4JI0M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji0M02
3JR4A 4JI0M 3U6MA 3U6SA 1L2DA 1TDZA 4G4NA 2UUAM 4X66M 4YHHM 1J5EM 3VK8A 4NRVA 1L1TA 3TWLA 4NXMM 2F5SA 2HKJA 1K3WA 5ITYA 4JV5M 3U6LA 4YY3M 5IT9S 1K82A 3GPUA 5ITQA 1Z5AA 2F4VM 1XMOM 4X62M 2VQFM 4X64M 3GP1A 4G4QA 4X65M 2ZBKB 3U6QA 4KHPM 4LFAM 4DR6M 3SAVA 1HNZM 3U6OA 1N33M 4DR5M 1Z5CA 1IBKM 4NXNM 4DV0M 3SBJA 3J7AS 4DV5M 1N34M 2E5LM 1Q3BA 2VQEM 4DR1M 3GQ5A 2OPFA 3GQ3A 3U6PA 3GO8A 4PCZA 4G4OA 4DUYM 4JI3M 1IBMM 4LF6M 3A46A 4JI6M 2HHHM 3DOAA 4LF8M 2XZFA 5ITUA 1XNRM 3SASA 4DV6M 4DV4M 3SAWA 2F5QA 1XC8A 2UXCM 1MX0A 4DV3M 3T1HM 2UXDM 1PJJA 1HR0M 2UUBM 4B3RM 4B3TM 3U6CA 4DUZM 4OX9M 4GKKM 1L2CA 2UU9M 4DR4M 4DV1M 4AQYM 5A2QS 4JI8M 3TWMA 3TWKA 2XZUA 3SARA 4LFBM 1K3XA 1Q3CA 1R2ZA 4B3SM 4DR3M 1XNQM 1IBLM 1Q39A 2Q2EB 5LMNM 4G4RA 2ZM6M 4LF9M 5FLXS 5ITXA 4LF7M 4JYAM 3C58A 3SAUA 4B3MM 3J80S 4K0KM 2UUCM 1NNJA 3GPXA 4DV7M 1FJGM 1HNWM 1KFVA 4CISA 3JAMS 4JI2M 4LF4M 1HNXM 1L1ZA 3U6EA 4MB7A 5LMUM 3SATA 2OQ4A 3VK7A 3GPPA 2EA0A 4JI4M 4GKJM 1TDHA 3J81S 4ITQA 3W0FA 5ITXE 4DR2M 3T1YM 3GQ4A 1N32M 2UXBM 4PD2A 1R2YA 1I94M 4NRWA 4LFCM 2F5NA 4JI5M 4JI1M 3A45A 4DR7M 1XMQM 3OTOM 4DV2M 4LF5M 1PJIA 1EE8A 4PDIA 5ITRA 1N36M 1L2BA 4JI7M 4PDGA 5ITTA 1Z59A 5IWAM 2F5OA 2F5PA 1Z5BA 5BR8M 3JR5A 3U6DA 1PM5A 3GPYA 3A42A 1MU5A
chains in the Genus database with same CATH superfamily
3JR4A 1E9SA 3C3EA 4L6V6 3U6SA 2JUJA 3THGA 2UUAM 1NJGA 3ZC7B 2CHQA 2MH8A 1IXSA 7CATA 2Y0QA 3E46A 2CEAA 4W5WA 4IBBA 1L1TA 3FUUA 3LCUA 3TWLA 1AIPC 1QDRA 1YUBA 1R4GA 2HKJA 3LMMA 1QUSA 3UZUA 2EKFA 3U6LA 4YY3M 1EFUB 5IT9S 2CE7A 2DNAA 1EIJA 2Z7JA 2JZ1A 2R45A 3FUTA 3KS4A 1JQJC 4B7HA 1XMOM 1IXSB 3DZDA 1G4AE 1PGYA 3FE3A 3M7GA 3Q8XA 4LRSA 2MR9A 2LXEA 4L4UA 4KHPM 1D0LA 4GHLA 3FD9A 2HCBA 3MK6A 2A5YB 4LJ7A 3TE6A 4DR5M 2YNMD 3ZCBB 2DWZB 5IREB 1TH4A 1N34M 1NV9A 3HJ8A 3ILKA 4B7FA 1C1KA 2Y20A 3MMPA 3GQ3A 4PCZA 2W82A 2G5GX 4L78A 1IN4A 4WW0A 3A98B 4WURA 3SFZA 3FKEA 3Q8GA 4MGKE 4LF8M 3HX3A 2CV2A 1DGGA 4WP2A 1Z6TA 2WSFF 3WHKA 4DV4M 5EXXA 2LVOC 2F5QA 1OFHA 3U5ZA 2XSZD 4MGHA 3FYCA 3H4JA 4M0WA 5DNYA 4DV3M 3T1HM 3BXWA 1OTRA 3W67A 4GITA 3I4YA 2UUBM 3ZQJA 4IBIA 2C9CA 5FTNA 1NY6A 4LG2A 1IN5A 1D2NA 2R6FA 1T43A 2MGWA 5EQTA 4JI8M 2K0BX 2XZUA 3SARA 1V92A 2CV0A 2JY6B 1XNQM 2EO2A 2OOBA 5E26A 2DHRA 3RE8A 3U5ZB 4G4RA 2DKLA 2MROB 3QAUA 2L6OA 3UMMA 3J80S 1J7KA 5EP3A 1OIPA 3K92A 4DV7M 3TPZA 2OO9A 1TTEA 4JI2M 1D0KA 2ERCA 3K2LA 4R3DA 3KS8A 1UFZA 2GNOA 2O25A 1JB0F 2V1CA 3DFZA 3SATA 4UN2B 3GPPA 4LRTA 5EP2A 2R62A 1IQPA 2ZTCA 1NVMA 3T1YM 1N32M 4CHTB 2BJWA 3PVSA 2ZTDA 3GLFB 4LY6A 3K8ZA 4NOOB 4NRWA 8CATA 2F5NA 4JI5M 1OKSA 3A45A 3HJSA 2QQ8A 3OTOM 2QBYA 1PJIA 4FWGA 4AZFA 3T6PA 1QAQA 2X49A 2M60A 3UJNA 4QOSA 3B7QA 2LVNC 1N36M 4KODA 3FTEA 1ORYB 2DHYA 3HHWA 4R71A 1VDDA 2JY5A 2P5TA 4GC9A 3GRVA 4LCBA 5ITTA 3FYDA 2JXNA 2F5OA 4IIWA 2F5PA 3M6AA 2DAIA 2LNHC 3FUXA 3NWLA 1QANA 1FNNA 1XXHB 2HAKA 3A42A 3KVWA 1P3QQ 1ZMWA 1TF0B 3HWSA 4JI0M 2QBYB 4FW9A 4CJ6A 4IBFA 3FRHA 3B9PA 3UGJA 2LHGA 4G4NA 3VDUA 3ZH9B 4AKIA 1J5EM 3R9XB 3EIHA 5EP4A 2V6ZM 2DVWB 2X8AA 3AFHA 1BVSA 2MJ5B 3RFWA 2JZ0A 1T6OA 3KSXA 2JNHA 4I4LA 4LJ8A 4RKUF 3VKGA 5EXTA 5L8RF 2R0IA 1N77A 4LJ6A 1N78A 2LH0A 3EIEA 3GRUA 4Z8XA 3T38A 4QOZC 2LVAA 1PJQA 1WJ7A 5ITQA 5JI3E 2F4VM 3W68A 3L25A 2VQFM 1ZV1A 4QNMA 3FTDA 3MJ5A 1TR8A 3KP1E 4Q7JA 3U6QA 4DR6M 2BJVA 1HNZM 1L8QA 3L29A 5EXSA 4NXNM 3J7AS 2XH9A 1E32A 2VF8A 4DR1M 4AG6A 3GQ5A 1W5TA 1NNUC 1SXJD 1GKIA 3GO8A 4MH0E 4G4OA 1G71A 2JY8A 3GLIA 2DI0A 1R5LA 1GL7A 2D7EA 4PT5A 4F2LA 4LF6M 4LGYA 2R4JA 2RKOA 3H4MA 3HJQA 2HHHM 3SYLA 3M0EA 1WXQA 4KLNA 4DV6M 1IXZA 1HT1E 1HT2E 2CRUA 2AHMA 5KPTA 5C1BA 3L26A 1QAOA 2DZLA 3GLIB 3IG5A 2DWMA 2VF7A 2CP8A 3GLIE 2K47A 3SYKA 4LZZA 3AOEA 2L4EA 3KDSE 5BPVA 3U6CA 3QYBA 4FD2A 2C99A 1V33A 1L2CA 4OX9M 1A5TA 4DV1M 2KNZA 4MGIE 5KQ8A 1HQYE 1GABA 4JN6A 1R2ZA 4DR3M 1IBLM 1Q39A 5DYGA 3WHLA 4ZPXA 1DGHA 