3HHYA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
total genus 70
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhyA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hhyA02
3PCLA 3HGIA 3PCDA 3PCBA 1YKLA 2PCDM 1DMHA 3PCHA 1YKMA 1YKLB 2BUMB 3MFLM 3PCIA 1DLTA 3LMXM 3LKTA 3LXVM 3HKPA 3MV6A 2BUWA 1EOBA 3MI5M 3MI1A 3PCGA 2BUWB 1EOBB 1YKPA 3O5UA 1YKPB 3PCLM 3T67A 3PCDM 3PCBM 4ILVA 2BV0A 3PCHM 4WHRA 3PCIM 2BV0B 3LKTM 5TD3A 3PCCA 4WHRB 3MV6M 4WHPA 3MI1M 3PCGM 2BUYA 4WHPB 4WHSD 3HHYA 2BUYB 1S9AA 1YKKA 1YKMB 4WHOD 3I51A 3T63A 1YKKB 1EOCA 3T67M 3PCKA 1DLMA 3PCMA 4WHOA 1TMXA 2BUZA 4WHOB 3PCCM 2BUZB 4WHQA 1EO9A 4WHQB 3O6JA 3PCNA 1EO9B 1EOAA 2BUVA 2BOYA 3O6RA 2BUVB 3T63M 2BURA 3O32A 1YKOA 2BURB 3PCKM 1DLQA 1YKOB 3HHXA 3PCMM 2BUTA 3MV4A 3N9TA 2BUQA 3PCAA 2BUTB 4WHSA 1EOCB 2XSRA 2XSVA 2BUQB 3HJ8A 3PCNM 4WHSB 2XSUA 4ILTA 3PCFA 2BUUA 4WHRF 2BUUB 3I4VA 2BUMA 3I4YA 3PCJA 3PCEA 1EOAB 3MV4M 3PCAM 2PCDA 1YKNA 2AZQA 3MFLA 1YKNB 3PCFM 3LMXA 1EO2A 3LXVA 3TH1A 1EO2B 3MI5A 4WHPD 3HJSA 3PCJM 2BUXA 3PCEM 3HJQA 2BUXB
chains in the Genus database with same CATH superfamily
1IXSB 3KOXE 5C1BA 3GO8A 5JI2E 1OIZA 1R6BX 2W82A 4IBGA 3PCBA 2G3QA 5EP3A 3U61B 2LVAA 4L8RC 3L2AA 2DENA 3PCHA 4XK8F 4LF4M 1NJFA 1YKLB 1TH3A 2QSFX 2B3TA 4NL4H 3LMXM 3RGPA 4GH9A 3MV6A 1WGNA 3WHKA 2WSFF 2L7HA 2HHHM 3MI5M 2QPAA 2EO2A 1TGUA 5E6JA 2FH0A 3R8FA 3L27A 3J27B 4MGZE 4DV6M 1EOBB 4K0KM 3C3EA 1YLAA 4QNMA 4DV5M 3U6MA 3O5UA 2XZFA 2DAMA 1YKPB 2JZ1A 5KPTA 3PCLM 5DFLA 2FS1A 3LVWA 5FTKA 1N36M 4DV3M 2BV0A 2ERCA 1Q39A 1QAOA 2XF3A 3LKTM 3IG8A 5EP4A 2HKJA 4IIWA 4YHHM 2EKFA 4AG5A 3GLGE 4LZZA 4L78A 1QUSA 3HHWA 3PCCA 2MGWA 3FTCA 5IREB 4DUZM 4WHPA 1GL7A 2L7IA 1DGHA 1XHBA 3MI1M 3FRIA 5KO3A 3U5ZB 2CHQA 1J09A 4QOZC 1S9AA 1YKKA 3FE3A 4WURA 4PD2A 2GQFA 4JI8M 3UJNA 2LBCA 4GIPA 2K6BA 4FWDA 4D80A 1XXHB 2UUCM 3B7ZA 1FJGM 4IBIA 3NBXX 4NRWA 1DLMA 3U6EA 5C18A 5FTNA 5EJCA 2ZAOA 1TDZA 4LCBA 4PT5A 1IXZA 3GPXA 2UXCM 2FFJA 2RRUA 3KSXA 2LXEA 2BUZB 2CHVA 4RF0A 1HT1E 1JR3E 2O25A 1SXJC 2J5YA 2ZTDA 3OTOM 1HJPA 3TWMA 4LF9M 3BOSA 2BJWA 2FNAA 3B89A 3O6JA 3HU2A 2HL7A 1ZMUA 3LW5F 4DV4M 3PCNA 1WIVA 1SXJA 1PJIA 4JV5M 3J80S 1EIJA 4GEWA 2C99A 3SBJA 2BUVB 2BWBA 2BURA 3HY5A 1GL6A 4X62M 1DO2A 2V6ZM 2R65A 1R2YA 3SARA 5GKNA 1XNQM 1YKOA 3ZC7B 1N77A 1Y8GA 2J7NA 2V1UA 1ZMVA 4QNRA 3HHXA 1OFHA 3GLIB 2OO9A 3PCMM 1D0MA 4M9SA 3T1YM 1PRBA 2HAKA 1HR0M 2CP8A 1NY6A 1PJSA 5EXXA 3MV4A 4G4NA 3PCAA 2EUCA 2VIIA 5FTJA 3FUXA 5EXSA 3HJ8A 2E5LM 4LFCM 3K2LA 4IBBA 1J5EM 1OKSA 1NHGC 3U60A 1N78A 2XSUA 2JP7A 4JN6A 4ILTA 3AL0C 1E94E 3GLHA 4CJ6A 2MROB 3TQSA 4D82A 2UUAM 4WHRF 2DZNB 1LV7A 1OIPA 2VF8A 2BUUB 3I4VA 4FCVA 2BUMA 4I5SA 1QYRA 5KPRA 4DV7M 1BVSA 2DWLA 3K9OA 1JB0F 3QYEA 3PNYA 1VG5A 3LCVB 3LXVM 4R3DA 2QBYA 1YKNB 3E4RA 1VDLA 2Q2EB 5EXPA 1KYIA 3JR5A 2OQ4A 1QUTA 5EP2A 1EO2B 1IY2A 3U6QA 2F5SA 2DAGA 4II7A 2LHCA 3J81S 1ZMWA 2HCBA 2LNHC 2Y0TA 1I94M 3PCJM 2BUXA 4AKIA 3CTWB 1TH2A 4HL4A 1IXRC 1D2NA 2BNKA 2XEPA 1MN3A 3RE8A 1EFUB 4FD2A 4IJFA 3PCDA 2Z8YM 2LH0A 3FKEA 2PCDM 3DZDA 2H5XA 3VLFB 3MK6A 1QAQA 1NSFA 2KRKA 4LJ7A 1IN5A 3DFZA 4LJ6A 4Y28F 3TWLA 2GNOA 2WSCF 2OPFA 2XZUA 3KS8A 3MFLM 2XSZD 5IZ7D 2UU9M 4GKKM 2Y20A 3GPPA 3HKPA 3KS4A 1IN4A 3A98B 1PGYA 3FD9A 2X8AA 3AOGA 3JAMS 2UXDM 2C9OA 3FTFA 4BB9A 3T63M 1Z6TA 5FTLA 2DWNA 4WP2A 2DAKA 1TTEA 3NWLA 2O01F 3A42A 3TL4X 3GRYA 4OVZA 4P16A 1Z5CA 3T6PA 1YKMA 1V34A 1XXHE 3W67A 3GPUA 3KOZE 3HHZA 3KOWE 4WHRA 1N32M 1R4GA 3W0FA 2YQZA 2EA0A 3D8BA 1JQJC 1K3WA 2DNAA 1R7RA 4AZFA 3KXEC 1JR3D 3T1HM 3SYKA 1CUKA 7CATA 2L4EA 2DWMA 2F4VM 2O5RA 2OOBA 2X49A 4RNAA 1HNZM 2BUYA 3PCGM 4WHPB 1VEKA 4B7FA 4B08A 2QP9X 3HHYA 3Q8GA 3SC3A 1DGHB 1PM5A 1K3XA 1JR3A 2JXNA 4CIZA 3LVVA 4PDIA 1EOCA 4DR1M 1YKKB 3T67M 3C58A 4IJEA 2DVWB 4DR3M 4DV1M 1XMOM 3RGSA 3FTEA 1YSYA 5EP1A 1MJGM 4MB7A 4RKUF 4B3SM 4M9ZA 1WGLA 3M7GA 4IBEA 2ZAMA 3KOYE 3KW6A 3LQQA 1VDDA 4L15A 1X37A 4LY6A 2L2DA 2KA6B 4QHSA 1OTRA 1EOAA 2F5NA 1Q3BA 4RF1A 1N75A 4NOOB 3FUVA 5KQDA 3TE6A 3O6RA 1I4WA 1SXJB 2J7OA 2F5QA 4B3TM 1N34M 1D0LA 4LRTA 2RGOA 2BURB 4R71A 3PCKM 1HQCA 1YKOB 2R6FA 1KSFX 3TWKA 2XFSA 2CHGA 4PDGA 4B7HA 2BUTA 1A5TA 2BUQA 3CF6E 1AUAA 1VEGA 1L2CA 4IBJA 4DV0M 3VDUA 1PJTA 3IECA 3HU1A 4W5WA 4LF5M 4LG2A 2Z7JA 2ZM6M 3PCFA 1IN6A 1W5TA 3U60B 2ZANA 3PFIA 5L8RF 4LJ9A 3KVWA 