3HHYA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 70
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hhyA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hhyA02
2AZQA 3PCFM 3PCNM 2PCDM 2BUXB 3PCGM 1EOAB 3T67M 3PCBA 1DLQA 4WHOA 3PCDM 3PCAA 5TD3A 3PCKA 4ILVA 4ILTA 3MV6A 2BUWB 2BUXA 2BUTB 3MI5M 3HHXA 1DLMA 4WHRA 3HJ8A 1YKKA 3LMXM 3PCLM 3MI1M 3PCEM 2BUWA 3HJQA 1YKOB 2XSRA 1EO2A 3MV4M 3PCMM 3O5UA 3PCFA 3PCNA 2PCDA 3HKPA 3HHYA 3PCGA 3N9TA 2XSVA 1YKLB 3PCHM 3T67A 3MFLM 3HJSA 1S9AA 2BV0B 3PCDA 4WHPD 4WHPB 1EOAA 3O6RA 3MI5A 1YKNB 4WHSD 4WHSB 2BUYB 3O32A 3LMXA 3LXVM 3PCCM 4WHPA 3MI1A 3PCEA 3PCIM 2BUVB 2BUTA 2XSUA 1EOCB 3PCMA 2BUYA 3PCJM 3LKTM 3I51A 1YKMB 1YKOA 2BUVA 1DLTA 3PCHA 3HGIA 3MFLA 1EOCA 2BOYA 3T63M 1YKLA 1YKPB 1TMXA 4WHQB 2BV0A 4WHOB 2BUMB 3TH1A 3PCLA 2BUZB 3LXVA 3PCCA 2BURB 2BUQB 3PCIA 3I4VA 3PCBM 1YKPA 1YKNA 4WHQA 3MV4A 3PCAM 4WHSA 1DMHA 3PCKM 2BUMA 3PCJA 4WHRB 1YKKB 3LKTA 2BUZA 3MV6M 2BURA 2BUQA 2BUUB 1EO9B 1EOBB 4WHRF 3I4YA 1EO2B 1YKMA 3O6JA 2BUUA 3T63A 1EO9A 1EOBA 4WHOD
chains in the Genus database with same CATH superfamily
1V92A 2CEAA 1WJ7A 2V1CA 2R0IA 2K0BX 4MGKE 4OU7A 5A2QS 1YLAA 2OOBA 3W0FA 2JY8A 2PCDM 2EUCA 1D2NA 1GO5A 3J7BA 4IBJA 4LJAA 3TL4X 2ERCA 2Z7JA 3IG8A 3PCBA 2Z4RA 1TDHA 2HAKA 2UU9M 2JZ1A 1XXHA 4ILVA 4LJ9A 5EXTA 4L8RC 2L4FA 3QYEA 2APLA 4LJ6A 3R9XB 2LWXA 3D8BA 2Y21A 4ZPXA 3T15A 2A5YB 3I01M 5IT9S 1IFYA 2EKFA 2KW0A 4DV7M 4LFBM 1KSFX 4FWDA 5ITUA 2XLJA 5DFLA 1V33A 1J7KA 1YKKA 1R4GA 1NY6A 2DZOB 2O01F 4M9XA 4B7HA 1IBMM 3TE6A 3BBZA 4RNAA 2CRUA 7CATA 3KP1E 4FCTA 2R65A 4DR6M 1QAQA 3SAUA 1QZEA 4OW0A 1EO2A 2KZSA 3UJNA 2DWNA 3KOYE 1HJPA 1VEKA 3DOAA 1WXQA 1EIJA 2MR9A 1IN6A 3HU3A 3GRRA 4LF4M 3PCGA 2DAMA 2J7NA 1A5TA 3C9PA 3HJSA 2KZUA 3GPYA 4TUWA 3MFLM 4Z6YA 3PCDA 3SYKA 2XEPA 4NC6A 2W82A 4QNRA 1OAOC 1DGGA 4R3DA 4AG6A 3FYDA 4XGIA 4LF7M 2BUUB 4WHPD 2OO9A 3B7ZA 3IG5A 3KDSE 5FTJA 4PCZA 1CUKA 3HZJA 1HNWM 3O6RA 1UM8A 4R7GA 4LJ7A 3I04M 3IHPA 4WHSD 5ITXA 3SASA 3FKEA 4MH0E 5L8RF 2Y0QA 5LMUM 3GLFA 3KS8A 3MI1A 3PCIM 3KSXA 4CIZA 2XSUA 2KEBA 4IIWA 4NXMM 5GKNA 1EOCB 3ZCBB 3B7QA 1QDTA 3GRYA 1I94M 3PCMA 1QDRA 4JI2M 3AOEA 2LHCA 3AKZA 2F5NA 2JY7A 2XSZA 3C58A 1L8QA 3M0EA 3HGIA 3LVWA 4NL4H 1TTEA 3GLGA 5LMNM 4HEOA 3A45A 3M7GA 4FCVA 2JZ0A 3U6OA 4JYAM 2BOYA 3T63M 5KQDA 4DR5M 2QCUA 3JAMS 2FS1A 3AJIB 3GLHB 4LGMA 5KO3A 2MROB 3QYBA 3WHKA 2CHGA 4KODA 4L15A 3LVVA 2DAGA 3CGWA 2BUMB 4WHOB 4XBOA 1WGNA 2BURB 1SXJA 3U60B 2BJWA 2JA2A 3PCBM 1QZMA 3NBXX 4GITA 4DV2M 1S3SA 2VQFM 4CJ6A 1NJFA 4P16A 3SAWA 4JI5M 4X62M 2BUZA 1GVNA 1OFHA 3L2AA 3RE8A 1EO9B 1IXSA 1K3WA 5KPRA 2CE7A 1GLNA 5ITTA 1YKOA 4I4LA 4IBGA 1D0MA 2R18A 1Z5BA 1W5TA 3LQQA 3PXGA 1GL7A 2BJVA 2WSCF 3A98B 1Q02A 3V76A 4JI6M 2F4VM 2F5PA 3UK6A 1EOBA 2QHOB 4M0WA 2LVNC 2V1UA 2AZQA 4IJFA 5EP3A 1IBKM 1XXHB 3UMMA 2JXNA 3CTWB 4DUYM 4DV0M 1HNZM 1VEGA 2WSFF 2NQ8C 3W0LB 2KNVA 4MB7A 1QAOA 2JNHA 4OVZA 3U6PA 1DO2A 1P3QQ 4DUZM 3PCGM 2I7PA 3GPUA 5FTNA 4JI0M 4NRWA 2UXBM 4WHOA 1HR0M 3TWLA 3PCDM 3GLIE 1JR3A 3U6MA 3FUUA 1GABA 4LG2A 2C9OA 1C1KA 3CF6E 2BWEA 2YFQA 4YY3M 1HT1E 2ZTDA 3BOSA 2HHHM 3U5ZA 3SHGB 1NHGC 1Z5CA 2JY5A 2B3TA 3TQSA 1DLMA 2DKLA 3HJ8A 1RU3A 3HWSA 3KOXE 2R6FA 3QAUA 3MI1M 4KLNA 2BUWA 2P5TA 2G5GX 2KDLA 3THGA 1GJSA 4GIPA 2CHVA 2DXIA 1R2ZA 3PCMM 1OTRA 3FUWA 2ZM6M 2LHGA 4M9SA 1KFVA 3GQ5A 2ZAMA 4I5SA 3VLFB 2ZTCA 3GLHE 5E26A 3HKPA 2EO2A 2YR0A 3GQ4A 4ITQA 2LVAA 4LRTA 1UFZA 4LFAM 1LTMA 1Q39A 3FD9A 1MU5A 3SC3A 1VEJA 1R7RA 3ZH9B 1ORYB 1R5LA 1S9AA 1IXRC 3HU2A 3GLFB 4B7GA 1DV0A 2DWMA 1T43A 1IN5A 3OTOM 4CHTB 4LJ8A 4MGHA 4LF5M 3MI5A 4NRVA 4Z8XA 2QBYA 1YKNB 1TH4A 2CP8A 2GQFA 4BB9A 2JWSA 3AV0A 1K82A 1HQYE 3K92A 4GEWA 3O32A 2UUCM 2CWBA 3PNYA 1AUAA 3SYLA 4JI7M 3J81S 4PDIA 3PCEA 3HHZA 2XFTA 2FE8A 4FCWA 4DR4M 2C9CA 4X64M 1PJQA 3LMXM 1IM2A 2CHQA 2QZ4A 3GLGB 2KRUA 2DZNB 2L7IA 4DV3M 2BWBA 3ZQJA 4DV1M 3MJ5A 3I51A 1SG9A 4G4QA 2Q2EB 4GKKM 3ZC7B 2BUVA 1KYIA 2DNAA 3PCHA 4IBFA 1N34M 1K3XA 1DGHB 4JI4M 1E9RA 2Y20A 3H4MA 1EE8A 1G59A 4JI1M 3T6PA 1PM5A 4B3SM 3MK6A 4REZA 1SXJB 5EXPA 5DYIA 2L4EA 4LF9M 1Q3CA 2K47A 1PGYA 3MMPA 4MGYE 2UXCM 2Z4SA 1OQYA 2RGHA 3TPZA 2BUZB 2R45A 2FFJA 4W5WA 3RGPA 1IXSB 1R6BX 2O5RA 4LF6M 1YKPA 1YKNA 1XB2B 1F4IA 1L1TA 4QOZC 1PJJA 4LZZA 4HLQA 1ZMWA 4B08A 1DMHA 1WGLA 4IJEA 4WHRB 2OQ4A 3F92A 