5LMNM 2KDLA 4HL4A 2ZM6M 3C58A 2ZAOA 4KT0F 3QYEA 3GLGA 4B3MM 5EP1A 1H6UA 1GL6A 1VG5A 1YSYA 4GMQA 1J09A 4BBAA 4II7A 1FJGM 1HNWM 1OIZA 1CUKA 4LJAA 2D7HA 4AKGA 3JAMS 1WHCA 3LVVA 1G41A 3L27A 2LTUA 1L1ZA 2YQZA 1QYRA 5EXPA 2J5YA 2RRUA 5LMUM 1DGHB 2D7GA 3VK7A 4LZJA 2EA0A 2Z8YM 2DWNA 3I4VA 3GLGB 3J81S 1IN8A 1DO0A 3GQ4A 3GLGE 2UXBM 2QNJA 3KOYE 4GC5A 4PD2A 1WIVA 1I4WA 3FRIA 3L28A 1NHWC 2CV1A 1Q02A 2H5XA 4DV2M 3KFUG 2WSCF 5FTJA 3IHPA 3VFDA 2KZSA 2LVQD 3CF6E 5ITRA 5FTKA 4FCVA 4GIPA 4PDGA 1GLNA 1OAOC 2FOIC 5BR8M 4S12A 3JR5A 2DENA 2C9OA 2EUCA 1VEKA 1PM5A 4LJ5A 5FTMA 1G59A 3FTFA 2Z4RA 1GJSA 3U6MA 4AI6A 3GRRA 3B89A 2VDBB 3E4RA 4L15A 4IBDA 4X66M 4YHHM 2Z3XA 4NRVA 3VK8A 4NC6A 2JA2A 2VIIA 3MHVC 3W0LB 4M0DA 3LVWA 4Y28F 1KSFX 2F5SA 4NXMM 4JV5M 3FUWA 5ITYA 2L7HA 1K3WA 2KRKA 2QPAA 4IJFA 3V76A 2O5RA 1Y8GA 3L2AA 3AKZA 4M9SA 1Z5AA 3SMSA 2EJSA 2K9DA 3TL4X 1NSFA 1ZMVA 3B7ZA 5KPZA 2I7PA 4AKHA 4M9ZA 3GP1A 4G4QA 2JP7A 1IN7A 4X65M 3HKPA 5IZ7D 1WGNA 3C9PA 4FWHA 3QWLA 3HU1A 3SAVA 1N33M 3U6OA 4FVMA 1N75A 1IBKM 3SBJA 3R8FA 2R46A 3AOEC 1ZQ9A 4DV5M 2DAGA 2XSZA 3K9PA 1Q3BA 3CTWB 2VQEM 4FCWA 1OFIA 3LCVB 1X37A 3U6PA 2V1UA 1G8PA 2H1RA 4DUYM 4JI3M 3KW6A 1NO1A 2HWJA 1R6BX 4G6ZA 4JI6M 4F1IA 3E21A 2XLJA 3DOAA 2J7NA 2K6BA 3HHXA 3HY5A 4IBCA 3HHYA 4CIZA 5ITUA 2XZFA 1JR3D 3DA1A 2KNAA 4LJ4A 3SAWA 3KXEC 5FTLA 4A3VB 3VDPA 2R4EA 3C3DA 2EKKA 2Y21A 3FTCA 4MGZE 1XC8A 1WGLA 2FE8A 2XGNA 5E6JA 2L09A 4XK8F 1HR0M 2G8LA 4B3RM 3IG8A 4DR4M 5GKNA 2GQFA 3KSJA 4AW4A 5H37D 1R7RA 5A2QS 3TWKA 1PRBA 5KO3A 4LFBM 4EIWA 2CHVA 4MGYE 4B3SM 1G3IA 1ZAEA 2ZAMA 3PFIA 1DO2A 5FLXS 4LF7M 2R44A 4JYAM 2QZ4A 3GRYA 2C96A 2KHHA 3SAUA 2XFSA 2QSFX 1SXJC 4P17A 4XGIA 4QNRA 3VLFB 5C18A 1NNJA 1E9RA 1VQ1A 1S3SA 4QHSA 2XEPA 3PXGA 4AG5A 2QCUA 1DGBA 4Z6YA 3U6EA 2C5RA 1YE9A 2B3TA 4MB7A 3BOSA 2OQ4A 4GH9A 3AOGA 1QVRA 3J2PB 1GJTA 1TDHA 2Y0TA 3RGSA 2ZANA 4QHTA 4CGYB 4DR2M 4L8RC 4XBOA 4FCTA 1MJGM 1R2YA 3KOZE 3F92A 1IY2A 3D8BA 1E94E 3SMPA 2G3QA 2QHOB 1OAIA 2FS1A 3CGWA 4JI1M 4LF5M 4DR7M 1GO5A 4BB9A 2Z4SA 1EE8A 4KO8A 3CF0A 4JI7M 3U61A 1YLAA 2N35A 2WZJA 3K1JA 4OVZA 2CWBA 3HZJA 1V34A 1SG9A 5IWAM 2DAEA 4IBGA 2DZOB 3RGPA 2X4AA 2BWEA 3GPYA 1MU5A 4D82A 2QENA 1QQWA 1JR3A 1F4IA 1IY1A 3J27B 3FUVA 1L2DA 4DBGB 1TDZA 1D0MA 1WR1B 3KP0E 2RGHA 5DFLA 3U61B 3VKHA 1XWIA 1HQCA 2L7IA 4OVZB 4HLQA 2DAKA 3AV0A 1MN3A 2L2DA 3AJIB 3CF2A 1IXRC 2FNAA 1NV8A 2HL7A 1K82A 2KRUA 1JR3E 2JWSA 3GPUA 1QDTA 1SXJA 2M5ZA 3K9OA 2I7NA 3LQRA 2CFOA 3UK6A 4X62M 2O01F 3E9SA 1C7YA 5JI2E 4X64M 2BWBA 1QUTA 1DV0A 2L4FA 4JXJA 2CHGA 2ZBKB 3T15A 2JY7A 1IY0A 2YR0A 2NQ8C 4BLCA 4LFAM 1UM8A 1TH3A 1HJPA 2KNVA 2LBCA 4IJEA 1Z5CA 5KQDA 3I01M 4NL4H 4DV0M 1TGUA 4B08A 1SXJB 2KA6B 2E5LM 3PNVA 4D80A 2OPFA 1SXJE 3KOXE 2R65A 5F3WA 4OU7A 1IBMM 2LWXA 1GVNA 3A46A 2KZUA 4ANRA 4IBJA 1PJSA 1XHBA 4RF1A 3GLFA 4R7GA 1XNRM 3SASA 3D8LA 3KOWE 2RGOA 1VDLA 1KYIA 1XB2B 2UXCM 3SHGB 1MX0A 4NSOB 3B74A 3HU2A 2DXIA 4IBKA 2UXDM 3HGIA 2FH0A 2LVPC 3LQQA 4P16A 1PJJA 1ZMUA 2KW0A 1VEGA 2FFJA 3IECA 2DWLA 4B3TM 3I04M 4HEOA 4DUZM 4GKKM 2UU9M 1QZEA 2APLA 4AQYM 1LTMA 3TWMA 1XXHA 4D81A 3GLFE 3NBXX 1K3XA 1Q3CA 4MM3B 1IFYA 1OJLA 3B7NA 2BNKA 2Q2EB 4M9XA 4LGMA 4LF9M 5ITXA 2QP9X 3PNYA 4I8OA 1W5SA 3HHZA 4TUWA 2C98A 5DYIA 3GLHA 3AL0C 1AUAA 2CUZA 2UUCM 4I5SA 5FSWA 4NSRA 1VEJA 3GPXA 1IM2A 2OOAA 5EJCA 1NY5A 1NHGC 4RNAA 1KFVA 4CISA 1T3TA 1DGFA 3HU3A 3NBIA 3LW5F 2YFQA 4G3OA 4LF4M 1HNXM 1QZMA 1XXHE 2R18A 4L16A 2WSEF 3I51A 4LJ9A 2DAMA 3TQSA 4GEWA 4JI4M 4GKJM 2J7OA 3SC3A 4REZA 4B7GA 4ITQA 2KEBA 3GLHB 1RU3A 3W0FA 5ITXE 3U60A 4GHAA 1IN6A 4I81A 2LHCA 3GLHE 4RF0A 1I94M 5KPRA 2DZNB 4LFCM 4GRIA 4OW0A 1XMQM 1TH2A 2XFTA 1PJTA 4FWDA 3SHFA 4PDIA 1L2BA 4IBEA 3BBZA 1LV7A 1NJFA 1OQYA 3J7BA 1Z59A 1QAMA 1Z5BA 3U60B 3U6DA 2XF3A 4K0KM 2KXEA
chains in the Genus database with same CATH topology