2R44A 2CFOA 1PJQA 1T6OA 2QENA 3GLHB 3TPZA 3I4YA 4IBFA 1IBLM 3VKHA 2R4EA 1EE8A 1WR1B 5KPZA 5IWAM 4DBGB 1ORYB 2R62A 4FCWA 3HZJA 1NV9A 1S3SA 2R18A 2VDBB 2R46A 2DZLA 3SMPA 3U6DA 4REZA 3VK7A 3SAUA 1WHCA 3FRHA 1IM2A 4GC5A 2P5TA 2JY7A 3KSJA 1C7YA 3LMXA 2JY6B 2K47A 4GMQA 3JR4A 2QBYB 3TH1A 2LVPC 2DAIA 3MI5A 4CHTB 3FUUA 2D7HA 2X4AA 3LQRA 4MGYE 3FTDA 3PCEM 4X64M 4B3RM 1E9SA 3KP1E 2NQ8C 1IBKM 3PNVA 2BUXB 3HU3A 1TF0B 4DUYM 2MR9A 3GLFE 1GLNA 1GVNA 3NBIA 1G8PA 3PCLA 3U6CA 1DMHA 4GHAA 2JY8A 2Z4RA 2C9CA 1TDHA 1OJLA 1OFIA 3D8LA 4JYAM 4DR2M 4LF7M 3GQ3A 1MU5A 1NV8A 1XXHA 2A5YB 3E46A 3W0LB 2BUWA 2DAEA 2DI0A 2EJSA 2R4JA 3MI1A 3UGJA 2YNMD 2QQ8A 1QAMA 2XGNA 2KZSA 1HT2E 1NNJA 3C3DA 1IY0A 1QANA 1NY5A 4LF8M 3LMMA 1TH4A 2D7EA 4OVZB 4FCTA 1HNWM 3PCBM 5BPVA 1K82A 5IT9S 1GJSA 1QDRA 5ITXE 3SASA 2CV0A 4ILVA 3PCHM 2KRUA 2M5ZA 3SAWA 3L26A 3B74A 4WHSD 1IFYA 4WHRB 3MV6M 2XFTA 3CF0A 1YUBA 1AIPC 1P3QQ 1OQYA 1T3TA 3GRRA 3W68A 2G8LA 2BUYB 3MJ5A 4LJAA 1Z5AA 3HWSA 4G4RA 3VKGA 4WHOD 3I51A 3WHLA 3SFZA 4I4LA 1XB2B 1N33M 3T63A 3VK8A 3SAVA 3K92A 1J7KA 2MH8A 1V33A 3DOAA 4NSOB 3PCIA 2DWZB 2I7NA 2XSZA 5ITYA 3GLGA 3C9PA 3PCMA 1Z59A 4OX9M 1TMXA 4WHOA 1DGFA 5A2QS 4G4OA 4AKGA 5EQTA 2Z3XA 3PCCM 1QVRA 4WHQA 5E26A 2UUBM 4JI6M 5F3WA 4IBDA 4LZJA 2JNHA 3A46A 1EO9A 4DR7M 4MH0E 1VQ1A 4Z8XA 5H37D 4JI7M 1E9RA 1ZAEA 5DYGA 5JI3E 4LRSA 3ZQJA 2BOYA 1HQYE 4R7GA 3DA1A 3SHFA 5LMNM 3GQ5A 2CV2A 2KXEA 4GITA 1DLQA 3THGA 2V1CA 3B7NA 4DV2M 4CISA 2LVNC 4EIWA 4A3VB 1QZEA 4KT0F 3N9TA 2R45A 4HEOA 1UFZA 2JUJA 3QYBA 3AOEA 5BR8M 2BUTB 4WHSA 2KHHA 2RGHA 2BUQB 4HLQA 2XSVA 3PCNM 3QAUA 3GLIE 3H4JA 2LTUA 3BBZA 1GKIA 1L2BA 3V76A 3EIEA 2JZ0A 3VDPA 2ZTCA 3ZH9B 5KQ8A 1TR8A 1NNUC 2C98A 3IHPA 1XMQM 2YFQA 4FWHA 1L1TA 1DGGA 3E9SA 3J2PB 3UK6A 4JI5M 1GJTA 2RKOA 3I01M 4IBKA 3K1JA 4UN2B 3UZUA 2CE7A 2C5RA 3PCJA 2N35A 2EKKA 1G41A 2QCUA 3M6AA 4GC9A 3MV4M 1OAIA 1RU3A 3HX3A 4M0DA 3GQ4A 3PCAM 3Q8XA 3AFHA 2ZBKB 1G4AE 2FOIC 4ANRA 2PCDA 4DR4M 2KNZA 3GLFA 2L4FA 3MFLA 2WSEF 4L4UA 2VQFM 3FYDA 1R5LA 4LGMA 1IQPA 4ZPXA 1IN7A 3M0EA 4TUWA 2CV1A 3U6PA 4PCZA 1XNRM 4JXJA 2DKLA 4WHPD 3HJSA 4S12A 2G5GX 4OW0A 3L25A 1DV0A 1F4IA 1IXSA 2Y0QA 3HJQA 5ITRA 1NVMA 3L29A 3U6LA 1ZV1A 4QOSA 5DYIA 3U61A 5FSWA 1NHWC 1G59A 3HGIA 4ITQA 1YKLA 3IG5A 3MHVC 2LWXA 4AKHA 1T43A 5FTMA 3GP1A 3A45A 3KDSE 4L16A 5EXTA 2BUMB 1DLTA 2JY5A 4CGYB 5ITXA 2LHGA 4GKJM 2DHRA 4B7GA 2F5OA 4AG6A 3SYLA 4B3MM 1EOBA 3ILKA 4NXMM 3VFDA 2BUWB 4LJ4A 3RFWA 4LF6M 3PCGA 2F5PA 1YE9A 2CRUA 2M60A 1YKPA 1W5SA 2BWEA 3AV0A 4MGHA 2K0BX 4NSRA 1HNXM 2KEBA 1SXJD 2JA2A 2K9DA 1LTMA 3B7QA 3EIHA 1NJGA 4Q7JA 4XGIA 3PCDM 3J7AS 3T67A 4M9XA 2Y21A 1Q02A 1OAOC 2L09A 5DNYA 3T15A 2CUZA 2HWJA 3SATA 3PCIM 2VF7A 5TD3A 2YR0A 1IBMM 2FE8A 2XLJA 2I7PA 4LFAM 4NC6A 1MX0A 3U5ZA 1WXQA 1KFVA 3AKZA 4AW4A 3L28A 3CF2A 3F92A 3KP0E 3UMMA 1YKMB 3FYCA 4FWGA 4KLNA 4I8OA 4FW9A 4LGYA 4JI4M 4LJ8A 4NRVA 5ITUA 3PCKA 4G4QA 3LCUA 1GABA 3ZCBB 2BUZA 4Z6YA 3FUTA 4D81A 4AQYM 3KFUG 1SG9A 2QZ4A 3GLGB 4WHOB 2D7GA 2DZOB 3FUWA 4L6V6 3I04M 1VEJA 4WHQB 2Z4SA 1D0KA 4DR6M 3BXWA 1EO9B 1QQWA 2BUVA 4JI3M 8CATA 2C96A 1R2ZA 2OOAA 2CWBA 4F1IA 4BLCA 3K9PA 4M0WA 3GLIA 2KDLA 3GRUA 4AI6A 1NO1A 4X65M 1XWIA 3PVSA 2KNVA 4LFBM 4G6ZA 3SMSA 3LKTA 3U6OA 2KZUA 3GRVA 3E21A 3AJIB 4P17A 1SXJE 1UM8A 2R0IA 3MMPA 3H4MA 2JWSA 2AHMA 4GRIA 4KO8A 4KODA 4MGIE 4JI0M 1FNNA 4I81A 1L2DA 1EOCB 4MGKE 2XSRA 2CEAA 4WHSB 1G71A 3GPYA 1PJJA 2BJVA 2KW0A 3CGWA 4OU7A 3U6SA 2WZJA 4YY3M 1Z5BA 2LVQD 2QNJA 2DHYA 2XH9A 2UXBM 2KNAA 3SHGB 2BUUA 3K8ZA 1DO0A 1ZQ9A 4FVMA 5LMUM 4QHTA 1IY1A 3O32A 1Q3CA 1XC8A 3PXGA 4GHLA 2VQEM 2APLA 3PCEA 2MJ5B 3T38A 1E32A 1EOAB 4MM3B 3B9PA 4IBCA 4DR5M 4XBOA 2QHOB 3J7BA 4JI1M 4F2LA 1DGBA 2L6OA 5ITTA 4G3OA 1QDTA 3GLHE 1L1ZA 1WJ7A 5FLXS 1YKNA 2LVOC 1G3IA 3AOEC 4LJ5A 2AZQA 1V92A 4KHPM 3PCFM 1H6UA 1EO2A 3GLFB 3LXVA 1QZMA 5ITQA 1IN8A 4BBAA 4WW0A 4NXNM 2DXIA 1GO5A 2BV0B 2H1RA 4JI2M 1L8QA 3QWLA 4X66M 3R9XB 1C1KA
chains in the Genus database with same CATH topology
