3HHYA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
total genus 70
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhyA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hhyA02
2BUVA 1YKNA 3PCIM 3PCLA 1DLTA 3LKTA 2PCDM 1EO2B 3PCJA 3PCMA 3MV4M 3HHYA 1EOAB 3PCLM 3HHXA 3MI5A 3PCEM 3O6RA 1DLQA 3LMXM 3PCGM 2BV0A 4WHQA 3PCKM 3MV4A 1YKPA 3PCHM 4WHSA 2XSRA 3MV6A 2BUXB 3PCDA 3PCBA 2BUUB 2XSVA 3PCDM 2BUQA 4WHPD 3T67A 2BUZB 2BUVB 3T67M 3PCBM 1YKOA 3PCNM 1YKNB 3N9TA 4WHOD 3PCKA 2BUWA 1EOAA 4WHSD 3MI1A 1EOBA 3PCEA 1EOCA 3I4YA 3PCIA 3HJSA 3TH1A 3PCJM 2BOYA 3PCCA 1YKPB 3LXVM 2BUUA 2BUXA 2AZQA 3PCFM 3PCHA 1EOBB 2BUTA 4ILVA 3O6JA 4WHRA 2BUWB 3PCAM 2BURA 3LXVA 1YKMA 4ILTA 3MFLM 3LKTM 4WHOA 1DMHA 2XSUA 1TMXA 3MI1M 2BUTB 4WHRF 3MFLA 4WHPA 1S9AA 1YKLB 2BUYB 2PCDA 3PCMM 1EO2A 2BUMB 3HJQA 1EO9B 3PCAA 5TD3A 1YKKB 3T63M 4WHRB 3HGIA 3O32A 3I4VA 4WHQB 2BURB 3PCFA 1YKMB 3HJ8A 3MI5M 1YKLA 2BUYA 3PCGA 3LMXA 3HKPA 3PCCM 1EO9A 1YKKA 1YKOB 1DLMA 3I51A 4WHPB 2BUMA 2BV0B 3T63A 4WHSB 3MV6M 3PCNA 1EOCB 3O5UA 4WHOB 2BUZA 2BUQB
chains in the Genus database with same CATH superfamily
2MGWA 2BWBA 4DR3M 2BUVA 3W0LB 1MU5A 3VK7A 2LVPC 3B7ZA 3QYEA 2V1UA 3HU1A 3TE6A 5ITUA 1VDDA 3PCLA 1OJLA 1DLTA 3KOYE 1HNZM 4B3RM 3B74A 4Z8XA 4KO8A 1W5SA 1OTRA 4BLCA 5LMNM 4DV2M 5ITYA 3U6PA 1EOAB 3PCLM 2F5PA 1S3SA 4LZJA 3SAWA 1N36M 1X37A 1DLQA 3M6AA 3LMXM 2CFOA 4GH9A 2DVWB 4PCZA 3GLIE 2BV0A 1IY0A 2KNZA 2L4EA 3QAUA 4LJ7A 4LJAA 4NRVA 3RFWA 3SMSA 3V76A 1YKPA 2LVQD 4JXJA 3MV6A 3D8LA 3PNVA 2UXCM 3PCDA 4F1IA 3B9PA 3L2AA 1WGLA 1G4AE 1XHBA 5FTLA 2BUQA 1Q02A 3GPXA 1NV9A 3CF2A 3UMMA 3KSXA 4DUYM 2QQ8A 4L15A 2DHYA 3MFLM 3U61A 2R45A 2JY8A 3BBZA 4M9SA 3U6MA 4HEOA 4WHOD 4KT0F 4NSOB 1VEKA 2B3TA 1XNRM 3DA1A 4WHSD 3LVVA 1PJTA 5EP2A 5FTJA 3PNYA 3E4RA 4RNAA 2LVNC 2YR0A 1IN5A 2BJWA 3IHPA 3L25A 3GLIB 4GIPA 2UUBM 1J5EM 3C58A 2WSEF 1IXSA 4G3OA 5FSWA 2BOYA 3JAMS 3FTEA 2KA6B 1VG5A 3Q8GA 1Z6TA 2ZANA 3K9PA 4WW0A 1R2YA 4JI4M 3R9XB 1AUAA 4B7HA 5H37D 1K82A 1QVRA 2XF3A 3PCHA 1DV0A 3U61B 1EOBB 3U5ZA 1GL6A 2GNOA 1QUSA 1JR3A 3KW6A 1VEJA 3GLIA 5EJCA 4LG2A 2BUWB 4IIWA 4ILTA 4GC5A 4MGIE 3A42A 3DOAA 1Y8GA 5IT9S 4FW9A 3GRVA 1OIPA 1DGGA 2L6OA 2K6BA 3W0FA 3SYLA 3L28A 1GKIA 5KPZA 3KOZE 1DGHB 2APLA 1S9AA 1YKLB 1GJTA 2M5ZA 2V1CA 1OKSA 2LVOC 4KLNA 2Z3XA 1EO9B 3PCAA 1NY6A 2CHGA 5TD3A 4GITA 4Q7JA 2J5YA 1L2DA 4X65M 3IG8A 4YHHM 2JA2A 1OFHA 1IQPA 8CATA 3U5ZB 1OAIA 3K8ZA 1TTEA 2Z4RA 4QHSA 2QBYA 3MV4A 2EJSA 2DWMA 1NV8A 2DNAA 5E26A 4KHPM 3GLHB 3KP0E 4IBCA 4NL4H 5ITXA 2RKOA 1E9RA 4OW0A 4I4LA 4QNMA 3ZC7B 3WHKA 2Y20A 3L26A 3VK8A 1DGFA 3HJ8A 3KXEC 3TQSA 3WHLA 1XMQM 3SBJA 2H5XA 3PCGA 4P16A 2R18A 3SC3A 5C1BA 2KHHA 3K2LA 4DV1M 2L2DA 3FUUA 1EO9A 1NVMA 3FTDA 3K92A 1YKKA 2Z4SA 4IBJA 3UK6A 3U6OA 2VQFM 2KDLA 3D8BA 3VLFB 4LFAM 1WXQA 1QANA 1TF0B 4QHTA 2JY6B 1YE9A 1QAMA 2V6ZM 2BV0B 2YFQA 3FUTA 4G4NA 4WHSB 4EIWA 3PCNA 3B7NA 1GO5A 3BXWA 2MJ5B 3KP1E 2HKJA 1WHCA 2I7NA 3M0EA 2Y0QA 3I01M 4LJ5A 3U60B 4I81A 2BUQB 3AOEA 1QUTA 1JQJC 2QENA 2MROB 2RGHA 1OFIA 2YNMD 1V92A 2OO9A 2LNHC 3LKTA 5IZ7D 2PCDM 1HJPA 4DV5M 3DZDA 1EO2B 3HU2A 3PCJA 3PCMA 4P17A 3HHYA 2CWBA 4LF7M 3LCUA 3M7GA 2HL7A 3HHXA 3MI5A 3PCEM 3LMMA 5KQ8A 2MH8A 4LF8M 3PCGM 2KRKA 4OVZA 5C18A 1XC8A 3GQ3A 3PCKM 1QAQA 1HQCA 3MJ5A 1Q39A 3C3DA 1MJGM 3FE3A 2G3QA 4XK8F 2KNAA 3JR5A 3GLFE 4OX9M 4WHSA 4PD2A 3TWMA 3PCBA 2F5SA 1TDHA 1TGUA 2KZSA 5IWAM 1T43A 3T67A 4S12A 3MMPA 4WHPD 1EE8A 1FJGM 4QOZC 2W82A 1IM2A 1SXJB 3PCBM 3MI1M 4F2LA 1HQYE 3W68A 1RU3A 2EUCA 2I7PA 3FRIA 3PFIA 4G6ZA 1J7KA 4DV0M 1I4WA 5EXSA 4GRIA 1OAOC 3NBXX 2ZAOA 1E94E 4QOSA 3PCEA 4NXNM 3GRRA 1IBKM 3QWLA 4B3TM 1V34A 1G3IA 1TR8A 4FCTA 2HHHM 3PCIA 3TH1A 1P3QQ 2LTUA 5EQTA 5E6JA 3SHGB 2DI0A 3TWKA 5FTKA 5KQDA 4FWGA 4AKIA 3R8FA 1L1ZA 1IXRC 3PCCA 2K47A 3W67A 2BUUA 2BUXA 1D0KA 3B89A 3LQRA 3QYBA 4II7A 4CHTB 1IXZA 2RRUA 1LTMA 1SG9A 2DENA 2DKLA 2JUJA 3MK6A 3O6JA 3IECA 5FLXS 1L2CA 4WHRA 2C5RA 1GVNA 4A3VB 2BWEA 1QQWA 3DFZA 3LXVA 4AQYM 1Q3BA 3KS4A 2DAGA 1IBMM 3U6LA 4IBDA 1I94M 5IREB 4WHOA 1WGNA 3GP1A 3SARA 4GMQA 3KS8A 1F4IA 4W5WA 1VQ1A 1TH3A 1FNNA 4HLQA 1JB0F 4Z6YA 3VDPA 5JI2E 3J27B 2C96A 4L78A 4WHRF 4RKUF 4CJ6A 2FFJA 3FRHA 4DUZM 2J7OA 2GQFA 3KOWE 3MHVC 2R62A 3HJQA 1XNQM 2UXDM 2BUMB 3F92A 1YKKB 4LGMA 4LFCM 4M9XA 2Z7JA 4IBKA 4RF1A 4I8OA 3GPYA 