3HHYA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
256
Chain Sequence
b'ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
molecule tags Oxidoreductase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
total genus 70
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhyA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hhyA02
1YKOA 3MI5M 2BUXA 3PCHA 3TH1A 2BUWA 1YKNA 1EOCA 1S9AA 3MI5A 3PCEM 3PCFA 2BUQA 2BUZA 2XSRA 3MV6A 4WHSD 1EOAA 3PCIA 3PCEA 2AZQA 4WHRB 3MV6M 3T67A 3PCIM 1YKOB 3PCLM 3PCDA 3PCMA 4WHPA 1EO2A 4ILTA 3PCJM 3PCLA 3PCBM 2BUMA 3LXVA 2BUTB 4WHPD 2BUZB 3HJSA 1EOCB 1YKKA 2BUQB 3PCGA 1YKPA 3PCHM 2BURA 2BUXB 3PCNA 3HHXA 2BUYB 5TD3A 3PCGM 1DLQA 3HKPA 3PCNM 3PCJA 1EO2B 2BUUA 3PCBA 1YKMB 3MV4A 3O5UA 4WHPB 3LXVM 4WHOB 3PCDM 1DLMA 3PCMM 2BUUB 3I4YA 1EO9B 2BV0A 4WHRF 3MV4M 2PCDA 3LKTM 3LMXA 3HJQA 4WHRA 1EOBA 3PCAM 1YKKB 3LKTA 3O6RA 1YKNB 3LMXM 1YKPB 3HHYA 3PCAA 1EOBB 3T63A 3MI1M 2BV0B 2BUMB 2BOYA 3MI1A 1TMXA 4ILVA 2PCDM 4WHOA 3HGIA 4WHQA 4WHSA 1YKLB 3PCCA 3I4VA 2XSUA 2BUYA 3PCKM 3MFLM 3I51A 1DMHA 2XSVA 3HJ8A 1EOAB 3PCFM 3T63M 3MFLA 2BURB 2BUWB 4WHOD 2BUTA 3N9TA 3O6JA 1EO9A 1YKLA 3PCCM 2BUVB 4WHQB 4WHSB 1YKMA 3T67M 3O32A 3PCKA 1DLTA 2BUVA
chains in the Genus database with same CATH superfamily
1PGYA 8CATA 4KLNA 1DO2A 1KSFX 4FCVA 4B7FA 3GLHE 3SBJA 2EUCA 3GLHA 2HAKA 1GLNA 4GH9A 2L2DA 1QUSA 1SXJC 3L25A 3SFZA 4PD2A 2OQ4A 4I8OA 1T3TA 2JZ1A 3NWLA 4LZJA 5E26A 1D0KA 4JI0M 1XXHA 1TDZA 2UXBM 1S9AA 4GC5A 4XK8F 3J80S 4B7GA 4AI6A 3ZCBB 1EOAA 2AZQA 4WHRB 3HHWA 3MV6M 1AIPC 2KA6B 4LJ8A 2DENA 2D7HA 5IREB 3B74A 3W0FA 3L26A 4JI4M 1IN4A 4MGKE 2JA2A 4D81A 2LWXA 3L27A 3SC3A 4FWDA 3KXEC 4I5SA 3A45A 1JR3D 1D0LA 1Q3CA 2OO9A 5FLXS 4DR5M 1K82A 2UUBM 3PCJM 2KRUA 3M6AA 2JY7A 3BOSA 1SXJD 3EIEA 4GEWA 4X64M 5C18A 2C9OA 5FTNA 2DWMA 3KOXE 2JY5A 4NXNM 2H5XA 5A2QS 3J81S 4L16A 1WIVA 4LZZA 1IM2A 3ZC7B 1QAMA 3KVWA 1R5LA 4DR1M 2RRUA 1K3XA 1YKPA 2BURA 3GQ4A 1IY0A 2ZTDA 2O25A 3VDUA 1DO0A 4GKJM 2ERCA 2K0BX 1OJLA 5C1BA 4LJ7A 4L4UA 4WURA 2L09A 3DA1A 2D7EA 4F1IA 1NY6A 2DXIA 5GKNA 3H4JA 3PCBA 4HL4A 3KP1E 2DHRA 4D82A 2BUUB 1SXJB 3IHPA 3U6OA 3TWKA 4WHRF 1NNUC 1GKIA 1PRBA 2Y20A 3KS8A 3MV4M 2QBYB 2JWSA 4L78A 3HY5A 3B89A 1EE8A 1OTRA 2LBCA 1GJTA 4G4OA 2UUAM 4M0WA 2CE7A 2QHOB 5EXSA 4B3SM 2LVQD 3AOEC 1GL7A 3GRVA 4RF0A 3FYDA 4LF4M 1C1KA 3HHYA 3SMSA 3T15A 4IJEA 1EOBB 1QAQA 5FTJA 5KQDA 4MGIE 5EXPA 2DAGA 2Q2EB 3THGA 4JI7M 3VK7A 2CHVA 4XGIA 4JI8M 4Q7JA 1VQ1A 1ZMWA 1TMXA 2LXEA 3GLGA 2L7HA 3QYBA 3CTWB 3I01M 4CIZA 5BPVA 3MK6A 3LCVB 1YKLB 2KHHA 3GLFA 2VQFM 3PCCA 1V92A 1IBKM 2QPAA 4AW4A 2XSUA 2LH0A 2NQ8C 3HU2A 4DR3M 3U6SA 1N75A 3E9SA 1BVSA 4G3OA 1DGFA 3LW5F 2JZ0A 2L7IA 3D8BA 2C5RA 4G6ZA 3PNYA 2C9CA 1R7RA 2WSEF 2BUWB 2KNAA 1GVNA 4AG5A 3TPZA 4DR7M 1G4AE 1X37A 1Q3BA 1XMQM 1QAOA 3GQ5A 5JI2E 3K8ZA 3N9TA 1ZAEA 4OU7A 1HNXM 2CV0A 1HT2E 3PCCM 2GQFA 4LGMA 3DZDA 3KOWE 4WHSB 4DR6M 1G71A 1DGGA 4YHHM 4FCWA 3J7BA 2VQEM 1PJJA 1IXSB 1LTMA 2BUVA 4CHTB 2ZTCA 4HEOA 2O01F 3CF2A 2R4EA 5EP2A 4W5WA 5ITUA 3U5ZA 1E9SA 3J2PB 3MI5M 1IY2A 2OOBA 3C3EA 4GHAA 3GLIB 1XC8A 3AOGA 3PVSA 2Y0QA 3M0EA 5EXTA 4NRWA 3HWSA 1YKNA 3TH1A 4R7GA 3MI5A 1OAOC 3BXWA 2YNMD 4JI5M 1ORYB 3VKGA 3PCEA 2M60A 3GP1A 2CV2A 1HQCA 5JI3E 4IBIA 4LFAM 4CJ6A 3GPXA 3E4RA 3SMPA 4LF6M 2DHYA 4IBEA 3PCMA 4DV0M 3AV0A 4M9XA 1QANA 5LMNM 4LJ9A 3U6DA 1R2ZA 3HU3A 4P17A 1N32M 3PCBM 2KEBA 2QSFX 3FUVA 2XLJA 1OIZA 3W67A 2BUTB 3E46A 3HX3A 1R6BX 1IFYA 4XBOA 5FTKA 2BUZB 3HJSA 4JYAM 2EKFA 2XH9A 1IBMM 3R8FA 1EOCB 1TTEA 3LQQA 2Z3XA 2BUQB 1EFUB 1PJQA 2R65A 2BUXB 4OW0A 5EP4A 4BLCA 2JY6B 2RKOA 2Y0TA 3HHXA 5TD3A 3AFHA 3CF0A 3MJ5A 3JAMS 3GO8A 2V1UA 3GRUA 2VF8A 3HKPA 2L4FA 3U6PA 3U6CA 3PCNM 5FSWA 3PCJA 2ZANA 4UN2B 3O5UA 2FFJA 4LCBA 3PCDM 2LVAA 2W82A 3D8LA 3I4YA 3LQRA 4D80A 1R2YA 2QP9X 3V76A 3U61A 1L2CA 2FNAA 2V6ZM 2HKJA 4JXJA 2CHQA 4JI6M 3FTEA 1IBLM 2PCDA 1FJGM 2DAEA 4AKHA 1RU3A 1NVMA 4L8RC 2JY8A 2K9DA 3WHLA 1YKKB 2H1RA 4X62M 1YKNB 3LKTA 1NV9A 4K0KM 3O6RA 3PCAA 4NL4H 2XFSA 5LMUM 3MI1M 1IQPA 3U61B 1QYRA 2CFOA 3RGSA 1HT1E 1OKSA 3VLFB 2R62A 3SAWA 3MI1A 2YQZA 4DBGB 1OIPA 5ITXE 4ZPXA 3K9OA 1HR0M 2J5YA 3GPYA 2MH8A 3L29A 1I4WA 4GIPA 1XWIA 4WHSA 2R0IA 3KP0E 2L6OA 4M0DA 4DUZM 3J7AS 2QNJA 3LMMA 3CGWA 5EQTA 1VEKA 3FTFA 1N77A 3HU1A 3UZUA 2WSFF 3GRYA 2JXNA 1IN7A 2JUJA 1DMHA 