1ORYB

Flagellar export chaperone in complex with its cognate binding partner
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
NVDFAKEMTEFTKYQIRMQSGVAMLAQANALPQLVLQLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords flagellar protein FliS
publication title Similar modes of polypeptide recognition by export chaperones in flagellar biosynthesis and type III secretion
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 14
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2003-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.410 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1oryB00
1ORYB
chains in the Genus database with same CATH superfamily
2JZ1A 2VQEM 1L1ZA 4M0DA 3GP1A 5BR8M 1SG9A 1IBLM 3LVVA 1GO5A 1DGFA 4KHPM 2YNMD 3L26A 2KNZA 3GPPA 2DAKA 4LFBM 1AUAA 4MM3B 1ORYB 3ZCBB 1GVNA 3T15A 2OQ4A 2DZNB 1IY1A 1XB2B 3NBIA 4RF1A 2WSEF 1PRBA 3U6PA 3U61A 4KO8A 3TL4X 5ITXE 2JUJA 2RKOA 1OAOC 1D2NA 4AKIA 2CEAA 2LVAA 3LQRA 4RNAA 5IZ7D 5KQDA 2Y0QA 1V34A 1CUKA 4DV1M 2BNKA 3UZUA 2XZUA 4FWGA 4R71A 1GJSA 1W5SA 3JR4A 2L2DA 3VLFB 1DO2A 4DR7M 1KYIA 4LJ4A 4BB9A 3HJSA 2LVPC 2G8LA 3GRUA 1XXHA 4CJ6A 4B08A 2C99A 3K8ZA 1R4GA 2JA2A 1PJSA 3HHXA 4PDIA 2F5NA 4DUZM 1S3SA 4G3OA 4I5SA 3VK8A 2R62A 5EQTA 1N34M 2MROB 4L16A 3VKHA 3VDUA 3BBZA 1N32M 1T6OA 2FH0A 4LCBA 3M7GA 2O5RA 5KQ8A 4NSRA 3HKPA 4Q7JA 2F5SA 2FFJA 1JQJC 2HCBA 2KEBA 4IBDA 2XSZD 2Z7JA 3EIHA 2M5ZA 3H4JA 1XNQM 3GQ4A 2XGNA 3U6MA 4KLNA 4FCWA 2CHQA 3J7AS 1QUSA 4MGIE 1JR3D 1XMQM 1HNZM 1HR0M 4WP2A 4LF6M 4JYAM 4QHSA 3VKGA 5F3WA 3U6CA 2UXBM 1G3IA 3L29A 4JI3M 4DBGB 3KSXA 1T43A 4FWHA 4JI5M 1IXZA 1Q39A 2W82A 3PFIA 1E9RA 3U6QA 3JR5A 1IN4A 3AL0C 3BXWA 1E9SA 2R44A 4GH9A 2XF3A 3K1JA 2LTUA 1OIZA 2XEPA 3CF6E 2KNVA 3DZDA 4IBBA 4MGKE 5A2QS 3GLIB 4B7FA 3HHWA 3F92A 2R46A 1N77A 4AG5A 5EXPA 8CATA 2OPFA 2C96A 3OTOM 4Z8XA 3HHYA 3SHFA 3FE3A 1TGUA 1PJIA 4X66M 2QPAA 3U5ZB 7CATA 4IBEA 2HL7A 4LJ5A 1FNNA 1NO1A 2ERCA 3AOGA 3J80S 1EE8A 5ITXA 2QSFX 1KSFX 3UGJA 1YLAA 3C9PA 4LF9M 1VEKA 4FD2A 2MH8A 1WIVA 2QCUA 1XHBA 2XZFA 3FUVA 2K9DA 5EP2A 4S12A 3NBXX 2R4JA 4B3RM 2LNHC 3I04M 1IY2A 1Z59A 2ZANA 3HHZA 4D81A 4L15A 1XMOM 4AKGA 4ANRA 3AFHA 4YHHM 1N75A 1YUBA 3L27A 1QYRA 3KOZE 1J7KA 1GL7A 4CIZA 1EIJA 2L09A 2DENA 4FW9A 3RE8A 3GLIA 3THGA 4UN2B 5KO3A 2CP8A 3WHLA 5ITUA 1NNJA 4JI8M 2C9OA 5IWAM 2CV2A 2NQ8C 5DNYA 2WZJA 1EFUB 2M60A 2BWEA 1DGGA 4GC9A 4DR5M 4AQYM 1QANA 3U6LA 3SBJA 1XWIA 3AOEC 4DV7M 3ZH9B 3CF0A 1HNXM 1WJ7A 3U5ZA 3B89A 3A42A 4NRVA 2C9CA 1I94M 3UK6A 3AKZA 1TTEA 4FWDA 4JN6A 1NY5A 3KSJA 2CV1A 3HU2A 2Z4SA 4IJEA 3H4MA 2DZOB 2L6OA 1NSFA 2YR0A 3CTWB 4Z6YA 4M9ZA 3FTEA 1NHGC 3HX3A 4LRTA 3FUXA 3ZQJA 1TF0B 4RF0A 2CV0A 4WURA 2ZAMA 3GRVA 3ILKA 3W67A 2OOBA 4DR2M 3E4RA 4AKHA 3T1YM 1GKIA 2JY6B 1C7YA 3KOXE 1WXQA 3A45A 3KS4A 3B7ZA 1IN7A 2FNAA 1NV8A 1QAMA 1ZMUA 3GLHA 2JNHA 3LVWA 4M0WA 1NJFA 3SHGB 2Z4RA 4EIWA 3VFDA 5FTLA 5JI3E 3GQ5A 1QDTA 2BWBA 5IT9S 3AJIB 3AV0A 5EXSA 2L4FA 2Y20A 4NSOB 1IFYA 4FCTA 3D8LA 3GPUA 4OX9M 1J09A 2VF7A 1TDZA 1DGBA 2D7EA 1JB0F 4LY6A 4P16A 2FE8A 4B3SM 2KHHA 3U6OA 1D0LA 4LZZA 2F5QA 3GLFE 3KVWA 3FYDA 1NNUC 4NXMM 2JWSA 2O25A 2KW0A 2MJ5B 2XFTA 1IM2A 2QNJA 4I81A 4OU7A 1G4AE 4HLQA 3SMPA 1F4IA 3IG8A 3GLGB 2ZTCA 2DWNA 3AOEA 3SC3A 1NJGA 4LFCM 4CGYB 1MU5A 3GLIE 2YFQA 4PCZA 1AIPC 2UUAM 3LCVB 1IY0A 2JY8A 3DOAA 3Q8XA 2G3QA 2KRKA 1D0KA 2MR9A 2L7HA 3TWLA 2H5XA 1OKSA 4RKUF 3MK6A 3UJNA 2C98A 3SATA 1R2YA 1G8PA 1Q3CA 2AHMA 3KP1E 4M9XA 2QP9X 1Y8GA 1PJTA 4DUYM 3TWMA 4I8OA 3TPZA 2RGHA 4QOZC 1N78A 1Q3BA 3QYEA 2ZAOA 1HT1E 4DV6M 1MJGM 3L28A 2F5OA 4PD2A 