4FCVA 1GL7A 2XLJA 4WHRB 4AW4A 3J81S 4JI6M 1G41A 1NNUC 3BOSA 3O32A 3JR4A 4WHQB 2BURB 2A5YB 2VQEM 4LF5M 1PJIA 2N35A 1J09A 1PRBA 2CEAA 4FCWA 4MGKE 1IY2A 1V33A 1LV7A 3A45A 3GPPA 2XSZA 1N78A 5KO3A 2BUYA 3MI5M 3RE8A 3LMXA 1XXHB 1ZQ9A 3GO8A 3PCCM 2EKFA 3THGA 2Z8YM 1SXJD 2K9DA 1ZMWA 1QDRA 3FYCA 4XGIA 2JXNA 1TH4A 4CGYB 3RGPA 4B3MM 2ZBKB 3T6PA 2QCUA 5A2QS 2L7HA 2JY5A 2R44A 2ZAMA 3FKEA 3VDUA 1IN7A 1ZAEA 2VDBB 3AFHA 4GKJM 2EA0A 2WSCF 4R7GA 4JI0M 4JI7M 1EOCB 1KYIA 3CGWA 2QP9X 3CTWB 2KNVA 4WHOB 3U6CA 3NBIA 2C9CA 3GLFA 2OPFA 1IBLM 4LF4M 2BUZA 2KRUA 4GHLA 3K9OA 2LHCA 3ZQJA 4DR7M 3FUWA 1VDLA 2R46A 4GEWA 4OU7A 1YKNA 3C9PA 3PCIM 3ZH9B 1N77A 2OOBA 2L09A 2XSZD 2JY7A 5BR8M 4HL4A 4IBFA 1C7YA 2LWXA 3J2PB 4MGYE 1Z5BA 3T38A 1D2NA 1T3TA 2D7HA 1KFVA 2KW0A 1PJQA 2J7NA 2DWZB 4IJEA 3PXGA 3B7QA 3E9SA 1IXSB 2DHRA 3PCHM 2DAKA 3CF0A 4XBOA 4JI2M 2XSRA 4R3DA 3J7BA 1Z59A 4TUWA 3T15A 3HZJA 5FTNA 3SAVA 2R6FA 2DWNA 3AOEC 4MGHA 4JI1M 1JR3E 1NHWC 5DYGA 1YKNB 3SAUA 3PCNM 2AHMA 2HAKA 3H4MA 3GPUA 4B3SM 3MI1A 2ERCA 3AKZA 1QZEA 1EOBA 5EP1A 4DV3M 1L1TA 1N33M 2L4FA 1MN3A 4LJ9A 3UZUA 1EOCA 3I04M 3AOGA 1C1KA 3HJSA 1UFZA 4DR1M 1IFYA 4X64M 2YQZA 4B7GA 2BNKA 4IBEA 1IN8A 3LXVM 4DR4M 1IN4A 3SMPA 4MH0E 1DGHA 1XWIA 3GRYA 3HY5A 1L8QA 2AZQA 2JZ0A 5ITTA 1NHGC 2RGOA 1K3XA 1HNXM 3LW5F 4JI3M 7CATA 2F5NA 2X4AA 2UUAM 1N32M 3SHFA 3U6DA 2BUTA 4ILVA 1QZMA 1DO2A 1TDZA 1ZV1A 2QBYB 2D7EA 2VF8A 4FWHA 3SFZA 5ITXE 1PM5A 4JV5M 4BB9A 3PCAM 1A5TA 3GLHE 2BURA 4G4RA 1D0LA 4MM3B 3TL4X 2CV0A 3UJNA 1YKMA 2L7IA 4LZZA 2QZ4A 1CUKA 1XB2B 4WP2A 2DAIA 1DMHA 2EKKA 4BBAA 3VFDA 4L16A 5EXPA 1SXJE 4WHPA 2BUYB 2O01F 2JWSA 2P5TA 2D7GA 2BJVA 3FD9A 3TWLA 2QSFX 2X8AA 5L8RF 3T63M 1BVSA 2VF7A 4PDIA 3KSJA 4DV6M 2DWLA 4G4OA 2JNHA 3GRUA 2QNJA 2R0IA 2CE7A 5EXXA 4CISA 3FUVA 1T6OA 4NRWA 2ZTDA 4M0DA 2JZ1A 1HNWM 1G71A 2XEPA 3LVWA 3KOXE 3OTOM 4LF6M 2CRUA 4AKHA 1QAOA 1YSYA 1D0MA 3HKPA 1QYRA 2Y0TA 3E46A 1MX0A 2XH9A 3L29A 3T1HM 5EXTA 1R4GA 1R5LA 1VEGA 3C3EA 3RGSA 2H1RA 1YKOB 3KVWA 3Q8XA 1ZMUA 4GKKM 4WHPB 1ZMVA 2FS1A 4DV4M 3U6EA 3SATA 3FTFA 2EO2A 2XZFA 1Q3CA 2LHGA 3SASA 1PGYA 3FUXA 2LVAA 4L6V6 4AG5A 4R71A 2DAMA 4QNRA 1JR3D 1KSFX 4PT5A 5LMUM 3H4JA 2LBCA 3PCKA 1HT1E 1K3WA 4L8RC 1XMOM 2DZLA 4NSRA 2HWJA 3GQ4A 3TPZA 4CIZA 1NO1A 5KPTA 2KXEA 4GHAA 4LJ8A 4LGYA 3EIHA 4Y28F 3A46A 1QDTA 2LH0A 4X66M 4NC6A 3MV4M 5ITQA 1R6BX 3GLGB 3VKHA 2XZUA 3K1JA 1DO0A 1G8PA 5EP3A 3O6RA 2FH0A 2O25A 5ITRA 4DR5M 2CV2A 1ORYB 1L2BA 1Z5AA 4IJFA 3A98B 4WHQA 3PVSA 1Z5CA 1NY5A 4LRSA 4LY6A 5GKNA 2CV1A 1NSFA 1YUBA 1G59A 3HHZA 2BUXB 2C9OA 2FNAA 5BPVA 2XGNA 4IBIA 2F4VM 4AKGA 2BUUB 2XSVA 3PCDM 4MB7A 2QHOB 2CHQA 4DV7M 4RF0A 2BUVB 2BUZB 3T67M 3GLGA 1EIJA 2G5GX 1WR1B 4JN6A 5KPRA 1YKOA 4DR2M 3J7AS 3AL0C 3N9TA 3AV0A 2WSFF 2DZOB 2UXBM 1E32A 2BUWA 1EOAA 3EIEA 4UN2B 3PCJM 2FOIC 1N75A 2Q2EB 3KDSE 4GC9A 1N34M 1OQYA 1PJJA 1NJFA 1GLNA 2VIIA 3I4YA 4LJ4A 5F3WA 1HT2E 1IN6A 3GLFB 3E21A 1PJSA 4JI8M 3FYDA 2DXIA 1YKPB 2M60A 4LJ6A 4IBGA 2WZJA 4LRTA 4B08A 4LFBM 5DYIA 1AIPC 2R65A 3VKGA 3HHWA 1IY1A 2C99A 3SYKA 3PCFM 3CF6E 2MR9A 2F5QA 1GJSA 4JYAM 2OOAA 5JI3E 3J80S 4WURA 4I5SA 4D82A 4AZFA 3GLHA 2X49A 2R4EA 2K0BX 4D80A 1R2ZA 1DGBA 2C98A 5EP4A 4IBBA 2OQ4A 1NNJA 3LQQA 4L4UA 1OIZA 4NOOB 4YY3M 1UM8A 1WIVA 2KZUA 3FTCA 4KODA 3U6SA 1XXHE 4FD2A 2E5LM 3LKTM 3ILKA 4D81A 2XSUA 5DFLA 5FTMA 1TMXA 4K0KM 4PDGA 2BUTB 2DAEA 2QPAA 1SXJA 2JP7A 4B7FA 3MFLA 4AI6A 1YLAA 4LCBA 2PCDA 3PCMM 2CP8A 2XFTA 1EO2A 3KFUG 4M9ZA 2LXEA 2UU9M 3L27A 2Y21A 2NQ8C 4X62M 3GQ5A 1NJGA 2CUZA 2XFSA 3HGIA 3I4VA 3U60A 4FVMA 2ZM6M 4DR6M 5DNYA 3PCFA 1SXJC 4MGZE 4NXMM 3HU3A 2UUCM 1W5TA 2R4JA 3AJIB 4DBGB 1GABA 1YKMB 4G4QA 4LF9M 2ZTCA 1YKLA 3T1YM 1E9SA 3UGJA 4ZPXA 1H6UA 2G8LA 4FWDA 3HWSA 3I51A 1DLMA 3NWLA 3ZCBB 2HCBA 2BUMA 4JI5M 1WJ7A 4OVZB 3GLGE 4M0WA 2FE8A 4ITQA 2KEBA 3T63A 2F5OA 1EFUB 2O5RA 3MV6M 3O5UA 1HR0M 1R7RA 3U6QA 3IG5A 2CHVA 1TH2A 3LCVB 1XXHA 4ANRA 2DZNB 4AG6A 3HX3A 4REZA
chains in the Genus database with same CATH topology