5DYGA 2G3QA 3FUXA 1IXZA 3K1JA 1NY5A 2XGNA 4DR7M 1DGBA 3KS4A 2EKKA 3HX3A 2CV2A 1EOBB 3A46A 3TWMA 4GMQA 2KRKA 4GC9A 3VKGA 2LH0A 1EFUB 3K9PA 4QHTA 1N33M 4RF0A 4I8OA 1D0LA 4P17A 2DENA 1J5EM 3L28A 3O6JA 2KA6B 4OVZB 2H1RA 2Y0TA 5EJCA 2LNHC 4AG5A 2VDBB 5KQ8A 3VKHA 3GLFE 1DGHA 3K2LA 1IN7A 2EA0A 1V34A 4MM3B 4GHLA 3VDUA 1IBLM 2DAKA 3R8FA 4D82A 5BPVA 1D0KA 1DLQA 2MH8A 1YE9A 2R4EA 4DR3M 1BVSA 3J80S 4F1IA 3U5ZB 4B3MM 1NSFA 3PCAA 1OKSA 3PCKA 1OJLA 4ILTA 4FD2A 2BUWB 2BUXA 3T1YM 3SMPA 1NVMA 2DVWB 4Y28F 1HNXM 2BUTB 3MI5M 3E9SA 3HHXA 4S12A 4WURA 3SHFA 4B7FA 1WR1B 4FWGA 3U6EA 4II7A 4WHRA 3GPPA 3NBIA 3PCEM 2BURA 3PFIA 1PJIA 3AL0C 3U6LA 3LCVB 2F5OA 2F5QA 4JV5M 2XSRA 4JI3M 5ITQA 1NNJA 1N32M 5KPTA 1SXJE 3GO8A 4JI8M 3PCFA 1TGUA 3PCNA 1FNNA 2JP7A 1XNQM 4GC5A 4PDGA 4BBAA 5H37D 4HL4A 1HT2E 2QQ8A 3N9TA 3PCHM 1QYRA 2K6BA 3T67A 3EIHA 2QBYB 4LGYA 4LF8M 4G4NA 3DFZA 1GL6A 1OFIA 1VQ1A 2YQZA 5F3WA 2DWLA 3ILKA 1MJGM 4EIWA 3FUVA 3KP0E 5C1BA 4G4RA 4LJ5A 4AKIA 1VG5A 4G4OA 1MX0A 2KNAA 5EQTA 1JB0F 3DZDA 3KOZE 3TWKA 4B3TM 3NWLA 4I81A 4RF1A 3Q8GA 2XSZD 3LMXA 4B3RM 4WHPA 1PRBA 4WP2A 2DI0A 2C96A 2BUVB 2BUTA 2LVOC 1NV9A 4FW9A 1YUBA 3GRUA 2C99A 5JI3E 4KO8A 4DV6M 2M60A 2OOAA 2QP9X 1TH2A 4QHSA 4K0KM 2BUYA 2VIIA 1G71A 1QVRA 2FH0A 2HCBA 1W5SA 1T6OA 3U61A 4RKUF 4MGIE 1AIPC 2LVQD 2ZAOA 4FVMA 2C5RA 2L6OA 4GRIA 3GPXA 3WHLA 4PD2A 3GRVA 5JI2E 2UUAM 4IBIA 5IWAM 2EJSA 3FRHA 4F2LA 2DAEA 1SXJD 3K8ZA 4QOSA 4R71A 1E9SA 2LXEA 1YKPB 2LBCA 4BLCA 1TMXA 1LV7A 1QANA 1N77A 2KXEA 5FTMA 4DR2M 1TF0B 1VDDA 2CV0A 4FWHA 3TH1A 4OX9M 3LXVA 3PCCA 1G4AE 1NV8A 3KVWA 3L27A 3L26A 1NO1A 1Z59A 4WHQA 3PCAM 2J5YA 3L29A 4IBCA 3PCKM 1MN3A 2VQEM 1L2CA 1WIVA 3E46A 3PCJA 2L2DA 3AOGA 3LKTA 3JR5A 1XXHE 2R46A 5EXXA 3T1HM 3U6SA 4IBKA 2BUQA 4CISA 4WHRF 2H5XA 2RKOA 4L4UA 4AW4A 3I4YA 1IY2A 1QAMA 4IBDA 4DV4M 3K9OA 3J2PB 3SATA 4LFCM 2X8AA 3FRIA 1N75A 2JY6B 2ZANA 2BUUA 1Z5AA 3CF0A 3J27B 1G41A 2VF8A 1L2BA 4WHOD 1I4WA 5IZ7D 2DHRA 3PCFM 3PCNM 1JR3D 5ITYA 2K9DA 1IN8A 4KT0F 2L7HA 3KSJA 4MGZE 3U6DA 1XMQM 3PNVA 3W67A 4AKHA 2BUXB 1TR8A 2O25A 3B89A 1EOAB 2D7EA 4CGYB 3T67M 1IY0A 2DHYA 2J7OA 3SMSA 3A42A 5EP2A 4AKGA 3LCUA 5TD3A 1ZQ9A 4AQYM 5C18A 2WSEF 4NOOB 4YHHM 1QUSA 5BR8M 3MV6A 3FUTA 2RGOA 4G6ZA 3BXWA 3SFZA 5E6JA 3LW5F 2UXDM 4XK8F 2M5ZA 3B9PA 3FYCA 3VFDA 5ITXE 3RFWA 2DAIA 5FTKA 3VDPA 2XZFA 3PCLM 3HJQA 2X4AA 1YKOB 1TH3A 3Q8XA 5DNYA 3GLIB 5EXSA 2N35A 1QUTA 1HQCA 2BNKA 3MV4M 4G3OA 3O5UA 1E32A 2I7NA 2WZJA 5EP4A 1PJSA 4M0DA 3LMMA 2PCDA 2HKJA 3FE3A 3J7AS 1DGFA 2D7HA 2R62A 4LCBA 4L78A 2R44A 3M6AA 3HHYA 1TDZA 2XSVA 2VF7A 3D8LA 1YKLB 2HL7A 3KOWE 3UZUA 2UUBM 1NJGA 3KFUG 3L25A 3AOEC 3U6QA 1T3TA 2QSFX 2MJ5B 3DA1A 3FTDA 4LJ4A 2BV0B 4DBGB 3GLGE 1R2YA 2D7GA 2CFOA 4WHPB 1IN4A 1OIZA 3B74A 1EOAA 1YSYA 3E4RA 5IREB 2G8LA 5FLXS 4NXNM 3CF2A 3KXEC 5FSWA 2QPAA 4DV5M 1E94E 2LTUA 4WHSB 1WHCA 2AHMA 2E5LM 2BUYB 1Z6TA 3LXVM 3PCCM 3JR4A 1J09A 3U61B 2RRUA 1FJGM 2MGWA 1H6UA 1C7YA 1IQPA 2X49A 3GP1A 2FOIC 3W68A 1X37A 4A3VB 3PCJM 4IBEA 3LKTM 1SXJC 2FNAA 1ZV1A 1YKMB 1Q3BA 3HHWA 1IY1A 3HY5A 5EP1A 4AZFA 4GHAA 3GLIA 1DLTA 3EIEA 4ANRA 3AFHA 3MFLA 1EOCA 3SARA 3C3EA 1PJTA 3FTEA 3VK8A 4M9ZA 1VDLA 2Z3XA 2DWZB 4UN2B 2KHHA 2ZBKB 4JXJA 1NNUC 4LZJA 4WW0A 2QENA 3MHVC 1YKLA 1GKIA 1XC8A 4WHQB 3HU1A 2F5SA 2XF3A 2HWJA 2R4JA 5FTLA 4LY6A 4NSOB 3RGSA 3H4JA 2BV0A 2L09A 4NSRA 3T38A 3PCLA 1XHBA 2V6ZM 2QNJA 2OPFA 2BUQB 1G3IA 4JN6A 3PCIA 1NHWC 2Z8YM 3I4VA 1ZAEA 2JUJA 1N78A 1XNRM 3GLHA 3LQRA 4IBBA 2LVPC 4L16A 1XMOM 3MV4A 4GH9A 3GQ3A 4WHSA 2CUZA 8CATA 4X66M 2BUMA 3VK7A 4PT5A 2YNMD 2GNOA 3PVSA 1YKKB 1JQJC 3MV6M 3FTCA 3IECA 1JR3E 1G8PA 1DO0A 1OIPA 1ZMVA 4LRSA 4Q7JA 3UGJA 1XWIA 2KNZA 4L6V6 4X65M 3SAVA 3U60A 2DZLA 4GKJM 3SBJA 4QNMA 4D80A 2XFSA 5KPZA 1EO2B 1GJTA 4D81A 3U6CA 3C3DA 2XZUA 1N36M 3FTFA 4KHPM 1ZMUA 2C98A 3E21A 2XH9A 1L1ZA 4AI6A 3QWLA 2CV1A 1YKMA 1OAIA 1L2DA 3KW6A 3B7NA 5ITRA 4DR1M 1EO9A 3T63A 1QQWA 1Y8GA
chains in the Genus database with same CATH topology
