1ORYB

Flagellar export chaperone in complex with its cognate binding partner
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
b'NVDFAKEMTEFTKYQIRMQSGVAMLAQANALPQLVLQLLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flagellar protein FliS
molecule tags Chaperone
source organism Aquifex aeolicus
publication title Similar modes of polypeptide recognition by export chaperones in flagellar biosynthesis and type III secretion
pubmed doi rcsb
total genus 14
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2003-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.410 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1oryB00
1ORYB
chains in the Genus database with same CATH superfamily
3LQQA 3L2AA 4M0DA 4R3DA 4PCZA 3GLGA 4DV5M 3RFWA 2KHHA 3MMPA 5ITXA 2DWLA 3FYDA 2DI0A 1F4IA 1K3XA 3U6QA 4IBIA 1IN5A 3BXWA 4LFAM 5JI2E 4LF5M 3GQ4A 3KOWE 1UFZA 2JXNA 1R2YA 4ITQA 1N33M 4IBBA 4I4LA 1NJFA 1WGNA 2ZTDA 3L28A 2C9CA 5EP1A 1DGBA 1WR1B 3DA1A 2D7EA 1G59A 1HT1E 3B7ZA 1R6BX 2O25A 1JR3A 3SAWA 3A46A 2UU9M 2KW0A 1Z5CA 2QPAA 1HR0M 4Y28F 4JI4M 3HX3A 3VDPA 4LF8M 3GLIE 4B3SM 1QAMA 2Z4RA 4RF0A 2DWZB 2R0IA 4LGMA 3U5ZA 3HU2A 3LQRA 2M60A 3GLGB 4NRWA 3QYBA 4K0KM 2R4EA 4JYAM 1KSFX 1XXHA 3K92A 3VK8A 5ITTA 3ZC7B 3T1YM 1IFYA 1EE8A 1L8QA 5EXXA 2RGOA 1G4AE 1PM5A 3C3EA 4IBEA 4R71A 1D0KA 1G41A 2XFSA 3SYKA 2Z4SA 4JI2M 1ZV1A 4P16A 4L16A 3FYCA 1DO0A 3AL0C 2OO9A 1RU3A 2R45A 1NO1A 4ZPXA 1L1ZA 1A5TA 3KS4A 3GRYA 2L4FA 1ORYB 3QYEA 1D0LA 1SXJE 5FTNA 1R5LA 4D81A 3M0EA 3VLFB 1DGHA 2CWBA 2KRKA 4CHTB 3VFDA 3UMMA 3U60B 2KEBA 2LVQD 2V6ZM 4XBOA 1XXHB 1QVRA 1TH4A 2KA6B 4GC9A 4MH0E 2DENA 4XGIA 4DV2M 4G4QA 3LW5F 3Q8GA 1T6OA 3PXGA 1DGGA 2L4EA 2A5YB 1OKSA 2QCUA 4IBDA 1XNQM 1EIJA 1TH2A 4OVZA 2J7OA 3TWLA 3E46A 5KQDA 2DAGA 4FCTA 5IT9S 4GHAA 2EA0A 1XB2B 4PDIA 3K2LA 1HQYE 2B3TA 4F2LA 1KFVA 2K47A 3HHXA 5FSWA 2JZ0A 3W0FA 4IBFA 4X65M 3A42A 3H4JA 3FUXA 4DV1M 3LMMA 4IJEA 4RKUF 1VEKA 2JA2A 5FLXS 1DGHB 4RNAA 2QBYA 4M0WA 3VKGA 1IXZA 1XHBA 1PRBA 3CGWA 3IG5A 2UUAM 4B08A 1TDZA 2C9OA 2BNKA 3KP0E 4REZA 4OU7A 1Q3CA 2F5PA 2VIIA 4KLNA 4YHHM 4QNMA 2MGWA 5FTLA 4X62M 2OOBA 1Z5AA 1SXJB 4GH9A 1IXSB 3FUTA 2DAIA 3GPUA 2FNAA 2LVOC 3K1JA 3B7QA 4AZFA 2F4VM 4LG2A 4JI7M 3NBIA 5F3WA 1GLNA 3I04M 4DR2M 2Y0QA 2UXDM 4BB9A 2DAMA 2KRUA 2JP7A 2DZNB 1WHCA 3AJIB 2VF7A 4LGYA 4DUYM 3TWMA 3FTFA 4D82A 2QBYB 1I94M 4JI0M 4GHLA 1CUKA 3SBJA 1QZMA 1SG9A 1UM8A 2DHRA 5ITYA 3L29A 3RE8A 5ITUA 1GO5A 3A45A 2F5QA 1SXJA 4LJ5A 4AW4A 2KNZA 2L6OA 2QHOB 5E26A 3K9OA 3I4YA 3HHYA 3GLFA 1ZMVA 3B9PA 4DUZM 4L6V6 2FOIC 3SFZA 1YE9A 4B7HA 1OFIA 1JR3D 3GQ5A 2UXCM 1IN7A 2BWEA 2CHQA 2ERCA 2JY7A 3KXEC 4IBCA 4IJFA 3AFHA 5LMUM 3KSJA 4LFBM 2R44A 2MROB 3TWKA 3THGA 2Q2EB 3J7BA 3MK6A 1EFUB 4CGYB 4PD2A 4JV5M 5DNYA 1Z59A 3FRHA 3ZCBB 2I7NA 3MHVC 3AOEA 2VF8A 3FD9A 2L09A 1IBMM 3SHGB 1NV8A 2LHCA 3EIEA 4JI3M 4PDGA 3W67A 4X66M 1QUSA 2DZOB 4QOZC 5JI3E 4G4RA 1P3QQ 1Z5BA 1N32M 3GLFB 4QOSA 4G6ZA 1V34A 1OFHA 5ITRA 4LCBA 2LWXA 4GC5A 4GITA 4MM3B 5ITXE 3U6DA 5DYGA 1L2CA 3GP1A 4DV7M 4LF4M 4QHSA 2KXEA 1HNWM 3PVSA 3CF6E 4FW9A 3U5ZB 2ZBKB 4EIWA 3HHZA 2EUCA 2YQZA 3B74A 1MN3A 3FUVA 3NWLA 1MU5A 5ITQA 2KZSA 3JR5A 1E94E 2K9DA 2V1CA 2EJSA 2MH8A 3Q8XA 4NL4H 1J7KA 5DFLA 1WGLA 3T1HM 3H4MA 3VK7A 4BLCA 2DVWB 4NSRA 5FTMA 4AKHA 3JAMS 1IXRC 2OQ4A 4YY3M 4GIPA 1IBKM 5DYIA 2OOAA 1G71A 4NXNM 1TF0B 1OJLA 2Y21A 4AI6A 4W5WA 1NHGC 5EP4A 4GMQA 2HCBA 3FTEA 2F5NA 5IWAM 1TGUA 1TH3A 5FTJA 3SMPA 3U6OA 5EQTA 3GLFE 2C99A 2CUZA 2CHVA 2JY8A 4I8OA 3UJNA 3A98B 1IN8A 1D0MA 3CF2A 5IREB 4JI8M 5EXPA 4RF1A 1NVMA 4FWGA 1T43A 