1IXSB 3KOXE 5C1BA 3GO8A 5JI2E 1R6BX 4IBGA 2W82A 3PCBA 5EP3A 3U61B 4L8RC 3L2AA 3PCHA 4LF4M 1YKLB 1NJFA 1TH3A 4NL4H 3LMXM 3RGPA 4GH9A 3MV6A 3WHKA 2L7HA 2HHHM 3MI5M 2QPAA 2EO2A 1TGUA 5E6JA 3R8FA 3L27A 3J27B 4MGZE 4DV6M 1EOBB 4K0KM 4QNMA 4DV5M 3U6MA 3O5UA 2XZFA 1YKPB 5KPTA 3PCLM 1N36M 3LVWA 5FTKA 4DV3M 2BV0A 2ERCA 1Q39A 1QAOA 2XF3A 3LKTM 3IG8A 5EP4A 2HKJA 4IIWA 4YHHM 4AG5A 4G4RA 4GKKM 4LZZA 4L78A 3HHWA 3PCCA 4WHPA 3FTCA 5IREB 4DUZM 1GL7A 2L7IA 1DGHA 1XHBA 3MI1M 5KO3A 3U5ZB 2CHQA 1J09A 4QOZC 1S9AA 1YKKA 4WURA 4PD2A 4JI8M 3UJNA 4GIPA 4FWDA 4D80A 1XXHB 2UUCM 1FJGM 4IBIA 1DLMA 4NRWA 3U6EA 5C18A 5FTNA 5EJCA 2ZAOA 1TDZA 4LCBA 4PT5A 1IXZA 3GPXA 2UXCM 2FFJA 3KSXA 2LXEA 2BUZB 2CHVA 4RF0A 1HT1E 3OTOM 3TWMA 1SXJC 4LF9M 3BOSA 2BJWA 2FNAA 3O6JA 3HU2A 2HL7A 4DV4M 3PCNA 1SXJA 1PJIA 4JV5M 3J80S 2C99A 3SBJA 2BUVB 3T63M 2BURA 4X62M 1GL6A 1XNQM 1DO2A 2V6ZM 2R65A 1R2YA 3SARA 5GKNA 1YKOA 3ZC7B 1N77A 2J7NA 2V1UA 4QNRA 3HHXA 1OFHA 3GLIB 3PCMM 4M9SA 3T1YM 3MV4A 1NY6A 5EXXA 4G4NA 3PCAA 2EUCA 2VIIA 5FTJA 3FUXA 5EXSA 3HJ8A 2E5LM 4LFCM 3K2LA 4IBBA 1J5EM 1N78A 1NHGC 3U60A 2XSUA 4JN6A 4ILTA 3AL0C 1E94E 3GLHA 2UUAM 4D82A 3TQSA 4WHRF 2DZNB 1LV7A 2BUUB 3I4VA 4FCVA 2BUMA 4I5SA 1QYRA 5KPRA 4DV7M 2DWLA 3PNYA 4R3DA 2QBYA 1YKNB 3E4RA 2Q2EB 5EXPA 1KYIA 3JR5A 2OQ4A 5EP2A 1EO2B 1IY2A 3U6QA 2F5SA 4II7A 3J81S 2Y0TA 2HCBA 2LNHC 1I94M 3PCJM 2BUXA 3CTWB 1TH2A 4HL4A 1IXRC 1D2NA 2BNKA 2XEPA 3RE8A 4IJFA 4FD2A 3PCDA 2LH0A 3FKEA 2PCDM 3DZDA 3VLFB 3MK6A 1QAQA 1NSFA 2KRKA 4LJ7A 1IN5A 3DFZA 4LJ6A 3TWLA 2OPFA 2XZUA 1YKMA 3MFLM 3PCIA 3KS8A 2XSZD 5IZ7D 2UU9M 2Y20A 3GPPA 3HKPA 3KS4A 1IN4A 3A98B 3FD9A 2X8AA 3AOGA 3JAMS 2UXDM 2C9OA 3FTFA 4BB9A 1Z6TA 5FTLA 2DWNA 3NWLA 3A42A 3TL4X 3GRYA 4OVZA 4P16A 1Z5CA 3GPUA 3KOZE 3HHZA 3KOWE 4WHRA 1N32M 3W0FA 2YQZA 2EA0A 3D8BA 1JQJC 4AKIA 4AZFA 1R7RA 3T1HM 3KXEC 1JR3D 2DWMA 3SYKA 7CATA 2F4VM 2O5RA 1HNZM 2X49A 4RNAA 2BUYA 3PCGM 4WHPB 4WHSD 4B08A 4B7FA 2QP9X 3HHYA 3SC3A 1PM5A 1DGHB 1K3XA 1JR3A 3LVVA 4PDIA 1EOCA 4DR1M 1YKKB 3T67M 3C58A 4IJEA 2DVWB 4DR3M 4DV1M 1XMOM 3RGSA 3FTEA 1YSYA 5EP1A 4MB7A 4B3SM 4M9ZA 3M7GA 4IBEA 4LY6A 2ZAMA 3KOYE 3KW6A 3LQQA 1VDDA 4L15A 1X37A 2KA6B 4QHSA 1EOAA 2F5NA 1Q3BA 4RF1A 1N75A 4NOOB 3FUVA 5KQDA 3TE6A 3O6RA 1I4WA 1SXJB 2J7OA 2F5QA 4B3TM 1N34M 4LRTA 2RGOA 2BURB 3PCKM 1HQCA 1YKOB 1KSFX 3TWKA 2XFSA 2CHGA 4PDGA 4B7HA 2BUTA 2BUQA 3CF6E 1L2CA 4IBJA 4DV0M 3VDUA 4W5WA 3HU1A 4LF5M 4LG2A 2Z7JA 2ZM6M 3PCFA 1IN6A 1W5TA 3U60B 2ZANA 3PFIA 4LJ9A 3KVWA 2CFOA 3GLHB 2QENA 3TPZA 3I4YA 4IBFA 1IBLM 3VKHA 2R4EA 1EE8A 5KPZA 5IWAM 1ORYB 2R62A 4FCWA 1S3SA 2R18A 2R46A 3SMPA 3U6DA 4REZA 3VK7A 3SAUA 1IM2A 4GC5A 2P5TA 3KSJA 3LMXA 2K47A 4GMQA 3JR4A 2QBYB 3TH1A 3MI5A 4CHTB 3FUUA 2D7HA 2X4AA 3LQRA 4MGYE 3FTDA 3PCEM 4X64M 4B3RM 1E9SA 3KP1E 2NQ8C 1IBKM 3PNVA 2BUXB 3HU3A 4DUYM 1GLNA 1GVNA 3NBIA 1G8PA 3PCLA 3U6CA 1DMHA 4GHAA 2Z4RA 2C9CA 1TDHA 1OJLA 1OFIA 3D8LA 4JYAM 4DR2M 4LF7M 3GQ3A 1MU5A 1XXHA 3W0LB 2A5YB 3LKTA 2BUWA 3LXVM 2R4JA 3MI1A 3UGJA 2YNMD 1QAMA 2XGNA 2KZSA 1HT2E 1NNJA 1IY0A 1QANA 1NY5A 4LF8M 3LMMA 1TH4A 2D7EA 4OVZB 4FCTA 1HNWM 3PCBM 5BPVA 1K82A 5IT9S 5ITXE 2CV0A 4ILVA 3PCHM 2KRUA 2M5ZA 3SAWA 3L26A 4WHRB 3MV6M 2XFTA 3CF0A 1YUBA 1T3TA 3GRRA 2G8LA 2BUYB 3MJ5A 4LJAA 1Z5AA 3HWSA 3VKGA 4WHOD 3I51A 3WHLA 3SFZA 4I4LA 1N33M 3T63A 3VK8A 3SAVA 3K92A 1J7KA 3DOAA 4NSOB 3PCMA 2DWZB 2I7NA 2XSZA 5ITYA 3GLGA 4WHOA 1Z59A 4OX9M 1TMXA 1DGFA 5A2QS 4G4OA 4AKGA 5EQTA 3PCCM 1QVRA 4WHQA 5E26A 2UUBM 4JI6M 5F3WA 4IBDA 4LZJA 1EO9A 3A46A 4DR7M 4MH0E 4Z8XA 5H37D 4JI7M 1E9RA 1ZAEA 5DYGA 5JI3E 4LRSA 2BOYA 1HQYE 4R7GA 3DA1A 3SHFA 5LMNM 3GQ5A 2CV2A 2KXEA 4GITA 1DLQA 3THGA 2V1CA 4DV2M 4CISA 4EIWA 4A3VB 3N9TA 2R45A 5BR8M 3AOEA 2BUTB 4WHSA 2RGHA 2BUQB 4HLQA 2XSVA 3PCNM 3QAUA 1GKIA 1L2BA 3EIEA 3VDPA 3ZH9B 5KQ8A 2C98A 1NNUC 1XMQM 1L1TA 2YFQA 4FWHA 1DGGA 3E9SA 3J2PB 3UK6A 4JI5M 2RKOA 3UZUA 4IBKA 2C5RA 3K1JA 2CE7A 3PCJA 1G41A 2QCUA 3M6AA 4GC9A 3MV4M 4M0DA 3GQ4A 3PCAM 3Q8XA 3AFHA 2ZBKB 1G4AE 2FOIC 2PCDA 4DR4M 3GLFA 3MFLA 4L4UA 2VQFM 3FYDA 4LGMA 1IQPA 4ZPXA 1IN7A 3M0EA 4TUWA 2CV1A 3U6PA 4PCZA 1XNRM 4JXJA 4WHPD 3HJSA 4S12A 2G5GX 4OW0A 3L25A 2Y0QA 3HJQA 5ITRA 3L29A 1NVMA 3U6LA 4QOSA 5DYIA 3U61A 5FSWA 1NHWC 1G59A 3HGIA 4ITQA 1YKLA 3IG5A 3MHVC 2LWXA 4AKHA 5FTMA 3GP1A 3A45A 3KDSE 4L16A 5EXTA 2BUMB 1DLTA 4CGYB 5ITXA 4GKJM 2DHRA 4B7GA 2F5OA 4AG6A 3SYLA 4B3MM 1EOBA 3ILKA 4NXMM 3VFDA 2BUWB 4LJ4A 3RFWA 4LF6M 3PCGA 2F5PA 1YE9A 2M60A 1YKPA 1W5SA 3AV0A 4MGHA 4NSRA 1HNXM 2KEBA 1SXJD 2JA2A 3EIHA 1NJGA 4XGIA 3PCDM 3T67A 3J7AS 4M9XA 2Y21A 2L09A 5DNYA 3T15A 2CUZA 3SATA 3PCIM 5TD3A 2YR0A 1IBMM 2FE8A 