4DR3M 2BUVA 3W0LB 1MU5A 3VK7A 2V1UA 3HU1A 3TE6A 5ITUA 1VDDA 3PCLA 1OJLA 1DLTA 3KOYE 1HNZM 4B3RM 4Z8XA 5LMNM 4KO8A 1W5SA 4BLCA 4DV2M 3U6PA 1EOAB 5ITYA 3PCLM 1S3SA 4LZJA 3SAWA 1N36M 1X37A 1DLQA 3M6AA 3LMXM 2CFOA 4GH9A 2DVWB 4PCZA 2BV0A 1IY0A 3RFWA 3SMSA 3QAUA 4LJ7A 4LJAA 4NRVA 3MV4A 1YKPA 4JXJA 3MV6A 3D8LA 3PNVA 2UXCM 3PCDA 3B9PA 3L2AA 1G4AE 1XHBA 5FTLA 2BUQA 3GPXA 3CF2A 3UMMA 3KSXA 4DUYM 4L15A 3U61A 2R45A 4M9SA 3U6MA 4WHOD 4NSOB 1XNRM 3DA1A 4WHSD 3LVVA 5EP2A 5FTJA 3PNYA 3E4RA 4RNAA 2YR0A 1IN5A 2BJWA 3L25A 3GLIB 4GIPA 2UUBM 1J5EM 3C58A 5FSWA 2BOYA 3JAMS 3FTEA 2KA6B 1Z6TA 2ZANA 4WW0A 1R2YA 3R9XB 4JI4M 4B7HA 5H37D 1K82A 1QVRA 2XF3A 3PCHA 3U61B 1EOBB 3U5ZA 1GL6A 1JR3A 3KW6A 3GLIA 5EJCA 4LG2A 2BUWB 4IIWA 4ILTA 4GC5A 4MGIE 3A42A 3DOAA 5IT9S 4FW9A 3GRVA 1DGGA 2L6OA 3W0FA 3SYLA 3L28A 1GKIA 5KPZA 3KOZE 1DGHB 1S9AA 1YKLB 2M5ZA 2V1CA 4KLNA 2Z3XA 1EO9B 3PCAA 1NY6A 2CHGA 5TD3A 4GITA 1L2DA 4X65M 3IG8A 4YHHM 2JA2A 1OFHA 1IQPA 8CATA 3U5ZB 2F5PA 3K8ZA 2Z4RA 2QBYA 4QHSA 2DWMA 5E26A 4KHPM 3GLHB 3KP0E 4IBCA 4NL4H 5ITXA 2RKOA 1E9RA 4OW0A 4I4LA 4QNMA 3ZC7B 3WHKA 2Y20A 3L26A 3VK8A 1DGFA 3HJ8A 3KXEC 3TQSA 3WHLA 1XMQM 3SBJA 3PCGA 4P16A 2R18A 3SC3A 5C1BA 3K2LA 4DV1M 3FUUA 1EO9A 1NVMA 3FTDA 3K92A 1YKKA 2Z4SA 4IBJA 3UK6A 3U6OA 2VQFM 3D8BA 3VLFB 4LFAM 1WXQA 1QANA 4QHTA 1YE9A 1QAMA 2V6ZM 2BV0B 2YFQA 3FUTA 4G4NA 4WHSB 4EIWA 3PCNA 4LJ5A 3M0EA 3KP1E 2HKJA 2I7NA 2Y0QA 3U60B 4I81A 2BUQB 3AOEA 1JQJC 2QENA 2RGHA 1OFIA 2YNMD 2LNHC 3LKTA 5IZ7D 2PCDM 4DV5M 1EO2B 3DZDA 3PCJA 3HU2A 3PCMA 3HHYA 4LF7M 3M7GA 2HL7A 3HHXA 3MI5A 3PCEM 3LMMA 5KQ8A 4LF8M 3PCGM 2KRKA 4OVZA 5C18A 1XC8A 3GQ3A 3PCKM 1QAQA 1HQCA 3MJ5A 1Q39A 4WHSA 3JR5A 4OX9M 4PD2A 3TWMA 3PCBA 2F5SA 1TDHA 1TGUA 2KZSA 5IWAM 3T67A 4S12A 4WHPD 1EE8A 1FJGM 4QOZC 2W82A 1IM2A 1SXJB 3PCBM 1HQYE 2EUCA 2I7PA 3PFIA 4G6ZA 1J7KA 4DV0M 1I4WA 5EXSA 4GRIA 4QOSA 3PCEA 2ZAOA 1E94E 4NXNM 3GRRA 1IBKM 3QWLA 4B3TM 1G3IA 4FCTA 2HHHM 3PCIA 3TH1A 3PCJM 5EQTA 5E6JA 3SHGB 3TWKA 5FTKA 5KQDA 4FWGA 4AKIA 3R8FA 1L1ZA 1IXRC 3PCCA 2K47A 2BUUA 2BUXA 4CHTB 3LQRA 4II7A 1IXZA 3MK6A 3O6JA 5FLXS 1L2CA 4WHRA 2C5RA 1GVNA 4A3VB 1QQWA 3DFZA 3LXVA 4AQYM 1Q3BA 3KS4A 1IBMM 3U6LA 4IBDA 1I94M 5IREB 4WHOA 3GP1A 3SARA 4GMQA 3KS8A 4W5WA 1TH3A 1FNNA 4HLQA 4Z6YA 3VDPA 5JI2E 3J27B 2C96A 4L78A 4WHRF 2FFJA 4DUZM 2J7OA 3KOWE 3MHVC 2UXDM 2R62A 3HJQA 1XNQM 2BUMB 1YKKB 4LGMA 4LFCM 4M9XA 2Z7JA 4IBKA 4RF1A 4I8OA 3GPYA 4FCVA 1GL7A 2XLJA 4WHRB 4AW4A 3J81S 4JI6M 1G41A 1NNUC 3BOSA 3O32A 3JR4A 4WHQB 2BURB 2A5YB 2VQEM 4LF5M 1PJIA 1J09A 4FCWA 2CEAA 4MGKE 1IY2A 3A45A 1LV7A 3GPPA 3MI5M 2XSZA 1N78A 5KO3A 2BUYA 3RE8A 3LMXA 1XXHB 1ZQ9A 3GO8A 3PCCM 3THGA 1SXJD 3FYCA 4B3MM 4XGIA 4CGYB 1TH4A 3RGPA 2ZBKB 2QCUA 5A2QS 2L7HA 3FKEA 2ZAMA 3VDUA 1IN7A 1ZAEA 4GKJM 3AFHA 2EA0A 4R7GA 4JI0M 4JI7M 1EOCB 1KYIA 2QP9X 3CTWB 4WHOB 3U6CA 3NBIA 2C9CA 3GLFA 2OPFA 1IBLM 4LF4M 2BUZA 2KRUA 4GHLA 4DR7M 3FUWA 2R46A 1YKNA 4OU7A 3PCIM 3ZH9B 1N77A 5BR8M 2L09A 2XSZD 4HL4A 4IBFA 2LWXA 3J2PB 4MGYE 1Z5BA 3T38A 1D2NA 1T3TA 2D7HA 1KFVA 2KW0A 2J7NA 2DWZB 4IJEA 3PXGA 3E9SA 1IXSB 2DHRA 3PCHM 3CF0A 4XBOA 4JI2M 2XSRA 4R3DA 3J7BA 1Z59A 4TUWA 3T15A 5FTNA 3SAVA 2DWNA 3AOEC 4MGHA 4JI1M 1NHWC 1YKNB 5DYGA 3PCNM 3SAUA 2AHMA 3H4MA 3GPUA 4B3SM 3MI1A 2ERCA 3AKZA 1EOBA 5EP1A 4DV3M 1L1TA 1N33M 4LJ9A 3UZUA 1EOCA 3AOGA 1C1KA 3HJSA 4DR1M 4X64M 2YQZA 4B7GA 2BNKA 4IBEA 1IN8A 3LXVM 4DR4M 1IN4A 3SMPA 4MH0E 1DGHA 1XWIA 3GRYA 1L8QA 2AZQA 5ITTA 1NHGC 2RGOA 1K3XA 1HNXM 4JI3M 7CATA 2F5NA 2X4AA 2UUAM 1N32M 3SHFA 3U6DA 2BUTA 4ILVA 1QZMA 1DO2A 1TDZA 2QBYB 2D7EA 3SFZA 4FWHA 5ITXE 1PM5A 4JV5M 4BB9A 3PCAM 2BURA 4G4RA 3TL4X 4MM3B 2CV0A 1YKMA 3UJNA 2L7IA 4LZZA 2QZ4A 1DMHA 4BBAA 3VFDA 4L16A 5EXPA 1SXJE 4WHPA 2BUYB 2P5TA 2D7GA 2BJVA 3FD9A 3TWLA 2X8AA 3T63M 4PDIA 3KSJA 4DV6M 2DWLA 4G4OA 3GRUA 2CE7A 5EXXA 4CISA 3FUVA 4NRWA 4M0DA 1HNWM 2XEPA 4LF6M 3LVWA 3KOXE 3OTOM 4AKHA 1QAOA 1YSYA 3HKPA 1QYRA 2Y0TA 1MX0A 2XH9A 3L29A 3T1HM 5EXTA 3RGSA 2H1RA 1YKOB 3KVWA 3Q8XA 4GKKM 4WHPB 4DV4M 3U6EA 3SATA 3FTFA 2EO2A 2XZFA 1Q3CA 3SASA 3FUXA 4AG5A 4QNRA 1JR3D 1KSFX 4PT5A 5LMUM 3PCKA 1HT1E 1K3WA 4L8RC 1XMOM 4NSRA 3GQ4A 3TPZA 5KPTA 2KXEA 4GHAA 4LJ8A 4LGYA 3EIHA 3A46A 2LH0A 4X66M 3MV4M 5ITQA 1R6BX 3GLGB 3VKHA 2XZUA 3K1JA 1DO0A 1G8PA 5EP3A 3O6RA 4DR5M 5ITRA 2CV2A 1ORYB 1L2BA 1Z5AA 4IJFA 3A98B 4WHQA 3PVSA 1Z5CA 1NY5A 4LRSA 4LY6A 5GKNA 2CV1A 1NSFA 1YUBA 1G59A 3HHZA 2BUXB 2C9OA 2FNAA 5BPVA 2XGNA 4IBIA 2F4VM 4AKGA 2BUUB 2XSVA 3PCDM 4MB7A 4DV7M 2CHQA 2BUVB 4RF0A 2BUZB 3T67M 3GLGA 2G5GX 4JN6A 5KPRA 1YKOA 4DR2M 3J7AS 3AL0C 3N9TA 3AV0A 2DZOB 2UXBM 1E32A 2BUWA 1EOAA 3EIEA 2FOIC 