2DHRA 4GKKM 1QZEA 5FTJA 1L2CA 1G59A 3GLFB 2YQZA 5FTKA 1VEGA 1Z5AA 4REZA 2OOAA 1E94E 4PDGA 5C18A 3GLGA 3VDPA 1QAQA 5DFLA 5L8RF 1L8QA 5GKNA 5LMNM 3E9SA 1SXJA 4XGIA 2A5YB 3GLHE 1PGYA 2HHHM 2LVQD 4IIWA 1IN8A 4F2LA 4KODA 4OW0A 5DYGA 5ITQA 1VEJA 1IXSB 3R8FA 3GPYA 4MGZE 2K47A 3J7BA 4G4OA 1KFVA 4P17A 3KOYE 1XNRM 2X49A 1WGLA 4A3VB 4NOOB 1QQWA 2QQ8A 4IJFA 4L6V6 4NXNM 3U60B 1IQPA 1NVMA 3LW5F 1ZMVA 2Y21A 2DWLA 3C3EA 1Z5BA 2I7NA 2H1RA 2LVNC 1QAOA 4LJ8A 3PXGA 3SYKA 3WHKA 3MHVC 3GLFA 4AG6A 3GO8A 5H37D 3I4VA 4X62M 2DVWB 1OQYA 4DV3M 3SAVA 1BVSA 2DWZB 3D8BA 4L4UA 3UMMA 3KFUG 2KNAA 5EXTA 1UFZA 3IG5A 4DV0M 4DV4M 3HU1A 3CF2A 4LGYA 4XK8F 1TH4A 4B7HA 4DR1M 2P5TA 4LRSA 3JAMS 3FTFA 4JI0M 1WHCA 3GLHB 4LZJA 3T38A 3GQ3A 4L78A 3QAUA 1HNWM 3K9PA 2HAKA 1IXSA 1TH3A 1N36M 2QBYB 1OTRA 2CHGA 2R65A 4BLCA 2DAGA 2EKKA 1ZAEA 2L4EA 2WSCF 4LF5M 1OIPA 3NWLA 2KA6B 3HU3A 1MX0A 4G6ZA 4HL4A 4DV5M 2CE7A 2DKLA 5E6JA 5EXXA 1HQCA 3TQSA 1V92A 3GPXA 1R2ZA 3FUUA 2HWJA 1ZMWA 4JXJA 3V76A 4CHTB 3U60A 1G41A 2DNAA 5LMUM 4LJAA 5ITYA 4W5WA 4B7GA 3J27B 1E32A 2R18A 3J2PB 2QENA 5KPTA 3GLGE 3U6EA 1QDRA 3LQQA 4GHLA 3W0FA 1G71A 1C1KA 3MMPA 1GJTA 1SXJE 3QWLA 5C1BA 1R6BX 1HT2E 2CUZA 2JY5A 4AW4A 4YY3M 2XH9A 3FRIA 1IXRC 1V33A 2RRUA 2VF8A 3FUWA 4LJ6A 1WGNA 3J81S 2XFSA 2QBYA 3IECA 5KPZA 2D7HA 4R7GA 2F5PA 1IN5A 2MGWA 3TWKA 1SXJC 1ZQ9A 3BOSA 3PVSA 4GEWA 1TDHA 2OO9A 3PNVA 2N35A 4LJ9A 4DR6M 3B7QA 4NL4H 1L2DA 2R6FA 1I4WA 1Q02A 2LBCA 2Z3XA 1XC8A 4M9SA 3KW6A 2WSFF 2DXIA 2VDBB 4GITA 2J7NA 4AZFA 4X64M 2Y0TA 1GL6A 3I01M 2J7OA 4OVZA 3K92A 1VDDA 4JV5M 1OFHA 1HJPA 4IBCA 4XBOA 1SXJB 1VDLA 3L25A 4TUWA 2J5YA 3TE6A 3SAWA 1K3WA 1OFIA 3SARA 2UUCM 4LF7M 2QHOB 3SMSA 3HWSA 5FTMA 4BBAA 4FCVA 4LF4M 4JI1M 2DAMA 1OJLA 4FVMA 4DR4M 1OAIA 2VQFM 3GRYA 4IBJA 3LCUA 4GRIA 3HY5A 2JZ0A 4ZPXA 2CHVA 2EA0A 3A98B 3LMMA 5DYIA 3HGIA 3HJQA 4JI4M 3M6AA 2JP7A 2LH0A 1IBKM 4DV2M 1YSYA 1RU3A 3K2LA 4IBGA 4LFAM 3Q8GA 1TH2A 4PT5A 1W5TA 2G5GX 2C5RA 2EUCA 2LHGA 3PNYA 3C58A 1QUTA 1NHWC 2EKFA 1R5LA 3U6SA 3HZJA 1X37A 3RGSA 3SASA 5ITRA 1L1TA 5IREB 3CGWA 3FUTA 3RGPA 3A46A 4GC5A 1PM5A 3SFZA 1DV0A 4GHAA 3RFWA 2DAEA 1R7RA 3GRRA 2CRUA 4MGHA 1JR3E 2ZTDA 3KP0E 2JXNA 2FOIC 2HKJA 1P3QQ 4B3TM 3FYCA 3DFZA 2BJVA 2GNOA 1IN6A 1D0MA 3QYBA 4QOSA 3C3DA 1DGHB 1H6UA 2VIIA 2UXDM 3M0EA 4NRWA 2UU9M 3K9OA 4JI6M 5E26A 1FJGM 1T3TA 1LTMA 2LHCA 3FD9A 2GQFA 1TR8A 2QZ4A 4MH0E 4I4LA 1PJQA 5EJCA 3ZC7B 3VK7A 1PJJA 4JI7M 4LG2A 5EP4A 5ITTA 4K0KM 2DI0A 2K6BA 3EIEA 3T6PA 3MJ5A 2LWXA 1GLNA 2V1CA 1N33M 2JY7A 4HEOA 5FSWA 4G4NA 4MB7A 4GIPA 2DAIA 4D80A 3L2AA 2R45A 3B7NA 3SYLA 3DA1A 5KPRA 2ZM6M 1WR1B 2Z8YM 4G4RA 4JI2M 1DO0A 2KZSA 5JI2E 3KDSE 4KT0F 2DHYA 2E5LM 1NV9A 4QHTA 2XLJA 4CISA 2KRUA 4AI6A 1MN3A 3E46A 2CFOA 2X8AA 4IBKA 2KDLA 1YE9A 3FKEA 4QNMA 2UUBM 1HQYE 2EO2A 2FS1A 3T1HM 1K3XA 3W68A 4GKJM 1VG5A 4IBFA 3IHPA 3W0LB 3SAUA 1QZMA 1UM8A 2LVOC 2V6ZM 4B3MM 2UXCM 2L7IA 1DGHA 3U6DA 4F1IA 1L2BA 1GABA 1K82A 4ITQA 4WW0A 1XXHE 3KS8A 4GMQA 4LF8M 3FRHA 1A5TA 4LGMA 1IBMM 1Z6TA 3I4YA 2I7PA 1QVRA 2V1UA 2B3TA 2R4EA 3FTCA 5BPVA 2X4AA 4X65M 2APLA 2DZLA 1VQ1A 2BJWA 4D82A 3FTDA 4LJ7A 2D7GA 4OVZB 2ZBKB 2R0IA 5EP3A 3U61B 1NY6A 1SXJD 2LXEA 2KXEA 4NC6A 3B74A 1J5EM 3KOWE 4QNRA 2XSZA 4Y28F 2DWMA 2F4VM 5FLXS 2KZUA 4DR3M 3KXEC 3HJ8A 4MGYE 1LV7A 1JR3A 2O01F 3I51A 1ZV1A 3R9XB 2Q2EB 1Z5CA 4G4QA 2K0BX 2RGOA 5EP1A 4II7A 5FTNA 2EJSA 4IBIA 4L8RC 3E21A 2CWBA 1XXHB 3B9PA 4R3DA
chains in the Genus database with same CATH topology