5IWAM 2DZNB 1G3IA 1MX0A 3HJ8A 4PCZA 1EOAB 3PCFM 3U6MA 1GJSA 3GLGE 2HL7A 1H6UA 3FUTA 3SHGB 3TE6A 1NNJA 4MM3B 1IY1A 2X4AA 2ZBKB 4DV7M 7CATA 2V1CA 4LJ6A 4OVZB 3U6LA 3T1YM 1EIJA 4WHOD 4QHSA 3UK6A 1QDTA 4G4RA 2G5GX 2LTUA 4WP2A 4RNAA 4Y28F 4B3MM 1L8QA 1E9RA 3T67M 2C98A 5DNYA 2CWBA 1UM8A 1WXQA 2BWBA 2QENA 4F2LA 1OQYA 3NBXX 5F3WA 3FTCA 1K3WA 2KXEA 4A3VB 1XHBA 2VDBB 5KPZA 2UUCM 1SG9A 3Q8GA 1I94M 1YKOA 4KO8A 1S3SA 2LHGA 3K9PA 3KOYE 4JV5M 2BUXA 3GRRA 5ITXA 3PCHA 1YLAA 1EOCA 3U60A 1QVRA 1L2BA 3A98B 3PCEM 3JR4A 4MB7A 3PCFA 2BUQA 2ZAOA 1WGNA 3GLFE 4DR4M 2BUZA 2UU9M 4WHSD 1E94E 1ZQ9A 3PCIA 4Z8XA 2CRUA 2HWJA 3U6QA 1G8PA 4YY3M 1NV8A 3AJIB 1TDHA 3KDSE 4LRTA 3UJNA 3A46A 3PCIM 1Z6TA 1V34A 3KW6A 1N78A 1YKOB 2CHGA 3UGJA 4DV1M 5H37D 4JI2M 3PCDA 1WHCA 4GMQA 4R71A 1ZV1A 2UXCM 4WHPA 4B3TM 4LF8M 2ZM6M 4ILTA 1IXRC 2DAMA 2A5YB 2QQ8A 3PCLA 1WGLA 1PJTA 3GQ3A 4LJAA 4X65M 2BUMA 3LXVA 4QNRA 5FTLA 4MGYE 1J5EM 3AOEA 1DGHB 1OFHA 2F5PA 2BJVA 4IBFA 5ITQA 1TGUA 3R9XB 1J7KA 4LRSA 4GHLA 2WZJA 1NO1A 2DWZB 4Z6YA 4DV5M 1L2DA 2R6FA 3Q8XA 4B08A 4LF7M 1YKKA 2XGNA 2YR0A 1Q02A 3TWLA 1V33A 4KT0F 1OFIA 4FVMA 3RE8A 2XZFA 1YE9A 5EXXA 2K47A 2HHHM 3B9PA 1OAIA 4MGHA 3QYEA 4KHPM 4HLQA 2X49A 1R4GA 3FYCA 2Z8YM 4CGYB 3UMMA 3MV4A 3FUXA 3GLGB 3PCMM 4WHPB 1WR1B 2XFTA 3K92A 2FH0A 4JN6A 1D0MA 5E6JA 4DR2M 2CUZA 2DZOB 5FTMA 2CP8A 1T6OA 3K1JA 3HJQA 2APLA 2MROB 2VF7A 2Z4SA 4PT5A 4R3DA 2Y21A 1EOBA 4WHRA 2XSZA 3W0LB 1GABA 1VEJA 1NJFA 1CUKA 4EIWA 4X66M 2K6BA 1N34M 3LMXM 3VK8A 2L4EA 4S12A 3U60B 2FOIC 3TWMA 1KYIA 4M9SA 5EJCA 5DFLA 3T63A 2BJWA 1Z5AA 2XSZD 1QZEA 3L2AA 3C58A 3OTOM 4G4NA 4DV6M 2RGHA 1IN8A 3PFIA 4IBDA 2XF3A 3FD9A 2LVNC 2DKLA 4L15A 2LVPC 3SAVA 3GLFB 4FWGA 3KS4A 3FKEA 1MU5A 2PCDM 4WHOA 3F92A 2CEAA 2KDLA 5DYGA 3RFWA 2F5OA 4DUYM 2BWEA 3WHKA 1G41A 2G8LA 2KNZA 1AUAA 3CF6E 2RGOA 3EIHA 3PCKM 1HJPA 3B7ZA 2OPFA 3QAUA 4JI3M 1C7YA 2EJSA 3MFLM 2JNHA 1ZMVA 1HNZM 5KPRA 3T63M 1SXJE 4PDGA 3U6EA 2FS1A 4II7A 3IG5A 4DV4M 2CV1A 3C9PA 3QWLA 4M9ZA 3T1HM 1NHGC 2C96A 4QHTA 2YFQA 1ZMUA 2X8AA 1GL6A 2HCBA 3DOAA 3M7GA 1QUTA 3O6JA 3KSJA 3K2LA 3B7NA 2G3QA 2BUVB 1XNRM 4PDIA 4WHQB 1QDRA 1A5TA 2R46A 2FE8A 3A42A 1NJGA 3PCKA 4LF5M 1PM5A 3LVWA 3NBIA 3C3DA 1DLTA 2D7GA 4NXMM 1D2NA 2WSCF 3HZJA 2KW0A 3SYKA 2DWLA 4IJFA 3ZQJA 4NC6A 4BBAA 1MN3A 4ITQA 3SYLA 4GC9A 1NSFA 3JR5A 1W5SA 1YUBA 3HHZA 1L1ZA 2BUWA 1J09A 4NSOB 2DZLA 2N35A 3SASA 4QOZC 4AZFA 4MH0E 4TUWA 1Z5BA 2VIIA 4B7HA 5KO3A 2XSRA 3MV6A 4LFCM 2M5ZA 5EP3A 3GLIA 2AHMA 3PNVA 5DYIA 1LV7A 4KODA 3GPUA 5IT9S 2BNKA 3T67A 3SAUA 2B3TA 1MJGM 3AKZA 1G59A 1IN6A 3PCLM 1IXSA 1QZMA 2R4JA 1Y8GA 1JB0F 3TL4X 3SATA 1HNWM 1EO2A 1JR3E 4NRVA 1IXZA 1Z5CA 1P3QQ 4IBGA 4IIWA 1PJSA 4I4LA 2I7PA 3B7QA 3RGPA 2MGWA 3J27B 3VFDA 1N33M 4WHPD 1PJIA 3FUUA 4QNMA 4RKUF 3LCUA 2KZUA 2MR9A 3PXGA 3PCGA 2I7NA 1Z59A 3PCHM 2MJ5B 3KOZE 5ITRA 2F5SA 4LGYA 5BR8M 3MHVC 3PCNA 5KPTA 1YSYA 1N36M 1Q39A 1WJ7A 1TR8A 1KFVA 4AQYM 2BUYB 3E21A 4WW0A 3PCGM 2KZSA 5KQ8A 4P16A 2QBYA 1DLQA 1SXJA 2UXDM 3FUWA 3ILKA 1EO2B 1IN5A 1VDDA 2Z7JA 4FWHA 2E5LM 2BUUA 2EKKA 4AG6A 1YKMB 4WHOB 3LXVM 2DNAA 4NSRA 4FCTA 1DLMA 4BB9A 2R45A 4DV2M 2KRKA 1XMOM 4B3RM 2KNVA 1EO9B 4MGZE 2F5QA 2LHCA 1UFZA 4CISA 2BV0A 3W68A 1QQWA 3LKTM 2F5NA 2OOAA 2DWNA 3LMXA 4LG2A 4FD2A 3AL0C 4LFBM 3T38A 1F4IA 3FE3A 4OVZA 1TF0B 3PCAM 4REZA 1E32A 3ZH9B 2O5RA 1YKPB 4JI1M 2F4VM 1JR3A 3L28A 1DGHA 2DVWB 1FNNA 5ITYA 3I04M 4I81A 3U5ZB 2BV0B 3KFUG 4NOOB 1NHWC 4ANRA 2BUMB 2BOYA 3SARA 1W5TA 2DAKA 2EA0A 1DV0A 4ILVA 4IBKA 1XXHE 5EP1A 2QCUA 3IECA 4LY6A 3HGIA 4GITA 2DI0A 4WHQA 1HQYE 3TQSA 3T6PA 4AKGA 2P5TA 3KSXA 2GNOA 2LNHC 3MMPA 3DFZA 3I4VA 3VKHA 4GRIA 2BUYA 2R44A 3I51A 4IBJA 1L1TA 2XSVA 2J7OA 3FTDA 3LVVA 2XZUA 1NY5A 5IZ7D 3SHFA 4LF9M 3MFLA 5ITTA 2LVOC 4LJ4A 2BURB 1VG5A 4L6V6 1XXHB 4IBBA 1VDLA 4G4QA 4AKIA 2Z4RA 2JP7A 1TH4A 2XEPA 4DV3M 2ZAMA 2C99A 3GPPA 2BUTA 4QOSA 3VDPA 4GKKM 3GLHB 5L8RF 1T43A 1TH3A 1XB2B 4RF1A 1VEGA 3IG8A 1JQJC 1DGBA 4IBCA 1EO9A 4OX9M 1XNQM 4LJ5A 1YKLA 1TH2A 3H4MA 2J7NA 3FRIA 2QZ4A 2DAIA 1GO5A 1YKMA 3O32A 2R18A 3BBZA 2EO2A 3FRHA 4FW9A 3GLIE
chains in the Genus database with same CATH topology