1N75A 2Q2EB 3KDSE 4GC9A 1N34M 1PJJA 1NJFA 1GLNA 2VIIA 3I4YA 4LJ4A 5F3WA 1HT2E 1IN6A 3GLFB 4JI8M 3FYDA 2DXIA 1YKPB 2M60A 4LJ6A 4IBGA 4LRTA 4B08A 4LFBM 5DYIA 2R65A 3VKGA 3HHWA 1IY1A 2C99A 3SYKA 3PCFM 3CF6E 2F5QA 4JYAM 5JI3E 3J80S 4WURA 4I5SA 4D82A 4AZFA 3GLHA 2X49A 2R4EA 4D80A 1R2ZA 1DGBA 2C98A 5EP4A 4IBBA 2OQ4A 1NNJA 3LQQA 4L4UA 4YY3M 4NOOB 3U6SA 1UM8A 3FTCA 2KZUA 4KODA 3LKTM 3MFLM 2E5LM 4FD2A 3ILKA 4D81A 2XSUA 5FTMA 1TMXA 4K0KM 4PDGA 2BUTB 2QPAA 3MFLA 1SXJA 4B7FA 3MI1M 4AI6A 4LCBA 2PCDA 3PCMM 2XFTA 1EO2A 3KFUG 4M9ZA 2LXEA 2UU9M 3L27A 2Y21A 2NQ8C 4X62M 3GQ5A 1NJGA 2CUZA 2XFSA 3HGIA 3I4VA 3U60A 4FVMA 2ZM6M 4DR6M 5DNYA 3PCFA 1SXJC 4MGZE 4NXMM 3HU3A 2UUCM 1W5TA 2R4JA 3AJIB 1YKMB 4G4QA 4LF9M 1YKLA 3T1YM 1E9SA 3UGJA 4ZPXA 1H6UA 2G8LA 4FWDA 3HWSA 3I51A 1DLMA 3NWLA 3ZCBB 2HCBA 2BUMA 4JI5M 4OVZB 4ITQA 4M0WA 2FE8A 2KEBA 3T63A 2F5OA 2O5RA 3MV6M 3O5UA 1HR0M 1R7RA 3U6QA 3IG5A 2CHVA 1TH2A 1XXHA 2DZNB 4AG6A 4REZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUV A;  1YKN A;  3PCI M;  3PCL A;  1DLT A;  3LKT A;  2PCD M;  1EO2 B;  3PCJ A;  3PCM A;  3MV4 M;  3HHY A;  1EOA B;  3PCL M;  3HHX A;  3MI5 A;  3PCE M;  3O6R A;  1DLQ A;  3LMX M;  3PCG M;  2BV0 A;  4WHQ A;  3PCK M;  3MV4 A;  1YKP A;  3PCH M;  4WHS A;  2XSR A;  3MV6 A;  2BUX B;  3PCD A;  3PCB A;  2BUU B;  2XSV A;  3PCD M;  2BUQ A;  4WHP D;  3T67 A;  2BUZ B;  2BUV B;  3T67 M;  3PCB M;  1YKO A;  3PCN M;  1YKN B;  3N9T A;  4WHO D;  3PCK A;  2BUW A;  1EOA A;  4WHS D;  3MI1 A;  1EOB A;  3PCE A;  1EOC A;  3I4Y A;  3PCI A;  3HJS A;  3TH1 A;  3PCJ M;  2BOY A;  3PCC A;  1YKP B;  3LXV M;  2BUU A;  2BUX A;  2AZQ A;  3PCF M;  3PCH A;  1EOB B;  2BUT A;  4ILV A;  3O6J A;  4WHR A;  2BUW B;  3PCA M;  2BUR A;  3LXV A;  1YKM A;  4ILT A;  3MFL M;  3LKT M;  4WHO A;  1DMH A;  2XSU A;  1TMX A;  3MI1 M;  2BUT B;  4WHR F;  3MFL A;  4WHP A;  1S9A A;  1YKL B;  2BUY B;  2PCD A;  3PCM M;  1EO2 A;  2BUM B;  3HJQ A;  1EO9 B;  3PCA A;  5TD3 A;  1YKK B;  3T63 M;  4WHR B;  3HGI A;  3O32 A;  3I4V A;  4WHQ B;  2BUR B;  3PCF A;  1YKM B;  3HJ8 A;  3MI5 M;  1YKL A;  2BUY A;  3PCG A;  3LMX A;  3HKP A;  3PCC M;  1EO9 A;  1YKK A;  1YKO B;  1DLM A;  3I51 A;  4WHP B;  2BUM A;  2BV0 B;  3T63 A;  4WHS B;  3MV6 M;  3PCN A;  1EOC B;  3O5U A;  4WHO B;  2BUZ A;  2BUQ B; 
#chains in the Genus database with same CATH topology
 2MGW A;  2BWB A;  4DR3 M;  2BUV A;  3W0L B;  1MU5 A;  3VK7 A;  2LVP C;  3B7Z A;  3QYE A;  2V1U A;  3HU1 A;  3TE6 A;  5ITU A;  1VDD A;  3PCL A;  1OJL A;  1DLT A;  3KOY E;  1HNZ M;  4B3R M;  3B74 A;  4Z8X A;  4KO8 A;  1W5S A;  1OTR A;  4BLC A;  5LMN M;  4DV2 M;  5ITY A;  3U6P A;  1EOA B;  3PCL M;  2F5P A;  1S3S A;  4LZJ A;  3SAW A;  1N36 M;  1X37 A;  1DLQ A;  3M6A A;  3LMX M;  2CFO A;  4GH9 A;  2DVW B;  4PCZ A;  3GLI E;  2BV0 A;  1IY0 A;  2KNZ A;  2L4E A;  3QAU A;  4LJ7 A;  4LJA A;  4NRV A;  3RFW A;  3SMS A;  3V76 A;  1YKP A;  2LVQ D;  4JXJ A;  3MV6 A;  3D8L A;  3PNV A;  2UXC M;  3PCD A;  4F1I A;  3B9P A;  3L2A A;  1WGL A;  1G4A E;  1XHB A;  5FTL A;  2BUQ A;  1Q02 A;  3GPX A;  1NV9 A;  3CF2 A;  3UMM A;  3KSX A;  4DUY M;  2QQ8 A;  4L15 A;  2DHY A;  3MFL M;  3U61 A;  2R45 A;  2JY8 A;  3BBZ A;  4M9S A;  3U6M A;  4HEO A;  4WHO D;  4KT0 F;  4NSO B;  1VEK A;  2B3T A;  1XNR M;  3DA1 A;  4WHS D;  3LVV A;  1PJT A;  5EP2 A;  5FTJ A;  3PNY A;  3E4R A;  4RNA A;  2LVN C;  2YR0 A;  1IN5 A;  2BJW A;  3IHP A;  3L25 A;  3GLI B;  4GIP A;  2UUB M;  1J5E M;  3C58 A;  2WSE F;  1IXS A;  4G3O A;  5FSW A;  2BOY A;  3JAM S;  3FTE A;  2KA6 B;  1VG5 A;  3Q8G A;  1Z6T A;  2ZAN A;  3K9P A;  4WW0 A;  1R2Y A;  4JI4 M;  3R9X B;  1AUA A;  4B7H A;  5H37 D;  1K82 A;  1QVR A;  2XF3 A;  3PCH A;  1DV0 A;  3U61 B;  1EOB B;  3U5Z A;  1GL6 A;  2GNO A;  1QUS A;  1JR3 A;  3KW6 A;  1VEJ A;  3GLI A;  5EJC A;  4LG2 A;  2BUW B;  4IIW A;  4ILT A;  4GC5 A;  4MGI E;  3A42 A;  3DOA A;  1Y8G A;  5IT9 S;  4FW9 A;  3GRV A;  1OIP A;  1DGG A;  2L6O A;  2K6B A;  3W0F A;  3SYL A;  3L28 A;  1GKI A;  5KPZ A;  3KOZ E;  1DGH B;  2APL A;  1S9A A;  1YKL B;  1GJT A;  2M5Z A;  2V1C A;  1OKS A;  2LVO C;  4KLN A;  2Z3X A;  1EO9 B;  3PCA A;  1NY6 A;  2CHG A;  5TD3 A;  4GIT A;  4Q7J A;  2J5Y A;  1L2D A;  4X65 M;  3IG8 A;  4YHH M;  2JA2 A;  1OFH A;  1IQP A;  8CAT