2VQEM 1L1ZA 4M0DA 3GP1A 5BR8M 1IBLM 3LVVA 1DGFA 4KHPM 2YNMD 3L26A 3GPPA 4LFBM 4MM3B 1ORYB 3ZCBB 1GVNA 3T15A 2OQ4A 2DZNB 1IY1A 3NBIA 4RF1A 3U6PA 3U61A 4KO8A 3TL4X 5ITXE 2RKOA 1D2NA 4AKIA 2CEAA 3LQRA 5IZ7D 4RNAA 5KQDA 2Y0QA 4DV1M 2BNKA 3UZUA 2XZUA 4FWGA 1W5SA 3JR4A 3VLFB 1DO2A 4DR7M 1KYIA 4LJ4A 4BB9A 3HJSA 2G8LA 3GRUA 1XXHA 4B08A 2C99A 3K8ZA 2JA2A 3HHXA 4PDIA 2F5NA 4DUZM 1S3SA 4I5SA 3VK8A 2R62A 5EQTA 1N34M 4L16A 3VKHA 3VDUA 1N32M 4LCBA 3M7GA 2O5RA 5KQ8A 4NSRA 3HKPA 2F5SA 2FFJA 1JQJC 2HCBA 2KEBA 4IBDA 2XSZD 2Z7JA 3EIHA 2M5ZA 1XNQM 3GQ4A 2XGNA 3U6MA 4KLNA 4FCWA 2CHQA 3J7AS 4MGIE 1JR3D 1XMQM 1HNZM 1HR0M 4LF6M 4JYAM 4QHSA 3VKGA 5F3WA 3U6CA 2UXBM 1G3IA 3L29A 4JI3M 4JI5M 3KSXA 4FWHA 1IXZA 1Q39A 2W82A 3PFIA 1E9RA 3U6QA 3JR5A 1IN4A 3AL0C 1E9SA 4GH9A 2XF3A 3K1JA 2XEPA 3CF6E 3DZDA 4IBBA 4MGKE 5A2QS 3GLIB 4B7FA 3HHWA 2R46A 1N77A 4AG5A 5EXPA 8CATA 2OPFA 2C96A 3OTOM 4Z8XA 3HHYA 3SHFA 1TGUA 1PJIA 4X66M 2QPAA 3U5ZB 7CATA 4IBEA 2HL7A 4LJ5A 1FNNA 2ERCA 3J80S 3AOGA 5ITXA 1EE8A 1KSFX 3UGJA 4LF9M 4FD2A 2QCUA 1XHBA 2XZFA 3FUVA 5EP2A 4S12A 2R4JA 4B3RM 2LNHC 1IY2A 1Z59A 2ZANA 3HHZA 4D81A 4L15A 1XMOM 4AKGA 3AFHA 4YHHM 1N75A 1YUBA 3L27A 1QYRA 3KOZE 1J7KA 1GL7A 2L09A 4FW9A 3RE8A 3GLIA 3THGA 5KO3A 5ITUA 3WHLA 1NNJA 4JI8M 2C9OA 5IWAM 2CV2A 2NQ8C 5DNYA 2M60A 1DGGA 4GC9A 4DR5M 4AQYM 1QANA 3U6LA 3SBJA 1XWIA 3AOEC 4DV7M 3ZH9B 3CF0A 1HNXM 3U5ZA 3A42A 4NRVA 2C9CA 1I94M 3UK6A 3AKZA 4FWDA 4JN6A 1NY5A 3KSJA 2CV1A 3HU2A 2Z4SA 4IJEA 3H4MA 2DZOB 2L6OA 1NSFA 2YR0A 3CTWB 4Z6YA 4M9ZA 3FTEA 1NHGC 2CV0A 4LRTA 3FUXA 4RF0A 4WURA 2ZAMA 3GRVA 3ILKA 4DR2M 3E4RA 4AKHA 3T1YM 1GKIA 3KOXE 1WXQA 3A45A 3KS4A 1IN7A 2FNAA 1QAMA 3GLHA 4M0WA 3SHGB 3LVWA 4EIWA 1NJFA 5FTLA 2Z4RA 3VFDA 5JI3E 3GQ5A 5IT9S 3AJIB 3AV0A 5EXSA 2Y20A 4NSOB 4FCTA 3D8LA 3GPUA 4OX9M 1J09A 1TDZA 1DGBA 2D7EA 4LY6A 4P16A 2FE8A 4B3SM 3U6OA 4LZZA 2F5QA 3KVWA 3FYDA 1NNUC 4NXMM 2KW0A 2XFTA 1IM2A 4I81A 4OU7A 1G4AE 4HLQA 3SMPA 3IG8A 3GLGB 2DWNA 3AOEA 3SC3A 1NJGA 4LFCM 4CGYB 1MU5A 2YFQA 4PCZA 2UUAM 1IY0A 3DOAA 3Q8XA 2KRKA 3TWLA 2L7HA 3MK6A 3UJNA 2C98A 3SATA 1R2YA 1G8PA 1Q3CA 2AHMA 3KP1E 4M9XA 2QP9X 4DUYM 3TWMA 4I8OA 3TPZA 2RGHA 4QOZC 1N78A 1Q3BA 2ZAOA 1HT1E 4DV6M 3L28A 2F5OA 4PD2A 2DHRA 4GKKM 5FTJA 1L2CA 1G59A 3GLFB 2YQZA 5FTKA 1Z5AA 4REZA 1E94E 4PDGA 5C18A 3GLGA 3VDPA 1QAQA 1L8QA 5GKNA 5LMNM 3E9SA 1SXJA 4XGIA 2A5YB 2HHHM 4IIWA 1IN8A 5ITQA 4KODA 4OW0A 5DYGA 1IXSB 3R8FA 3GPYA 4MGZE 2K47A 3J7BA 4G4OA 1KFVA 1XNRM 3KOYE 2X49A 4A3VB 4NOOB 1QQWA 4IJFA 3U60B 4NXNM 1IQPA 1NVMA 2Y21A 2DWLA 1Z5BA 2I7NA 2H1RA 1QAOA 4LJ8A 3PXGA 3SYKA 3WHKA 3MHVC 3GLFA 4AG6A 3GO8A 5H37D 3I4VA 4X62M 2DVWB 4DV3M 3SAVA 2DWZB 3D8BA 4L4UA 3UMMA 3KFUG 5EXTA 3IG5A 4DV0M 4DV4M 3HU1A 3CF2A 4LGYA 4B7HA 1TH4A 4DR1M 3FTFA 2P5TA 4LRSA 3JAMS 4JI0M 3GLHB 4LZJA 3T38A 3GQ3A 4L78A 3QAUA 1HNWM 1TH3A 1N36M 2QBYB 2CHGA 2R65A 4BLCA 1ZAEA 4LF5M 3NWLA 2KA6B 3HU3A 1MX0A 4G6ZA 4HL4A 4DV5M 2CE7A 5EXXA 5E6JA 1HQCA 3TQSA 3GPXA 1R2ZA 3FUUA 4JXJA 4CHTB 3U60A 1G41A 5LMUM 4LJAA 5ITYA 4W5WA 4B7GA 3J27B 1E32A 2R18A 3J2PB 2QENA 5KPTA 3U6EA 3LQQA 4GHLA 3W0FA 1C1KA 1SXJE 3QWLA 5C1BA 1R6BX 1HT2E 2CUZA 4AW4A 4YY3M 2XH9A 1IXRC 3FUWA 4LJ6A 3J81S 2XFSA 2QBYA 5KPZA 2D7HA 4R7GA 2F5PA 1IN5A 3TWKA 1SXJC 1ZQ9A 3BOSA 3PVSA 1TDHA 3PNVA 4LJ9A 4DR6M 4NL4H 1L2DA 1I4WA 2Z3XA 1XC8A 4M9SA 3KW6A 2DXIA 4GITA 2J7NA 4AZFA 4X64M 2Y0TA 1GL6A 2J7OA 4OVZA 3K92A 1VDDA 4JV5M 1OFHA 4IBCA 4XBOA 3L25A 1SXJB 4TUWA 3TE6A 3SAWA 1K3WA 1OFIA 3SARA 2UUCM 3SMSA 3HWSA 5FTMA 4BBAA 4FCVA 4LF4M 4JI1M 1OJLA 4FVMA 4DR4M 2VQFM 3GRYA 4IBJA 4GRIA 2EA0A 4ZPXA 2CHVA 3A98B 3LMMA 5DYIA 3HGIA 3HJQA 4JI4M 3M6AA 2LH0A 1IBKM 4DV2M 1YSYA 3K2LA 4IBGA 4LFAM 2C5RA 