4JI0M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 22
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji0M02
4X64M 2UUCM 5BR8M 4PD2A 2VQEM 4LFAM 2OQ4A 4DR3M 4OX9M 2UXDM 4PDGA 3U6LA 3U6QA 2HHHM 3A45A 1KFVA 4JI1M 5ITRA 3VK7A 1HNZM 1XNQM 2EA0A 5IT9S 3U6SA 1L1ZA 4KHPM 3T1YM 3SAVA 3J81S 2F4VM 2F5NA 3U6MA 1IBKM 3GPXA 2Q2EB 1R2YA 4LF5M 3GP1A 4PCZA 4NXNM 1XMOM 1Z59A 3OTOM 4NRWA 5ITUA 3JR5A 4DR4M 1Z5CA 3GPYA 1EE8A 2ZBKB 3SBJA 1K82A 4JI2M 4MB7A 4X62M 1XC8A 3TWKA 4DV6M 3SAUA 5ITYA 2UU9M 2OPFA 1R2ZA 3GPPA 4DR1M 3VK8A 2F5SA 4YY3M 4JI6M 3GQ3A 3J80S 1N33M 5ITQA 4JI0M 2UXBM 4YHHM 1TDZA 4DV5M 3TWLA 3GPUA 4DV3M 4DV1M 5LMUM 3U6OA 3SASA 1N36M 1TDHA 4LF9M 1IBLM 1L2CA 1PJIA 4JYAM 4LF6M 4DV0M 4DUYM 2UUAM 3A46A 1Q3BA 5A2QS 1K3WA 1PM5A 2ZM6M 5ITXE 1HNWM 1HR0M 2XZUA 1Q39A 4DR7M 1K3XA 1I94M 4NRVA 3C58A 4GKJM 4ITQA 4LF8M 2F5OA 5LMNM 2F5PA 2UUBM 4CISA 4G4QA 1IBMM 4JI4M 1XMQM 3GQ5A 3GQ4A 3U6EA 1NNJA 2XZFA 1MU5A 5ITXA 4B3RM 4DV7M 3U6DA 3TWMA 4DV2M 3U6CA 3SARA 2HKJA 3J7AS 4K0KM 4DUZM 4JI8M 4G4RA 1HNXM 4G4NA 3A42A 5ITTA 4JI3M 1Z5BA 1MX0A 3DOAA 3JR4A 4DR6M 4LF4M 4B3MM 4DV4M 3SAWA 3JAMS 1L2BA 4B3SM 1N32M 2UXCM 1L1TA 4LFBM 4X65M 1L2DA 4LF7M 1FJGM 1Q3CA 4B3TM 3T1HM 4JI7M 4GKKM 1XNRM 4PDIA 4G4OA 3GO8A 2VQFM 4AQYM 4JI5M 1PJJA 3SATA 1N34M 4X66M 4DR5M 5IWAM 4DR2M 3W0FA 4NXMM 3U6PA 1J5EM 4LFCM 4JV5M 2E5LM 2F5QA 1Z5AA 5FLXS
chains in the Genus database with same CATH superfamily
4X64M 2DZNB 2JY5A 4PD2A 5BR8M 2VQEM 1IFYA 4PDGA 3KS4A 3U6QA 1VQ1A 1WIVA 2CRUA 2VF7A 1SXJA 4LJ4A 3GLGB 1KFVA 3UGJA 5C1BA 2FNAA 1AIPC 1DV0A 2EA0A 5C18A 1OAOC 5GKNA 2CHVA 3ZH9B 1L1ZA 3V76A 3AOGA 3J81S 2R4EA 4W5WA 1X37A 4LG2A 2LTUA 2Q2EB 5KO3A 1R2YA 4M0WA 4AKGA 2RGHA 3KXEC 3RGPA 1IQPA 1LV7A 4IBJA 2P5TA 1UFZA 3OTOM 2ERCA 1G71A 4LJ5A 4DR4M 1YUBA 3SYKA 1MN3A 1EE8A 5H37D 4JXJA 1LTMA 4WURA 4WP2A 4JI2M 4IBKA 3GRRA 3TWKA 2L7HA 4RF0A 1GKIA 2XEPA 3PNYA 4P16A 3SAUA 1C7YA 4M9XA 4GITA 2UU9M 2OPFA 1R2ZA 1J09A 3GPPA 1T6OA 4AG6A 4JI6M 1OFHA 3VLFB 2R44A 2OOAA 3FYDA 4LZZA 3LW5F 4IBIA 4F1IA 3HU2A 3FTEA 1QQWA 2YFQA 1QDRA 3LCVB 2MROB 3PFIA 3FTDA 2O5RA 2QQ8A 3LQRA 2JXNA 5LMUM 4DV1M 2DWNA 3BOSA 1N36M 1WGLA 1Q02A 4MM3B 4MGKE 4QOSA 4FCVA 5EXSA 3GLFE 4LF6M 2KRKA 7CATA 4DV0M 4UN2B 1P3QQ 5FTJA 1VEJA 2V1UA 4AKHA 1HNWM 3KFUG 2DENA 3KVWA 2K47A 3B7ZA 2L4FA 4LRSA 4CHTB 3GLIE 1QYRA 2XH9A 4OVZB 2KW0A 4B7GA 2BWBA 3IHPA 4G4QA 3IG8A 3GLFA 3IG5A 3E9SA 3RFWA 3NBIA 3L27A 1D0MA 4MH0E 2XZFA 1IN5A 2QHOB 5KPZA 2DAEA 2WZJA 4GH9A 2K9DA 3ILKA 4I4LA 1IY1A 4F2LA 2QZ4A 4L78A 3GLIA 1GJSA 3KS8A 4RKUF 1WXQA 2X49A 4WW0A 1QANA 4IIWA 4AZFA 1VDDA 4FWDA 4B3MM 1QAMA 2CWBA 3JAMS 3H4MA 4B3SM 1QDTA 2EKKA 2ZAOA 1JB0F 2J5YA 1G4AE 1XB2B 3QYEA 3K8ZA 1KYIA 2O01F 1OIPA 3KOYE 4B3TM 2G8LA 1ZAEA 4IBDA 5KPRA 4GKKM 3KSJA 1N75A 1ZQ9A 4PDIA 4AQYM 3VFDA 4IBFA 1IN7A 1N34M 1G41A 4DR5M 1WHCA 3W67A 3FTCA 2CUZA 3I4YA 2ZAMA 3K92A 4LFCM 5KQDA 4JV5M 2UXDM 3M0EA 4LFAM 2OQ4A 5EXTA 1AUAA 1BVSA 2I7NA 2DWLA 4QHTA 3U6LA 3UMMA 4GHLA 3RE8A 4G6ZA 4IBEA 4JI1M 2L7IA 1IM2A 3HZJA 3VK7A 1HNZM 1VG5A 1V34A 3D8LA 3HHZA 3L29A 1D0LA 4HEOA 3T1YM 1A5TA 2XGNA 1TGUA 3SAVA 2KEBA 4QHSA 2C5RA 2F5NA 2XSZA 3FUTA 2DKLA 1R5LA 2DHYA 2KA6B 2O25A 3B89A 8CATA 4LF5M 3RGSA 4LGMA 2WSEF 3MK6A 1Z59A 3U5ZB 1OAIA 4B08A 4CIZA 1N78A 4NRWA 3JR5A 1NSFA 2LVOC 5BPVA 3E46A 1FNNA 2JY6B 3L26A 4AKIA 4M9SA 4LJ9A 4NC6A 4X62M 2Z7JA 1XC8A 3AOEA 4II7A 2LXEA 1VEGA 2CV1A 2MR9A 3J27B 5F3WA 1NNUC 3LVVA 2Y0TA 2K6BA 2JZ0A 4DR1M 4GRIA 1DGHB 2DAMA 4LJ6A 1H6UA 1NJFA 3THGA 1XHBA 2HCBA 2OOBA 3BBZA 1JR3D 1DO0A 1PJSA 3HHYA 3J80S 3U61A 1YE9A 1N33M 5ITQA 3NWLA 2UXBM 4YHHM 2QBYB 4DV5M 3GRUA 3MMPA 1DGBA 1OIZA 3GLHB 4KODA 1NHGC 1IXSA 3F92A 2Z8YM 4L16A 3GPUA 3W68A 4A3VB 2EJSA 3FRIA 1QAQA 2XF3A 3KOXE 3FUWA 4KT0F 1Y8GA 2LNHC 1D2NA 1NO1A 2C99A 1L2CA 1WGNA 3TQSA 2R65A 1SG9A 5KQ8A 2DAKA 2UUAM 1Q3BA 2WSCF 4MGZE 3GLGE 4FW9A 4NL4H 2L6OA 2ZM6M 5ITXE 3FYCA 1DO2A 