4JI0M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4ji0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4ji0M02
4B3RM 3T1YM 4DV6M 3OTOM 1XMQM 1TDZA 1L1TA 1IBLM 3JR4A 3SATA 1XNRM 1N33M 1Q3BA 1I94M 4DR2M 4LF4M 3U6PA 4K0KM 5ITYA 2EA0A 3TWMA 2F5OA 4NRVA 1R2ZA 3A42A 4NXNM 2F4VM 3GPUA 1HNXM 3SARA 5ITXE 4LFAM 5BR8M 4JI3M 3TWLA 2F5SA 5ITXA 4X64M 4DV2M 4GKJM 1XC8A 4X66M 2E5LM 4B3MM 3SAVA 3GQ4A 4PDIA 4DV1M 4NXMM 1MX0A 4YY3M 4G4QA 4B3SM 1Q39A 3VK8A 3T1HM 3J80S 5ITRA 4CISA 1Z59A 3U6CA 4G4OA 1HNZM 2UUAM 4LF9M 4LFCM 4PCZA 3U6MA 1Z5AA 4JI6M 3GPYA 1KFVA 1IBMM 3SBJA 4G4NA 1PJIA 1NNJA 4NRWA 3VK7A 1PM5A 3U6LA 1IBKM 4B3TM 2VQFM 5FLXS 2UUCM 4DUYM 4DV4M 2OQ4A 1HNWM 3U6DA 5LMNM 4OX9M 2Q2EB 5IWAM 4ITQA 3DOAA 3A45A 5ITUA 1N36M 5ITTA 4DV7M 1J5EM 4PDGA 4X62M 4JI4M 4LF8M 4AQYM 4DV0M 2XZUA 3J81S 2UXCM 1K3XA 4DR3M 1HR0M 2HHHM 3U6EA 3GP1A 3U6OA 3GPXA 3SASA 5A2QS 2ZM6M 4DR6M 4LFBM 5ITQA 1L1ZA 1XMOM 1Z5BA 2UU9M 4JI5M 4KHPM 4YHHM 4MB7A 1XNQM 4GKKM 4DV3M 1R2YA 3W0FA 1EE8A 3C58A 2UXBM 1K82A 3GQ3A 3GQ5A 2UUBM 1K3WA 1Z5CA 4DR1M 1PJJA 1L2DA 4DR5M 1L2BA 2F5NA 3J7AS 3SAWA 2UXDM 5IT9S 4JI8M 4JV5M 1N32M 1MU5A 4PD2A 2F5QA 1L2CA 2ZBKB 4LF6M 3SAUA 2OPFA 4JI7M 3JR5A 2HKJA 1N34M 4JI1M 4JI0M 3TWKA 5LMUM 1FJGM 4X65M 3U6SA 4LF7M 2XZFA 3JAMS 4DR7M 4DUZM 4DR4M 2VQEM 1Q3CA 4G4RA 4JI2M 4LF5M 3GO8A 4DV5M 3U6QA 1TDHA 2F5PA 3A46A 4JYAM 3GPPA
chains in the Genus database with same CATH superfamily
4MGZE 4JN6A 4KLNA 3L27A 4R71A 2DKLA 3SC3A 3JR4A 2Z8YM 3UMMA 2XF3A 4XK8F 2DI0A 3KXEC 4FCWA 2LXEA 4L8RC 5DYGA 2C98A 2RRUA 2I7PA 2N35A 5IZ7D 2XLJA 4AKHA 3TWMA 4AW4A 1GL6A 2F5OA 4L4UA 1NNUC 1KSFX 1G41A 2ZANA 3SARA 1ORYB 2CFOA 2VDBB 4LFAM 5BR8M 4JI3M 2EKFA 1WR1B 1SG9A 5JI2E 4GEWA 4LG2A 4AG6A 3FE3A 1YUBA 2M5ZA 4DV2M 3LCVB 5GKNA 4IBFA 3VLFB 4X66M 4B7HA 5EQTA 1IXZA 3K8ZA 1MX0A 3VKGA 3VK8A 3DZDA 2K9DA 4G3OA 3T1HM 4LRSA 4CISA 4IBKA 1OIZA 4R7GA 4ZPXA 3ZC7B 4PCZA 3U6MA 3KS8A 2ERCA 1QUSA 3ILKA 2DXIA 4CIZA 2FNAA 2H1RA 3I04M 1KFVA 3AFHA 3KSXA 1IBMM 4OVZB 1G3IA 4MM3B 5EJCA 4IJFA 3GLGB 4G4NA 4HLQA 4IJEA 3GLGE 1IXRC 2KRKA 1NNJA 4NRWA 2QZ4A 7CATA 4OVZA 2NQ8C 1DGGA 2XEPA 3PNVA 1OKSA 3TE6A 3U6LA 1GLNA 1PM5A 1ZQ9A 3W68A 2R46A 4FWHA 3KOXE 5LMNM 1IN4A 1ZMUA 3H4MA 3J2PB 3LVVA 4P17A 5KQ8A 4LJ9A 2VIIA 4I5SA 4DV0M 3FTEA 4M0WA 5KPZA 2UXCM 2GNOA 1K3XA 3K92A 1D0LA 3U6OA 3GPXA 1NVMA 3PVSA 2C5RA 2DNAA 2DWZB 4NSOB 2L4EA 1IY0A 4FCTA 1VQ1A 5F3WA 1OTRA 1R4GA 2C9CA 1D0MA 2CRUA 3TPZA 1T6OA 4RF0A 1BVSA 1Z5BA 2UU9M 2JWSA 1PGYA 4MB7A 3QYEA 4IBIA 3VKHA 3W0FA 3R8FA 1G4AE 3H4JA 3PFIA 1EE8A 3KP1E 1HQYE 4FWDA 1PJTA 3GQ3A 2UUBM 2Z4SA 2R65A 2RGOA 4WURA 3UZUA 1LTMA 3KOYE 1WIVA 4M9ZA 4OU7A 3NBIA 2H5XA 4GIPA 3L2AA 2WSEF 1GO5A 1N32M 5EXXA 4PD2A 1F4IA 4IBCA 3SAUA 5FTJA 2APLA 1NY6A 2ZAOA 2HKJA 4NOOB 3AOEA 5FTMA 4B7FA 1C1KA 3VDPA 5L8RF 2X49A 3RE8A 2JY7A 3W67A 4GH9A 1XB2B 3SYKA 1FNNA 4JI2M 4D81A 4Q7JA 4REZA 2HWJA 2YFQA 2KHHA 3UGJA 4QOZC 3A46A 4F2LA 3L28A 4LGMA 2CEAA 3FUXA 2KNZA 4CJ6A 4B3RM 1OQYA 1PJSA 1GJSA 1AIPC 3E21A 4LY6A 5C1BA 2G8LA 2CHQA 3HU2A 3U61B 3SATA 1N33M 1IQPA 2EKKA 1I94M 2CP8A 2HAKA 3FD9A 3WHLA 4QNRA 4W5WA 3U6PA 4K0KM 3U61A 2LVNC 2MH8A 4KT0F 2UUCM 2RGHA 4GMQA 1R2ZA 4NXNM 2J5YA 1QYRA 1IFYA 3IHPA 1WJ7A 2EUCA 2KEBA 2LVAA 3L29A 2Y0QA 1IM2A 4JXJA 5EP1A 5EXPA 3KOZE 4GRIA 1ZMVA 1A5TA 1OAIA 4GKJM 4B3MM 2QP9X 3SAVA 3GQ4A 2LHGA 3KS4A 1OFIA 2EJSA 1TTEA 4UN2B 1TF0B 5EXSA 3J80S 2CHVA 3W0LB 3U6CA 4LF9M 4LFCM 2B3TA 3HHZA 2JY8A 2DENA 4JI6M 2XSZA 2M60A 2KNAA 2QCUA 4ANRA 4FW9A 1OFHA 2XGNA 1PJIA 4MGKE 3BXWA 4R3DA 2D7GA 4FVMA 3K2LA 3VK7A 2DHRA 2R44A 1VDLA 3HU1A 2FE8A 1DGBA 4DUYM 2DAEA 3HWSA 1IN6A 2OQ4A 4OX9M 1TGUA 1MN3A 2VF8A 3K9OA 3FTDA 2K0BX 2MROB 2D7EA 2R4JA 3GRVA 1XXHB 3KSJA 5BPVA 4PDGA 1SXJD 1XXHE 4PT5A 2JY5A 2Z3XA 1LV7A 1EFUB 2JY6B 3FUWA 1XXHA 1HT2E 3KW6A 3B7QA 2Y20A 3THGA 3F92A 3T15A 2LVPC 3E4RA 1NO1A 1JR3D 4WW0A 3HJQA 1XMOM 2V1CA 4LJ4A 1R6BX 3B9PA 