1TH2A 4PT5A 1W5TA 2G5GX 2EUCA 3PNYA 3C58A 3U6SA 1NHWC 1X37A 3RGSA 3SASA 5ITRA 1L1TA 5IREB 3FUTA 3RGPA 3A46A 4GC5A 1PM5A 3SFZA 4GHAA 3RFWA 1R7RA 3GRRA 4MGHA 3KP0E 2FOIC 2HKJA 4B3TM 3FYCA 3DFZA 2BJVA 1IN6A 4QOSA 1DGHB 1H6UA 2VIIA 2UXDM 3M0EA 4NRWA 2UU9M 1FJGM 4JI6M 5E26A 1T3TA 4MH0E 3FD9A 4LF7M 2QZ4A 3VK7A 1PJJA 4I4LA 5EJCA 3ZC7B 4JI7M 4K0KM 4LG2A 5EP4A 5ITTA 3EIEA 3MJ5A 2LWXA 1GLNA 2V1CA 1N33M 5FSWA 4G4NA 4MB7A 4GIPA 4D80A 3L2AA 2R45A 2ZM6M 3SYLA 3DA1A 5KPRA 4G4RA 4JI2M 1DO0A 2KZSA 5JI2E 3KDSE 2E5LM 4QHTA 2XLJA 4CISA 2KRUA 4AI6A 2CFOA 2X8AA 4IBKA 2UUBM 1YE9A 3FKEA 4QNMA 1HQYE 2EO2A 3T1HM 1K3XA 4GKJM 4IBFA 3W0LB 3SAUA 1QZMA 1UM8A 2V6ZM 4B3MM 2UXCM 2L7IA 1DGHA 3U6DA 1L2BA 1K82A 4ITQA 4WW0A 3KS8A 4GMQA 4LF8M 1IBMM 4LGMA 1Z6TA 3I4YA 2I7PA 1QVRA 2V1UA 2R4EA 3FTCA 5BPVA 2X4AA 4X65M 2BJWA 4D82A 3FTDA 4LJ7A 2D7GA 4OVZB 2ZBKB 5EP3A 3U61B 1NY6A 1SXJD 2LXEA 2KXEA 1J5EM 3KOWE 4QNRA 2XSZA 2DWMA 2F4VM 5FLXS 2KZUA 4DR3M 3KXEC 3HJ8A 4MGYE 1LV7A 1JR3A 3I51A 3R9XB 2Q2EB 1Z5CA 4G4QA 2RGOA 5EP1A 4II7A 5FTNA 4IBIA 4L8RC 1XXHB 3B9PA 4R3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORY B; 
#chains in the Genus database with same CATH topology
 2JZ1 A;  2VQE M;  1L1Z A;  4M0D A;  3GP1 A;  5BR8 M;  1SG9 A;  1IBL M;  3LVV A;  1GO5 A;  1DGF A;  4KHP M;  2YNM D;  3L26 A;  2KNZ A;  3GPP A;  2DAK A;  4LFB M;  1AUA A;  4MM3 B;  1ORY B;  3ZCB B;  1GVN A;  3T15 A;  2OQ4 A;  2DZN B;  1IY1 A;  1XB2 B;  3NBI A;  4RF1 A;  2WSE F;  1PRB A;  3U6P A;  3U61 A;  4KO8 A;  3TL4 X;  5ITX E;  2JUJ A;  2RKO A;  1OAO C;  1D2N A;  4AKI A;  2CEA A;  2LVA A;  3LQR A;  4RNA A;  5IZ7 D;  5KQD A;  2Y0Q A;  1V34 A;  1CUK A;  4DV1 M;  2BNK A;  3UZU A;  2XZU A;  4FWG A;  4R71 A;  1GJS A;  1W5S A;  3JR4 A;  2L2D A;  3VLF B;  1DO2 A;  4DR7 M;  1KYI A;  4LJ4 A;  4BB9 A;  3HJS A;  2LVP C;  2G8L A;  3GRU A;  1XXH A;  4CJ6 A;  4B08 A;  2C99 A;  3K8Z A;  1R4G A;  2JA2 A;  1PJS A;  3HHX A;  4PDI A;  2F5N A;  4DUZ M;  1S3S A;  4G3O A;  4I5S A;  3VK8 A;  2R62 A;  5EQT A;  1N34 M;  2MRO B;  4L16 A;  3VKH A;  3VDU A;  3BBZ A;  1N32 M;  1T6O A;  2FH0 A;  4LCB A;  3M7G A;  2O5R A;  5KQ8 A;  4NSR A;  3HKP A;  4Q7J A;  2F5S A;  2FFJ A;  1JQJ C;  2HCB A;  2KEB A;  4IBD A;  2XSZ D;  2Z7J A;  3EIH A;  2M5Z A;  3H4J A;  1XNQ M;  3GQ4 A;  2XGN A;  3U6M A;  4KLN A;  4FCW A;  2CHQ A;  3J7A S;  1QUS A;  4MGI E;  1JR3 D;  1XMQ M;  1HNZ M;  1HR0 M;  4WP2 A;  4LF6 M;  4JYA M;  4QHS A;  3VKG A;  5F3W A;  3U6C A;  2UXB M;  1G3I A;  3L29 A;  4JI3 M;  4DBG B;  3KSX A;  1T43 A;  4FWH A;  4JI5 M;  1IXZ A;  1Q39 A;  2W82 A;  3PFI A;  1E9R A;  3U6Q A;  3JR5 A;  1IN4 A;  3AL0 C;  3BXW A;  1E9S A;  2R44 A;  4GH9 A;  2XF3 A;  3K1J A;  2LTU A;  1OIZ A;  2XEP A;  3CF6 E;  2KNV A;  3DZD A;  4IBB A;  4MGK E;  5A2Q S;  3GLI B;  4B7F A;  3HHW A;  3F92 A;  2R46 A;  1N77 A;  4AG5 A;  5EXP A;  8CAT A;  2OPF A;  2C96 A;  3OTO M;  4Z8X A;  3HHY A;  3SHF A;  3FE3 A;  1TGU A;  1PJI A;  4X66 M;  2QPA A;  3U5Z B;  7CAT A;  4IBE A;  2HL7 A;  4LJ5 A;  1FNN A;  1NO1 A;  2ERC A;  3AOG A;  3J80 S;  1EE8 A;  5ITX A;  2QSF X;  1KSF X;  3UGJ A;  1YLA A;  3C9P A;  4LF9 M;  1VEK A;  4FD2 A;  2MH8 A;  1WIV A;  2QCU A;  1XHB A;  2XZF A;  3FUV A;  2K9D A;  5EP2 A;  4S12 A;  3NBX X;  2R4J A;  4B3R M;  2LNH C;  3I04 M;  1IY2 A;  1Z59 A;  2ZAN A;  3HHZ A;  4D81 A;  4L15 A;  1XMO M;  4AKG A;  4ANR A;  3AFH A;  4YHH M;  1N75 A;  1YUB A;  3L27 A;  1QYR A;  3KOZ E;  1J7K A;  1GL7 A;  4CIZ A;  1EIJ A;  2L09 A;  2DEN A;  4FW9 A;  3RE8 A;  3GLI A;  3THG A;  4UN2 