2FE8A 2KZUA 5IZ7D 1R7RA 4GEWA 3AJIB 4BBAA 2D7GA 1YLAA 4ANRA 3AKZA 1K3XA 1HT1E 1F4IA 5LMNM 1MJGM 2ZTDA 2CP8A 1TH4A 2Z3XA 1IBMM 1JQJC 1PJQA 1ZMUA 2MJ5B 4GC9A 2R45A 3GLGA 3FUUA 1SXJD 3C3EA 1MU5A 1XWIA 3HU1A 2FFJA 1E9SA 3HU3A 5ITXA 3UZUA 1WR1B 2XFTA 2Z4SA 4B3RM 3TWMA 3U6CA 2QPAA 4K0KM 1ZMWA 3FUVA 4DUZM 5FTNA 4JI8M 4G4RA 1OKSA 3VKHA 1NJGA 3HWSA 1EFUB 1HNXM 1NVMA 1Z5BA 2BNKA 1G59A 2LH0A 2R62A 1GL7A 1CUKA 1MX0A 1NY5A 4NSOB 3HGIA 2CEAA 3A98B 3E21A 4DV4M 3K9OA 2DAGA 2HL7A 1L2BA 4TUWA 3U60B 4QOZC 4LFBM 2W82A 2FOIC 4Y28F 1GVNA 3MHVC 4LJAA 1XXHB 5EP1A 1NV8A 2FS1A 2KNZA 3LCUA 3SFZA 2VDBB 1EIJA 2Y21A 3R8FA 1Q3CA 5IREB 3L28A 3SMSA 4JI7M 1T43A 2KNAA 3QYBA 3LVWA 4G4OA 2N35A 1PJJA 1D0KA 3T15A 3KW6A 1IY0A 3HKPA 2KRUA 1E9RA 2C96A 4KLNA 2C98A 3J2PB 3W0FA 1QZMA 2YNMD 2F5QA 5ITTA 1K82A 2B3TA 2DWZB 2CV0A 2LVQD 4OX9M 3Q8XA 4RNAA 2HHHM 2GNOA 2RGOA 2EUCA 4XK8F 4FWHA 2V6ZM 4LY6A 4KO8A 3HJSA 3LQQA 5EP4A 5IT9S 3Q8GA 2R46A 4KHPM 5FTLA 2YQZA 3B7NA 2KDLA 1G8PA 3U6MA 2K0BX 1IBKM 4Q7JA 3B9PA 2KNVA 1XMOM 3I4VA 5FSWA 2LVNC 3H4JA 2G3QA 3I04M 4B7HA 3AV0A 4REZA 2R4JA 5ITUA 2Y20A 5DFLA 3VKGA 4R3DA 1OJLA 3KOWE 3GRVA 3C9PA 2L09A 4OVZA 4D81A 4FWGA 3L25A 2L2DA 2ZANA 4FD2A 2CE7A 2JY7A 3CF0A 2C9OA 4G3OA 3HY5A 1GL6A 2QENA 3I01M 4DV6M 4HL4A 2KZSA 1KSFX 3QWLA 4GC5A 3FKEA 1E32A 4R7GA 1HJPA 1QUSA 3FD9A 3HJ8A 3T6PA 3BXWA 2F5SA 4YY3M 4DBGB 5KPTA 2OO9A 3TPZA 4MGHA 3KDSE 1TDZA 3KOZE 1SXJB 4LZJA 3HJQA 3AFHA 3IECA 3TWLA 3W0LB 4DV3M 2KHHA 3U6OA 2MGWA 2LVPC 3UJNA 4LF9M 3CTWB 2DXIA 1IBLM 1T3TA 3AOEC 1PRBA 3L2AA 3U61B 5E6JA 3HX3A 3A46A 2DWMA 1SXJC 1PM5A 4CGYB 2XZUA 1Q39A 1ORYB 4DR7M 4NRVA 2YR0A 3C58A 4OW0A 4LF8M 3KP0E 4I81A 1GO5A 1HQCA 3AL0C 2UUBM 4CISA 4GHAA 3C3DA 3GQ5A 3GQ4A 3U6EA 1E94E 4DV7M 4LJ7A 2MH8A 1L8QA 1N77A 3U6DA 3NBXX 3J7BA 4PT5A 4DV2M 1J7KA 2EO2A 2HKJA 3J7AS 1GABA 2C9CA 4L8RC 3MJ5A 4CJ6A 2L4EA 1GLNA 2XSZD 2G5GX 4FCWA 2DZLA 3DA1A 2J7NA 2QP9X 3A42A 1UM8A 3HHXA 4IJEA 3DOAA 4LF4M 3FE3A 4M0DA 4QNMA 2ZTCA 3SAWA 3U5ZA 1TH2A 5EP3A 3GRYA 1IXRC 1TR8A 2WSFF 5DNYA 2UXCM 1L1TA 1PGYA 2FH0A 4X65M 1L2DA 1NV9A 4XGIA 5L8RF 4LF7M 4Z8XA 4AW4A 2JZ1A 1NHWC 1TTEA 2XFSA 4I8OA 3E4RA 3SYLA 2JUJA 4FVMA 4S12A 1FJGM 3T1HM 2RKOA 4FCTA 1WJ7A 2LVAA 2NQ8C 3GLHE 3QAUA 4RF1A 2VQFM 1TF0B 3K2LA 1W5SA 3FRHA 4Z6YA 1IN8A 1S3SA 4X66M 4JI5M 5IWAM 3CF6E 1HQYE 1OQYA 5FTMA 1QZEA 4NXMM 1J5EM 4NOOB 1DGHA 3EIHA 3K1JA 1IN4A 3KP1E 3PNVA 1R4GA 2HAKA 3TL4X 1Z5AA 3UK6A 2E5LM 3SHFA 2UUCM 3GLFB 2H1RA 3T38A 4DR3M 2QBYA 3GLHA 3A45A 4QNRA 2DHRA 5ITRA 1XNQM 1V33A 4MGIE 2AHMA 2DZOB 3CGWA 1DGFA 3SHGB 3U6SA 2CV2A 1VEKA 3GLIB 2QCUA 2F4VM 3KSXA 3FTFA 4L4UA 2D7HA 3SC3A 2APLA 1PJTA 3GPXA 4MGYE 1QUTA 2R18A 3B7QA 5DYGA 3GP1A 4LRTA 4PCZA 4NXNM 3DZDA 4NSRA 3EIEA 1DGGA 5EXPA 3PXGA 3WHLA 1Z5CA 2EKFA 2KXEA 2LHGA 4IBCA 1QAOA 3GPYA 3WHKA 4OU7A 4B7FA 2DNAA 2ZBKB 3SBJA 4GIPA 4MB7A 5JI3E 2CHGA 3SMPA 5ITYA 2DI0A 2QSFX 4LCBA 3FUXA 4IJFA 1XXHE 1OFIA 3VK8A 2R0IA 1I4WA 3GQ3A 4IBGA 3B74A 2JP7A 4JI0M 2A5YB 2J7OA 4LJ8A 4M9ZA 2R6FA 3U60A 1TH3A 2V1CA 4HLQA 3SASA 5FTKA 1TDHA 1XXHA 3PVSA 2M60A 5JI2E 2VF8A 1Z6TA 1ZMVA 5EQTA 3K9PA 4JYAM 1C1KA 1PJIA 2QNJA 4P17A 1IN6A 4DUYM 1YSYA 4JN6A 3D8BA 5A2QS 1K3WA 2X4AA 2H5XA 1HR0M 2LBCA 1I94M 2LHCA 2BJVA 4GKJM 4ITQA 4IBBA 5DYIA 2F5OA 2JA2A 3M6AA 4XBOA 2F5PA 4D80A 4EIWA 4JI4M 1JR3E 2RRUA 5E26A 1XMQM 2Y0QA 2JWSA 1NNJA 2DVWB 3HHWA 1W5TA 1ZV1A 1OTRA 4BLCA 2XLJA 5EJCA 3SARA 3ZC7B 3ZCBB 3TE6A 1HT2E 1GJTA 1V92A 2X8AA 3VDUA 4G4NA 2DAIA 4GMQA 4JI3M 1JR3A 1QVRA 4L6V6 3JR4A 4DR6M 3CF2A 4I5SA 1IY2A 3I51A 1IXZA 4L15A 4ZPXA 2M5ZA 4AG5A 3LMMA 1IXSB 1N32M 4R71A 3ZQJA 1G3IA 5EXXA 2JNHA 4LGYA 3R9XB 2BWEA 1RU3A 1VDLA 2CHQA 2GQFA 2LWXA 4BB9A 2JY8A 1XNRM 3DFZA 1SXJE 3GO8A 2I7PA 2HWJA 2D7EA 3M7GA 2Z4RA 3SATA 4DR2M 1R6BX 4D82A 3U6PA 3VDPA 4AI6A 2BJWA 1NY6A 2VIIA 2CFOA 5FLXS 5EP2A
chains in the Genus database with same CATH topology