8CATA 4KLNA 1DO2A 1KSFX 4FCVA 4B7FA 3SBJA 2EUCA 3GLHA 1GLNA 4GH9A 1SXJC 3L25A 3SFZA 4PD2A 2OQ4A 4I8OA 1T3TA 3NWLA 4LZJA 5E26A 4JI0M 1XXHA 1TDZA 2UXBM 1S9AA 4GC5A 3J80S 4B7GA 4AI6A 3ZCBB 1EOAA 2AZQA 4WHRB 3HHWA 3MV6M 3L26A 2KA6B 4LJ8A 5IREB 2D7HA 3W0FA 4JI4M 1IN4A 4MGKE 2JA2A 4D81A 2LWXA 3L27A 3SC3A 4FWDA 3KXEC 4I5SA 3A45A 1JR3D 1Q3CA 5FLXS 4DR5M 1K82A 1IBMM 2UUBM 3PCJM 2KRUA 3M6AA 3BOSA 1SXJD 3EIEA 4X64M 5C18A 2C9OA 5FTNA 2DWMA 3KOXE 4NXNM 5A2QS 3J81S 4L16A 4LZZA 1IM2A 3ZC7B 1QAMA 3KVWA 4DR1M 1K3XA 1YKPA 2BURA 3GQ4A 1IY0A 3VDUA 1DO0A 4GKJM 2ERCA 1OJLA 5C1BA 4LJ7A 4L4UA 4WURA 2L09A 3DA1A 2D7EA 1NY6A 2DXIA 5GKNA 3PCBA 4HL4A 3KP1E 2DHRA 4D82A 2BUUB 1SXJB 3U6OA 3TWKA 4WHRF 1NNUC 1GKIA 2Y20A 3MV4M 3KS8A 2QBYB 4L78A 1EE8A 4G4OA 2UUAM 4M0WA 2CE7A 5EXSA 4B3SM 3AOEC 1GL7A 3GRVA 4RF0A 3FYDA 4LF4M 1C1KA 3HHYA 3SMSA 3T15A 4IJEA 1EOBB 1QAQA 5FTJA 5KQDA 4MGIE 5EXPA 2Q2EB 3THGA 4JI7M 3VK7A 2CHVA 4XGIA 4JI8M 1TMXA 2LXEA 3GLGA 2L7HA 3CTWB 5BPVA 3MK6A 1YKLB 3GLFA 2VQFM 3PCCA 1IBKM 2QPAA 4AW4A 2XSUA 2LH0A 2NQ8C 3HU2A 4DR3M 3U6SA 1N75A 3E9SA 1DGFA 2L7IA 3D8BA 2C5RA 4G6ZA 3PNYA 2C9CA 1R7RA 2BUWB 1GVNA 4AG5A 3TPZA 4DR7M 1G4AE 1X37A 1Q3BA 1XMQM 1QAOA 3GQ5A 5JI2E 3K8ZA 3N9TA 1ZAEA 4OU7A 1HNXM 1HT2E 3PCCM 4LGMA 3DZDA 3KOWE 4WHSB 4DR6M 1DGGA 4YHHM 4FCWA 3J7BA 2VQEM 1PJJA 1IXSB 2BUVA 4CHTB 3CF2A 2R4EA 5EP2A 4W5WA 5ITUA 3U5ZA 1E9SA 3J2PB 3MI5M 1IY2A 4GHAA 3GLIB 1XC8A 3AOGA 3PVSA 2Y0QA 3M0EA 5EXTA 4NRWA 3HWSA 1YKNA 3TH1A 4R7GA 3MI5A 2YNMD 4JI5M 1ORYB 3VKGA 3PCEA 2M60A 3GP1A 2CV2A 1HQCA 5JI3E 4IBIA 4LFAM 3GPXA 3E4RA 3SMPA 4LF6M 3PCMA 4IBEA 4DV0M 3AV0A 4M9XA 1QANA 5LMNM 4LJ9A 3U6DA 1R2ZA 3HU3A 1N32M 3PCBM 2KEBA 3FUVA 2XLJA 2BUTB 1R6BX 4XBOA 5FTKA 2BUZB 3HJSA 4JYAM 2XH9A 1EOCB 2BUQB 3R8FA 3LQQA 2Z3XA 2R65A 2BUXB 4OW0A 5EP4A 4BLCA 2RKOA 2Y0TA 3HHXA 5TD3A 3AFHA 3CF0A 3MJ5A 3JAMS 3GO8A 2V1UA 3GRUA 3HKPA 3U6PA 3U6CA 3PCNM 5FSWA 3PCJA 2ZANA 3O5UA 2FFJA 4LCBA 3PCDM 2W82A 3D8LA 3I4YA 3LQRA 4D80A 1R2YA 2QP9X 3U61A 1L2CA 4JI6M 2FNAA 2V6ZM 2HKJA 4JXJA 2CHQA 3FTEA 2PCDA 1IBLM 1FJGM 4AKHA 1NVMA 4L8RC 3WHLA 1YKKB 3LKTA 2H1RA 4X62M 1YKNB 3O6RA 4K0KM 3PCAA 4NL4H 2XFSA 5LMUM 3MI1M 1IQPA 3U61B 1QYRA 2CFOA 3RGSA 1HT1E 3VLFB 2R62A 3SAWA 3MI1A 2YQZA 5ITXE 4ZPXA 1HR0M 3GPYA 3L29A 4GIPA 1I4WA 4WHSA 1XWIA 3KP0E 4M0DA 2L6OA 4DUZM 3J7AS 5EQTA 3LMMA 3FTFA 1N77A 3HU1A 3UZUA 3GRYA 1IN7A 1DMHA 5IWAM 2DZNB 1G3IA 1MX0A 3HJ8A 4PCZA 1EOAB 3PCFM 3U6MA 2HL7A 1H6UA 3FUTA 3SHGB 3TE6A 1NNJA 4MM3B 1IY1A 2X4AA 2ZBKB 4DV7M 7CATA 2V1CA 4LJ6A 4OVZB 3U6LA 3T1YM 4WHOD 4QHSA 3UK6A 4G4RA 2G5GX 4RNAA 4B3MM 1L8QA 1E9RA 3T67M 2C98A 5DNYA 1UM8A 1WXQA 2QENA 5F3WA 1K3WA 3FTCA 2UUCM 2KXEA 4A3VB 1XHBA 5KPZA 1I94M 1YKOA 4KO8A 1S3SA 3KOYE 4JV5M 2BUXA 3GRRA 5ITXA 3PCHA 1EOCA 3U60A 1QVRA 1L2BA 3A98B 3PCEM 3JR4A 4MB7A 3PCFA 2BUQA 2ZAOA 2BUZA 4DR4M 2UU9M 4WHSD 1E94E 1ZQ9A 3PCIA 4Z8XA 3U6QA 1G8PA 4YY3M 3AJIB 4LRTA 1TDHA 3KDSE 3UJNA 3A46A 3PCIM 1Z6TA 3KW6A 1N78A 1YKOB 2CHGA 3UGJA 4DV1M 5H37D 4JI2M 3PCDA 4GMQA 2UXCM 4WHPA 4B3TM 4LF8M 2ZM6M 4ILTA 1IXRC 2A5YB 3PCLA 3GQ3A 4LJAA 4X65M 2BUMA 3LXVA 4QNRA 5FTLA 4MGYE 1J5EM 3AOEA 1DGHB 1OFHA 2F5PA 2BJVA 4IBFA 5ITQA 1TGUA 3R9XB 1J7KA 4LRSA 4GHLA 4Z6YA 2DWZB 4DV5M 1L2DA 1YKKA 4B08A 3Q8XA 4LF7M 2XGNA 2YR0A 3TWLA 1OFIA 4FVMA 3RE8A 2XZFA 1YE9A 5EXXA 2K47A 2HHHM 3B9PA 4MGHA 4KHPM 4HLQA 2X49A 3FYCA 4CGYB 3UMMA 3MV4A 4WHPB 3FUXA 3GLGB 3PCMM 2XFTA 3K92A 4JN6A 5E6JA 4DR2M 2CUZA 2DZOB 5FTMA 4R3DA 3K1JA 3HJQA 2Z4SA 4PT5A 4WHRA 1EOBA 2Y21A 2XSZA 3W0LB 1NJFA 4EIWA 4X66M 1N34M 3LMXM 3VK8A 4S12A 3U60B 2FOIC 3TWMA 1KYIA 4M9SA 5EJCA 3T63A 2BJWA 1Z5AA 2XSZD 3L2AA 3C58A 3OTOM 4G4NA 4DV6M 2RGHA 1IN8A 3PFIA 4IBDA 2XF3A 3FD9A 4L15A 3SAVA 3GLFB 4FWGA 3KS4A 3FKEA 1MU5A 2PCDM 4WHOA 2CEAA 3RFWA 5DYGA 2F5OA 4DUYM 3WHKA 1G41A 2G8LA 3CF6E 2RGOA 3EIHA 3PCKM 2OPFA 3QAUA 4JI3M 3MFLM 1HNZM 5KPRA 3T63M 1SXJE 4PDGA 3U6EA 4II7A 3IG5A 4DV4M 2CV1A 3QWLA 4M9ZA 3T1HM 1NHGC 2C96A 4QHTA 2YFQA 2X8AA 1GL6A 2HCBA 3DOAA 3M7GA 3O6JA 3KSJA 3K2LA 2BUVB 1XNRM 4PDIA 4WHQB 2FE8A 2R46A 3A42A 1NJGA 3PCKA 4LF5M 1PM5A 3LVWA 3NBIA 1DLTA 2D7GA 4NXMM 1D2NA 3SYKA 2KW0A 2DWLA 4IJFA 4BBAA 4ITQA 3SYLA 4GC9A 1NSFA 3JR5A 1W5SA 1YUBA 3HHZA 1L1ZA 2BUWA 1J09A 4NSOB 4TUWA 3SASA 4QOZC 4AZFA 4MH0E 1Z5BA 2VIIA 4B7HA 5KO3A 2XSRA 3MV6A 4LFCM 2M5ZA 5EP3A 3GLIA 2AHMA 3PNVA 5DYIA 1LV7A 4KODA 3GPUA 5IT9S 2BNKA 3T67A 3SAUA 3AKZA 1G59A 1IN6A 3PCLM 1QZMA 2R4JA 3TL4X 3SATA 1HNWM 1EO2A 4NRVA 1IXZA 1Z5CA 4IBGA 4IIWA 4I4LA 2I7PA 3RGPA 3J27B 3VFDA 1N33M 