3BBZA

Structure of the nucleocapsid-binding domain from the mumps virus phosphoprotein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
48
structure length
48
Chain Sequence
b'GQKVMITKMITDSVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords P protein
molecule tags Viral protein, replication
source organism Mumps virus
publication title Structure of the nucleocapsid-binding domain from the mumps virus polymerase; an example of protein folding induced by crystallization
pubmed doi rcsb
total genus 20
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3bbzA00
3GLFE 1MN3A 3E21A 2HAKA 4WP2A 1G3IA 2G3QA 3BBZA 2JP7A 1TR8A 1Q02A 1ZV1A 2JY6B 2JY7A 1T6OA 1A5TA 2LBCA 1QZEA 3B89A 1VG5A 2KNZA 2QNJA 2DAEA 2KHHA 3IHPA 3K9OA 3LCUA 1F4IA 2MROB 2KNVA 2WZJA 1P3QQ 1IXSA 2DENA 2JNHA 2DZLA 2JY5A 1C7YA 2DHYA 2EJSA 4GEWA 2JUJA 1TTEA 1HQYE 2R0IA 1VEJA 2L4EA 2CP8A 1AIPC 2RRUA 2MR9A 1HT1E 2K9DA 4UN2B 3FRIA 3MMPA 1G41A 4G3OA 1V92A 1OAIA 3LCVB 3IECA 3T6PA 1NV8A 1YLAA 4R71A 1DV0A 1PGYA 2DAIA 4F1IA 2JZ1A 1VEGA 3K9PA 1SG9A 1E94E 1DO2A 2L2DA 1OQYA 1OKSA 2JY8A 2DI0A 2K0BX 1OTRA 1R4GA 2LVNC 1ZMWA 2CWBA 2EKFA 2KNAA 4HEOA 2LVOC 3GLGE 2LVPC 1T43A 1WGNA 1WJ7A 5JI2E 3FRHA 1VQ1A 4F2LA 2HWJA 2DAMA 1DO0A 4Q7JA 2QHOB 2LTUA 1HJPA 1VDLA 2OOBA 1ZMUA 1ZMVA 2DAKA 1WIVA 3FE3A 2O25A 1UFZA 2MGWA 2LVQD 2LVAA 2BWBA 1HT2E 3H4JA 2H5XA 1XXHE 2DNAA 3E46A 1Y8GA 3F92A 1WR1B 1GO5A 2OOAA 2MJ5B 1KYIA 2QSFX 1XB2B 2ZTCA 1NV9A 1VEKA 2JZ0A 1BVSA 1CUKA 2ZTDA 1G4AE 1EFUB 4DBGB 1IFYA 1WHCA 2OO9A 1WGLA 2BWEA 3GLIE 1IM2A 1JR3E 2B3TA 2DAGA 2DKLA 5DFLA 2EKKA 2L4FA 3GLHE
chains in the Genus database with same CATH superfamily
