 2R45A 2Y0QA 1QAMA 2R4EA 3RGPA 3KS4A 1R7RA 4NOOB 1IBMM 3KOZE 4OX9M 4QNMA 2KXEA 2UXDM 2GNOA 2BJVA 4DR7M 3KFUG 1MX0A 3T1YM 5DNYA 3GPXA 1IN8A 2DAEA 3F92A 2O5RA 3I04M 4ITQA 4CGYB 2FH0A 2KW0A 3U6SA 2QBYB 4PDIA 3K92A 4LJ6A 5KO3A 2Y20A 4GHAA 1JQJC 2R0IA 4UN2B 3D8LA 3GRRA 3Q8XA 5BPVA 1IXZA 3AFHA 2BWEA 2WSCF 4CISA 2J7OA 2MR9A 2C9OA 4HLQA 1FJGM 4FW9A 1IXSA 2LVOC 2LVAA 3ILKA 2LBCA 2Z4SA 2DAIA 3K1JA 1WXQA 2CHGA 2FE8A 2ZAMA 4KHPM 2K6BA 5FTLA 2ERCA 2ZTDA 3C9PA 1VEJA 1DO2A 2GQFA 3L28A 3HKPA 3ZH9B 2KRKA 5ITQA 1QZEA 5IWAM 2X4AA 1E9RA 1QAQA 1T43A 2K47A 2L2DA 2L4EA 3KSXA 4BLCA 2XGNA 2L4FA 2M60A 1IBLM 1J5EM 3GLGA 4RKUF 2DAKA 1VG5A 1YUBA 1E32A 3DFZA 4NRVA 4CHTB 4DUZM 1Z59A 3LVWA 1IY2A 5LMUM 1S3SA 2DXIA 3GRUA 1V33A 3J80S 4I8OA 3C3DA 4FWDA 2YFQA 2DAMA 4MGIE 4GC9A 4DR5M 2EO2A 2R44A 3A45A 1TH3A 1PJIA 1YE9A 5EP4A 3EIHA 1PM5A 4M9ZA 2ZANA 3EIEA 2D7GA 4LY6A 3GLIE 1D2NA 3IECA 1G3IA 1HT1E 3CF6E 3K9OA 3JR5A 4X64M 3SYLA 2QHOB 1GLNA 3FRIA 2XSZA 2KNVA 4GITA 1NJFA 1VDLA 3BBZA 1NV8A 2BNKA 2X8AA 4DUYM 3R8FA 3IG8A 2KA6B 2HWJA 5FTJA 1N33M 2V1UA 4PCZA 3KVWA 2CEAA 5EXXA 5L8RF 4AKGA 4GHLA 2P5TA 4CIZA 1T3TA 2QENA 3J7BA 4W5WA 3RE8A 2E5LM 1Z5BA 1W5TA 4PT5A 4KO8A 3T15A 2F5NA 4WP2A 3B9PA 4OVZB 2JWSA 3E9SA 1NJGA 2CHQA 1JR3A 1QDRA 3BOSA 3MJ5A 4DV6M 1HNXM 4B3TM 3U6EA 3HGIA 2UUAM 5FTNA 3HU3A 5FSWA 1W5SA 1GJTA 2DVWB 1DGFA 4MGZE 3U61B 1OJLA 3LCVB 3GQ3A 5H37D 1NHGC 4LF9M 2KEBA 2QSFX 1NSFA 2XSZD 3A98B 3H4MA 4LJ4A 4AG5A 3GPUA 4FVMA 2O25A 4AKHA 2Z7JA 4NXNM 4RF1A 2H5XA 3VDPA 4DV5M 2HAKA 3PNYA 1SXJE 4F1IA 3U6DA 2CV2A 4LF7M 1N36M 3KOYE 2L7HA 2WSFF 4JI2M 3GPYA 4REZA 1DGGA 1KFVA 2G3QA 4FCWA 1NHWC 3FD9A 1HJPA 3M7GA 3UMMA 1XC8A 4JI1M 1QQWA 1GVNA 1KYIA 4IIWA 2D7EA 2R6FA 4L16A 1A5TA 3IHPA 1C1KA 2FOIC 2DKLA 5IT9S 2W82A 2UU9M 3J27B 2C9CA 2ZAOA 2DZLA 7CATA 2C5RA 3GLFB 1MJGM 2RRUA 3KOWE 1XB2B 1EIJA 1D0KA 1TTEA 1QANA 4G4QA 4LCBA 3FTCA 2LVQD 4GH9A 3E46A 4LJ8A 4GMQA 1PJSA 1ZMUA 3UJNA 4P16A 1OFHA 4KLNA 1Z5CA 2L6OA 3AJIB 2M5ZA 3BXWA 2R65A 1HNWM 4B3MM 2VDBB 1ZMWA 3LQQA 2CP8A 5ITUA 4LJ7A 1L1TA 3J7AS 4MM3B 1NV9A 4G4RA 2APLA 3J81S 1Y8GA 1TF0B 2YQZA 2LWXA 4MGHA 2F5QA 3TWMA 3AOEA 1Q39A 2EA0A 1P3QQ 1BVSA 2JY8A 4B3RM 1ZQ9A 2Y0TA 3FYDA 2EJSA 3C58A 3FUXA 3FE3A
chains in the Genus database with same CATH topology
1SXJD 2CV1A 4OW0A 1QAOA 3M0EA 3KDSE 1XMOM 5JI3E 3GQ5A 3CTWB 2OQ4A 3TPZA 1IBKM 3QAUA 1DO0A 3LVVA 3FKEA 3AKZA 5EQTA 1DGHB 3HWSA 3IG5A 2R4JA 3NWLA 1HQYE 3SAWA 3SC3A 1NY6A 2XZFA 3RFWA 1IN4A 1NNUC 1XXHB 1TH4A 1VDDA 4R3DA 1XNQM 2DHRA 1IXRC 3FTFA 2XFTA 4MH0E 2R18A 1L2BA 2KRUA 5IREB 4JI6M 3GRYA 4DR4M 1TGUA 1HT2E 1R2YA 2QBYA 4OU7A 3U6OA 5ITXA 3HU2A 1EE8A 1J09A 1IN5A 3KP1E 3L2AA 3U6LA 4TUWA 2LXEA 3L26A 4JXJA 3SFZA 1NVMA 2CV0A 4QNRA 2DZOB 3KXEC 4FCVA 2R62A 4M9XA 4X66M 3U5ZB 2V1CA 3GLIB 5DYIA 5FTKA 1G59A 4LJ9A 4FD2A 2L09A 1R6BX 3LMMA 3LQRA 5EP3A 3SBJA 3GO8A 3PFIA 2NQ8C 4X62M 4DV1M 4PDGA 4IBBA 3U6CA 3I4VA 2CUZA 2X49A 4WW0A 4II7A 5EXPA 4DV0M 3DA1A 1SXJC 2HHHM 3U60A 3HHXA 