4WHPD 1PJIA 3FUUA 4QNMA 2KZUA 3PXGA 3PCGA 2I7NA 1Z59A 3PCHM 3KOZE 5ITRA 2F5SA 4LGYA 5BR8M 3MHVC 3PCNA 5KPTA 1YSYA 1N36M 1Q39A 2BUYB 1KFVA 4AQYM 4WW0A 3PCGM 2KZSA 5KQ8A 4P16A 2QBYA 1DLQA 1SXJA 2UXDM 3FUWA 3ILKA 1EO2B 1IN5A 1VDDA 2Z7JA 4FWHA 2E5LM 2BUUA 4AG6A 1YKMB 4WHOB 3LXVM 4NSRA 4FCTA 1DLMA 4BB9A 2R45A 4DV2M 2KRKA 1XMOM 4B3RM 1EO9B 4MGZE 2F5QA 4CISA 2BV0A 1QQWA 3LKTM 2F5NA 2DWNA 3LMXA 4LG2A 4FD2A 3AL0C 4LFBM 3T38A 4OVZA 3PCAM 4REZA 1E32A 3ZH9B 2O5RA 1YKPB 4JI1M 2F4VM 1JR3A 3L28A 1DGHA 2DVWB 1FNNA 5ITYA 4I81A 3U5ZB 2BV0B 3KFUG 4NOOB 1NHWC 2BUMB 2BOYA 3SARA 1W5TA 2EA0A 4ILVA 4IBKA 5EP1A 2QCUA 4LY6A 3HGIA 4GITA 4WHQA 1HQYE 3TQSA 4AKGA 2P5TA 3KSXA 3VKHA 2LNHC 3DFZA 3I4VA 4GRIA 2BUYA 3I51A 4IBJA 1L1TA 2XSVA 2J7OA 3FTDA 3LVVA 2XZUA 1NY5A 5IZ7D 3SHFA 4LF9M 3MFLA 5ITTA 4LJ4A 2BURB 1XXHB 4IBBA 4AKIA 4G4QA 2Z4RA 2XEPA 1TH4A 4DV3M 2ZAMA 2C99A 3GPPA 2BUTA 4QOSA 3VDPA 4GKKM 3GLHB 1TH3A 4RF1A 3IG8A 1JQJC 1DGBA 4IBCA 1EO9A 4OX9M 1XNQM 4LJ5A 1YKLA 1TH2A 3H4MA 2J7NA 1YKMA 2QZ4A 3O32A 2R18A 2EO2A 4FW9A 2CV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKO A;  3MI5 M;  2BUX A;  3PCH A;  3TH1 A;  2BUW A;  1YKN A;  1EOC A;  1S9A A;  3MI5 A;  3PCE M;  3PCF A;  2BUQ A;  2BUZ A;  2XSR A;  3MV6 A;  4WHS D;  1EOA A;  3PCI A;  3PCE A;  2AZQ A;  4WHR B;  3MV6 M;  3T67 A;  3PCI M;  1YKO B;  3PCL M;  3PCD A;  3PCM A;  4WHP A;  1EO2 A;  4ILT A;  3PCJ M;  3PCL A;  3PCB M;  2BUM A;  3LXV A;  2BUT B;  4WHP D;  2BUZ B;  3HJS A;  1EOC B;  1YKK A;  2BUQ B;  3PCG A;  1YKP A;  3PCH M;  2BUR A;  2BUX B;  3PCN A;  3HHX A;  2BUY B;  5TD3 A;  3PCG M;  1DLQ A;  3HKP A;  3PCN M;  3PCJ A;  1EO2 B;  2BUU A;  3PCB A;  1YKM B;  3MV4 A;  3O5U A;  4WHP B;  3LXV M;  4WHO B;  3PCD M;  1DLM A;  3PCM M;  2BUU B;  3I4Y A;  1EO9 B;  2BV0 A;  4WHR F;  3MV4 M;  2PCD A;  3LKT M;  3LMX A;  3HJQ A;  4WHR A;  1EOB A;  3PCA M;  1YKK B;  3LKT A;  3O6R A;  1YKN B;  3LMX M;  1YKP B;  3HHY A;  3PCA A;  1EOB B;  3T63 A;  3MI1 M;  2BV0 B;  2BUM B;  2BOY A;  3MI1 A;  1TMX A;  4ILV A;  2PCD M;  4WHO A;  3HGI A;  4WHQ A;  4WHS A;  1YKL B;  3PCC A;  3I4V A;  2XSU A;  2BUY A;  3PCK M;  3MFL M;  3I51 A;  1DMH A;  2XSV A;  3HJ8 A;  1EOA B;  3PCF M;  3T63 M;  3MFL A;  2BUR B;  2BUW B;  4WHO D;  2BUT A;  3N9T A;  3O6J A;  1EO9 A;  1YKL A;  3PCC M;  2BUV B;  4WHQ B;  4WHS B;  1YKM A;  3T67 M;  3O32 A;  3PCK A;  1DLT A;  2BUV A; 
#chains in the Genus database with same CATH topology
 1PGY A;  8CAT A;  4KLN A;  1DO2 A;  1KSF X;  4FCV A;  4B7F A;  3GLH E;  3SBJ A;  2EUC A;  3GLH A;  2HAK A;  1GLN A;  4GH9 A;  2L2D A;  1QUS A;  1SXJ C;  3L25 A;  3SFZ A;  4PD2 A;  2OQ4 A;  4I8O A;  1T3T A;  2JZ1 A;  3NWL A;  4LZJ A;  5E26 A;  1D0K A;  4JI0 M;  1XXH A;  1TDZ A;  2UXB M;  1S9A A;  4GC5 A;  4XK8 F;  3J80 S;  4B7G A;  4AI6 A;  3ZCB B;  1EOA A;  2AZQ A;  4WHR B;  3HHW A;  3MV6 M;  1AIP C;  2KA6 B;  4LJ8 A;  2DEN A;  2D7H A;  5IRE B;  3B74 A;  3W0F A;  3L26 A;  4JI4 M;  1IN4 A;  4MGK E;  2JA2 A;  4D81 A;  2LWX A;  3L27 A;  3SC3 A;  4FWD A;  3KXE C;  4I5S A;  3A45 A;  1JR3 D;  1D0L A;  1Q3C A;  2OO9 A;  5FLX S;  4DR5 M;  1K82 A;  2UUB M;  3PCJ M;  2KRU A;  3M6A A;  2JY7 A;  3BOS A;  1SXJ D;  3EIE A;  4GEW A;  4X64 M;  5C18 A;  2C9O A;  5FTN A;  2DWM A;  3KOX E;  2JY5 A;  4NXN M;  2H5X A;  5A2Q S;  3J81 S;  4L16 A;  1WIV A;  4LZZ A;  1IM2 A;  3ZC7 B;  1QAM A;  3KVW A;  1R5L A;  4DR1 M;  2RRU A;  1K3X A;  1YKP A;  2BUR A;  3GQ4 A;  1IY0 A;  2ZTD A;  2O25 A;  3VDU A;  1DO0 A;  4GKJ M;  2ERC A;  2K0B X;  1OJL A;  5C1B A;  4LJ7 A;  4L4U A;  4WUR A;  2L09 A;  3DA1 A;  2D7E A;  4F1I A;  1NY6 A;  2DXI A;  5GKN A;  3H4J A;  3PCB A;  4HL4 A;  3KP1 E;  2DHR A;  4D82 A;  2BUU B;  1SXJ B;  3IHP A;  3U6O A;  3TWK A;  4WHR F;  1NNU C;  1GKI A;  1PRB A;  2Y20 A;  3KS8 A;  3MV4 M;  2QBY B;  2JWS A;  4L78 A;  3HY5 A;  3B89 A;  1EE8 A;  1OTR A;  2LBC A;  1GJT A;  4G4O A;  2UUA M;  4M0W A;  2CE7 A;  2QHO B;  5EXS A;  4B3S M;  2LVQ D;  3AOE C;  1GL7 A;  3GRV A;  4RF0 A;  3FYD A;  4LF4 M;  1C1K A;  3HHY A;  3SMS A;  3T15 A;  4IJE A;  1EOB B;  1QAQ A;  5FTJ A;  5KQD A;  4MGI E;  5EXP A;  2DAG A;  2Q2E B;  3THG A;  4JI7 M;  3VK7 A;  2CHV A;  4XGI A;  4JI8 M;  4Q7J A;  1VQ1 A;  1ZMW A;  1TMX A;  2LXE A;  3GLG A;  2L7H A;  3QYB A;  