4IJFA 1R7RA 1IN4A 5EXXA 2HKJA 5BR8M 4GRIA 1TR8A 4PDGA 2JY6B 4D82A 1A5TA 1NVMA 1QZEA 2DXIA 3CF6E 3U61B 4DR2M 3TPZA 2I7NA 2VF7A 1V33A 4DR6M 2FE8A 2QPAA 2LHCA 3K9OA 1KSFX 2WZJA 1DGGA 2F5PA 1J5EM 2OPFA 4PT5A 3FTCA 3KSXA 4LY6A 3MHVC 2D7GA 3SHFA 2XZUA 1MU5A 2HCBA 3GP1A 1QVRA 1C7YA 4JI0M 3DFZA 3GQ4A 4DR5M 3W68A 4X64M 1TTEA 1HQYE 2R0IA 1PM5A 4ANRA 4B3SM 3FUTA 2C96A 3FKEA 3K2LA 1AIPC 4DV7M 5L8RF 3EIEA 1UM8A 3FUXA 4I5SA 2R44A 4JN6A 2RRUA 4JI3M 4JI4M 1I94M 2CHQA 3DA1A 1NSFA 2CV0A 2J7NA 1OAIA 4IBEA 4B3MM 3A46A 1L1ZA 3IECA 3I51A 1YLAA 3KP1E 1PJIA 4GC5A 3QYEA 3D8BA 1G8PA 4LJ7A 5A2QS 2DAIA 1XC8A 3VLFB 3K9PA 3T15A 2AHMA 1DO2A 5EP2A 4FCVA 4W5WA 3KS8A 1YE9A 2ZAOA 4DV3M 1HR0M 2D7HA 4LCBA 1OKSA 5KPRA 2QBYB 1V34A 1HNZM 2LVNC 3SYKA 4CJ6A 1EE8A 1H6UA 2R4JA 3FTEA 2CWBA 4HLQA 3HHZA 2KNAA 2VDBB 4HEOA 3FUUA 3B7ZA 3FRHA 1N75A 2R65A 1VQ1A 4LZJA 1NO1A 3A42A 3HU1A 4F2LA 5FTJA 5JI3E 3SATA 3T1HM 2QP9X 4G6ZA 2E5LM 1DO0A 8CATA 1HJPA 4MB7A 4PDIA 1C1KA 1ZMVA 2DVWB 2DAKA 3AL0C 1G71A 2KW0A 4BLCA 3M6AA 3HY5A 1XMQM 2RKOA 4QHTA 4NRVA 1QDRA 3DZDA 1IBKM 3SASA 3DOAA 4FWHA 2YQZA 4LF9M 1FJGM 1HT2E 5FTMA 4LF6M 1KFVA 3UJNA 5EP4A 2DNAA 2VIIA 3PXGA 2XZFA 2HHHM 4L15A 3TE6A 1Y8GA 3KOWE 3SARA 3E4RA 2WSEF 3EIHA 1GABA 4L16A 1IQPA 2KRUA 4IBFA 5EP1A 3U6MA 5DYGA 2UXBM 4P17A 2X4AA 1SXJB 1NJFA 1R2ZA 5ITQA 1XB2B 3U60B 3UZUA 2EO2A 4AG6A 2QQ8A 3C58A 3TL4X 4AI6A 1BVSA 1CUKA 3SYLA 1G4AE 4NSOB 1WHCA 2X49A 3U6QA 4CIZA 5FSWA 1QQWA 4MH0E 2XF3A 3FTFA 4G4QA 3HWSA 1IN7A 2BWEA 3GLGA 4LF5M 2RGOA 4TUWA 2B3TA 4X62M 2DKLA 2L7HA 2LXEA 2CEAA 4M9SA 3ZC7B 4L8RC 3VFDA 1XNRM 1D0KA 1QZMA 3FYCA 3E21A 2HAKA 4WP2A 4NC6A 3BBZA 2G3QA 1PJJA 3FYDA 3RFWA 4DR1M 4DR3M 3FD9A 2JY7A 2LBCA 1QAMA 3SFZA 2O01F 3GLGB 4Z8XA 1OIPA 1Z5AA 4WW0A 1EIJA 4MGYE 1DGHB 2EUCA 1QAQA 4QOSA 3JR5A 3ZCBB 4GMQA 1Q3BA 3U6CA 4GIPA 1TDHA 1HNWM 3VKHA 4G4NA 2L09A 2Z8YM 2DENA 5KO3A 3U6LA 1XNQM 4RNAA 2J5YA 1DGHA 3TWMA 1OJLA 1E9SA 1K3XA 2R4EA 5EXTA 2WSFF 2DHYA 1TGUA 1IXZA 5H37D 3MK6A 4FCWA 