3LVVA 3J81S 2ZAOA 3KDSE 1IY0A 4AG6A 4PT5A 2R46A 4DV0M 3HWSA 4R7GA 2LNHC 3AOGA 3WHLA 1TDHA 3GRRA 4IBGA 2RRUA 4TUWA 1GABA 1HT2E 4DR3M 1WIVA 3GLHA 3KP1E 1DV0A 2GNOA 4LJ9A 1H6UA 2JNHA 4OX9M 1IN6A 1GL6A 3PNVA 4FWHA 1HQCA 3ZH9B 2CHGA 1ZQ9A 2JY6B 3E9SA 2YNMD 2X8AA 4MGHA 3HGIA 3U61B 1FNNA 2H1RA 4LZJA 4CJ6A 2DAEA 1J5EM 4B7GA 1XMOM 2WSFF 2QZ4A 4GRIA 3GQ3A 2LXEA 4DV4M 3U6SA 4LJ4A 3TQSA 3VDUA 3HJQA 3J7AS 2DWMA 1WJ7A 2ZM6M 2EKFA 4DV3M 4GKKM 2CFOA 2CRUA 4I81A 4L8RC 2QNJA 3J2PB 3FUUA 2ZAMA 3W68A 4KHPM 2WSEF 5BPVA 2Z3XA 4L78A 4L15A 1D2NA 3KSXA 1JB0F 2W82A 2C96A 2LTUA 1XC8A 2APLA 4Z6YA 3FUWA 2DNAA 3U61A 4LJ6A 7CATA 1IY2A 1SXJD 1HNZM 2X49A 1PJTA 1PJSA 3U6LA 1T3TA 1V33A 3DZDA 3E4RA 1I4WA 2D7HA 4B3RM 4HL4A 1N77A 2HAKA 2CV1A 2N35A 3SMSA 2M5ZA 3SC3A 3IG8A 2XEPA 1GKIA 1N34M 1LV7A 5FTKA 3TE6A 1VQ1A 2XF3A 1QANA 2ZTCA 1NY6A 1JR3E 2DZLA 3GRVA 3MJ5A 4JI6M 4FD2A 1K3WA 2HWJA 2C5RA 2DWNA 1X37A 1R7RA 4NOOB 4DR6M 2CP8A 3BBZA 2DAKA 3GLIA 1W5TA 3SYLA 1NHWC 3M6AA 4B7FA 1OAOC 3SARA 3HHWA 1R2ZA 1NJGA 4AKGA 1IY1A 1QAOA 4ANRA 3SAUA 1Q39A 2BWBA 4WW0A 2YR0A 4IBKA 2GQFA 3T6PA 2XSZA 3K8ZA 5KPRA 1C7YA 1NV9A 2BJWA 1QDRA 1VG5A 2CEAA 1DO2A 2I7PA 3B7NA 3BOSA 2Z8YM 2LVPC 4AG5A 2P5TA 4JI1M 2KDLA 1PGYA 2WZJA 4X64M 1G8PA 4Q7JA 3GLIB 2DHYA 4JXJA 3I4VA 3QWLA 3FRIA 3B89A 1Q3BA 2O5RA 3CTWB 3KOYE 1WXQA 5KPTA 1VEGA 1IM2A 1AUAA 3IHPA 2G5GX 1AIPC 3RGSA 3RGPA 3UK6A 3SASA 2VQEM 2KNAA 8CATA 3HU1A 1OQYA 4GEWA 1MX0A 3HJ8A 4M9ZA 2FFJA 4QNRA 3TL4X 5KQ8A 3GO8A 3UGJA 4G4OA 1GJTA 1V92A 4MGKE 2AHMA 2XFTA 1YLAA 2FH0A 3FE3A 3T38A 5GKNA 5BR8M 2HKJA 2DKLA 2J7NA 3DFZA 2G3QA 2R18A 3CF0A 2CV2A 4AKIA 2BJVA 3L26A 4G3OA 2L7IA 1OIZA 3E21A 1GJSA 1ZMUA 3HY5A 4DR4M 1OTRA 5EP3A 1BVSA 4FCVA 1YUBA 2XLJA 1NNJA 4KT0F 3SATA 1L2DA 4NC6A 4D80A 4AQYM 3IECA 1L1TA 3T15A 1NSFA 3GPYA 3KS8A 1MJGM 3VKHA 3HJSA 1NY5A 2EO2A 2DXIA 1W5SA 3FTDA 3R8FA 4B3TM 4QHTA 3J27B 2H5XA 4KODA 1VDLA 4OW0A 3PNYA 4IBJA 4LFCM 3EIHA 2Y20A 4FWDA 2LVNC 3D8BA 4II7A 4I5SA 5H37D 3U6MA 3L27A 3PFIA 3HZJA 5E6JA 3C58A 2UXBM 3GLHB 2XZUA 4CIZA 1N36M 1S3SA 4MGIE 1XWIA 4MB7A 1XMQM 3ILKA 4LJ8A 4P17A 3TPZA 2CV0A 2JY5A 2R4JA 4DR5M 3I51A 5EXSA 1GL7A 5C18A 1TTEA 5IZ7D 2QQ8A 3C9PA 3J80S 2R65A 1XXHE 3U60A 2F5OA 1VEJA 5KO3A 2F5SA 4M9SA 3KW6A 1E9SA 1YSYA 1QZEA 3U6CA 2FE8A 3M7GA 2NQ8C 1IBLM 2D7GA 4OVZB 2VDBB 2XSZD 1QUTA 2MJ5B 3UZUA 2WSCF 5A2QS 1FJGM 2JZ1A 5EP2A 1PJIA 3R9XB 3LCVB 4B3MM 2KNVA 1PJQA 2K0BX 2L2DA 3GRUA 3NBXX 1QDTA 2J5YA 4IIWA 4M9XA 3FKEA 4NSOB 5KPZA 2KZUA 4G4NA 2XH9A 2LBCA 3SAVA 2E5LM 2JUJA 3U6EA 2C98A 4LJAA 3LVWA 3KOZE 4MGZE 1HNXM 2O01F 3W0LB 3WHKA 1IQPA 1NNUC 1QAQA 2CE7A 5LMNM 3AOEC 4BBAA 1Y8GA 1ZMWA 2R62A 4KO8A 4F1IA 1Z6TA 2QENA 4NRVA 4DV6M 3SHFA 4LJ7A 4XK8F 4MGYE 2JWSA 2LH0A 3KFUG 3C3DA 1E32A 2R6FA 4Z8XA 2V1UA 3JR4A 1C1KA 2MR9A 3FTCA 4LRSA 2UUCM 4DBGB 3V76A 1IXSA 4WP2A 1R4GA 2OPFA 2L7HA 2QP9X 1PJJA 1IN4A 1G3IA 1TR8A 2FS1A 1ZAEA 2QSFX 1E9RA 2YFQA 5EXTA 2VQFM 1K82A 4LF7M 1LTMA 2HL7A 4DR1M 5EJCA 4FCWA 3AV0A 4UN2B 3GLHE 3KVWA 2LVAA 1KYIA 4LF6M 4LF9M 5L8RF 3L25A 4LZZA 4FVMA 3U6PA 2RGHA 3DOAA 3D8LA 3QAUA 1QYRA 3KOXE 1OIPA 3AKZA 4CISA 3HKPA 4WURA 5C1BA 4HLQA 3GLGE 2RKOA 1DGFA 1Q02A 3HU3A 3K9PA 3GPXA 1XNRM 2HHHM 1N75A 4GKJM 3F92A 2X4AA 3OTOM 2EKKA 4A3VB 2LHGA 4S12A 3I01M 4NXMM 2XGNA 2Y0TA 4DR7M 1QQWA 1VDDA 1JQJC 3LCUA 3ZQJA 1GVNA 3GPPA 1N78A 1SXJC 1J09A 4LRTA 1HJPA 2Z7JA 2K6BA 1OAIA 4HEOA 4JN6A 4L4UA 4LY6A 1L2BA 2UUBM 2ZANA 2XZFA 2G8LA 4JI5M
chains in the Genus database with same CATH topology