3CTW B;  3I01 M;  4CIZ A;  5BPV A;  3MK6 A;  3LCV B;  1YKL B;  2KHH A;  3GLF A;  2VQF M;  3PCC A;  1V92 A;  1IBK M;  2QPA A;  4AW4 A;  2XSU A;  2LH0 A;  2NQ8 C;  3HU2 A;  4DR3 M;  3U6S A;  1N75 A;  3E9S A;  1BVS A;  4G3O A;  1DGF A;  3LW5 F;  2JZ0 A;  2L7I A;  3D8B A;  2C5R A;  4G6Z A;  3PNY A;  2C9C A;  1R7R A;  2WSE F;  2BUW B;  2KNA A;  1GVN A;  4AG5 A;  3TPZ A;  4DR7 M;  1G4A E;  1X37 A;  1Q3B A;  1XMQ M;  1QAO A;  3GQ5 A;  5JI2 E;  3K8Z A;  3N9T A;  1ZAE A;  4OU7 A;  1HNX M;  2CV0 A;  1HT2 E;  3PCC M;  2GQF A;  4LGM A;  3DZD A;  3KOW E;  4WHS B;  4DR6 M;  1G71 A;  1DGG A;  4YHH M;  4FCW A;  3J7B A;  2VQE M;  1PJJ A;  1IXS B;  1LTM A;  2BUV A;  4CHT B;  2ZTC A;  4HEO A;  2O01 F;  3CF2 A;  2R4E A;  5EP2 A;  4W5W A;  5ITU A;  3U5Z A;  1E9S A;  3J2P B;  3MI5 M;  1IY2 A;  2OOB A;  3C3E A;  4GHA A;  3GLI B;  1XC8 A;  3AOG A;  3PVS A;  2Y0Q A;  3M0E A;  5EXT A;  4NRW A;  3HWS A;  1YKN A;  3TH1 A;  4R7G A;  3MI5 A;  1OAO C;  3BXW A;  2YNM D;  4JI5 M;  1ORY B;  3VKG A;  3PCE A;  2M60 A;  3GP1 A;  2CV2 A;  1HQC A;  5JI3 E;  4IBI A;  4LFA M;  4CJ6 A;  3GPX A;  3E4R A;  3SMP A;  4LF6 M;  2DHY A;  4IBE A;  3PCM A;  4DV0 M;  3AV0 A;  4M9X A;  1QAN A;  5LMN M;  4LJ9 A;  3U6D A;  1R2Z A;  3HU3 A;  4P17 A;  1N32 M;  3PCB M;  2KEB A;  2QSF X;  3FUV A;  2XLJ A;  1OIZ A;  3W67 A;  2BUT B;  3E46 A;  3HX3 A;  1R6B X;  1IFY A;  4XBO A;  5FTK A;  2BUZ B;  3HJS A;  4JYA M;  2EKF A;  2XH9 A;  1IBM M;  3R8F A;  1EOC B;  1TTE A;  3LQQ A;  2Z3X A;  2BUQ B;  1EFU B;  1PJQ A;  2R65 A;  2BUX B;  4OW0 A;  5EP4 A;  4BLC A;  2JY6 B;  2RKO A;  2Y0T A;  3HHX A;  5TD3 A;  3AFH A;  3CF0 A;  3MJ5 A;  3JAM S;  3GO8 A;  2V1U A;  3GRU A;  2VF8 A;  3HKP A;  2L4F A;  3U6P A;  3U6C A;  3PCN M;  5FSW A;  3PCJ A;  2ZAN A;  4UN2 B;  3O5U A;  2FFJ A;  4LCB A;  3PCD M;  2LVA A;  2W82 A;  3D8L A;  3I4Y A;  3LQR A;  4D80 A;  1R2Y A;  2QP9 X;  3V76 A;  3U61 A;  1L2C A;  2FNA A;  2V6Z M;  2HKJ A;  4JXJ A;  2CHQ A;  4JI6 M;  3FTE A;  1IBL M;  2PCD A;  1FJG M;  2DAE A;  4AKH A;  1RU3 A;  1NVM A;  4L8R C;  2JY8 A;  2K9D A;  3WHL A;  1YKK B;  2H1R A;  4X62 M;  1YKN B;  3LKT A;  1NV9 A;  4K0K M;  3O6R A;  3PCA A;  4NL4 H;  2XFS A;  5LMU M;  3MI1 M;  1IQP A;  3U61 B;  1QYR A;  2CFO A;  3RGS A;  1HT1 E;  1OKS A;  3VLF B;  2R62 A;  3SAW A;  3MI1 A;  2YQZ A;  4DBG B;  1OIP A;  5ITX E;  4ZPX A;  3K9O A;  1HR0 M;  2J5Y A;  3GPY A;  2MH8 A;  3L29 A;  1I4W A;  4GIP A;  1XWI A;  4WHS A;  2R0I A;  3KP0 E;  2L6O A;  4M0D A;  4DUZ M;  3J7A S;  2QNJ A;  3LMM A;  3CGW A;  5EQT A;  1VEK A;  3FTF A;  1N77 A;  3HU1 A;  3UZU A;  2WSF F;  3GRY A;  2JXN A;  1IN7 A;  2JUJ A;  1DMH A;  5IWA M;  2DZN B;  1G3I A;  1MX0 A;  3HJ8 A;  4PCZ A;  1EOA B;  3PCF M;  3U6M A;  1GJS A;  3GLG E;  2HL7 A;  1H6U A;  3FUT A;  3SHG B;  3TE6 A;  1NNJ A;  4MM3 B;  1IY1 A;  2X4A A;  2ZBK B;  4DV7 M;  7CAT A;  2V1C A;  4LJ6 A;  4OVZ B;  3U6L A;  3T1Y M;  1EIJ A;  4WHO D;  4QHS A;  3UK6 A;  1QDT A;  4G4R A;  2G5G X;  2LTU A;  4WP2 A;  4RNA A;  4Y28 F;  4B3M M;  1L8Q A;  1E9R A;  3T67 M;  2C98 A;  5DNY A;  2CWB A;  1UM8 A;  1WXQ A;  2BWB A;  2QEN A;  4F2L A;  1OQY A;  3NBX X;  5F3W A;  3FTC A;  1K3W A;  2KXE A;  4A3V B;  1XHB A;  2VDB B;  5KPZ A;  2UUC M;  1SG9 A;  3Q8G A;  1I94 M;  1YKO A;  4KO8 A;  1S3S A;  2LHG A;  3K9P A;  3KOY E;  4JV5 M;  2BUX A;  3GRR A;  5ITX A;  3PCH A;  1YLA A;  1EOC A;  3U60 A;  1QVR A;  1L2B A;  3A98 B;  3PCE M;  3JR4 A;  4MB7 A;  3PCF A;  2BUQ A;  2ZAO A;  1WGN A;  3GLF E;  4DR4 M;  2BUZ A;  2UU9 M;  4WHS D;  1E94 E;  1ZQ9 A;  3PCI A;  4Z8X A;  2CRU A;  2HWJ A;  3U6Q A;  1G8P A;  4YY3 M;  1NV8 A;  3AJI B;  1TDH A;  3KDS E;  4LRT A;  3UJN A;  3A46 A;  3PCI M;  1Z6T A;  1V34 A;  3KW6 A;  1N78 A;  1YKO B;  2CHG A;  3UGJ A;  4DV1 M;  5H37 D;  4JI2 M;  3PCD A;  1WHC A;  4GMQ A;  4R71 A;  1ZV1 A;  2UXC M;  4WHP A;  4B3T M;  4LF8 M;  2ZM6 M;  4ILT A;  1IXR C;  2DAM A;  2A5Y B;  2QQ8 A;  3PCL A;  1WGL A;  1PJT A;  3GQ3 A;  4LJA A;  4X65 M;  2BUM A;  3LXV A;  4QNR A;  5FTL A;  4MGY E;  1J5E M;  3AOE A;  1DGH B;  1OFH A;  2F5P A;  2BJV A;  4IBF A;  5ITQ A;  1TGU A;  3R9X B;  1J7K A;  4LRS A;  4GHL A;  2WZJ A;  1NO1 A;  2DWZ B;  4Z6Y A;  4DV5 M;  1L2D A;  2R6F A;  3Q8X A;  4B08 A;  4LF7 M;  1YKK A;  2XGN