3JR4A 1E9SA 3U6SA 3THGA 2UUAM 1NJGA 3ZC7B 2CHQA 7CATA 2Y0QA 2CEAA 4W5WA 4IBBA 1L1TA 3FUUA 3TWLA 1YUBA 2HKJA 3LMMA 3UZUA 3U6LA 4YY3M 5IT9S 2CE7A 2Z7JA 4B7HA 2R45A 3FUTA 3KS4A 1JQJC 1XMOM 1IXSB 3DZDA 1G4AE 3M7GA 3Q8XA 4LRSA 4L4UA 2LXEA 4KHPM 4GHLA 3FD9A 2HCBA 3MK6A 2A5YB 4LJ7A 3TE6A 4DR5M 2YNMD 3ZCBB 2DWZB 5IREB 1TH4A 1N34M 3HJ8A 3ILKA 4B7FA 1C1KA 2Y20A 3GQ3A 4PCZA 2W82A 2G5GX 4L78A 1IN4A 4WW0A 3A98B 4WURA 3SFZA 3FKEA 4MGKE 4LF8M 2CV2A 1DGGA 1Z6TA 3WHKA 4DV4M 5EXXA 2F5QA 1OFHA 3U5ZA 2XSZD 4MGHA 3FYCA 4M0WA 5DNYA 4DV3M 3T1HM 4GITA 3I4YA 2UUBM 4IBIA 2C9CA 5FTNA 1NY6A 4LG2A 1IN5A 1D2NA 5EQTA 4JI8M 2XZUA 3SARA 2CV0A 1XNQM 2EO2A 3RE8A 5E26A 2DHRA 3U5ZB 4G4RA 3QAUA 2L6OA 3UMMA 3J80S 1J7KA 5EP3A 3K92A 4DV7M 3TPZA 4JI2M 2ERCA 3K2LA 4R3DA 3KS8A 2V1CA 3DFZA 3SATA 3GPPA 4LRTA 5EP2A 2R62A 1IQPA 1NVMA 3T1YM 1N32M 4CHTB 2BJWA 3PVSA 3GLFB 4LY6A 3K8ZA 4NOOB 4NRWA 8CATA 2F5NA 4JI5M 3A45A 3HJSA 3OTOM 2QBYA 1PJIA 4FWGA 4AZFA 3UJNA 1QAQA 2X49A 2M60A 1N36M 4QOSA 3FTEA 4KODA 1ORYB 3HHWA 1VDDA 2P5TA 4GC9A 3GRVA 4LCBA 5ITTA 3FYDA 2F5OA 2F5PA 4IIWA 3M6AA 2LNHC 3FUXA 3NWLA 1QANA 1FNNA 1XXHB 3KVWA 3A42A 3HWSA 4JI0M 2QBYB 4FW9A 4IBFA 3B9PA 3UGJA 4G4NA 3VDUA 3ZH9B 4AKIA 1J5EM 3R9XB 3EIHA 5EP4A 2V6ZM 2DVWB 2X8AA 3AFHA 3RFWA 3KSXA 4I4LA 4LJ8A 3VKGA 5EXTA 1N77A 4LJ6A 1N78A 2LH0A 3EIEA 3GRUA 4Z8XA 3T38A 4QOZC 5JI3E 5ITQA 2F4VM 3L25A 2VQFM 4QNMA 3FTDA 3MJ5A 3KP1E 3U6QA 4DR6M 2BJVA 1HNZM 1L8QA 3L29A 5EXSA 4NXNM 3J7AS 2XH9A 1E32A 4DR1M 4AG6A 3GQ5A 1W5TA 1NNUC 1SXJD 1GKIA 3GO8A 4MH0E 4G4OA 3GLIA 4PT5A 2D7EA 1GL7A 4LF6M 4LGYA 2R4JA 2RKOA 3H4MA 3HJQA 2HHHM 3SYLA 3M0EA 1WXQA 4KLNA 4DV6M 1IXZA 1HT1E 1HT2E 2AHMA 5KPTA 5C1BA 3L26A 1QAOA 3GLIB 3IG5A 2DWMA 2K47A 3SYKA 4LZZA 3AOEA 3U6CA 3KDSE 5BPVA 4OX9M 4FD2A 2C99A 1L2CA 4DV1M 5KQ8A 4MGIE 1HQYE 4JN6A 1R2ZA 4DR3M 1IBLM 1Q39A 5DYGA 3WHLA 4ZPXA 1DGHA 5LMNM 4HL4A 2ZM6M 3C58A 2ZAOA 3GLGA 4B3MM 5EP1A 1H6UA 1GL6A 1YSYA 4GMQA 1J09A 4BBAA 4II7A 1FJGM 1HNWM 4AKGA 4LJAA 2D7HA 3JAMS 3LVVA 1G41A 3L27A 1L1ZA 2YQZA 1QYRA 5EXPA 5LMUM 1DGHB 2D7GA 3VK7A 4LZJA 2EA0A 2DWNA 3I4VA 3GLGB 3J81S 1IN8A 1DO0A 3GQ4A 2UXBM 3KOYE 4PD2A 4GC5A 1I4WA 3L28A 1NHWC 2CV1A 4DV2M 3KFUG 5FTJA 3VFDA 2KZSA 3CF6E 5ITRA 5FTKA 4FCVA 4GIPA 4PDGA 1GLNA 2FOIC 5BR8M 4S12A 3JR5A 2C9OA 2EUCA 1PM5A 4LJ5A 5FTMA 1G59A 3FTFA 2Z4RA 3U6MA 4AI6A 3GRRA 3E4RA 4L15A 4X66M 4IBDA 4YHHM 2Z3XA 3VK8A 4NRVA 2JA2A 2VIIA 3MHVC 3W0LB 4M0DA 3LVWA 1KSFX 2F5SA 4NXMM 4JV5M 3FUWA 5ITYA 2L7HA 1K3WA 2KRKA 2QPAA 4IJFA 2O5RA 3L2AA 3AKZA 4M9SA 1Z5AA 3SMSA 3TL4X 1NSFA 4AKHA 5KPZA 2I7PA 4M9ZA 3GP1A 4G4QA 1IN7A 4X65M 3HKPA 5IZ7D 4FWHA 3QWLA 3HU1A 3SAVA 1N33M 3U6OA 4FVMA 1N75A 1IBKM 3SBJA 3R8FA 2R46A 3AOEC 1ZQ9A 4DV5M 2XSZA 1Q3BA 3CTWB 2VQEM 4FCWA 1OFIA 1X37A 3U6PA 2V1UA 1G8PA 2H1RA 4DUYM 4JI3M 3KW6A 1R6BX 4G6ZA 4JI6M 2XLJA 3DOAA 2J7NA 3HHXA 4IBCA 2XZFA 3HHYA 5ITUA 1JR3D 3DA1A 4LJ4A 3SAWA 3KXEC 5FTLA 4A3VB 3VDPA 2R4EA 2Y21A 4MGZE 3FTCA 1XC8A 2FE8A 2XGNA 5E6JA 2L09A 1HR0M 2G8LA 4B3RM 3IG8A 4DR4M 5GKNA 3KSJA 4AW4A 5H37D 1R7RA 5A2QS 3TWKA 5KO3A 4LFBM 4EIWA 2CHVA 4MGYE 4B3SM 1G3IA 1ZAEA 2ZAMA 3PFIA 1DO2A 5FLXS 4LF7M 4JYAM 2QZ4A 3GRYA 2C96A 3SAUA 2XFSA 1SXJC 4XGIA 4QNRA 3VLFB 5C18A 1NNJA 1E9RA 4QHSA 1S3SA 2XEPA 3PXGA 4AG5A 2QCUA 1DGBA 4Z6YA 3U6EA 2C5RA 1YE9A 4MB7A 3BOSA 2OQ4A 4GH9A 3AOGA 1QVRA 3J2PB 1TDHA 2Y0TA 3RGSA 2ZANA 4QHTA 4CGYB 4DR2M 4L8RC 4XBOA 4FCTA 1R2YA 3KOZE 1IY2A 3D8BA 1E94E 3SMPA 4JI1M 4DR7M 4LF5M 4BB9A 2Z4SA 1EE8A 4KO8A 3CF0A 4JI7M 3U61A 3K1JA 4OVZA 5IWAM 4IBGA 2DZOB 3RGPA 2X4AA 3GPYA 1MU5A 4D82A 2QENA 1QQWA 1JR3A 1IY1A 3J27B 3FUVA 1L2DA 1TDZA 3KP0E 2RGHA 3U61B 3VKHA 1XWIA 1HQCA 2L7IA 4OVZB 4HLQA 3AV0A 3AJIB 3CF2A 1IXRC 2FNAA 2HL7A 1K82A 2KRUA 3GPUA 1SXJA 2M5ZA 2I7NA 3LQRA 2CFOA 3UK6A 4X62M 3E9SA 5JI2E 4X64M 4JXJA 2CHGA 2ZBKB 3T15A 1IY0A 2YR0A 2NQ8C 4BLCA 4LFAM 1UM8A 1TH3A 5KQDA 4IJEA 1Z5CA 4DV0M 4NL4H 1TGUA 4B08A 1SXJB 2KA6B 2E5LM 3PNVA 4D80A 2OPFA 1SXJE 3KOXE 2R65A 5F3WA 