2CEAA 2V1CA 4MGKE 4OU7A 5A2QS 3W0FA 2PCDM 2EUCA 1D2NA 3J7BA 4IBJA 4LJAA 3TL4X 2ERCA 2Z7JA 3IG8A 3PCBA 2Z4RA 1TDHA 2UU9M 1XXHA 4ILVA 4LJ9A 5EXTA 4L8RC 4LJ6A 3R9XB 2LWXA 3D8BA 2Y21A 4ZPXA 3T15A 2A5YB 5IT9S 2KW0A 4DV7M 4LFBM 1KSFX 4FWDA 5ITUA 2XLJA 1YKKA 1J7KA 1NY6A 2DZOB 4B7HA 4M9XA 1IBMM 3TE6A 4RNAA 7CATA 3KP1E 4FCTA 2R65A 4DR6M 1QAQA 3SAUA 4OW0A 1EO2A 2KZSA 3UJNA 2DWNA 3KOYE 3DOAA 1WXQA 3HU3A 1IN6A 3GRRA 4LF4M 3PCGA 2J7NA 4TUWA 3MFLM 3HJSA 2KZUA 3GPYA 4Z6YA 3PCDA 3SYKA 2XEPA 4QNRA 2W82A 4R3DA 4AG6A 1DGGA 4LF7M 4WHPD 3FYDA 4XGIA 3KDSE 3IG5A 5FTJA 4PCZA 1HNWM 3O6RA 1UM8A 4R7GA 4LJ7A 4WHSD 5ITXA 3SASA 3FKEA 4MH0E 2Y0QA 5LMUM 3GLFA 3KS8A 3MI1A 3PCIM 3KSXA 2XSUA 2KEBA 4IIWA 4NXMM 5GKNA 1EOCB 3ZCBB 3GRYA 3PCMA 4JI2M 3AOEA 3AKZA 2F5NA 2XSZA 3C58A 1L8QA 3M0EA 3HGIA 3LVWA 4NL4H 3GLGA 5LMNM 3A45A 3M7GA 4FCVA 3U6OA 4JYAM 2BOYA 3T63M 5KQDA 4DR5M 2QCUA 3JAMS 3AJIB 3GLHB 4LGMA 5KO3A 3WHKA 4WHOB 2CHGA 4KODA 4L15A 3LVVA 2BUMB 4XBOA 2BURB 1SXJA 3U60B 2BJWA 2JA2A 3PCBM 1QZMA 4DV2M 4GITA 1S3SA 2VQFM 1NJFA 4P16A 3SAWA 4JI5M 4X62M 2BUZA 1GVNA 1OFHA 3L2AA 3RE8A 1EO9B 1K3WA 5KPRA 2CE7A 1GLNA 5ITTA 4I4LA 4IBGA 2R18A 1Z5BA 1W5TA 3LQQA 3PXGA 1GL7A 2BJVA 3A98B 4JI6M 2F4VM 2F5PA 3UK6A 1EOBA 4M0WA 2V1UA 2AZQA 4IJFA 5EP3A 1IBKM 1XXHB 3UMMA 3CTWB 4DUYM 4DV0M 1HNZM 1I94M 2NQ8C 3W0LB 4MB7A 4OVZA 1QAOA 3U6PA 3PCGM 1DO2A 4DUZM 2I7PA 3GPUA 5FTNA 4JI0M 4NRWA 2UXBM 4WHOA 1HR0M 3TWLA 3PCDM 1JR3A 3U6MA 3FUUA 4LG2A 2C9OA 1C1KA 3CF6E 2YFQA 4YY3M 1HT1E 3BOSA 2HHHM 3U5ZA 3SHGB 1NHGC 1Z5CA 3TQSA 1DLMA 3HWSA 3HJ8A 3KOXE 3QAUA 3MI1M 4KLNA 2BUWA 2P5TA 2G5GX 3THGA 4GIPA 2CHVA 2DXIA 1R2ZA 3PCMM 3FUWA 2ZM6M 4M9SA 1KFVA 3GQ5A 2ZAMA 4I5SA 3VLFB 5E26A 3HKPA 2EO2A 2YR0A 3GQ4A 4ITQA 4LRTA 4LFAM 1Q39A 3FD9A 1MU5A 3SC3A 1R7RA 3ZH9B 1ORYB 1S9AA 1IXRC 3HU2A 3GLFB 4B7GA 2DWMA 1IN5A 3OTOM 4CHTB 4LJ8A 4MGHA 4LF5M 3MI5A 4NRVA 4Z8XA 2QBYA 1YKNB 1TH4A 4BB9A 3AV0A 1K82A 1HQYE 3K92A 3O32A 2UUCM 3PNYA 3SYLA 4JI7M 3J81S 4PDIA 3PCEA 3HHZA 2XFTA 2FE8A 4FCWA 4DR4M 2C9CA 4X64M 1IM2A 2CHQA 2QZ4A 3GLGB 2KRUA 2DZNB 2L7IA 4DV3M 4DV1M 3MJ5A 3I51A 4G4QA 2Q2EB 4GKKM 3ZC7B 2BUVA 1KYIA 3PCHA 4IBFA 1N34M 1K3XA 1DGHB 4JI4M 1E9RA 2Y20A 3H4MA 1EE8A 1G59A 4JI1M 1PM5A 4B3SM 3MK6A 4REZA 1SXJB 5EXPA 5DYIA 4LF9M 1Q3CA 2K47A 2UXCM 4MGYE 2Z4SA 2RGHA 3TPZA 2BUZB 2R45A 2FFJA 4W5WA 3RGPA 1IXSB 1R6BX 2O5RA 4LF6M 1YKPA 1YKNA 1L1TA 4QOZC 1PJJA 4LZZA 4HLQA 1DMHA 4B08A 4IJEA 4WHRB 2OQ4A 5DYGA 3FUXA 1IXZA 3K1JA 1NY5A 2XGNA 4DR7M 1DGBA 3KS4A 1EOBB 2CV2A 3A46A 3TWMA 4GMQA 2KRKA 4GC9A 3VKGA 2LH0A 4QHTA 1N33M 4RF0A 4I8OA 1J5EM 3L28A 3O6JA 2KA6B 4OVZB 2H1RA 2Y0TA 5EJCA 2LNHC 4AG5A 5KQ8A 3VKHA 1DGHA 3K2LA 1IN7A 2EA0A 4MM3B 4GHLA 3VDUA 1IBLM 3R8FA 4D82A 5BPVA 1DLQA 1YE9A 2R4EA 4DR3M 3J80S 3U5ZB 3PCAA 4B3MM 1NSFA 3PCKA 1OJLA 4ILTA 4FD2A 2BUWB 2BUXA 3T1YM 3SMPA 1NVMA 2DVWB 1HNXM 2BUTB 3MI5M 3E9SA 3HHXA 4S12A 4WURA 3SHFA 4B7FA 4FWGA 3U6EA 4II7A 4WHRA 3GPPA 3NBIA 3PCEM 3PFIA 1PJIA 3AL0C 3U6LA 2F5OA 2F5QA 4JV5M 2XSRA 4JI3M 5ITQA 1NNJA 1N32M 5KPTA 1SXJE 3GO8A 4JI8M 3PCFA 1TGUA 3PCNA 1FNNA 1XNQM 4GC5A 4PDGA 4BBAA 5H37D 4HL4A 1HT2E 3N9TA 3PCHM 1QYRA 3T67A 3EIHA 2QBYB 4LGYA 4LF8M 4G4NA 3DFZA 1GL6A 1OFIA 2YQZA 5F3WA 2DWLA 3ILKA 4EIWA 3FUVA 3KP0E 5C1BA 4G4RA 4LJ5A 4AKIA 4G4OA 1MX0A 5EQTA 3DZDA 3KOZE 3TWKA 4B3TM 3NWLA 4I81A 4RF1A 2XSZD 3LMXA 4B3RM 4WHPA 2C96A 2BUVB 2BUTA 4FW9A 1YUBA 3GRUA 2C99A 5JI3E 4KO8A 4DV6M 2M60A 2QP9X 1TH2A 4QHSA 4K0KM 2BUYA 2VIIA 1QVRA 2HCBA 1W5SA 3U61A 4MGIE 2ZAOA 4FVMA 2C5RA 2L6OA 4GRIA 3GPXA 3WHLA 4PD2A 3GRVA 5JI2E 2UUAM 4IBIA 5IWAM 1SXJD 3K8ZA 4QOSA 1E9SA 2LXEA 1YKPB 1TMXA 4BLCA 1LV7A 1QANA 1N77A 2KXEA 5FTMA 4DR2M 1VDDA 2CV0A 4FWHA 3TH1A 4OX9M 3LXVA 3PCCA 1G4AE 3KVWA 3L27A 3L26A 1Z59A 4WHQA 3PCAM 3L29A 4IBCA 3PCKM 1L2CA 2VQEM 3PCJA 3AOGA 3LKTA 3JR5A 5EXXA 2R46A 3T1HM 2BUQA 3U6SA 4IBKA 4CISA 4WHRF 2RKOA 4L4UA 4AW4A 3I4YA 1IY2A 1QAMA 4IBDA 4DV4M 3J2PB 3SATA 4LFCM 2X8AA 1N75A 2ZANA 2BUUA 1Z5AA 3CF0A 3J27B 1G41A 1L2BA 4WHOD 1I4WA 5IZ7D 2DHRA 3PCFM 3PCNM 1JR3D 5ITYA 1IN8A 2L7HA 3KSJA 4MGZE 3U6DA 1XMQM 3PNVA 4AKHA 2BUXB 1EOAB 2D7EA 4CGYB 3T67M 1IY0A 2J7OA 3SMSA 3A42A 5EP2A 4AKGA 5TD3A 1ZQ9A 4AQYM 5C18A 4NOOB 4YHHM 5BR8M 3MV6A 3FUTA 2RGOA 4G6ZA 3SFZA 5E6JA 2UXDM 2M5ZA 3B9PA 3FYCA 3VFDA 5ITXE 3RFWA 5FTKA 3VDPA 2XZFA 3LMXM 3PCLM 3HJQA 2X4AA 1YKOB 1TH3A 3Q8XA 5DNYA 3GLIB 5EXSA 3MV4M 1HQCA 2BNKA 3O5UA 1E32A 2I7NA 5EP4A 4M0DA 3LMMA 2PCDA 2HKJA 3J7AS 1DGFA 2D7HA 2R62A 4LCBA 4L78A 3HHYA 3M6AA 1TDZA 2XSVA 3D8LA 1YKLB 2HL7A 3KOWE 3UZUA 2UUBM 1NJGA 3KFUG 3L25A 3AOEC 3U6QA 1T3TA 3FTDA 2BV0B 3DA1A 4LJ4A 1R2YA 2D7GA 2CFOA 4WHPB 