4L78A 2DAGA 4RKUF 4YHHM 1PRBA 1DV0A 1XNQM 1V34A 4MH0E 1WXQA 1Q02A 3SYLA 3T38A 4DV3M 4I81A 3GLGA 1YE9A 3E9SA 3C9PA 1QZEA 1HJPA 3C58A 3AKZA 5FSWA 3AJIB 2MGWA 1Z5CA 1L2DA 2L09A 3L26A 3HY5A 5EXTA 2F5NA 3J7AS 3CF6E 2VF7A 4AZFA 1L2CA 2ZBKB 3GRRA 2LVOC 3FYDA 3SMPA 2OPFA 4JI7M 3JR5A 2YNMD 4S12A 3A98B 1N34M 1D2NA 2QPAA 4JI0M 3SFZA 2JZ1A 3TWKA 1GL7A 2C96A 1IN5A 3PNYA 2BWBA 4HL4A 4GC5A 4DR7M 2YR0A 5C18A 2LHCA 2VQEM 2DWLA 4QOSA 3KVWA 3FTFA 2L2DA 1E32A 2DZOB 2LNHC 2RKOA 4AKIA 1GJTA 2I7NA 3GLHB 2JUJA 2KXEA 2P5TA 3GLHE 2F5PA 4JYAM 3GLHA 1XMQM 4LJ7A 2R18A 5IREB 3FUTA 2CV1A 1L1TA 1IBLM 3M6AA 2CHGA 1XNRM 1J7KA 2L7IA 1N75A 1X37A 1NSFA 2G3QA 1VEJA 2BJVA 3B74A 1C7YA 2Z4RA 4I4LA 8CATA 2X4AA 2EA0A 2HCBA 4NRVA 3A42A 2F4VM 1KYIA 1L8QA 2OOBA 3IG5A 1UFZA 3MK6A 3HHYA 1TH3A 2R6FA 4F1IA 1HNXM 3CF2A 4AI6A 3I01M 4MGYE 3CTWB 2F5SA 2DAKA 2AHMA 3HZJA 5DFLA 1V33A 1G8PA 1TH2A 1CUKA 4FD2A 4X64M 1G71A 3D8LA 2E5LM 2DWNA 4IBBA 4LJ5A 4XBOA 4AG5A 2MJ5B 4G4QA 4B3SM 3SHFA 2LVQD 2R4EA 4IBGA 5E26A 2UUAM 4G4OA 2LBCA 1HNZM 1Z5AA 2Y21A 2Y0TA 1SXJC 5KPTA 3EIHA 1RU3A 2JNHA 4FWGA 1IN7A 3C3DA 2DZNB 2JP7A 2WZJA 2XFSA 1V92A 4GITA 1IY2A 1QAOA 2ZTDA 3KOWE 1MJGM 2O01F 1HNWM 2L7HA 4ITQA 3A45A 1NJGA 5DYIA 4M0DA 5ITTA 4BLCA 1N36M 2KNVA 2FS1A 3Q8GA 5JI3E 4JI4M 4LF8M 3HHWA 3I4VA 1QVRA 3HU3A 4Z6YA 2XZUA 4DR3M 3ZCBB 1HR0M 3L25A 3U6EA 2OO9A 2FH0A 2R45A 4IBJA 2XH9A 4B08A 3FUUA 3HHXA 4WP2A 3ZH9B 4IBEA 5A2QS 2ZM6M 4BB9A 3GLFB 4LFBM 5EP2A 5KPRA 3GLFE 3RFWA 3HKPA 4NL4H 4RF1A 4JI5M 3M7GA 3GLFA 3TQSA 1JQJC 3R9XB 2GQFA 4BBAA 2O5RA 2BWEA 3U60B 4GKKM 3LCUA 1QAMA 1QDTA 2K47A 3GRYA 3HGIA 1JB0F 1QZMA 3HJSA 1R7RA 2CE7A 3U60A 2UXBM 5E6JA 3GQ5A 3NWLA 5KQDA 1K3WA 3MHVC 4DR1M 2FOIC 2BJWA 1PJJA 2DVWB 2W82A 4L16A 4DR5M 1EIJA 4Y28F 2QHOB 4QHSA 4EIWA 2LH0A 4JI8M 4JV5M 1YSYA 3ZQJA 4LCBA 2L4FA 3B7NA 3KP0E 1VEKA 3HX3A 3E46A 2KA6B 2MR9A 1HT1E 5KO3A 4TUWA 1XHBA 4LJ6A 3LVWA 1VDDA 2XZFA 3JAMS 4DUZM 1AUAA 4DR4M 5H37D 1T43A 1GVNA 1Q3CA 4G4RA 2QENA 3FKEA 2OOAA 4LGYA 4CHTB 4L15A 1IN8A 1TH4A 2CWBA 3GO8A 2K6BA 1G59A 1OIPA 2KRUA 2CV2A 3TL4X 4KODA 4MGIE 2BNKA 3EIEA 1E94E 3V76A 1ZV1A 3NBXX 3RGSA 3OTOM 4DV6M 3T1YM 5EP4A 2DZLA 1TDZA 1QAQA 1DO0A 2KDLA 3C3EA 1DGFA 1Q3BA 3IG8A 4FCVA 3SHGB 2LTUA 4DR2M 4LF4M 5EP3A 4L6V6 3GLIB 5ITYA 1NY5A 3GLIE 2QBYB 2QQ8A 3Q8XA 4A3VB 1QQWA 3J7BA 4CGYB 4MGHA 3GLIA 3J27B 5ITXE 1VG5A 3FUVA 4RNAA 1I4WA 4II7A 3TWLA 3VFDA 2QBYA 4GHLA 4DBGB 2D7HA 2L6OA 3BBZA 5FTKA 5ITXA 2JXNA 2QSFX 5FTLA 2WSCF 3U5ZB 2LWXA 1XC8A 3AOGA 1ZMWA 4QNMA 3FRHA 2YQZA 2ZAMA 3B7ZA 4PDIA 1OAOC 4DV1M 4YY3M 3U5ZA 3BOSA 4NXMM 1Q39A 5ITRA 2G5GX 3LW5F 1Z59A 4LZJA 3VDUA 3FYCA 2C99A 2DAMA 1PJQA 3DFZA 4XGIA 3GPYA 1QUTA 1YLAA 1R5LA 4M9XA 2XSZD 3SBJA 1GKIA 3UK6A 1TR8A 1D0KA 1UM8A 1NJFA 3AV0A 3B89A 3LQQA 1QDRA 4IIWA 2J7OA 2WSFF 1IBKM 4B3TM 2R62A 3SMSA 3IECA 5FLXS 2VQFM 1QANA 1SXJB 1WHCA 3QYBA 3MMPA 4OW0A 1SXJE 4M9SA 4B7GA 3M0EA 4DV4M 3U6DA 2Q2EB 3FRIA 5IWAM 3DOAA 1S3SA 1WGNA 2J7NA 1DGHB 5ITUA 2V1UA 1H6UA 1SXJA 2O25A 4P16A 4DV7M 3QAUA 3PXGA 5DNYA 1J5EM 4KO8A 4X62M 4AQYM 1DGHA 2XFTA 3CF0A 4D82A 2R0IA 3J81S 1VEGA 1JR3E 2HHHM 3GP1A 1P3QQ 1T3TA 4LRTA 3K9PA 4NC6A 4Z8XA 3SASA 1W5SA 5FTNA 1JR3A 2DHYA 4I8OA 1N77A 4DR6M 1IXSB 4HEOA 3FTCA 3D8BA 5ITQA 1L1ZA 1NV8A 3K1JA 1ZAEA 1XWIA 1IXSA 3DA1A 4KHPM 4AKGA 1W5TA 4NSRA 1NV9A 1J09A 3KFUG 2JZ0A 3I51A 1R2YA 2KZSA 4LJAA 4D80A 1K82A 4IBDA 1E9SA 3AOEC 3GPUA 2ZTCA 3I4YA 1N78A 1HQCA 2QNJA 3LMMA 1L2BA 3SAWA 2UXDM 3WHKA 3AL0C 4GHAA 5IT9S 1MU5A 4GC9A 2F5QA 1OJLA 1Y8GA 4LF6M 4LJ8A 2CUZA 3T6PA 2V6ZM 4LZZA 3RGPA 3MJ5A 2Z7JA 1E9RA 3KDSE 2CV0A 2JA2A 4JI1M 1GABA 3QWLA 3CGWA 3HJ8A 5LMUM 1FJGM 4X65M 3U6SA 1DO2A 3LQRA 2HL7A 4LF7M 1NHGC 2C9OA 3GRUA 2X8AA 2DAIA 4QHTA 2KW0A 1Z6TA 4G6ZA 1IY1A 3UJNA 1WGLA 2EO2A 2A5YB 4LF5M 4DV5M 3U6QA 1NHWC 1TDHA 2DWMA 2KZUA 3GPPA 2FFJA
chains in the Genus database with same CATH topology