4OU7A 1IBMM 2LWXA 1GVNA 3A46A 2KZUA 4IBJA 1XHBA 4RF1A 3GLFA 4R7GA 1XNRM 3SASA 3D8LA 3KOWE 2RGOA 1KYIA 2UXCM 3SHGB 1MX0A 4NSOB 3HU2A 2DXIA 2UXDM 4IBKA 3HGIA 3LQQA 4P16A 1PJJA 2KW0A 2FFJA 4B3TM 2DWLA 4DUZM 4GKKM 2UU9M 4AQYM 3TWMA 1XXHA 4D81A 1K3XA 1Q3CA 4MM3B 1OJLA 2BNKA 2Q2EB 4M9XA 4LGMA 4LF9M 5ITXA 2QP9X 3PNYA 4I8OA 1W5SA 3HHZA 4TUWA 2C98A 5DYIA 3GLHA 3AL0C 2CUZA 2UUCM 4I5SA 5FSWA 4NSRA 3GPXA 1IM2A 5EJCA 1NY5A 1NHGC 4RNAA 1KFVA 4CISA 1T3TA 1DGFA 3HU3A 3NBIA 4LF4M 2YFQA 1HNXM 1QZMA 2R18A 4L16A 3I51A 4LJ9A 3TQSA 4JI4M 4GKJM 2J7OA 3SC3A 4REZA 4B7GA 4ITQA 2KEBA 3GLHB 3W0FA 5ITXE 3U60A 4GHAA 1IN6A 4I81A 4RF0A 1I94M 5KPRA 2DZNB 4LFCM 4GRIA 4OW0A 1XMQM 1TH2A 2XFTA 4FWDA 3SHFA 4PDIA 1L2BA 4IBEA 1LV7A 1NJFA 3J7BA 1Z59A 1QAMA 1Z5BA 3U60B 3U6DA 2XF3A 4K0KM 2KXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JR4 A;  4JI0 M;  3U6M A;  3U6S A;  1L2D A;  1TDZ A;  4G4N A;  2UUA M;  4X66 M;  4YHH M;  1J5E M;  3VK8 A;  4NRV A;  1L1T A;  3TWL A;  4NXM M;  2F5S A;  2HKJ A;  1K3W A;  5ITY A;  4JV5 M;  3U6L A;  4YY3 M;  5IT9 S;  1K82 A;  3GPU A;  5ITQ A;  1Z5A A;  2F4V M;  1XMO M;  4X62 M;  2VQF M;  4X64 M;  3GP1 A;  4G4Q A;  4X65 M;  2ZBK B;  3U6Q A;  4KHP M;  4LFA M;  4DR6 M;  3SAV A;  1HNZ M;  3U6O A;  1N33 M;  4DR5 M;  1Z5C A;  1IBK M;  4NXN M;  4DV0 M;  3SBJ A;  3J7A S;  4DV5 M;  1N34 M;  2E5L M;  1Q3B A;  2VQE M;  4DR1 M;  3GQ5 A;  2OPF A;  3GQ3 A;  3U6P A;  3GO8 A;  4PCZ A;  4G4O A;  4DUY M;  4JI3 M;  1IBM M;  4LF6 M;  3A46 A;  4JI6 M;  2HHH M;  3DOA A;  4LF8 M;  2XZF A;  5ITU A;  1XNR M;  3SAS A;  4DV6 M;  4DV4 M;  3SAW A;  2F5Q A;  1XC8 A;  2UXC M;  1MX0 A;  4DV3 M;  3T1H M;  2UXD M;  1PJJ A;  1HR0 M;  2UUB M;  4B3R M;  4B3T M;  3U6C A;  4DUZ M;  4OX9 M;  4GKK M;  1L2C A;  2UU9 M;  4DR4 M;  4DV1 M;  4AQY M;  5A2Q S;  4JI8 M;  3TWM A;  3TWK A;  2XZU A;  3SAR A;  4LFB M;  1K3X A;  1Q3C A;  1R2Z A;  4B3S M;  4DR3 M;  1XNQ M;  1IBL M;  1Q39 A;  2Q2E B;  5LMN M;  4G4R A;  2ZM6 M;  4LF9 M;  5FLX S;  5ITX A;  4LF7 M;  4JYA M;  3C58 A;  3SAU A;  4B3M M;  3J80 S;  4K0K M;  2UUC M;  1NNJ A;  3GPX A;  4DV7 M;  1FJG M;  1HNW M;  1KFV A;  4CIS A;  3JAM S;  4JI2 M;  4LF4 M;  1HNX M;  1L1Z A;  3U6E A;  4MB7 A;  5LMU M;  3SAT A;  2OQ4 A;  3VK7 A;  3GPP A;  2EA0 A;  4JI4 M;  4GKJ M;  1TDH A;  3J81 S;  4ITQ A;  3W0F A;  5ITX E;  4DR2 M;  3T1Y M;  3GQ4 A;  1N32 M;  2UXB M;  4PD2 A;  1R2Y A;  1I94 M;  4NRW A;  4LFC M;  2F5N A;  4JI5 M;  4JI1 M;  3A45 A;  4DR7 M;  1XMQ M;  3OTO M;  4DV2 M;  4LF5 M;  1PJI A;  1EE8 A;  4PDI A;  5ITR A;  1N36 M;  1L2B A;  4JI7 M;  4PDG A;  5ITT A;  1Z59 A;  5IWA M;  2F5O A;  2F5P A;  1Z5B A;  5BR8 M;  3JR5 A;  3U6D A;  1PM5 A;  3GPY A;  3A42 A;  1MU5 A; 
#chains in the Genus database with same CATH topology
 3JR4 A;  1E9S A;  3C3E A;  4L6V 6;  3U6S A;  2JUJ A;  3THG A;  2UUA M;  1NJG A;  3ZC7 B;  2CHQ A;  2MH8 A;  1IXS A;  7CAT A;  2Y0Q A;  3E46 A;  2CEA A;  4W5W A;  4IBB A;  1L1T A;  3FUU A;  3LCU A;  3TWL A;  1AIP C;  1QDR A;  1YUB A;  1R4G A;  2HKJ A;  3LMM A;  1QUS A;  3UZU A;  2EKF A;  3U6L A;  4YY3 M;  1EFU B;  5IT9 S;  2CE7 A;  2DNA A;  1EIJ A;  2Z7J A;  2JZ1 A;  2R45 A;  3FUT A;  3KS4 A;  1JQJ C;  4B7H A;  1XMO M;  1IXS B;  3DZD A;  1G4A E;  1PGY A;  3FE3 A;  3M7G A;  3Q8X A;  4LRS A;  2MR9 A;  2LXE A;  4L4U A;  4KHP M;  1D0L A;  4GHL A;  3FD9 A;  2HCB A;  3MK6 A;  2A5Y B;  4LJ7 A;  3TE6 A;  4DR5 M;  2YNM D;  3ZCB B;  2DWZ B;  5IRE B;  1TH4 A;  1N34 M;  1NV9 A;  3HJ8 A;  3ILK A;  4B7F A;  1C1K A;  2Y20 A;  3MMP A;  3GQ3 A;  4PCZ A;  2W82 A;  2G5G X;  4L78 A;  1IN4 A;  4WW0 A;  3A98 B;  4WUR A;  3SFZ A;  3FKE A;  3Q8G A;  4MGK E;  4LF8 M;  3HX3 A;  2CV2 A;  1DGG A;  4WP2 A;  1Z6T A;  2WSF F;  3WHK A;  4DV4 M;  5EXX A;  2LVO C;  2F5Q A;  1OFH A;  3U5Z A;  2XSZ D;  4MGH A;  3FYC A;  3H4J A;  4M0W A;  5DNY A;  4DV3 M;  3T1H M;  