2CFOA 4DV7M 2VIIA 4JI0M 3HHZA 4IBJA 3E4RA 4G6ZA 1K82A 3QWLA 5E26A 1E9SA 4L8RC 1I4WA 4LF4M 4PD2A 2RGOA 3UK6A 2D7HA 4DV2M 3KSJA 3WHKA 2HCBA 4D82A 4IJFA 3HHYA 2KZUA 3OTOM 4JN6A 5KPRA 4DV3M 3T38A 1L1ZA 2XH9A 3GLHA 4LF8M 1XMQM 4LZJA 3JAMS 3GP1A 3VK8A 3GPPA 3U6QA 4KODA 4B7HA 4LGYA 4NL4H 1HQCA 1SXJB 4X65M 3W0FA 3SAVA 4GKKM 2F5OA 3TWLA 4NXMM 1FNNA 3FUWA 1Z5AA 4JV5M 4OVZA 2UXBM 4JI4M 1JR3D 1LV7A 2CE7A 5ITTA 4LFAM 3SMSA 4AW4A 3A46A 4IBIA 5GKNA 1K3XA 4Z6YA 3SYKA 1X37A 2DWZB 4IJEA 1PJJA 2ZBKB 1IN6A 3U61A 4M0DA 3KW6A 4L15A 3K8ZA 2DWMA 3SHFA 3HHWA 2LH0A 1L8QA 1IN7A 2XF3A 4AG6A 4B08A 8CATA 4G4NA 3U6PA 5F3WA 2F5SA 2G8LA 4L78A 1GL6A 1YSYA 1ZAEA 4NSRA 3UZUA 4B3SM 4EIWA 5KPTA 1TDZA 4NRWA 1IXSB 3DZDA 2UXCM 4RNAA 1KSFX 1N78A 2C99A 1ORYB 3UGJA 3HJ8A 1DGBA 1QYRA 2FNAA 4B7FA 1J7KA 4LZZA 3GLFA 2G5GX 5C1BA 3SATA 3THGA 2C96A 3AOGA 2J7NA 5KQ8A 2Z4RA 4L4UA 2UUCM 3SARA 4IBDA 1XWIA 3PXGA 2I7PA 4MGKE 3GLGB 4G4OA 1NNJA 4IBFA 4GKJM 5EXTA 5ITXE 2DWLA 4D80A 3L29A 3U6MA 3SHGB 4LRSA 2ZM6M 3D8BA 3SASA 3PNVA 3T1HM 4A3VB 3FUUA 1GKIA 4MGYE 4ZPXA 3HJQA 4LRTA 4M9SA 3RGSA 4RF0A 4YY3M 3TL4X 5C18A 3AL0C 4LJAA 3R9XB 5FTMA 2FFJA 5EP2A 4JI8M 1G41A 4FCTA 4NSOB 1N34M 4JI7M 3SMPA 3JR4A 4LF5M 3MHVC 2HKJA 4LG2A 5IZ7D 1Q3CA 2KZSA 3CF2A 4JYAM 4D81A 1OFIA 2F5PA 1E94E 1NY5A 4MB7A 3L25A 4DR6M 3FTDA 5ITYA 5E6JA 1DGHA 4B7GA 3VK7A 3U60B 3ZC7B 4QOZC 4IBGA 2R46A 3J2PB 4R7GA 4BB9A 1H6UA 4AQYM 1XXHA 3FUTA 3VDUA 2VQFM 5DYGA 3WHLA 4YHHM 4LFBM 2I7NA 4M0WA 5FLXS 3CF0A 4GIPA 4FWHA 3VKHA 4LJ5A 1XNRM 4IBCA 3VKGA 4HL4A 3HU1A 3ZCBB 2Q2EB 4AKIA 3PVSA 3GLHB 3I4YA 3KP0E 2JA2A 3K2LA 4IBKA 4QHTA 4GRIA 4LGMA 5BR8M 3GQ4A 1IY0A 1MU5A 2V6ZM 3U5ZA 3TQSA 3GLIA 1L2DA 1IM2A 2YNMD 3M6AA 4DR1M 4K0KM 1UM8A 5EP1A 2RKOA 4DR2M 1N77A 1TH2A 2L7IA 4GC5A 5KPZA 3AV0A 3FUVA 3I51A 4IBEA 2QZ4A 3L27A 2QCUA 4I4LA 3AOEC 4DV4M 4LFCM 2VQEM 2F4VM 3A42A 2XZUA 2RGHA 2XFSA 2XEPA 1G8PA 2CHVA 4FWGA 1K3WA 1GL7A 1Z6TA 3MK6A 5JI2E 1I94M 2QP9X 4I81A 3TE6A 1IQPA 5LMNM 1N32M 2OPFA 4QHSA 3DOAA 2UUBM 2A5YB 3FYCA 2Y21A 4QOSA 3FTEA 2H1RA 1QZMA 1Q3BA 3GRVA 3W0LB 3SAUA 4LF6M 1HR0M 1QVRA 5A2QS 3VLFB 2C98A 4JI3M 1L2CA 4S12A 1G4AE 3KS8A 3KOXE 4AZFA 4Z8XA 1TDHA 2AHMA 2Z3XA 1SXJA 4XBOA 5KQDA 4DR3M 3HJSA 4WURA 4XGIA 3VFDA 1XHBA 3TWKA 4I5SA 1IY1A 3NBIA 2BJWA 4BBAA 2DWNA 1HNZM 2LNHC 5EJCA 1R2ZA 5EXSA 4JI5M 4AI6A 2XLJA 2DZNB 2EUCA 1N75A 2YR0A 2HL7A 2QPAA 2R45A 2Y0QA 1QAMA 2R4EA 3RGPA 3KS4A 1R7RA 4NOOB 1IBMM 3KOZE 4OX9M 4QNMA 2KXEA 2UXDM 2BJVA 4DR7M 3KFUG 1MX0A 3T1YM 5DNYA 3GPXA 1IN8A 2O5RA 4ITQA 4CGYB 2KW0A 3U6SA 2QBYB 4PDIA 3K92A 4LJ6A 5KO3A 2Y20A 4GHAA 1JQJC 3D8LA 3GRRA 3Q8XA 5BPVA 1IXZA 3AFHA 4CISA 2J7OA 2C9OA 4HLQA 1FJGM 4FW9A 3ILKA 2Z4SA 3K1JA 1WXQA 2CHGA 2FE8A 2ZAMA 4KHPM 5FTLA 2ERCA 3L28A 3ZH9B 1DO2A 3HKPA 2KRKA 5ITQA 5IWAM 2X4AA 1E9RA 1QAQA 2K47A 3KSXA 4BLCA 2XGNA 2M60A 1IBLM 1J5EM 3GLGA 3DFZA 1YUBA 1E32A 4NRVA 4CHTB 4DUZM 1Z59A 3LVWA 1IY2A 5LMUM 1S3SA 2DXIA 3GRUA 3J80S 4I8OA 4FWDA 2YFQA 4MGIE 4GC9A 4DR5M 