3LQQA 3L2AA 4M0DA 4R3DA 4PCZA 3GLGA 4DV5M 3RFWA 5ITXA 2DWLA 3FYDA 1K3XA 4IBIA 1IN5A 4LFAM 5JI2E 4LF5M 3GQ4A 3KOWE 4ITQA 1N33M 1R2YA 4IBBA 4I4LA 1NJFA 3L28A 2C9CA 5EP1A 1DGBA 3DA1A 2D7EA 1G59A 1HT1E 1R6BX 1JR3A 3SAWA 3A46A 2UU9M 2KW0A 1Z5CA 2QPAA 1HR0M 4JI4M 3VDPA 4LF8M 4B3SM 1QAMA 2Z4RA 4RF0A 2DWZB 4LGMA 3U5ZA 3HU2A 3LQRA 2M60A 3GLGB 4NRWA 4K0KM 4JYAM 2R4EA 1KSFX 1XXHA 3K92A 3VK8A 5ITTA 3ZC7B 3T1YM 1EE8A 1L8QA 5EXXA 2RGOA 1G4AE 1PM5A 4IBEA 3SYKA 1G41A 2XFSA 2Z4SA 4JI2M 4P16A 4L16A 3FYCA 1DO0A 3AL0C 2R45A 1L1ZA 4ZPXA 3KS4A 3GRYA 1ORYB 1SXJE 5FTNA 4D81A 3M0EA 3VLFB 1DGHA 4CHTB 2KRKA 3UMMA 3VFDA 3U60B 2KEBA 2V6ZM 4XBOA 4XGIA 1XXHB 1QVRA 1TH4A 2KA6B 4GC9A 4MH0E 4DV2M 4G4QA 4KHPM 3U6QA 1XNQM 3PXGA 1DGGA 2A5YB 4IBDA 2QCUA 1TH2A 4OVZA 2J7OA 3TWLA 5KQDA 5IT9S 4FCTA 4GHAA 2EA0A 4PDIA 3K2LA 1HQYE 1KFVA 2K47A 3HHXA 5FSWA 3W0FA 4IBFA 4X65M 3A42A 3FUXA 4DV1M 3LMMA 4IJEA 2JA2A 5FLXS 1DGHB 4RNAA 2QBYA 4M0WA 3VKGA 1IXZA 1XHBA 3IG5A 2UUAM 4B08A 1TDZA 2C9OA 2BNKA 3KP0E 4REZA 4OU7A 1Q3CA 2F5PA 2VIIA 4KLNA 4YHHM 4QNMA 5FTLA 4X62M 4GH9A 1Z5AA 1SXJB 3FUTA 1IXSB 3GPUA 2FNAA 3K1JA 2F4VM 4AZFA 4LG2A 4JI7M 3NBIA 5F3WA 1GLNA 4DR2M 2Y0QA 2UXDM 4BB9A 2KRUA 2DZNB 3AJIB 4LGYA 4DUYM 3TWMA 3FTFA 4D82A 2QBYB 1I94M 4JI0M 4GHLA 3SBJA 1QZMA 1UM8A 2DHRA 5ITYA 3L29A 3RE8A 5ITUA 3A45A 2F5QA 1SXJA 4LJ5A 4AW4A 2L6OA 5E26A 3I4YA 3HHYA 3GLFA 3B9PA 4DUZM 2FOIC 3SFZA 1YE9A 4B7HA 1OFIA 1JR3D 3GQ5A 2UXCM 1IN7A 2CHQA 2ERCA 3KXEC 4IBCA 4IJFA 3AFHA 5LMUM 3KSJA 4LFBM 3TWKA 3THGA 2Q2EB 3J7BA 3MK6A 4PD2A 4CGYB 4JV5M 5DNYA 1Z59A 3ZCBB 2I7NA 3MHVC 3AOEA 3FD9A 2L09A 1IBMM 3SHGB 4JI3M 3EIEA 4PDGA 4X66M 2DZOB 4QOZC 5JI3E 4G4RA 1Z5BA 1N32M 3GLFB 4QOSA 4G6ZA 1OFHA 5ITRA 4LCBA 2LWXA 4GC5A 4GITA 4MM3B 5ITXE 3U6DA 5DYGA 1L2CA 3GP1A 4DV7M 4LF4M 4QHSA 2KXEA 1HNWM 3PVSA 3CF6E 4FW9A 3U5ZB 2ZBKB 4EIWA 3HHZA 2EUCA 2YQZA 3FUVA 3NWLA 1MU5A 5ITQA 2KZSA 3JR5A 1E94E 2V1CA 3Q8XA 4NL4H 3T1HM 1J7KA 3H4MA 3VK7A 4BLCA 2DVWB 4NSRA 5FTMA 4AKHA 3JAMS 1IXRC 2OQ4A 4YY3M 4GIPA 1IBKM 5DYIA 4NXNM 1OJLA 2Y21A 4AI6A 4W5WA 1NHGC 5EP4A 4GMQA 2HCBA 3FTEA 2F5NA 5IWAM 1TGUA 1TH3A 5FTJA 3SMPA 3U6OA 5EQTA 2C99A 2CUZA 2CHVA 4I8OA 3UJNA 3A98B 1IN8A 3CF2A 5IREB 4JI8M 5EXPA 4RF1A 1NVMA 4FWGA 3LVVA 3J81S 2ZAOA 3KDSE 1IY0A 4AG6A 4PT5A 2R46A 4DV0M 3HWSA 4R7GA 2LNHC 3AOGA 3WHLA 1TDHA 3GRRA 4IBGA 4TUWA 1HT2E 4DR3M 3GLHA 3KP1E 4LJ9A 1H6UA 4OX9M 1IN6A 1GL6A 4FWHA 3PNVA 1HQCA 3ZH9B 2CHGA 1ZQ9A 3E9SA 2YNMD 2X8AA 4MGHA 3HGIA 3U61B 1FNNA 2H1RA 4LZJA 1J5EM 4B7GA 1XMOM 2QZ4A 4GRIA 3GQ3A 2LXEA 4DV4M 3U6SA 4LJ4A 3TQSA 3VDUA 3HJQA 3J7AS 2DWMA 2ZM6M 4DV3M 4GKKM 2CFOA 4I81A 4L8RC 3J2PB 3FUUA 2ZAMA 5BPVA 2Z3XA 4L78A 4L15A 1D2NA 3KSXA 2W82A 2C96A 1XC8A 4Z6YA 3FUWA 3U61A 4LJ6A 7CATA 1IY2A 1SXJD 1HNZM 2X49A 3U6LA 1T3TA 3DZDA 3E4RA 1I4WA 2D7HA 4B3RM 4HL4A 1N77A 2CV1A 3SMSA 2M5ZA 3SC3A 3IG8A 2XEPA 1GKIA 1N34M 1LV7A 5FTKA 3TE6A 2XF3A 3GRVA 1QANA 4JI6M 1NY6A 3MJ5A 4FD2A 1K3WA 2C5RA 2DWNA 1X37A 1R7RA 4NOOB 4DR6M 3GLIA 1W5TA 3SYLA 1NHWC 3M6AA 4B7FA 3SARA 3HHWA 1R2ZA 1NJGA 4AKGA 1IY1A 1QAOA 3SAUA 1Q39A 4WW0A 2YR0A 4IBKA 2XSZA 3K8ZA 5KPRA 2BJWA 2CEAA 1DO2A 2I7PA 3BOSA 4AG5A 2P5TA 4JI1M 4X64M 1G8PA 3GLIB 4JXJA 3I4VA 3QWLA 1Q3BA 2O5RA 3CTWB 3KOYE 1WXQA 5KPTA 1IM2A 3RGSA 3RGPA 2G5GX 3SASA 3UK6A 2VQEM 8CATA 3HU1A 1MX0A 3HJ8A 4M9ZA 2FFJA 4QNRA 3TL4X 5KQ8A 3GO8A 3UGJA 4G4OA 4MGKE 2AHMA 2XFTA 3T38A 5GKNA 5BR8M 2HKJA 2J7NA 3DFZA 2R18A 3CF0A 2CV2A 4AKIA 2BJVA 3L26A 2L7IA 4DR4M 5EP3A 4FCVA 1NNJA 1YUBA 2XLJA 3SATA 1L2DA 4D80A 4AQYM 1L1TA 3KS8A 3T15A 1NSFA 3GPYA 3VKHA 3HJSA 1NY5A 2EO2A 2DXIA 1W5SA 3FTDA 3R8FA 4B3TM 4QHTA 3J27B 4KODA 4OW0A 3PNYA 4IBJA 4LFCM 3EIHA 2Y20A 