3BXW A;  1OTR A;  3W67 A;  4GIT A;  3I4Y A;  2UUB M;  3ZQJ A;  4IBI A;  2C9C A;  5FTN A;  1NY6 A;  4LG2 A;  1IN5 A;  1D2N A;  2R6F A;  1T43 A;  2MGW A;  5EQT A;  4JI8 M;  2K0B X;  2XZU A;  3SAR A;  1V92 A;  2CV0 A;  2JY6 B;  1XNQ M;  2EO2 A;  2OOB A;  5E26 A;  2DHR A;  3RE8 A;  3U5Z B;  4G4R A;  2DKL A;  2MRO B;  3QAU A;  2L6O A;  3UMM A;  3J80 S;  1J7K A;  5EP3 A;  1OIP A;  3K92 A;  4DV7 M;  3TPZ A;  2OO9 A;  1TTE A;  4JI2 M;  1D0K A;  2ERC A;  3K2L A;  4R3D A;  3KS8 A;  1UFZ A;  2GNO A;  2O25 A;  1JB0 F;  2V1C A;  3DFZ A;  3SAT A;  4UN2 B;  3GPP A;  4LRT A;  5EP2 A;  2R62 A;  1IQP A;  2ZTC A;  1NVM A;  3T1Y M;  1N32 M;  4CHT B;  2BJW A;  3PVS A;  2ZTD A;  3GLF B;  4LY6 A;  3K8Z A;  4NOO B;  4NRW A;  8CAT A;  2F5N A;  4JI5 M;  1OKS A;  3A45 A;  3HJS A;  2QQ8 A;  3OTO M;  2QBY A;  1PJI A;  4FWG A;  4AZF A;  3T6P A;  1QAQ A;  2X49 A;  2M60 A;  3UJN A;  4QOS A;  3B7Q A;  2LVN C;  1N36 M;  4KOD A;  3FTE A;  1ORY B;  2DHY A;  3HHW A;  4R71 A;  1VDD A;  2JY5 A;  2P5T A;  4GC9 A;  3GRV A;  4LCB A;  5ITT A;  3FYD A;  2JXN A;  2F5O A;  4IIW A;  2F5P A;  3M6A A;  2DAI A;  2LNH C;  3FUX A;  3NWL A;  1QAN A;  1FNN A;  1XXH B;  2HAK A;  3A42 A;  3KVW A;  1P3Q Q;  1ZMW A;  1TF0 B;  3HWS A;  4JI0 M;  2QBY B;  4FW9 A;  4CJ6 A;  4IBF A;  3FRH A;  3B9P A;  3UGJ A;  2LHG A;  4G4N A;  3VDU A;  3ZH9 B;  4AKI A;  1J5E M;  3R9X B;  3EIH A;  5EP4 A;  2V6Z M;  2DVW B;  2X8A A;  3AFH A;  1BVS A;  2MJ5 B;  3RFW A;  2JZ0 A;  1T6O A;  3KSX A;  2JNH A;  4I4L A;  4LJ8 A;  4RKU F;  3VKG A;  5EXT A;  5L8R F;  2R0I A;  1N77 A;  4LJ6 A;  1N78 A;  2LH0 A;  3EIE A;  3GRU A;  4Z8X A;  3T38 A;  4QOZ C;  2LVA A;  1PJQ A;  1WJ7 A;  5ITQ A;  5JI3 E;  2F4V M;  3W68 A;  3L25 A;  2VQF M;  1ZV1 A;  4QNM A;  3FTD A;  3MJ5 A;  1TR8 A;  3KP1 E;  4Q7J A;  3U6Q A;  4DR6 M;  2BJV A;  1HNZ M;  1L8Q A;  3L29 A;  5EXS A;  4NXN M;  3J7A S;  2XH9 A;  1E32 A;  2VF8 A;  4DR1 M;  4AG6 A;  3GQ5 A;  1W5T A;  1NNU C;  1SXJ D;  1GKI A;  3GO8 A;  4MH0 E;  4G4O A;  1G71 A;  2JY8 A;  3GLI A;  2DI0 A;  1R5L A;  1GL7 A;  2D7E A;  4PT5 A;  4F2L A;  4LF6 M;  4LGY A;  2R4J A;  2RKO A;  3H4M A;  3HJQ A;  2HHH M;  3SYL A;  3M0E A;  1WXQ A;  4KLN A;  4DV6 M;  1IXZ A;  1HT1 E;  1HT2 E;  2CRU A;  2AHM A;  5KPT A;  5C1B A;  3L26 A;  1QAO A;  2DZL A;  3GLI B;  3IG5 A;  2DWM A;  2VF7 A;  2CP8 A;  3GLI E;  2K47 A;  3SYK A;  4LZZ A;  3AOE A;  2L4E A;  3KDS E;  5BPV A;  3U6C A;  3QYB A;  4FD2 A;  2C99 A;  1V33 A;  1L2C A;  4OX9 M;  1A5T A;  4DV1 M;  2KNZ A;  4MGI E;  5KQ8 A;  1HQY E;  1GAB A;  4JN6 A;  1R2Z A;  4DR3 M;  1IBL M;  1Q39 A;  5DYG A;  3WHL A;  4ZPX A;  1DGH A;  5LMN M;  2KDL A;  4HL4 A;  2ZM6 M;  3C58 A;  2ZAO A;  4KT0 F;  3QYE A;  3GLG A;  4B3M M;  5EP1 A;  1H6U A;  1GL6 A;  1VG5 A;  1YSY A;  4GMQ A;  1J09 A;  4BBA A;  4II7 A;  1FJG M;  1HNW M;  1OIZ A;  1CUK A;  4LJA A;  2D7H A;  4AKG A;  3JAM S;  1WHC A;  3LVV A;  1G41 A;  3L27 A;  2LTU A;  1L1Z A;  2YQZ A;  1QYR A;  5EXP A;  2J5Y A;  2RRU A;  5LMU M;  1DGH B;  2D7G A;  3VK7 A;  4LZJ A;  2EA0 A;  2Z8Y M;  2DWN A;  3I4V A;  3GLG B;  3J81 S;  1IN8 A;  1DO0 A;  3GQ4 A;  3GLG E;  2UXB M;  2QNJ A;  3KOY E;  4GC5 A;  4PD2 A;  1WIV A;  1I4W A;  3FRI A;  3L28 A;  1NHW C;  2CV1 A;  1Q02 A;  2H5X A;  4DV2 M;  3KFU G;  2WSC F;  5FTJ A;  3IHP A;  3VFD A;  2KZS A;  2LVQ D;  3CF6 E;  5ITR A;  5FTK A;  4FCV A;  4GIP A;  4PDG A;  1GLN A;  1OAO C;  2FOI C;  5BR8 M;  4S12 A;  3JR5 A;  2DEN A;  2C9O A;  2EUC A;  1VEK A;  1PM5 A;  4LJ5 A;  5FTM A;  1G59 A;  3FTF A;  2Z4R A;  1GJS A;  3U6M A;  4AI6 A;  3GRR A;  3B89 A;  2VDB B;  3E4R A;  4L15 A;  4IBD A;  4X66 M;  4YHH M;  2Z3X A;  4NRV A;  3VK8 A;  4NC6 A;  2JA2 A;  2VII A;  3MHV C;  3W0L B;  4M0D A;  3LVW A;  4Y28 F;  1KSF X;  2F5S A;  4NXM M;  4JV5 M;  3FUW A;  5ITY A;  2L7H A;  1K3W A;  2KRK A;  2QPA A;  4IJF A;  