2EO2A 3A45A 1PJIA 1TH3A 1YE9A 5EP4A 3EIHA 1PM5A 4M9ZA 2ZANA 3EIEA 2D7GA 4LY6A 1D2NA 1G3IA 1HT1E 3CF6E 3JR5A 4X64M 3SYLA 1GLNA 2XSZA 4GITA 1NJFA 2BNKA 3R8FA 2X8AA 4DUYM 3IG8A 2KA6B 5FTJA 1N33M 2V1UA 4PCZA 3KVWA 2CEAA 5EXXA 4AKGA 4GHLA 2P5TA 1T3TA 2QENA 3J7BA 4W5WA 3RE8A 2E5LM 1Z5BA 1W5TA 4PT5A 4KO8A 3T15A 2F5NA 3B9PA 4OVZB 3E9SA 1NJGA 2CHQA 1JR3A 3BOSA 3MJ5A 1HNXM 4DV6M 4B3TM 3U6EA 3HGIA 2UUAM 5FTNA 3HU3A 5FSWA 1W5SA 2DVWB 1DGFA 4MGZE 3U61B 1OJLA 3GQ3A 5H37D 1NHGC 4LF9M 2KEBA 4AG5A 1NSFA 2XSZD 3A98B 3H4MA 4LJ4A 3GPUA 4FVMA 4AKHA 2Z7JA 4NXNM 4RF1A 3VDPA 4DV5M 3PNYA 1SXJE 3U6DA 4LF7M 2CV2A 1N36M 3KOYE 2L7HA 4JI2M 3GPYA 4REZA 1DGGA 1KFVA 4FCWA 1NHWC 3FD9A 3M7GA 3UMMA 1XC8A 4JI1M 1QQWA 1GVNA 1KYIA 4IIWA 2D7EA 4L16A 1C1KA 2FOIC 5IT9S 2W82A 2UU9M 3J27B 2C9CA 2ZAOA 2C5RA 7CATA 3GLFB 3KOWE 1QANA 4G4QA 4LCBA 3FTCA 4GH9A 4LJ8A 4GMQA 3UJNA 4P16A 1OFHA 4KLNA 1Z5CA 2L6OA 3AJIB 2M5ZA 2R65A 1HNWM 4B3MM 3LQQA 5ITUA 4LJ7A 1L1TA 3J7AS 4MM3B 4G4RA 3J81S 2YQZA 2LWXA 4MGHA 2F5QA 3TWMA 3AOEA 1Q39A 2EA0A 4B3RM 1ZQ9A 2Y0TA 3FYDA 5ITRA 3C58A 3FUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORY B; 
#chains in the Genus database with same CATH topology
 1SXJ D;  2J5Y A;  2CV1 A;  2JY7 A;  4OW0 A;  1QAO A;  2JZ1 A;  3M0E A;  3KDS E;  2JY5 A;  1XMO M;  3B89 A;  5JI3 E;  1T6O A;  3CTW B;  3GQ5 A;  1V34 A;  2FS1 A;  2OQ4 A;  3TPZ A;  1IBK M;  3GLG E;  3QAU A;  1DO0 A;  3LVV A;  3FKE A;  3AKZ A;  5EQT A;  1DGH B;  3HWS A;  3IG5 A;  2R4J A;  3NWL A;  1HQY E;  3SAW A;  3SC3 A;  1NY6 A;  3FRH A;  3RFW A;  2XZF A;  1IN4 A;  1NNU C;  1XXH B;  1GJS A;  1TH4 A;  1VDD A;  4R3D A;  1XNQ M;  1ZMV A;  1IXR C;  2DHR A;  2WSE F;  3FTF A;  2XFT A;  4MH0 E;  2R18 A;  1AUA A;  1L2B A;  2KRU A;  5IRE B;  4JI6 M;  3GRY A;  4DR4 M;  1TGU A;  1HT2 E;  1R2Y A;  2QBY A;  1VEG A;  4OU7 A;  3U6O A;  5ITX A;  3HU2 A;  1EE8 A;  1IN5 A;  1J09 A;  3KP1 E;  3L2A A;  3U6L A;  2QQ8 A;  4L6V 6;  2LXE A;  3L26 A;  4JXJ A;  4XK8 F;  3SFZ A;  1NVM A;  2CV0 A;  4QNR A;  1OAI A;  4NC6 A;  2DZO B;  3KXE C;  4FCV A;  2R62 A;  3E21 A;  2DHY A;  4M9X A;  4X66 M;  3U5Z B;  1OIP A;  2LHG A;  2V1C A;  5DYI A;  5FTK A;  3GLI B;  1G59 A;  2KNA A;  2KHH A;  3LW5 F;  4LJ9 A;  4FD2 A;  2L09 A;  1R6B X;  3H4J A;  3LMM A;  2B3T A;  3LQR A;  5EP3 A;  1WJ7 A;  1JR3 E;  3GO8 A;  3SBJ A;  3PFI A;  2NQ8 C;  4X62 M;  4DV1 M;  4PDG A;  1WHC A;  4IBB A;  1WGL A;  3U6C A;  3I4V A;  1OTR A;  2CUZ A;  2X49 A;  4WW0 A;  4II7 A;  5EXP A;  4DV0 M;  3DA1 A;  1SXJ C;  2HHH M;  3U60 A;  3HHX A;  2CFO A;  4DV7 M;  2VII A;  4JI0 M;  3HHZ A;  4IBJ A;  3E4R A;  3GLH E;  4G6Z A;  1K82 A;  3QWL A;  1IFY A;  5E26 A;  1E9S A;  4L8R C;  1I4W A;  4LF4 M;  4PD2 A;  2RGO A;  3UK6 A;  2D7H A;  4DV2 M;  3HZJ A;  3KSJ A;  3WHK A;  2HCB A;  4D82 A;  1JB0 F;  4IJF A;  3HHY A;  3B74 A;  2KZU A;  3OTO M;  4JN6 A;  5KPR A;  4DV3 M;  3T38 A;  1L1Z A;  2VF7 A;  2XH9 A;  3GLH A;  4LF8 M;  3NBX X;  