A;  3U5Z B;  1OAI A;  3K8Z A;  1TTE A;  2Z4R A;  4QHS A;  2QBY A;  3MV4 A;  2EJS A;  2DWM A;  1NV8 A;  2DNA A;  5E26 A;  4KHP M;  3GLH B;  3KP0 E;  4IBC A;  4NL4 H;  5ITX A;  2RKO A;  1E9R A;  4OW0 A;  4I4L A;  4QNM A;  3ZC7 B;  3WHK A;  2Y20 A;  3L26 A;  3VK8 A;  1DGF A;  3HJ8 A;  3KXE C;  3TQS A;  3WHL A;  1XMQ M;  3SBJ A;  2H5X A;  3PCG A;  4P16 A;  2R18 A;  3SC3 A;  5C1B A;  2KHH A;  3K2L A;  4DV1 M;  2L2D A;  3FUU A;  1EO9 A;  1NVM A;  3FTD A;  3K92 A;  1YKK A;  2Z4S A;  4IBJ A;  3UK6 A;  3U6O A;  2VQF M;  2KDL A;  3D8B A;  3VLF B;  4LFA M;  1WXQ A;  1QAN A;  1TF0 B;  4QHT A;  2JY6 B;  1YE9 A;  1QAM A;  2V6Z M;  2BV0 B;  2YFQ A;  3FUT A;  4G4N A;  4WHS B;  4EIW A;  3PCN A;  3B7N A;  1GO5 A;  3BXW A;  2MJ5 B;  3KP1 E;  2HKJ A;  1WHC A;  2I7N A;  3M0E A;  2Y0Q A;  3I01 M;  4LJ5 A;  3U60 B;  4I81 A;  2BUQ B;  3AOE A;  1QUT A;  1JQJ C;  2QEN A;  2MRO B;  2RGH A;  1OFI A;  2YNM D;  1V92 A;  2OO9 A;  2LNH C;  3LKT A;  5IZ7 D;  2PCD M;  1HJP A;  4DV5 M;  3DZD A;  1EO2 B;  3HU2 A;  3PCJ A;  3PCM A;  4P17 A;  3HHY A;  2CWB A;  4LF7 M;  3LCU A;  3M7G A;  2HL7 A;  3HHX A;  3MI5 A;  3PCE M;  3LMM A;  5KQ8 A;  2MH8 A;  4LF8 M;  3PCG M;  2KRK A;  4OVZ A;  5C18 A;  1XC8 A;  3GQ3 A;  3PCK M;  1QAQ A;  1HQC A;  3MJ5 A;  1Q39 A;  3C3D A;  1MJG M;  3FE3 A;  2G3Q A;  4XK8 F;  2KNA A;  3JR5 A;  3GLF E;  4OX9 M;  4WHS A;  4PD2 A;  3TWM A;  3PCB A;  2F5S A;  1TDH A;  1TGU A;  2KZS A;  5IWA M;  1T43 A;  3T67 A;  4S12 A;  3MMP A;  4WHP D;  1EE8 A;  1FJG M;  4QOZ C;  2W82 A;  1IM2 A;  1SXJ B;  3PCB M;  3MI1 M;  4F2L A;  1HQY E;  3W68 A;  1RU3 A;  2EUC A;  2I7P A;  3FRI A;  3PFI A;  4G6Z A;  1J7K A;  4DV0 M;  1I4W A;  5EXS A;  4GRI A;  1OAO C;  3NBX X;  2ZAO A;  1E94 E;  4QOS A;  3PCE A;  4NXN M;  3GRR A;  1IBK M;  3QWL A;  4B3T M;  1V34 A;  1G3I A;  1TR8 A;  4FCT A;  2HHH M;  3PCI A;  3TH1 A;  1P3Q Q;  2LTU A;  5EQT A;  5E6J A;  3SHG B;  2DI0 A;  3TWK A;  5FTK A;  5KQD A;  4FWG A;  4AKI A;  3R8F A;  1L1Z A;  1IXR C;  3PCC A;  2K47 A;  3W67 A;  2BUU A;  2BUX A;  1D0K A;  3B89 A;  3LQR A;  3QYB A;  4II7 A;  4CHT B;  1IXZ A;  2RRU A;  1LTM A;  1SG9 A;  2DEN A;  2DKL A;  2JUJ A;  3MK6 A;  3O6J A;  3IEC A;  5FLX S;  1L2C A;  4WHR A;  2C5R A;  1GVN A;  4A3V B;  2BWE A;  1QQW A;  3DFZ A;  3LXV A;  4AQY M;  1Q3B A;  3KS4 A;  2DAG A;  1IBM M;  3U6L A;  4IBD A;  1I94 M;  5IRE B;  4WHO A;  1WGN A;  3GP1 A;  3SAR A;  4GMQ A;  3KS8 A;  1F4I A;  4W5W A;  1VQ1 A;  1TH3 A;  1FNN A;  4HLQ A;  1JB0 F;  4Z6Y A;  3VDP A;  5JI2 E;  3J27 B;  2C96 A;  4L78 A;  4WHR F;  4RKU F;  4CJ6 A;  2FFJ A;  3FRH A;  4DUZ M;  2J7O A;  2GQF A;  3KOW E;  3MHV C;  2R62 A;  3HJQ A;  1XNQ M;  2UXD M;  2BUM B;  3F92 A;  1YKK B;  4LGM A;  4LFC M;  4M9X A;  2Z7J A;  4IBK A;  4RF1 A;  4I8O A;  3GPY A;  4FCV A;  1GL7 A;  2XLJ A;  4WHR B;  4AW4 A;  3J81 S;  4JI6 M;  1G41 A;  1NNU C;  3BOS A;  3O32 A;  3JR4 A;  4WHQ B;  2BUR B;  2A5Y B;  2VQE M;  4LF5 M;  1PJI A;  2N35 A;  1J09 A;  1PRB A;  2CEA A;  4FCW A;  4MGK E;  1IY2 A;  1V33 A;  1LV7 A;  3A45 A;  3GPP A;  2XSZ A;  1N78 A;  5KO3 A;  2BUY A;  3MI5 M;  3RE8 A;  3LMX A;  1XXH B;  1ZQ9 A;  3GO8 A;  3PCC M;  2EKF A;  3THG A;  2Z8Y M;  1SXJ D;  2K9D A;  1ZMW A;  1QDR A;  3FYC A;  4XGI A;  2JXN A;  1TH4 A;  4CGY B;  3RGP A;  4B3M M;  2ZBK B;  3T6P A;  2QCU A;  5A2Q S;  2L7H A;  2JY5 A;  2R44 A;  2ZAM A;  3FKE A;  3VDU A;  1IN7 A;  1ZAE A;  2VDB B;  3AFH A;  4GKJ M;  2EA0 A;  2WSC F;  4R7G A;  4JI0 M;  4JI7 M;  1EOC B;  1KYI A;  3CGW A;  2QP9 X;  3CTW B;  2KNV A;  4WHO B;  3U6C A;  3NBI A;  2C9C A;  3GLF A;  2OPF A;  1IBL M;  4LF4 M;  2BUZ A;  2KRU A;  4GHL A;  3K9O A;  2LHC A;  3ZQJ A;  4DR7 M;  3FUW A;  1VDL A;  2R46 A;  4GEW A;  4OU7 A;  1YKN A;  3C9P A;  3PCI M;  3ZH9 B;  1N77 A;  2OOB A;  2L09 A;  2XSZ D;  2JY7 A;  5BR8 M;  4HL4 A;  4IBF A;  1C7Y A;  2LWX A;  3J2P B;  4MGY E;  1Z5B A;  3T38 A;  1D2N A;  1T3T A;  2D7H A;  1KFV A;  2KW0 A;  1PJQ A;  2J7N A;  2DWZ B;  4IJE A;  3PXG A;  3B7Q A;  3E9S A;  1IXS B;  2DHR A;  3PCH M;  2DAK A;  3CF0 A;  4XBO A;  4JI2 M;  2XSR A;  4R3D A;  3J7B A;  1Z59 A;  4TUW A;  3T15 A;  3HZJ A;  5FTN A;  3SAV A;  2R6F A;  2DWN A;  3AOE C;  4MGH A;  4JI1 M;  1JR3 E;  1NHW C;  5DYG A;  1YKN B;  