B;  5KO3 A;  2CP8 A;  3WHL A;  5ITU A;  1NNJ A;  4JI8 M;  2C9O A;  5IWA M;  2CV2 A;  2NQ8 C;  5DNY A;  2WZJ A;  1EFU B;  2M60 A;  2BWE A;  1DGG A;  4GC9 A;  4DR5 M;  4AQY M;  1QAN A;  3U6L A;  3SBJ A;  1XWI A;  3AOE C;  4DV7 M;  3ZH9 B;  3CF0 A;  1HNX M;  1WJ7 A;  3U5Z A;  3B89 A;  3A42 A;  4NRV A;  2C9C A;  1I94 M;  3UK6 A;  3AKZ A;  1TTE A;  4FWD A;  4JN6 A;  1NY5 A;  3KSJ A;  2CV1 A;  3HU2 A;  2Z4S A;  4IJE A;  3H4M A;  2DZO B;  2L6O A;  1NSF A;  2YR0 A;  3CTW B;  4Z6Y A;  4M9Z A;  3FTE A;  1NHG C;  3HX3 A;  4LRT A;  3FUX A;  3ZQJ A;  1TF0 B;  4RF0 A;  2CV0 A;  4WUR A;  2ZAM A;  3GRV A;  3ILK A;  3W67 A;  2OOB A;  4DR2 M;  3E4R A;  4AKH A;  3T1Y M;  1GKI A;  2JY6 B;  1C7Y A;  3KOX E;  1WXQ A;  3A45 A;  3KS4 A;  3B7Z A;  1IN7 A;  2FNA A;  1NV8 A;  1QAM A;  1ZMU A;  3GLH A;  2JNH A;  3LVW A;  4M0W A;  1NJF A;  3SHG B;  2Z4R A;  4EIW A;  3VFD A;  5FTL A;  5JI3 E;  3GQ5 A;  1QDT A;  2BWB A;  5IT9 S;  3AJI B;  3AV0 A;  5EXS A;  2L4F A;  2Y20 A;  4NSO B;  1IFY A;  4FCT A;  3D8L A;  3GPU A;  4OX9 M;  1J09 A;  2VF7 A;  1TDZ A;  1DGB A;  2D7E A;  1JB0 F;  4LY6 A;  4P16 A;  2FE8 A;  4B3S M;  2KHH A;  3U6O A;  1D0L A;  4LZZ A;  2F5Q A;  3GLF E;  3KVW A;  3FYD A;  1NNU C;  4NXM M;  2JWS A;  2O25 A;  2KW0 A;  2MJ5 B;  2XFT A;  1IM2 A;  2QNJ A;  4I81 A;  4OU7 A;  1G4A E;  4HLQ A;  3SMP A;  1F4I A;  3IG8 A;  3GLG B;  2ZTC A;  2DWN A;  3AOE A;  3SC3 A;  1NJG A;  4LFC M;  4CGY B;  1MU5 A;  3GLI E;  2YFQ A;  4PCZ A;  1AIP C;  2UUA M;  3LCV B;  1IY0 A;  2JY8 A;  3DOA A;  3Q8X A;  2G3Q A;  2KRK A;  1D0K A;  2MR9 A;  2L7H A;  3TWL A;  2H5X A;  1OKS A;  4RKU F;  3MK6 A;  3UJN A;  2C98 A;  3SAT A;  1R2Y A;  1G8P A;  1Q3C A;  2AHM A;  3KP1 E;  4M9X A;  2QP9 X;  1Y8G A;  1PJT A;  4DUY M;  3TWM A;  4I8O A;  3TPZ A;  2RGH A;  4QOZ C;  1N78 A;  1Q3B A;  3QYE A;  2ZAO A;  1HT1 E;  4DV6 M;  1MJG M;  3L28 A;  2F5O A;  4PD2 A;  2DHR A;  4GKK M;  1QZE A;  5FTJ A;  1L2C A;  1G59 A;  3GLF B;  2YQZ A;  5FTK A;  1VEG A;  1Z5A A;  4REZ A;  2OOA A;  1E94 E;  4PDG A;  5C18 A;  3GLG A;  3VDP A;  1QAQ A;  5DFL A;  5L8R F;  1L8Q A;  5GKN A;  5LMN M;  3E9S A;  1SXJ A;  4XGI A;  2A5Y B;  3GLH E;  1PGY A;  2HHH M;  2LVQ D;  4IIW A;  1IN8 A;  4F2L A;  4KOD A;  4OW0 A;  5DYG A;  5ITQ A;  1VEJ A;  1IXS B;  3R8F A;  3GPY A;  4MGZ E;  2K47 A;  3J7B A;  4G4O A;  1KFV A;  4P17 A;  3KOY E;  1XNR M;  2X49 A;  1WGL A;  4A3V B;  4NOO B;  1QQW A;  2QQ8 A;  4IJF A;  4L6V 6;  4NXN M;  3U60 B;  1IQP A;  1NVM A;  3LW5 F;  1ZMV A;  2Y21 A;  2DWL A;  3C3E A;  1Z5B A;  2I7N A;  2H1R A;  2LVN C;  1QAO A;  4LJ8 A;  3PXG A;  3SYK A;  3WHK A;  3MHV C;  3GLF A;  4AG6 A;  3GO8 A;  5H37 D;  3I4V A;  4X62 M;  2DVW B;  1OQY A;  4DV3 M;  3SAV A;  1BVS A;  2DWZ B;  3D8B A;  4L4U A;  3UMM A;  3KFU G;  2KNA A;  5EXT A;  1UFZ A;  3IG5 A;  4DV0 M;  4DV4 M;  3HU1 A;  3CF2 A;  4LGY A;  4XK8 F;  1TH4 A;  4B7H A;  4DR1 M;  2P5T A;  4LRS A;  3JAM S;  3FTF A;  4JI0 M;  1WHC A;  3GLH B;  4LZJ A;  3T38 A;  3GQ3 A;  4L78 A;  3QAU A;  1HNW M;  3K9P A;  2HAK A;  1IXS A;  1TH3 A;  1N36 M;  2QBY B;  1OTR A;  2CHG A;  2R65 A;  4BLC A;  2DAG A;  2EKK A;  1ZAE A;  2L4E A;  2WSC F;  4LF5 M;  1OIP A;  3NWL A;  2KA6 B;  3HU3 A;  1MX0 A;  4G6Z A;  4HL4 A;  4DV5 M;  2CE7 A;  2DKL A;  5E6J A;  5EXX A;  1HQC A;  3TQS A;  1V92 A;  3GPX A;  1R2Z A;  3FUU A;  2HWJ A;  1ZMW A;  4JXJ A;  3V76 A;  4CHT B;  3U60 A;  1G41 A;  2DNA A;  5LMU M;  4LJA A;  5ITY A;  4W5W A;  4B7G A;  3J27 B;  1E32 A;  2R18 A;  3J2P B;  2QEN A;  5KPT A;  3GLG E;  