1XMQ M;  4LZJ A;  3JAM S;  3GP1 A;  3VK8 A;  3CGW A;  2DI0 A;  3GPP A;  3U6Q A;  2KNZ A;  3QYB A;  2WZJ A;  3I01 M;  4KOD A;  4LGY A;  4B7H A;  4NL4 H;  1HQC A;  1SXJ B;  2DNA A;  4X65 M;  3W0F A;  3SAV A;  4GKK M;  2QNJ A;  2F5O A;  1DV0 A;  3TWL A;  4NXM M;  1FNN A;  3MMP A;  3FUW A;  4F2L A;  1Z5A A;  1R5L A;  4JV5 M;  4OVZ A;  2UXB M;  4JI4 M;  1JR3 D;  1LV7 A;  3C3E A;  2CE7 A;  5ITT A;  4LFA M;  3SMS A;  4AW4 A;  3A46 A;  4IBI A;  5GKN A;  1K3X A;  1NO1 A;  4Z6Y A;  3SYK A;  1X37 A;  2DWZ B;  2O01 F;  4IJE A;  1PJJ A;  2ZBK B;  3ZQJ A;  1IN6 A;  3U61 A;  4M0D A;  2BWB A;  3KW6 A;  2JP7 A;  5DFL A;  4L15 A;  1PJT A;  2MRO B;  3K8Z A;  2DWM A;  3SHF A;  3HHW A;  2LH0 A;  3K9P A;  1L8Q A;  1IN7 A;  1RU3 A;  2XF3 A;  4AG6 A;  4B08 A;  8CAT A;  4G4N A;  3U6P A;  5F3W A;  2F5S A;  2G8L A;  4L78 A;  1GL6 A;  1YSY A;  1ZAE A;  4NSR A;  3UZU A;  4DBG B;  2KDL A;  3T6P A;  4B3S M;  4EIW A;  2LVP C;  2CRU A;  3W68 A;  5KPT A;  1TDZ A;  1C7Y A;  4NRW A;  1IXS B;  2JNH A;  2LTU A;  3DZD A;  2UXC M;  4RNA A;  4CJ6 A;  1KSF X;  1N78 A;  2C99 A;  1ORY B;  2K9D A;  3UGJ A;  3HJ8 A;  1DGB A;  1QYR A;  1QDT A;  2FNA A;  4B7F A;  1J7K A;  2LHC A;  4LZZ A;  3GLF A;  2G5G X;  5C1B A;  3SAT A;  1UFZ A;  1V92 A;  4TUW A;  3THG A;  2C96 A;  3AOG A;  2J7N A;  3Q8G A;  1GAB A;  5KQ8 A;  2Z4R A;  4L4U A;  2UUC M;  2JXN A;  4IBD A;  3SAR A;  1XWI A;  3PXG A;  2I7P A;  4MGK E;  3GLG B;  4G4O A;  1NNJ A;  4IBF A;  4GKJ M;  5EXT A;  5ITX E;  2DWL A;  4D80 A;  2Z8Y M;  3L29 A;  3U6M A;  3SHG B;  4LRS A;  4Y28 F;  3W67 A;  2ZM6 M;  3D8B A;  3SAS A;  2LVN C;  3PNV A;  3T1H M;  4A3V B;  3FUU A;  1GKI A;  4MGY E;  4ZPX A;  3HJQ A;  4LRT A;  4M9S A;  3RGS A;  4RF0 A;  4YY3 M;  1TR8 A;  1GO5 A;  3TL4 X;  5C18 A;  3AL0 C;  4LJA A;  3R9X B;  5FTM A;  2FFJ A;  5EP2 A;  3V76 A;  4JI8 M;  1G41 A;  4FCT A;  4NSO B;  1N34 M;  4JI7 M;  3SMP A;  3JR4 A;  4LF5 M;  3MHV C;  1VEK A;  2HKJ A;  1XXH E;  4LG2 A;  5IZ7 D;  1Q3C A;  2KZS A;  3CF2 A;  3QYE A;  4JYA M;  1QUT A;  1EFU B;  4D81 A;  1OFI A;  2F5P A;  1OIZ A;  1E94 E;  3LCU A;  1QUS A;  1NY5 A;  4MB7 A;  3L25 A;  4DR6 M;  1ZV1 A;  2MH8 A;  3FTD A;  5ITY A;  5E6J A;  1DGH A;  4B7G A;  3VK7 A;  3U60 B;  1G71 A;  3ZC7 B;  4QOZ C;  4IBG A;  1WIV A;  2R46 A;  3J2P B;  4R7G A;  4BB9 A;  1CUK A;  1OAO C;  1H6U A;  4AQY M;  1XXH A;  2DAG A;  2JZ0 A;  3FUT A;  3VDU A;  2N35 A;  5DYG A;  3WHL A;  4YHH M;  2VQF M;  4LFB M;  2I7N A;  4M0W A;  2DEN A;  5FLX S;  3CF0 A;  4GIP A;  4FWH A;  3VKH A;  4LJ5 A;  2CWB A;  2OOA A;  1XNR M;  4IBC A;  3VKG A;  4HL4 A;  3HU1 A;  3ZCB B;  2Q2E B;  1OKS A;  4AKI A;  1D0L A;  3PVS A;  3GLH B;  3I4Y A;  3KP0 E;  2JA2 A;  3K2L A;  4IBK A;  4QHT A;  4GRI A;  4LGM A;  5BR8 M;  3GQ4 A;  1IY0 A;  1MU5 A;  4R71 A;  2V6Z M;  3U5Z A;  3TQS A;  3GLI A;  1L2D A;  1IM2 A;  2YNM D;  3B7Z A;  3M6A A;  4DR1 M;  4K0K M;  3HX3 A;  1UM8 A;  5EP1 A;  2RKO A;  4DR2 