4X64M 2DZNB 4PD2A 5BR8M 2VQEM 4PDGA 3KS4A 3U6QA 3GLGB 1SXJA 4LJ4A 1KFVA 3UGJA 5C1BA 2FNAA 2EA0A 5C18A 5GKNA 2CHVA 3ZH9B 1L1ZA 3AOGA 3J81S 2R4EA 4W5WA 1X37A 4LG2A 2Q2EB 5KO3A 1R2YA 4M0WA 4AKGA 2RGHA 3KXEC 3RGPA 1IQPA 1LV7A 4IBJA 2P5TA 3OTOM 2ERCA 4LJ5A 4DR4M 1YUBA 3SYKA 1EE8A 5H37D 4JXJA 4WURA 4JI2M 4IBKA 3GRRA 3TWKA 2L7HA 4RF0A 1GKIA 2XEPA 3PNYA 4P16A 3SAUA 4M9XA 4GITA 2UU9M 2OPFA 1R2ZA 1J09A 3GPPA 4AG6A 4JI6M 1OFHA 3VLFB 3FYDA 4LZZA 4IBIA 3FTEA 3HU2A 1QQWA 2YFQA 3PFIA 3FTDA 2O5RA 4DV1M 3LQRA 5LMUM 2DWNA 3BOSA 1N36M 4MM3B 4MGKE 4QOSA 4FCVA 5EXSA 4LF6M 2KRKA 7CATA 4DV0M 5FTJA 2V1UA 4AKHA 1HNWM 3KFUG 3KVWA 2K47A 4LRSA 4CHTB 1QYRA 2XH9A 4OVZB 2KW0A 4B7GA 4G4QA 3IG8A 3GLFA 3IG5A 3E9SA 3RFWA 3NBIA 3L27A 4MH0E 2XZFA 1IN5A 5KPZA 4GH9A 3ILKA 4I4LA 1IY1A 2QZ4A 4L78A 3GLIA 3KS8A 1WXQA 2X49A 4WW0A 1QANA 4IIWA 4AZFA 1VDDA 4FWDA 4B3MM 1QAMA 3JAMS 3H4MA 4B3SM 2ZAOA 1G4AE 3K8ZA 1KYIA 3KOYE 4B3TM 2G8LA 1ZAEA 4IBDA 5KPRA 4GKKM 3KSJA 1N75A 1ZQ9A 4PDIA 4AQYM 3VFDA 4IBFA 1IN7A 1N34M 1G41A 4DR5M 3I4YA 3FTCA 2CUZA 2ZAMA 3K92A 4LFCM 5KQDA 4JV5M 2UXDM 3M0EA 4LFAM 2OQ4A 5EXTA 2I7NA 2DWLA 4QHTA 3U6LA 3UMMA 4GHLA 3RE8A 4G6ZA 4IBEA 4JI1M 2L7IA 1IM2A 3VK7A 1HNZM 3D8LA 3HHZA 3L29A 3T1YM 2XGNA 3SAVA 1TGUA 2KEBA 4QHSA 2C5RA 2F5NA 2XSZA 3FUTA 2KA6B 8CATA 4LF5M 3RGSA 4LGMA 3MK6A 1Z59A 3U5ZB 4B08A 1N78A 4NRWA 3JR5A 1NSFA 5BPVA 1FNNA 3L26A 4AKIA 4M9SA 4LJ9A 4X62M 2Z7JA 1XC8A 3AOEA 4II7A 2LXEA 2CV1A 3J27B 5F3WA 1NNUC 3LVVA 2Y0TA 4DR1M 4GRIA 1DGHB 4LJ6A 3THGA 1H6UA 1NJFA 1XHBA 2HCBA 1JR3D 1DO0A 3HHYA 3J80S 3U61A 1YE9A 1N33M 5ITQA 3NWLA 2UXBM 4YHHM 2QBYB 4DV5M 3GRUA 3TQSA 1DGBA 3GLHB 4KODA 4L16A 1NHGC 3GPUA 4A3VB 1QAQA 2XF3A 3KOXE 3FUWA 2LNHC 1D2NA 2C99A 1L2CA 2R65A 5KQ8A 2UUAM 1Q3BA 4MGZE 4FW9A 4NL4H 2L6OA 2ZM6M 5ITXE 3FYCA 1DO2A 2FE8A 2KZUA 5IZ7D 1R7RA 3AJIB 4BBAA 2D7GA 3AKZA 1K3XA 1HT1E 5LMNM 1TH4A 1IBMM 1JQJC 4GC9A 2R45A 3GLGA 3FUUA 1SXJD 3HU1A 3HU3A 1MU5A 1XWIA 2FFJA 1E9SA 5ITXA 3UZUA 4EIWA 2XFTA 2Z4SA 4B3RM 3TWMA 3U6CA 2QPAA 4K0KM 3FUVA 4DUZM 5FTNA 4JI8M 4G4RA 3VKHA 3HWSA 1NJGA 1HNXM 1NVMA 1Z5BA 2BNKA 1G59A 2LH0A 2R62A 1GL7A 1MX0A 1NY5A 4NSOB 3HGIA 2CEAA 3A98B 4DV4M 2HL7A 1L2BA 4TUWA 3U60B 4QOZC 4LFBM 2W82A 2FOIC 1GVNA 3MHVC 4LJAA 1XXHB 5EP1A 3SFZA 2Y21A 3R8FA 1Q3CA 5IREB 3L28A 3SMSA 4JI7M 3LVWA 4G4OA 1PJJA 3T15A 3KW6A 1IY0A 3HKPA 2KRUA 1E9RA 2C96A 4KLNA 2C98A 3J2PB 3W0FA 1QZMA 2YNMD 2F5QA 5ITTA 1K82A 2DWZB 2CV0A 4OX9M 3Q8XA 4RNAA 2HHHM 2RGOA 2EUCA 4FWHA 2V6ZM 4LY6A 4KO8A 3HJSA 3LQQA 5EP4A 5IT9S 2R46A 4KHPM 5FTLA 2YQZA 1G8PA 3U6MA 1IBKM 3B9PA 1XMOM 3I4VA 5FSWA 4B7HA 3AV0A 4REZA 2R4JA 5ITUA 2Y20A 3VKGA 4R3DA 1OJLA 3KOWE 3GRVA 2L09A 4OVZA 4D81A 4FWGA 3L25A 2ZANA 4FD2A 2CE7A 3CF0A 2C9OA 1GL6A 2QENA 4DV6M 4HL4A 2KZSA 1KSFX 3QWLA 4GC5A 3FKEA 1E32A 4R7GA 3FD9A 3HJ8A 2F5SA 4YY3M 5KPTA 3TPZA 4MGHA 3KDSE 1TDZA 3KOZE 1SXJB 4LZJA 3HJQA 3AFHA 3TWLA 3W0LB 4DV3M 3U6OA 3UJNA 4LF9M 3CTWB 2DXIA 1IBLM 1T3TA 3AOEC 3L2AA 3U61B 5E6JA 3A46A 2DWMA 1SXJC 1PM5A 4CGYB 2XZUA 1Q39A 1ORYB 4DR7M 4NRVA 2YR0A 3C58A 4OW0A 4LF8M 3KP0E 4I81A 1HQCA 3AL0C 2UUBM 4CISA 4GHAA 3GQ5A 3GQ4A 3U6EA 1E94E 4DV7M 4LJ7A 1L8QA 1N77A 3U6DA 4PT5A 3J7BA 4DV2M 1J7KA 2EO2A 2HKJA 3J7AS 2C9CA 4L8RC 3MJ5A 1GLNA 2XSZD 2G5GX 4FCWA 2Z3XA 3DA1A 3HHXA 2J7NA 2QP9X 1UM8A 3A42A 4IJEA 3DOAA 4LF4M 4M0DA 4QNMA 3SAWA 3U5ZA 1TH2A 5EP3A 3GRYA 1IXRC 5DNYA 2UXCM 1L1TA 4X65M 1L2DA 4XGIA 4LF7M 4Z8XA 4AW4A 1NHWC 2XFSA 4I8OA 3E4RA 3SYLA 4FVMA 4S12A 1FJGM 3T1HM 2RKOA 4FCTA 2NQ8C 3QAUA 2VQFM 4RF1A 3K2LA 1W5SA 4Z6YA 4JI5M 1IN8A 1S3SA 4X66M 5IWAM 3CF6E 1HQYE 5FTMA 4NXMM 1J5EM 4NOOB 3K1JA 1DGHA 3EIHA 1IN4A 3KP1E 3PNVA 3TL4X 2E5LM 1Z5AA 3UK6A 3SHFA 2UUCM 3GLFB 2H1RA 3T38A 4DR3M 2QBYA 3GLHA 3A45A 4QNRA 2DHRA 5ITRA 1XNQM 4MGIE 2AHMA 2DZOB 3SHGB 1DGFA 3U6SA 2CV2A 3GLIB 2QCUA 2F4VM 3KSXA 3FTFA 4L4UA 2D7HA 3SC3A 3GPXA 4MGYE 2R18A 3GP1A 5DYGA 4LRTA 4PCZA 4NXNM 3DZDA 4NSRA 3EIEA 1DGGA 5EXPA 