1ORYB 2JUJA 4LF4M 2G8LA 3NBXX 1R6BX 3KOXE 4M9ZA 4REZA 3SBJA 4M0DA 2LH0A 1OAOC 3A45A 1HT1E 4UN2B 5LMUM 3GRVA 4D80A 5KQ8A 1YUBA 3VDUA 3AOEC 4G3OA 1V92A 2DWNA 1SXJC 4JXJA 4P16A 4AZFA 3NBIA 4AW4A 3T6PA 3GPYA 1GVNA 3K8ZA 2Z3XA 1DV0A 1PGYA 2JA2A 2JWSA 2D7EA 1VEGA 5ITUA 5FLXS 4I81A 2YR0A 5FTNA 2F5OA 1IN5A 4XK8F 3IG8A 3OTOM 4LRTA 3FUWA 4G4RA 1OQYA 1DGBA 3TWKA 4B3RM 2LHGA 4G4OA 2JY8A 1OTRA 4FVMA 2LWXA 5F3WA 1J09A 5FTKA 3GLHA 4MGHA 4AKGA 2VF8A 3I01M 3GLIA 5EP3A 3J7BA 4DR4M 3UK6A 4MGKE 3CTWB 3HKPA 3SAUA 2DAMA 1QDTA 1D2NA 2QCUA 3J27B 1IBLM 3LVWA 1W5SA 1GLNA 2QENA 2QHOB 3AKZA 3LMMA 1VDLA 2OOBA 3HU2A 4IBIA 3BOSA 2R18A 1ZAEA 4QNRA 3PVSA 4LJ6A 2Y21A 3W0FA 2VQFM 4EIWA 2ZAMA 3FE3A 3L29A 2F5QA 1DGFA 2K47A 1UFZA 4GC9A 2C99A 3AOEA 2C5RA 4OU7A 1JQJC 3U6OA 3E46A 4IIWA 2O5RA 3M0EA 2CV2A 4AQYM 1YSYA 1WR1B 1Q39A 2FNAA 4FWDA 2R46A 3SAVA 3QWLA 4QNMA 4WURA 3R9XB 1NNUC 3I4VA 3E9SA 3AJIB 3J2PB 3RGSA 5KQDA 1IFYA 2H1RA 2V1CA 1WGLA 2XSZD 4RF0A 2UUBM 3C9PA 2CV1A 4D81A 3GPPA 1PJQA 2V6ZM 3Q8XA 2XFSA 1ZQ9A 4OVZB 4NL4H 1MN3A 4FWGA 4XGIA 3AV0A 4KHPM 1K3WA 2BJWA 3T1YM 4IBJA 1GJTA 2JP7A 5E26A 4CGYB 3GLIB 2P5TA 3B89A 1Z59A 4B7GA 1VG5A 1L8QA 2QNJA 3GRRA 2DAEA 3PFIA 1L2CA 3LCUA 4GITA 2FH0A 3CGWA 4LFCM 3L27A 2KNVA 2KXEA 2R45A 2Z4RA 1IN6A 3VK8A 1I4WA 2DZLA 2KRKA 5C1BA 1D0MA 2DZOB 4KO8A 3GQ3A 5FTLA 2CE7A 2JY5A 1QUTA 2N35A 4FD2A 3ZH9B 2DWMA 3L26A 2I7PA 1Z5CA 2CRUA 3TQSA 3HX3A 4GEWA 3UMMA 5BPVA 2M5ZA 2L4EA 1SXJD 2CUZA 2CP8A 1D0LA 1QAOA 4RF1A 3B7NA 3KSJA 1JR3D 1XWIA 1TH4A 1Z6TA 5ITXA 1N34M 2Z4SA 2CHVA 4AG5A 4I8OA 1N32M 3THGA 3MMPA 2XLJA 3SAWA 2GNOA 1SXJE 1OFHA 3LVVA 3KS4A 3LCVB 4DV4M 3V76A 4R71A 4QHSA 1NJGA 1MX0A 2DHRA 3GRUA 5ITTA 2ZANA 1TF0B 1XXHA 2KEBA 1PRBA 1MJGM 2JZ1A 1PJSA 1X37A 1LV7A 3LQQA 3A98B 1SG9A 3ILKA 1E94E 3L2AA 3HHYA 3D8LA 2Q2EB 4IBBA 4B7FA 5ITXE 4AKIA 