M;  1N77 A;  1TH2 A;  2L7I A;  3B7N A;  4GC5 A;  5KPZ A;  2JUJ A;  3AV0 A;  3FUV A;  3I51 A;  1PRB A;  2QZ4 A;  3L27 A;  2QCU A;  4I4L A;  4IBE A;  4G3O A;  3AOE C;  4DV4 M;  1WGN A;  1WR1 B;  3B7Q A;  4ANR A;  4LFC M;  2VQE M;  2F4V M;  1F4I A;  2MGW A;  1R4G A;  2K0B X;  3A42 A;  2XZU A;  5ITR A;  2RGH A;  4P17 A;  2XFS A;  1PGY A;  1PJQ A;  2XEP A;  2ZTC A;  1G8P A;  2CHV A;  4FWG A;  1K3W A;  1GL7 A;  1Z6T A;  3MK6 A;  5JI2 E;  2MJ5 B;  1I94 M;  2QP9 X;  2VF8 A;  4I81 A;  1IQP A;  3TE6 A;  4Q7J A;  5LMN M;  1N32 M;  1D0M A;  2OPF A;  1Q02 A;  4QHS A;  3DOA A;  2UUB M;  2A5Y B;  2EKF A;  1YLA A;  2EKK A;  3FYC A;  2Y21 A;  4QOS A;  3FTE A;  2H1R A;  1QZM A;  1OQY A;  1Q3B A;  1LTM A;  1MN3 A;  3GRV A;  3W0L B;  3SAU A;  4LF6 M;  1HR0 M;  1AIP C;  1QVR A;  2OOB A;  5A2Q S;  3VLF B;  2C98 A;  4JI3 M;  1L2C A;  4S12 A;  1G4A E;  3KS8 A;  2OO9 A;  3KOX E;  4AZF A;  4Z8X A;  1TDH A;  3GLF E;  2AHM A;  2Z3X A;  1SXJ A;  4XBO A;  5KQD A;  4DR3 M;  3HJS A;  1VQ1 A;  4WUR A;  4XGI A;  3VFD A;  1XHB A;  3TWK A;  4I5S A;  1IY1 A;  3NBI A;  4GEW A;  2BJW A;  1SG9 A;  4BBA A;  2DWN A;  1HNZ M;  2LNH C;  5EJC A;  1R2Z A;  4HEO A;  2JY6 B;  3HY5 A;  5EXS A;  4JI5 M;  4AI6 A;  2XLJ A;  2DZN B;  2EUC A;  1N75 A;  2YR0 A;  4KT0 F;  2HL7 A;  2QPA A;  2R45 A;  2Y0Q A;  1QAM A;  2R4E A;  3RGP A;  3KS4 A;  1R7R A;  4NOO B;  1IBM M;  3KOZ E;  4OX9 M;  4QNM A;  2KXE A;  2UXD M;  2GNO A;  2BJV A;  4DR7 M;  3KFU G;  1MX0 A;  3T1Y M;  5DNY A;  3GPX A;  1IN8 A;  2DAE A;  3F92 A;  2O5R A;  3I04 M;  4ITQ A;  4CGY B;  2FH0 A;  2KW0 A;  3U6S A;  2QBY B;  4PDI A;  3K92 A;  4LJ6 A;  5KO3 A;  2Y20 A;  4GHA A;  1JQJ C;  2R0I A;  4UN2 B;  3D8L A;  3GRR A;  3Q8X A;  5BPV A;  1IXZ A;  3AFH A;  2BWE A;  2WSC F;  4CIS A;  2J7O A;  2MR9 A;  2C9O A;  4HLQ A;  1FJG M;  4FW9 A;  1IXS A;  2LVO C;  2LVA A;  3ILK A;  2LBC A;  2Z4S A;  2DAI A;  3K1J A;  1WXQ A;  2CHG A;  2FE8 A;  2ZAM A;  4KHP M;  2K6B A;  5FTL A;  2ERC A;  2ZTD A;  3C9P A;  1VEJ A;  1DO2 A;  2GQF A;  3L28 A;  3HKP A;  3ZH9 B;  2KRK A;  5ITQ A;  1QZE A;  5IWA M;  2X4A A;  1E9R A;  1QAQ A;  1T43 A;  2K47 A;  2L2D A;  2L4E A;  3KSX A;  4BLC A;  2XGN A;  2L4F A;  2M60 A;  1IBL M;  1J5E M;  3GLG A;  4RKU F;  2DAK A;  1VG5 A;  1YUB A;  1E32 A;  3DFZ A;  4NRV A;  4CHT B;  4DUZ M;  1Z59 A;  3LVW A;  1IY2 A;  5LMU M;  1S3S A;  2DXI A;  3GRU A;  1V33 A;  3J80 S;  4I8O A;  3C3D A;  4FWD A;  2YFQ A;  2DAM A;  4MGI E;  4GC9 A;  4DR5 M;  2EO2 A;  2R44 A;  3A45 A;  1TH3 A;  1PJI A;  1YE9 A;  5EP4 A;  3EIH A;  1PM5 A;  4M9Z A;  2ZAN A;  3EIE A;  2D7G A;  4LY6 A;  3GLI E;  1D2N A;  3IEC A;  1G3I A;  1HT1 E;  3CF6 E;  3K9O A;  3JR5 A;  4X64 M;  3SYL A;  2QHO B;  1GLN A;  3FRI A;  2XSZ A;  2KNV A;  4GIT A;  1NJF A;  1VDL A;  3BBZ A;  1NV8 A;  2BNK A;  2X8A A;  4DUY M;  3R8F A;  3IG8 A;  2KA6 B;  2HWJ A;  5FTJ A;  1N33 M;  2V1U A;  4PCZ A;  3KVW A;  2CEA A;  5EXX A;  5L8R F;  4AKG