3SAU A;  3PCN M;  2AHM A;  2HAK A;  3H4M A;  3GPU A;  4B3S M;  3MI1 A;  2ERC A;  3AKZ A;  1QZE A;  1EOB A;  5EP1 A;  4DV3 M;  1L1T A;  1N33 M;  2L4F A;  1MN3 A;  4LJ9 A;  3UZU A;  1EOC A;  3I04 M;  3AOG A;  1C1K A;  3HJS A;  1UFZ A;  4DR1 M;  1IFY A;  4X64 M;  2YQZ A;  4B7G A;  2BNK A;  4IBE A;  1IN8 A;  3LXV M;  4DR4 M;  1IN4 A;  3SMP A;  4MH0 E;  1DGH A;  1XWI A;  3GRY A;  3HY5 A;  1L8Q A;  2AZQ A;  2JZ0 A;  5ITT A;  1NHG C;  2RGO A;  1K3X A;  1HNX M;  3LW5 F;  4JI3 M;  7CAT A;  2F5N A;  2X4A A;  2UUA M;  1N32 M;  3SHF A;  3U6D A;  2BUT A;  4ILV A;  1QZM A;  1DO2 A;  1TDZ A;  1ZV1 A;  2QBY B;  2D7E A;  2VF8 A;  4FWH A;  3SFZ A;  5ITX E;  1PM5 A;  4JV5 M;  4BB9 A;  3PCA M;  1A5T A;  3GLH E;  2BUR A;  4G4R A;  1D0L A;  4MM3 B;  3TL4 X;  2CV0 A;  3UJN A;  1YKM A;  2L7I A;  4LZZ A;  2QZ4 A;  1CUK A;  1XB2 B;  4WP2 A;  2DAI A;  1DMH A;  2EKK A;  4BBA A;  3VFD A;  4L16 A;  5EXP A;  1SXJ E;  4WHP A;  2BUY B;  2O01 F;  2JWS A;  2P5T A;  2D7G A;  2BJV A;  3FD9 A;  3TWL A;  2QSF X;  2X8A A;  5L8R F;  3T63 M;  1BVS A;  2VF7 A;  4PDI A;  3KSJ A;  4DV6 M;  2DWL A;  4G4O A;  2JNH A;  3GRU A;  2QNJ A;  2R0I A;  2CE7 A;  5EXX A;  4CIS A;  3FUV A;  1T6O A;  4NRW A;  2ZTD A;  4M0D A;  2JZ1 A;  1HNW M;  1G71 A;  2XEP A;  3LVW A;  3KOX E;  3OTO M;  4LF6 M;  2CRU A;  4AKH A;  1QAO A;  1YSY A;  1D0M A;  3HKP A;  1QYR A;  2Y0T A;  3E46 A;  1MX0 A;  2XH9 A;  3L29 A;  3T1H M;  5EXT A;  1R4G A;  1R5L A;  1VEG A;  3C3E A;  3RGS A;  2H1R A;  1YKO B;  3KVW A;  3Q8X A;  1ZMU A;  4GKK M;  4WHP B;  1ZMV A;  2FS1 A;  4DV4 M;  3U6E A;  3SAT A;  3FTF A;  2EO2 A;  2XZF A;  1Q3C A;  2LHG A;  3SAS A;  1PGY A;  3FUX A;  2LVA A;  4L6V 6;  4AG5 A;  4R71 A;  2DAM A;  4QNR A;  1JR3 D;  1KSF X;  4PT5 A;  5LMU M;  3H4J A;  2LBC A;  3PCK A;  1HT1 E;  1K3W A;  4L8R C;  1XMO M;  2DZL A;  4NSR A;  2HWJ A;  3GQ4 A;  3TPZ A;  4CIZ A;  1NO1 A;  5KPT A;  2KXE A;  4GHA A;  4LJ8 A;  4LGY A;  3EIH A;  4Y28 F;  3A46 A;  1QDT A;  2LH0 A;  4X66 M;  4NC6 A;  3MV4 M;  5ITQ A;  1R6B X;  3GLG B;  3VKH A;  2XZU A;  3K1J A;  1DO0 A;  1G8P A;  5EP3 A;  3O6R A;  2FH0 A;  2O25 A;  5ITR A;  4DR5 M;  2CV2 A;  1ORY B;  1L2B A;  1Z5A A;  4IJF A;  3A98 B;  4WHQ A;  3PVS A;  1Z5C A;  1NY5 A;  4LRS A;  4LY6 A;  5GKN A;  2CV1 A;  1NSF A;  1YUB A;  1G59 A;  3HHZ A;  2BUX B;  2C9O A;  2FNA A;  5BPV A;  2XGN A;  4IBI A;  2F4V M;  4AKG A;  2BUU B;  2XSV A;  3PCD M;  4MB7 A;  2QHO B;  2CHQ A;  4DV7 M;  4RF0 A;  2BUV B;  2BUZ B;  3T67 M;  3GLG A;  1EIJ A;  2G5G X;  1WR1 B;  4JN6 A;  5KPR A;  1YKO A;  4DR2 M;  3J7A S;  3AL0 C;  3N9T A;  3AV0 A;  2WSF F;  2DZO B;  2UXB M;  1E32 A;  2BUW A;  1EOA A;  3EIE A;  4UN2 B;  3PCJ M;  2FOI C;  1N75 A;  2Q2E B;  3KDS E;  4GC9 A;  1N34 M;  1OQY A;  1PJJ A;  1NJF A;  1GLN A;  2VII A;  3I4Y A;  4LJ4 A;  5F3W A;  1HT2 E;  1IN6 A;  3GLF B;  3E21 A;  1PJS A;  4JI8 M;  3FYD A;  2DXI A;  1YKP B;  2M60 A;  4LJ6 A;  4IBG A;  2WZJ A;  4LRT A;  4B08 A;  4LFB M;  5DYI A;  1AIP C;  2R65 A;  3VKG A;  3HHW A;  1IY1 A;  2C99 A;  3SYK A;  3PCF M;  3CF6 E;  2MR9 A;  2F5Q A;  1GJS A;  4JYA M;  2OOA A;  5JI3 E;  3J80 S;  4WUR A;  4I5S A;  4D82 A;  4AZF A;  3GLH A;  2X49 A;  2R4E A;  2K0B X;  4D80 A;  1R2Z A;  1DGB A;  2C98 A;  5EP4 A;  4IBB A;  2OQ4 A;  1NNJ A;  3LQQ A;  4L4U A;  1OIZ A;  4NOO B;  4YY3 M;  1UM8 A;  1WIV A;  2KZU A;  3FTC A;  4KOD A;  3U6S A;  1XXH E;  4FD2 A;  2E5L M;  3LKT M;  3ILK A;  4D81 A;  2XSU A;  5DFL A;  5FTM A;  1TMX A;  4K0K M;  4PDG A;  2BUT B;  2DAE A;  2QPA A;  1SXJ A;  2JP7 A;  4B7F A;  3MFL A;  4AI6 A;  1YLA A;  4LCB A;  2PCD A;  3PCM M;  2CP8 A;  2XFT A;  1EO2 A;  3KFU G;  4M9Z A;  2LXE A;  2UU9 M;  3L27 A;  2Y21 A;  2NQ8 C;  4X62 M;  3GQ5 A;  1NJG A;  2CUZ A;  2XFS A;  3HGI A;  3I4V A;  3U60 A;  4FVM A;  2ZM6 M;  4DR6 M;  5DNY A;  3PCF A;  1SXJ C;  4MGZ E;  4NXM M;  3HU3 A;  2UUC M;  1W5T A;  2R4J A;  3AJI B;  4DBG B;  1GAB A;  1YKM B;  4G4Q A;  4LF9 M;  2ZTC A;  1YKL A;  3T1Y M;  1E9S A;  3UGJ A;  4ZPX A;  1H6U A;  2G8L A;  4FWD A;  3HWS A;  3I51 A;  1DLM A;  3NWL A;  3ZCB B;  2HCB A;  2BUM A;  4JI5 M;  1WJ7 A;  4OVZ B;  3GLG E;  4M0W A;  2FE8 A;  4ITQ A;  2KEB A;  3T63 A;  2F5O A;  1EFU B;  2O5R A;  3MV6 M;  3O5U A;  1HR0 M;  1R7R A;  3U6Q A;  3IG5 A;  2CHV A;  1TH2 A;  3LCV B;  1XXH A;  4ANR A;  2DZN B;  4AG6 A;  3HX3 A;  4REZ A; 