3U6E A;  1QDR A;  3LQQ A;  4GHL A;  3W0F A;  1G71 A;  1C1K A;  3MMP A;  1GJT A;  1SXJ E;  3QWL A;  5C1B A;  1R6B X;  1HT2 E;  2CUZ A;  2JY5 A;  4AW4 A;  4YY3 M;  2XH9 A;  3FRI A;  1IXR C;  1V33 A;  2RRU A;  2VF8 A;  3FUW A;  4LJ6 A;  1WGN A;  3J81 S;  2XFS A;  2QBY A;  3IEC A;  5KPZ A;  2D7H A;  4R7G A;  2F5P A;  1IN5 A;  2MGW A;  3TWK A;  1SXJ C;  1ZQ9 A;  3BOS A;  3PVS A;  4GEW A;  1TDH A;  2OO9 A;  3PNV A;  2N35 A;  4LJ9 A;  4DR6 M;  3B7Q A;  4NL4 H;  1L2D A;  2R6F A;  1I4W A;  1Q02 A;  2LBC A;  2Z3X A;  1XC8 A;  4M9S A;  3KW6 A;  2WSF F;  2DXI A;  2VDB B;  4GIT A;  2J7N A;  4AZF A;  4X64 M;  2Y0T A;  1GL6 A;  3I01 M;  2J7O A;  4OVZ A;  3K92 A;  1VDD A;  4JV5 M;  1OFH A;  1HJP A;  4IBC A;  4XBO A;  1SXJ B;  1VDL A;  3L25 A;  4TUW A;  2J5Y A;  3TE6 A;  3SAW A;  1K3W A;  1OFI A;  3SAR A;  2UUC M;  4LF7 M;  2QHO B;  3SMS A;  3HWS A;  5FTM A;  4BBA A;  4FCV A;  4LF4 M;  4JI1 M;  2DAM A;  1OJL A;  4FVM A;  4DR4 M;  1OAI A;  2VQF M;  3GRY A;  4IBJ A;  3LCU A;  4GRI A;  3HY5 A;  2JZ0 A;  4ZPX A;  2CHV A;  2EA0 A;  3A98 B;  3LMM A;  5DYI A;  3HGI A;  3HJQ A;  4JI4 M;  3M6A A;  2JP7 A;  2LH0 A;  1IBK M;  4DV2 M;  1YSY A;  1RU3 A;  3K2L A;  4IBG A;  4LFA M;  3Q8G A;  1TH2 A;  4PT5 A;  1W5T A;  2G5G X;  2C5R A;  2EUC A;  2LHG A;  3PNY A;  3C58 A;  1QUT A;  1NHW C;  2EKF A;  1R5L A;  3U6S A;  3HZJ A;  1X37 A;  3RGS A;  3SAS A;  5ITR A;  1L1T A;  5IRE B;  3CGW A;  3FUT A;  3RGP A;  3A46 A;  4GC5 A;  1PM5 A;  3SFZ A;  1DV0 A;  4GHA A;  3RFW A;  2DAE A;  1R7R A;  3GRR A;  2CRU A;  4MGH A;  1JR3 E;  2ZTD A;  3KP0 E;  2JXN A;  2FOI C;  2HKJ A;  1P3Q Q;  4B3T M;  3FYC A;  3DFZ A;  2BJV A;  2GNO A;  1IN6 A;  1D0M A;  3QYB A;  4QOS A;  3C3D A;  1DGH B;  1H6U A;  2VII A;  2UXD M;  3M0E A;  4NRW A;  2UU9 M;  3K9O A;  4JI6 M;  5E26 A;  1FJG M;  1T3T A;  1LTM A;  2LHC A;  3FD9 A;  2GQF A;  1TR8 A;  2QZ4 A;  4MH0 E;  4I4L A;  1PJQ A;  5EJC A;  3ZC7 B;  3VK7 A;  1PJJ A;  4JI7 M;  4LG2 A;  5EP4 A;  5ITT A;  4K0K M;  2DI0 A;  2K6B A;  3EIE A;  3T6P A;  3MJ5 A;  2LWX A;  1GLN A;  2V1C A;  1N33 M;  2JY7 A;  4HEO A;  5FSW A;  4G4N A;  4MB7 A;  4GIP A;  2DAI A;  4D80 A;  3L2A A;  2R45 A;  3B7N A;  3SYL A;  3DA1 A;  5KPR A;  2ZM6 M;  1WR1 B;  2Z8Y M;  4G4R A;  4JI2 M;  1DO0 A;  2KZS A;  5JI2 E;  3KDS E;  4KT0 F;  2DHY A;  2E5L M;  1NV9 A;  4QHT A;  2XLJ A;  4CIS A;  2KRU A;  4AI6 A;  1MN3 A;  3E46 A;  2CFO A;  2X8A A;  4IBK A;  2KDL A;  1YE9 A;  3FKE A;  4QNM A;  2UUB M;  1HQY E;  2EO2 A;  2FS1 A;  3T1H M;  1K3X A;  3W68 A;  4GKJ M;  1VG5 A;  4IBF A;  3IHP A;  3W0L B;  3SAU A;  1QZM A;  1UM8 A;  2LVO C;  2V6Z M;  4B3M M;  2UXC M;  2L7I A;  1DGH A;  3U6D A;  4F1I A;  1L2B A;  1GAB A;  1K82 A;  4ITQ A;  4WW0 A;  1XXH E;  3KS8 A;  4GMQ A;  4LF8 M;  3FRH A;  1A5T A;  4LGM A;  1IBM M;  1Z6T A;  3I4Y A;  2I7P A;  1QVR A;  2V1U A;  2B3T A;  2R4E A;  3FTC A;  5BPV A;  2X4A A;  4X65 M;  2APL A;  2DZL A;  1VQ1 A;  2BJW A;  4D82 A;  3FTD A;  4LJ7 A;  2D7G A;  4OVZ B;  2ZBK B;  2R0I A;  5EP3 A;  3U61 B;  1NY6 A;  1SXJ D;  2LXE A;  2KXE A;  4NC6 A;  3B74 A;  1J5E M;  3KOW E;  4QNR A;  2XSZ A;  4Y28 F;  2DWM A;  2F4V M;  5FLX S;  2KZU A;  4DR3 M;  3KXE C;  3HJ8 A;  4MGY E;  1LV7 A;  1JR3 A;  2O01 F;  3I51 A;  1ZV1 A;  3R9X B;  2Q2E B;  1Z5C A;  4G4Q A;  2K0B X;  2RGO A;  5EP1 A;  4II7 A;  5FTN A;  2EJS A;  4IBI A;  4L8R C;  3E21 A;  2CWB A;  1XXH B;  3B9P A;  4R3D A; 
#chains in the Genus database with same CATH homology