A;  4GHL A;  2P5T A;  4CIZ A;  1T3T A;  2QEN A;  3J7B A;  4W5W A;  3RE8 A;  2E5L M;  1Z5B A;  1W5T A;  4PT5 A;  4KO8 A;  3T15 A;  2F5N A;  4WP2 A;  3B9P A;  4OVZ B;  2JWS A;  3E9S A;  1NJG A;  2CHQ A;  1JR3 A;  1QDR A;  3BOS A;  3MJ5 A;  4DV6 M;  1HNX M;  4B3T M;  3U6E A;  3HGI A;  2UUA M;  5FTN A;  3HU3 A;  5FSW A;  1W5S A;  1GJT A;  2DVW B;  1DGF A;  4MGZ E;  3U61 B;  1OJL A;  3LCV B;  3GQ3 A;  5H37 D;  1NHG C;  4LF9 M;  2KEB A;  2QSF X;  1NSF A;  2XSZ D;  3A98 B;  3H4M A;  4LJ4 A;  4AG5 A;  3GPU A;  4FVM A;  2O25 A;  4AKH A;  2Z7J A;  4NXN M;  4RF1 A;  2H5X A;  3VDP A;  4DV5 M;  2HAK A;  3PNY A;  1SXJ E;  4F1I A;  3U6D A;  2CV2 A;  4LF7 M;  1N36 M;  3KOY E;  2L7H A;  2WSF F;  4JI2 M;  3GPY A;  4REZ A;  1DGG A;  1KFV A;  2G3Q A;  4FCW A;  1NHW C;  3FD9 A;  1HJP A;  3M7G A;  3UMM A;  1XC8 A;  4JI1 M;  1QQW A;  1GVN A;  1KYI A;  4IIW A;  2D7E A;  2R6F A;  4L16 A;  1A5T A;  3IHP A;  1C1K A;  2FOI C;  2DKL A;  5IT9 S;  2W82 A;  2UU9 M;  3J27 B;  2C9C A;  2ZAO A;  2DZL A;  7CAT A;  2C5R A;  3GLF B;  1MJG M;  2RRU A;  3KOW E;  1XB2 B;  1EIJ A;  1D0K A;  1TTE A;  1QAN A;  4G4Q A;  4LCB A;  3FTC A;  2LVQ D;  4GH9 A;  3E46 A;  4LJ8 A;  4GMQ A;  1PJS A;  1ZMU A;  3UJN A;  4P16 A;  1OFH A;  4KLN A;  1Z5C A;  2L6O A;  3AJI B;  2M5Z A;  3BXW A;  2R65 A;  1HNW M;  4B3M M;  2VDB B;  1ZMW A;  3LQQ A;  2CP8 A;  5ITU A;  4LJ7 A;  1L1T A;  3J7A S;  4MM3 B;  1NV9 A;  4G4R A;  2APL A;  3J81 S;  1Y8G A;  1TF0 B;  2YQZ A;  2LWX A;  4MGH A;  2F5Q A;  3TWM A;  3AOE A;  1Q39 A;  2EA0 A;  1P3Q Q;  1BVS A;  2JY8 A;  4B3R M;  1ZQ9 A;  2Y0T A;  3FYD A;  2EJS A;  3C58 A;  3FUX A;  3FE3 A; 
#chains in the Genus database with same CATH homology
 1SXJ D;  2CV1 A;  4OW0 A;  1QAO A;  3M0E A;  3KDS E;  1XMO M;  5JI3 E;  3GQ5 A;  3CTW B;  2OQ4 A;  3TPZ A;  1IBK M;  3QAU A;  1DO0 A;  3LVV A;  3FKE A;  3AKZ A;  5EQT A;  1DGH B;  3HWS A;  3IG5 A;  2R4J A;  3NWL A;  1HQY E;  3SAW A;  3SC3 A;  1NY6 A;  2XZF A;  3RFW A;  1IN4 A;  1NNU C;  1XXH B;  1TH4 A;  1VDD A;  4R3D A;  1XNQ M;  2DHR A;  1IXR C;  3FTF A;  2XFT A;  4MH0 E;  2R18 A;  1L2B A;  2KRU A;  5IRE B;  4JI6 M;  3GRY A;  4DR4 M;  1TGU A;  1HT2 E;  1R2Y A;  2QBY A;  4OU7 A;  3U6O A;  5ITX A;  3HU2 A;  1EE8 A;  1J09 A;  1IN5 A;  3KP1 E;  3L2A A;  3U6L A;  4TUW A;  2LXE A;  3L26 A;  4JXJ A;  3SFZ A;  1NVM A;  2CV0 A;  4QNR A;  2DZO B;  3KXE C;  4FCV A;  2R62 A;  4M9X A;  4X66 M;  3U5Z B;  2V1C A;  3GLI B;  5DYI A;  5FTK A;  1G59 A;  4LJ9 A;  4FD2 A;  2L09 A;  1R6B X;  3LMM A;  3LQR A;  5EP3 A;  3SBJ A;  3GO8 A;  3PFI A;  2NQ8 C;  4X62 M;  4DV1 M;  4PDG A;  4IBB A;  3U6C A;  3I4V A;  2CUZ A;  2X49 A;  4WW0 A;  4II7 A;  5EXP A;  4DV0 M;  3DA1 A;  1SXJ C;  2HHH M;  3U60 A;  3HHX A;  2CFO A;  4DV7 M;  2VII A;  4JI0 M;  3HHZ A;  4IBJ A;  3E4R A;  4G6Z A;  1K82 A;  3QWL A;  5E26 A;  1E9S A;  4L8R C;  1I4W A;  4LF4 M;  4PD2 A;  2RGO A;  3UK6 A;  2D7H A;  4DV2 M;  3KSJ A;  