1IN4A 1EOAA 1YSYA 3E4RA 5IREB 2G8LA 5FLXS 4NXNM 3CF2A 3KXEC 5FSWA 2QPAA 4DV5M 1E94E 4WHSB 2E5LM 2AHMA 2BUYB 1Z6TA 3LXVM 3PCCM 3JR4A 1J09A 3U61B 1FJGM 1H6UA 1IQPA 2X49A 3GP1A 2FOIC 1X37A 4A3VB 3PCJM 4IBEA 3LKTM 1SXJC 2FNAA 1YKMB 1Q3BA 3HHWA 1IY1A 5EP1A 4AZFA 4GHAA 1YKOA 3GLIA 1DLTA 3EIEA 3AFHA 3MFLA 1EOCA 3SARA 3FTEA 3VK8A 4M9ZA 2Z3XA 2DWZB 2ZBKB 4JXJA 1NNUC 4LZJA 4WW0A 2QENA 3MHVC 1YKLA 1GKIA 1XC8A 4WHQB 3HU1A 2F5SA 2XF3A 5FTLA 2R4JA 2BV0A 4LY6A 4NSOB 3RGSA 2L09A 4NSRA 3T38A 3PCLA 1XHBA 2V6ZM 2OPFA 2BUQB 1G3IA 4JN6A 3PCIA 1NHWC 3I4VA 1ZAEA 1N78A 1XNRM 3GLHA 3LQRA 4IBBA 4L16A 1XMOM 3MV4A 4WHSA 4GH9A 3GQ3A 2CUZA 8CATA 4X66M 2BUMA 3VK7A 4PT5A 2YNMD 3PVSA 1YKKB 1JQJC 3MV6M 3FTCA 4LRSA 2BURA 1G8PA 1DO0A 4X65M 2BUUB 3UGJA 1XWIA 3U60A 4GKJM 3SAVA 3SBJA 4QNMA 4D80A 2XFSA 5KPZA 1EO2B 4D81A 3U6CA 2XZUA 1N36M 3FTFA 4KHPM 2C98A 2XH9A 1L1ZA 4AI6A 3QWLA 2CV1A 1YKMA 1L2DA 3KW6A 5ITRA 1EO9A 4DR1M 3T63A 1QQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZQ A;  3PCF M;  3PCN M;  2PCD M;  2BUX B;  3PCG M;  1EOA B;  3T67 M;  3PCB A;  1DLQ A;  4WHO A;  3PCD M;  3PCA A;  5TD3 A;  3PCK A;  4ILV A;  4ILT A;  3MV6 A;  2BUW B;  2BUX A;  2BUT B;  3MI5 M;  3HHX A;  1DLM A;  4WHR A;  3HJ8 A;  1YKK A;  3LMX M;  3PCL M;  3MI1 M;  3PCE M;  2BUW A;  3HJQ A;  1YKO B;  2XSR A;  1EO2 A;  3MV4 M;  3PCM M;  3O5U A;  3PCF A;  3PCN A;  2PCD A;  3HKP A;  3HHY A;  3PCG A;  3N9T A;  2XSV A;  1YKL B;  3PCH M;  3T67 A;  3MFL M;  3HJS A;  1S9A A;  2BV0 B;  3PCD A;  4WHP D;  4WHP B;  1EOA A;  3O6R A;  3MI5 A;  1YKN B;  4WHS D;  4WHS B;  2BUY B;  3O32 A;  3LMX A;  3LXV M;  3PCC M;  4WHP A;  3MI1 A;  3PCE A;  3PCI M;  2BUV B;  2BUT A;  2XSU A;  1EOC B;  3PCM A;  2BUY A;  3PCJ M;  3LKT M;  3I51 A;  1YKM B;  1YKO A;  2BUV A;  1DLT A;  3PCH A;  3HGI A;  3MFL A;  1EOC A;  2BOY A;  3T63 M;  1YKL A;  1YKP B;  1TMX A;  4WHQ B;  2BV0 A;  4WHO B;  2BUM B;  3TH1 A;  3PCL A;  2BUZ B;  3LXV A;  3PCC A;  2BUR B;  2BUQ B;  3PCI A;  3I4V A;  3PCB M;  1YKP A;  1YKN A;  4WHQ A;  3MV4 A;  3PCA M;  4WHS A;  1DMH A;  3PCK M;  2BUM A;  3PCJ A;  4WHR B;  1YKK B;  3LKT A;  2BUZ A;  3MV6 M;  2BUR A;  2BUQ A;  2BUU B;  1EO9 B;  1EOB B;  4WHR F;  3I4Y A;  1EO2 B;  1YKM A;  3O6J A;  2BUU A;  3T63 A;  1EO9 A;  1EOB A;  4WHO D; 
#chains in the Genus database with same CATH topology
 1V92 A;  2CEA A;  1WJ7 A;  2V1C A;  2R0I A;  2K0B X;  4MGK E;  4OU7 A;  5A2Q S;  1YLA A;  2OOB A;  3W0F A;  2JY8 A;  2PCD M;  2EUC A;  1D2N A;  1GO5 A;  3J7B A;  4IBJ A;  4LJA A;  3TL4 X;  2ERC A;  2Z7J A;  3IG8 A;  3PCB A;  2Z4R A;  1TDH A;  2HAK A;  2UU9 M;  2JZ1 A;  1XXH A;  4ILV A;  4LJ9 A;  5EXT A;  4L8R C;  2L4F A;  3QYE A;  2APL A;  4LJ6 A;  3R9X B;  2LWX A;  3D8B A;  2Y21 A;  4ZPX A;  3T15 A;  2A5Y B;  3I01 M;  5IT9 S;  1IFY A;  2EKF A;  2KW0 A;  4DV7 M;  4LFB M;  1KSF X;  4FWD A;  5ITU A;  2XLJ A;  5DFL A;  1V33 A;  1J7K A;  1YKK A;  1R4G A;  1NY6 A;  2DZO B;  2O01 F;  4M9X A;  4B7H A;  1IBM M;  3TE6 A;  3BBZ A;  4RNA A;  2CRU A;  7CAT A;  3KP1 E;  4FCT A;  2R65 A;  4DR6 M;  1QAQ A;  3SAU A;  1QZE A;  4OW0 A;  1EO2 A;  2KZS A;  3UJN A;  2DWN A;  3KOY E;  1HJP A;  1VEK A;  3DOA A;  1WXQ A;  1EIJ A;  2MR9 A;  1IN6 A;  3HU3 A;  3GRR A;  4LF4 M;  3PCG A;  2DAM A;  2J7N A;  1A5T A;  3C9P A;  3HJS A;  2KZU A;  3GPY A;  4TUW A;  3MFL M;  4Z6Y A;  3PCD A;  3SYK A;  2XEP A;  4NC6 A;  2W82 A;  4QNR A;  1OAO C;  1DGG A;  4R3D A;  4AG6 A;  3FYD A;  4XGI A;  4LF7 M;  2BUU B;  4WHP D;  2OO9 A;  3B7Z A;  3IG5 A;  3KDS E;  5FTJ A;  4PCZ A;  1CUK A;  3HZJ A;  1HNW M;  3O6R A;  1UM8 A;  4R7G A;  4LJ7 A;  3I04 M;  3IHP A;  4WHS D;  5ITX A;  3SAS A;  3FKE A;  4MH0 E;  5L8R F;  2Y0Q A;  5LMU M;  3GLF A;  3KS8 A;  3MI1 A;  3PCI M;  3KSX A;  4CIZ A;  2XSU A;  2KEB A;  4IIW A;  4NXM M;  5GKN A;  1EOC B;  3ZCB B;  3B7Q A;  1QDT A;  3GRY A;  1I94 M;  3PCM A;  1QDR A;  4JI2 M;  3AOE A;  2LHC A;  3AKZ A;  2F5N A;  2JY7 A;  2XSZ A;  3C58 A;  1L8Q A;  3M0E A;  3HGI A;  3LVW A;  4NL4 H;  1TTE A;  3GLG A;  5LMN M;  4HEO A;  3A45 A;  3M7G A;  4FCV A;  2JZ0 A;  3U6O A;  4JYA M;  2BOY A;  3T63 M;  5KQD A;  4DR5 M;  2QCU A;  3JAM S;  2FS1 A;  3AJI B;  3GLH B;  4LGM A;  5KO3 A;  2MRO B;  3QYB A;  3WHK A;  2CHG A;  4KOD A;  