3PXGA 3WHLA 1Z5CA 2KXEA 4IBCA 1QAOA 3GPYA 3WHKA 4OU7A 4B7FA 2ZBKB 3SBJA 4GIPA 4MB7A 5JI3E 2CHGA 3SMPA 5ITYA 4LCBA 3FUXA 4IJFA 1OFIA 3VK8A 1I4WA 3GQ3A 4IBGA 4JI0M 2A5YB 2J7OA 4LJ8A 4M9ZA 3U60A 1TH3A 2V1CA 4HLQA 3SASA 5FTKA 1TDHA 1XXHA 3PVSA 2M60A 5JI2E 1Z6TA 5EQTA 4JYAM 1C1KA 1PJIA 1IN6A 4DUYM 1YSYA 4JN6A 3D8BA 5A2QS 1K3WA 2X4AA 1HR0M 1I94M 2BJVA 4GKJM 4ITQA 4IBBA 5DYIA 2F5OA 2JA2A 3M6AA 4XBOA 2F5PA 4D80A 4JI4M 5E26A 1XMQM 2Y0QA 1NNJA 2DVWB 3HHWA 1W5TA 4BLCA 2XLJA 5EJCA 3SARA 3ZC7B 3ZCBB 3TE6A 1HT2E 2X8AA 3VDUA 4G4NA 4GMQA 4JI3M 1JR3A 1QVRA 3JR4A 4DR6M 3CF2A 4I5SA 1IY2A 3I51A 1IXZA 4L15A 4ZPXA 2M5ZA 4AG5A 3LMMA 1IXSB 1N32M 1G3IA 5EXXA 4LGYA 3R9XB 2CHQA 2LWXA 4BB9A 1XNRM 3DFZA 1SXJE 3GO8A 2I7PA 2D7EA 3M7GA 2Z4RA 3SATA 4DR2M 1R6BX 4D82A 3U6PA 3VDPA 4AI6A 2BJWA 1NY6A 2VIIA 2CFOA 5FLXS 5EP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 M;  2UUC M;  5BR8 M;  4PD2 A;  2VQE M;  4LFA M;  2OQ4 A;  4DR3 M;  4OX9 M;  2UXD M;  4PDG A;  3U6L A;  3U6Q A;  2HHH M;  3A45 A;  1KFV A;  4JI1 M;  5ITR A;  3VK7 A;  1HNZ M;  1XNQ M;  2EA0 A;  5IT9 S;  3U6S A;  1L1Z A;  4KHP M;  3T1Y M;  3SAV A;  3J81 S;  2F4V M;  2F5N A;  3U6M A;  1IBK M;  3GPX A;  2Q2E B;  1R2Y A;  4LF5 M;  3GP1 A;  4PCZ A;  4NXN M;  1XMO M;  1Z59 A;  3OTO M;  4NRW A;  5ITU A;  3JR5 A;  4DR4 M;  1Z5C A;  3GPY A;  1EE8 A;  2ZBK B;  3SBJ A;  1K82 A;  4JI2 M;  4MB7 A;  4X62 M;  1XC8 A;  3TWK A;  4DV6 M;  3SAU A;  5ITY A;  2UU9 M;  2OPF A;  1R2Z A;  3GPP A;  4DR1 M;  3VK8 A;  2F5S A;  4YY3 M;  4JI6 M;  3GQ3 A;  3J80 S;  1N33 M;  5ITQ A;  4JI0 M;  2UXB M;  4YHH M;  1TDZ A;  4DV5 M;  3TWL A;  3GPU A;  4DV3 M;  4DV1 M;  5LMU M;  3U6O A;  3SAS A;  1N36 M;  1TDH A;  4LF9 M;  1IBL M;  1L2C A;  1PJI A;  4JYA M;  4LF6 M;  4DV0 M;  4DUY M;  2UUA M;  3A46 A;  1Q3B A;  5A2Q S;  1K3W A;  1PM5 A;  2ZM6 M;  5ITX E;  1HNW M;  1HR0 M;  2XZU A;  1Q39 A;  4DR7 M;  1K3X A;  1I94 M;  4NRV A;  3C58 A;  4GKJ M;  4ITQ A;  4LF8 M;  2F5O A;  5LMN M;  2F5P A;  2UUB M;  4CIS A;  4G4Q A;  1IBM M;  4JI4 M;  1XMQ M;  3GQ5 A;  3GQ4 A;  3U6E A;  1NNJ A;  2XZF A;  1MU5 A;  5ITX A;  4B3R M;  4DV7 M;  3U6D A;  3TWM A;  4DV2 M;  3U6C A;  3SAR A;  2HKJ A;  3J7A S;  4K0K M;  4DUZ M;  4JI8 M;  4G4R A;  1HNX M;  4G4N A;  3A42 A;  5ITT A;  4JI3 M;  1Z5B A;  1MX0 A;  3DOA A;  3JR4 A;  4DR6 M;  4LF4 M;  4B3M M;  4DV4 M;  3SAW A;  3JAM S;  1L2B A;  4B3S M;  1N32 M;  2UXC M;  1L1T A;  4LFB M;  4X65 M;  1L2D A;  4LF7 M;  1FJG M;  1Q3C A;  4B3T M;  3T1H M;  4JI7 M;  4GKK M;  1XNR M;  4PDI A;  4G4O A;  3GO8 A;  2VQF M;  4AQY M;  4JI5 M;  1PJJ A;  3SAT A;  1N34 M;  4X66 M;  4DR5 M;  5IWA M;  4DR2 M;  3W0F A;  4NXM M;  3U6P A;  1J5E M;  4LFC M;  4JV5 M;  2E5L M;  2F5Q A;  1Z5A A;  5FLX S; 
#chains in the Genus database with same CATH topology
 4X64 M;  2DZN B;  2JY5 A;  4PD2 A;  5BR8 M;  2VQE M;  1IFY A;  4PDG A;  3KS4 A;  3U6Q A;  1VQ1 A;  1WIV A;  2CRU A;  2VF7 A;  1SXJ A;  4LJ4 A;  3GLG B;  1KFV A;  3UGJ A;  5C1B A;  2FNA A;  1AIP C;  1DV0 A;  2EA0 A;  5C18 A;  1OAO C;  5GKN A;  2CHV A;  3ZH9 B;  1L1Z A;  3V76 A;  3AOG A;  3J81 S;  2R4E A;  4W5W A;  1X37 A;  4LG2 A;  2LTU A;  2Q2E B;  5KO3 A;  1R2Y A;  4M0W A;  4AKG A;  2RGH A;  3KXE C;  3RGP A;  1IQP A;  1LV7 A;  4IBJ A;  2P5T A;  1UFZ A;  3OTO M;  2ERC A;  1G71 A;  4LJ5 A;  4DR4 M;  1YUB A;  3SYK A;  1MN3 A;  1EE8 A;  5H37 D;  4JXJ A;  1LTM A;  4WUR A;  4WP2 A;  4JI2 M;  4IBK A;  3GRR A;  3TWK A;  2L7H A;  4RF0 A;  1GKI A;  2XEP A;  3PNY A;  4P16 A;  3SAU A;  1C7Y A;  4M9X A;  4GIT A;  2UU9 M;  2OPF A;  1R2Z A;  1J09 A;  3GPP A;  1T6O A;  4AG6 A;  4JI6 M;  1OFH A;  3VLF B;  2R44 A;  2OOA A;  3FYD A;  4LZZ A;  3LW5 F;  4IBI A;  4F1I A;  3HU2 A;  3FTE A;  1QQW A;  2YFQ A;  1QDR A;  3LCV B;  2MRO B;  3PFI A;  3FTD A;  2O5R A;  2QQ8 A;  3LQR A;  2JXN A;  5LMU M;  4DV1 M;  2DWN A;  3BOS A;  