3WHK A;  2HCB A;  4D82 A;  4IJF A;  3HHY A;  2KZU A;  3OTO M;  4JN6 A;  5KPR A;  4DV3 M;  3T38 A;  1L1Z A;  2XH9 A;  3GLH A;  4LF8 M;  1XMQ M;  4LZJ A;  3JAM S;  3GP1 A;  3VK8 A;  3GPP A;  3U6Q A;  4KOD A;  4B7H A;  4LGY A;  4NL4 H;  1HQC A;  1SXJ B;  4X65 M;  3W0F A;  3SAV A;  4GKK M;  2F5O A;  3TWL A;  4NXM M;  1FNN A;  3FUW A;  1Z5A A;  4JV5 M;  4OVZ A;  2UXB M;  4JI4 M;  1JR3 D;  1LV7 A;  2CE7 A;  5ITT A;  4LFA M;  3SMS A;  4AW4 A;  3A46 A;  4IBI A;  5GKN A;  1K3X A;  4Z6Y A;  3SYK A;  1X37 A;  2DWZ B;  4IJE A;  1PJJ A;  2ZBK B;  1IN6 A;  3U61 A;  4M0D A;  3KW6 A;  4L15 A;  3K8Z A;  2DWM A;  3SHF A;  3HHW A;  2LH0 A;  1L8Q A;  1IN7 A;  2XF3 A;  4AG6 A;  4B08 A;  8CAT A;  4G4N A;  3U6P A;  5F3W A;  2F5S A;  2G8L A;  4L78 A;  1GL6 A;  1YSY A;  1ZAE A;  4NSR A;  3UZU A;  4B3S M;  4EIW A;  5KPT A;  1TDZ A;  4NRW A;  1IXS B;  3DZD A;  2UXC M;  4RNA A;  1KSF X;  1N78 A;  2C99 A;  1ORY B;  3UGJ A;  3HJ8 A;  1DGB A;  1QYR A;  2FNA A;  4B7F A;  1J7K A;  4LZZ A;  3GLF A;  2G5G X;  5C1B A;  3SAT A;  3THG A;  2C96 A;  3AOG A;  2J7N A;  5KQ8 A;  2Z4R A;  4L4U A;  2UUC M;  3SAR A;  4IBD A;  1XWI A;  3PXG A;  2I7P A;  4MGK E;  3GLG B;  4G4O A;  1NNJ A;  4IBF A;  4GKJ M;  5EXT A;  5ITX E;  2DWL A;  4D80 A;  3L29 A;  3U6M A;  3SHG B;  4LRS A;  2ZM6 M;  3D8B A;  3SAS A;  3PNV A;  3T1H M;  4A3V B;  3FUU A;  1GKI A;  4MGY E;  4ZPX A;  3HJQ A;  4LRT A;  4M9S A;  3RGS A;  4RF0 A;  4YY3 M;  3TL4 X;  5C18 A;  3AL0 C;  4LJA A;  3R9X B;  5FTM A;  2FFJ A;  5EP2 A;  4JI8 M;  1G41 A;  4FCT A;  4NSO B;  1N34 M;  4JI7 M;  3SMP A;  3JR4 A;  4LF5 M;  3MHV C;  2HKJ A;  4LG2 A;  5IZ7 D;  1Q3C A;  2KZS A;  3CF2 A;  4JYA M;  4D81 A;  1OFI A;  2F5P A;  1E94 E;  1NY5 A;  4MB7 A;  3L25 A;  4DR6 M;  3FTD A;  5ITY A;  5E6J A;  1DGH A;  4B7G A;  3VK7 A;  3U60 B;  3ZC7 B;  4QOZ C;  4IBG A;  2R46 A;  3J2P B;  4R7G A;  4BB9 A;  1H6U A;  4AQY M;  1XXH A;  3FUT A;  3VDU A;  2VQF M;  5DYG A;  3WHL A;  4YHH M;  4LFB M;  2I7N A;  4M0W A;  5FLX S;  3CF0 A;  4GIP A;  4FWH A;  3VKH A;  4LJ5 A;  1XNR M;  4IBC A;  3VKG A;  4HL4 A;  3HU1 A;  3ZCB B;  2Q2E B;  4AKI A;  3PVS A;  3GLH B;  3I4Y A;  3KP0 E;  2JA2 A;  3K2L A;  4IBK A;  4QHT A;  4GRI A;  4LGM A;  5BR8 M;  3GQ4 A;  1IY0 A;  1MU5 A;  2V6Z M;  3U5Z A;  3TQS A;  3GLI A;  1L2D A;  1IM2 A;  2YNM D;  3M6A A;  4DR1 M;  4K0K M;  1UM8 A;  5EP1 A;  2RKO A;  4DR2 M;  1N77 A;  1TH2 A;  2L7I A;  4GC5 A;  5KPZ A;  3AV0 A;  3FUV A;  3I51 A;  4IBE A;  2QZ4 A;  3L27 A;  2QCU A;  4I4L A;  3AOE C;  4DV4 M;  4LFC M;  2VQE M;  2F4V M;  3A42 A;  2XZU A;  2RGH A;  2XFS A;  2XEP A;  1G8P A;  2CHV A;  4FWG A;  1K3W A;  1GL7 A;  1Z6T A;  3MK6 A;  5JI2 E;  1I94 M;  2QP9 X;  4I81 A;  3TE6 A;  1IQP A;  5LMN M;  1N32 M;  2OPF A;  4QHS A;  3DOA A;  2UUB M;  2A5Y B;  3FYC A;  2Y21 A;  4QOS A;  3FTE A;  2H1R A;  1QZM A;  1Q3B A;  3GRV A;  3W0L B;  3SAU A;  4LF6 M;  1HR0 M;  1QVR A;  5A2Q S;  3VLF B;  2C98 A;  