4L15 A;  3LVV A;  2DAG A;  3CGW A;  2BUM B;  4WHO B;  4XBO A;  1WGN A;  2BUR B;  1SXJ A;  3U60 B;  2BJW A;  2JA2 A;  3PCB M;  1QZM A;  3NBX X;  4GIT A;  4DV2 M;  1S3S A;  2VQF M;  4CJ6 A;  1NJF A;  4P16 A;  3SAW A;  4JI5 M;  4X62 M;  2BUZ A;  1GVN A;  1OFH A;  3L2A A;  3RE8 A;  1EO9 B;  1IXS A;  1K3W A;  5KPR A;  2CE7 A;  1GLN A;  5ITT A;  1YKO A;  4I4L A;  4IBG A;  1D0M A;  2R18 A;  1Z5B A;  1W5T A;  3LQQ A;  3PXG A;  1GL7 A;  2BJV A;  2WSC F;  3A98 B;  1Q02 A;  3V76 A;  4JI6 M;  2F4V M;  2F5P A;  3UK6 A;  1EOB A;  2QHO B;  4M0W A;  2LVN C;  2V1U A;  2AZQ A;  4IJF A;  5EP3 A;  1IBK M;  1XXH B;  3UMM A;  2JXN A;  3CTW B;  4DUY M;  4DV0 M;  1HNZ M;  1VEG A;  2WSF F;  2NQ8 C;  3W0L B;  2KNV A;  4MB7 A;  1QAO A;  2JNH A;  4OVZ A;  3U6P A;  1DO2 A;  1P3Q Q;  4DUZ M;  3PCG M;  2I7P A;  3GPU A;  5FTN A;  4JI0 M;  4NRW A;  2UXB M;  4WHO A;  1HR0 M;  3TWL A;  3PCD M;  3GLI E;  1JR3 A;  3U6M A;  3FUU A;  1GAB A;  4LG2 A;  2C9O A;  1C1K A;  3CF6 E;  2BWE A;  2YFQ A;  4YY3 M;  1HT1 E;  2ZTD A;  3BOS A;  2HHH M;  3U5Z A;  3SHG B;  1NHG C;  1Z5C A;  2JY5 A;  2B3T A;  3TQS A;  1DLM A;  2DKL A;  3HJ8 A;  1RU3 A;  3HWS A;  3KOX E;  2R6F A;  3QAU A;  3MI1 M;  4KLN A;  2BUW A;  2P5T A;  2G5G X;  2KDL A;  3THG A;  1GJS A;  4GIP A;  2CHV A;  2DXI A;  1R2Z A;  3PCM M;  1OTR A;  3FUW A;  2ZM6 M;  2LHG A;  4M9S A;  1KFV A;  3GQ5 A;  2ZAM A;  4I5S A;  3VLF B;  2ZTC A;  3GLH E;  5E26 A;  3HKP A;  2EO2 A;  2YR0 A;  3GQ4 A;  4ITQ A;  2LVA A;  4LRT A;  1UFZ A;  4LFA M;  1LTM A;  1Q39 A;  3FD9 A;  1MU5 A;  3SC3 A;  1VEJ A;  1R7R A;  3ZH9 B;  1ORY B;  1R5L A;  1S9A A;  1IXR C;  3HU2 A;  3GLF B;  4B7G A;  1DV0 A;  2DWM A;  1T43 A;  1IN5 A;  3OTO M;  4CHT B;  4LJ8 A;  4MGH A;  4LF5 M;  3MI5 A;  4NRV A;  4Z8X A;  2QBY A;  1YKN B;  1TH4 A;  2CP8 A;  2GQF A;  4BB9 A;  2JWS A;  3AV0 A;  1K82 A;  1HQY E;  3K92 A;  4GEW A;  3O32 A;  2UUC M;  2CWB A;  3PNY A;  1AUA A;  3SYL A;  4JI7 M;  3J81 S;  4PDI A;  3PCE A;  3HHZ A;  2XFT A;  2FE8 A;  4FCW A;  4DR4 M;  2C9C A;  4X64 M;  1PJQ A;  3LMX M;  1IM2 A;  2CHQ A;  2QZ4 A;  3GLG B;  2KRU A;  2DZN B;  2L7I A;  4DV3 M;  2BWB A;  3ZQJ A;  4DV1 M;  3MJ5 A;  3I51 A;  1SG9 A;  4G4Q A;  2Q2E B;  4GKK M;  3ZC7 B;  2BUV A;  1KYI A;  2DNA A;  3PCH A;  4IBF A;  1N34 M;  1K3X A;  1DGH B;  4JI4 M;  1E9R A;  2Y20 A;  3H4M A;  1EE8 A;  1G59 A;  4JI1 M;  3T6P A;  1PM5 A;  4B3S M;  3MK6 A;  4REZ A;  1SXJ B;  5EXP A;  5DYI A;  2L4E A;  4LF9 M;  1Q3C A;  2K47 A;  1PGY A;  3MMP A;  4MGY E;  2UXC M;  2Z4S A;  1OQY A;  2RGH A;  3TPZ A;  2BUZ B;  2R45 A;  2FFJ A;  4W5W A;  3RGP A;  1IXS B;  1R6B X;  2O5R A;  4LF6 M;  1YKP A;  1YKN A;  1XB2 B;  1F4I A;  1L1T A;  4QOZ C;  1PJJ A;  4LZZ A;  4HLQ A;  1ZMW A;  4B08 A;  1DMH A;  1WGL A;  4IJE A;  4WHR B;  2OQ4 A;  3F92 A;  5DYG A;  2G3Q A;  3FUX A;  1IXZ A;  3K1J A;  1NY5 A;  2XGN A;  4DR7 M;  1DGB A;  3KS4 A;  2EKK A;  3HX3 A;  2CV2 A;  1EOB B;  3A46 A;  3TWM A;  4GMQ A;  2KRK A;  4GC9 A;  3VKG A;  2LH0 A;  1EFU B;  3K9P A;  4QHT A;  1N33 M;  4RF0 A;  4I8O A;  1D0L A;  4P17 A;  2DEN A;  1J5E M;  3L28 A;  3O6J A;  2KA6 B;  4OVZ B;  2H1R A;  2Y0T A;  5EJC A;  2LNH C;  4AG5 A;  2VDB B;  5KQ8 A;  3VKH A;  3GLF E;  1DGH A;  3K2L A;  1IN7 A;  2EA0 A;  1V34 A;  4MM3 B;  4GHL A;  3VDU A;  1IBL M;  2DAK A;  3R8F A;  4D82 A;  5BPV A;  1D0K A;  1DLQ A;  2MH8 A;  1YE9 A;  2R4E A;  4DR3 M;  1BVS A;  3J80 S;  4F1I A;  3U5Z B;  4B3M M;  1NSF A;  3PCA A;  1OKS A;  3PCK A;  1OJL A;  4ILT A;  4FD2 A;  2BUW B;  2BUX A;  3T1Y M;  3SMP A;  1NVM A;  2DVW B;  4Y28 F;  1HNX M;  2BUT B;  3MI5 M;  3E9S A;  3HHX A;  4S12 A;  4WUR A;  3SHF A;  4B7F A;  1WR1 B;  4FWG A;  3U6E A;  4II7 A;  4WHR A;  3GPP A;  3NBI A;  3PCE M;  2BUR A;  3PFI A;  1PJI A;  3AL0 C;  3U6L A;  3LCV B;  2F5O A;  2F5Q A;  4JV5 M;  2XSR A;  4JI3 M;  5ITQ A;  1NNJ A;  1N32 M;  5KPT A;  1SXJ E;  3GO8 A;  4JI8 M;  3PCF A;  1TGU A;  3PCN A;  1FNN A;  2JP7 A;  1XNQ M;  4GC5 A;  4PDG A;  4BBA A;  5H37 D;  4HL4 A;  1HT2 E;  2QQ8 A;  3N9T A;  3PCH M;  1QYR A;  2K6B A;  3T67 A;  3EIH A;  2QBY B;  4LGY A;  4LF8 M;  4G4N A;  3DFZ A;  1GL6 A;  1OFI A;  1VQ1 A;  2YQZ A;  5F3W A;  2DWL A;  3ILK A;  1MJG M;  4EIW A;  3FUV A;  3KP0 E;  5C1B A;  4G4R