 2VQE M;  1L1Z A;  4M0D A;  3GP1 A;  5BR8 M;  1IBL M;  3LVV A;  1DGF A;  4KHP M;  2YNM D;  3L26 A;  3GPP A;  4LFB M;  4MM3 B;  1ORY B;  3ZCB B;  1GVN A;  3T15 A;  2OQ4 A;  2DZN B;  1IY1 A;  3NBI A;  4RF1 A;  3U6P A;  3U61 A;  4KO8 A;  3TL4 X;  5ITX E;  2RKO A;  1D2N A;  4AKI A;  2CEA A;  3LQR A;  5IZ7 D;  4RNA A;  5KQD A;  2Y0Q A;  4DV1 M;  2BNK A;  3UZU A;  2XZU A;  4FWG A;  1W5S A;  3JR4 A;  3VLF B;  1DO2 A;  4DR7 M;  1KYI A;  4LJ4 A;  4BB9 A;  3HJS A;  2G8L A;  3GRU A;  1XXH A;  4B08 A;  2C99 A;  3K8Z A;  2JA2 A;  3HHX A;  4PDI A;  2F5N A;  4DUZ M;  1S3S A;  4I5S A;  3VK8 A;  2R62 A;  5EQT A;  1N34 M;  4L16 A;  3VKH A;  3VDU A;  1N32 M;  4LCB A;  3M7G A;  2O5R A;  5KQ8 A;  4NSR A;  3HKP A;  2F5S A;  2FFJ A;  1JQJ C;  2HCB A;  2KEB A;  4IBD A;  2XSZ D;  2Z7J A;  3EIH A;  2M5Z A;  1XNQ M;  3GQ4 A;  2XGN A;  3U6M A;  4KLN A;  4FCW A;  2CHQ A;  3J7A S;  4MGI E;  1JR3 D;  1XMQ M;  1HNZ M;  1HR0 M;  4LF6 M;  4JYA M;  4QHS A;  3VKG A;  5F3W A;  3U6C A;  2UXB M;  1G3I A;  3L29 A;  4JI3 M;  4JI5 M;  3KSX A;  4FWH A;  1IXZ A;  1Q39 A;  2W82 A;  3PFI A;  1E9R A;  3U6Q A;  3JR5 A;  1IN4 A;  3AL0 C;  1E9S A;  4GH9 A;  2XF3 A;  3K1J A;  2XEP A;  3CF6 E;  3DZD A;  4IBB A;  4MGK E;  5A2Q S;  3GLI B;  4B7F A;  3HHW A;  2R46 A;  1N77 A;  4AG5 A;  5EXP A;  8CAT A;  2OPF A;  2C96 A;  3OTO M;  4Z8X A;  3HHY A;  3SHF A;  1TGU A;  1PJI A;  4X66 M;  2QPA A;  3U5Z B;  7CAT A;  4IBE A;  2HL7 A;  4LJ5 A;  1FNN A;  2ERC A;  3J80 S;  3AOG A;  5ITX A;  1EE8 A;  1KSF X;  3UGJ A;  4LF9 M;  4FD2 A;  2QCU A;  1XHB A;  2XZF A;  3FUV A;  5EP2 A;  4S12 A;  2R4J A;  4B3R M;  2LNH C;  1IY2 A;  1Z59 A;  2ZAN A;  3HHZ A;  4D81 A;  4L15 A;  1XMO M;  4AKG A;  3AFH A;  4YHH M;  1N75 A;  1YUB A;  3L27 A;  1QYR A;  3KOZ E;  1J7K A;  1GL7 A;  2L09 A;  4FW9 A;  3RE8 A;  3GLI A;  3THG A;  5KO3 A;  5ITU A;  3WHL A;  1NNJ A;  4JI8 M;  2C9O A;  5IWA M;  2CV2 A;  2NQ8 C;  5DNY A;  2M60 A;  1DGG A;  4GC9 A;  4DR5 M;  4AQY M;  1QAN A;  3U6L A;  3SBJ A;  1XWI A;  3AOE C;  4DV7 M;  3ZH9 B;  3CF0 A;  1HNX M;  3U5Z A;  3A42 A;  4NRV A;  2C9C A;  1I94 M;  3UK6 A;  3AKZ A;  4FWD A;  4JN6 A;  1NY5 A;  3KSJ A;  2CV1 A;  3HU2 A;  2Z4S A;  4IJE A;  3H4M A;  2DZO B;  2L6O A;  1NSF A;  2YR0 A;  3CTW B;  4Z6Y A;  4M9Z A;  3FTE A;  1NHG C;  2CV0 A;  4LRT A;  3FUX A;  4RF0 A;  4WUR A;  2ZAM A;  3GRV A;  3ILK A;  4DR2 M;  3E4R A;  4AKH A;  3T1Y M;  1GKI A;  3KOX E;  1WXQ A;  3A45 A;  3KS4 A;  1IN7 A;  2FNA A;  1QAM A;  3GLH A;  4M0W A;  3SHG B;  3LVW A;  4EIW A;  1NJF A;  5FTL A;  2Z4R A;  3VFD A;  5JI3 E;  3GQ5 A;  5IT9 S;  3AJI B;  3AV0 A;  5EXS A;  2Y20 A;  4NSO B;  4FCT A;  3D8L A;  3GPU A;  4OX9 M;  1J09 A;  1TDZ A;  1DGB A;  2D7E A;  4LY6 A;  4P16 A;  2FE8 A;  4B3S M;  3U6O A;  4LZZ A;  2F5Q A;  3KVW A;  3FYD A;  1NNU C;  4NXM M;  2KW0 A;  2XFT A;  1IM2 A;  4I81 A;  4OU7 A;  1G4A E;  4HLQ A;  3SMP A;  3IG8 A;  3GLG B;  2DWN A;  3AOE A;  3SC3 A;  1NJG A;  4LFC M;  4CGY B;  1MU5 A;  2YFQ A;  4PCZ A;  2UUA M;  1IY0 A;  3DOA A;  3Q8X A;  2KRK A;  3TWL A;  2L7H A;  3MK6 A;  3UJN A;  2C98 A;  3SAT A;  1R2Y A;  1G8P A;  1Q3C A;  2AHM A;  3KP1 E;  4M9X A;  2QP9 X;  4DUY M;  3TWM A;  4I8O A;  3TPZ A;  2RGH A;  4QOZ C;  1N78 A;  1Q3B A;  2ZAO A;  1HT1 E;  4DV6 M;  3L28 A;  2F5O A;  4PD2 A;  2DHR A;  4GKK M;  5FTJ A;  1L2C A;  1G59 A;  3GLF B;  2YQZ A;  5FTK A;  1Z5A A;  4REZ A;  1E94 E;  4PDG A;  5C18 A;  3GLG A;  3VDP A;  1QAQ A;  1L8Q A;  5GKN A;  5LMN M;  3E9S A;  1SXJ A;  4XGI A;  2A5Y B;  2HHH M;  4IIW A;  1IN8 A;  5ITQ A;  4KOD A;  4OW0 A;  5DYG A;  1IXS B;  