4FWDA 3D8BA 4II7A 4I5SA 5H37D 3U6MA 3L27A 3PFIA 5E6JA 3C58A 2UXBM 3GLHB 2XZUA 1N36M 1S3SA 4MGIE 1XWIA 4MB7A 1XMQM 3ILKA 4LJ8A 2CV0A 3TPZA 2R4JA 4DR5M 3I51A 5EXSA 1GL7A 5C18A 5IZ7D 3J80S 2R65A 3U60A 2F5OA 5KO3A 2F5SA 4M9SA 3KW6A 1E9SA 1YSYA 3U6CA 2FE8A 3M7GA 2NQ8C 1IBLM 2D7GA 4OVZB 2XSZD 3UZUA 5A2QS 1FJGM 5EP2A 1PJIA 3R9XB 4B3MM 3GRUA 4IIWA 4M9XA 4NSOB 5KPZA 3FKEA 2KZUA 4G4NA 2XH9A 3SAVA 2E5LM 3U6EA 2C98A 4LJAA 3LVWA 3KOZE 4MGZE 1HNXM 3W0LB 3WHKA 1IQPA 1NNUC 1QAQA 2CE7A 5LMNM 3AOEC 4BBAA 2R62A 4KO8A 1Z6TA 2QENA 4NRVA 4DV6M 3SHFA 4LJ7A 4MGYE 2LH0A 3KFUG 1E32A 4Z8XA 2V1UA 3JR4A 1C1KA 3FTCA 4LRSA 2UUCM 2OPFA 2L7HA 2QP9X 1PJJA 1IN4A 1G3IA 2YFQA 5EXTA 1ZAEA 2VQFM 1E9RA 1K82A 4LF7M 2HL7A 4DR1M 5EJCA 4FCWA 3AV0A 3KVWA 4LF9M 1KYIA 4LF6M 3L25A 4LZZA 4FVMA 3U6PA 2RGHA 3DOAA 3D8LA 3QAUA 1QYRA 3KOXE 3AKZA 4CISA 3HKPA 4WURA 5C1BA 4HLQA 2RKOA 1DGFA 3HU3A 1XNRM 3GPXA 2HHHM 1N75A 4GKJM 2X4AA 3OTOM 4A3VB 4S12A 4NXMM 2XGNA 2Y0TA 4DR7M 1QQWA 1VDDA 1JQJC 3GPPA 1GVNA 1N78A 1SXJC 1J09A 4LRTA 2Z7JA 4JN6A 1L2BA 4L4UA 4LY6A 2UUBM 2ZANA 2XZFA 2G8LA 4JI5M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORY B; 
#chains in the Genus database with same CATH topology
 3LQQ A;  3L2A A;  4M0D A;  4R3D A;  4PCZ A;  3GLG A;  4DV5 M;  3RFW A;  2KHH A;  3MMP A;  5ITX A;  2DWL A;  3FYD A;  2DI0 A;  1F4I A;  1K3X A;  3U6Q A;  4IBI A;  1IN5 A;  3BXW A;  4LFA M;  5JI2 E;  4LF5 M;  3GQ4 A;  3KOW E;  1UFZ A;  2JXN A;  1R2Y A;  4ITQ A;  1N33 M;  4IBB A;  4I4L A;  1NJF A;  1WGN A;  2ZTD A;  3L28 A;  2C9C A;  5EP1 A;  1DGB A;  1WR1 B;  3DA1 A;  2D7E A;  1G59 A;  1HT1 E;  3B7Z A;  1R6B X;  2O25 A;  1JR3 A;  3SAW A;  3A46 A;  2UU9 M;  2KW0 A;  1Z5C A;  2QPA A;  1HR0 M;  4Y28 F;  4JI4 M;  3HX3 A;  3VDP A;  4LF8 M;  3GLI E;  4B3S M;  1QAM A;  2Z4R A;  4RF0 A;  2DWZ B;  2R0I A;  4LGM A;  3U5Z A;  3HU2 A;  3LQR A;  2M60 A;  3GLG B;  4NRW A;  3QYB A;  4K0K M;  2R4E A;  4JYA M;  1KSF X;  1XXH A;  3K92 A;  3VK8 A;  5ITT A;  3ZC7 B;  3T1Y M;  1IFY A;  1EE8 A;  1L8Q A;  5EXX A;  2RGO A;  1G4A E;  1PM5 A;  3C3E A;  4IBE A;  4R71 A;  1D0K A;  1G41 A;  2XFS A;  3SYK A;  2Z4S A;  4JI2 M;  1ZV1 A;  4P16 A;  4L16 A;  3FYC A;  1DO0 A;  3AL0 C;  2OO9 A;  1RU3 A;  2R45 A;  1NO1 A;  4ZPX A;  1L1Z A;  1A5T A;  3KS4 A;  3GRY A;  2L4F A;  1ORY B;  3QYE A;  1D0L A;  1SXJ E;  5FTN A;  1R5L A;  4D81 A;  3M0E A;  3VLF B;  1DGH A;  2CWB A;  2KRK A;  4CHT B;  3VFD A;  3UMM A;  3U60 B;  2KEB A;  2LVQ D;  2V6Z M;  4XBO A;  1XXH B;  1QVR A;  1TH4 A;  2KA6 B;  4GC9 A;  4MH0 E;  2DEN A;  4XGI A;  4DV2 M;  4G4Q A;  3LW5 F;  3Q8G A;  1T6O A;  3PXG A;  1DGG A;  2L4E A;  2A5Y B;  1OKS A;  2QCU A;  4IBD A;  1XNQ M;  1EIJ A;  1TH2 A;  4OVZ A;  2J7O A;  3TWL A;  3E46 A;  5KQD A;  2DAG A;  4FCT A;  5IT9 S;  4GHA A;  2EA0 A;  1XB2 B;  4PDI A;  3K2L A;  1HQY E;  2B3T A;  4F2L A;  1KFV A;  2K47 A;  3HHX A;  5FSW A;  2JZ0 A;  3W0F A;  4IBF A;  4X65 M;  3A42 A;  3H4J A;  3FUX A;  4DV1 M;  3LMM A;  4IJE A;  4RKU F;  1VEK A;  2JA2 A;  5FLX S;  1DGH B;  4RNA A;  2QBY A;  4M0W A;  3VKG A;  1IXZ A;  1XHB A;  1PRB A;  3CGW A;  3IG5 A;  2UUA M;  4B08 A;  1TDZ A;  2C9O A;  2BNK A;  3KP0 E;  4REZ A;  4OU7 A;  1Q3C A;  2F5P A;  2VII A;  4KLN A;  4YHH M;  4QNM A;  2MGW A;  5FTL A;  4X62 M;  2OOB A;  1Z5A A;  1SXJ B;  4GH9 A;  1IXS B;  3FUT A;  2DAI A;  3GPU A;  2FNA A;  2LVO C;  3K1J A;  3B7Q A;  4AZF A;  2F4V M;  4LG2 A;  4JI7 M;  3NBI A;  5F3W A;  1GLN A;  3I04 M;  4DR2 M;  2Y0Q A;  2UXD M;  4BB9 A;  2DAM A;  2KRU A;  2JP7 A;  2DZN B;  