A;  4LJ5 A;  4AKI A;  1VG5 A;  4G4O A;  1MX0 A;  2KNA A;  5EQT A;  1JB0 F;  3DZD A;  3KOZ E;  3TWK A;  4B3T M;  3NWL A;  4I81 A;  4RF1 A;  3Q8G A;  2XSZ D;  3LMX A;  4B3R M;  4WHP A;  1PRB A;  4WP2 A;  2DI0 A;  2C96 A;  2BUV B;  2BUT A;  2LVO C;  1NV9 A;  4FW9 A;  1YUB A;  3GRU A;  2C99 A;  5JI3 E;  4KO8 A;  4DV6 M;  2M60 A;  2OOA A;  2QP9 X;  1TH2 A;  4QHS A;  4K0K M;  2BUY A;  2VII A;  1G71 A;  1QVR A;  2FH0 A;  2HCB A;  1W5S A;  1T6O A;  3U61 A;  4RKU F;  4MGI E;  1AIP C;  2LVQ D;  2ZAO A;  4FVM A;  2C5R A;  2L6O A;  4GRI A;  3GPX A;  3WHL A;  4PD2 A;  3GRV A;  5JI2 E;  2UUA M;  4IBI A;  5IWA M;  2EJS A;  3FRH A;  4F2L A;  2DAE A;  1SXJ D;  3K8Z A;  4QOS A;  4R71 A;  1E9S A;  2LXE A;  1YKP B;  2LBC A;  4BLC A;  1TMX A;  1LV7 A;  1QAN A;  1N77 A;  2KXE A;  5FTM A;  4DR2 M;  1TF0 B;  1VDD A;  2CV0 A;  4FWH A;  3TH1 A;  4OX9 M;  3LXV A;  3PCC A;  1G4A E;  1NV8 A;  3KVW A;  3L27 A;  3L26 A;  1NO1 A;  1Z59 A;  4WHQ A;  3PCA M;  2J5Y A;  3L29 A;  4IBC A;  3PCK M;  1MN3 A;  2VQE M;  1L2C A;  1WIV A;  3E46 A;  3PCJ A;  2L2D A;  3AOG A;  3LKT A;  3JR5 A;  1XXH E;  2R46 A;  5EXX A;  3T1H M;  3U6S A;  4IBK A;  2BUQ A;  4CIS A;  4WHR F;  2H5X A;  2RKO A;  4L4U A;  4AW4 A;  3I4Y A;  1IY2 A;  1QAM A;  4IBD A;  4DV4 M;  3K9O A;  3J2P B;  3SAT A;  4LFC M;  2X8A A;  3FRI A;  1N75 A;  2JY6 B;  2ZAN A;  2BUU A;  1Z5A A;  3CF0 A;  3J27 B;  1G41 A;  2VF8 A;  1L2B A;  4WHO D;  1I4W A;  5IZ7 D;  2DHR A;  3PCF M;  3PCN M;  1JR3 D;  5ITY A;  2K9D A;  1IN8 A;  4KT0 F;  2L7H A;  3KSJ A;  4MGZ E;  3U6D A;  1XMQ M;  3PNV A;  3W67 A;  4AKH A;  2BUX B;  1TR8 A;  2O25 A;  3B89 A;  1EOA B;  2D7E A;  4CGY B;  3T67 M;  1IY0 A;  2DHY A;  2J7O A;  3SMS A;  3A42 A;  5EP2 A;  4AKG A;  3LCU A;  5TD3 A;  1ZQ9 A;  4AQY M;  5C18 A;  2WSE F;  4NOO B;  4YHH M;  1QUS A;  5BR8 M;  3MV6 A;  3FUT A;  2RGO A;  4G6Z A;  3BXW A;  3SFZ A;  5E6J A;  3LW5 F;  2UXD M;  4XK8 F;  2M5Z A;  3B9P A;  3FYC A;  3VFD A;  5ITX E;  3RFW A;  2DAI A;  5FTK A;  3VDP A;  2XZF A;  3PCL M;  3HJQ A;  2X4A A;  1YKO B;  1TH3 A;  3Q8X A;  5DNY A;  3GLI B;  5EXS A;  2N35 A;  1QUT A;  1HQC A;  2BNK A;  3MV4 M;  4G3O A;  3O5U A;  1E32 A;  2I7N A;  2WZJ A;  5EP4 A;  1PJS A;  4M0D A;  3LMM A;  2PCD A;  2HKJ A;  3FE3 A;  3J7A S;  1DGF A;  2D7H A;  2R62 A;  4LCB A;  4L78 A;  2R44 A;  3M6A A;  3HHY A;  1TDZ A;  2XSV A;  2VF7 A;  3D8L A;  1YKL B;  2HL7 A;  3KOW E;  3UZU A;  2UUB M;  1NJG A;  3KFU G;  3L25 A;  3AOE C;  3U6Q A;  1T3T A;  2QSF X;  2MJ5 B;  3DA1 A;  3FTD A;  4LJ4 A;  2BV0 B;  4DBG B;  3GLG E;  1R2Y A;  2D7G A;  2CFO A;  4WHP B;  1IN4 A;  1OIZ A;  3B74 A;  1EOA A;  1YSY A;  3E4R A;  5IRE B;  2G8L A;  5FLX S;  4NXN M;  3CF2 A;  3KXE C;  5FSW A;  2QPA A;  4DV5 M;  1E94 E;  2LTU A;  4WHS B;  1WHC A;  2AHM A;  2E5L M;  2BUY B;  1Z6T A;  3LXV M;  3PCC M;  3JR4 A;  1J09 A;  3U61 B;  2RRU A;  1FJG M;  2MGW A;  1H6U A;  1C7Y A;  1IQP A;  2X49 A;  3GP1 A;  2FOI C;  3W68 A;  1X37 A;  4A3V B;  3PCJ M;  4IBE A;  3LKT M;  1SXJ C;  2FNA A;  1ZV1 A;  1YKM B;  1Q3B A;  3HHW A;  1IY1 A;  3HY5 A;  5EP1 A;  4AZF A;  4GHA A;  3GLI A;  1DLT A;  3EIE A;  4ANR A;  3AFH A;  3MFL A;  1EOC A;  3SAR A;  3C3E A;  1PJT A;  3FTE A;  3VK8 A;  4M9Z A;  1VDL A;  2Z3X A;  2DWZ B;  4UN2 B;  2KHH A;  2ZBK B;  4JXJ A;  1NNU C;  4LZJ A;  4WW0 A;  2QEN A;  3MHV C;  1YKL A;  1GKI A;  1XC8 A;  4WHQ B;  3HU1 A;  2F5S A;  2XF3 A;  2HWJ A;  2R4J A;  5FTL A;  4LY6 A;  4NSO B;  3RGS A;  3H4J A;  2BV0 A;  2L09 A;  4NSR A;  3T38 A;  3PCL A;  1XHB A;  2V6Z M;  2QNJ A;  2OPF A;  2BUQ B;  1G3I A;  4JN6 A;  3PCI A;  1NHW C;  2Z8Y M;  3I4V A;  1ZAE A;  2JUJ A;  1N78 A;  1XNR M;  3GLH A;  3LQR A;  4IBB A;  2LVP C;  4L16 A;  1XMO M;  3MV4 A;  4GH9 A;  3GQ3 A;  4WHS A;  2CUZ A;  8CAT A;  4X66 M;  2BUM A;  3VK7 A;  4PT5 A;  2YNM D;  2GNO A;  3PVS A;  1YKK B;  1JQJ C;  3MV6 M;  3FTC A;  3IEC A;  1JR3 E;  1G8P A;  1DO0 A;  1OIP A;  1ZMV A;  4LRS A;  4Q7J A;  3UGJ A;  1XWI A;  2KNZ A;  4L6V 6;  4X65 M;  3SAV A;  3U60 A;  2DZL A;  4GKJ M;  3SBJ A;  4QNM A;  4D80 A;  2XFS A;  5KPZ A;  1EO2 B;  1GJT A;  4D81 A;  3U6C A;  3C3D A;  2XZU A;  1N36 M;  3FTF A;  4KHP M;  1ZMU A;  2C98 A;  3E21 A;  2XH9 A;  1L1Z A;  4AI6 A;  3QWL A;  2CV1 A;  1YKM A;  1OAI A;  1L2D A;  3KW6 A;  3B7N A;  5ITR A;  4DR1 M;  1EO9 A;  3T63 A;  1QQW A;  1Y8G A; 