1N36 M;  1WGL A;  1Q02 A;  4MM3 B;  4MGK E;  4QOS A;  4FCV A;  5EXS A;  3GLF E;  4LF6 M;  2KRK A;  7CAT A;  4DV0 M;  4UN2 B;  1P3Q Q;  5FTJ A;  1VEJ A;  2V1U A;  4AKH A;  1HNW M;  3KFU G;  2DEN A;  3KVW A;  2K47 A;  3B7Z A;  2L4F A;  4LRS A;  4CHT B;  3GLI E;  1QYR A;  2XH9 A;  4OVZ B;  2KW0 A;  4B7G A;  2BWB A;  3IHP A;  4G4Q A;  3IG8 A;  3GLF A;  3IG5 A;  3E9S A;  3RFW A;  3NBI A;  3L27 A;  1D0M A;  4MH0 E;  2XZF A;  1IN5 A;  2QHO B;  5KPZ A;  2DAE A;  2WZJ A;  4GH9 A;  2K9D A;  3ILK A;  4I4L A;  1IY1 A;  4F2L A;  2QZ4 A;  4L78 A;  3GLI A;  1GJS A;  3KS8 A;  4RKU F;  1WXQ A;  2X49 A;  4WW0 A;  1QAN A;  4IIW A;  4AZF A;  1VDD A;  4FWD A;  4B3M M;  1QAM A;  2CWB A;  3JAM S;  3H4M A;  4B3S M;  1QDT A;  2EKK A;  2ZAO A;  1JB0 F;  2J5Y A;  1G4A E;  1XB2 B;  3QYE A;  3K8Z A;  1KYI A;  2O01 F;  1OIP A;  3KOY E;  4B3T M;  2G8L A;  1ZAE A;  4IBD A;  5KPR A;  4GKK M;  3KSJ A;  1N75 A;  1ZQ9 A;  4PDI A;  4AQY M;  3VFD A;  4IBF A;  1IN7 A;  1N34 M;  1G41 A;  4DR5 M;  1WHC A;  3W67 A;  3FTC A;  2CUZ A;  3I4Y A;  2ZAM A;  3K92 A;  4LFC M;  5KQD A;  4JV5 M;  2UXD M;  3M0E A;  4LFA M;  2OQ4 A;  5EXT A;  1AUA A;  1BVS A;  2I7N A;  2DWL A;  4QHT A;  3U6L A;  3UMM A;  4GHL A;  3RE8 A;  4G6Z A;  4IBE A;  4JI1 M;  2L7I A;  1IM2 A;  3HZJ A;  3VK7 A;  1HNZ M;  1VG5 A;  1V34 A;  3D8L A;  3HHZ A;  3L29 A;  1D0L A;  4HEO A;  3T1Y M;  1A5T A;  2XGN A;  1TGU A;  3SAV A;  2KEB A;  4QHS A;  2C5R A;  2F5N A;  2XSZ A;  3FUT A;  2DKL A;  1R5L A;  2DHY A;  2KA6 B;  2O25 A;  3B89 A;  8CAT A;  4LF5 M;  3RGS A;  4LGM A;  2WSE F;  3MK6 A;  1Z59 A;  3U5Z B;  1OAI A;  4B08 A;  4CIZ A;  1N78 A;  4NRW A;  3JR5 A;  1NSF A;  2LVO C;  5BPV A;  3E46 A;  1FNN A;  2JY6 B;  3L26 A;  4AKI A;  4M9S A;  4LJ9 A;  4NC6 A;  4X62 M;  2Z7J A;  1XC8 A;  3AOE A;  4II7 A;  2LXE A;  1VEG A;  2CV1 A;  2MR9 A;  3J27 B;  5F3W A;  1NNU C;  3LVV A;  2Y0T A;  2K6B A;  2JZ0 A;  4DR1 M;  4GRI A;  1DGH B;  2DAM A;  4LJ6 A;  1H6U A;  1NJF A;  3THG A;  1XHB A;  2HCB A;  2OOB A;  3BBZ A;  1JR3 D;  1DO0 A;  1PJS A;  3HHY A;  3J80 S;  3U61 A;  1YE9 A;  1N33 M;  5ITQ A;  3NWL A;  2UXB M;  4YHH M;  2QBY B;  4DV5 M;  3GRU A;  3MMP A;  1DGB A;  1OIZ A;  3GLH B;  4KOD A;  1NHG C;  1IXS A;  3F92 A;  2Z8Y M;  4L16 A;  3GPU A;  3W68 A;  4A3V B;  2EJS A;  3FRI A;  1QAQ A;  2XF3 A;  3KOX E;  3FUW A;  4KT0 F;  1Y8G A;  2LNH C;  1D2N A;  1NO1 A;  2C99 A;  1L2C A;  1WGN A;  3TQS A;  2R65 A;  1SG9 A;  5KQ8 A;  2DAK A;  2UUA M;  1Q3B A;  2WSC F;  4MGZ E;  3GLG E;  4FW9 A;  4NL4 H;  2L6O A;  2ZM6 M;  5ITX E;  3FYC A;  1DO2 A;  2FE8 A;  2KZU A;  5IZ7 D;  1R7R A;  4GEW A;  3AJI B;  4BBA A;  2D7G A;  1YLA A;  4ANR A;  3AKZ A;  1K3X A;  1HT1 E;  1F4I A;  5LMN M;  1MJG M;  2ZTD A;  2CP8 A;  1TH4 A;  2Z3X A;  1IBM M;  1JQJ C;  1PJQ A;  1ZMU A;  2MJ5 B;  4GC9 A;  2R45 A;  3GLG A;  3FUU A;  1SXJ D;  3C3E A;  1MU5 A;  1XWI A;  3HU1 A;  2FFJ A;  1E9S A;  3HU3 A;  5ITX A;  3UZU A;  1WR1 B;  2XFT A;  2Z4S A;  4B3R M;  3TWM A;  3U6C A;  2QPA A;  4K0K M;  1ZMW A;  3FUV A;  4DUZ M;  5FTN A;  4JI8 M;  4G4R A;  1OKS A;  3VKH A;  1NJG A;  3HWS A;  1EFU B;  1HNX M;  1NVM A;  1Z5B A;  2BNK A;  1G59 A;  2LH0 A;  2R62 A;  1GL7 A;  1CUK A;  1MX0 A;  1NY5 A;  4NSO B;  3HGI A;  2CEA A;  3A98 B;  3E21 A;  4DV4 M;  3K9O A;  2DAG A;  2HL7 A;  1L2B A;  4TUW A;  3U60 B;  4QOZ C;  4LFB M;  2W82 A;  2FOI C;  4Y28 F;  1GVN A;  3MHV C;  4LJA A;  1XXH B;  5EP1 A;  1NV8 A;  2FS1 A;  2KNZ A;  3LCU A;  3SFZ A;  2VDB B;  1EIJ A;  2Y21 A;  3R8F A;  1Q3C A;  5IRE B;  3L28 A;  3SMS A;  4JI7 M;  1T43 A;  2KNA A;  3QYB A;  3LVW A;  4G4O A;  2N35 A;  1PJJ A;  1D0K A;  3T15 A;  3KW6 A;  1IY0 A;  3HKP A;  2KRU A;  1E9R A;  2C96 A;  4KLN A;  2C98 A;  3J2P B;  3W0F A;  1QZM A;  2YNM D;  2F5Q A;  5ITT A;  1K82 A;  2B3T A;  2DWZ B;  2CV0 A;  2LVQ D;  4OX9 M;  3Q8X A;  4RNA A;  