1ORYB

Flagellar export chaperone in complex with its cognate binding partner
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
NVDFAKEMTEFTKYQIRMQSGVAMLAQANALPQLVLQLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Similar modes of polypeptide recognition by export chaperones in flagellar biosynthesis and type III secretion
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Chaperone
molecule keywords flagellar protein FliS
total genus 14
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2003-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.410 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1oryB00
1ORYB
chains in the Genus database with same CATH superfamily
1PJQA 4A3VB 4F2LA 3KFUG 2C99A 2KNVA 5BPVA 3HY5A 4LF9M 3K92A 2QBYB 4XGIA 2JA2A 2HWJA 1IXSB 2DAGA 2G8LA 2ZBKB 1D0LA 4DV2M 3PNYA 4M9SA 2QBYA 4FCTA 3AOEC 2A5YB 2DKLA 5KPTA 3AOEA 1AIPC 4L8RC 4MGZE 4PT5A 1N36M 4ZPXA 2DAMA 5FSWA 2D7GA 1ZMWA 1S3SA 3EIEA 4I4LA 3UGJA 4QOZC 4X64M 3U6EA 2L4EA 1DO2A 5EXXA 2CRUA 1PGYA 1QDTA 2KA6B 1VQ1A 2XSZD 3FRHA 4JN6A 4BB9A 1J7KA 3GLGE 1TH2A 2ZAMA 3KS8A 4AKGA 4LRTA 2CV0A 2XH9A 1DGGA 3GLHB 2F4VM 2F5PA 4LCBA 2OPFA 1E9RA 4ITQA 3MJ5A 5ITTA 3FTDA 1SXJE 2XZFA 1TDHA 1IXZA 2CV2A 3FUWA 3B74A 1HT2E 2ZTDA 2M60A 3KP0E 2EO2A 4LJ8A 2DWNA 3QYBA 4MB7A 2LVNC 4LF8M 2BWBA 2Q2EB 1NHGC 2BJVA 2L09A 2QPAA 1IXRC 3VKHA 2K6BA 1N33M 3DFZA 1HNZM 3HKPA 1XHBA 2C9OA 2G3QA 2HKJA 4B3MM 3E46A 1GJTA 2R46A 2UUCM 3HU3A 1HQCA 3HU1A 2DWZB 3AOGA 2DAIA 3J81S 2MJ5B 4FD2A 2EUCA 3C3DA 4IBDA 1KYIA 1QZEA 5EQTA 1SXJA 2ZAOA 2FE8A 1HR0M 4JI2M 4OW0A 3J27B 2EKFA 4FCWA 3SARA 4JI8M 1IFYA 2GNOA 2K0BX 2Z7JA 4IBJA 2Y20A 4NSOB 5EXPA 5JI2E 1JR3A 1SXJB 3MHVC 5IREB 3HHYA 3T1YM 2C5RA 5IZ7D 4GKJM 3T15A 2X4AA 4I5SA 4MGYE 4LF6M 2KW0A 2LVPC 3TL4X 1G8PA 4UN2B 5KO3A 4F1IA 4DR2M 2JNHA 5EJCA 1IY0A 1OIZA 4IJFA 1IXSA 4KO8A 4QNMA 4REZA 1C1KA 1XXHA 1WGLA 4LFBM 1DV0A 1G3IA 3U60B 4AZFA 2O25A 4LJ9A 1Z59A 5JI3E 2F5OA 2VQEM 4GHLA 2Y0TA 1VEKA 2I7PA 1QYRA 3A42A 3D8LA 3I01M 4NXNM 2CP8A 3E9SA 2L6OA 4M0DA 1GL6A 2YQZA 3U60A 4FWDA 3A98B 5FTMA 2M5ZA 3FRIA 4DR4M 1V34A 4MGKE 2CEAA 4LJ5A 5FLXS 1IM2A 3BOSA 1OQYA 3JR4A 4X62M 2CUZA 3J7BA 1DGBA 3EIHA 2VF8A 3FTCA 1NY6A 1QUSA 3IG8A 1SXJC 2XFTA 2Y21A 3MK6A 2UXDM 3GP1A 4FVMA 2X8AA 3C9PA 3TWMA 3W0FA 3GLHA 5C18A 1XMOM 2JWSA 1L2BA 4Z8XA 3J2PB 1YLAA 2DVWB 2YR0A 1MJGM 1Q3BA 1Z5AA 3I4VA 3KSXA 3GQ5A 4JI0M 4B7FA 4JI4M 2QNJA 2C9CA 4GRIA 4IBCA 3I4YA 3HJ8A 4L78A 3GLFB 4DV6M 1PM5A 1L1ZA 4I81A 4D81A 1D0MA 1DO0A 4FW9A 2H5XA 2KEBA 3DZDA 1XB2B 1JB0F 4AKIA 1TGUA 2CHVA 1D0KA 3CTWB 2HL7A 2DHYA 2OOAA 4LGYA 1PRBA 2LWXA 8CATA 2DZOB 5EXSA 1NJFA 1T6OA 1EIJA 4WURA 2L2DA 1KSFX 4LF7M 2KRUA 4IIWA 1NNJA 2R18A 1Q02A 1GVNA 3FE3A 4DR1M 3KOZE 4PD2A 2APLA 3QWLA 4JXJA 4QOSA 3SMPA 3PNVA 3U5ZA 1GL7A 2KHHA 4IBEA 3JR5A 1K3XA 4LRSA 5ITXA 4DBGB 3LQRA 2MGWA 1EE8A 3LCVB 3V76A 1OFIA 2X49A 3K2LA 5FTNA 1IBMM 4JI1M 2R45A 2ZM6M 1QANA 5EP3A 3RE8A 2DZLA 2K9DA 4LJ6A 3SYLA 1P3QQ 2L4FA 2QENA 4GH9A 1IN7A 1XXHB 4G4NA 1EFUB 2JY8A 4IBIA 4AQYM 1D2NA 3KVWA 1Z6TA 2DENA 3ZC7B 4KODA 3IHPA 3GLHE 1WIVA 1YE9A 3M6AA 4B3TM 2XFSA 3B7NA 2EKKA 1VEJA 3U6DA 3LVWA 1J5EM 3GRYA 2KZSA 4JYAM 4OX9M 4TUWA 2QQ8A 4R7GA 2H1RA 2FNAA 5C1BA 1N77A 2P5TA 2XEPA 3CF2A 4JI6M 3RFWA 3FYDA 2MH8A 2LHCA 3HJSA 2DAKA 1TH4A 2J5YA 4K0KM 2BWEA 4R3DA 4ANRA 3HGIA 3SHFA 1QQWA 3LCUA 3KDSE 3CGWA 2UUAM 4IBKA 1F4IA 3SAVA 3GO8A 2R4EA 5FTJA 2QZ4A 1NSFA 2O01F 4G4QA 5KPRA 3L25A 1RU3A 4L6V6 2J7OA 4HEOA 3ZQJA 1V33A 3GRRA 4W5WA 3FTEA 1NJGA 3K8ZA 1E32A 3TE6A 3GLFA 4GKKM 3U6LA 1JQJC 1HJPA 1Q3CA 