3V76 A;  2O5R A;  1Y8G A;  3L2A A;  3AKZ A;  4M9S A;  1Z5A A;  3SMS A;  2EJS A;  2K9D A;  3TL4 X;  1NSF A;  1ZMV A;  3B7Z A;  5KPZ A;  2I7P A;  4AKH A;  4M9Z A;  3GP1 A;  4G4Q A;  2JP7 A;  1IN7 A;  4X65 M;  3HKP A;  5IZ7 D;  1WGN A;  3C9P A;  4FWH A;  3QWL A;  3HU1 A;  3SAV A;  1N33 M;  3U6O A;  4FVM A;  1N75 A;  1IBK M;  3SBJ A;  3R8F A;  2R46 A;  3AOE C;  1ZQ9 A;  4DV5 M;  2DAG A;  2XSZ A;  3K9P A;  1Q3B A;  3CTW B;  2VQE M;  4FCW A;  1OFI A;  3LCV B;  1X37 A;  3U6P A;  2V1U A;  1G8P A;  2H1R A;  4DUY M;  4JI3 M;  3KW6 A;  1NO1 A;  2HWJ A;  1R6B X;  4G6Z A;  4JI6 M;  4F1I A;  3E21 A;  2XLJ A;  3DOA A;  2J7N A;  2K6B A;  3HHX A;  3HY5 A;  4IBC A;  3HHY A;  4CIZ A;  5ITU A;  2XZF A;  1JR3 D;  3DA1 A;  2KNA A;  4LJ4 A;  3SAW A;  3KXE C;  5FTL A;  4A3V B;  3VDP A;  2R4E A;  3C3D A;  2EKK A;  2Y21 A;  3FTC A;  4MGZ E;  1XC8 A;  1WGL A;  2FE8 A;  2XGN A;  5E6J A;  2L09 A;  4XK8 F;  1HR0 M;  2G8L A;  4B3R M;  3IG8 A;  4DR4 M;  5GKN A;  2GQF A;  3KSJ A;  4AW4 A;  5H37 D;  1R7R A;  5A2Q S;  3TWK A;  1PRB A;  5KO3 A;  4LFB M;  4EIW A;  2CHV A;  4MGY E;  4B3S M;  1G3I A;  1ZAE A;  2ZAM A;  3PFI A;  1DO2 A;  5FLX S;  4LF7 M;  2R44 A;  4JYA M;  2QZ4 A;  3GRY A;  2C96 A;  2KHH A;  3SAU A;  2XFS A;  2QSF X;  1SXJ C;  4P17 A;  4XGI A;  4QNR A;  3VLF B;  5C18 A;  1NNJ A;  1E9R A;  1VQ1 A;  1S3S A;  4QHS A;  2XEP A;  3PXG A;  4AG5 A;  2QCU A;  1DGB A;  4Z6Y A;  3U6E A;  2C5R A;  1YE9 A;  2B3T A;  4MB7 A;  3BOS A;  2OQ4 A;  4GH9 A;  3AOG A;  1QVR A;  3J2P B;  1GJT A;  1TDH A;  2Y0T A;  3RGS A;  2ZAN A;  4QHT A;  4CGY B;  4DR2 M;  4L8R C;  4XBO A;  4FCT A;  1MJG M;  1R2Y A;  3KOZ E;  3F92 A;  1IY2 A;  3D8B A;  1E94 E;  3SMP A;  2G3Q A;  2QHO B;  1OAI A;  2FS1 A;  3CGW A;  4JI1 M;  4LF5 M;  4DR7 M;  1GO5 A;  4BB9 A;  2Z4S A;  1EE8 A;  4KO8 A;  3CF0 A;  4JI7 M;  3U61 A;  1YLA A;  2N35 A;  2WZJ A;  3K1J A;  4OVZ A;  2CWB A;  3HZJ A;  1V34 A;  1SG9 A;  5IWA M;  2DAE A;  4IBG A;  2DZO B;  3RGP A;  2X4A A;  2BWE A;  3GPY A;  1MU5 A;  4D82 A;  2QEN A;  1QQW A;  1JR3 A;  1F4I A;  1IY1 A;  3J27 B;  3FUV A;  1L2D A;  4DBG B;  1TDZ A;  1D0M A;  1WR1 B;  3KP0 E;  2RGH A;  5DFL A;  3U61 B;  3VKH A;  1XWI A;  1HQC A;  2L7I A;  4OVZ B;  4HLQ A;  2DAK A;  3AV0 A;  1MN3 A;  2L2D A;  3AJI B;  3CF2 A;  1IXR C;  2FNA A;  1NV8 A;  2HL7 A;  1K82 A;  2KRU A;  1JR3 E;  2JWS A;  3GPU A;  1QDT A;  1SXJ A;  2M5Z A;  3K9O A;  2I7N A;  3LQR A;  2CFO A;  3UK6 A;  4X62 M;  2O01 F;  3E9S A;  1C7Y A;  5JI2 E;  4X64 M;  2BWB A;  1QUT A;  1DV0 A;  2L4F A;  4JXJ A;  2CHG A;  2ZBK B;  3T15 A;  2JY7 A;  1IY0 A;  2YR0 A;  2NQ8 C;  4BLC A;  4LFA M;  1UM8 A;  1TH3 A;  1HJP A;  2KNV A;  2LBC A;  4IJE A;  1Z5C A;  5KQD A;  3I01 M;  4NL4 H;  4DV0 M;  1TGU A;  4B08 A;  1SXJ B;  2KA6 B;  2E5L M;  3PNV A;  4D80 A;  2OPF A;  1SXJ E;  3KOX E;  2R65 A;  5F3W A;  4OU7 A;  1IBM M;  2LWX A;  1GVN A;  3A46 A;  2KZU A;  4ANR A;  4IBJ A;  1PJS A;  1XHB A;  4RF1 A;  3GLF A;  4R7G A;  1XNR M;  3SAS A;  3D8L A;  3KOW E;  2RGO A;  1VDL A;  1KYI A;  1XB2 B;  2UXC M;  3SHG B;  1MX0 A;  4NSO B;  3B74 A;  3HU2 A;  2DXI A;  4IBK A;  2UXD M;  3HGI A;  2FH0 A;  2LVP C;  3LQQ A;  4P16 A;  1PJJ A;  1ZMU A;  2KW0 A;  1VEG A;  2FFJ A;  3IEC A;  2DWL A;  4B3T M;  3I04 M;  4HEO A;  4DUZ M;  4GKK M;  2UU9 M;  1QZE A;  2APL A;  4AQY M;  1LTM A;  3TWM A;  1XXH A;  4D81 A;  3GLF E;  3NBX X;  1K3X A;  1Q3C A;  4MM3 B;  1IFY A;  1OJL A;  3B7N A;  2BNK A;  2Q2E B;  4M9X A;  4LGM A;  4LF9 M;  5ITX A;  2QP9 X;  3PNY A;  4I8O A;  1W5S A;  3HHZ A;  4TUW A;  2C98 A;  5DYI A;  3GLH A;  3AL0 C;  1AUA A;  2CUZ A;  2UUC M;  4I5S A;  5FSW A;  4NSR A;  1VEJ A;  3GPX A;  1IM2 A;  2OOA A;  5EJC A;  1NY5 A;  1NHG C;  4RNA A;  1KFV A;  4CIS A;  1T3T A;  1DGF A;  3HU3 A;  3NBI A;  3LW5 F;  2YFQ A;  4G3O A;  4LF4 M;  1HNX M;  1QZM A;  1XXH E;  2R18 A;  4L16 A;  2WSE F;  3I51 A;  4LJ9 A;  2DAM A;  3TQS A;  4GEW A;  4JI4 M;  4GKJ M;  2J7O A;  3SC3 A;  4REZ A;  4B7G A;  4ITQ A;  2KEB A;  3GLH B;  1RU3 A;  3W0F A;  5ITX E;  3U60 A;  4GHA A;  1IN6 A;  4I81 A;  2LHC A;  3GLH E;  4RF0 A;  1I94 M;  5KPR A;  2DZN B;  4LFC M;  4GRI A;  4OW0 A;  1XMQ M;  1TH2 A;  2XFT A;  1PJT A;  4FWD A;  3SHF A;  4PDI A;  1L2B A;  4IBE A;  3BBZ A;  1LV7 A;  1NJF A;  1OQY A;  3J7B A;  1Z59 A;  1QAM A;  1Z5B A;  3U60 B;  3U6D A;  2XF3 A;  4K0K M;  2KXE A; 