2XLJA 2I7PA 4LFAM 1MX0A 3U5ZA 1WXQA 1KFVA 3AKZA 4AW4A 3L28A 3CF2A 3KP0E 3UMMA 1YKMB 3FYCA 4FWGA 4KLNA 4I8OA 4FW9A 4LGYA 4JI4M 4LJ8A 4NRVA 5ITUA 3PCKA 4G4QA 3ZCBB 2BUZA 4Z6YA 3FUTA 4D81A 4AQYM 3KFUG 3GLGB 2QZ4A 4WHOB 2D7GA 2DZOB 3FUWA 4WHQB 2Z4SA 4DR6M 1EO9B 1QQWA 2BUVA 4JI3M 8CATA 2C96A 1R2ZA 4BLCA 4M0WA 3GLIA 3GRUA 4AI6A 4X65M 1XWIA 3PVSA 4LFBM 4G6ZA 3SMSA 3U6OA 2KZUA 3GRVA 1K3WA 3AJIB 1HR0M 1SXJE 1UM8A 4GRIA 4JI0M 3H4MA 4MGIE 2AHMA 2Z3XA 4KO8A 4KODA 3SASA 1FNNA 4I81A 1L2DA 1EOCB 4MGKE 2XSRA 2CEAA 4WHSB 3GPYA 1PJJA 2BJVA 2KW0A 4OU7A 3U6SA 4YY3M 1Z5BA 2XH9A 2UXBM 3SHGB 2BUUA 3K8ZA 1DO0A 1ZQ9A 4FVMA 5LMUM 4QHTA 1IY1A 3O32A 1Q3CA 1XC8A 3PXGA 4GHLA 2VQEM 3PCEA 1EOAB 3T38A 1E32A 4MM3B 3B9PA 4IBCA 4DR5M 4XBOA 3J7BA 4JI1M 1DGBA 2L6OA 5ITTA 1L1ZA 5FLXS 1YKNA 3AOEC 1G3IA 4LJ5A 2AZQA 4KHPM 3PCFM 1H6UA 1EO2A 3GLFB 3LXVA 1QZMA 5ITQA 1IN8A 4BBAA 4WW0A 4NXNM 2DXIA 2BV0B 2H1RA 4JI2M 1L8QA 3QWLA 4X66M 3R9XB 1C1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PCL A;  3HGI A;  3PCD A;  3PCB A;  1YKL A;  2PCD M;  1DMH A;  3PCH A;  1YKM A;  1YKL B;  2BUM B;  3MFL M;  3PCI A;  1DLT A;  3LMX M;  3LKT A;  3LXV M;  3HKP A;  3MV6 A;  2BUW A;  1EOB A;  3MI5 M;  3MI1 A;  3PCG A;  2BUW B;  1EOB B;  1YKP A;  3O5U A;  1YKP B;  3PCL M;  3T67 A;  3PCD M;  3PCB M;  4ILV A;  2BV0 A;  3PCH M;  4WHR A;  3PCI M;  2BV0 B;  3LKT M;  5TD3 A;  3PCC A;  4WHR B;  3MV6 M;  4WHP A;  3MI1 M;  3PCG M;  2BUY A;  4WHP B;  4WHS D;  3HHY A;  2BUY B;  1S9A A;  1YKK A;  1YKM B;  4WHO D;  3I51 A;  3T63 A;  1YKK B;  1EOC A;  3T67 M;  3PCK A;  1DLM A;  3PCM A;  4WHO A;  1TMX A;  2BUZ A;  4WHO B;  3PCC M;  2BUZ B;  4WHQ A;  1EO9 A;  4WHQ B;  3O6J A;  3PCN A;  1EO9 B;  1EOA A;  2BUV A;  2BOY A;  3O6R A;  2BUV B;  3T63 M;  2BUR A;  3O32 A;  1YKO A;  2BUR B;  3PCK M;  1DLQ A;  1YKO B;  3HHX A;  3PCM M;  2BUT A;  3MV4 A;  3N9T A;  2BUQ A;  3PCA A;  2BUT B;  4WHS A;  1EOC B;  2XSR A;  2XSV A;  2BUQ B;  3HJ8 A;  3PCN M;  4WHS B;  2XSU A;  4ILT A;  3PCF A;  2BUU A;  4WHR F;  2BUU B;  3I4V A;  2BUM A;  3I4Y A;  3PCJ A;  3PCE A;  1EOA B;  3MV4 M;  3PCA M;  2PCD A;  1YKN A;  2AZQ A;  3MFL A;  1YKN B;  3PCF M;  3LMX A;  1EO2 A;  3LXV A;  3TH1 A;  1EO2 B;  3MI5 A;  4WHP D;  3HJS A;  3PCJ M;  2BUX A;  3PCE M;  3HJQ A;  2BUX B; 
#chains in the Genus database with same CATH topology
 1IXS B;  3KOX E;  5C1B A;  3GO8 A;  5JI2 E;  1OIZ A;  1R6B X;  2W82 A;  4IBG A;  3PCB A;  2G3Q A;  5EP3 A;  3U61 B;  2LVA A;  4L8R C;  3L2A A;  2DEN A;  3PCH A;  4XK8 F;  4LF4 M;  1NJF A;  1YKL B;  1TH3 A;  2QSF X;  2B3T A;  4NL4 H;  3LMX M;  3RGP A;  4GH9 A;  3MV6 A;  1WGN A;  3WHK A;  2WSF F;  2L7H A;  2HHH M;  3MI5 M;  2QPA A;  2EO2 A;  1TGU A;  5E6J A;  2FH0 A;  3R8F A;  3L27 A;  3J27 B;  4MGZ E;  4DV6 M;  1EOB B;  4K0K M;  3C3E A;  1YLA A;  4QNM A;  4DV5 M;  3U6M A;  3O5U A;  2XZF A;  2DAM A;  1YKP B;  2JZ1 A;  5KPT A;  3PCL M;  5DFL A;  2FS1 A;  3LVW A;  5FTK A;  1N36 M;  4DV3 M;  2BV0 A;  2ERC A;  1Q39 A;  1QAO A;  2XF3 A;  3LKT M;  3IG8 A;  5EP4 A;  2HKJ A;  4IIW A;  4YHH M;  2EKF A;  4AG5 A;  3GLG E;  4LZZ A;  4L78 A;  1QUS A;  3HHW A;  3PCC A;  2MGW A;  3FTC A;  5IRE B;  4DUZ M;  4WHP A;  1GL7 A;  2L7I A;  1DGH A;  1XHB A;  3MI1 M;  3FRI A;  5KO3 A;  3U5Z B;  2CHQ A;  1J09 A;  4QOZ C;  1S9A A;  1YKK A;  3FE3 A;  4WUR A;  4PD2 A;  2GQF A;  4JI8 M;  3UJN A;  2LBC A;  4GIP A;  2K6B A;  4FWD A;  4D80 A;  1XXH B;  2UUC M;  3B7Z A;  1FJG M;  4IBI A;  3NBX X;  4NRW A;  1DLM A;  3U6E A;  5C18 A;  5FTN A;  5EJC A;  2ZAO A;  1TDZ A;  4LCB A;  4PT5 A;  1IXZ A;  3GPX A;  2UXC M;  2FFJ A;  2RRU A;  3KSX A;  2LXE A;  2BUZ B;  2CHV A;  4RF0 A;  1HT1 E;  1JR3 E;  2O25 A;  1SXJ C;  2J5Y A;  2ZTD A;  3OTO M;  1HJP A;  3TWM A;  4LF9 M;  3BOS A;  2BJW A;  2FNA A;  3B89 A;  3O6J A;  3HU2 A;  2HL7 A;  1ZMU A;  3LW5 F;  4DV4 M;  3PCN A;  1WIV A;  1SXJ A;  1PJI A;  4JV5 M;  3J80 S;  1EIJ A;  4GEW A;  2C99 A;  3SBJ A;  2BUV B;  2BWB A;  2BUR A;  3HY5 A;  1GL6 A;  4X62 M;  1DO2 A;  2V6Z M;  2R65 A;  1R2Y A;  3SAR A;  5GKN A;  1XNQ M;  1YKO A;  3ZC7 B;  1N77 A;  1Y8G A;  2J7N A;  2V1U A;  1ZMV A;  4QNR A;  3HHX A;  1OFH A;  3GLI B;  2OO9 A;  3PCM M;  1D0M A;  4M9S A;  3T1Y M;  1PRB A;  2HAK A;  1HR0 M;  2CP8 