A;  2YR0 A;  1Q02 A;  3TWL A;  1V33 A;  4KT0 F;  1OFI A;  4FVM A;  3RE8 A;  2XZF A;  1YE9 A;  5EXX A;  2K47 A;  2HHH M;  3B9P A;  1OAI A;  4MGH A;  3QYE A;  4KHP M;  4HLQ A;  2X49 A;  1R4G A;  3FYC A;  2Z8Y M;  4CGY B;  3UMM A;  3MV4 A;  3FUX A;  3GLG B;  3PCM M;  4WHP B;  1WR1 B;  2XFT A;  3K92 A;  2FH0 A;  4JN6 A;  1D0M A;  5E6J A;  4DR2 M;  2CUZ A;  2DZO B;  5FTM A;  2CP8 A;  1T6O A;  3K1J A;  3HJQ A;  2APL A;  2MRO B;  2VF7 A;  2Z4S A;  4PT5 A;  4R3D A;  2Y21 A;  1EOB A;  4WHR A;  2XSZ A;  3W0L B;  1GAB A;  1VEJ A;  1NJF A;  1CUK A;  4EIW A;  4X66 M;  2K6B A;  1N34 M;  3LMX M;  3VK8 A;  2L4E A;  4S12 A;  3U60 B;  2FOI C;  3TWM A;  1KYI A;  4M9S A;  5EJC A;  5DFL A;  3T63 A;  2BJW A;  1Z5A A;  2XSZ D;  1QZE A;  3L2A A;  3C58 A;  3OTO M;  4G4N A;  4DV6 M;  2RGH A;  1IN8 A;  3PFI A;  4IBD A;  2XF3 A;  3FD9 A;  2LVN C;  2DKL A;  4L15 A;  2LVP C;  3SAV A;  3GLF B;  4FWG A;  3KS4 A;  3FKE A;  1MU5 A;  2PCD M;  4WHO A;  3F92 A;  2CEA A;  2KDL A;  5DYG A;  3RFW A;  2F5O A;  4DUY M;  2BWE A;  3WHK A;  1G41 A;  2G8L A;  2KNZ A;  1AUA A;  3CF6 E;  2RGO A;  3EIH A;  3PCK M;  1HJP A;  3B7Z A;  2OPF A;  3QAU A;  4JI3 M;  1C7Y A;  2EJS A;  3MFL M;  2JNH A;  1ZMV A;  1HNZ M;  5KPR A;  3T63 M;  1SXJ E;  4PDG A;  3U6E A;  2FS1 A;  4II7 A;  3IG5 A;  4DV4 M;  2CV1 A;  3C9P A;  3QWL A;  4M9Z A;  3T1H M;  1NHG C;  2C96 A;  4QHT A;  2YFQ A;  1ZMU A;  2X8A A;  1GL6 A;  2HCB A;  3DOA A;  3M7G A;  1QUT A;  3O6J A;  3KSJ A;  3K2L A;  3B7N A;  2G3Q A;  2BUV B;  1XNR M;  4PDI A;  4WHQ B;  1QDR A;  1A5T A;  2R46 A;  2FE8 A;  3A42 A;  1NJG A;  3PCK A;  4LF5 M;  1PM5 A;  3LVW A;  3NBI A;  3C3D A;  1DLT A;  2D7G A;  4NXM M;  1D2N A;  2WSC F;  3HZJ A;  2KW0 A;  3SYK A;  2DWL A;  4IJF A;  3ZQJ A;  4NC6 A;  4BBA A;  1MN3 A;  4ITQ A;  3SYL A;  4GC9 A;  1NSF A;  3JR5 A;  1W5S A;  1YUB A;  3HHZ A;  1L1Z A;  2BUW A;  1J09 A;  4NSO B;  2DZL A;  2N35 A;  3SAS A;  4QOZ C;  4AZF A;  4MH0 E;  4TUW A;  1Z5B A;  2VII A;  4B7H A;  5KO3 A;  2XSR A;  3MV6 A;  4LFC M;  2M5Z A;  5EP3 A;  3GLI A;  2AHM A;  3PNV A;  5DYI A;  1LV7 A;  4KOD A;  3GPU A;  5IT9 S;  2BNK A;  3T67 A;  3SAU A;  2B3T A;  1MJG M;  3AKZ A;  1G59 A;  1IN6 A;  3PCL M;  1IXS A;  1QZM A;  2R4J A;  1Y8G A;  1JB0 F;  3TL4 X;  3SAT A;  1HNW M;  1EO2 A;  1JR3 E;  4NRV A;  1IXZ A;  1Z5C A;  1P3Q Q;  4IBG A;  4IIW A;  1PJS A;  4I4L A;  2I7P A;  3B7Q A;  3RGP A;  2MGW A;  3J27 B;  3VFD A;  1N33 M;  4WHP D;  1PJI A;  3FUU A;  4QNM A;  4RKU F;  3LCU A;  2KZU A;  2MR9 A;  3PXG A;  3PCG A;  2I7N A;  1Z59 A;  3PCH M;  2MJ5 B;  3KOZ E;  5ITR A;  2F5S A;  4LGY A;  5BR8 M;  3MHV C;  3PCN A;  5KPT A;  1YSY A;  1N36 M;  1Q39 A;  1WJ7 A;  1TR8 A;  1KFV A;  4AQY M;  2BUY B;  3E21 A;  4WW0 A;  3PCG M;  2KZS A;  5KQ8 A;  4P16 A;  2QBY A;  1DLQ A;  1SXJ A;  2UXD M;  3FUW A;  3ILK A;  1EO2 B;  1IN5 A;  1VDD A;  2Z7J A;  4FWH A;  2E5L M;  2BUU A;  2EKK A;  4AG6 A;  1YKM B;  4WHO B;  3LXV M;  2DNA A;  4NSR A;  4FCT A;  1DLM A;  4BB9 A;  2R45 A;  4DV2 M;  2KRK A;  1XMO M;  4B3R M;  2KNV A;  1EO9 B;  4MGZ E;  2F5Q A;  2LHC A;  1UFZ A;  4CIS A;  2BV0 A;  3W68 A;  1QQW A;  3LKT M;  2F5N A;  2OOA A;  2DWN A;  3LMX A;  4LG2 A;  4FD2 A;  3AL0 C;  4LFB M;  3T38 A;  1F4I A;  3FE3 A;  4OVZ A;  1TF0 B;  3PCA M;  4REZ A;  1E32 A;  3ZH9 B;  2O5R A;  1YKP B;  4JI1 M;  2F4V M;  1JR3 A;  3L28 A;  1DGH A;  2DVW B;  1FNN A;  5ITY A;  3I04 M;  4I81 A;  3U5Z B;  2BV0 B;  3KFU G;  4NOO B;  1NHW C;  4ANR A;  2BUM B;  2BOY A;  3SAR A;  1W5T A;  2DAK A;  2EA0 A;  1DV0 A;  4ILV A;  4IBK A;  1XXH E;  5EP1 A;  2QCU A;  3IEC A;  4LY6 A;  3HGI A;  4GIT A;  2DI0 A;  4WHQ A;  1HQY E;  3TQS A;  3T6P A;  4AKG A;  2P5T A;  3KSX A;  2GNO A;  2LNH C;  3MMP A;  3DFZ A;  3I4V A;  3VKH A;  4GRI A;  2BUY A;  2R44 A;  3I51 A;  4IBJ A;  1L1T A;  2XSV A;  2J7O A;  3FTD A;  3LVV A;  2XZU A;  1NY5 A;  5IZ7 D;  3SHF A;  4LF9 M;  3MFL A;  5ITT A;  2LVO C;  4LJ4 A;  2BUR B;  1VG5 A;  4L6V 6;  1XXH B;  4IBB A;  1VDL A;  4G4Q A;  4AKI A;  2Z4R A;  2JP7 A;  1TH4 A;  2XEP A;  4DV3 M;  2ZAM A;  2C99 A;  3GPP A;  2BUT A;  4QOS A;  3VDP A;  4GKK M;  3GLH B;  5L8R F;  1T43 A;  1TH3 A;  1XB2 B;  4RF1 A;  1VEG A;  3IG8 A;  1JQJ C;  1DGB A;  4IBC A;  1EO9 A;  4OX9 M;  1XNQ M;  4LJ5 A;  1YKL A;  1TH2 A;  3H4M A;  2J7N A;  3FRI A;  2QZ4 A;  2DAI A;  1GO5 A;  1YKM A;  3O32 A;  2R18 A;  3BBZ A;  2EO2 A;  3FRH A;  4FW9 A;  3GLI E; 