3I04M 5LMUM 3VFDA 4NL4H 3PVSA 4B7GA 1Z5BA 5GKNA 1XNQM 3FUVA 3HWSA 2VQFM 2R6FA 1OFHA 1PJTA 4QHSA 2KNAA 4AG6A 4QHTA 2DZNB 1JR3D 2KDLA 1DGHB 4NOOB 2UUBM 4GIPA 1N75A 1XWIA 1LV7A 2Z3XA 1L8QA 3GRUA 4MH0E 3F92A 3U5ZB 1OAOC 4IBBA 1DGHA 3B7ZA 5LMNM 2KZUA 1QVRA 3WHLA 1ZQ9A 4S12A 4IBFA 1YUBA 1L1TA 2UXCM 5H37D 3L27A 2LHGA 2RGOA 3LQQA 2G5GX 4L4UA 2OQ4A 1IN8A 2J7NA 3AV0A 4NC6A 1W5SA 2O5RA 3H4MA 3I51A 3W0LB 5BR8M 2YNMD 1SG9A 2LVOC 1YSYA 5E26A 1G71A 3LMMA 5DYGA 3SYKA 5F3WA 4YY3M 1K82A 4P17A 4M9XA 3GLIE 4RNAA 1PJSA 2D7EA 3AFHA 4B3RM 3VK7A 1V92A 5EXTA 3AL0C 2CHQA 3SHGB 5EP4A 4AI6A 1R5LA 4L15A 5EP2A 3DOAA 3L26A 2NQ8C 4B08A 3HHXA 4DR6M 3Q8GA 4DV0M 3IG5A 1R2YA 1I4WA 4B3SM 4NXMM 1AUAA 3HHWA 1IY1A 1OKSA 2FH0A 4MM3B 2DWLA 1VDLA 1E94E 4LJ4A 1PJIA 4DUZM 1VEGA 4NRWA 5IT9S 3VKGA 2RKOA 1GLNA 3GQ4A 4X65M 1XNRM 1T3TA 1QAMA 5DFLA 3ZCBB 3U61B 5EP1A 2FOIC 2LNHC 3J80S 1TH3A 3SAUA 1KFVA 3GRVA 3AJIB 2QP9X 3KSJA 3PXGA 1IBLM 2F5QA 3K9PA 1ORYB 2B3TA 3U61A 1MN3A 2QSFX 2YFQA 4GC9A 4CJ6A 3GLGA 2F5NA 2DI0A 3R8FA 4Y28F 1A5TA 2AHMA 1WR1B 1TR8A 3NWLA 3HU2A 3U6MA 4LFCM 2RGHA 3KOXE 4Z6YA 4FCVA 1N78A 1GJSA 5ITUA 3VLFB 2HAKA 4LJ7A 3L2AA 3TPZA 3JAMS 5FTKA 5L8RF 4DV1M 4CISA 3THGA 4LZJA 1GO5A 1TF0B 1J09A 1N32M 1N34M 1FJGM 3SASA 1UFZA 3K9OA 4DV3M 2JY5A 3UJNA 1XC8A 3U6CA 1NNUC 4RF1A 3SAWA 1L2CA 3KP1E 3LW5F 3VDUA 2WZJA 3MMPA 2CHGA 1IN6A 5DNYA 4NSRA 2CV1A 1TTEA 3E4RA 1NVMA 2LXEA 4LF5M 3D8BA 1JR3E 2VF7A 3HX3A 1OTRA 2L7IA 3J7AS 2V1UA 3B7QA 3M7GA 4EIWA 1HNXM 2DXIA 4Q7JA 4GITA 4HL4A 1WXQA 3T1HM 1OIPA 1UM8A 1WHCA 4GC5A 4NRVA 1XXHE 2MR9A 5ITRA 2HCBA 1QUTA 2QCUA 5IWAM 4G4OA 2Z4RA 4G6ZA 4D80A 3OTOM 2WSFF 2EJSA 3QAUA 2XZUA 3QYEA 1HT1E 3LVVA 4M9ZA 1FNNA 2KXEA 4OU7A 1HNWM 1QAOA 2RRUA 3HJQA 4G4RA 3U6QA 2C96A 2LH0A 1IBKM 2V6ZM 1MX0A 4P16A 4II7A 4RF0A 2WSEF 1H6UA 3W67A 4R71A 1G4AE 2EA0A 5E6JA 3GPUA 3FUTA 4DV5M 4JV5M 3B9PA 1IN5A 3KW6A 4LJAA 2CWBA 4XK8F 3AKZA 3SATA 2HHHM 3FD9A 1Y8GA 2DNAA 1GKIA 3SBJA 2C98A 3CF6E 2D7HA 4YHHM 3FYCA 1WGNA 3C3EA 1E9SA 3GPXA 1R6BX 4FWGA 4B7HA 1ZV1A 2JZ1A 4AG5A 4FWHA 4KT0F 3SC3A 1QDRA 1ZMVA 3GQ3A 4CHTB 2JY6B 3L28A 3BBZA 4BLCA 5KPZA 3GLGB 4JI3M 4KLNA 2ZTCA 3WHKA 3U6PA 3SMSA 2N35A 3GPPA 1C7YA 4LGMA 3TQSA 2KRKA 2LBCA 7CATA 4M0WA 5ITXE 2Y0QA 4DUYM 4MGIE 1CUKA 4KHPM 5ITYA 1PJJA 4DR7M 2K47A 3HZJA 4G3OA 2W82A 2Z8YM 1OAIA 1VG5A 1Q39A 2FFJA 4QNRA 3VK8A 3PFIA 3C58A 4GEWA 4MGHA 3IECA 3KOWE 2BJWA 1WJ7A 3CF0A 4LF4M 2R65A 1G41A 3K1JA 3KOYE 4PCZA 1R2ZA 3UMMA 2VIIA 4IBGA 4LZZA 3FUXA 2WSCF 3FUUA 1IY2A 4JI5M 2CE7A 2KNZA 3UK6A 1R7RA 1NV9A 3FKEA 5KQ8A 1NV8A 4GMQA 1DGFA 2DHRA 3H4JA 4AW4A 3GLFE 2JY7A 2ZANA 2QHOB 3L29A 2XLJA 2R4JA 1Z5CA 2FS1A 1XMQM 1QAQA 1VDDA 3U6SA 4WP2A 4LY6A 4BBAA 2Z4SA 1NY5A 4I8OA 4PDGA 4DR5M 2JUJA 4CGYB 4RKUF 1NHWC 2CFOA 4GHAA 4D82A 1LTMA 3ILKA 2BNKA 3Q8XA 3A46A 4DR3M 2F5SA 3TWKA 5A2QS 4L16A 3GLIB 1IN4A 1ZAEA 4PDIA 2JP7A 4OVZA 2L7HA 2R0IA 2OOBA 2E5LM 2R44A 3DA1A 2OO9A 5ITQA 3RGPA 3UZUA 1QZMA 3GLIA 2ERCA 5KQDA 1TDZA 3T6PA 1K3WA 2UU9M 1MU5A 4HLQA 3B89A 4IJEA 4OVZB 1IQPA 1T43A 3U6OA 1I94M 1X37A 3KXEC 1NO1A 3ZH9B 3GPYA 2JZ0A 2XGNA 2DWMA 1HQYE 2VDBB 4WW0A 1R4GA 2GQFA 4CIZA 5DYIA 4JI7M 2MROB 2XSZA 3E21A 3M0EA 3SFZA 1OJLA 2XF3A 2UXBM 1G59A 3T38A 1BVSA 3W68A 4X66M 3R9XB 1SXJD 1L2DA 3TWLA 2LTUA 4DV7M 4LG2A 2DAEA 3NBIA 3NBXX 3FTFA 3BXWA 4LFAM 1GABA 4XBOA 3KS4A 3HHZA 2R62A 2LVQD 2V1CA 5FTLA 2JXNA 4DV4M 3RGSA 2LVAA 1ZMUA 2I7NA 3VDPA 4AKHA 3A45A 1W5TA
chains in the Genus database with same CATH topology
4A3VB 3KFUG 2C99A 5BPVA 3K92A 2QBYB 4XGIA 2JA2A 1IXSB 2G8LA 2ZBKB 4DV2M 3PNYA 4M9SA 2QBYA 4FCTA 3AOEC 2A5YB 5KPTA 3AOEA 4L8RC 4MGZE 4PT5A 1N36M 4ZPXA 5FSWA 2D7GA 1S3SA 3EIEA 4I4LA 3UGJA 4QOZC 4X64M 3U6EA 1DO2A 5EXXA 2KA6B 2XSZD 4JN6A 4BB9A 1J7KA 1TH2A 2ZAMA 3KS8A 4AKGA 4LRTA 2CV0A 2XH9A 1DGGA 3GLHB 2F5PA 4LCBA 2OPFA 1E9RA 4ITQA 3MJ5A 5ITTA 3FTDA 1SXJE 2XZFA 1TDHA 1IXZA 2CV2A 3FUWA 1HT2E 3KP0E 2M60A 4LJ8A 2EO2A 2DWNA 4MB7A 4LF8M 2Q2EB 1NHGC 2BJVA 2L09A 2QPAA 1IXRC 3VKHA 1N33M 3DFZA 1HNZM 3HKPA 1XHBA 2C9OA 2HKJA 4B3MM 2R46A 2UUCM 3HU3A 1HQCA 3HU1A 2DWZB 3AOGA 3J81S 4FD2A 2EUCA 4IBDA 1KYIA 5EQTA 4JI2M 1SXJA 2ZAOA 2FE8A 1HR0M 4JI8M 4OW0A 3J27B 4FCWA 3SARA 2Z7JA 4IBJA 2Y20A 4NSOB 5EXPA 5JI2E 1JR3A 1SXJB 3MHVC 5IREB 3HHYA 3T1YM 2C5RA 5IZ7D 4GKJM 3T15A 2X4AA 4I5SA 4MGYE 4LF6M 2KW0A 3TL4X 1G8PA 4DR2M 5KO3A 5EJCA 1IY0A 4QNMA 4IJFA 4KO8A 4REZA 1C1KA 1XXHA 4LFBM 1G3IA 3U60B 4AZFA 2F5OA 4LJ9A 1Z59A 5JI3E 4GHLA 2VQEM 2Y0TA 2I7PA 1QYRA 3A42A 3D8LA 4NXNM 3E9SA 4M0DA 2L6OA 1GL6A 2YQZA 3U60A 4FWDA 3A98B 5FTMA 2M5ZA 4DR4M 4MGKE 2CEAA 4LJ5A 5FLXS 1IM2A 3BOSA 3JR4A 4X62M 2CUZA 3J7BA 1DGBA 3EIHA 3FTCA 3IG8A 1NY6A 1SXJC 3MK6A 2XFTA 2Y21A 2UXDM 3GP1A 4FVMA 2X8AA 3TWMA 3W0FA 3GLHA 5C18A 1XMOM 1L2BA 4Z8XA 3J2PB 2DVWB 2YR0A 1Q3BA 1Z5AA 3I4VA 3KSXA 3GQ5A 4JI0M 4B7FA 4JI4M 2C9CA 4GRIA 4IBCA 3I4YA 3HJ8A 4L78A 3GLFB 4DV6M 1PM5A 1L1ZA 4I81A 4D81A 1DO0A 4FW9A 2KEBA 3DZDA 4AKIA 1TGUA 2CHVA 3CTWB 2HL7A 4LGYA 8CATA 2LWXA 2DZOB 5EXSA 1NJFA 4WURA 1KSFX 4LF7M 2KRUA 4IIWA 1NNJA 2R18A 1GVNA 4DR1M 3KOZE 4PD2A 3QWLA 4JXJA 4QOSA 3SMPA 3PNVA 3U5ZA 1GL7A 3JR5A 4IBEA 1K3XA 4LRSA 5ITXA 3LQRA 1EE8A 1IBMM 1OFIA 2X49A 3K2LA 5FTNA 4JI1M 2R45A 2ZM6M 1QANA 5EP3A 3RE8A 4LJ6A 3SYLA 4GH9A 2QENA 4G4NA 1IN7A 1XXHB 4IBIA 4AQYM 1D2NA 3KVWA 1Z6TA 3ZC7B 4KODA 1YE9A 3M6AA 4B3TM 2XFSA 1J5EM 3U6DA 4LF9M 4JYAM 3LVWA 3GRYA 2KZSA 4OX9M 4TUWA 4R7GA 2H1RA 2FNAA 5C1BA 1N77A 2P5TA 2XEPA 3CF2A 4JI6M 3RFWA 3FYDA 3HJSA 1TH4A 4K0KM 4R3DA 3HGIA 3SHFA 1QQWA 3KDSE 2UUAM 4IBKA 3SAVA 3GO8A 2R4EA 5FTJA 2QZ4A 1NSFA 4G4QA 5KPRA 3L25A 2J7OA 4W5WA 3GRRA 3FTEA 1NJGA 3K8ZA 1E32A 3TE6A 3GLFA 4GKKM 3U6LA 1JQJC 1Q3CA 5LMUM 3VFDA 4NL4H 3PVSA 4B7GA 1Z5BA 5GKNA 1XNQM 3FUVA 3HWSA 2VQFM 4AG6A 1OFHA 4QHSA 4QHTA 2DZNB 1JR3D 1DGHB 4NOOB 2UUBM 4GIPA 1N75A 1XWIA 1LV7A 2Z3XA 1L8QA 3GRUA 4MH0E 3U5ZB 4IBBA 1DGHA 5LMNM 2KZUA 1QVRA 3WHLA 1ZQ9A 4S12A 4IBFA 1YUBA 1L1TA 2UXCM 5H37D 3L27A 3LQQA 2RGOA 2G5GX 4L4UA 2OQ4A 1IN8A 2J7NA 3AV0A 1W5SA 2O5RA 3H4MA 3I51A 3W0LB 5BR8M 2YNMD 1YSYA 5E26A 3LMMA 5DYGA 3SYKA 5F3WA 4YY3M 1K82A 4M9XA 4RNAA 2D7EA 3AFHA 4B3RM 3VK7A 3AL0C 5EXTA 2CHQA 3SHGB 5EP4A 4AI6A 4L15A 5EP2A 3DOAA 3L26A 2NQ8C 4B08A 3HHXA 4DR6M 4DV0M 3IG5A 1R2YA 1I4WA 4B3SM 4NXMM 3HHWA 1IY1A 4MM3B 2DWLA 1E94E 4LJ4A 1PJIA 4DUZM 4NRWA 5IT9S 3VKGA 2RKOA 1GLNA 3GQ4A 4X65M 1XNRM 1T3TA 1QAMA 3ZCBB 3U61B 5EP1A 2FOIC 2LNHC 3J80S 1TH3A 3SAUA 1KFVA 3GRVA 3AJIB 2QP9X 3KSJA 3PXGA 1IBLM 2F5QA 1ORYB 3U61A 4GC9A 2F5NA 2YFQA 3GLGA 3R8FA 2AHMA 3NWLA 3HU2A 3U6MA 4LFCM 2RGHA 3KOXE 4Z6YA 4FCVA 1N78A 5ITUA 3VLFB 4LJ7A 3L2AA 3TPZA 3JAMS 5FTKA 4DV1M 4CISA 3THGA 4LZJA 1N32M 1J09A 1N34M 1FJGM 3SASA 4DV3M 3UJNA 1XC8A 3U6CA 1NNUC 4RF1A 3SAWA 1L2CA 3KP1E 3VDUA 2CHGA 1IN6A 5DNYA 4NSRA 2CV1A 3E4RA 1NVMA 2LXEA 4LF5M 3D8BA 2L7IA 3J7AS 2V1UA 3M7GA 4EIWA 1HNXM 2DXIA 4GITA 4HL4A 1WXQA 3T1HM 1UM8A 4GC5A 4NRVA 5ITRA 2HCBA 2QCUA 5IWAM 4G4OA 2Z4RA 4G6ZA 4D80A 3OTOM 3QAUA 2XZUA 1HT1E 3LVVA 4M9ZA 1FNNA 2KXEA 4OU7A 1HNWM 1QAOA 3HJQA 4G4RA 3U6QA 2C96A 2LH0A 2V6ZM 1MX0A 4P16A 4II7A 4RF0A 1H6UA 1G4AE 2EA0A 5E6JA 3GPUA 3FUTA 4DV5M 4JV5M 3B9PA 1IN5A 3KW6A 4LJAA 3AKZA 3SATA 2HHHM 3FD9A 1GKIA 