A;  1NY6 A;  1PJS A;  5EXX A;  3MV4 A;  4G4N A;  3PCA A;  2EUC A;  2VII A;  5FTJ A;  3FUX A;  5EXS A;  3HJ8 A;  2E5L M;  4LFC M;  3K2L A;  4IBB A;  1J5E M;  1OKS A;  1NHG C;  3U60 A;  1N78 A;  2XSU A;  2JP7 A;  4JN6 A;  4ILT A;  3AL0 C;  1E94 E;  3GLH A;  4CJ6 A;  2MRO B;  3TQS A;  4D82 A;  2UUA M;  4WHR F;  2DZN B;  1LV7 A;  1OIP A;  2VF8 A;  2BUU B;  3I4V A;  4FCV A;  2BUM A;  4I5S A;  1QYR A;  5KPR A;  4DV7 M;  1BVS A;  2DWL A;  3K9O A;  1JB0 F;  3QYE A;  3PNY A;  1VG5 A;  3LCV B;  3LXV M;  4R3D A;  2QBY A;  1YKN B;  3E4R A;  1VDL A;  2Q2E B;  5EXP A;  1KYI A;  3JR5 A;  2OQ4 A;  1QUT A;  5EP2 A;  1EO2 B;  1IY2 A;  3U6Q A;  2F5S A;  2DAG A;  4II7 A;  2LHC A;  3J81 S;  1ZMW A;  2HCB A;  2LNH C;  2Y0T A;  1I94 M;  3PCJ M;  2BUX A;  4AKI A;  3CTW B;  1TH2 A;  4HL4 A;  1IXR C;  1D2N A;  2BNK A;  2XEP A;  1MN3 A;  3RE8 A;  1EFU B;  4FD2 A;  4IJF A;  3PCD A;  2Z8Y M;  2LH0 A;  3FKE A;  2PCD M;  3DZD A;  2H5X A;  3VLF B;  3MK6 A;  1QAQ A;  1NSF A;  2KRK A;  4LJ7 A;  1IN5 A;  3DFZ A;  4LJ6 A;  4Y28 F;  3TWL A;  2GNO A;  2WSC F;  2OPF A;  2XZU A;  3KS8 A;  3MFL M;  2XSZ D;  5IZ7 D;  2UU9 M;  4GKK M;  2Y20 A;  3GPP A;  3HKP A;  3KS4 A;  1IN4 A;  3A98 B;  1PGY A;  3FD9 A;  2X8A A;  3AOG A;  3JAM S;  2UXD M;  2C9O A;  3FTF A;  4BB9 A;  3T63 M;  1Z6T A;  5FTL A;  2DWN A;  4WP2 A;  2DAK A;  1TTE A;  3NWL A;  2O01 F;  3A42 A;  3TL4 X;  3GRY A;  4OVZ A;  4P16 A;  1Z5C A;  3T6P A;  1YKM A;  1V34 A;  1XXH E;  3W67 A;  3GPU A;  3KOZ E;  3HHZ A;  3KOW E;  4WHR A;  1N32 M;  1R4G A;  3W0F A;  2YQZ A;  2EA0 A;  3D8B A;  1JQJ C;  1K3W A;  2DNA A;  1R7R A;  4AZF A;  3KXE C;  1JR3 D;  3T1H M;  3SYK A;  1CUK A;  7CAT A;  2L4E A;  2DWM A;  2F4V M;  2O5R A;  2OOB A;  2X49 A;  4RNA A;  1HNZ M;  2BUY A;  3PCG M;  4WHP B;  1VEK A;  4B7F A;  4B08 A;  2QP9 X;  3HHY A;  3Q8G A;  3SC3 A;  1DGH B;  1PM5 A;  1K3X A;  1JR3 A;  2JXN A;  4CIZ A;  3LVV A;  4PDI A;  1EOC A;  4DR1 M;  1YKK B;  3T67 M;  3C58 A;  4IJE A;  2DVW B;  4DR3 M;  4DV1 M;  1XMO M;  3RGS A;  3FTE A;  1YSY A;  5EP1 A;  1MJG M;  4MB7 A;  4RKU F;  4B3S M;  4M9Z A;  1WGL A;  3M7G A;  4IBE A;  2ZAM A;  3KOY E;  3KW6 A;  3LQQ A;  1VDD A;  4L15 A;  1X37 A;  4LY6 A;  2L2D A;  2KA6 B;  4QHS A;  1OTR A;  1EOA A;  2F5N A;  1Q3B A;  4RF1 A;  1N75 A;  4NOO B;  3FUV A;  5KQD A;  3TE6 A;  3O6R A;  1I4W A;  1SXJ B;  2J7O A;  2F5Q A;  4B3T M;  1N34 M;  1D0L A;  4LRT A;  2RGO A;  2BUR B;  4R71 A;  3PCK M;  1HQC A;  1YKO B;  2R6F A;  1KSF X;  3TWK A;  2XFS A;  2CHG A;  4PDG A;  4B7H A;  2BUT A;  1A5T A;  2BUQ A;  3CF6 E;  1AUA A;  1VEG A;  1L2C A;  4IBJ A;  4DV0 M;  3VDU A;  1PJT A;  3IEC A;  3HU1 A;  4W5W A;  4LF5 M;  4LG2 A;  2Z7J A;  2ZM6 M;  3PCF A;  1IN6 A;  1W5T A;  3U60 B;  2ZAN A;  3PFI A;  5L8R F;  4LJ9 A;  3KVW A;  2R44 A;  2CFO A;  1PJQ A;  1T6O A;  2QEN A;  3GLH B;  3TPZ A;  3I4Y A;  4IBF A;  1IBL M;  3VKH A;  2R4E A;  1EE8 A;  1WR1 B;  5KPZ A;  5IWA M;  4DBG B;  1ORY B;  2R62 A;  4FCW A;  3HZJ A;  1NV9 A;  1S3S A;  2R18 A;  2VDB B;  2R46 A;  2DZL A;  3SMP A;  3U6D A;  4REZ A;  3VK7 A;  3SAU A;  1WHC A;  3FRH A;  1IM2 A;  4GC5 A;  2P5T A;  2JY7 A;  3KSJ A;  1C7Y A;  3LMX A;  2JY6 B;  2K47 A;  4GMQ A;  3JR4 A;  2QBY B;  3TH1 A;  2LVP C;  2DAI A;  3MI5 A;  4CHT B;  3FUU A;  2D7H A;  2X4A A;  3LQR A;  4MGY E;  3FTD A;  3PCE M;  4X64 M;  4B3R M;  1E9S A;  3KP1 E;  2NQ8 C;  1IBK M;  3PNV A;  2BUX B;  3HU3 A;  1TF0 B;  4DUY M;  2MR9 A;  3GLF E;  1GLN A;  1GVN A;  3NBI A;  1G8P A;  3PCL A;  3U6C A;  1DMH A;  4GHA A;  2JY8 A;  2Z4R A;  2C9C A;  1TDH A;  1OJL A;  1OFI A;  3D8L A;  4JYA M;  4DR2 M;  4LF7 M;  3GQ3 A;  1MU5 A;  1NV8 A;  1XXH A;  2A5Y B;  3E46 A;  3W0L B;  2BUW A;  2DAE A;  2DI0 A;  2EJS A;  2R4J A;  3MI1 A;  3UGJ A;  2YNM D;  2QQ8 A;  1QAM A;  2XGN A;  2KZS A;  1HT2 E;  1NNJ A;  3C3D A;  1IY0 A;  1QAN A;  1NY5 A;  4LF8 M;  3LMM A;  1TH4 A;  2D7E A;  4OVZ B;  4FCT A;  1HNW M;  3PCB M;  5BPV A;  1K82 A;  5IT9 S;  1GJS A;  1QDR A;  5ITX E;  3SAS A;  2CV0 A;  4ILV A;  3PCH M;  2KRU A;  2M5Z A;  3SAW A;  3L26 A;  3B74 A;  4WHS D;  1IFY A;  4WHR B;  3MV6 M;  2XFT A;  3CF0 A;  1YUB A;  1AIP C;  1P3Q Q;  1OQY A;  1T3T A;  3GRR A;  3W68 A;  2G8L A;  2BUY B;  3MJ5 A;  4LJA A;  1Z5A A;  