2HHH M;  2GNO A;  2RGO A;  2EUC A;  4XK8 F;  4FWH A;  2V6Z M;  4LY6 A;  4KO8 A;  3HJS A;  3LQQ A;  5EP4 A;  5IT9 S;  3Q8G A;  2R46 A;  4KHP M;  5FTL A;  2YQZ A;  3B7N A;  2KDL A;  1G8P A;  3U6M A;  2K0B X;  1IBK M;  4Q7J A;  3B9P A;  2KNV A;  1XMO M;  3I4V A;  5FSW A;  2LVN C;  3H4J A;  2G3Q A;  3I04 M;  4B7H A;  3AV0 A;  4REZ A;  2R4J A;  5ITU A;  2Y20 A;  5DFL A;  3VKG A;  4R3D A;  1OJL A;  3KOW E;  3GRV A;  3C9P A;  2L09 A;  4OVZ A;  4D81 A;  4FWG A;  3L25 A;  2L2D A;  2ZAN A;  4FD2 A;  2CE7 A;  2JY7 A;  3CF0 A;  2C9O A;  4G3O A;  3HY5 A;  1GL6 A;  2QEN A;  3I01 M;  4DV6 M;  4HL4 A;  2KZS A;  1KSF X;  3QWL A;  4GC5 A;  3FKE A;  1E32 A;  4R7G A;  1HJP A;  1QUS A;  3FD9 A;  3HJ8 A;  3T6P A;  3BXW A;  2F5S A;  4YY3 M;  4DBG B;  5KPT A;  2OO9 A;  3TPZ A;  4MGH A;  3KDS E;  1TDZ A;  3KOZ E;  1SXJ B;  4LZJ A;  3HJQ A;  3AFH A;  3IEC A;  3TWL A;  3W0L B;  4DV3 M;  2KHH A;  3U6O A;  2MGW A;  2LVP C;  3UJN A;  4LF9 M;  3CTW B;  2DXI A;  1IBL M;  1T3T A;  3AOE C;  1PRB A;  3L2A A;  3U61 B;  5E6J A;  3HX3 A;  3A46 A;  2DWM A;  1SXJ C;  1PM5 A;  4CGY B;  2XZU A;  1Q39 A;  1ORY B;  4DR7 M;  4NRV A;  2YR0 A;  3C58 A;  4OW0 A;  4LF8 M;  3KP0 E;  4I81 A;  1GO5 A;  1HQC A;  3AL0 C;  2UUB M;  4CIS A;  4GHA A;  3C3D A;  3GQ5 A;  3GQ4 A;  3U6E A;  1E94 E;  4DV7 M;  4LJ7 A;  2MH8 A;  1L8Q A;  1N77 A;  3U6D A;  3NBX X;  3J7B A;  4PT5 A;  4DV2 M;  1J7K A;  2EO2 A;  2HKJ A;  3J7A S;  1GAB A;  2C9C A;  4L8R C;  3MJ5 A;  4CJ6 A;  2L4E A;  1GLN A;  2XSZ D;  2G5G X;  4FCW A;  2DZL A;  3DA1 A;  2J7N A;  2QP9 X;  3A42 A;  1UM8 A;  3HHX A;  4IJE A;  3DOA A;  4LF4 M;  3FE3 A;  4M0D A;  4QNM A;  2ZTC A;  3SAW A;  3U5Z A;  1TH2 A;  5EP3 A;  3GRY A;  1IXR C;  1TR8 A;  2WSF F;  5DNY A;  2UXC M;  1L1T A;  1PGY A;  2FH0 A;  4X65 M;  1L2D A;  1NV9 A;  4XGI A;  5L8R F;  4LF7 M;  4Z8X A;  4AW4 A;  2JZ1 A;  1NHW C;  1TTE A;  2XFS A;  4I8O A;  3E4R A;  3SYL A;  2JUJ A;  4FVM A;  4S12 A;  1FJG M;  3T1H M;  2RKO A;  4FCT A;  1WJ7 A;  2LVA A;  2NQ8 C;  3GLH E;  3QAU A;  4RF1 A;  2VQF M;  1TF0 B;  3K2L A;  1W5S A;  3FRH A;  4Z6Y A;  1IN8 A;  1S3S A;  4X66 M;  4JI5 M;  5IWA M;  3CF6 E;  1HQY E;  1OQY A;  5FTM A;  1QZE A;  4NXM M;  1J5E M;  4NOO B;  1DGH A;  3EIH A;  3K1J A;  1IN4 A;  3KP1 E;  3PNV A;  1R4G A;  2HAK A;  3TL4 X;  1Z5A A;  3UK6 A;  2E5L M;  3SHF A;  2UUC M;  3GLF B;  2H1R A;  3T38 A;  4DR3 M;  2QBY A;  3GLH A;  3A45 A;  4QNR A;  2DHR A;  5ITR A;  1XNQ M;  1V33 A;  4MGI E;  2AHM A;  2DZO B;  3CGW A;  1DGF A;  3SHG B;  3U6S A;  2CV2 A;  1VEK A;  3GLI B;  2QCU A;  2F4V M;  3KSX A;  3FTF A;  4L4U A;  2D7H A;  3SC3 A;  2APL A;  1PJT A;  3GPX A;  4MGY E;  1QUT A;  2R18 A;  3B7Q A;  5DYG A;  3GP1 A;  4LRT A;  4PCZ A;  4NXN M;  3DZD A;  4NSR A;  3EIE A;  1DGG A;  5EXP A;  3PXG A;  3WHL A;  1Z5C A;  2EKF A;  2KXE A;  2LHG A;  4IBC A;  1QAO A;  3GPY A;  3WHK A;  4OU7 A;  4B7F A;  2DNA A;  2ZBK B;  3SBJ A;  4GIP A;  4MB7 A;  5JI3 E;  2CHG A;  3SMP A;  5ITY A;  2DI0 A;  2QSF X;  4LCB A;  3FUX A;  4IJF A;  1XXH E;  1OFI A;  3VK8 A;  2R0I A;  1I4W A;  3GQ3 A;  4IBG A;  3B74 A;  2JP7 A;  4JI0 M;  2A5Y B;  2J7O A;  4LJ8 A;  4M9Z A;  2R6F A;  3U60 A;  1TH3 A;  2V1C A;  4HLQ A;  3SAS A;  5FTK A;  1TDH A;  1XXH A;  3PVS A;  2M60 A;  5JI2 E;  2VF8 A;  1Z6T A;  1ZMV A;  5EQT A;  3K9P A;  4JYA M;  1C1K A;  1PJI A;  2QNJ A;  4P17 A;  1IN6 A;  4DUY M;  1YSY A;  4JN6 A;  3D8B A;  5A2Q S;  1K3W A;  2X4A A;  2H5X A;  1HR0 M;  2LBC A;  1I94 M;  2LHC A;  2BJV A;  4GKJ M;  4ITQ A;  4IBB A;  5DYI A;  2F5O A;  2JA2 A;  3M6A A;  4XBO A;  2F5P A;  4D80 A;  4EIW A;  4JI4 M;  1JR3 E;  2RRU A;  5E26 A;  1XMQ M;  2Y0Q A;  2JWS A;  1NNJ A;  2DVW B;  3HHW A;  1W5T A;  1ZV1 A;  1OTR A;  4BLC A;  2XLJ A;  5EJC A;  3SAR A;  3ZC7 B;  3ZCB B;  3TE6 A;  1HT2 E;  1GJT A;  1V92 A;  2X8A A;  3VDU A;  4G4N A;  2DAI A;  4GMQ A;  4JI3 M;  1JR3 A;  1QVR A;  4L6V 6;  3JR4 A;  4DR6 M;  3CF2 A;  4I5S A;  1IY2 A;  3I51 A;  1IXZ A;  4L15 A;  4ZPX A;  2M5Z A;  4AG5 A;  3LMM A;  1IXS B;  1N32 M;  4R71 A;  3ZQJ A;  1G3I A;  5EXX A;  2JNH A;  4LGY A;  3R9X B;  2BWE A;  1RU3 A;  1VDL A;  2CHQ A;  2GQF A;  2LWX A;  4BB9 A;  2JY8 A;  1XNR M;  3DFZ A;  1SXJ E;  3GO8 A;  2I7P A;  2HWJ A;  2D7E A;  3M7G A;  2Z4R A;  3SAT A;  4DR2 M;  1R6B X;  4D82 A;  3U6P A;  3VDP A;  4AI6 A;  2BJW A;  1NY6 A;  2VII A;  2CFO A;  5FLX S;  5EP2 A; 