4MGZE 4JN6A 4KLNA 3L27A 3SC3A 3JR4A 3UMMA 2XF3A 3KXEC 4FCWA 2LXEA 4L8RC 5DYGA 2C98A 2I7PA 5IZ7D 2XLJA 4AKHA 3TWMA 4AW4A 1GL6A 2F5OA 4L4UA 1NNUC 1KSFX 1G41A 2ZANA 3SARA 1ORYB 2CFOA 4LFAM 5BR8M 4JI3M 5JI2E 4LG2A 4AG6A 1YUBA 2M5ZA 4DV2M 5GKNA 3VLFB 4IBFA 4X66M 4B7HA 5EQTA 1IXZA 3K8ZA 1MX0A 3VKGA 3VK8A 3DZDA 3T1HM 4LRSA 4CISA 4IBKA 4R7GA 4ZPXA 4PCZA 3ZC7B 3U6MA 3KS8A 2ERCA 3ILKA 2DXIA 2FNAA 2H1RA 1KFVA 3AFHA 3KSXA 1IBMM 4OVZB 1G3IA 4MM3B 5EJCA 4IJFA 3GLGB 4G4NA 4HLQA 4IJEA 1IXRC 2KRKA 1NNJA 4NRWA 2QZ4A 7CATA 4OVZA 2NQ8C 1DGGA 2XEPA 3PNVA 3TE6A 1PM5A 3U6LA 1GLNA 1ZQ9A 2R46A 4FWHA 3KOXE 5LMNM 1IN4A 3J2PB 3H4MA 3LVVA 5KQ8A 4LJ9A 2VIIA 4I5SA 4DV0M 3FTEA 4M0WA 5KPZA 2UXCM 1K3XA 3K92A 3U6OA 3GPXA 1NVMA 3PVSA 2C5RA 2DWZB 4NSOB 1IY0A 4FCTA 5F3WA 2C9CA 3TPZA 4RF0A 1Z5BA 2UU9M 4MB7A 4IBIA 3VKHA 3W0FA 3R8FA 1G4AE 3PFIA 1EE8A 3KP1E 1HQYE 4FWDA 3GQ3A 2UUBM 2Z4SA 2R65A 2RGOA 4WURA 3UZUA 3KOYE 4M9ZA 4OU7A 3NBIA 4GIPA 3L2AA 1N32M 5EXXA 4PD2A 4IBCA 3SAUA 5FTJA 1NY6A 2ZAOA 2HKJA 4NOOB 3AOEA 5FTMA 4B7FA 1C1KA 3VDPA 2X49A 3RE8A 4GH9A 3SYKA 1FNNA 4JI2M 4D81A 4REZA 2YFQA 3UGJA 4QOZC 3A46A 3L28A 4LGMA 2CEAA 3FUXA 4B3RM 4LY6A 5C1BA 2G8LA 2CHQA 3HU2A 3U61B 3SATA 1N33M 1IQPA 1I94M 3FD9A 3WHLA 4QNRA 4W5WA 3U6PA 4K0KM 3U61A 2RGHA 4GMQA 1R2ZA 4NXNM 1QYRA 2EUCA 2KEBA 3L29A 2Y0QA 1IM2A 4JXJA 5EP1A 5EXPA 3KOZE 4GRIA 4GKJM 4B3MM 2QP9X 3SAVA 3GQ4A 3KS4A 1OFIA 5EXSA 3J80S 2CHVA 3W0LB 3U6CA 4LF9M 4LFCM 3HHZA 4JI6M 2XSZA 2M60A 2QCUA 4FW9A 1OFHA 2XGNA 1PJIA 4MGKE 4R3DA 2D7GA 4FVMA 3K2LA 3VK7A 2DHRA 3HU1A 2FE8A 1DGBA 4DUYM 2OQ4A 3HWSA 1IN6A 4OX9M 1TGUA 3FTDA 2R4JA 2D7EA 3GRVA 3KSJA 1XXHB 5BPVA 4PDGA 1SXJD 4PT5A 2Z3XA 1LV7A 3FUWA 1XXHA 1HT2E 3KW6A 2Y20A 3THGA 3T15A 3E4RA 1JR3D 4WW0A 3HJQA 1XMOM 2V1CA 4LJ4A 1R6BX 3B9PA 4L78A 4YHHM 1XNQM 4MH0E 1WXQA 4DV3M 3SYLA 3T38A 4I81A 3GLGA 1YE9A 3E9SA 3C58A 3AKZA 5FSWA 3AJIB 1Z5CA 1L2DA 2L09A 3L26A 5EXTA 2F5NA 3J7AS 3CF6E 4AZFA 1L2CA 2ZBKB 3GRRA 3FYDA 3SMPA 2OPFA 4JI7M 3JR5A 2YNMD 4S12A 3A98B 1N34M 1D2NA 2QPAA 4JI0M 3SFZA 3TWKA 1GL7A 2C96A 1IN5A 3PNYA 4HL4A 4GC5A 4DR7M 2YR0A 5C18A 2VQEM 2DWLA 4QOSA 3KVWA 3FTFA 1E32A 2DZOB 2LNHC 2RKOA 4AKIA 2I7NA 3GLHB 2KXEA 2P5TA 2F5PA 4JYAM 3GLHA 1XMQM 4LJ7A 2R18A 5IREB 3FUTA 2CV1A 1L1TA 1IBLM 3M6AA 2CHGA 1XNRM 1J7KA 2L7IA 1N75A 1X37A 1NSFA 2BJVA 2Z4RA 4I4LA 8CATA 2X4AA 2EA0A 2HCBA 4NRVA 3A42A 2F4VM 1KYIA 1L8QA 3GPUA 3IG5A 1HNXM 3MK6A 3HHYA 1TH3A 3CF2A 4AI6A 4MGYE 3CTWB 2F5SA 2AHMA 1G8PA 1TH2A 4X64M 4FD2A 3D8LA 2E5LM 2DWNA 4IBBA 4LJ5A 4XBOA 4AG5A 4G4QA 4B3SM 3SHFA 2R4EA 4IBGA 5E26A 2UUAM 4G4OA 1HNZM 1Z5AA 2Y21A 2Y0TA 1SXJC 5KPTA 3EIHA 4FWGA 1IN7A 2DZNB 2XFSA 4GITA 1IY2A 1QAOA 3KOWE 1HNWM 2L7HA 4ITQA 3A45A 1NJGA 5DYIA 4M0DA 5ITTA 4BLCA 1N36M 5JI3E 4JI4M 4LF8M 3HHWA 3I4VA 1QVRA 3HU3A 4Z6YA 2XZUA 4DR3M 3ZCBB 1HR0M 3L25A 3U6EA 2R45A 4IBJA 2XH9A 4B08A 3FUUA 3HHXA 5A2QS 3ZH9B 4IBEA 2ZM6M 4BB9A 3GLFB 4LFBM 5EP2A 5KPRA 3RFWA 3HKPA 4NL4H 4RF1A 4JI5M 3M7GA 3GLFA 3TQSA 1JQJC 3R9XB 4BBAA 2O5RA 3U60B 4GKKM 1QAMA 2K47A 3GRYA 3HGIA 1QZMA 3HJSA 1R7RA 2CE7A 3U60A 2UXBM 5E6JA 3GQ5A 3NWLA 5KQDA 1K3WA 3MHVC 4DR1M 2FOIC 2BJWA 1PJJA 2DVWB 2W82A 4L16A 4DR5M 4QHSA 4EIWA 2LH0A 4JI8M 4JV5M 1YSYA 4LCBA 3KP0E 2KA6B 1HT1E 5KO3A 4TUWA 1XHBA 4LJ6A 3LVWA 1VDDA 2XZFA 3JAMS 4DUZM 4DR4M 5H37D 1GVNA 1Q3CA 4G4RA 2QENA 3FKEA 4CHTB 4LGYA 4L15A 1IN8A 1TH4A 3GO8A 1G59A 2KRUA 2CV2A 3TL4X 4KODA 4MGIE 2BNKA 3EIEA 1E94E 3RGSA 4DV6M 3OTOM 3T1YM 5EP4A 1TDZA 1QAQA 1DO0A 1DGFA 1Q3BA 3IG8A 4FCVA 3SHGB 4DR2M 4LF4M 5EP3A 3GLIB 5ITYA 1NY5A 2QBYB 3Q8XA 4A3VB 1QQWA 3J7BA 4CGYB 4MGHA 3GLIA 3J27B 5ITXE 2QBYA 3FUVA 4RNAA 1I4WA 4II7A 3TWLA 3VFDA 4GHLA 2D7HA 2L6OA 5ITXA 5FTKA 5FTLA 3U5ZB 2LWXA 1XC8A 3AOGA 4QNMA 2YQZA 2ZAMA 4PDIA 4DV1M 4NXMM 4YY3M 3U5ZA 3BOSA 1Q39A 5ITRA 2G5GX 1Z59A 4LZJA 3VDUA 3FYCA 2C99A 3DFZA 4XGIA 3GPYA 4M9XA 2XSZD 3SBJA 1GKIA 3UK6A 1UM8A 1NJFA 3AV0A 3LQQA 4IIWA 2J7OA 1IBKM 4B3TM 