#chains in the Genus database with same CATH homology
 2CEA A;  2V1C A;  4MGK E;  4OU7 A;  5A2Q S;  3W0F A;  2PCD M;  2EUC A;  1D2N A;  3J7B A;  4IBJ A;  4LJA A;  3TL4 X;  2ERC A;  2Z7J A;  3IG8 A;  3PCB A;  2Z4R A;  1TDH A;  2UU9 M;  1XXH A;  4ILV A;  4LJ9 A;  5EXT A;  4L8R C;  4LJ6 A;  3R9X B;  2LWX A;  3D8B A;  2Y21 A;  4ZPX A;  3T15 A;  2A5Y B;  5IT9 S;  2KW0 A;  4DV7 M;  4LFB M;  1KSF X;  4FWD A;  5ITU A;  2XLJ A;  1YKK A;  1J7K A;  1NY6 A;  2DZO B;  4B7H A;  4M9X A;  1IBM M;  3TE6 A;  4RNA A;  7CAT A;  3KP1 E;  4FCT A;  2R65 A;  4DR6 M;  1QAQ A;  3SAU A;  4OW0 A;  1EO2 A;  2KZS A;  3UJN A;  2DWN A;  3KOY E;  3DOA A;  1WXQ A;  3HU3 A;  1IN6 A;  3GRR A;  4LF4 M;  3PCG A;  2J7N A;  4TUW A;  3MFL M;  3HJS A;  2KZU A;  3GPY A;  4Z6Y A;  3PCD A;  3SYK A;  2XEP A;  4QNR A;  2W82 A;  4R3D A;  4AG6 A;  1DGG A;  4LF7 M;  4WHP D;  3FYD A;  4XGI A;  3KDS E;  3IG5 A;  5FTJ A;  4PCZ A;  1HNW M;  3O6R A;  1UM8 A;  4R7G A;  4LJ7 A;  4WHS D;  5ITX A;  3SAS A;  3FKE A;  4MH0 E;  2Y0Q A;  5LMU M;  3GLF A;  3KS8 A;  3MI1 A;  3PCI M;  3KSX A;  2XSU A;  2KEB A;  4IIW A;  4NXM M;  5GKN A;  1EOC B;  3ZCB B;  3GRY A;  3PCM A;  4JI2 M;  3AOE A;  3AKZ A;  2F5N A;  2XSZ A;  3C58 A;  1L8Q A;  3M0E A;  3HGI A;  3LVW A;  4NL4 H;  3GLG A;  5LMN M;  3A45 A;  3M7G A;  4FCV A;  3U6O A;  4JYA M;  2BOY A;  3T63 M;  5KQD A;  4DR5 M;  2QCU A;  3JAM S;  3AJI B;  3GLH B;  4LGM A;  5KO3 A;  3WHK A;  4WHO B;  2CHG A;  4KOD A;  4L15 A;  3LVV A;  2BUM B;  4XBO A;  2BUR B;  1SXJ A;  3U60 B;  2BJW A;  2JA2 A;  3PCB M;  1QZM A;  4DV2 M;  4GIT A;  1S3S A;  2VQF M;  1NJF A;  4P16 A;  3SAW A;  4JI5 M;  4X62 M;  2BUZ A;  1GVN A;  1OFH A;  3L2A A;  3RE8 A;  1EO9 B;  1K3W A;  5KPR A;  2CE7 A;  1GLN A;  5ITT A;  4I4L A;  4IBG A;  2R18 A;  1Z5B A;  1W5T A;  3LQQ A;  3PXG A;  1GL7 A;  2BJV A;  3A98 B;  4JI6 M;  2F4V M;  2F5P A;  3UK6 A;  1EOB A;  4M0W A;  2V1U A;  2AZQ A;  4IJF A;  5EP3 A;  1IBK M;  1XXH B;  3UMM A;  3CTW B;  4DUY M;  4DV0 M;  1HNZ M;  1I94 M;  2NQ8 C;  3W0L B;  4MB7 A;  4OVZ A;  1QAO A;  3U6P A;  3PCG M;  1DO2 A;  4DUZ M;  2I7P A;  3GPU A;  5FTN A;  4JI0 M;  4NRW A;  2UXB M;  4WHO A;  1HR0 M;  3TWL A;  3PCD M;  1JR3 A;  3U6M A;  3FUU A;  4LG2 A;  2C9O A;  1C1K A;  3CF6 E;  2YFQ A;  4YY3 M;  1HT1 E;  3BOS A;  2HHH M;  3U5Z A;  3SHG B;  1NHG C;  1Z5C A;  3TQS A;  1DLM A;  3HWS A;  3HJ8 A;  3KOX E;  3QAU A;  3MI1 M;  4KLN A;  2BUW A;  2P5T A;  2G5G X;  3THG A;  4GIP A;  2CHV A;  2DXI A;  1R2Z A;  3PCM M;  3FUW A;  2ZM6 M;  4M9S A;  1KFV A;  3GQ5 A;  2ZAM A;  4I5S A;  3VLF B;  5E26 A;  3HKP A;  2EO2 A;  2YR0 A;  3GQ4 A;  4ITQ A;  4LRT A;  4LFA M;  1Q39 A;  3FD9 A;  1MU5 A;  3SC3 A;  1R7R A;  3ZH9 B;  1ORY B;  1S9A A;  1IXR C;  3HU2 A;  3GLF B;  4B7G A;  2DWM A;  1IN5 A;  3OTO M;  4CHT B;  4LJ8 A;  4MGH A;  4LF5 M;  3MI5 A;  4NRV A;  4Z8X A;  2QBY A;  1YKN B;  1TH4 A;  4BB9 A;  3AV0 A;  1K82 A;  1HQY E;  3K92 A;  3O32 A;  2UUC M;  3PNY A;  3SYL A;  4JI7 M;  3J81 S;  4PDI A;  3PCE A;  3HHZ A;  2XFT A;  2FE8 A;  4FCW A;  4DR4 M;  2C9C A;  4X64 M;  1IM2 A;  2CHQ A;  2QZ4 A;  3GLG B;  2KRU A;  2DZN B;  2L7I A;  4DV3 M;  4DV1 M;  3MJ5 A;  3I51 A;  4G4Q A;  2Q2E B;  4GKK M;  3ZC7 B;  2BUV A;  1KYI A;  3PCH A;  4IBF A;  1N34 M;  1K3X A;  1DGH B;  4JI4 M;  1E9R A;  2Y20 A;  3H4M A;  1EE8 A;  1G59 A;  4JI1 M;  1PM5 A;  4B3S M;  3MK6 A;  4REZ A;  1SXJ B;  5EXP A;  5DYI A;  4LF9 M;  1Q3C A;  2K47 A;  2UXC M;  4MGY E;  2Z4S A;  2RGH A;  3TPZ A;  2BUZ B;  2R45 A;  2FFJ A;  4W5W A;  3RGP A;  1IXS B;  1R6B X;  2O5R A;  4LF6 M;  1YKP A;  1YKN A;  1L1T A;  4QOZ C;  1PJJ A;  4LZZ A;  4HLQ A;  1DMH A;  4B08 A;  4IJE A;  4WHR B;  2OQ4 A;  5DYG A;  3FUX A;  1IXZ A;  3K1J A;  1NY5 A;  2XGN A;  4DR7 M;  1DGB A;  3KS4 A;  1EOB B;  2CV2 A;  3A46 A;  3TWM A;  4GMQ A;  2KRK A;  4GC9 A;  3VKG A;  2LH0 A;  4QHT A;  1N33 M;  4RF0 A;  4I8O A;  1J5E M;  3L28 A;  3O6J A;  2KA6 B;  4OVZ B;  2H1R A;  2Y0T A;  5EJC A;  2LNH C;  4AG5 A;  5KQ8 A;  3VKH A;  1DGH A;  3K2L A;  1IN7 A;  2EA0 A;  4MM3 B;  4GHL A;  3VDU A;  1IBL M;  3R8F A;  4D82 A;  5BPV A;  1DLQ A;  1YE9 A;  2R4E A;  