3HWS A;  4G4R A;  3VKG A;  4WHO D;  3I51 A;  3WHL A;  3SFZ A;  4I4L A;  1XB2 B;  1N33 M;  3T63 A;  3VK8 A;  3SAV A;  3K92 A;  1J7K A;  2MH8 A;  1V33 A;  3DOA A;  4NSO B;  3PCI A;  2DWZ B;  2I7N A;  2XSZ A;  5ITY A;  3GLG A;  3C9P A;  3PCM A;  1Z59 A;  4OX9 M;  1TMX A;  4WHO A;  1DGF A;  5A2Q S;  4G4O A;  4AKG A;  5EQT A;  2Z3X A;  3PCC M;  1QVR A;  4WHQ A;  5E26 A;  2UUB M;  4JI6 M;  5F3W A;  4IBD A;  4LZJ A;  2JNH A;  3A46 A;  1EO9 A;  4DR7 M;  4MH0 E;  1VQ1 A;  4Z8X A;  5H37 D;  4JI7 M;  1E9R A;  1ZAE A;  5DYG A;  5JI3 E;  4LRS A;  3ZQJ A;  2BOY A;  1HQY E;  4R7G A;  3DA1 A;  3SHF A;  5LMN M;  3GQ5 A;  2CV2 A;  2KXE A;  4GIT A;  1DLQ A;  3THG A;  2V1C A;  3B7N A;  4DV2 M;  4CIS A;  2LVN C;  4EIW A;  4A3V B;  1QZE A;  4KT0 F;  3N9T A;  2R45 A;  4HEO A;  1UFZ A;  2JUJ A;  3QYB A;  3AOE A;  5BR8 M;  2BUT B;  4WHS A;  2KHH A;  2RGH A;  2BUQ B;  4HLQ A;  2XSV A;  3PCN M;  3QAU A;  3GLI E;  3H4J A;  2LTU A;  3BBZ A;  1GKI A;  1L2B A;  3V76 A;  3EIE A;  2JZ0 A;  3VDP A;  2ZTC A;  3ZH9 B;  5KQ8 A;  1TR8 A;  1NNU C;  2C98 A;  3IHP A;  1XMQ M;  2YFQ A;  4FWH A;  1L1T A;  1DGG A;  3E9S A;  3J2P B;  3UK6 A;  4JI5 M;  1GJT A;  2RKO A;  3I01 M;  4IBK A;  3K1J A;  4UN2 B;  3UZU A;  2CE7 A;  2C5R A;  3PCJ A;  2N35 A;  2EKK A;  1G41 A;  2QCU A;  3M6A A;  4GC9 A;  3MV4 M;  1OAI A;  1RU3 A;  3HX3 A;  4M0D A;  3GQ4 A;  3PCA M;  3Q8X A;  3AFH A;  2ZBK B;  1G4A E;  2FOI C;  4ANR A;  2PCD A;  4DR4 M;  2KNZ A;  3GLF A;  2L4F A;  3MFL A;  2WSE F;  4L4U A;  2VQF M;  3FYD A;  1R5L A;  4LGM A;  1IQP A;  4ZPX A;  1IN7 A;  3M0E A;  4TUW A;  2CV1 A;  3U6P A;  4PCZ A;  1XNR M;  4JXJ A;  2DKL A;  4WHP D;  3HJS A;  4S12 A;  2G5G X;  4OW0 A;  3L25 A;  1DV0 A;  1F4I A;  1IXS A;  2Y0Q A;  3HJQ A;  5ITR A;  1NVM A;  3L29 A;  3U6L A;  1ZV1 A;  4QOS A;  5DYI A;  3U61 A;  5FSW A;  1NHW C;  1G59 A;  3HGI A;  4ITQ A;  1YKL A;  3IG5 A;  3MHV C;  2LWX A;  4AKH A;  1T43 A;  5FTM A;  3GP1 A;  3A45 A;  3KDS E;  4L16 A;  5EXT A;  2BUM B;  1DLT A;  2JY5 A;  4CGY B;  5ITX A;  2LHG A;  4GKJ M;  2DHR A;  4B7G A;  2F5O A;  4AG6 A;  3SYL A;  4B3M M;  1EOB A;  3ILK A;  4NXM M;  3VFD A;  2BUW B;  4LJ4 A;  3RFW A;  4LF6 M;  3PCG A;  2F5P A;  1YE9 A;  2CRU A;  2M60 A;  1YKP A;  1W5S A;  2BWE A;  3AV0 A;  4MGH A;  2K0B X;  4NSR A;  1HNX M;  2KEB A;  1SXJ D;  2JA2 A;  2K9D A;  1LTM A;  3B7Q A;  3EIH A;  1NJG A;  4Q7J A;  4XGI A;  3PCD M;  3J7A S;  3T67 A;  4M9X A;  2Y21 A;  1Q02 A;  1OAO C;  2L09 A;  5DNY A;  3T15 A;  2CUZ A;  2HWJ A;  3SAT A;  3PCI M;  2VF7 A;  5TD3 A;  2YR0 A;  1IBM M;  2FE8 A;  2XLJ A;  2I7P A;  4LFA M;  4NC6 A;  1MX0 A;  3U5Z A;  1WXQ A;  1KFV A;  3AKZ A;  4AW4 A;  3L28 A;  3CF2 A;  3F92 A;  3KP0 E;  3UMM A;  1YKM B;  3FYC A;  4FWG A;  4KLN A;  4I8O A;  4FW9 A;  4LGY A;  4JI4 M;  4LJ8 A;  4NRV A;  5ITU A;  3PCK A;  4G4Q A;  3LCU A;  1GAB A;  3ZCB B;  2BUZ A;  4Z6Y A;  3FUT A;  4D81 A;  4AQY M;  3KFU G;  1SG9 A;  2QZ4 A;  3GLG B;  4WHO B;  2D7G A;  2DZO B;  3FUW A;  4L6V 6;  3I04 M;  1VEJ A;  4WHQ B;  2Z4S A;  1D0K A;  4DR6 M;  3BXW A;  1EO9 B;  1QQW A;  2BUV A;  4JI3 M;  8CAT A;  2C96 A;  1R2Z A;  2OOA A;  2CWB A;  4F1I A;  4BLC A;  3K9P A;  4M0W A;  3GLI A;  2KDL A;  3GRU A;  4AI6 A;  1NO1 A;  4X65 M;  1XWI A;  3PVS A;  2KNV A;  4LFB M;  4G6Z A;  3SMS A;  3LKT A;  3U6O A;  2KZU A;  3GRV A;  3E21 A;  3AJI B;  4P17 A;  1SXJ E;  1UM8 A;  2R0I A;  3MMP A;  3H4M A;  2JWS A;  2AHM A;  4GRI A;  4KO8 A;  4KOD A;  4MGI E;  4JI0 M;  1FNN A;  4I81 A;  1L2D A;  1EOC B;  4MGK E;  2XSR A;  2CEA A;  4WHS B;  1G71 A;  3GPY A;  1PJJ A;  2BJV A;  2KW0 A;  3CGW A;  4OU7 A;  3U6S A;  2WZJ A;  4YY3 M;  1Z5B A;  2LVQ D;  2QNJ A;  2DHY A;  2XH9 A;  2UXB M;  2KNA A;  3SHG B;  2BUU A;  3K8Z A;  1DO0 A;  1ZQ9 A;  4FVM A;  5LMU M;  4QHT A;  1IY1 A;  3O32 A;  1Q3C A;  1XC8 A;  3PXG A;  4GHL A;  2VQE M;  2APL A;  3PCE A;  2MJ5 B;  3T38 A;  1E32 A;  1EOA B;  4MM3 B;  3B9P A;  4IBC A;  4DR5 M;  4XBO A;  2QHO B;  3J7B A;  4JI1 M;  4F2L A;  1DGB A;  2L6O A;  5ITT A;  4G3O A;  1QDT A;  3GLH E;  1L1Z A;  1WJ7 A;  5FLX S;  1YKN A;  2LVO C;  1G3I A;  3AOE C;  4LJ5 A;  2AZQ A;  1V92 A;  4KHP M;  3PCF M;  1H6U A;  1EO2 A;  3GLF B;  3LXV A;  1QZM A;  5ITQ A;  1IN8 A;  4BBA A;  4WW0 A;  4NXN M;  2DXI A;  1GO5 A;  2BV0 B;  2H1R A;  4JI2 M;  1L8Q A;  3QWL A;  4X66 M;  3R9X B;  1C1K A; 