#chains in the Genus database with same CATH homology
 8CAT A;  4KLN A;  1DO2 A;  1KSF X;  4FCV A;  4B7F A;  3SBJ A;  2EUC A;  3GLH A;  1GLN A;  4GH9 A;  1SXJ C;  3L25 A;  3SFZ A;  4PD2 A;  2OQ4 A;  4I8O A;  1T3T A;  3NWL A;  4LZJ A;  5E26 A;  4JI0 M;  1XXH A;  1TDZ A;  2UXB M;  1S9A A;  4GC5 A;  3J80 S;  4B7G A;  4AI6 A;  3ZCB B;  1EOA A;  2AZQ A;  4WHR B;  3HHW A;  3MV6 M;  3L26 A;  2KA6 B;  4LJ8 A;  5IRE B;  2D7H A;  3W0F A;  4JI4 M;  1IN4 A;  4MGK E;  2JA2 A;  4D81 A;  2LWX A;  3L27 A;  3SC3 A;  4FWD A;  3KXE C;  4I5S A;  3A45 A;  1JR3 D;  1Q3C A;  5FLX S;  4DR5 M;  1K82 A;  1IBM M;  2UUB M;  3PCJ M;  2KRU A;  3M6A A;  3BOS A;  1SXJ D;  3EIE A;  4X64 M;  5C18 A;  2C9O A;  5FTN A;  2DWM A;  3KOX E;  4NXN M;  5A2Q S;  3J81 S;  4L16 A;  4LZZ A;  1IM2 A;  3ZC7 B;  1QAM A;  3KVW A;  4DR1 M;  1K3X A;  1YKP A;  2BUR A;  3GQ4 A;  1IY0 A;  3VDU A;  1DO0 A;  4GKJ M;  2ERC A;  1OJL A;  5C1B A;  4LJ7 A;  4L4U A;  4WUR A;  2L09 A;  3DA1 A;  2D7E A;  1NY6 A;  2DXI A;  5GKN A;  3PCB A;  4HL4 A;  3KP1 E;  2DHR A;  4D82 A;  2BUU B;  1SXJ B;  3U6O A;  3TWK A;  4WHR F;  1NNU C;  1GKI A;  2Y20 A;  3MV4 M;  3KS8 A;  2QBY B;  4L78 A;  1EE8 A;  4G4O A;  2UUA M;  4M0W A;  2CE7 A;  5EXS A;  4B3S M;  3AOE C;  1GL7 A;  3GRV A;  4RF0 A;  3FYD A;  4LF4 M;  1C1K A;  3HHY A;  3SMS A;  3T15 A;  4IJE A;  1EOB B;  1QAQ A;  5FTJ A;  5KQD A;  4MGI E;  5EXP A;  2Q2E B;  3THG A;  4JI7 M;  3VK7 A;  2CHV A;  4XGI A;  4JI8 M;  1TMX A;  2LXE A;  3GLG A;  2L7H A;  3CTW B;  5BPV A;  3MK6 A;  1YKL B;  3GLF A;  2VQF M;  3PCC A;  1IBK M;  2QPA A;  4AW4 A;  2XSU A;  2LH0 A;  2NQ8 C;  3HU2 A;  4DR3 M;  3U6S A;  1N75 A;  3E9S A;  1DGF A;  2L7I A;  3D8B A;  2C5R A;  4G6Z A;  3PNY A;  2C9C A;  1R7R A;  2BUW B;  1GVN A;  4AG5 A;  3TPZ A;  4DR7 M;  1G4A E;  1X37 A;  1Q3B A;  1XMQ M;  1QAO A;  3GQ5 A;  5JI2 E;  3K8Z A;  3N9T A;  1ZAE A;  4OU7 A;  1HNX M;  1HT2 E;  3PCC M;  4LGM A;  3DZD A;  3KOW E;  4WHS B;  4DR6 M;  1DGG A;  4YHH M;  4FCW A;  3J7B A;  2VQE M;  1PJJ A;  1IXS B;  2BUV A;  4CHT B;  3CF2 A;  2R4E A;  5EP2 A;  4W5W A;  5ITU A;  3U5Z A;  1E9S A;  3J2P B;  3MI5 M;  1IY2 A;  4GHA A;  3GLI B;  1XC8 A;  3AOG A;  3PVS A;  2Y0Q A;  3M0E A;  5EXT A;  4NRW A;  3HWS A;  1YKN A;  3TH1 A;  4R7G A;  3MI5 A;  2YNM D;  4JI5 M;  1ORY B;  3VKG A;  3PCE A;  2M60 A;  3GP1 A;  2CV2 A;  1HQC A;  5JI3 E;  4IBI A;  4LFA M;  3GPX A;  3E4R A;  3SMP A;  4LF6 M;  3PCM A;  4IBE A;  4DV0 M;  3AV0 A;  4M9X A;  1QAN A;  5LMN M;  4LJ9 A;  3U6D A;  1R2Z A;  3HU3 A;  1N32 M;  3PCB M;  2KEB A;  3FUV A;  2XLJ A;  2BUT B;  1R6B X;  4XBO A;  5FTK A;  2BUZ B;  3HJS A;  4JYA M;  2XH9 A;  1EOC B;  2BUQ B;  3R8F A;  3LQQ A;  2Z3X A;  2R65 A;  2BUX B;  4OW0 A;  5EP4 A;  4BLC A;  2RKO A;  2Y0T A;  3HHX A;  5TD3 A;  3AFH A;  3CF0 A;  3MJ5 A;  3JAM S;  3GO8 A;  2V1U A;  3GRU A;  3HKP A;  3U6P A;  3U6C A;  3PCN M;  5FSW A;  3PCJ A;  2ZAN A;  3O5U A;  2FFJ A;  4LCB A;  3PCD M;  2W82 A;  3D8L A;  3I4Y A;  3LQR A;  4D80 A;  1R2Y A;  2QP9 X;  3U61 A;  1L2C A;  4JI6 M;  2FNA A;  2V6Z M;  2HKJ A;  4JXJ A;  2CHQ A;  3FTE A;  2PCD A;  1IBL M;  1FJG M;  4AKH A;  1NVM A;  4L8R C;  3WHL A;  1YKK B;  3LKT A;  2H1R A;  4X62 M;  1YKN B;  3O6R A;  4K0K M;  3PCA A;  4NL4 H;  2XFS A;  5LMU M;  3MI1 M;  1IQP A;  3U61 B;  1QYR A;  2CFO A;  3RGS A;  1HT1 E;  3VLF B;  2R62 A;  3SAW A;  3MI1 A;  2YQZ A;  5ITX E;  4ZPX A;  1HR0 M;  3GPY A;  3L29 A;  4GIP A;  1I4W A;  4WHS A;  1XWI A;  3KP0 E;  4M0D A;  2L6O A;  4DUZ M;  3J7A S;  5EQT A;  3LMM A;  3FTF A;  1N77 A;  3HU1 A;  3UZU A;  3GRY A;  1IN7 A;  1DMH A;  5IWA M;  2DZN B;  1G3I A;  1MX0 A;  3HJ8 A;  4PCZ A;  1EOA B;  3PCF M;  3U6M A;  2HL7 A;  1H6U A;  3FUT A;  3SHG B;  3TE6 A;  1NNJ A;  4MM3 B;  1IY1 A;  2X4A A;  2ZBK B;  4DV7 M;  7CAT A;  2V1C A;  4LJ6 A;  4OVZ B;  3U6L A;  3T1Y M;  4WHO D;  4QHS A;  3UK6 A;  4G4R A;  2G5G X;  4RNA A;  4B3M M;  1L8Q A;  1E9R A;  3T67 M;  2C98 A;  5DNY A;  1UM8 A;  1WXQ A;  2QEN A;  5F3W A;  1K3W A;  3FTC A;  2UUC M;  2KXE A;  4A3V B;  1XHB A;  5KPZ A;  1I94 M;  1YKO A;  4KO8 A;  1S3S A;  3KOY E;  4JV5 M;  