1WHC A;  3AJI B;  2VF7 A;  4LGY A;  4DUY M;  3TWM A;  3FTF A;  4D82 A;  2QBY B;  1I94 M;  4JI0 M;  4GHL A;  1CUK A;  3SBJ A;  1QZM A;  1SG9 A;  1UM8 A;  2DHR A;  5ITY A;  3L29 A;  3RE8 A;  5ITU A;  1GO5 A;  3A45 A;  2F5Q A;  1SXJ A;  4LJ5 A;  4AW4 A;  2KNZ A;  2L6O A;  2QHO B;  5E26 A;  3K9O A;  3I4Y A;  3HHY A;  3GLF A;  1ZMV A;  3B9P A;  4DUZ M;  4L6V 6;  2FOI C;  3SFZ A;  1YE9 A;  4B7H A;  1OFI A;  1JR3 D;  3GQ5 A;  2UXC M;  1IN7 A;  2BWE A;  2CHQ A;  2ERC A;  2JY7 A;  3KXE C;  4IBC A;  4IJF A;  3AFH A;  5LMU M;  3KSJ A;  4LFB M;  2R44 A;  2MRO B;  3TWK A;  3THG A;  2Q2E B;  3J7B A;  3MK6 A;  1EFU B;  4CGY B;  4PD2 A;  4JV5 M;  5DNY A;  1Z59 A;  3FRH A;  3ZCB B;  2I7N A;  3MHV C;  3AOE A;  2VF8 A;  3FD9 A;  2L09 A;  1IBM M;  3SHG B;  1NV8 A;  2LHC A;  3EIE A;  4JI3 M;  4PDG A;  3W67 A;  4X66 M;  1QUS A;  2DZO B;  4QOZ C;  5JI3 E;  4G4R A;  1P3Q Q;  1Z5B A;  1N32 M;  3GLF B;  4QOS A;  4G6Z A;  1V34 A;  1OFH A;  5ITR A;  4LCB A;  2LWX A;  4GC5 A;  4GIT A;  4MM3 B;  5ITX E;  3U6D A;  5DYG A;  1L2C A;  3GP1 A;  4DV7 M;  4LF4 M;  4QHS A;  2KXE A;  1HNW M;  3PVS A;  3CF6 E;  4FW9 A;  3U5Z B;  2ZBK B;  4EIW A;  3HHZ A;  2EUC A;  2YQZ A;  3B74 A;  1MN3 A;  3FUV A;  3NWL A;  1MU5 A;  5ITQ A;  2KZS A;  3JR5 A;  1E94 E;  2K9D A;  2V1C A;  2EJS A;  2MH8 A;  3Q8X A;  4NL4 H;  1J7K A;  5DFL A;  1WGL A;  3T1H M;  3H4M A;  3VK7 A;  4BLC A;  2DVW B;  4NSR A;  5FTM A;  4AKH A;  3JAM S;  1IXR C;  2OQ4 A;  4YY3 M;  4GIP A;  1IBK M;  5DYI A;  2OOA A;  1G71 A;  4NXN M;  1TF0 B;  1OJL A;  2Y21 A;  4AI6 A;  4W5W A;  1NHG C;  5EP4 A;  4GMQ A;  2HCB A;  3FTE A;  2F5N A;  5IWA M;  1TGU A;  1TH3 A;  5FTJ A;  3SMP A;  3U6O A;  5EQT A;  3GLF E;  2C99 A;  2CUZ A;  2CHV A;  2JY8 A;  4I8O A;  3UJN A;  3A98 B;  1IN8 A;  1D0M A;  3CF2 A;  5IRE B;  4JI8 M;  5EXP A;  4RF1 A;  1NVM A;  4FWG A;  1T43 A;  3LVV A;  3J81 S;  2ZAO A;  3KDS E;  1IY0 A;  4AG6 A;  4PT5 A;  2R46 A;  4DV0 M;  3HWS A;  4R7G A;  2LNH C;  3AOG A;  3WHL A;  1TDH A;  3GRR A;  4IBG A;  2RRU A;  4TUW A;  1GAB A;  1HT2 E;  4DR3 M;  1WIV A;  3GLH A;  3KP1 E;  1DV0 A;  2GNO A;  4LJ9 A;  1H6U A;  2JNH A;  4OX9 M;  1IN6 A;  1GL6 A;  3PNV A;  4FWH A;  1HQC A;  3ZH9 B;  2CHG A;  1ZQ9 A;  2JY6 B;  3E9S A;  2YNM D;  2X8A A;  4MGH A;  3HGI A;  3U61 B;  1FNN A;  2H1R A;  4LZJ A;  4CJ6 A;  2DAE A;  1J5E M;  4B7G A;  1XMO M;  2WSF F;  2QZ4 A;  4GRI A;  3GQ3 A;  2LXE A;  4DV4 M;  3U6S A;  4LJ4 A;  3TQS A;  3VDU A;  3HJQ A;  3J7A S;  2DWM A;  1WJ7 A;  2ZM6 M;  2EKF A;  4DV3 M;  4GKK M;  2CFO A;  2CRU A;  4I81 A;  4L8R C;  2QNJ A;  3J2P B;  3FUU A;  2ZAM A;  3W68 A;  4KHP M;  2WSE F;  5BPV A;  2Z3X A;  4L78 A;  4L15 A;  1D2N A;  3KSX A;  1JB0 F;  2W82 A;  2C96 A;  2LTU A;  1XC8 A;  2APL A;  4Z6Y A;  3FUW A;  2DNA A;  3U61 A;  4LJ6 A;  7CAT A;  1IY2 A;  1SXJ D;  1HNZ M;  2X49 A;  1PJT A;  1PJS A;  3U6L A;  1T3T A;  1V33 A;  3DZD A;  3E4R A;  1I4W A;  2D7H A;  4B3R M;  4HL4 A;  1N77 A;  2HAK A;  2CV1 A;  2N35 A;  3SMS A;  2M5Z A;  3SC3 A;  3IG8 A;  2XEP A;  1GKI A;  1N34 M;  1LV7 A;  5FTK A;  3TE6 A;  1VQ1 A;  2XF3 A;  1QAN A;  2ZTC A;  1NY6 A;  1JR3 E;  2DZL A;  3GRV A;  3MJ5 A;  4JI6 M;  4FD2 A;  1K3W A;  2HWJ A;  2C5R A;  2DWN A;  1X37 A;  1R7R A;  4NOO B;  4DR6 M;  2CP8 A;  3BBZ A;  2DAK A;  3GLI A;  1W5T A;  3SYL A;  1NHW C;  3M6A A;  4B7F A;  1OAO C;  3SAR A;  3HHW A;  1R2Z A;  1NJG A;  4AKG A;  1IY1 A;  1QAO A;  4ANR A;  3SAU A;  1Q39 A;  2BWB A;  4WW0 A;  2YR0 A;  4IBK A;  2GQF A;  3T6P A;  2XSZ A;  3K8Z A;  5KPR A;  