#chains in the Genus database with same CATH homology
 1IXS B;  3KOX E;  5C1B A;  3GO8 A;  5JI2 E;  1R6B X;  4IBG A;  2W82 A;  3PCB A;  5EP3 A;  3U61 B;  4L8R C;  3L2A A;  3PCH A;  4LF4 M;  1YKL B;  1NJF A;  1TH3 A;  4NL4 H;  3LMX M;  3RGP A;  4GH9 A;  3MV6 A;  3WHK A;  2L7H A;  2HHH M;  3MI5 M;  2QPA A;  2EO2 A;  1TGU A;  5E6J A;  3R8F A;  3L27 A;  3J27 B;  4MGZ E;  4DV6 M;  1EOB B;  4K0K M;  4QNM A;  4DV5 M;  3U6M A;  3O5U A;  2XZF A;  1YKP B;  5KPT A;  3PCL M;  1N36 M;  3LVW A;  5FTK A;  4DV3 M;  2BV0 A;  2ERC A;  1Q39 A;  1QAO A;  2XF3 A;  3LKT M;  3IG8 A;  5EP4 A;  2HKJ A;  4IIW A;  4YHH M;  4AG5 A;  4G4R A;  4GKK M;  4LZZ A;  4L78 A;  3HHW A;  3PCC A;  4WHP A;  3FTC A;  5IRE B;  4DUZ M;  1GL7 A;  2L7I A;  1DGH A;  1XHB A;  3MI1 M;  5KO3 A;  3U5Z B;  2CHQ A;  1J09 A;  4QOZ C;  1S9A A;  1YKK A;  4WUR A;  4PD2 A;  4JI8 M;  3UJN A;  4GIP A;  4FWD A;  4D80 A;  1XXH B;  2UUC M;  1FJG M;  4IBI A;  1DLM A;  4NRW A;  3U6E A;  5C18 A;  5FTN A;  5EJC A;  2ZAO A;  1TDZ A;  4LCB A;  4PT5 A;  1IXZ A;  3GPX A;  2UXC M;  2FFJ A;  3KSX A;  2LXE A;  2BUZ B;  2CHV A;  4RF0 A;  1HT1 E;  3OTO M;  3TWM A;  1SXJ C;  4LF9 M;  3BOS A;  2BJW A;  2FNA A;  3O6J A;  3HU2 A;  2HL7 A;  4DV4 M;  3PCN A;  1SXJ A;  1PJI A;  4JV5 M;  3J80 S;  2C99 A;  3SBJ A;  2BUV B;  3T63 M;  2BUR A;  4X62 M;  1GL6 A;  1XNQ M;  1DO2 A;  2V6Z M;  2R65 A;  1R2Y A;  3SAR A;  5GKN A;  1YKO A;  3ZC7 B;  1N77 A;  2J7N A;  2V1U A;  4QNR A;  3HHX A;  1OFH A;  3GLI B;  3PCM M;  4M9S A;  3T1Y M;  3MV4 A;  1NY6 A;  5EXX A;  4G4N A;  3PCA A;  2EUC A;  2VII A;  5FTJ A;  3FUX A;  5EXS A;  3HJ8 A;  2E5L M;  4LFC M;  3K2L A;  4IBB A;  1J5E M;  1N78 A;  1NHG C;  3U60 A;  2XSU A;  4JN6 A;  4ILT A;  3AL0 C;  1E94 E;  3GLH A;  2UUA M;  4D82 A;  3TQS A;  4WHR F;  2DZN B;  1LV7 A;  2BUU B;  3I4V A;  4FCV A;  2BUM A;  4I5S A;  1QYR A;  5KPR A;  4DV7 M;  2DWL A;  3PNY A;  4R3D A;  2QBY A;  1YKN B;  3E4R A;  2Q2E B;  5EXP A;  1KYI A;  3JR5 A;  2OQ4 A;  5EP2 A;  1EO2 B;  1IY2 A;  3U6Q A;  2F5S A;  4II7 A;  3J81 S;  2Y0T A;  2HCB A;  2LNH C;  1I94 M;  3PCJ M;  2BUX A;  3CTW B;  1TH2 A;  4HL4 A;  1IXR C;  1D2N A;  2BNK A;  2XEP A;  3RE8 A;  4IJF A;  4FD2 A;  3PCD A;  2LH0 A;  3FKE A;  2PCD M;  3DZD A;  3VLF B;  3MK6 A;  1QAQ A;  1NSF A;  2KRK A;  4LJ7 A;  1IN5 A;  3DFZ A;  4LJ6 A;  3TWL A;  2OPF A;  2XZU A;  1YKM A;  3MFL M;  3PCI A;  3KS8 A;  2XSZ D;  5IZ7 D;  2UU9 M;  2Y20 A;  3GPP A;  3HKP A;  3KS4 A;  1IN4 A;  3A98 B;  3FD9 A;  2X8A A;  3AOG A;  3JAM S;  2UXD M;  2C9O A;  3FTF A;  4BB9 A;  1Z6T A;  5FTL A;  2DWN A;  3NWL A;  3A42 A;  3TL4 X;  3GRY A;  4OVZ A;  4P16 A;  1Z5C A;  3GPU A;  3KOZ E;  3HHZ A;  3KOW E;  4WHR A;  1N32 M;  3W0F A;  2YQZ A;  2EA0 A;  3D8B A;  1JQJ C;  4AKI A;  4AZF A;  1R7R A;  3T1H M;  3KXE C;  1JR3 D;  2DWM A;  3SYK A;  7CAT A;  2F4V M;  2O5R A;  1HNZ M;  2X49 A;  4RNA A;  2BUY A;  3PCG M;  4WHP B;  4WHS D;  4B08 A;  4B7F A;  2QP9 X;  3HHY A;  3SC3 A;  1PM5 A;  1DGH B;  1K3X A;  1JR3 A;  3LVV A;  4PDI A;  1EOC A;  4DR1 M;  1YKK B;  3T67 M;  3C58 A;  4IJE A;  2DVW B;  4DR3 M;  4DV1 M;  1XMO M;  3RGS A;  3FTE A;  1YSY A;  5EP1 A;  4MB7 A;  4B3S M;  4M9Z A;  3M7G A;  4IBE A;  4LY6 A;  2ZAM A;  3KOY E;  3KW6 A;  3LQQ A;  1VDD A;  4L15 A;  1X37 A;  2KA6 B;  4QHS A;  1EOA A;  2F5N A;  1Q3B A;  4RF1 A;  1N75 A;  4NOO B;  3FUV A;  5KQD A;  3TE6 A;  3O6R A;  1I4W A;  1SXJ B;  2J7O A;  2F5Q A;  4B3T M;  1N34 M;  4LRT A;  2RGO A;  2BUR B;  3PCK M;  1HQC A;  1YKO B;  1KSF X;  3TWK A;  2XFS A;  2CHG A;  4PDG A;  4B7H A;  2BUT A;  2BUQ A;  3CF6 E;  1L2C A;  4IBJ A;  4DV0 M;  3VDU A;  4W5W A;  3HU1 A;  4LF5 M;  4LG2 A;  2Z7J A;  2ZM6 M;  3PCF A;  1IN6 A;  1W5T A;  3U60 B;  2ZAN A;  3PFI A;  4LJ9 A;  3KVW A;  2CFO A;  3GLH B;  2QEN A;  3TPZ A;  3I4Y A;  4IBF A;  1IBL M;  3VKH A;  2R4E A;  1EE8 A;  5KPZ A;  5IWA M;  1ORY B;  2R62 A;  4FCW A;  1S3S A;  2R18 A;  2R46 A;  3SMP A;  3U6D A;  4REZ A;  3VK7 A;  3SAU A;  1IM2 A;  4GC5 A;  2P5T A;  3KSJ A;  3LMX A;  2K47 A;  4GMQ A;  3JR4 A;  2QBY B;  3TH1 A;  3MI5 A;  4CHT B;  3FUU A;  2D7H A;  2X4A A;  3LQR A;  4MGY E;  