3SBJA 2C98A 3CF6E 2D7HA 4YHHM 3FYCA 1E9SA 3GPXA 1R6BX 4FWGA 4B7HA 4AG5A 4FWHA 3SC3A 3GQ3A 1IBKM 4CHTB 4BLCA 3L28A 5KPZA 3GLGB 4JI3M 4KLNA 3WHKA 3U6PA 3SMSA 3GPPA 4LGMA 3TQSA 2KRKA 7CATA 4M0WA 5ITXE 2Y0QA 4DUYM 4MGIE 4KHPM 5ITYA 1PJJA 4DR7M 2K47A 2W82A 1Q39A 2FFJA 4QNRA 3VK8A 3PFIA 3C58A 4MGHA 3KOWE 2BJWA 3CF0A 4LF4M 2R65A 1G41A 3K1JA 3KOYE 4PCZA 1R2ZA 3UMMA 2VIIA 4IBGA 4LZZA 3FUXA 3FUUA 1IY2A 4JI5M 2CE7A 3UK6A 1R7RA 3FKEA 5KQ8A 4GMQA 1DGFA 2DHRA 4AW4A 2ZANA 3L29A 2XLJA 2R4JA 1Z5CA 1XMQM 1QAQA 1VDDA 3U6SA 4LY6A 4BBAA 2Z4SA 1NY5A 4I8OA 4PDGA 4DR5M 4CGYB 1NHWC 2CFOA 4GHAA 4D82A 3ILKA 2BNKA 3Q8XA 3A46A 4DR3M 2F5SA 3TWKA 5A2QS 4L16A 3GLIB 1IN4A 1ZAEA 4PDIA 4OVZA 2L7HA 2E5LM 3DA1A 5ITQA 3RGPA 3UZUA 1QZMA 3GLIA 2ERCA 5KQDA 1TDZA 1K3WA 2UU9M 2F4VM 1MU5A 4HLQA 4OVZB 4IJEA 3U6OA 1IQPA 1I94M 1X37A 3KXEC 3ZH9B 3GPYA 2XGNA 2DWMA 1HQYE 4WW0A 4JI7M 5DYIA 2XSZA 3M0EA 3SFZA 1OJLA 2XF3A 2UXBM 1G59A 3T38A 4X66M 3R9XB 1SXJD 1L2DA 3TWLA 4LG2A 4DV7M 3NBIA 3FTFA 4LFAM 4XBOA 3KS4A 3HHZA 2R62A 2V1CA 5FTLA 4DV4M 3RGSA 2I7NA 3VDPA 4AKHA 3A45A 1W5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORY B; 
#chains in the Genus database with same CATH topology
 1PJQ A;  4A3V B;  4F2L A;  3KFU G;  2C99 A;  2KNV A;  5BPV A;  3HY5 A;  4LF9 M;  3K92 A;  2QBY B;  4XGI A;  2JA2 A;  2HWJ A;  1IXS B;  2DAG A;  2G8L A;  2ZBK B;  1D0L A;  4DV2 M;  3PNY A;  4M9S A;  2QBY A;  4FCT A;  3AOE C;  2A5Y B;  2DKL A;  5KPT A;  3AOE A;  1AIP C;  4L8R C;  4MGZ E;  4PT5 A;  1N36 M;  4ZPX A;  2DAM A;  5FSW A;  2D7G A;  1ZMW A;  1S3S A;  3EIE A;  4I4L A;  3UGJ A;  4QOZ C;  4X64 M;  3U6E A;  2L4E A;  1DO2 A;  5EXX A;  2CRU A;  1PGY A;  1QDT A;  2KA6 B;  1VQ1 A;  2XSZ D;  3FRH A;  4JN6 A;  4BB9 A;  1J7K A;  3GLG E;  1TH2 A;  2ZAM A;  3KS8 A;  4AKG A;  4LRT A;  2CV0 A;  2XH9 A;  1DGG A;  3GLH B;  2F4V M;  2F5P A;  4LCB A;  2OPF A;  1E9R A;  4ITQ A;  3MJ5 A;  5ITT A;  3FTD A;  1SXJ E;  2XZF A;  1TDH A;  1IXZ A;  2CV2 A;  3FUW A;  3B74 A;  1HT2 E;  2ZTD A;  2M60 A;  3KP0 E;  2EO2 A;  4LJ8 A;  2DWN A;  3QYB A;  4MB7 A;  2LVN C;  4LF8 M;  2BWB A;  2Q2E B;  1NHG C;  2BJV A;  2L09 A;  2QPA A;  1IXR C;  3VKH A;  2K6B A;  1N33 M;  3DFZ A;  1HNZ M;  3HKP A;  1XHB A;  2C9O A;  2G3Q A;  2HKJ A;  4B3M M;  3E46 A;  1GJT A;  2R46 A;  2UUC M;  3HU3 A;  1HQC A;  3HU1 A;  2DWZ B;  3AOG A;  2DAI A;  3J81 S;  2MJ5 B;  4FD2 A;  2EUC A;  3C3D A;  4IBD A;  1KYI A;  1QZE A;  5EQT A;  1SXJ A;  2ZAO A;  2FE8 A;  1HR0 M;  4JI2 M;  4OW0 A;  3J27 B;  2EKF A;  4FCW A;  3SAR A;  4JI8 M;  1IFY A;  2GNO A;  2K0B X;  2Z7J A;  4IBJ A;  2Y20 A;  4NSO B;  5EXP A;  5JI2 E;  1JR3 A;  1SXJ B;  3MHV C;  5IRE B;  3HHY A;  3T1Y M;  2C5R A;  5IZ7 D;  4GKJ M;  3T15 A;  2X4A A;  4I5S A;  4MGY E;  4LF6 M;  2KW0 A;  2LVP C;  3TL4 X;  1G8P A;  4UN2 B;  5KO3 A;  4F1I A;  4DR2 M;  2JNH A;  5EJC A;  1IY0 A;  1OIZ A;  4IJF A;  1IXS A;  4KO8 A;  4QNM A;  4REZ A;  1C1K A;  1XXH A;  1WGL A;  4LFB M;  1DV0 A;  1G3I A;  3U60 B;  4AZF A;  2O25 A;  4LJ9 A;  1Z59 A;  5JI3 E;  2F5O A;  2VQE M;  4GHL A;  2Y0T A;  1VEK A;  2I7P A;  1QYR A;  3A42 A;  3D8L A;  3I01 M;  4NXN M;  2CP8 A;  3E9S A;  2L6O A;  4M0D A;  1GL6 A;  2YQZ A;  3U60 A;  4FWD A;  3A98 B;  5FTM A;  2M5Z A;  3FRI A;  4DR4 M;  1V34 A;  4MGK E;  2CEA A;  4LJ5 A;  5FLX S;  1IM2 A;  3BOS A;  1OQY A;  3JR4 A;  4X62 M;  2CUZ A;  3J7B A;  1DGB A;  3EIH A;  2VF8 A;  3FTC A;  1NY6 A;  1QUS A;  3IG8 A;  1SXJ C;  2XFT A;  2Y21 A;  3MK6 A;  2UXD M;  3GP1 A;  4FVM A;  2X8A A;  3C9P A;  3TWM A;  3W0F