#chains in the Genus database with same CATH homology
 3JR4 A;  1E9S A;  3U6S A;  3THG A;  2UUA M;  1NJG A;  3ZC7 B;  2CHQ A;  7CAT A;  2Y0Q A;  2CEA A;  4W5W A;  4IBB A;  1L1T A;  3FUU A;  3TWL A;  1YUB A;  2HKJ A;  3LMM A;  3UZU A;  3U6L A;  4YY3 M;  5IT9 S;  2CE7 A;  2Z7J A;  4B7H A;  2R45 A;  3FUT A;  3KS4 A;  1JQJ C;  1XMO M;  1IXS B;  3DZD A;  1G4A E;  3M7G A;  3Q8X A;  4LRS A;  4L4U A;  2LXE A;  4KHP M;  4GHL A;  3FD9 A;  2HCB A;  3MK6 A;  2A5Y B;  4LJ7 A;  3TE6 A;  4DR5 M;  2YNM D;  3ZCB B;  2DWZ B;  5IRE B;  1TH4 A;  1N34 M;  3HJ8 A;  3ILK A;  4B7F A;  1C1K A;  2Y20 A;  3GQ3 A;  4PCZ A;  2W82 A;  2G5G X;  4L78 A;  1IN4 A;  4WW0 A;  3A98 B;  4WUR A;  3SFZ A;  3FKE A;  4MGK E;  4LF8 M;  2CV2 A;  1DGG A;  1Z6T A;  3WHK A;  4DV4 M;  5EXX A;  2F5Q A;  1OFH A;  3U5Z A;  2XSZ D;  4MGH A;  3FYC A;  4M0W A;  5DNY A;  4DV3 M;  3T1H M;  4GIT A;  3I4Y A;  2UUB M;  4IBI A;  2C9C A;  5FTN A;  1NY6 A;  4LG2 A;  1IN5 A;  1D2N A;  5EQT A;  4JI8 M;  2XZU A;  3SAR A;  2CV0 A;  1XNQ M;  2EO2 A;  3RE8 A;  5E26 A;  2DHR A;  3U5Z B;  4G4R A;  3QAU A;  2L6O A;  3UMM A;  3J80 S;  1J7K A;  5EP3 A;  3K92 A;  4DV7 M;  3TPZ A;  4JI2 M;  2ERC A;  3K2L A;  4R3D A;  3KS8 A;  2V1C A;  3DFZ A;  3SAT A;  3GPP A;  4LRT A;  5EP2 A;  2R62 A;  1IQP A;  1NVM A;  3T1Y M;  1N32 M;  4CHT B;  2BJW A;  3PVS A;  3GLF B;  4LY6 A;  3K8Z A;  4NOO B;  4NRW A;  8CAT A;  2F5N A;  4JI5 M;  3A45 A;  3HJS A;  3OTO M;  2QBY A;  1PJI A;  4FWG A;  4AZF A;  3UJN A;  1QAQ A;  2X49 A;  2M60 A;  1N36 M;  4QOS A;  3FTE A;  4KOD A;  1ORY B;  3HHW A;  1VDD A;  2P5T A;  4GC9 A;  3GRV A;  4LCB A;  5ITT A;  3FYD A;  2F5O A;  2F5P A;  4IIW A;  3M6A A;  2LNH C;  3FUX A;  3NWL A;  1QAN A;  1FNN A;  1XXH B;  3KVW A;  3A42 A;  3HWS A;  4JI0 M;  2QBY B;  4FW9 A;  4IBF A;  3B9P A;  3UGJ A;  4G4N A;  3VDU A;  3ZH9 B;  4AKI A;  1J5E M;  3R9X B;  3EIH A;  5EP4 A;  2V6Z M;  2DVW B;  2X8A A;  3AFH A;  3RFW A;  3KSX A;  4I4L A;  4LJ8 A;  3VKG A;  5EXT A;  1N77 A;  4LJ6 A;  1N78 A;  2LH0 A;  3EIE A;  3GRU A;  4Z8X A;  3T38 A;  4QOZ C;  5JI3 E;  5ITQ A;  2F4V M;  3L25 A;  2VQF M;  4QNM A;  3FTD A;  3MJ5 A;  3KP1 E;  3U6Q A;  4DR6 M;  2BJV A;  1HNZ M;  1L8Q A;  3L29 A;  5EXS A;  4NXN M;  3J7A S;  2XH9 A;  1E32 A;  4DR1 M;  4AG6 A;  3GQ5 A;  1W5T A;  1NNU C;  1SXJ D;  1GKI A;  3GO8 A;  4MH0 E;  4G4O A;  3GLI A;  4PT5 A;  2D7E A;  1GL7 A;  4LF6 M;  4LGY A;  2R4J A;  2RKO A;  3H4M A;  3HJQ A;  2HHH M;  3SYL A;  3M0E A;  1WXQ A;  4KLN A;  4DV6 M;  1IXZ A;  1HT1 E;  1HT2 E;  2AHM A;  5KPT A;  5C1B A;  3L26 A;  1QAO A;  3GLI B;  3IG5 A;  2DWM A;  2K47 A;  3SYK A;  4LZZ A;  3AOE A;  3U6C A;  3KDS E;  5BPV A;  4OX9 M;  4FD2 A;  2C99 A;  1L2C A;  4DV1 M;  5KQ8 A;  4MGI E;  1HQY E;  4JN6 A;  1R2Z A;  4DR3 M;  1IBL M;  1Q39 A;  5DYG A;  3WHL A;  4ZPX A;  1DGH A;  5LMN M;  4HL4 A;  2ZM6 M;  3C58 A;  2ZAO A;  3GLG A;  4B3M M;  5EP1 A;  1H6U A;  1GL6 A;  1YSY A;  4GMQ A;  1J09 A;  4BBA A;  4II7 A;  1FJG M;  1HNW M;  4AKG A;  4LJA A;  2D7H A;  3JAM S;  3LVV A;  1G41 A;  3L27 A;  1L1Z A;  2YQZ A;  1QYR A;  5EXP A;  5LMU M;  1DGH B;  2D7G A;  3VK7 A;  4LZJ A;  2EA0 A;  2DWN A;  3I4V A;  3GLG B;  3J81 S;  1IN8 A;  1DO0 A;  3GQ4 A;  2UXB M;  3KOY E;  4PD2 A;  4GC5 A;  1I4W A;  3L28 A;  1NHW C;  2CV1 A;  4DV2 M;  3KFU G;  5FTJ A;  3VFD A;  2KZS