2R62A 3SMSA 5FLXS 2VQFM 2UUCM 1QANA 1SXJB 4OW0A 4B7GA 4DV4M 1SXJE 4M9SA 3U6DA 3M0EA 2Q2EB 5IWAM 3DOAA 1S3SA 2J7NA 1DGHB 5ITUA 2V1UA 1H6UA 1SXJA 4P16A 4DV7M 3QAUA 3PXGA 5DNYA 1J5EM 4KO8A 4X62M 4AQYM 1DGHA 2XFTA 3CF0A 4D82A 3J81S 2HHHM 3GP1A 1T3TA 4LRTA 4Z8XA 3SASA 1W5SA 5FTNA 1JR3A 4I8OA 1N77A 4DR6M 1IXSB 3FTCA 3D8BA 5ITQA 1L1ZA 3K1JA 1ZAEA 1XWIA 4KHPM 3DA1A 4AKGA 1W5TA 4NSRA 1J09A 3KFUG 3I51A 1R2YA 2KZSA 4LJAA 4D80A 1K82A 4IBDA 1E9SA 3AOEC 1N78A 3I4YA 1HQCA 3LMMA 1L2BA 3SAWA 2UXDM 3WHKA 3AL0C 4GHAA 5IT9S 1MU5A 4GC9A 2F5QA 1OJLA 4LF6M 4LJ8A 2CUZA 2V6ZM 4LZZA 3RGPA 3MJ5A 2Z7JA 1E9RA 3KDSE 2CV0A 2JA2A 4JI1M 3QWLA 5LMUM 3HJ8A 1FJGM 4X65M 3U6SA 1DO2A 3LQRA 2HL7A 4LF7M 1NHGC 2C9OA 3GRUA 2X8AA 4QHTA 2KW0A 1Z6TA 4G6ZA 1IY1A 3UJNA 2EO2A 2A5YB 4LF5M 4DV5M 3U6QA 1NHWC 1TDHA 2DWMA 2KZUA 3GPPA 2FFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R M;  3T1Y M;  4DV6 M;  3OTO M;  1XMQ M;  1TDZ A;  1L1T A;  1IBL M;  3JR4 A;  3SAT A;  1XNR M;  1N33 M;  1Q3B A;  1I94 M;  4DR2 M;  4LF4 M;  3U6P A;  4K0K M;  5ITY A;  2EA0 A;  3TWM A;  2F5O A;  4NRV A;  1R2Z A;  3A42 A;  4NXN M;  2F4V M;  3GPU A;  1HNX M;  3SAR A;  5ITX E;  4LFA M;  5BR8 M;  4JI3 M;  3TWL A;  2F5S A;  5ITX A;  4X64 M;  4DV2 M;  4GKJ M;  1XC8 A;  4X66 M;  2E5L M;  4B3M M;  3SAV A;  3GQ4 A;  4PDI A;  4DV1 M;  4NXM M;  1MX0 A;  4YY3 M;  4G4Q A;  4B3S M;  1Q39 A;  3VK8 A;  3T1H M;  3J80 S;  5ITR A;  4CIS A;  1Z59 A;  3U6C A;  4G4O A;  1HNZ M;  2UUA M;  4LF9 M;  4LFC M;  4PCZ A;  3U6M A;  1Z5A A;  4JI6 M;  3GPY A;  1KFV A;  1IBM M;  3SBJ A;  4G4N A;  1PJI A;  1NNJ A;  4NRW A;  3VK7 A;  1PM5 A;  3U6L A;  1IBK M;  4B3T M;  2VQF M;  5FLX S;  2UUC M;  4DUY M;  4DV4 M;  2OQ4 A;  1HNW M;  3U6D A;  5LMN M;  4OX9 M;  2Q2E B;  5IWA M;  4ITQ A;  3DOA A;  3A45 A;  5ITU A;  1N36 M;  5ITT A;  4DV7 M;  1J5E M;  4PDG A;  4X62 M;  4JI4 M;  4LF8 M;  4AQY M;  4DV0 M;  2XZU A;  3J81 S;  2UXC M;  1K3X A;  4DR3 M;  1HR0 M;  2HHH M;  3U6E A;  3GP1 A;  3U6O A;  3GPX A;  3SAS A;  5A2Q S;  2ZM6 M;  4DR6 M;  4LFB M;  5ITQ A;  1L1Z A;  1XMO M;  1Z5B A;  2UU9 M;  4JI5 M;  4KHP M;  4YHH M;  4MB7 A;  1XNQ M;  4GKK M;  4DV3 M;  1R2Y A;  3W0F A;  1EE8 A;  3C58 A;  2UXB M;  1K82 A;  3GQ3 A;  3GQ5 A;  2UUB M;  1K3W A;  1Z5C A;  4DR1 M;  1PJJ A;  1L2D A;  4DR5 M;  1L2B A;  2F5N A;  3J7A S;  3SAW A;  2UXD M;  5IT9 S;  4JI8 M;  4JV5 M;  1N32 M;  1MU5 A;  4PD2 A;  2F5Q A;  1L2C A;  2ZBK B;  4LF6 M;  3SAU A;  2OPF A;  4JI7 M;  3JR5 A;  2HKJ A;  1N34 M;  4JI1 M;  4JI0 M;  3TWK A;  5LMU M;  1FJG M;  4X65 M;  3U6S A;  4LF7 M;  2XZF A;  3JAM S;  4DR7 M;  4DUZ M;  4DR4 M;  2VQE M;  1Q3C A;  4G4R A;  4JI2 M;  4LF5 M;  3GO8 A;  4DV5 M;  3U6Q A;  1TDH A;  2F5P A;  3A46 A;  4JYA M;  3GPP A; 
#chains in the Genus database with same CATH topology
 4MGZ E;  4JN6 A;  4KLN A;  3L27 A;  4R71 A;  2DKL A;  3SC3 A;  3JR4 A;  2Z8Y M;  3UMM A;  2XF3 A;  4XK8 F;  2DI0 A;  3KXE C;  4FCW A;  2LXE A;  4L8R C;  5DYG A;  2C98 A;  2RRU A;  2I7P A;  2N35 A;  5IZ7 D;  2XLJ A;  4AKH A;  3TWM A;  4AW4 A;  1GL6 A;  2F5O A;  4L4U A;  1NNU C;  1KSF X;  1G41 A;  2ZAN A;  3SAR A;  1ORY B;  2CFO A;  2VDB B;  4LFA M;  5BR8 M;  4JI3 M;  2EKF A;  1WR1 B;  1SG9 A;  5JI2 E;  4GEW A;  4LG2 A;  4AG6 A;  3FE3 A;  1YUB A;  2M5Z A;  4DV2 M;  3LCV B;  5GKN A;  4IBF A;  3VLF B;  4X66 M;  4B7H A;  5EQT A;  1IXZ A;  3K8Z A;  1MX0 A;  3VKG A;  3VK8 A;  3DZD A;  2K9D A;  4G3O A;  3T1H M;  4LRS A;  4CIS A;  4IBK A;  1OIZ A;  4R7G A;  4ZPX A;  3ZC7 B;  4PCZ A;  3U6M A;  3KS8 A;  2ERC A;  1QUS A;  3ILK A;  2DXI A;  4CIZ A;  2FNA A;  2H1R A;  3I04 M;  1KFV A;  3AFH A;  3KSX A;  1IBM M;  4OVZ B;  1G3I A;  4MM3 B;  5EJC A;  4IJF A;  3GLG B;  4G4N A;  4HLQ A;  4IJE A;  3GLG E;  1IXR C;  2KRK A;  1NNJ A;  4NRW A;  2QZ4 A;  7CAT A;  4OVZ A;  2NQ8 C;  1DGG A;  2XEP A;  3PNV A;  1OKS A;  3TE6 A;  