A;  3GLH A;  5C18 A;  1XMO M;  2JWS A;  1L2B A;  4Z8X A;  3J2P B;  1YLA A;  2DVW B;  2YR0 A;  1MJG M;  1Q3B A;  1Z5A A;  3I4V A;  3KSX A;  3GQ5 A;  4JI0 M;  4B7F A;  4JI4 M;  2QNJ A;  2C9C A;  4GRI A;  4IBC A;  3I4Y A;  3HJ8 A;  4L78 A;  3GLF B;  4DV6 M;  1PM5 A;  1L1Z A;  4I81 A;  4D81 A;  1D0M A;  1DO0 A;  4FW9 A;  2H5X A;  2KEB A;  3DZD A;  1XB2 B;  1JB0 F;  4AKI A;  1TGU A;  2CHV A;  1D0K A;  3CTW B;  2HL7 A;  2DHY A;  2OOA A;  4LGY A;  1PRB A;  2LWX A;  8CAT A;  2DZO B;  5EXS A;  1NJF A;  1T6O A;  1EIJ A;  4WUR A;  2L2D A;  1KSF X;  4LF7 M;  2KRU A;  4IIW A;  1NNJ A;  2R18 A;  1Q02 A;  1GVN A;  3FE3 A;  4DR1 M;  3KOZ E;  4PD2 A;  2APL A;  3QWL A;  4JXJ A;  4QOS A;  3SMP A;  3PNV A;  3U5Z A;  1GL7 A;  2KHH A;  4IBE A;  3JR5 A;  1K3X A;  4LRS A;  5ITX A;  4DBG B;  3LQR A;  2MGW A;  1EE8 A;  3LCV B;  3V76 A;  1OFI A;  2X49 A;  3K2L A;  5FTN A;  1IBM M;  4JI1 M;  2R45 A;  2ZM6 M;  1QAN A;  5EP3 A;  3RE8 A;  2DZL A;  2K9D A;  4LJ6 A;  3SYL A;  1P3Q Q;  2L4F A;  2QEN A;  4GH9 A;  1IN7 A;  1XXH B;  4G4N A;  1EFU B;  2JY8 A;  4IBI A;  4AQY M;  1D2N A;  3KVW A;  1Z6T A;  2DEN A;  3ZC7 B;  4KOD A;  3IHP A;  3GLH E;  1WIV A;  1YE9 A;  3M6A A;  4B3T M;  2XFS A;  3B7N A;  2EKK A;  1VEJ A;  3U6D A;  3LVW A;  1J5E M;  3GRY A;  2KZS A;  4JYA M;  4OX9 M;  4TUW A;  2QQ8 A;  4R7G A;  2H1R A;  2FNA A;  5C1B A;  1N77 A;  2P5T A;  2XEP A;  3CF2 A;  4JI6 M;  3RFW A;  3FYD A;  2MH8 A;  2LHC A;  3HJS A;  2DAK A;  1TH4 A;  2J5Y A;  4K0K M;  2BWE A;  4R3D A;  4ANR A;  3HGI A;  3SHF A;  1QQW A;  3LCU A;  3KDS E;  3CGW A;  2UUA M;  4IBK A;  1F4I A;  3SAV A;  3GO8 A;  2R4E A;  5FTJ A;  2QZ4 A;  1NSF A;  2O01 F;  4G4Q A;  5KPR A;  3L25 A;  1RU3 A;  4L6V 6;  2J7O A;  4HEO A;  3ZQJ A;  1V33 A;  3GRR A;  4W5W A;  3FTE A;  1NJG A;  3K8Z A;  1E32 A;  3TE6 A;  3GLF A;  4GKK M;  3U6L A;  1JQJ C;  1HJP A;  1Q3C A;  3I04 M;  5LMU M;  3VFD A;  4NL4 H;  3PVS A;  4B7G A;  1Z5B A;  5GKN A;  1XNQ M;  3FUV A;  3HWS A;  2VQF M;  2R6F A;  1OFH A;  1PJT A;  4QHS A;  2KNA A;  4AG6 A;  4QHT A;  2DZN B;  1JR3 D;  2KDL A;  1DGH B;  4NOO B;  2UUB M;  4GIP A;  1N75 A;  1XWI A;  1LV7 A;  2Z3X A;  1L8Q A;  3GRU A;  4MH0 E;  3F92 A;  3U5Z B;  1OAO C;  4IBB A;  1DGH A;  3B7Z A;  5LMN M;  2KZU A;  1QVR A;  3WHL A;  1ZQ9 A;  4S12 A;  4IBF A;  1YUB A;  1L1T A;  2UXC M;  5H37 D;  3L27 A;  2LHG A;  2RGO A;  3LQQ A;  2G5G X;  4L4U A;  2OQ4 A;  1IN8 A;  2J7N A;  3AV0 A;  4NC6 A;  1W5S A;  2O5R A;  3H4M A;  3I51 A;  3W0L B;  5BR8 M;  2YNM D;  1SG9 A;  2LVO C;  1YSY A;  5E26 A;  1G71 A;  3LMM A;  5DYG A;  3SYK A;  5F3W A;  4YY3 M;  1K82 A;  4P17 A;  4M9X A;  3GLI E;  4RNA A;  1PJS A;  2D7E A;  3AFH A;  4B3R M;  3VK7 A;  1V92 A;  5EXT A;  3AL0 C;  2CHQ A;  3SHG B;  5EP4 A;  4AI6 A;  1R5L A;  4L15 A;  5EP2 A;  3DOA A;  3L26 A;  2NQ8 C;  4B08 A;  3HHX A;  4DR6 M;  3Q8G A;  4DV0 M;  3IG5 A;  1R2Y A;  1I4W A;  4B3S M;  4NXM M;  1AUA A;  3HHW A;  1IY1 A;  1OKS A;  2FH0 A;  4MM3 B;  2DWL A;  1VDL A;  1E94 E;  4LJ4 A;  1PJI A;  4DUZ M;  1VEG A;  4NRW A;  5IT9 S;  3VKG A;  2RKO A;  1GLN A;  3GQ4 A;  4X65 M;  1XNR M;  1T3T A;  1QAM A;  5DFL A;  3ZCB B;  3U61 B;  5EP1 A;  2FOI C;  2LNH C;  3J80 S;  1TH3 A;  3SAU A;  1KFV A;  3GRV A;  3AJI B;  2QP9 X;  3KSJ A;  3PXG A;  1IBL M;  2F5Q A;  3K9P A;  1ORY B;  2B3T A;  3U61 A;  1MN3 A;  2QSF X;  2YFQ A;  4GC9 A;  4CJ6 A;  3GLG A;  2F5N A;  2DI0 A;  3R8F A;  4Y28 F;  1A5T A;  2AHM A;  1WR1 B;  1TR8 A;  3NWL A;  3HU2 A;  3U6M A;  4LFC M;  2RGH A;  3KOX E;  4Z6Y A;  4FCV