A;  3CF6 E;  5ITR A;  5FTK A;  4FCV A;  4GIP A;  4PDG A;  1GLN A;  2FOI C;  5BR8 M;  4S12 A;  3JR5 A;  2C9O A;  2EUC A;  1PM5 A;  4LJ5 A;  5FTM A;  1G59 A;  3FTF A;  2Z4R A;  3U6M A;  4AI6 A;  3GRR A;  3E4R A;  4L15 A;  4X66 M;  4IBD A;  4YHH M;  2Z3X A;  3VK8 A;  4NRV A;  2JA2 A;  2VII A;  3MHV C;  3W0L B;  4M0D A;  3LVW A;  1KSF X;  2F5S A;  4NXM M;  4JV5 M;  3FUW A;  5ITY A;  2L7H A;  1K3W A;  2KRK A;  2QPA A;  4IJF A;  2O5R A;  3L2A A;  3AKZ A;  4M9S A;  1Z5A A;  3SMS A;  3TL4 X;  1NSF A;  4AKH A;  5KPZ A;  2I7P A;  4M9Z A;  3GP1 A;  4G4Q A;  1IN7 A;  4X65 M;  3HKP A;  5IZ7 D;  4FWH A;  3QWL A;  3HU1 A;  3SAV A;  1N33 M;  3U6O A;  4FVM A;  1N75 A;  1IBK M;  3SBJ A;  3R8F A;  2R46 A;  3AOE C;  1ZQ9 A;  4DV5 M;  2XSZ A;  1Q3B A;  3CTW B;  2VQE M;  4FCW A;  1OFI A;  1X37 A;  3U6P A;  2V1U A;  1G8P A;  2H1R A;  4DUY M;  4JI3 M;  3KW6 A;  1R6B X;  4G6Z A;  4JI6 M;  2XLJ A;  3DOA A;  2J7N A;  3HHX A;  4IBC A;  2XZF A;  3HHY A;  5ITU A;  1JR3 D;  3DA1 A;  4LJ4 A;  3SAW A;  3KXE C;  5FTL A;  4A3V B;  3VDP A;  2R4E A;  2Y21 A;  4MGZ E;  3FTC A;  1XC8 A;  2FE8 A;  2XGN A;  5E6J A;  2L09 A;  1HR0 M;  2G8L A;  4B3R M;  3IG8 A;  4DR4 M;  5GKN A;  3KSJ A;  4AW4 A;  5H37 D;  1R7R A;  5A2Q S;  3TWK A;  5KO3 A;  4LFB M;  4EIW A;  2CHV A;  4MGY E;  4B3S M;  1G3I A;  1ZAE A;  2ZAM A;  3PFI A;  1DO2 A;  5FLX S;  4LF7 M;  4JYA M;  2QZ4 A;  3GRY A;  2C96 A;  3SAU A;  2XFS A;  1SXJ C;  4XGI A;  4QNR A;  3VLF B;  5C18 A;  1NNJ A;  1E9R A;  4QHS A;  1S3S A;  2XEP A;  3PXG A;  4AG5 A;  2QCU A;  1DGB A;  4Z6Y A;  3U6E A;  2C5R A;  1YE9 A;  4MB7 A;  3BOS A;  2OQ4 A;  4GH9 A;  3AOG A;  1QVR A;  3J2P B;  1TDH A;  2Y0T A;  3RGS A;  2ZAN A;  4QHT A;  4CGY B;  4DR2 M;  4L8R C;  4XBO A;  4FCT A;  1R2Y A;  3KOZ E;  1IY2 A;  3D8B A;  1E94 E;  3SMP A;  4JI1 M;  4DR7 M;  4LF5 M;  4BB9 A;  2Z4S A;  1EE8 A;  4KO8 A;  3CF0 A;  4JI7 M;  3U61 A;  3K1J A;  4OVZ A;  5IWA M;  4IBG A;  2DZO B;  3RGP A;  2X4A A;  3GPY A;  1MU5 A;  4D82 A;  2QEN A;  1QQW A;  1JR3 A;  1IY1 A;  3J27 B;  3FUV A;  1L2D A;  1TDZ A;  3KP0 E;  2RGH A;  3U61 B;  3VKH A;  1XWI A;  1HQC A;  2L7I A;  4OVZ B;  4HLQ A;  3AV0 A;  3AJI B;  3CF2 A;  1IXR C;  2FNA A;  2HL7 A;  1K82 A;  2KRU A;  3GPU A;  1SXJ A;  2M5Z A;  2I7N A;  3LQR A;  2CFO A;  3UK6 A;  4X62 M;  3E9S A;  5JI2 E;  4X64 M;  4JXJ A;  2CHG A;  2ZBK B;  3T15 A;  1IY0 A;  2YR0 A;  2NQ8 C;  4BLC A;  4LFA M;  1UM8 A;  1TH3 A;  5KQD A;  4IJE A;  1Z5C A;  4DV0 M;  4NL4 H;  1TGU A;  4B08 A;  1SXJ B;  2KA6 B;  2E5L M;  3PNV A;  4D80 A;  2OPF A;  1SXJ E;  3KOX E;  2R65 A;  5F3W A;  4OU7 A;  1IBM M;  2LWX A;  1GVN A;  3A46 A;  2KZU A;  4IBJ A;  1XHB A;  4RF1 A;  3GLF A;  4R7G A;  1XNR M;  3SAS A;  3D8L A;  3KOW E;  2RGO A;  1KYI A;  2UXC M;  3SHG B;  1MX0 A;  4NSO B;  3HU2 A;  2DXI A;  2UXD M;  4IBK A;  3HGI A;  3LQQ A;  4P16 A;  1PJJ A;  2KW0 A;  2FFJ A;  4B3T M;  2DWL A;  4DUZ M;  4GKK M;  2UU9 M;  4AQY M;  3TWM A;  1XXH A;  4D81 A;  1K3X A;  1Q3C A;  4MM3 B;  1OJL A;  2BNK A;  2Q2E B;  4M9X A;  4LGM A;  4LF9 M;  5ITX A;  2QP9 X;  3PNY A;  4I8O A;  1W5S A;  3HHZ A;  4TUW A;  2C98 A;  5DYI A;  3GLH A;  3AL0 C;  2CUZ A;  2UUC M;  4I5S A;  5FSW A;  4NSR A;  3GPX A;  1IM2 A;  5EJC A;  1NY5 A;  1NHG C;  4RNA A;  1KFV A;  4CIS A;  1T3T A;  1DGF A;  3HU3 A;  3NBI A;  4LF4 M;  2YFQ A;  1HNX M;  1QZM A;  2R18 A;  4L16 A;  3I51 A;  4LJ9 A;  3TQS A;  4JI4 M;  4GKJ M;  2J7O A;  3SC3 A;  4REZ A;  4B7G A;  4ITQ A;  2KEB A;  3GLH B;  3W0F A;  5ITX E;  3U60 A;  4GHA A;  1IN6 A;  4I81 A;  4RF0 A;  1I94 M;  5KPR A;  2DZN B;  4LFC M;  4GRI A;  4OW0 A;  1XMQ M;  1TH2 A;  2XFT A;  4FWD A;  3SHF A;  4PDI A;  1L2B A;  4IBE A;  1LV7 A;  1NJF A;  3J7B A;  1Z59 A;  1QAM A;  1Z5B A;  3U60 B;  3U6D A;  2XF3 A;  4K0K M;  2KXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...