3U6L A;  1GLN A;  1PM5 A;  1ZQ9 A;  3W68 A;  2R46 A;  4FWH A;  3KOX E;  5LMN M;  1IN4 A;  1ZMU A;  3H4M A;  3J2P B;  3LVV A;  4P17 A;  5KQ8 A;  4LJ9 A;  2VII A;  4I5S A;  4DV0 M;  3FTE A;  4M0W A;  5KPZ A;  2UXC M;  2GNO A;  1K3X A;  3K92 A;  1D0L A;  3U6O A;  3GPX A;  1NVM A;  3PVS A;  2C5R A;  2DNA A;  2DWZ B;  4NSO B;  2L4E A;  1IY0 A;  4FCT A;  1VQ1 A;  5F3W A;  1OTR A;  1R4G A;  2C9C A;  1D0M A;  2CRU A;  3TPZ A;  1T6O A;  4RF0 A;  1BVS A;  1Z5B A;  2UU9 M;  2JWS A;  1PGY A;  4MB7 A;  3QYE A;  4IBI A;  3VKH A;  3W0F A;  3R8F A;  1G4A E;  3H4J A;  3PFI A;  1EE8 A;  3KP1 E;  1HQY E;  4FWD A;  1PJT A;  3GQ3 A;  2UUB M;  2Z4S A;  2R65 A;  2RGO A;  4WUR A;  3UZU A;  1LTM A;  3KOY E;  1WIV A;  4M9Z A;  4OU7 A;  3NBI A;  2H5X A;  4GIP A;  3L2A A;  2WSE F;  1GO5 A;  1N32 M;  5EXX A;  4PD2 A;  1F4I A;  4IBC A;  3SAU A;  5FTJ A;  2APL A;  1NY6 A;  2ZAO A;  2HKJ A;  4NOO B;  3AOE A;  5FTM A;  4B7F A;  1C1K A;  3VDP A;  5L8R F;  2X49 A;  3RE8 A;  2JY7 A;  3W67 A;  4GH9 A;  1XB2 B;  3SYK A;  1FNN A;  4JI2 M;  4D81 A;  4Q7J A;  4REZ A;  2HWJ A;  2YFQ A;  2KHH A;  3UGJ A;  4QOZ C;  3A46 A;  4F2L A;  3L28 A;  4LGM A;  2CEA A;  3FUX A;  2KNZ A;  4CJ6 A;  4B3R M;  1OQY A;  1PJS A;  1GJS A;  1AIP C;  3E21 A;  4LY6 A;  5C1B A;  2G8L A;  2CHQ A;  3HU2 A;  3U61 B;  3SAT A;  1N33 M;  1IQP A;  2EKK A;  1I94 M;  2CP8 A;  2HAK A;  3FD9 A;  3WHL A;  4QNR A;  4W5W A;  3U6P A;  4K0K M;  3U61 A;  2LVN C;  2MH8 A;  4KT0 F;  2UUC M;  2RGH A;  4GMQ A;  1R2Z A;  4NXN M;  2J5Y A;  1QYR A;  1IFY A;  3IHP A;  1WJ7 A;  2EUC A;  2KEB A;  2LVA A;  3L29 A;  2Y0Q A;  1IM2 A;  4JXJ A;  5EP1 A;  5EXP A;  3KOZ E;  4GRI A;  1ZMV A;  1A5T A;  1OAI A;  4GKJ M;  4B3M M;  2QP9 X;  3SAV A;  3GQ4 A;  2LHG A;  3KS4 A;  1OFI A;  2EJS A;  1TTE A;  4UN2 B;  1TF0 B;  5EXS A;  3J80 S;  2CHV A;  3W0L B;  3U6C A;  4LF9 M;  4LFC M;  2B3T A;  3HHZ A;  2JY8 A;  2DEN A;  4JI6 M;  2XSZ A;  2M60 A;  2KNA A;  2QCU A;  4ANR A;  4FW9 A;  1OFH A;  2XGN A;  1PJI A;  4MGK E;  3BXW A;  4R3D A;  2D7G A;  4FVM A;  3K2L A;  3VK7 A;  2DHR A;  2R44 A;  1VDL A;  3HU1 A;  2FE8 A;  1DGB A;  4DUY M;  2DAE A;  3HWS A;  1IN6 A;  2OQ4 A;  4OX9 M;  1TGU A;  1MN3 A;  2VF8 A;  3K9O A;  3FTD A;  2K0B X;  2MRO B;  2D7E A;  2R4J A;  3GRV A;  1XXH B;  3KSJ A;  5BPV A;  4PDG A;  1SXJ D;  1XXH E;  4PT5 A;  2JY5 A;  2Z3X A;  1LV7 A;  1EFU B;  2JY6 B;  3FUW A;  1XXH A;  1HT2 E;  3KW6 A;  3B7Q A;  2Y20 A;  3THG A;  3F92 A;  3T15 A;  2LVP C;  3E4R A;  1NO1 A;  1JR3 D;  4WW0 A;  3HJQ A;  1XMO M;  2V1C A;  4LJ4 A;  1R6B X;  3B9P A;  4L78 A;  2DAG A;  4RKU F;  4YHH M;  1PRB A;  1DV0 A;  1XNQ M;  1V34 A;  4MH0 E;  1WXQ A;  1Q02 A;  3SYL A;  3T38 A;  4DV3 M;  4I81 A;  3GLG A;  1YE9 A;  3E9S A;  3C9P A;  1QZE A;  1HJP A;  3C58 A;  3AKZ A;  5FSW A;  3AJI B;  2MGW A;  1Z5C A;  1L2D A;  2L09 A;  3L26 A;  3HY5 A;  5EXT A;  2F5N A;  3J7A S;  3CF6 E;  2VF7 A;  4AZF A;  1L2C A;  2ZBK B;  3GRR A;  2LVO C;  3FYD A;  3SMP A;  2OPF A;  4JI7 M;  3JR5 A;  2YNM D;  4S12 A;  3A98 B;  1N34 M;  1D2N A;  2QPA A;  4JI0 M;  3SFZ A;  2JZ1 A;  3TWK A;  1GL7 A;  2C96 A;  1IN5 A;  3PNY A;  2BWB A;  4HL4 A;  4GC5 A;  4DR7 M;  2YR0 A;  5C18 A;  2LHC A;  2VQE M;  2DWL A;  4QOS A;  3KVW A;  3FTF A;  2L2D A;  1E32 A;  2DZO B;  2LNH C;  2RKO A;  4AKI A;  1GJT A;  2I7N A;  3GLH B;  2JUJ A;  2KXE A;  2P5T A;  3GLH E;  2F5P A;  4JYA M;  3GLH A;  1XMQ M;  4LJ7 A;  2R18 A;  5IRE B;  3FUT A;  2CV1 A;  1L1T A;  1IBL M;  3M6A A;  2CHG A;  1XNR M;  1J7K A;  2L7I A;  1N75 A;  1X37 A;  1NSF A;  2G3Q A;  1VEJ A;  2BJV A;  3B74 A;  1C7Y A;  2Z4R A;  4I4L A;  8CAT A;  2X4A A;  2EA0 A;  2HCB A;  4NRV A;  3A42 A;  2F4V M;  1KYI A;  1L8Q A;  2OOB A;  3IG5 A;  1UFZ A;  3MK6 A;  3HHY A;  1TH3 A;  2R6F A;  4F1I A;  1HNX M;  3CF2 A;  4AI6 A;  3I01 M;  4MGY E;  3CTW B;  2F5S A;  2DAK A;  