A;  1N78 A;  1GJS A;  5ITU A;  3VLF B;  2HAK A;  4LJ7 A;  3L2A A;  3TPZ A;  3JAM S;  5FTK A;  5L8R F;  4DV1 M;  4CIS A;  3THG A;  4LZJ A;  1GO5 A;  1TF0 B;  1J09 A;  1N32 M;  1N34 M;  1FJG M;  3SAS A;  1UFZ A;  3K9O A;  4DV3 M;  2JY5 A;  3UJN A;  1XC8 A;  3U6C A;  1NNU C;  4RF1 A;  3SAW A;  1L2C A;  3KP1 E;  3LW5 F;  3VDU A;  2WZJ A;  3MMP A;  2CHG A;  1IN6 A;  5DNY A;  4NSR A;  2CV1 A;  1TTE A;  3E4R A;  1NVM A;  2LXE A;  4LF5 M;  3D8B A;  1JR3 E;  2VF7 A;  3HX3 A;  1OTR A;  2L7I A;  3J7A S;  2V1U A;  3B7Q A;  3M7G A;  4EIW A;  1HNX M;  2DXI A;  4Q7J A;  4GIT A;  4HL4 A;  1WXQ A;  3T1H M;  1OIP A;  1UM8 A;  1WHC A;  4GC5 A;  4NRV A;  1XXH E;  2MR9 A;  5ITR A;  2HCB A;  1QUT A;  2QCU A;  5IWA M;  4G4O A;  2Z4R A;  4G6Z A;  4D80 A;  3OTO M;  2WSF F;  2EJS A;  3QAU A;  2XZU A;  3QYE A;  1HT1 E;  3LVV A;  4M9Z A;  1FNN A;  2KXE A;  4OU7 A;  1HNW M;  1QAO A;  2RRU A;  3HJQ A;  4G4R A;  3U6Q A;  2C96 A;  2LH0 A;  1IBK M;  2V6Z M;  1MX0 A;  4P16 A;  4II7 A;  4RF0 A;  2WSE F;  1H6U A;  3W67 A;  4R71 A;  1G4A E;  2EA0 A;  5E6J A;  3GPU A;  3FUT A;  4DV5 M;  4JV5 M;  3B9P A;  1IN5 A;  3KW6 A;  4LJA A;  2CWB A;  4XK8 F;  3AKZ A;  3SAT A;  2HHH M;  3FD9 A;  1Y8G A;  2DNA A;  1GKI A;  3SBJ A;  2C98 A;  3CF6 E;  2D7H A;  4YHH M;  3FYC A;  1WGN A;  3C3E A;  1E9S A;  3GPX A;  1R6B X;  4FWG A;  4B7H A;  1ZV1 A;  2JZ1 A;  4AG5 A;  4FWH A;  4KT0 F;  3SC3 A;  1QDR A;  1ZMV A;  3GQ3 A;  4CHT B;  2JY6 B;  3L28 A;  3BBZ A;  4BLC A;  5KPZ A;  3GLG B;  4JI3 M;  4KLN A;  2ZTC A;  3WHK A;  3U6P A;  3SMS A;  2N35 A;  3GPP A;  1C7Y A;  4LGM A;  3TQS A;  2KRK A;  2LBC A;  7CAT A;  4M0W A;  5ITX E;  2Y0Q A;  4DUY M;  4MGI E;  1CUK A;  4KHP M;  5ITY A;  1PJJ A;  4DR7 M;  2K47 A;  3HZJ A;  4G3O A;  2W82 A;  2Z8Y M;  1OAI A;  1VG5 A;  1Q39 A;  2FFJ A;  4QNR A;  3VK8 A;  3PFI A;  3C58 A;  4GEW A;  4MGH A;  3IEC A;  3KOW E;  2BJW A;  1WJ7 A;  3CF0 A;  4LF4 M;  2R65 A;  1G41 A;  3K1J A;  3KOY E;  4PCZ A;  1R2Z A;  3UMM A;  2VII A;  4IBG A;  4LZZ A;  3FUX A;  2WSC F;  3FUU A;  1IY2 A;  4JI5 M;  2CE7 A;  2KNZ A;  3UK6 A;  1R7R A;  1NV9 A;  3FKE A;  5KQ8 A;  1NV8 A;  4GMQ A;  1DGF A;  2DHR A;  3H4J A;  4AW4 A;  3GLF E;  2JY7 A;  2ZAN A;  2QHO B;  3L29 A;  2XLJ A;  2R4J A;  1Z5C A;  2FS1 A;  1XMQ M;  1QAQ A;  1VDD A;  3U6S A;  4WP2 A;  4LY6 A;  4BBA A;  2Z4S A;  1NY5 A;  4I8O A;  4PDG A;  4DR5 M;  2JUJ A;  4CGY B;  4RKU F;  1NHW C;  2CFO A;  4GHA A;  4D82 A;  1LTM A;  3ILK A;  2BNK A;  3Q8X A;  3A46 A;  4DR3 M;  2F5S A;  3TWK A;  5A2Q S;  4L16 A;  3GLI B;  1IN4 A;  1ZAE A;  4PDI A;  2JP7 A;  4OVZ A;  2L7H A;  2R0I A;  2OOB A;  2E5L M;  2R44 A;  3DA1 A;  2OO9 A;  5ITQ A;  3RGP A;  3UZU A;  1QZM A;  3GLI A;  2ERC A;  5KQD A;  1TDZ A;  3T6P A;  1K3W A;  2UU9 M;  1MU5 A;  4HLQ A;  3B89 A;  4IJE A;  4OVZ B;  1IQP A;  1T43 A;  3U6O A;  1I94 M;  1X37 A;  3KXE C;  1NO1 A;  3ZH9 B;  3GPY A;  2JZ0 A;  2XGN A;  2DWM A;  1HQY E;  2VDB B;  4WW0 A;  1R4G A;  2GQF A;  4CIZ A;  5DYI A;  4JI7 M;  2MRO B;  2XSZ A;  3E21 A;  3M0E A;  3SFZ A;  1OJL A;  2XF3 A;  2UXB M;  1G59 A;  3T38 A;  1BVS A;  3W68 A;  4X66 M;  3R9X B;  1SXJ D;  1L2D A;  3TWL A;  2LTU A;  4DV7 M;  4LG2 A;  2DAE A;  3NBI A;  3NBX X;  3FTF A;  3BXW A;  4LFA M;  1GAB A;  4XBO A;  3KS4 A;  3HHZ A;  2R62 A;  2LVQ D;  2V1C A;  5FTL A;  2JXN A;  4DV4 M;  3RGS A;  2LVA A;  1ZMU A;  2I7N A;  3VDP A;  4AKH A;  3A45 A;  1W5T A; 
#chains in the Genus database with same CATH homology