1C7Y A;  1NV9 A;  2BJW A;  1QDR A;  1VG5 A;  2CEA A;  1DO2 A;  2I7P A;  3B7N A;  3BOS A;  2Z8Y M;  2LVP C;  4AG5 A;  2P5T A;  4JI1 M;  2KDL A;  1PGY A;  2WZJ A;  4X64 M;  1G8P A;  4Q7J A;  3GLI B;  2DHY A;  4JXJ A;  3I4V A;  3QWL A;  3FRI A;  3B89 A;  1Q3B A;  2O5R A;  3CTW B;  3KOY E;  1WXQ A;  5KPT A;  1VEG A;  1IM2 A;  1AUA A;  3IHP A;  2G5G X;  1AIP C;  3RGS A;  3RGP A;  3UK6 A;  3SAS A;  2VQE M;  2KNA A;  8CAT A;  3HU1 A;  1OQY A;  4GEW A;  1MX0 A;  3HJ8 A;  4M9Z A;  2FFJ A;  4QNR A;  3TL4 X;  5KQ8 A;  3GO8 A;  3UGJ A;  4G4O A;  1GJT A;  1V92 A;  4MGK E;  2AHM A;  2XFT A;  1YLA A;  2FH0 A;  3FE3 A;  3T38 A;  5GKN A;  5BR8 M;  2HKJ A;  2DKL A;  2J7N A;  3DFZ A;  2G3Q A;  2R18 A;  3CF0 A;  2CV2 A;  4AKI A;  2BJV A;  3L26 A;  4G3O A;  2L7I A;  1OIZ A;  3E21 A;  1GJS A;  1ZMU A;  3HY5 A;  4DR4 M;  1OTR A;  5EP3 A;  1BVS A;  4FCV A;  1YUB A;  2XLJ A;  1NNJ A;  4KT0 F;  3SAT A;  1L2D A;  4NC6 A;  4D80 A;  4AQY M;  3IEC A;  1L1T A;  3T15 A;  1NSF A;  3GPY A;  3KS8 A;  1MJG M;  3VKH A;  3HJS A;  1NY5 A;  2EO2 A;  2DXI A;  1W5S A;  3FTD A;  3R8F A;  4B3T M;  4QHT A;  3J27 B;  2H5X A;  4KOD A;  1VDL A;  4OW0 A;  3PNY A;  4IBJ A;  4LFC M;  3EIH A;  2Y20 A;  4FWD A;  2LVN C;  3D8B A;  4II7 A;  4I5S A;  5H37 D;  3U6M A;  3L27 A;  3PFI A;  3HZJ A;  5E6J A;  3C58 A;  2UXB M;  3GLH B;  2XZU A;  4CIZ A;  1N36 M;  1S3S A;  4MGI E;  1XWI A;  4MB7 A;  1XMQ M;  3ILK A;  4LJ8 A;  4P17 A;  3TPZ A;  2CV0 A;  2JY5 A;  2R4J A;  4DR5 M;  3I51 A;  5EXS A;  1GL7 A;  5C18 A;  1TTE A;  5IZ7 D;  2QQ8 A;  3C9P A;  3J80 S;  2R65 A;  1XXH E;  3U60 A;  2F5O A;  1VEJ A;  5KO3 A;  2F5S A;  4M9S A;  3KW6 A;  1E9S A;  1YSY A;  1QZE A;  3U6C A;  2FE8 A;  3M7G A;  2NQ8 C;  1IBL M;  2D7G A;  4OVZ B;  2VDB B;  2XSZ D;  1QUT A;  2MJ5 B;  3UZU A;  2WSC F;  5A2Q S;  1FJG M;  2JZ1 A;  5EP2 A;  1PJI A;  3R9X B;  3LCV B;  4B3M M;  2KNV A;  1PJQ A;  2K0B X;  2L2D A;  3GRU A;  3NBX X;  1QDT A;  2J5Y A;  4IIW A;  4M9X A;  3FKE A;  4NSO B;  5KPZ A;  2KZU A;  4G4N A;  2XH9 A;  2LBC A;  3SAV A;  2E5L M;  2JUJ A;  3U6E A;  2C98 A;  4LJA A;  3LVW A;  3KOZ E;  4MGZ E;  1HNX M;  2O01 F;  3W0L B;  3WHK A;  1IQP A;  1NNU C;  1QAQ A;  2CE7 A;  5LMN M;  3AOE C;  4BBA A;  1Y8G A;  1ZMW A;  2R62 A;  4KO8 A;  4F1I A;  1Z6T A;  2QEN A;  4NRV A;  4DV6 M;  3SHF A;  4LJ7 A;  4XK8 F;  4MGY E;  2JWS A;  2LH0 A;  3KFU G;  3C3D A;  1E32 A;  2R6F A;  4Z8X A;  2V1U A;  3JR4 A;  1C1K A;  2MR9 A;  3FTC A;  4LRS A;  2UUC M;  4DBG B;  3V76 A;  1IXS A;  4WP2 A;  1R4G A;  2OPF A;  2L7H A;  2QP9 X;  1PJJ A;  1IN4 A;  1G3I A;  1TR8 A;  2FS1 A;  1ZAE A;  2QSF X;  1E9R A;  2YFQ A;  5EXT A;  2VQF M;  1K82 A;  4LF7 M;  1LTM A;  2HL7 A;  4DR1 M;  5EJC A;  4FCW A;  3AV0 A;  4UN2 B;  3GLH E;  3KVW A;  2LVA A;  1KYI A;  4LF6 M;  4LF9 M;  5L8R F;  3L25 A;  4LZZ A;  4FVM A;  3U6P A;  2RGH A;  3DOA A;  3D8L A;  3QAU A;  1QYR A;  3KOX E;  1OIP A;  3AKZ A;  4CIS A;  3HKP A;  4WUR A;  5C1B A;  4HLQ A;  3GLG E;  2RKO A;  1DGF A;  1Q02 A;  3HU3 A;  3K9P A;  3GPX A;  1XNR M;  2HHH M;  1N75 A;  4GKJ M;  3F92 A;  2X4A A;  3OTO M;  2EKK A;  4A3V B;  2LHG A;  4S12 A;  3I01 M;  4NXM M;  2XGN A;  2Y0T A;  4DR7 M;  1QQW A;  1VDD A;  1JQJ C;  3LCU A;  3ZQJ A;  1GVN A;  3GPP A;  1N78 A;  1SXJ C;  1J09 A;  4LRT A;  1HJP A;  2Z7J A;  2K6B A;  1OAI A;  4HEO A;  4JN6 A;  4L4U A;  4LY6 A;  1L2B A;  2UUB M;  2ZAN A;  2XZF A;  2G8L A;  4JI5 M; 
#chains in the Genus database with same CATH homology