1S3SA 2KDLA 5ITRA 3GLFB 4NSRA 2CHGA 1NHWC 4DV5M 3LW5F 1L2DA 5KPTA 4NXMM 4L6V6 1R4GA 4B3TM 1NY5A 3L25A 5EXSA 2LVOC 3GLGE 2LVPC 4GHLA 2VQEM 4II7A 5DNYA 3ZQJA 1N36M 2L6OA 1GKIA 2KA6B 1T3TA 5LMNM 4DV0M 3U6PA 1L2BA 2GQFA 3KVWA 3U61A 3W67A 4LJ5A 4K0KM 1Q3CA 2C98A 4MM3B 4PD2A 4JYAM 1FNNA 1WIVA 4NOOB 3SMSA 2XEPA 3GPUA 1TH2A 5IWAM 2A5YB 4JV5M 2MGWA 2LVQD 4NRWA 2ZBKB 4XBOA 2NQ8C 3GQ5A 2H5XA 2ERCA 4S12A 3U60A 4LFBM 1HNXM 2W82A 3F92A 3WHLA 1R2YA 4IJEA 3U5ZA 3SHGB 3WHKA 2UXDM 1GO5A 2OOAA 3GO8A 4A3VB 4X66M 3R8FA 4IBCA 4JI6M 2DWLA 1NV9A 4GHAA 4DR7M 1VEKA 2HL7A 2ZTDA 2DZNB 4JI2M 1XMOM 3Q8GA 5ITYA 2QZ4A 1IXRC 3J80S 4QOZC 3KDSE 4ZPXA 4L78A 4LRSA 3KW6A 3GLIE 3GPXA 1GJSA 2XH9A 1WXQA 5DFLA 2EKKA 3GLHE 4OW0A 1E9RA 1VDDA 5EXPA 3GLFE 1N78A 4BB9A 3KFUG 4LJAA 5EQTA 4B08A 2XGNA 3HHXA 1G3IA 4LGYA 3SC3A 1E32A 4ITQA 5E6JA 1Q02A 1ZV1A 2UUCM 4DV6M 1T6OA 4X65M 4DUYM 3KOYE 4KODA 4MGZE 1R5LA 3U6EA 4R3DA 4LG2A 4JI5M 2CFOA 2KNZA 4DV1M 3GLHB 2KHHA 1XHBA 3IHPA 4LFAM 3VKGA 3GLFA 4CISA 4M0WA 4LF8M 1F4IA 2MROB 2ZM6M 3T38A 3VK7A 4FCTA 1P3QQ 2J7OA 1IXSA 2JNHA 4YY3M 1Z5BA 4I4LA 2UUAM 2OQ4A 3K1JA 2K6BA 4B7HA 1IN8A 2KZUA 4RKUF 2EJSA 4DUZM 4CHTB 1TH3A 1IXSB 4JI1M 3UGJA 1L1TA 1K82A 1VEJA 4KT0F 1QUSA 3TWLA 2FOIC 1IY0A 5C18A 4IBDA 1QYRA 2C9CA 3CF0A 3QAUA 4IBKA 2MR9A 2K9DA 2YFQA 3FRIA 3CF2A 1IY1A 1JB0F 1G41A 4GH9A 4Z6YA 3HGIA 2BJVA 3L28A 5EJCA 2F4VM 1OIZA 3M7GA 5GKNA 1NV8A 2XFTA 1QANA 3HHWA 2UU9M 4Y28F 2JXNA 2F5NA 3IG5A 1NHGC 4LGMA 3B74A 4F1IA 4HL4A 3JAMS 2QBYA 1PJTA 4YHHM 2UXCM 3C3DA 2V1UA 4OX9M 4FW9A 1NNJA 3RGPA 2L7IA 2Z7JA 2L2DA 4BBAA 3W0LB 3RE8A 2DI0A 2K0BX 5KPZA 2R62A 7CATA 4R7GA 4OVZA 1ZMWA 3U6SA 1IY2A 3FTDA 3I4YA 3JR4A 3PNVA 1N33M 3QYBA 1OFIA 2EKFA 3PNYA 5IT9S 1TDZA 2APLA 3AOGA 1T43A 1GL6A 1WGNA 1WJ7A 2Y20A 3H4MA 5JI2E 2C9OA 3AFHA 3KOZE 5IZ7D 3SMPA 1IBMM 1LTMA 