2BUX A;  3GRR A;  5ITX A;  3PCH A;  1EOC A;  3U60 A;  1QVR A;  1L2B A;  3A98 B;  3PCE M;  3JR4 A;  4MB7 A;  3PCF A;  2BUQ A;  2ZAO A;  2BUZ A;  4DR4 M;  2UU9 M;  4WHS D;  1E94 E;  1ZQ9 A;  3PCI A;  4Z8X A;  3U6Q A;  1G8P A;  4YY3 M;  3AJI B;  4LRT A;  1TDH A;  3KDS E;  3UJN A;  3A46 A;  3PCI M;  1Z6T A;  3KW6 A;  1N78 A;  1YKO B;  2CHG A;  3UGJ A;  4DV1 M;  5H37 D;  4JI2 M;  3PCD A;  4GMQ A;  2UXC M;  4WHP A;  4B3T M;  4LF8 M;  2ZM6 M;  4ILT A;  1IXR C;  2A5Y B;  3PCL A;  3GQ3 A;  4LJA A;  4X65 M;  2BUM A;  3LXV A;  4QNR A;  5FTL A;  4MGY E;  1J5E M;  3AOE A;  1DGH B;  1OFH A;  2F5P A;  2BJV A;  4IBF A;  5ITQ A;  1TGU A;  3R9X B;  1J7K A;  4LRS A;  4GHL A;  4Z6Y A;  2DWZ B;  4DV5 M;  1L2D A;  1YKK A;  4B08 A;  3Q8X A;  4LF7 M;  2XGN A;  2YR0 A;  3TWL A;  1OFI A;  4FVM A;  3RE8 A;  2XZF A;  1YE9 A;  5EXX A;  2K47 A;  2HHH M;  3B9P A;  4MGH A;  4KHP M;  4HLQ A;  2X49 A;  3FYC A;  4CGY B;  3UMM A;  3MV4 A;  4WHP B;  3FUX A;  3GLG B;  3PCM M;  2XFT A;  3K92 A;  4JN6 A;  5E6J A;  4DR2 M;  2CUZ A;  2DZO B;  5FTM A;  4R3D A;  3K1J A;  3HJQ A;  2Z4S A;  4PT5 A;  4WHR A;  1EOB A;  2Y21 A;  2XSZ A;  3W0L B;  1NJF A;  4EIW A;  4X66 M;  1N34 M;  3LMX M;  3VK8 A;  4S12 A;  3U60 B;  2FOI C;  3TWM A;  1KYI A;  4M9S A;  5EJC A;  3T63 A;  2BJW A;  1Z5A A;  2XSZ D;  3L2A A;  3C58 A;  3OTO M;  4G4N A;  4DV6 M;  2RGH A;  1IN8 A;  3PFI A;  4IBD A;  2XF3 A;  3FD9 A;  4L15 A;  3SAV A;  3GLF B;  4FWG A;  3KS4 A;  3FKE A;  1MU5 A;  2PCD M;  4WHO A;  2CEA A;  3RFW A;  5DYG A;  2F5O A;  4DUY M;  3WHK A;  1G41 A;  2G8L A;  3CF6 E;  2RGO A;  3EIH A;  3PCK M;  2OPF A;  3QAU A;  4JI3 M;  3MFL M;  1HNZ M;  5KPR A;  3T63 M;  1SXJ E;  4PDG A;  3U6E A;  4II7 A;  3IG5 A;  4DV4 M;  2CV1 A;  3QWL A;  4M9Z A;  3T1H M;  1NHG C;  2C96 A;  4QHT A;  2YFQ A;  2X8A A;  1GL6 A;  2HCB A;  3DOA A;  3M7G A;  3O6J A;  3KSJ A;  3K2L A;  2BUV B;  1XNR M;  4PDI A;  4WHQ B;  2FE8 A;  2R46 A;  3A42 A;  1NJG A;  3PCK A;  4LF5 M;  1PM5 A;  3LVW A;  3NBI A;  1DLT A;  2D7G A;  4NXM M;  1D2N A;  3SYK A;  2KW0 A;  2DWL A;  4IJF A;  4BBA A;  4ITQ A;  3SYL A;  4GC9 A;  1NSF A;  3JR5 A;  1W5S A;  1YUB A;  3HHZ A;  1L1Z A;  2BUW A;  1J09 A;  4NSO B;  4TUW A;  3SAS A;  4QOZ C;  4AZF A;  4MH0 E;  1Z5B A;  2VII A;  4B7H A;  5KO3 A;  2XSR A;  3MV6 A;  4LFC M;  2M5Z A;  5EP3 A;  3GLI A;  2AHM A;  3PNV A;  5DYI A;  1LV7 A;  4KOD A;  3GPU A;  5IT9 S;  2BNK A;  3T67 A;  3SAU A;  3AKZ A;  1G59 A;  1IN6 A;  3PCL M;  1QZM A;  2R4J A;  3TL4 X;  3SAT A;  1HNW M;  1EO2 A;  4NRV A;  1IXZ A;  1Z5C A;  4IBG A;  4IIW A;  4I4L A;  2I7P A;  3RGP A;  3J27 B;  3VFD A;  1N33 M;  4WHP D;  1PJI A;  3FUU A;  4QNM A;  2KZU A;  3PXG A;  3PCG A;  2I7N A;  1Z59 A;  3PCH M;  3KOZ E;  5ITR A;  2F5S A;  4LGY A;  5BR8 M;  3MHV C;  3PCN A;  5KPT A;  1YSY A;  1N36 M;  1Q39 A;  2BUY B;  1KFV A;  4AQY M;  4WW0 A;  3PCG M;  2KZS A;  5KQ8 A;  4P16 A;  2QBY A;  1DLQ A;  1SXJ A;  2UXD M;  3FUW A;  3ILK A;  1EO2 B;  1IN5 A;  1VDD A;  2Z7J A;  4FWH A;  2E5L M;  2BUU A;  4AG6 A;  1YKM B;  4WHO B;  3LXV M;  4NSR A;  4FCT A;  1DLM A;  4BB9 A;  2R45 A;  4DV2 M;  2KRK A;  1XMO M;  4B3R M;  1EO9 B;  4MGZ E;  2F5Q A;  4CIS A;  2BV0 A;  1QQW A;  3LKT M;  2F5N A;  2DWN A;  3LMX A;  4LG2 A;  4FD2 A;  3AL0 C;  4LFB M;  3T38 A;  4OVZ A;  3PCA M;  4REZ A;  1E32 A;  3ZH9 B;  2O5R A;  1YKP B;  4JI1 M;  2F4V M;  1JR3 A;  3L28 A;  1DGH A;  2DVW B;  1FNN A;  5ITY A;  4I81 A;  3U5Z B;  2BV0 B;  3KFU G;  4NOO B;  1NHW C;  2BUM B;  2BOY A;  3SAR A;  1W5T A;  2EA0 A;  4ILV A;  4IBK A;  5EP1 A;  2QCU A;  4LY6 A;  3HGI A;  4GIT A;  4WHQ A;  1HQY E;  3TQS A;  4AKG A;  2P5T A;  3KSX A;  3VKH A;  2LNH C;  3DFZ A;  3I4V A;  4GRI A;  2BUY A;  3I51 A;  4IBJ A;  1L1T A;  2XSV A;  2J7O A;  3FTD A;  3LVV A;  2XZU A;  1NY5 A;  5IZ7 D;  3SHF A;  4LF9 M;  3MFL A;  5ITT A;  4LJ4 A;  2BUR B;  1XXH B;  4IBB A;  4AKI A;  4G4Q A;  2Z4R A;  2XEP A;  1TH4 A;  4DV3 M;  2ZAM A;  2C99 A;  3GPP A;  2BUT A;  4QOS A;  3VDP A;  4GKK M;  3GLH B;  1TH3 A;  4RF1 A;  3IG8 A;  1JQJ C;  1DGB A;  4IBC A;  1EO9 A;  4OX9 M;  1XNQ M;  4LJ5 A;  1YKL A;  1TH2 A;  3H4M A;  2J7N A;  1YKM A;  2QZ4 A;  3O32 A;  2R18 A;  2EO2 A;  4FW9 A;  2CV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...