4JI3 M;  1L2C A;  4S12 A;  1G4A E;  3KS8 A;  3KOX E;  4AZF A;  4Z8X A;  1TDH A;  2AHM A;  2Z3X A;  1SXJ A;  4XBO A;  5KQD A;  4DR3 M;  3HJS A;  4WUR A;  4XGI A;  3VFD A;  1XHB A;  3TWK A;  4I5S A;  1IY1 A;  3NBI A;  2BJW A;  4BBA A;  2DWN A;  1HNZ M;  2LNH C;  5EJC A;  1R2Z A;  5EXS A;  4JI5 M;  4AI6 A;  2XLJ A;  2DZN B;  2EUC A;  1N75 A;  2YR0 A;  2HL7 A;  2QPA A;  2R45 A;  2Y0Q A;  1QAM A;  2R4E A;  3RGP A;  3KS4 A;  1R7R A;  4NOO B;  1IBM M;  3KOZ E;  4OX9 M;  4QNM A;  2KXE A;  2UXD M;  2BJV A;  4DR7 M;  3KFU G;  1MX0 A;  3T1Y M;  5DNY A;  3GPX A;  1IN8 A;  2O5R A;  4ITQ A;  4CGY B;  2KW0 A;  3U6S A;  2QBY B;  4PDI A;  3K92 A;  4LJ6 A;  5KO3 A;  2Y20 A;  4GHA A;  1JQJ C;  3D8L A;  3GRR A;  3Q8X A;  5BPV A;  1IXZ A;  3AFH A;  4CIS A;  2J7O A;  2C9O A;  4HLQ A;  1FJG M;  4FW9 A;  3ILK A;  2Z4S A;  3K1J A;  1WXQ A;  2CHG A;  2FE8 A;  2ZAM A;  4KHP M;  5FTL A;  2ERC A;  3L28 A;  3ZH9 B;  1DO2 A;  3HKP A;  2KRK A;  5ITQ A;  5IWA M;  2X4A A;  1E9R A;  1QAQ A;  2K47 A;  3KSX A;  4BLC A;  2XGN A;  2M60 A;  1IBL M;  1J5E M;  3GLG A;  3DFZ A;  1YUB A;  1E32 A;  4NRV A;  4CHT B;  4DUZ M;  1Z59 A;  3LVW A;  1IY2 A;  5LMU M;  1S3S A;  2DXI A;  3GRU A;  3J80 S;  4I8O A;  4FWD A;  2YFQ A;  4MGI E;  4GC9 A;  4DR5 M;  2EO2 A;  3A45 A;  1PJI A;  1TH3 A;  1YE9 A;  5EP4 A;  3EIH A;  1PM5 A;  4M9Z A;  2ZAN A;  3EIE A;  2D7G A;  4LY6 A;  1D2N A;  1G3I A;  1HT1 E;  3CF6 E;  3JR5 A;  4X64 M;  3SYL A;  1GLN A;  2XSZ A;  4GIT A;  1NJF A;  2BNK A;  3R8F A;  2X8A A;  4DUY M;  3IG8 A;  2KA6 B;  5FTJ A;  1N33 M;  2V1U A;  4PCZ A;  3KVW A;  2CEA A;  5EXX A;  4AKG A;  4GHL A;  2P5T A;  1T3T A;  2QEN A;  3J7B A;  4W5W A;  3RE8 A;  2E5L M;  1Z5B A;  1W5T A;  4PT5 A;  4KO8 A;  3T15 A;  2F5N A;  3B9P A;  4OVZ B;  3E9S A;  1NJG A;  2CHQ A;  1JR3 A;  3BOS A;  3MJ5 A;  1HNX M;  4DV6 M;  4B3T M;  3U6E A;  3HGI A;  2UUA M;  5FTN A;  3HU3 A;  5FSW A;  1W5S A;  2DVW B;  1DGF A;  4MGZ E;  3U61 B;  1OJL A;  3GQ3 A;  5H37 D;  1NHG C;  4LF9 M;  2KEB A;  4AG5 A;  1NSF A;  2XSZ D;  3A98 B;  3H4M A;  4LJ4 A;  3GPU A;  4FVM A;  4AKH A;  2Z7J A;  4NXN M;  4RF1 A;  3VDP A;  4DV5 M;  3PNY A;  1SXJ E;  3U6D A;  4LF7 M;  2CV2 A;  1N36 M;  3KOY E;  2L7H A;  4JI2 M;  3GPY A;  4REZ A;  1DGG A;  1KFV A;  4FCW A;  1NHW C;  3FD9 A;  3M7G A;  3UMM A;  1XC8 A;  4JI1 M;  1QQW A;  1GVN A;  1KYI A;  4IIW A;  2D7E A;  4L16 A;  1C1K A;  2FOI C;  5IT9 S;  2W82 A;  2UU9 M;  3J27 B;  2C9C A;  2ZAO A;  2C5R A;  7CAT A;  3GLF B;  3KOW E;  1QAN A;  4G4Q A;  4LCB A;  3FTC A;  4GH9 A;  4LJ8 A;  4GMQ A;  3UJN A;  4P16 A;  1OFH A;  4KLN A;  1Z5C A;  2L6O A;  3AJI B;  2M5Z A;  2R65 A;  1HNW M;  4B3M M;  3LQQ A;  5ITU A;  4LJ7 A;  1L1T A;  3J7A S;  4MM3 B;  4G4R A;  3J81 S;  2YQZ A;  2LWX A;  4MGH A;  2F5Q A;  3TWM A;  3AOE A;  1Q39 A;  2EA0 A;  4B3R M;  1ZQ9 A;  2Y0T A;  3FYD A;  5ITR A;  3C58 A;  3FUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...