4JI7M 2HWJA 4IBGA 4LF7M 3KP0E 1NY6A 3HJQA 3HJSA 4Q7JA 1W5TA 4PCZA 2LTUA 2DWZB 1ZMUA 5DYIA 2F5SA 4MGIE 1GL7A 2Y0QA 1N77A 4GKJM 2O25A 2X8AA 4LJ4A 4KLNA 1G59A 3U5ZB 1RU3A 2FS1A 2G5GX 2LNHC 2LVAA 2BWBA 3LQRA 4LZZA 3U6DA 1SXJA 3B9PA 3H4JA 1XXHE 1JR3A 3NWLA 3FUVA 3MJ5A 3VDPA 2R6FA 3I04M 4JI8M 3K92A 2MJ5B 2RGHA 1KYIA 2QSFX 2YNMD 3J81S 1J7KA 4M9XA 3BXWA 2BNKA 1XXHB 2Y0TA 2ZTCA 2M60A 2JZ0A 3HZJA 4L4UA 4LJ9A 4DBGB 1EFUB 2KZSA 2MH8A 2OO9A 3KXEC 3B7QA 3GRYA 4GKKM 4LJ8A 2FFJA 3C3EA 1AUAA 5IREB 2EA0A 4NXNM 3HU3A 4AKHA 2XSZA 1IM2A 1JR3E 2DAGA 2WSCF 3J7AS 4DV2M 1HQCA 2L4FA 3HJ8A
chains in the Genus database with same CATH topology
3GLFE 1MN3A 3E21A 2HAKA 4WP2A 1G3IA 2G3QA 3BBZA 2JP7A 1TR8A 1Q02A 1ZV1A 2JY6B 2JY7A 1T6OA 1A5TA 2LBCA 1QZEA 3B89A 1VG5A 2KNZA 2QNJA 2DAEA 2KHHA 3IHPA 3K9OA 3LCUA 1F4IA 2MROB 2KNVA 2WZJA 1P3QQ 1IXSA 2DENA 2JNHA 2DZLA 2JY5A 1C7YA 2DHYA 2EJSA 4GEWA 2JUJA 1TTEA 1HQYE 2R0IA 1VEJA 2L4EA 2CP8A 1AIPC 2RRUA 2MR9A 1HT1E 2K9DA 4UN2B 3FRIA 3MMPA 1G41A 4G3OA 1V92A 1OAIA 3LCVB 3IECA 3T6PA 1NV8A 1YLAA 4R71A 1DV0A 1PGYA 2DAIA 4F1IA 2JZ1A 1VEGA 3K9PA 1SG9A 1E94E 1DO2A 2L2DA 1OQYA 1OKSA 2JY8A 2DI0A 2K0BX 1OTRA 1R4GA 2LVNC 1ZMWA 2CWBA 2EKFA 2KNAA 4HEOA 2LVOC 3GLGE 2LVPC 1T43A 1WGNA 1WJ7A 5JI2E 3FRHA 1VQ1A 4F2LA 2HWJA 2DAMA 1DO0A 4Q7JA 2QHOB 2LTUA 1HJPA 1VDLA 2OOBA 1ZMUA 1ZMVA 2DAKA 1WIVA 3FE3A 2O25A 1UFZA 2MGWA 2LVQD 2LVAA 2BWBA 1HT2E 3H4JA 2H5XA 1XXHE 2DNAA 3E46A 1Y8GA 3F92A 1WR1B 1GO5A 2OOAA 2MJ5B 1KYIA 2QSFX 1XB2B 2ZTCA 1NV9A 1VEKA 2JZ0A 1BVSA 1CUKA 2ZTDA 1G4AE 1EFUB 4DBGB 1IFYA 1WHCA 2OO9A 1WGLA 2BWEA 3GLIE 1IM2A 1JR3E 2B3TA 2DAGA 2DKLA 5DFLA 2EKKA 2L4FA 3GLHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLF E;  1MN3 A;  3E21 A;  2HAK A;  4WP2 A;  1G3I A;  2G3Q A;  3BBZ A;  2JP7 A;  1TR8 A;  1Q02 A;  1ZV1 A;  2JY6 