 4A3V B;  3KFU G;  2C99 A;  5BPV A;  3K92 A;  2QBY B;  4XGI A;  2JA2 A;  1IXS B;  2G8L A;  2ZBK B;  4DV2 M;  3PNY A;  4M9S A;  2QBY A;  4FCT A;  3AOE C;  2A5Y B;  5KPT A;  3AOE A;  4L8R C;  4MGZ E;  4PT5 A;  1N36 M;  4ZPX A;  5FSW A;  2D7G A;  1S3S A;  3EIE A;  4I4L A;  3UGJ A;  4QOZ C;  4X64 M;  3U6E A;  1DO2 A;  5EXX A;  2KA6 B;  2XSZ D;  4JN6 A;  4BB9 A;  1J7K A;  1TH2 A;  2ZAM A;  3KS8 A;  4AKG A;  4LRT A;  2CV0 A;  2XH9 A;  1DGG A;  3GLH B;  2F5P A;  4LCB A;  2OPF A;  1E9R A;  4ITQ A;  3MJ5 A;  5ITT A;  3FTD A;  1SXJ E;  2XZF A;  1TDH A;  1IXZ A;  2CV2 A;  3FUW A;  1HT2 E;  3KP0 E;  2M60 A;  4LJ8 A;  2EO2 A;  2DWN A;  4MB7 A;  4LF8 M;  2Q2E B;  1NHG C;  2BJV A;  2L09 A;  2QPA A;  1IXR C;  3VKH A;  1N33 M;  3DFZ A;  1HNZ M;  3HKP A;  1XHB A;  2C9O A;  2HKJ A;  4B3M M;  2R46 A;  2UUC M;  3HU3 A;  1HQC A;  3HU1 A;  2DWZ B;  3AOG A;  3J81 S;  4FD2 A;  2EUC A;  4IBD A;  1KYI A;  5EQT A;  4JI2 M;  1SXJ A;  2ZAO A;  2FE8 A;  1HR0 M;  4JI8 M;  4OW0 A;  3J27 B;  4FCW A;  3SAR A;  2Z7J A;  4IBJ A;  2Y20 A;  4NSO B;  5EXP A;  5JI2 E;  1JR3 A;  1SXJ B;  3MHV C;  5IRE B;  3HHY A;  3T1Y M;  2C5R A;  5IZ7 D;  4GKJ M;  3T15 A;  2X4A A;  4I5S A;  4MGY E;  4LF6 M;  2KW0 A;  3TL4 X;  1G8P A;  4DR2 M;  5KO3 A;  5EJC A;  1IY0 A;  4QNM A;  4IJF A;  4KO8 A;  4REZ A;  1C1K A;  1XXH A;  4LFB M;  1G3I A;  3U60 B;  4AZF A;  2F5O A;  4LJ9 A;  1Z59 A;  5JI3 E;  4GHL A;  2VQE M;  2Y0T A;  2I7P A;  1QYR A;  3A42 A;  3D8L A;  4NXN M;  3E9S A;  4M0D A;  2L6O A;  1GL6 A;  2YQZ A;  3U60 A;  4FWD A;  3A98 B;  5FTM A;  2M5Z A;  4DR4 M;  4MGK E;  2CEA A;  4LJ5 A;  5FLX S;  1IM2 A;  3BOS A;  3JR4 A;  4X62 M;  2CUZ A;  3J7B A;  1DGB A;  3EIH A;  3FTC A;  3IG8 A;  1NY6 A;  1SXJ C;  3MK6 A;  2XFT A;  2Y21 A;  2UXD M;  3GP1 A;  4FVM A;  2X8A A;  3TWM A;  3W0F A;  3GLH A;  5C18 A;  1XMO M;  1L2B A;  4Z8X A;  3J2P B;  2DVW B;  2YR0 A;  1Q3B A;  1Z5A A;  3I4V A;  3KSX A;  3GQ5 A;  4JI0 M;  4B7F A;  4JI4 M;  2C9C A;  4GRI A;  4IBC A;  3I4Y A;  3HJ8 A;  4L78 A;  3GLF B;  4DV6 M;  1PM5 A;  1L1Z A;  4I81 A;  4D81 A;  1DO0 A;  4FW9 A;  2KEB A;  3DZD A;  4AKI A;  1TGU A;  2CHV A;  3CTW B;  2HL7 A;  4LGY A;  8CAT A;  2LWX A;  2DZO B;  5EXS A;  1NJF A;  4WUR A;  1KSF X;  4LF7 M;  2KRU A;  4IIW A;  1NNJ A;  2R18 A;  1GVN A;  4DR1 M;  3KOZ E;  4PD2 A;  3QWL A;  4JXJ A;  4QOS A;  3SMP A;  3PNV A;  3U5Z A;  1GL7 A;  3JR5 A;  4IBE A;  1K3X A;  4LRS A;  5ITX A;  3LQR A;  1EE8 A;  1IBM M;  1OFI A;  2X49 A;  3K2L A;  5FTN A;  4JI1 M;  2R45 A;  2ZM6 M;  1QAN A;  5EP3 A;  3RE8 A;  4LJ6 A;  3SYL A;  4GH9 A;  2QEN A;  4G4N A;  1IN7 A;  1XXH B;  4IBI A;  4AQY M;  1D2N A;  3KVW A;  1Z6T A;  3ZC7 B;  4KOD A;  1YE9 A;  3M6A A;  4B3T M;  2XFS A;  1J5E M;  3U6D A;  4LF9 M;  4JYA M;  3LVW A;  3GRY A;  2KZS A;  4OX9 M;  4TUW A;  4R7G A;  2H1R A;  2FNA A;  5C1B A;  1N77 A;  2P5T A;  2XEP A;  3CF2 A;  4JI6 M;  3RFW A;  3FYD A;  3HJS A;  1TH4 A;  4K0K M;  4R3D A;  3HGI A;  3SHF A;  1QQW A;  3KDS E;  2UUA M;  4IBK A;  3SAV A;  3GO8 A;  2R4E A;  5FTJ A;  2QZ4 A;  1NSF A;  4G4Q A;  5KPR A;  3L25 A;  2J7O A;  4W5W A;  3GRR A;  3FTE A;  1NJG A;  3K8Z A;  1E32 A;  3TE6 A;  3GLF A;  4GKK M;  3U6L A;  1JQJ C;  1Q3C A;  5LMU M;  3VFD A;  4NL4 H;  3PVS A;  4B7G A;  1Z5B A;  5GKN A;  1XNQ M;  3FUV A;  3HWS A;  2VQF M;  4AG6 A;  1OFH A;  4QHS A;  4QHT A;  2DZN B;  1JR3 D;  1DGH B;  4NOO B;  2UUB M;  4GIP A;  1N75 A;  1XWI A;  1LV7 A;  2Z3X A;  1L8Q A;  3GRU A;  4MH0 E;  3U5Z B;  4IBB A;  1DGH A;  5LMN M;  2KZU A;  1QVR A;  3WHL A;  1ZQ9 A;  4S12 A;  4IBF A;  1YUB A;  1L1T A;  