 3LQQ A;  3L2A A;  4M0D A;  4R3D A;  4PCZ A;  3GLG A;  4DV5 M;  3RFW A;  5ITX A;  2DWL A;  3FYD A;  1K3X A;  4IBI A;  1IN5 A;  4LFA M;  5JI2 E;  4LF5 M;  3GQ4 A;  3KOW E;  4ITQ A;  1N33 M;  1R2Y A;  4IBB A;  4I4L A;  1NJF A;  3L28 A;  2C9C A;  5EP1 A;  1DGB A;  3DA1 A;  2D7E A;  1G59 A;  1HT1 E;  1R6B X;  1JR3 A;  3SAW A;  3A46 A;  2UU9 M;  2KW0 A;  1Z5C A;  2QPA A;  1HR0 M;  4JI4 M;  3VDP A;  4LF8 M;  4B3S M;  1QAM A;  2Z4R A;  4RF0 A;  2DWZ B;  4LGM A;  3U5Z A;  3HU2 A;  3LQR A;  2M60 A;  3GLG B;  4NRW A;  4K0K M;  4JYA M;  2R4E A;  1KSF X;  1XXH A;  3K92 A;  3VK8 A;  5ITT A;  3ZC7 B;  3T1Y M;  1EE8 A;  1L8Q A;  5EXX A;  2RGO A;  1G4A E;  1PM5 A;  4IBE A;  3SYK A;  1G41 A;  2XFS A;  2Z4S A;  4JI2 M;  4P16 A;  4L16 A;  3FYC A;  1DO0 A;  3AL0 C;  2R45 A;  1L1Z A;  4ZPX A;  3KS4 A;  3GRY A;  1ORY B;  1SXJ E;  5FTN A;  4D81 A;  3M0E A;  3VLF B;  1DGH A;  4CHT B;  2KRK A;  3UMM A;  3VFD A;  3U60 B;  2KEB A;  2V6Z M;  4XBO A;  4XGI A;  1XXH B;  1QVR A;  1TH4 A;  2KA6 B;  4GC9 A;  4MH0 E;  4DV2 M;  4G4Q A;  4KHP M;  3U6Q A;  1XNQ M;  3PXG A;  1DGG A;  2A5Y B;  4IBD A;  2QCU A;  1TH2 A;  4OVZ A;  2J7O A;  3TWL A;  5KQD A;  5IT9 S;  4FCT A;  4GHA A;  2EA0 A;  4PDI A;  3K2L A;  1HQY E;  1KFV A;  2K47 A;  3HHX A;  5FSW A;  3W0F A;  4IBF A;  4X65 M;  3A42 A;  3FUX A;  4DV1 M;  3LMM A;  4IJE A;  2JA2 A;  5FLX S;  1DGH B;  4RNA A;  2QBY A;  4M0W A;  3VKG A;  1IXZ A;  1XHB A;  3IG5 A;  2UUA M;  4B08 A;  1TDZ A;  2C9O A;  2BNK A;  3KP0 E;  4REZ A;  4OU7 A;  1Q3C A;  2F5P A;  2VII A;  4KLN A;  4YHH M;  4QNM A;  5FTL A;  4X62 M;  4GH9 A;  1Z5A A;  1SXJ B;  3FUT A;  1IXS B;  3GPU A;  2FNA A;  3K1J A;  2F4V M;  4AZF A;  4LG2 A;  4JI7 M;  3NBI A;  5F3W A;  1GLN A;  4DR2 M;  2Y0Q A;  2UXD M;  4BB9 A;  2KRU A;  2DZN B;  3AJI B;  4LGY A;  4DUY M;  3TWM A;  3FTF A;  4D82 A;  2QBY B;  1I94 M;  4JI0 M;  4GHL A;  3SBJ A;  1QZM A;  1UM8 A;  2DHR A;  5ITY A;  3L29 A;  3RE8 A;  5ITU A;  3A45 A;  2F5Q A;  1SXJ A;  4LJ5 A;  4AW4 A;  2L6O A;  5E26 A;  3I4Y A;  3HHY A;  3GLF A;  3B9P A;  4DUZ M;  2FOI C;  3SFZ A;  1YE9 A;  4B7H A;  1OFI A;  1JR3 D;  3GQ5 A;  2UXC M;  1IN7 A;  2CHQ A;  2ERC A;  3KXE C;  4IBC A;  4IJF A;  3AFH A;  5LMU M;  3KSJ A;  4LFB M;  3TWK A;  3THG A;  2Q2E B;  3J7B A;  3MK6 A;  4PD2 A;  4CGY B;  4JV5 M;  5DNY A;  1Z59 A;  3ZCB B;  2I7N A;  3MHV C;  3AOE A;  3FD9 A;  2L09 A;  1IBM M;  3SHG B;  4JI3 M;  3EIE A;  4PDG A;  4X66 M;  2DZO B;  4QOZ C;  5JI3 E;  4G4R A;  1Z5B A;  1N32 M;  3GLF B;  4QOS A;  4G6Z A;  1OFH A;  5ITR A;  4LCB A;  2LWX A;  4GC5 A;  4GIT A;  4MM3 B;  5ITX E;  3U6D A;  5DYG A;  1L2C A;  3GP1 A;  4DV7 M;  4LF4 M;  4QHS A;  2KXE A;  1HNW M;  3PVS A;  3CF6 E;  4FW9 A;  3U5Z B;  2ZBK B;  4EIW A;  3HHZ A;  2EUC A;  2YQZ A;  3FUV A;  3NWL A;  1MU5 A;  5ITQ A;  2KZS A;  3JR5 A;  1E94 E;  2V1C A;  3Q8X A;  4NL4 H;  3T1H M;  1J7K A;  3H4M A;  3VK7 A;  4BLC A;  2DVW B;  4NSR A;  5FTM A;  4AKH A;  3JAM S;  1IXR C;  2OQ4 A;  4YY3 M;  4GIP A;  1IBK M;  5DYI A;  4NXN M;  1OJL A;  2Y21 A;  4AI6 A;  4W5W A;  1NHG C;  5EP4 A;  4GMQ A;  2HCB A;  3FTE A;  2F5N A;  5IWA M;  1TGU A;  1TH3 A;  5FTJ A;  3SMP A;  3U6O A;  5EQT A;  2C99 A;  2CUZ A;  2CHV A;  4I8O A;  3UJN A;  3A98 B;  1IN8 A;  3CF2 A;  5IRE B;  4JI8 M;  5EXP A;  4RF1 A;  1NVM A;  4FWG A;  3LVV A;  3J81 S;  2ZAO A;  3KDS E;  1IY0 A;  4AG6 A;  4PT5 A;  2R46 A;  4DV0 M;  3HWS A;  4R7G A;  2LNH C;  3AOG A;  3WHL A;  1TDH A;  3GRR A;  4IBG A;  4TUW A;  1HT2 E;  4DR3 M;  3GLH A;  3KP1 E;  4LJ9 A;  1H6U A;  4OX9 M;  1IN6 A;  1GL6 A;  4FWH A;  3PNV A;  