#chains in the Genus database with same CATH homology
 4DR3 M;  2BUV A;  3W0L B;  1MU5 A;  3VK7 A;  2V1U A;  3HU1 A;  3TE6 A;  5ITU A;  1VDD A;  3PCL A;  1OJL A;  1DLT A;  3KOY E;  1HNZ M;  4B3R M;  4Z8X A;  5LMN M;  4KO8 A;  1W5S A;  4BLC A;  4DV2 M;  3U6P A;  1EOA B;  5ITY A;  3PCL M;  1S3S A;  4LZJ A;  3SAW A;  1N36 M;  1X37 A;  1DLQ A;  3M6A A;  3LMX M;  2CFO A;  4GH9 A;  2DVW B;  4PCZ A;  2BV0 A;  1IY0 A;  3RFW A;  3SMS A;  3QAU A;  4LJ7 A;  4LJA A;  4NRV A;  3MV4 A;  1YKP A;  4JXJ A;  3MV6 A;  3D8L A;  3PNV A;  2UXC M;  3PCD A;  3B9P A;  3L2A A;  1G4A E;  1XHB A;  5FTL A;  2BUQ A;  3GPX A;  3CF2 A;  3UMM A;  3KSX A;  4DUY M;  4L15 A;  3U61 A;  2R45 A;  4M9S A;  3U6M A;  4WHO D;  4NSO B;  1XNR M;  3DA1 A;  4WHS D;  3LVV A;  5EP2 A;  5FTJ A;  3PNY A;  3E4R A;  4RNA A;  2YR0 A;  1IN5 A;  2BJW A;  3L25 A;  3GLI B;  4GIP A;  2UUB M;  1J5E M;  3C58 A;  5FSW A;  2BOY A;  3JAM S;  3FTE A;  2KA6 B;  1Z6T A;  2ZAN A;  4WW0 A;  1R2Y A;  3R9X B;  4JI4 M;  4B7H A;  5H37 D;  1K82 A;  1QVR A;  2XF3 A;  3PCH A;  3U61 B;  1EOB B;  3U5Z A;  1GL6 A;  1JR3 A;  3KW6 A;  3GLI A;  5EJC A;  4LG2 A;  2BUW B;  4IIW A;  4ILT A;  4GC5 A;  4MGI E;  3A42 A;  3DOA A;  5IT9 S;  4FW9 A;  3GRV A;  1DGG A;  2L6O A;  3W0F A;  3SYL A;  3L28 A;  1GKI A;  5KPZ A;  3KOZ E;  1DGH B;  1S9A A;  1YKL B;  2M5Z A;  2V1C A;  4KLN A;  2Z3X A;  1EO9 B;  3PCA A;  1NY6 A;  2CHG A;  5TD3 A;  4GIT A;  1L2D A;  4X65 M;  3IG8 A;  4YHH M;  2JA2 A;  1OFH A;  1IQP A;  8CAT A;  3U5Z B;  2F5P A;  3K8Z A;  2Z4R A;  2QBY A;  4QHS A;  2DWM A;  5E26 A;  4KHP M;  3GLH B;  3KP0 E;  4IBC A;  4NL4 H;  5ITX A;  2RKO A;  1E9R A;  4OW0 A;  4I4L A;  4QNM A;  3ZC7 B;  3WHK A;  2Y20 A;  3L26 A;  3VK8 A;  1DGF A;  3HJ8 A;  3KXE C;  3TQS A;  3WHL A;  1XMQ M;  3SBJ A;  3PCG A;  4P16 A;  2R18 A;  3SC3 A;  5C1B A;  3K2L A;  4DV1 M;  3FUU A;  1EO9 A;  1NVM A;  3FTD A;  3K92 A;  1YKK A;  2Z4S A;  4IBJ A;  3UK6 A;  3U6O A;  2VQF M;  3D8B A;  3VLF B;  4LFA M;  1WXQ A;  1QAN A;  4QHT A;  1YE9 A;  1QAM A;  2V6Z M;  2BV0 B;  2YFQ A;  3FUT A;  4G4N A;  4WHS B;  4EIW A;  3PCN A;  4LJ5 A;  3M0E A;  3KP1 E;  2HKJ A;  2I7N A;  2Y0Q A;  3U60 B;  4I81 A;  2BUQ B;  3AOE A;  1JQJ C;  2QEN A;  2RGH A;  1OFI A;  2YNM D;  2LNH C;  3LKT A;  5IZ7 D;  2PCD M;  4DV5 M;  1EO2 B;  3DZD A;  3PCJ A;  3HU2 A;  3PCM A;  3HHY A;  4LF7 M;  3M7G A;  2HL7 A;  3HHX A;  3MI5 A;  3PCE M;  3LMM A;  5KQ8 A;  4LF8 M;  3PCG M;  2KRK A;  4OVZ A;  5C18 A;  1XC8 A;  3GQ3 A;  3PCK M;  1QAQ A;  1HQC A;  3MJ5 A;  1Q39 A;  4WHS A;  3JR5 A;  4OX9 M;  4PD2 A;  3TWM A;  3PCB A;  2F5S A;  1TDH A;  1TGU A;  2KZS A;  5IWA M;  3T67 A;  4S12 A;  4WHP D;  1EE8 A;  1FJG M;  4QOZ C;  2W82 A;  1IM2 A;  1SXJ B;  3PCB M;  1HQY E;  2EUC A;  2I7P A;  3PFI A;  4G6Z A;  1J7K A;  4DV0 M;  1I4W A;  5EXS A;  4GRI A;  4QOS A;  3PCE A;  2ZAO A;  1E94 E;  4NXN M;  3GRR A;  1IBK M;  3QWL A;  4B3T M;  1G3I A;  4FCT A;  2HHH M;  3PCI A;  3TH1 A;  3PCJ M;  5EQT A;  5E6J A;  3SHG B;  3TWK A;  5FTK A;  5KQD A;  4FWG A;  4AKI A;  3R8F A;  1L1Z A;  1IXR C;  3PCC A;  2K47 A;  2BUU A;  2BUX A;  4CHT B;  3LQR A;  4II7 A;  1IXZ A;  3MK6 A;  3O6J A;  5FLX S;  1L2C A;  4WHR A;  2C5R A;  1GVN A;  4A3V B;  1QQW A;  3DFZ A;  3LXV A;  4AQY M;  1Q3B A;  3KS4 A;  1IBM M;  3U6L A;  4IBD A;  1I94 M;  5IRE B;  4WHO A;  3GP1 A;  3SAR A;  4GMQ A;  3KS8 A;  4W5W A;  1TH3 A;  1FNN A;  4HLQ A;  4Z6Y A;  3VDP A;  5JI2 E;  3J27 B;  2C96 A;  4L78 A;  4WHR F;  2FFJ A;  4DUZ M;  2J7O A;  3KOW E;  3MHV C;  2UXD M;  2R62 A;  3HJQ A;  1XNQ M;  2BUM B;  1YKK B;  4LGM A;  4LFC M;  4M9X A;  2Z7J A;  4IBK A;  4RF1 A;  4I8O A;  3GPY A;  4FCV A;  1GL7 A;  2XLJ A;  4WHR B;  4AW4 A;  3J81 S;  4JI6 M;  1G41 A;  1NNU C;  3BOS A;  3O32 A;  3JR4 A;  4WHQ B;  2BUR B;  2A5Y B;  2VQE M;  4LF5 M;  1PJI A;  1J09 A;  4FCW A;  2CEA A;  4MGK E;  1IY2 A;  3A45 A;  1LV7 A;  3GPP A;  3MI5 M;  2XSZ A;  1N78 A;  5KO3 A;  2BUY A;  3RE8 A;  3LMX A;  1XXH B;  1ZQ9 A;  3GO8 A;  3PCC M;  3THG A;  1SXJ D;  3FYC A;  4B3M M;  4XGI A;  4CGY B;  1TH4 A;  3RGP A;  2ZBK B;  2QCU A;  5A2Q S;  2L7H A;  3FKE A;  2ZAM A;  