2UXC M;  5H37 D;  3L27 A;  3LQQ A;  2RGO A;  2G5G X;  4L4U A;  2OQ4 A;  1IN8 A;  2J7N A;  3AV0 A;  1W5S A;  2O5R A;  3H4M A;  3I51 A;  3W0L B;  5BR8 M;  2YNM D;  1YSY A;  5E26 A;  3LMM A;  5DYG A;  3SYK A;  5F3W A;  4YY3 M;  1K82 A;  4M9X A;  4RNA A;  2D7E A;  3AFH A;  4B3R M;  3VK7 A;  3AL0 C;  5EXT A;  2CHQ A;  3SHG B;  5EP4 A;  4AI6 A;  4L15 A;  5EP2 A;  3DOA A;  3L26 A;  2NQ8 C;  4B08 A;  3HHX A;  4DR6 M;  4DV0 M;  3IG5 A;  1R2Y A;  1I4W A;  4B3S M;  4NXM M;  3HHW A;  1IY1 A;  4MM3 B;  2DWL A;  1E94 E;  4LJ4 A;  1PJI A;  4DUZ M;  4NRW A;  5IT9 S;  3VKG A;  2RKO A;  1GLN A;  3GQ4 A;  4X65 M;  1XNR M;  1T3T A;  1QAM A;  3ZCB B;  3U61 B;  5EP1 A;  2FOI C;  2LNH C;  3J80 S;  1TH3 A;  3SAU A;  1KFV A;  3GRV A;  3AJI B;  2QP9 X;  3KSJ A;  3PXG A;  1IBL M;  2F5Q A;  1ORY B;  3U61 A;  4GC9 A;  2F5N A;  2YFQ A;  3GLG A;  3R8F A;  2AHM A;  3NWL A;  3HU2 A;  3U6M A;  4LFC M;  2RGH A;  3KOX E;  4Z6Y A;  4FCV A;  1N78 A;  5ITU A;  3VLF B;  4LJ7 A;  3L2A A;  3TPZ A;  3JAM S;  5FTK A;  4DV1 M;  4CIS A;  3THG A;  4LZJ A;  1N32 M;  1J09 A;  1N34 M;  1FJG M;  3SAS A;  4DV3 M;  3UJN A;  1XC8 A;  3U6C A;  1NNU C;  4RF1 A;  3SAW A;  1L2C A;  3KP1 E;  3VDU A;  2CHG A;  1IN6 A;  5DNY A;  4NSR A;  2CV1 A;  3E4R A;  1NVM A;  2LXE A;  4LF5 M;  3D8B A;  2L7I A;  3J7A S;  2V1U A;  3M7G A;  4EIW A;  1HNX M;  2DXI A;  4GIT A;  4HL4 A;  1WXQ A;  3T1H M;  1UM8 A;  4GC5 A;  4NRV A;  5ITR A;  2HCB A;  2QCU A;  5IWA M;  4G4O A;  2Z4R A;  4G6Z A;  4D80 A;  3OTO M;  3QAU A;  2XZU A;  1HT1 E;  3LVV A;  4M9Z A;  1FNN A;  2KXE A;  4OU7 A;  1HNW M;  1QAO A;  3HJQ A;  4G4R A;  3U6Q A;  2C96 A;  2LH0 A;  2V6Z M;  1MX0 A;  4P16 A;  4II7 A;  4RF0 A;  1H6U A;  1G4A E;  2EA0 A;  5E6J A;  3GPU A;  3FUT A;  4DV5 M;  4JV5 M;  3B9P A;  1IN5 A;  3KW6 A;  4LJA A;  3AKZ A;  3SAT A;  2HHH M;  3FD9 A;  1GKI A;  3SBJ A;  2C98 A;  3CF6 E;  2D7H A;  4YHH M;  3FYC A;  1E9S A;  3GPX A;  1R6B X;  4FWG A;  4B7H A;  4AG5 A;  4FWH A;  3SC3 A;  3GQ3 A;  1IBK M;  4CHT B;  4BLC A;  3L28 A;  5KPZ A;  3GLG B;  4JI3 M;  4KLN A;  3WHK A;  3U6P A;  3SMS A;  3GPP A;  4LGM A;  3TQS A;  2KRK A;  7CAT A;  4M0W A;  5ITX E;  2Y0Q A;  4DUY M;  4MGI E;  4KHP M;  5ITY A;  1PJJ A;  4DR7 M;  2K47 A;  2W82 A;  1Q39 A;  2FFJ A;  4QNR A;  3VK8 A;  3PFI A;  3C58 A;  4MGH A;  3KOW E;  2BJW A;  3CF0 A;  4LF4 M;  2R65 A;  1G41 A;  3K1J A;  3KOY E;  4PCZ A;  1R2Z A;  3UMM A;  2VII A;  4IBG A;  4LZZ A;  3FUX A;  3FUU A;  1IY2 A;  4JI5 M;  2CE7 A;  3UK6 A;  1R7R A;  3FKE A;  5KQ8 A;  4GMQ A;  1DGF A;  2DHR A;  4AW4 A;  2ZAN A;  3L29 A;  2XLJ A;  2R4J A;  1Z5C A;  1XMQ M;  1QAQ A;  1VDD A;  3U6S A;  4LY6 A;  4BBA A;  2Z4S A;  1NY5 A;  4I8O A;  4PDG A;  4DR5 M;  4CGY B;  1NHW C;  2CFO A;  4GHA A;  4D82 A;  3ILK A;  2BNK A;  3Q8X A;  3A46 A;  4DR3 M;  2F5S A;  3TWK A;  5A2Q S;  4L16 A;  3GLI B;  1IN4 A;  1ZAE A;  4PDI A;  4OVZ A;  2L7H A;  2E5L M;  3DA1 A;  5ITQ A;  3RGP A;  3UZU A;  1QZM A;  3GLI A;  2ERC A;  5KQD A;  1TDZ A;  1K3W A;  2UU9 M;  2F4V M;  1MU5 A;  4HLQ A;  4OVZ B;  4IJE A;  3U6O A;  1IQP A;  1I94 M;  1X37 A;  3KXE C;  3ZH9 B;  3GPY A;  2XGN A;  2DWM A;  1HQY E;  4WW0 A;  4JI7 M;  5DYI A;  2XSZ A;  3M0E A;  3SFZ A;  1OJL A;  2XF3 A;  2UXB M;  1G59 A;  3T38 A;  4X66 M;  3R9X B;  1SXJ D;  1L2D A;  3TWL A;  4LG2 A;  4DV7 M;  3NBI A;  3FTF A;  4LFA M;  4XBO A;  3KS4 A;  3HHZ A;  2R62 A;  2V1C A;  5FTL A;  4DV4 M;  3RGS A;  2I7N A;  3VDP A;  4AKH A;  3A45 A;  1W5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...