2AHM A;  3HZJ A;  5DFL A;  1V33 A;  1G8P A;  1TH2 A;  1CUK A;  4FD2 A;  4X64 M;  1G71 A;  3D8L A;  2E5L M;  2DWN A;  4IBB A;  4LJ5 A;  4XBO A;  4AG5 A;  2MJ5 B;  4G4Q A;  4B3S M;  3SHF A;  2LVQ D;  2R4E A;  4IBG A;  5E26 A;  2UUA M;  4G4O A;  2LBC A;  1HNZ M;  1Z5A A;  2Y21 A;  2Y0T A;  1SXJ C;  5KPT A;  3EIH A;  1RU3 A;  2JNH A;  4FWG A;  1IN7 A;  3C3D A;  2DZN B;  2JP7 A;  2WZJ A;  2XFS A;  1V92 A;  4GIT A;  1IY2 A;  1QAO A;  2ZTD A;  3KOW E;  1MJG M;  2O01 F;  1HNW M;  2L7H A;  4ITQ A;  3A45 A;  1NJG A;  5DYI A;  4M0D A;  5ITT A;  4BLC A;  1N36 M;  2KNV A;  2FS1 A;  3Q8G A;  5JI3 E;  4JI4 M;  4LF8 M;  3HHW A;  3I4V A;  1QVR A;  3HU3 A;  4Z6Y A;  2XZU A;  4DR3 M;  3ZCB B;  1HR0 M;  3L25 A;  3U6E A;  2OO9 A;  2FH0 A;  2R45 A;  4IBJ A;  2XH9 A;  4B08 A;  3FUU A;  3HHX A;  4WP2 A;  3ZH9 B;  4IBE A;  5A2Q S;  2ZM6 M;  4BB9 A;  3GLF B;  4LFB M;  5EP2 A;  5KPR A;  3GLF E;  3RFW A;  3HKP A;  4NL4 H;  4RF1 A;  4JI5 M;  3M7G A;  3GLF A;  3TQS A;  1JQJ C;  3R9X B;  2GQF A;  4BBA A;  2O5R A;  2BWE A;  3U60 B;  4GKK M;  3LCU A;  1QAM A;  1QDT A;  2K47 A;  3GRY A;  3HGI A;  1JB0 F;  1QZM A;  3HJS A;  1R7R A;  2CE7 A;  3U60 A;  2UXB M;  5E6J A;  3GQ5 A;  3NWL A;  5KQD A;  1K3W A;  3MHV C;  4DR1 M;  2FOI C;  2BJW A;  1PJJ A;  2DVW B;  2W82 A;  4L16 A;  4DR5 M;  1EIJ A;  4Y28 F;  2QHO B;  4QHS A;  4EIW A;  2LH0 A;  4JI8 M;  4JV5 M;  1YSY A;  3ZQJ A;  4LCB A;  2L4F A;  3B7N A;  3KP0 E;  1VEK A;  3HX3 A;  3E46 A;  2KA6 B;  2MR9 A;  1HT1 E;  5KO3 A;  4TUW A;  1XHB A;  4LJ6 A;  3LVW A;  1VDD A;  2XZF A;  3JAM S;  4DUZ M;  1AUA A;  4DR4 M;  5H37 D;  1T43 A;  1GVN A;  1Q3C A;  4G4R A;  2QEN A;  3FKE A;  2OOA A;  4LGY A;  4CHT B;  4L15 A;  1IN8 A;  1TH4 A;  2CWB A;  3GO8 A;  2K6B A;  1G59 A;  1OIP A;  2KRU A;  2CV2 A;  3TL4 X;  4KOD A;  4MGI E;  2BNK A;  3EIE A;  1E94 E;  3V76 A;  1ZV1 A;  3NBX X;  3RGS A;  3OTO M;  4DV6 M;  3T1Y M;  5EP4 A;  2DZL A;  1TDZ A;  1QAQ A;  1DO0 A;  2KDL A;  3C3E A;  1DGF A;  1Q3B A;  3IG8 A;  4FCV A;  3SHG B;  2LTU A;  4DR2 M;  4LF4 M;  5EP3 A;  4L6V 6;  3GLI B;  5ITY A;  1NY5 A;  3GLI E;  2QBY B;  2QQ8 A;  3Q8X A;  4A3V B;  1QQW A;  3J7B A;  4CGY B;  4MGH A;  3GLI A;  3J27 B;  5ITX E;  1VG5 A;  3FUV A;  4RNA A;  1I4W A;  4II7 A;  3TWL A;  3VFD A;  2QBY A;  4GHL A;  4DBG B;  2D7H A;  2L6O A;  3BBZ A;  5FTK A;  5ITX A;  2JXN A;  2QSF X;  5FTL A;  2WSC F;  3U5Z B;  2LWX A;  1XC8 A;  3AOG A;  1ZMW A;  4QNM A;  3FRH A;  2YQZ A;  2ZAM A;  3B7Z A;  4PDI A;  1OAO C;  4DV1 M;  4YY3 M;  3U5Z A;  3BOS A;  4NXM M;  1Q39 A;  5ITR A;  2G5G X;  3LW5 F;  1Z59 A;  4LZJ A;  3VDU A;  3FYC A;  2C99 A;  2DAM A;  1PJQ A;  3DFZ A;  4XGI A;  3GPY A;  1QUT A;  1YLA A;  1R5L A;  4M9X A;  2XSZ D;  3SBJ A;  1GKI A;  3UK6 A;  1TR8 A;  1D0K A;  1UM8 A;  1NJF A;  3AV0 A;  3B89 A;  3LQQ A;  1QDR A;  4IIW A;  2J7O A;  2WSF F;  1IBK M;  4B3T M;  2R62 A;  3SMS A;  3IEC A;  5FLX S;  2VQF M;  1QAN A;  1SXJ B;  1WHC A;  3QYB A;  3MMP A;  4OW0 A;  1SXJ E;  4M9S A;  4B7G A;  3M0E A;  4DV4 M;  3U6D A;  2Q2E B;  3FRI A;  5IWA M;  3DOA A;  1S3S A;  1WGN A;  2J7N A;  1DGH B;  5ITU A;  2V1U A;  1H6U A;  1SXJ A;  2O25 A;  4P16 A;  4DV7 M;  3QAU A;  3PXG A;  5DNY A;  1J5E M;  4KO8 A;  4X62 M;  4AQY M;  1DGH A;  2XFT A;  3CF0 A;  4D82 A;  2R0I A;  3J81 S;  1VEG A;  1JR3 E;  2HHH M;  3GP1 A;  1P3Q Q;  1T3T A;  4LRT A;  3K9P A;  4NC6 A;  4Z8X A;  3SAS A;  1W5S A;  5FTN A;  1JR3 A;  2DHY A;  4I8O A;  1N77 A;  4DR6 M;  1IXS B;  4HEO A;  3FTC A;  3D8B A;  5ITQ A;  1L1Z A;  1NV8 A;  3K1J A;  1ZAE A;  1XWI A;  1IXS A;  3DA1 A;  4KHP M;  4AKG A;  1W5T A;  4NSR A;  1NV9 A;  1J09 A;  3KFU G;  2JZ0 A;  3I51 A;  1R2Y A;  2KZS A;  4LJA A;  4D80 A;  1K82 A;  4IBD A;  1E9S A;  3AOE C;  3GPU A;  2ZTC A;  3I4Y A;  1N78 A;  1HQC A;  2QNJ A;  3LMM A;  1L2B A;  3SAW A;  2UXD M;  3WHK A;  3AL0 C;  4GHA A;  5IT9 S;  1MU5 A;  4GC9 A;  2F5Q A;  1OJL A;  1Y8G A;  4LF6 M;  4LJ8 A;  2CUZ A;  3T6P A;  2V6Z M;  4LZZ A;  3RGP A;  3MJ5 A;  2Z7J A;  1E9R A;  3KDS E;  2CV0 A;  2JA2 A;  4JI1 M;  1GAB A;  3QWL A;  3CGW A;  3HJ8 A;  5LMU M;  1FJG M;  4X65 M;  3U6S A;  1DO2 A;  3LQR A;  2HL7 A;  4LF7 M;  1NHG C;  2C9O A;  3GRU A;  2X8A A;  2DAI A;  4QHT A;  2KW0 A;  1Z6T A;  4G6Z A;  1IY1 A;  3UJN A;  1WGL A;  2EO2 A;  2A5Y B;  4LF5 M;  4DV5 M;  3U6Q A;  1NHW C;  1TDH A;  2DWM A;  2KZU A;  3GPP A;  2FFJ A; 