3VDU A;  1IN7 A;  1ZAE A;  4GKJ M;  3AFH A;  2EA0 A;  4R7G A;  4JI0 M;  4JI7 M;  1EOC B;  1KYI A;  2QP9 X;  3CTW B;  4WHO B;  3U6C A;  3NBI A;  2C9C A;  3GLF A;  2OPF A;  1IBL M;  4LF4 M;  2BUZ A;  2KRU A;  4GHL A;  4DR7 M;  3FUW A;  2R46 A;  1YKN A;  4OU7 A;  3PCI M;  3ZH9 B;  1N77 A;  5BR8 M;  2L09 A;  2XSZ D;  4HL4 A;  4IBF A;  2LWX A;  3J2P B;  4MGY E;  1Z5B A;  3T38 A;  1D2N A;  1T3T A;  2D7H A;  1KFV A;  2KW0 A;  2J7N A;  2DWZ B;  4IJE A;  3PXG A;  3E9S A;  1IXS B;  2DHR A;  3PCH M;  3CF0 A;  4XBO A;  4JI2 M;  2XSR A;  4R3D A;  3J7B A;  1Z59 A;  4TUW A;  3T15 A;  5FTN A;  3SAV A;  2DWN A;  3AOE C;  4MGH A;  4JI1 M;  1NHW C;  1YKN B;  5DYG A;  3PCN M;  3SAU A;  2AHM A;  3H4M A;  3GPU A;  4B3S M;  3MI1 A;  2ERC A;  3AKZ A;  1EOB A;  5EP1 A;  4DV3 M;  1L1T A;  1N33 M;  4LJ9 A;  3UZU A;  1EOC A;  3AOG A;  1C1K A;  3HJS A;  4DR1 M;  4X64 M;  2YQZ A;  4B7G A;  2BNK A;  4IBE A;  1IN8 A;  3LXV M;  4DR4 M;  1IN4 A;  3SMP A;  4MH0 E;  1DGH A;  1XWI A;  3GRY A;  1L8Q A;  2AZQ A;  5ITT A;  1NHG C;  2RGO A;  1K3X A;  1HNX M;  4JI3 M;  7CAT A;  2F5N A;  2X4A A;  2UUA M;  1N32 M;  3SHF A;  3U6D A;  2BUT A;  4ILV A;  1QZM A;  1DO2 A;  1TDZ A;  2QBY B;  2D7E A;  3SFZ A;  4FWH A;  5ITX E;  1PM5 A;  4JV5 M;  4BB9 A;  3PCA M;  2BUR A;  4G4R A;  3TL4 X;  4MM3 B;  2CV0 A;  1YKM A;  3UJN A;  2L7I A;  4LZZ A;  2QZ4 A;  1DMH A;  4BBA A;  3VFD A;  4L16 A;  5EXP A;  1SXJ E;  4WHP A;  2BUY B;  2P5T A;  2D7G A;  2BJV A;  3FD9 A;  3TWL A;  2X8A A;  3T63 M;  4PDI A;  3KSJ A;  4DV6 M;  2DWL A;  4G4O A;  3GRU A;  2CE7 A;  5EXX A;  4CIS A;  3FUV A;  4NRW A;  4M0D A;  1HNW M;  2XEP A;  4LF6 M;  3LVW A;  3KOX E;  3OTO M;  4AKH A;  1QAO A;  1YSY A;  3HKP A;  1QYR A;  2Y0T A;  1MX0 A;  2XH9 A;  3L29 A;  3T1H M;  5EXT A;  3RGS A;  2H1R A;  1YKO B;  3KVW A;  3Q8X A;  4GKK M;  4WHP B;  4DV4 M;  3U6E A;  3SAT A;  3FTF A;  2EO2 A;  2XZF A;  1Q3C A;  3SAS A;  3FUX A;  4AG5 A;  4QNR A;  1JR3 D;  1KSF X;  4PT5 A;  5LMU M;  3PCK A;  1HT1 E;  1K3W A;  4L8R C;  1XMO M;  4NSR A;  3GQ4 A;  3TPZ A;  5KPT A;  2KXE A;  4GHA A;  4LJ8 A;  4LGY A;  3EIH A;  3A46 A;  2LH0 A;  4X66 M;  3MV4 M;  5ITQ A;  1R6B X;  3GLG B;  3VKH A;  2XZU A;  3K1J A;  1DO0 A;  1G8P A;  5EP3 A;  3O6R A;  4DR5 M;  5ITR A;  2CV2 A;  1ORY B;  1L2B A;  1Z5A A;  4IJF A;  3A98 B;  4WHQ A;  3PVS A;  1Z5C A;  1NY5 A;  4LRS A;  4LY6 A;  5GKN A;  2CV1 A;  1NSF A;  1YUB A;  1G59 A;  3HHZ A;  2BUX B;  2C9O A;  2FNA A;  5BPV A;  2XGN A;  4IBI A;  2F4V M;  4AKG A;  2BUU B;  2XSV A;  3PCD M;  4MB7 A;  4DV7 M;  2CHQ A;  2BUV B;  4RF0 A;  2BUZ B;  3T67 M;  3GLG A;  2G5G X;  4JN6 A;  5KPR A;  1YKO A;  4DR2 M;  3J7A S;  3AL0 C;  3N9T A;  3AV0 A;  2DZO B;  2UXB M;  1E32 A;  2BUW A;  1EOA A;  3EIE A;  2FOI C;  1N75 A;  2Q2E B;  3KDS E;  4GC9 A;  1N34 M;  1PJJ A;  1NJF A;  1GLN A;  2VII A;  3I4Y A;  4LJ4 A;  5F3W A;  1HT2 E;  1IN6 A;  3GLF B;  4JI8 M;  3FYD A;  2DXI A;  1YKP B;  2M60 A;  4LJ6 A;  4IBG A;  4LRT A;  4B08 A;  4LFB M;  5DYI A;  2R65 A;  3VKG A;  3HHW A;  1IY1 A;  2C99 A;  3SYK A;  3PCF M;  3CF6 E;  2F5Q A;  4JYA M;  5JI3 E;  3J80 S;  4WUR A;  4I5S A;  4D82 A;  4AZF A;  3GLH A;  2X49 A;  2R4E A;  4D80 A;  1R2Z A;  1DGB A;  2C98 A;  5EP4 A;  4IBB A;  2OQ4 A;  1NNJ A;  3LQQ A;  4L4U A;  4YY3 M;  4NOO B;  3U6S A;  1UM8 A;  3FTC A;  2KZU A;  4KOD A;  3LKT M;  3MFL M;  2E5L M;  4FD2 A;  3ILK A;  4D81 A;  2XSU A;  5FTM A;  1TMX A;  4K0K M;  4PDG A;  2BUT B;  2QPA A;  3MFL A;  1SXJ A;  4B7F A;  3MI1 M;  4AI6 A;  4LCB A;  2PCD A;  3PCM M;  2XFT A;  1EO2 A;  3KFU G;  4M9Z A;  2LXE A;  2UU9 M;  3L27 A;  2Y21 A;  2NQ8 C;  4X62 M;  3GQ5 A;  1NJG A;  2CUZ A;  2XFS A;  3HGI A;  3I4V A;  3U60 A;  4FVM A;  2ZM6 M;  4DR6 M;  5DNY A;  3PCF A;  1SXJ C;  4MGZ E;  4NXM M;  3HU3 A;  2UUC M;  1W5T A;  2R4J A;  3AJI B;  1YKM B;  4G4Q A;  4LF9 M;  1YKL A;  3T1Y M;  1E9S A;  3UGJ A;  4ZPX A;  1H6U A;  2G8L A;  4FWD A;  3HWS A;  3I51 A;  1DLM A;  3NWL A;  3ZCB B;  2HCB A;  2BUM A;  4JI5 M;  4OVZ B;  4ITQ A;  4M0W A;  2FE8 A;  2KEB A;  3T63 A;  2F5O A;  2O5R A;  3MV6 M;  3O5U A;  1HR0 M;  1R7R A;  3U6Q A;  3IG5 A;  2CHV A;  1TH2 A;  1XXH A;  2DZN B;  4AG6 A;  4REZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...