4DR3 M;  3J80 S;  3U5Z B;  3PCA A;  4B3M M;  1NSF A;  3PCK A;  1OJL A;  4ILT A;  4FD2 A;  2BUW B;  2BUX A;  3T1Y M;  3SMP A;  1NVM A;  2DVW B;  1HNX M;  2BUT B;  3MI5 M;  3E9S A;  3HHX A;  4S12 A;  4WUR A;  3SHF A;  4B7F A;  4FWG A;  3U6E A;  4II7 A;  4WHR A;  3GPP A;  3NBI A;  3PCE M;  3PFI A;  1PJI A;  3AL0 C;  3U6L A;  2F5O A;  2F5Q A;  4JV5 M;  2XSR A;  4JI3 M;  5ITQ A;  1NNJ A;  1N32 M;  5KPT A;  1SXJ E;  3GO8 A;  4JI8 M;  3PCF A;  1TGU A;  3PCN A;  1FNN A;  1XNQ M;  4GC5 A;  4PDG A;  4BBA A;  5H37 D;  4HL4 A;  1HT2 E;  3N9T A;  3PCH M;  1QYR A;  3T67 A;  3EIH A;  2QBY B;  4LGY A;  4LF8 M;  4G4N A;  3DFZ A;  1GL6 A;  1OFI A;  2YQZ A;  5F3W A;  2DWL A;  3ILK A;  4EIW A;  3FUV A;  3KP0 E;  5C1B A;  4G4R A;  4LJ5 A;  4AKI A;  4G4O A;  1MX0 A;  5EQT A;  3DZD A;  3KOZ E;  3TWK A;  4B3T M;  3NWL A;  4I81 A;  4RF1 A;  2XSZ D;  3LMX A;  4B3R M;  4WHP A;  2C96 A;  2BUV B;  2BUT A;  4FW9 A;  1YUB A;  3GRU A;  2C99 A;  5JI3 E;  4KO8 A;  4DV6 M;  2M60 A;  2QP9 X;  1TH2 A;  4QHS A;  4K0K M;  2BUY A;  2VII A;  1QVR A;  2HCB A;  1W5S A;  3U61 A;  4MGI E;  2ZAO A;  4FVM A;  2C5R A;  2L6O A;  4GRI A;  3GPX A;  3WHL A;  4PD2 A;  3GRV A;  5JI2 E;  2UUA M;  4IBI A;  5IWA M;  1SXJ D;  3K8Z A;  4QOS A;  1E9S A;  2LXE A;  1YKP B;  1TMX A;  4BLC A;  1LV7 A;  1QAN A;  1N77 A;  2KXE A;  5FTM A;  4DR2 M;  1VDD A;  2CV0 A;  4FWH A;  3TH1 A;  4OX9 M;  3LXV A;  3PCC A;  1G4A E;  3KVW A;  3L27 A;  3L26 A;  1Z59 A;  4WHQ A;  3PCA M;  3L29 A;  4IBC A;  3PCK M;  1L2C A;  2VQE M;  3PCJ A;  3AOG A;  3LKT A;  3JR5 A;  5EXX A;  2R46 A;  3T1H M;  2BUQ A;  3U6S A;  4IBK A;  4CIS A;  4WHR F;  2RKO A;  4L4U A;  4AW4 A;  3I4Y A;  1IY2 A;  1QAM A;  4IBD A;  4DV4 M;  3J2P B;  3SAT A;  4LFC M;  2X8A A;  1N75 A;  2ZAN A;  2BUU A;  1Z5A A;  3CF0 A;  3J27 B;  1G41 A;  1L2B A;  4WHO D;  1I4W A;  5IZ7 D;  2DHR A;  3PCF M;  3PCN M;  1JR3 D;  5ITY A;  1IN8 A;  2L7H A;  3KSJ A;  4MGZ E;  3U6D A;  1XMQ M;  3PNV A;  4AKH A;  2BUX B;  1EOA B;  2D7E A;  4CGY B;  3T67 M;  1IY0 A;  2J7O A;  3SMS A;  3A42 A;  5EP2 A;  4AKG A;  5TD3 A;  1ZQ9 A;  4AQY M;  5C18 A;  4NOO B;  4YHH M;  5BR8 M;  3MV6 A;  3FUT A;  2RGO A;  4G6Z A;  3SFZ A;  5E6J A;  2UXD M;  2M5Z A;  3B9P A;  3FYC A;  3VFD A;  5ITX E;  3RFW A;  5FTK A;  3VDP A;  2XZF A;  3LMX M;  3PCL M;  3HJQ A;  2X4A A;  1YKO B;  1TH3 A;  3Q8X A;  5DNY A;  3GLI B;  5EXS A;  3MV4 M;  1HQC A;  2BNK A;  3O5U A;  1E32 A;  2I7N A;  5EP4 A;  4M0D A;  3LMM A;  2PCD A;  2HKJ A;  3J7A S;  1DGF A;  2D7H A;  2R62 A;  4LCB A;  4L78 A;  3HHY A;  3M6A A;  1TDZ A;  2XSV A;  3D8L A;  1YKL B;  2HL7 A;  3KOW E;  3UZU A;  2UUB M;  1NJG A;  3KFU G;  3L25 A;  3AOE C;  3U6Q A;  1T3T A;  3FTD A;  2BV0 B;  3DA1 A;  4LJ4 A;  1R2Y A;  2D7G A;  2CFO A;  4WHP B;  1IN4 A;  1EOA A;  1YSY A;  3E4R A;  5IRE B;  2G8L A;  5FLX S;  4NXN M;  3CF2 A;  3KXE C;  5FSW A;  2QPA A;  4DV5 M;  1E94 E;  4WHS B;  2E5L M;  2AHM A;  2BUY B;  1Z6T A;  3LXV M;  3PCC M;  3JR4 A;  1J09 A;  3U61 B;  1FJG M;  1H6U A;  1IQP A;  2X49 A;  3GP1 A;  2FOI C;  1X37 A;  4A3V B;  3PCJ M;  4IBE A;  3LKT M;  1SXJ C;  2FNA A;  1YKM B;  1Q3B A;  3HHW A;  1IY1 A;  5EP1 A;  4AZF A;  4GHA A;  1YKO A;  3GLI A;  1DLT A;  3EIE A;  3AFH A;  3MFL A;  1EOC A;  3SAR A;  3FTE A;  3VK8 A;  4M9Z A;  2Z3X A;  2DWZ B;  2ZBK B;  4JXJ A;  1NNU C;  4LZJ A;  4WW0 A;  2QEN A;  3MHV C;  1YKL A;  1GKI A;  1XC8 A;  4WHQ B;  3HU1 A;  2F5S A;  2XF3 A;  5FTL A;  2R4J A;  2BV0 A;  4LY6 A;  4NSO B;  3RGS A;  2L09 A;  4NSR A;  3T38 A;  3PCL A;  1XHB A;  2V6Z M;  2OPF A;  2BUQ B;  1G3I A;  4JN6 A;  3PCI A;  1NHW C;  3I4V A;  1ZAE A;  1N78 A;  1XNR M;  3GLH A;  3LQR A;  4IBB A;  4L16 A;  1XMO M;  3MV4 A;  4WHS A;  4GH9 A;  3GQ3 A;  2CUZ A;  8CAT A;  4X66 M;  2BUM A;  3VK7 A;  4PT5 A;  2YNM D;  3PVS A;  1YKK B;  1JQJ C;  3MV6 M;  3FTC A;  4LRS A;  2BUR A;  1G8P A;  1DO0 A;  4X65 M;  2BUU B;  3UGJ A;  1XWI A;  3U60 A;  4GKJ M;  3SAV A;  3SBJ A;  4QNM A;  4D80 A;  2XFS A;  5KPZ A;  1EO2 B;  4D81 A;  3U6C A;  2XZU A;  1N36 M;  3FTF A;  4KHP M;  2C98 A;  2XH9 A;  1L1Z A;  4AI6 A;  3QWL A;  2CV1 A;  1YKM A;  1L2D A;  3KW6 A;  5ITR A;  1EO9 A;  4DR1 M;  3T63 A;  1QQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...