#chains in the Genus database with same CATH homology
 4MGZ E;  4JN6 A;  4KLN A;  3L27 A;  3SC3 A;  3JR4 A;  3UMM A;  2XF3 A;  3KXE C;  4FCW A;  2LXE A;  4L8R C;  5DYG A;  2C98 A;  2I7P A;  5IZ7 D;  2XLJ A;  4AKH A;  3TWM A;  4AW4 A;  1GL6 A;  2F5O A;  4L4U A;  1NNU C;  1KSF X;  1G41 A;  2ZAN A;  3SAR A;  1ORY B;  2CFO A;  4LFA M;  5BR8 M;  4JI3 M;  5JI2 E;  4LG2 A;  4AG6 A;  1YUB A;  2M5Z A;  4DV2 M;  5GKN A;  3VLF B;  4IBF A;  4X66 M;  4B7H A;  5EQT A;  1IXZ A;  3K8Z A;  1MX0 A;  3VKG A;  3VK8 A;  3DZD A;  3T1H M;  4LRS A;  4CIS A;  4IBK A;  4R7G A;  4ZPX A;  4PCZ A;  3ZC7 B;  3U6M A;  3KS8 A;  2ERC A;  3ILK A;  2DXI A;  2FNA A;  2H1R A;  1KFV A;  3AFH A;  3KSX A;  1IBM M;  4OVZ B;  1G3I A;  4MM3 B;  5EJC A;  4IJF A;  3GLG B;  4G4N A;  4HLQ A;  4IJE A;  1IXR C;  2KRK A;  1NNJ A;  4NRW A;  2QZ4 A;  7CAT A;  4OVZ A;  2NQ8 C;  1DGG A;  2XEP A;  3PNV A;  3TE6 A;  1PM5 A;  3U6L A;  1GLN A;  1ZQ9 A;  2R46 A;  4FWH A;  3KOX E;  5LMN M;  1IN4 A;  3J2P B;  3H4M A;  3LVV A;  5KQ8 A;  4LJ9 A;  2VII A;  4I5S A;  4DV0 M;  3FTE A;  4M0W A;  5KPZ A;  2UXC M;  1K3X A;  3K92 A;  3U6O A;  3GPX A;  1NVM A;  3PVS A;  2C5R A;  2DWZ B;  4NSO B;  1IY0 A;  4FCT A;  5F3W A;  2C9C A;  3TPZ A;  4RF0 A;  1Z5B A;  2UU9 M;  4MB7 A;  4IBI A;  3VKH A;  3W0F A;  3R8F A;  1G4A E;  3PFI A;  1EE8 A;  3KP1 E;  1HQY E;  4FWD A;  3GQ3 A;  2UUB M;  2Z4S A;  2R65 A;  2RGO A;  4WUR A;  3UZU A;  3KOY E;  4M9Z A;  4OU7 A;  3NBI A;  4GIP A;  3L2A A;  1N32 M;  5EXX A;  4PD2 A;  4IBC A;  3SAU A;  5FTJ A;  1NY6 A;  2ZAO A;  2HKJ A;  4NOO B;  3AOE A;  5FTM A;  4B7F A;  1C1K A;  3VDP A;  2X49 A;  3RE8 A;  4GH9 A;  3SYK A;  1FNN A;  4JI2 M;  4D81 A;  4REZ A;  2YFQ A;  3UGJ A;  4QOZ C;  3A46 A;  3L28 A;  4LGM A;  2CEA A;  3FUX A;  4B3R M;  4LY6 A;  5C1B A;  2G8L A;  2CHQ A;  3HU2 A;  3U61 B;  3SAT A;  1N33 M;  1IQP A;  1I94 M;  3FD9 A;  3WHL A;  4QNR A;  4W5W A;  3U6P A;  4K0K M;  3U61 A;  2RGH A;  4GMQ A;  1R2Z A;  4NXN M;  1QYR A;  2EUC A;  2KEB A;  3L29 A;  2Y0Q A;  1IM2 A;  4JXJ A;  5EP1 A;  5EXP A;  3KOZ E;  4GRI A;  4GKJ M;  4B3M M;  2QP9 X;  3SAV A;  3GQ4 A;  3KS4 A;  1OFI A;  5EXS A;  3J80 S;  2CHV A;  3W0L B;  3U6C A;  4LF9 M;  4LFC M;  3HHZ A;  4JI6 M;  2XSZ A;  2M60 A;  2QCU A;  4FW9 A;  1OFH A;  2XGN A;  1PJI A;  4MGK E;  4R3D A;  2D7G A;  4FVM A;  3K2L A;  3VK7 A;  2DHR A;  3HU1 A;  2FE8 A;  1DGB A;  4DUY M;  2OQ4 A;  3HWS A;  1IN6 A;  4OX9 M;  1TGU A;  3FTD A;  2R4J A;  2D7E A;  3GRV A;  3KSJ A;  1XXH B;  5BPV A;  4PDG A;  1SXJ D;  4PT5 A;  2Z3X A;  1LV7 A;  3FUW A;  1XXH A;  1HT2 E;  3KW6 A;  2Y20 A;  3THG A;  3T15 A;  3E4R A;  1JR3 D;  4WW0 A;  3HJQ A;  1XMO M;  2V1C A;  4LJ4 A;  1R6B X;  3B9P A;  4L78 A;  4YHH M;  1XNQ M;  4MH0 E;  1WXQ A;  4DV3 M;  3SYL A;  3T38 A;  4I81 A;  3GLG A;  1YE9 A;  3E9S A;  3C58 A;  3AKZ A;  5FSW A;  3AJI B;  1Z5C A;  1L2D A;  2L09 A;  3L26 A;  5EXT A;  2F5N A;  3J7A S;  3CF6 E;  4AZF A;  1L2C A;  2ZBK B;  3GRR A;  3FYD A;  3SMP A;  2OPF A;  4JI7 M;  3JR5 A;  2YNM D;  4S12 A;  3A98 B;  1N34 M;  1D2N A;  2QPA A;  4JI0 M;  3SFZ A;  3TWK A;  1GL7 A;  2C96 A;  1IN5 A;  3PNY A;  4HL4 A;  4GC5 A;  4DR7 M;  2YR0 A;  5C18 A;  2VQE M;  2DWL A;  4QOS A;  3KVW A;  3FTF A;  1E32 A;  2DZO B;  2LNH C;  2RKO A;  4AKI A;  2I7N A;  3GLH B;  2KXE A;  2P5T A;  2F5P