1HQC A;  3ZH9 B;  2CHG A;  1ZQ9 A;  3E9S A;  2YNM D;  2X8A A;  4MGH A;  3HGI A;  3U61 B;  1FNN A;  2H1R A;  4LZJ A;  1J5E M;  4B7G A;  1XMO M;  2QZ4 A;  4GRI A;  3GQ3 A;  2LXE A;  4DV4 M;  3U6S A;  4LJ4 A;  3TQS A;  3VDU A;  3HJQ A;  3J7A S;  2DWM A;  2ZM6 M;  4DV3 M;  4GKK M;  2CFO A;  4I81 A;  4L8R C;  3J2P B;  3FUU A;  2ZAM A;  5BPV A;  2Z3X A;  4L78 A;  4L15 A;  1D2N A;  3KSX A;  2W82 A;  2C96 A;  1XC8 A;  4Z6Y A;  3FUW A;  3U61 A;  4LJ6 A;  7CAT A;  1IY2 A;  1SXJ D;  1HNZ M;  2X49 A;  3U6L A;  1T3T A;  3DZD A;  3E4R A;  1I4W A;  2D7H A;  4B3R M;  4HL4 A;  1N77 A;  2CV1 A;  3SMS A;  2M5Z A;  3SC3 A;  3IG8 A;  2XEP A;  1GKI A;  1N34 M;  1LV7 A;  5FTK A;  3TE6 A;  2XF3 A;  3GRV A;  1QAN A;  4JI6 M;  1NY6 A;  3MJ5 A;  4FD2 A;  1K3W A;  2C5R A;  2DWN A;  1X37 A;  1R7R A;  4NOO B;  4DR6 M;  3GLI A;  1W5T A;  3SYL A;  1NHW C;  3M6A A;  4B7F A;  3SAR A;  3HHW A;  1R2Z A;  1NJG A;  4AKG A;  1IY1 A;  1QAO A;  3SAU A;  1Q39 A;  4WW0 A;  2YR0 A;  4IBK A;  2XSZ A;  3K8Z A;  5KPR A;  2BJW A;  2CEA A;  1DO2 A;  2I7P A;  3BOS A;  4AG5 A;  2P5T A;  4JI1 M;  4X64 M;  1G8P A;  3GLI B;  4JXJ A;  3I4V A;  3QWL A;  1Q3B A;  2O5R A;  3CTW B;  3KOY E;  1WXQ A;  5KPT A;  1IM2 A;  3RGS A;  3RGP A;  2G5G X;  3SAS A;  3UK6 A;  2VQE M;  8CAT A;  3HU1 A;  1MX0 A;  3HJ8 A;  4M9Z A;  2FFJ A;  4QNR A;  3TL4 X;  5KQ8 A;  3GO8 A;  3UGJ A;  4G4O A;  4MGK E;  2AHM A;  2XFT A;  3T38 A;  5GKN A;  5BR8 M;  2HKJ A;  2J7N A;  3DFZ A;  2R18 A;  3CF0 A;  2CV2 A;  4AKI A;  2BJV A;  3L26 A;  2L7I A;  4DR4 M;  5EP3 A;  4FCV A;  1NNJ A;  1YUB A;  2XLJ A;  3SAT A;  1L2D A;  4D80 A;  4AQY M;  1L1T A;  3KS8 A;  3T15 A;  1NSF A;  3GPY A;  3VKH A;  3HJS A;  1NY5 A;  2EO2 A;  2DXI A;  1W5S A;  3FTD A;  3R8F A;  4B3T M;  4QHT A;  3J27 B;  4KOD A;  4OW0 A;  3PNY A;  4IBJ A;  4LFC M;  3EIH A;  2Y20 A;  4FWD A;  3D8B A;  4II7 A;  4I5S A;  5H37 D;  3U6M A;  3L27 A;  3PFI A;  5E6J A;  3C58 A;  2UXB M;  3GLH B;  2XZU A;  1N36 M;  1S3S A;  4MGI E;  1XWI A;  4MB7 A;  1XMQ M;  3ILK A;  4LJ8 A;  2CV0 A;  3TPZ A;  2R4J A;  4DR5 M;  3I51 A;  5EXS A;  1GL7 A;  5C18 A;  5IZ7 D;  3J80 S;  2R65 A;  3U60 A;  2F5O A;  5KO3 A;  2F5S A;  4M9S A;  3KW6 A;  1E9S A;  1YSY A;  3U6C A;  2FE8 A;  3M7G A;  2NQ8 C;  1IBL M;  2D7G A;  4OVZ B;  2XSZ D;  3UZU A;  5A2Q S;  1FJG M;  5EP2 A;  1PJI A;  3R9X B;  4B3M M;  3GRU A;  4IIW A;  4M9X A;  4NSO B;  5KPZ A;  3FKE A;  2KZU A;  4G4N A;  2XH9 A;  3SAV A;  2E5L M;  3U6E A;  2C98 A;  4LJA A;  3LVW A;  3KOZ E;  4MGZ E;  1HNX M;  3W0L B;  3WHK A;  1IQP A;  1NNU C;  1QAQ A;  2CE7 A;  5LMN M;  3AOE C;  4BBA A;  2R62 A;  4KO8 A;  1Z6T A;  2QEN A;  4NRV A;  4DV6 M;  3SHF A;  4LJ7 A;  4MGY E;  2LH0 A;  3KFU G;  1E32 A;  4Z8X A;  2V1U A;  3JR4 A;  1C1K A;  3FTC A;  4LRS A;  2UUC M;  2OPF A;  2L7H A;  2QP9 X;  1PJJ A;  1IN4 A;  1G3I A;  2YFQ A;  5EXT A;  1ZAE A;  2VQF M;  1E9R A;  1K82 A;  4LF7 M;  2HL7 A;  4DR1 M;  5EJC A;  4FCW A;  3AV0 A;  3KVW A;  4LF9 M;  1KYI A;  4LF6 M;  3L25 A;  4LZZ A;  4FVM A;  3U6P A;  2RGH A;  3DOA A;  3D8L A;  3QAU A;  1QYR A;  3KOX E;  3AKZ A;  4CIS A;  3HKP A;  4WUR A;  5C1B A;  4HLQ A;  2RKO A;  1DGF A;  3HU3 A;  1XNR M;  3GPX A;  2HHH M;  1N75 A;  4GKJ M;  2X4A A;  3OTO M;  4A3V B;  4S12 A;  4NXM M;  2XGN A;  2Y0T A;  4DR7 M;  1QQW A;  1VDD A;  1JQJ C;  3GPP A;  1GVN A;  1N78 A;  1SXJ C;  1J09 A;  4LRT A;  2Z7J A;  4JN6 A;  1L2B A;  4L4U A;  4LY6 A;  2UUB M;  2ZAN A;  2XZF A;  2G8L A;  4JI5 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...