3FTD A;  3PCE M;  4X64 M;  4B3R M;  1E9S A;  3KP1 E;  2NQ8 C;  1IBK M;  3PNV A;  2BUX B;  3HU3 A;  4DUY M;  1GLN A;  1GVN A;  3NBI A;  1G8P A;  3PCL A;  3U6C A;  1DMH A;  4GHA A;  2Z4R A;  2C9C A;  1TDH A;  1OJL A;  1OFI A;  3D8L A;  4JYA M;  4DR2 M;  4LF7 M;  3GQ3 A;  1MU5 A;  1XXH A;  3W0L B;  2A5Y B;  3LKT A;  2BUW A;  3LXV M;  2R4J A;  3MI1 A;  3UGJ A;  2YNM D;  1QAM A;  2XGN A;  2KZS A;  1HT2 E;  1NNJ A;  1IY0 A;  1QAN A;  1NY5 A;  4LF8 M;  3LMM A;  1TH4 A;  2D7E A;  4OVZ B;  4FCT A;  1HNW M;  3PCB M;  5BPV A;  1K82 A;  5IT9 S;  5ITX E;  2CV0 A;  4ILV A;  3PCH M;  2KRU A;  2M5Z A;  3SAW A;  3L26 A;  4WHR B;  3MV6 M;  2XFT A;  3CF0 A;  1YUB A;  1T3T A;  3GRR A;  2G8L A;  2BUY B;  3MJ5 A;  4LJA A;  1Z5A A;  3HWS A;  3VKG A;  4WHO D;  3I51 A;  3WHL A;  3SFZ A;  4I4L A;  1N33 M;  3T63 A;  3VK8 A;  3SAV A;  3K92 A;  1J7K A;  3DOA A;  4NSO B;  3PCM A;  2DWZ B;  2I7N A;  2XSZ A;  5ITY A;  3GLG A;  4WHO A;  1Z59 A;  4OX9 M;  1TMX A;  1DGF A;  5A2Q S;  4G4O A;  4AKG A;  5EQT A;  3PCC M;  1QVR A;  4WHQ A;  5E26 A;  2UUB M;  4JI6 M;  5F3W A;  4IBD A;  4LZJ A;  1EO9 A;  3A46 A;  4DR7 M;  4MH0 E;  4Z8X A;  5H37 D;  4JI7 M;  1E9R A;  1ZAE A;  5DYG A;  5JI3 E;  4LRS A;  2BOY A;  1HQY E;  4R7G A;  3DA1 A;  3SHF A;  5LMN M;  3GQ5 A;  2CV2 A;  2KXE A;  4GIT A;  1DLQ A;  3THG A;  2V1C A;  4DV2 M;  4CIS A;  4EIW A;  4A3V B;  3N9T A;  2R45 A;  5BR8 M;  3AOE A;  2BUT B;  4WHS A;  2RGH A;  2BUQ B;  4HLQ A;  2XSV A;  3PCN M;  3QAU A;  1GKI A;  1L2B A;  3EIE A;  3VDP A;  3ZH9 B;  5KQ8 A;  2C98 A;  1NNU C;  1XMQ M;  1L1T A;  2YFQ A;  4FWH A;  1DGG A;  3E9S A;  3J2P B;  3UK6 A;  4JI5 M;  2RKO A;  3UZU A;  4IBK A;  2C5R A;  3K1J A;  2CE7 A;  3PCJ A;  1G41 A;  2QCU A;  3M6A A;  4GC9 A;  3MV4 M;  4M0D A;  3GQ4 A;  3PCA M;  3Q8X A;  3AFH A;  2ZBK B;  1G4A E;  2FOI C;  2PCD A;  4DR4 M;  3GLF A;  3MFL A;  4L4U A;  2VQF M;  3FYD A;  4LGM A;  1IQP A;  4ZPX A;  1IN7 A;  3M0E A;  4TUW A;  2CV1 A;  3U6P A;  4PCZ A;  1XNR M;  4JXJ A;  4WHP D;  3HJS A;  4S12 A;  2G5G X;  4OW0 A;  3L25 A;  2Y0Q A;  3HJQ A;  5ITR A;  3L29 A;  1NVM A;  3U6L A;  4QOS A;  5DYI A;  3U61 A;  5FSW A;  1NHW C;  1G59 A;  3HGI A;  4ITQ A;  1YKL A;  3IG5 A;  3MHV C;  2LWX A;  4AKH A;  5FTM A;  3GP1 A;  3A45 A;  3KDS E;  4L16 A;  5EXT A;  2BUM B;  1DLT A;  4CGY B;  5ITX A;  4GKJ M;  2DHR A;  4B7G A;  2F5O A;  4AG6 A;  3SYL A;  4B3M M;  1EOB A;  3ILK A;  4NXM M;  3VFD A;  2BUW B;  4LJ4 A;  3RFW A;  4LF6 M;  3PCG A;  2F5P A;  1YE9 A;  2M60 A;  1YKP A;  1W5S A;  3AV0 A;  4MGH A;  4NSR A;  1HNX M;  2KEB A;  1SXJ D;  2JA2 A;  3EIH A;  1NJG A;  4XGI A;  3PCD M;  3T67 A;  3J7A S;  4M9X A;  2Y21 A;  2L09 A;  5DNY A;  3T15 A;  2CUZ A;  3SAT A;  3PCI M;  5TD3 A;  2YR0 A;  1IBM M;  2FE8 A;  2XLJ A;  2I7P A;  4LFA M;  1MX0 A;  3U5Z A;  1WXQ A;  1KFV A;  3AKZ A;  4AW4 A;  3L28 A;  3CF2 A;  3KP0 E;  3UMM A;  1YKM B;  3FYC A;  4FWG A;  4KLN A;  4I8O A;  4FW9 A;  4LGY A;  4JI4 M;  4LJ8 A;  4NRV A;  5ITU A;  3PCK A;  4G4Q A;  3ZCB B;  2BUZ A;  4Z6Y A;  3FUT A;  4D81 A;  4AQY M;  3KFU G;  3GLG B;  2QZ4 A;  4WHO B;  2D7G A;  2DZO B;  3FUW A;  4WHQ B;  2Z4S A;  4DR6 M;  1EO9 B;  1QQW A;  2BUV A;  4JI3 M;  8CAT A;  2C96 A;  1R2Z A;  4BLC A;  4M0W A;  3GLI A;  3GRU A;  4AI6 A;  4X65 M;  1XWI A;  3PVS A;  4LFB M;  4G6Z A;  3SMS A;  3U6O A;  2KZU A;  3GRV A;  1K3W A;  3AJI B;  1HR0 M;  1SXJ E;  1UM8 A;  4GRI A;  4JI0 M;  3H4M A;  4MGI E;  2AHM A;  2Z3X A;  4KO8 A;  4KOD A;  3SAS A;  1FNN A;  4I81 A;  1L2D A;  1EOC B;  4MGK E;  2XSR A;  2CEA A;  4WHS B;  3GPY A;  1PJJ A;  2BJV A;  2KW0 A;  4OU7 A;  3U6S A;  4YY3 M;  1Z5B A;  2XH9 A;  2UXB M;  3SHG B;  2BUU A;  3K8Z A;  1DO0 A;  1ZQ9 A;  4FVM A;  5LMU M;  4QHT A;  1IY1 A;  3O32 A;  1Q3C A;  1XC8 A;  3PXG A;  4GHL A;  2VQE M;  3PCE A;  1EOA B;  3T38 A;  1E32 A;  4MM3 B;  3B9P A;  4IBC A;  4DR5 M;  4XBO A;  3J7B A;  4JI1 M;  1DGB A;  2L6O A;  5ITT A;  1L1Z A;  5FLX S;  1YKN A;  3AOE C;  1G3I A;  4LJ5 A;  2AZQ A;  4KHP M;  3PCF M;  1H6U A;  1EO2 A;  3GLF B;  3LXV A;  1QZM A;  5ITQ A;  1IN8 A;  4BBA A;  4WW0 A;  4NXN M;  2DXI A;  2BV0 B;  2H1R A;  4JI2 M;  1L8Q A;  3QWL A;  4X66 M;  3R9X B;  1C1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...