A;  4JYA M;  3GLH A;  1XMQ M;  4LJ7 A;  2R18 A;  5IRE B;  3FUT A;  2CV1 A;  1L1T A;  1IBL M;  3M6A A;  2CHG A;  1XNR M;  1J7K A;  2L7I A;  1N75 A;  1X37 A;  1NSF A;  2BJV A;  2Z4R A;  4I4L A;  8CAT A;  2X4A A;  2EA0 A;  2HCB A;  4NRV A;  3A42 A;  2F4V M;  1KYI A;  1L8Q A;  3GPU A;  3IG5 A;  1HNX M;  3MK6 A;  3HHY A;  1TH3 A;  3CF2 A;  4AI6 A;  4MGY E;  3CTW B;  2F5S A;  2AHM A;  1G8P A;  1TH2 A;  4X64 M;  4FD2 A;  3D8L A;  2E5L M;  2DWN A;  4IBB A;  4LJ5 A;  4XBO A;  4AG5 A;  4G4Q A;  4B3S M;  3SHF A;  2R4E A;  4IBG A;  5E26 A;  2UUA M;  4G4O A;  1HNZ M;  1Z5A A;  2Y21 A;  2Y0T A;  1SXJ C;  5KPT A;  3EIH A;  4FWG A;  1IN7 A;  2DZN B;  2XFS A;  4GIT A;  1IY2 A;  1QAO A;  3KOW E;  1HNW M;  2L7H A;  4ITQ A;  3A45 A;  1NJG A;  5DYI A;  4M0D A;  5ITT A;  4BLC A;  1N36 M;  5JI3 E;  4JI4 M;  4LF8 M;  3HHW A;  3I4V A;  1QVR A;  3HU3 A;  4Z6Y A;  2XZU A;  4DR3 M;  3ZCB B;  1HR0 M;  3L25 A;  3U6E A;  2R45 A;  4IBJ A;  2XH9 A;  4B08 A;  3FUU A;  3HHX A;  5A2Q S;  3ZH9 B;  4IBE A;  2ZM6 M;  4BB9 A;  3GLF B;  4LFB M;  5EP2 A;  5KPR A;  3RFW A;  3HKP A;  4NL4 H;  4RF1 A;  4JI5 M;  3M7G A;  3GLF A;  3TQS A;  1JQJ C;  3R9X B;  4BBA A;  2O5R A;  3U60 B;  4GKK M;  1QAM A;  2K47 A;  3GRY A;  3HGI A;  1QZM A;  3HJS A;  1R7R A;  2CE7 A;  3U60 A;  2UXB M;  5E6J A;  3GQ5 A;  3NWL A;  5KQD A;  1K3W A;  3MHV C;  4DR1 M;  2FOI C;  2BJW A;  1PJJ A;  2DVW B;  2W82 A;  4L16 A;  4DR5 M;  4QHS A;  4EIW A;  2LH0 A;  4JI8 M;  4JV5 M;  1YSY A;  4LCB A;  3KP0 E;  2KA6 B;  1HT1 E;  5KO3 A;  4TUW A;  1XHB A;  4LJ6 A;  3LVW A;  1VDD A;  2XZF A;  3JAM S;  4DUZ M;  4DR4 M;  5H37 D;  1GVN A;  1Q3C A;  4G4R A;  2QEN A;  3FKE A;  4CHT B;  4LGY A;  4L15 A;  1IN8 A;  1TH4 A;  3GO8 A;  1G59 A;  2KRU A;  2CV2 A;  3TL4 X;  4KOD A;  4MGI E;  2BNK A;  3EIE A;  1E94 E;  3RGS A;  4DV6 M;  3OTO M;  3T1Y M;  5EP4 A;  1TDZ A;  1QAQ A;  1DO0 A;  1DGF A;  1Q3B A;  3IG8 A;  4FCV A;  3SHG B;  4DR2 M;  4LF4 M;  5EP3 A;  3GLI B;  5ITY A;  1NY5 A;  2QBY B;  3Q8X A;  4A3V B;  1QQW A;  3J7B A;  4CGY B;  4MGH A;  3GLI A;  3J27 B;  5ITX E;  2QBY A;  3FUV A;  4RNA A;  1I4W A;  4II7 A;  3TWL A;  3VFD A;  4GHL A;  2D7H A;  2L6O A;  5ITX A;  5FTK A;  5FTL A;  3U5Z B;  2LWX A;  1XC8 A;  3AOG A;  4QNM A;  2YQZ A;  2ZAM A;  4PDI A;  4DV1 M;  4NXM M;  4YY3 M;  3U5Z A;  3BOS A;  1Q39 A;  5ITR A;  2G5G X;  1Z59 A;  4LZJ A;  3VDU A;  3FYC A;  2C99 A;  3DFZ A;  4XGI A;  3GPY A;  4M9X A;  2XSZ D;  3SBJ A;  1GKI A;  3UK6 A;  1UM8 A;  1NJF A;  3AV0 A;  3LQQ A;  4IIW A;  2J7O A;  1IBK M;  4B3T M;  2R62 A;  3SMS A;  5FLX S;  2VQF M;  2UUC M;  1QAN A;  1SXJ B;  4OW0 A;  4B7G A;  4DV4 M;  1SXJ E;  4M9S A;  3U6D A;  3M0E A;  2Q2E B;  5IWA M;  3DOA A;  1S3S A;  2J7N A;  1DGH B;  5ITU A;  2V1U A;  1H6U A;  1SXJ A;  4P16 A;  4DV7 M;  3QAU A;  3PXG A;  5DNY A;  1J5E M;  4KO8 A;  4X62 M;  4AQY M;  1DGH A;  2XFT A;  3CF0 A;  4D82 A;  3J81 S;  2HHH M;  3GP1 A;  1T3T A;  4LRT A;  4Z8X A;  3SAS A;  1W5S A;  5FTN A;  1JR3 A;  4I8O A;  1N77 A;  4DR6 M;  1IXS B;  3FTC A;  3D8B A;  5ITQ A;  1L1Z A;  3K1J A;  1ZAE A;  1XWI A;  4KHP M;  3DA1 A;  4AKG A;  1W5T A;  4NSR A;  1J09 A;  3KFU G;  3I51 A;  1R2Y A;  2KZS A;  4LJA A;  4D80 A;  1K82 A;  4IBD A;  1E9S A;  3AOE C;  1N78 A;  3I4Y A;  1HQC A;  3LMM A;  1L2B A;  3SAW A;  2UXD M;  3WHK A;  3AL0 C;  4GHA A;  5IT9 S;  1MU5 A;  4GC9 A;  2F5Q A;  1OJL A;  4LF6 M;  4LJ8 A;  2CUZ A;  2V6Z M;  4LZZ A;  3RGP A;  3MJ5 A;  2Z7J A;  1E9R A;  3KDS E;  2CV0 A;  2JA2 A;  4JI1 M;  3QWL A;  5LMU M;  3HJ8 A;  1FJG M;  4X65 M;  3U6S A;  1DO2 A;  3LQR A;  2HL7 A;  4LF7 M;  1NHG C;  2C9O A;  3GRU A;  2X8A A;  4QHT A;  2KW0 A;  1Z6T A;  4G6Z A;  1IY1 A;  3UJN A;  2EO2 A;  2A5Y B;  4LF5 M;  4DV5 M;  3U6Q A;  1NHW C;  1TDH A;  2DWM A;  2KZU A;  3GPP A;  2FFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...