#chains in the Genus database with same CATH homology
 4X64 M;  2DZN B;  4PD2 A;  5BR8 M;  2VQE M;  4PDG A;  3KS4 A;  3U6Q A;  3GLG B;  1SXJ A;  4LJ4 A;  1KFV A;  3UGJ A;  5C1B A;  2FNA A;  2EA0 A;  5C18 A;  5GKN A;  2CHV A;  3ZH9 B;  1L1Z A;  3AOG A;  3J81 S;  2R4E A;  4W5W A;  1X37 A;  4LG2 A;  2Q2E B;  5KO3 A;  1R2Y A;  4M0W A;  4AKG A;  2RGH A;  3KXE C;  3RGP A;  1IQP A;  1LV7 A;  4IBJ A;  2P5T A;  3OTO M;  2ERC A;  4LJ5 A;  4DR4 M;  1YUB A;  3SYK A;  1EE8 A;  5H37 D;  4JXJ A;  4WUR A;  4JI2 M;  4IBK A;  3GRR A;  3TWK A;  2L7H A;  4RF0 A;  1GKI A;  2XEP A;  3PNY A;  4P16 A;  3SAU A;  4M9X A;  4GIT A;  2UU9 M;  2OPF A;  1R2Z A;  1J09 A;  3GPP A;  4AG6 A;  4JI6 M;  1OFH A;  3VLF B;  3FYD A;  4LZZ A;  4IBI A;  3FTE A;  3HU2 A;  1QQW A;  2YFQ A;  3PFI A;  3FTD A;  2O5R A;  4DV1 M;  3LQR A;  5LMU M;  2DWN A;  3BOS A;  1N36 M;  4MM3 B;  4MGK E;  4QOS A;  4FCV A;  5EXS A;  4LF6 M;  2KRK A;  7CAT A;  4DV0 M;  5FTJ A;  2V1U A;  4AKH A;  1HNW M;  3KFU G;  3KVW A;  2K47 A;  4LRS A;  4CHT B;  1QYR A;  2XH9 A;  4OVZ B;  2KW0 A;  4B7G A;  4G4Q A;  3IG8 A;  3GLF A;  3IG5 A;  3E9S A;  3RFW A;  3NBI A;  3L27 A;  4MH0 E;  2XZF A;  1IN5 A;  5KPZ A;  4GH9 A;  3ILK A;  4I4L A;  1IY1 A;  2QZ4 A;  4L78 A;  3GLI A;  3KS8 A;  1WXQ A;  2X49 A;  4WW0 A;  1QAN A;  4IIW A;  4AZF A;  1VDD A;  4FWD A;  4B3M M;  1QAM A;  3JAM S;  3H4M A;  4B3S M;  2ZAO A;  1G4A E;  3K8Z A;  1KYI A;  3KOY E;  4B3T M;  2G8L A;  1ZAE A;  4IBD A;  5KPR A;  4GKK M;  3KSJ A;  1N75 A;  1ZQ9 A;  4PDI A;  4AQY M;  3VFD A;  4IBF A;  1IN7 A;  1N34 M;  1G41 A;  4DR5 M;  3I4Y A;  3FTC A;  2CUZ A;  2ZAM A;  3K92 A;  4LFC M;  5KQD A;  4JV5 M;  2UXD M;  3M0E A;  4LFA M;  2OQ4 A;  5EXT A;  2I7N A;  2DWL A;  4QHT A;  3U6L A;  3UMM A;  4GHL A;  3RE8 A;  4G6Z A;  4IBE A;  4JI1 M;  2L7I A;  1IM2 A;  3VK7 A;  1HNZ M;  3D8L A;  3HHZ A;  3L29 A;  3T1Y M;  2XGN A;  3SAV A;  1TGU A;  2KEB A;  4QHS A;  2C5R A;  2F5N A;  2XSZ A;  3FUT A;  2KA6 B;  8CAT A;  4LF5 M;  3RGS A;  4LGM A;  3MK6 A;  1Z59 A;  3U5Z B;  4B08 A;  1N78 A;  4NRW A;  3JR5 A;  1NSF A;  5BPV A;  1FNN A;  3L26 A;  4AKI A;  4M9S A;  4LJ9 A;  4X62 M;  2Z7J A;  1XC8 A;  3AOE A;  4II7 A;  2LXE A;  2CV1 A;  3J27 B;  5F3W A;  1NNU C;  3LVV A;  2Y0T A;  4DR1 M;  4GRI A;  1DGH B;  4LJ6 A;  3THG A;  1H6U A;  1NJF A;  1XHB A;  2HCB A;  1JR3 D;  1DO0 A;  3HHY A;  3J80 S;  3U61 A;  1YE9 A;  1N33 M;  5ITQ A;  3NWL A;  2UXB M;  4YHH M;  2QBY B;  4DV5 M;  3GRU A;  3TQS A;  1DGB A;  3GLH B;  4KOD A;  4L16 A;  1NHG C;  3GPU A;  4A3V B;  1QAQ A;  2XF3 A;  3KOX E;  3FUW A;  2LNH C;  1D2N A;  2C99 A;  1L2C A;  2R65 A;  5KQ8 A;  2UUA M;  1Q3B A;  4MGZ E;  4FW9 A;  4NL4 H;  2L6O A;  2ZM6 M;  5ITX E;  3FYC A;  1DO2 A;  2FE8 A;  2KZU A;  5IZ7 D;  1R7R A;  3AJI B;  4BBA A;  2D7G A;  3AKZ A;  1K3X A;  1HT1 E;  5LMN M;  1TH4 A;  1IBM M;  1JQJ C;  4GC9 A;  2R45 A;  3GLG A;  3FUU A;  1SXJ D;  3HU1 A;  3HU3 A;  1MU5 A;  1XWI A;  2FFJ A;  1E9S A;  5ITX A;  3UZU A;  4EIW A;  2XFT A;  2Z4S A;  4B3R M;  3TWM A;  3U6C A;  2QPA A;  4K0K M;  3FUV A;  4DUZ M;  5FTN A;  4JI8 M;  4G4R A;  3VKH A;  3HWS A;  1NJG A;  1HNX M;  1NVM A;  1Z5B A;  2BNK A;  1G59 A;  2LH0 A;  2R62 A;  1GL7 A;  1MX0 A;  1NY5 A;  4NSO B;  3HGI A;  2CEA A;  3A98 B;  4DV4 M;  2HL7 A;  1L2B A;  4TUW A;  3U60 B;  4QOZ C;  4LFB M;  2W82 A;  2FOI C;  1GVN A;  3MHV C;  4LJA A;  1XXH B;  5EP1 A;  3SFZ A;  2Y21 A;  3R8F A;  1Q3C A;  5IRE B;  3L28 A;  3SMS A;  4JI7 M;  3LVW A;  4G4O A;  1PJJ A;  3T15 A;  3KW6 A;  1IY0 A;  3HKP A;  2KRU A;  1E9R A;  2C96 A;  4KLN A;  2C98 A;  3J2P B;  3W0F A;  1QZM A;  2YNM D;  2F5Q A;  5ITT A;  1K82 A;  2DWZ B;  2CV0 A;  4OX9 M;  3Q8X A;  4RNA A;  2HHH M;  2RGO A;  2EUC A;  4FWH A;  2V6Z M;  4LY6 A;  4KO8 A;  3HJS A;  3LQQ A;  5EP4 A;  5IT9 S;  2R46 A;  4KHP M;  5FTL A;  2YQZ A;  1G8P A;  3U6M A;  1IBK M;  3B9P A;  1XMO M;  3I4V A;  5FSW A;  4B7H A;  3AV0 A;  4REZ A;  2R4J A;  5ITU A;  2Y20 A;  3VKG A;  4R3D A;  1OJL A;  3KOW E;  3GRV A;  2L09 A;  4OVZ A;  4D81 A;  4FWG A;  3L25 A;  2ZAN A;  4FD2 A;  2CE7 A;  3CF0 A;  2C9O A;  1GL6 A;  2QEN A;  4DV6 M;  4HL4 A;  2KZS A;  1KSF X;  3QWL A;  4GC5 A;  3FKE A;  1E32 A;  4R7G A;  3FD9 A;  3HJ8 A;  2F5S A;  4YY3 M;  5KPT A;  3TPZ A;  4MGH A;  3KDS E;  1TDZ A;  3KOZ E;  1SXJ B;  4LZJ A;  3HJQ A;  3AFH A;  3TWL A;  3W0L B;  4DV3 M;  3U6O A;  3UJN A;  4LF9 M;  3CTW B;  2DXI A;  1IBL M;  1T3T A;  3AOE C;  3L2A A;  3U61 B;  5E6J A;  3A46 A;  2DWM A;  1SXJ C;  1PM5 A;  4CGY B;  2XZU A;  1Q39 A;  1ORY B;  4DR7 M;  4NRV A;  2YR0 A;  3C58 A;  4OW0 A;  4LF8 M;  3KP0 E;  4I81 A;  1HQC A;  3AL0 C;  2UUB M;  4CIS A;  4GHA A;  3GQ5 A;  3GQ4 A;  3U6E A;  1E94 E;  4DV7 M;  4LJ7 A;  1L8Q A;  1N77 A;  3U6D A;  4PT5 A;  3J7B A;  4DV2 M;  1J7K A;  2EO2 A;  2HKJ A;  3J7A S;  2C9C A;  4L8R C;  3MJ5 A;  1GLN A;  2XSZ D;  2G5G X;  4FCW A;  2Z3X A;  3DA1 A;  3HHX A;  2J7N A;  2QP9 X;  1UM8 A;  3A42 A;  4IJE A;  3DOA A;  4LF4 M;  4M0D A;  4QNM A;  3SAW A;  3U5Z A;  1TH2 A;  5EP3 A;  3GRY A;  1IXR C;  5DNY A;  2UXC M;  1L1T A;  4X65 M;  1L2D A;  4XGI A;  4LF7 M;  4Z8X A;  4AW4 A;  1NHW C;  2XFS A;  4I8O A;  3E4R A;  3SYL A;  4FVM A;  4S12 A;  1FJG M;  3T1H M;  2RKO A;  4FCT A;  2NQ8 C;  3QAU A;  2VQF M;  4RF1 A;  3K2L A;  1W5S A;  4Z6Y A;  4JI5 M;  1IN8 A;  1S3S A;  4X66 M;  5IWA M;  3CF6 E;  1HQY E;  5FTM A;  4NXM M;  1J5E M;  4NOO B;  3K1J A;  1DGH A;  3EIH A;  1IN4 A;  3KP1 E;  3PNV A;  3TL4 X;  2E5L M;  1Z5A A;  3UK6 A;  3SHF A;  2UUC M;  3GLF B;  2H1R A;  3T38 A;  4DR3 M;  2QBY A;  3GLH A;  3A45 A;  4QNR A;  2DHR A;  5ITR A;  1XNQ M;  4MGI E;  2AHM A;  2DZO B;  3SHG B;  1DGF A;  3U6S A;  2CV2 A;  3GLI B;  2QCU A;  2F4V M;  3KSX A;  3FTF A;  4L4U A;  2D7H A;  3SC3 A;  3GPX A;  4MGY E;  2R18 A;  3GP1 A;  5DYG A;  4LRT A;  4PCZ A;  4NXN M;  3DZD A;  4NSR A;  3EIE A;  1DGG A;  5EXP A;  3PXG A;  3WHL A;  1Z5C A;  2KXE A;  4IBC A;  1QAO A;  3GPY A;  3WHK A;  4OU7 A;  4B7F A;  2ZBK B;  3SBJ A;  4GIP A;  4MB7 A;  5JI3 E;  2CHG A;  3SMP A;  5ITY A;  4LCB A;  3FUX A;  4IJF A;  1OFI A;  3VK8 A;  1I4W A;  3GQ3 A;  4IBG A;  4JI0 M;  2A5Y B;  2J7O A;  4LJ8 A;  4M9Z A;  3U60 A;  1TH3 A;  2V1C A;  4HLQ A;  3SAS A;  5FTK A;  1TDH A;  1XXH A;  3PVS A;  2M60 A;  5JI2 E;  1Z6T A;  5EQT A;  4JYA M;  1C1K A;  1PJI A;  1IN6 A;  4DUY M;  1YSY A;  4JN6 A;  3D8B A;  5A2Q S;  1K3W A;  2X4A A;  1HR0 M;  1I94 M;  2BJV A;  4GKJ M;  4ITQ A;  4IBB A;  5DYI A;  2F5O A;  2JA2 A;  3M6A A;  4XBO A;  2F5P A;  4D80 A;  4JI4 M;  5E26 A;  1XMQ M;  2Y0Q A;  1NNJ A;  2DVW B;  3HHW A;  1W5T A;  4BLC A;  2XLJ A;  5EJC A;  3SAR A;  3ZC7 B;  3ZCB B;  3TE6 A;  1HT2 E;  2X8A A;  3VDU A;  4G4N A;  4GMQ A;  4JI3 M;  1JR3 A;  1QVR A;  3JR4 A;  4DR6 M;  3CF2 A;  4I5S A;  1IY2 A;  3I51 A;  1IXZ A;  4L15 A;  4ZPX A;  2M5Z A;  4AG5 A;  3LMM A;  1IXS B;  1N32 M;  1G3I A;  5EXX A;  4LGY A;  3R9X B;  2CHQ A;  2LWX A;  4BB9 A;  1XNR M;  3DFZ A;  1SXJ E;  3GO8 A;  2I7P A;  2D7E A;  3M7G A;  2Z4R A;  3SAT A;  4DR2 M;  1R6B X;  4D82 A;  3U6P A;  3VDP A;  4AI6 A;  2BJW A;  1NY6 A;  2VII A;  2CFO A;  5FLX S;  5EP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...