3R8F A;  3GPY A;  4MGZ E;  2K47 A;  3J7B A;  4G4O A;  1KFV A;  1XNR M;  3KOY E;  2X49 A;  4A3V B;  4NOO B;  1QQW A;  4IJF A;  3U60 B;  4NXN M;  1IQP A;  1NVM A;  2Y21 A;  2DWL A;  1Z5B A;  2I7N A;  2H1R A;  1QAO A;  4LJ8 A;  3PXG A;  3SYK A;  3WHK A;  3MHV C;  3GLF A;  4AG6 A;  3GO8 A;  5H37 D;  3I4V A;  4X62 M;  2DVW B;  4DV3 M;  3SAV A;  2DWZ B;  3D8B A;  4L4U A;  3UMM A;  3KFU G;  5EXT A;  3IG5 A;  4DV0 M;  4DV4 M;  3HU1 A;  3CF2 A;  4LGY A;  4B7H A;  1TH4 A;  4DR1 M;  3FTF A;  2P5T A;  4LRS A;  3JAM S;  4JI0 M;  3GLH B;  4LZJ A;  3T38 A;  3GQ3 A;  4L78 A;  3QAU A;  1HNW M;  1TH3 A;  1N36 M;  2QBY B;  2CHG A;  2R65 A;  4BLC A;  1ZAE A;  4LF5 M;  3NWL A;  2KA6 B;  3HU3 A;  1MX0 A;  4G6Z A;  4HL4 A;  4DV5 M;  2CE7 A;  5EXX A;  5E6J A;  1HQC A;  3TQS A;  3GPX A;  1R2Z A;  3FUU A;  4JXJ A;  4CHT B;  3U60 A;  1G41 A;  5LMU M;  4LJA A;  5ITY A;  4W5W A;  4B7G A;  3J27 B;  1E32 A;  2R18 A;  3J2P B;  2QEN A;  5KPT A;  3U6E A;  3LQQ A;  4GHL A;  3W0F A;  1C1K A;  1SXJ E;  3QWL A;  5C1B A;  1R6B X;  1HT2 E;  2CUZ A;  4AW4 A;  4YY3 M;  2XH9 A;  1IXR C;  3FUW A;  4LJ6 A;  3J81 S;  2XFS A;  2QBY A;  5KPZ A;  2D7H A;  4R7G A;  2F5P A;  1IN5 A;  3TWK A;  1SXJ C;  1ZQ9 A;  3BOS A;  3PVS A;  1TDH A;  3PNV A;  4LJ9 A;  4DR6 M;  4NL4 H;  1L2D A;  1I4W A;  2Z3X A;  1XC8 A;  4M9S A;  3KW6 A;  2DXI A;  4GIT A;  2J7N A;  4AZF A;  4X64 M;  2Y0T A;  1GL6 A;  2J7O A;  4OVZ A;  3K92 A;  1VDD A;  4JV5 M;  1OFH A;  4IBC A;  4XBO A;  3L25 A;  1SXJ B;  4TUW A;  3TE6 A;  3SAW A;  1K3W A;  1OFI A;  3SAR A;  2UUC M;  3SMS A;  3HWS A;  5FTM A;  4BBA A;  4FCV A;  4LF4 M;  4JI1 M;  1OJL A;  4FVM A;  4DR4 M;  2VQF M;  3GRY A;  4IBJ A;  4GRI A;  2EA0 A;  4ZPX A;  2CHV A;  3A98 B;  3LMM A;  5DYI A;  3HGI A;  3HJQ A;  4JI4 M;  3M6A A;  2LH0 A;  1IBK M;  4DV2 M;  1YSY A;  3K2L A;  4IBG A;  4LFA M;  2C5R A;  1TH2 A;  4PT5 A;  1W5T A;  2G5G X;  2EUC A;  3PNY A;  3C58 A;  3U6S A;  1NHW C;  1X37 A;  3RGS A;  3SAS A;  5ITR A;  1L1T A;  5IRE B;  3FUT A;  3RGP A;  3A46 A;  4GC5 A;  1PM5 A;  3SFZ A;  4GHA A;  3RFW A;  1R7R A;  3GRR A;  4MGH A;  3KP0 E;  2FOI C;  2HKJ A;  4B3T M;  3FYC A;  3DFZ A;  2BJV A;  1IN6 A;  4QOS A;  1DGH B;  1H6U A;  2VII A;  2UXD M;  3M0E A;  4NRW A;  2UU9 M;  1FJG M;  4JI6 M;  5E26 A;  1T3T A;  4MH0 E;  3FD9 A;  4LF7 M;  2QZ4 A;  3VK7 A;  1PJJ A;  4I4L A;  5EJC A;  3ZC7 B;  4JI7 M;  4K0K M;  4LG2 A;  5EP4 A;  5ITT A;  3EIE A;  3MJ5 A;  2LWX A;  1GLN A;  2V1C A;  1N33 M;  5FSW A;  4G4N A;  4MB7 A;  4GIP A;  4D80 A;  3L2A A;  2R45 A;  2ZM6 M;  3SYL A;  3DA1 A;  5KPR A;  4G4R A;  4JI2 M;  1DO0 A;  2KZS A;  5JI2 E;  3KDS E;  2E5L M;  4QHT A;  2XLJ A;  4CIS A;  2KRU A;  4AI6 A;  2CFO A;  2X8A A;  4IBK A;  2UUB M;  1YE9 A;  3FKE A;  4QNM A;  1HQY E;  2EO2 A;  3T1H M;  1K3X A;  4GKJ M;  4IBF A;  3W0L B;  3SAU A;  1QZM A;  1UM8 A;  2V6Z M;  4B3M M;  2UXC M;  2L7I A;  1DGH A;  3U6D A;  1L2B A;  1K82 A;  4ITQ A;  4WW0 A;  3KS8 A;  4GMQ A;  4LF8 M;  1IBM M;  4LGM A;  1Z6T A;  3I4Y A;  2I7P A;  1QVR A;  2V1U A;  2R4E A;  3FTC A;  5BPV A;  2X4A A;  4X65 M;  2BJW A;  4D82 A;  3FTD A;  4LJ7 A;  2D7G A;  4OVZ B;  2ZBK B;  5EP3 A;  3U61 B;  1NY6 A;  1SXJ D;  2LXE A;  2KXE A;  1J5E M;  3KOW E;  4QNR A;  2XSZ A;  2DWM A;  2F4V M;  5FLX S;  2KZU A;  4DR3 M;  3KXE C;  3HJ8 A;  4MGY E;  1LV7 A;  1JR3 A;  3I51 A;  3R9X B;  2Q2E B;  1Z5C A;  4G4Q A;  2RGO A;  5EP1 A;  4II7 A;  5FTN A;  4IBI A;  4L8R C;  1XXH B;  3B9P A;  4R3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...