B;  2JY7 A;  1T6O A;  1A5T A;  2LBC A;  1QZE A;  3B89 A;  1VG5 A;  2KNZ A;  2QNJ A;  2DAE A;  2KHH A;  3IHP A;  3K9O A;  3LCU A;  1F4I A;  2MRO B;  2KNV A;  2WZJ A;  1P3Q Q;  1IXS A;  2DEN A;  2JNH A;  2DZL A;  2JY5 A;  1C7Y A;  2DHY A;  2EJS A;  4GEW A;  2JUJ A;  1TTE A;  1HQY E;  2R0I A;  1VEJ A;  2L4E A;  2CP8 A;  1AIP C;  2RRU A;  2MR9 A;  1HT1 E;  2K9D A;  4UN2 B;  3FRI A;  3MMP A;  1G41 A;  4G3O A;  1V92 A;  1OAI A;  3LCV B;  3IEC A;  3T6P A;  1NV8 A;  1YLA A;  4R71 A;  1DV0 A;  1PGY A;  2DAI A;  4F1I A;  2JZ1 A;  1VEG A;  3K9P A;  1SG9 A;  1E94 E;  1DO2 A;  2L2D A;  1OQY A;  1OKS A;  2JY8 A;  2DI0 A;  2K0B X;  1OTR A;  1R4G A;  2LVN C;  1ZMW A;  2CWB A;  2EKF A;  2KNA A;  4HEO A;  2LVO C;  3GLG E;  2LVP C;  1T43 A;  1WGN A;  1WJ7 A;  5JI2 E;  3FRH A;  1VQ1 A;  4F2L A;  2HWJ A;  2DAM A;  1DO0 A;  4Q7J A;  2QHO B;  2LTU A;  1HJP A;  1VDL A;  2OOB A;  1ZMU A;  1ZMV A;  2DAK A;  1WIV A;  3FE3 A;  2O25 A;  1UFZ A;  2MGW A;  2LVQ D;  2LVA A;  2BWB A;  1HT2 E;  3H4J A;  2H5X A;  1XXH E;  2DNA A;  3E46 A;  1Y8G A;  3F92 A;  1WR1 B;  1GO5 A;  2OOA A;  2MJ5 B;  1KYI A;  2QSF X;  1XB2 B;  2ZTC A;  1NV9 A;  1VEK A;  2JZ0 A;  1BVS A;  1CUK A;  2ZTD A;  1G4A E;  1EFU B;  4DBG B;  1IFY A;  1WHC A;  2OO9 A;  1WGL A;  2BWE A;  3GLI E;  1IM2 A;  1JR3 E;  2B3T A;  2DAG A;  2DKL A;  5DFL A;  2EKK A;  2L4F A;  3GLH E; 
#chains in the Genus database with same CATH topology
 4IJF A;  1R7R A;  1IN4 A;  5EXX A;  2HKJ A;  5BR8 M;  4GRI A;  1TR8 A;  4PDG A;  2JY6 B;  4D82 A;  1A5T A;  1NVM A;  1QZE A;  2DXI A;  3CF6 E;  3U61 B;  4DR2 M;  3TPZ A;  2I7N A;  2VF7 A;  1V33 A;  4DR6 M;  2FE8 A;  2QPA A;  2LHC A;  3K9O A;  1KSF X;  2WZJ A;  1DGG A;  2F5P A;  1J5E M;  2OPF A;  4PT5 A;  3FTC A;  3KSX A;  4LY6 A;  3MHV C;  2D7G A;  3SHF A;  2XZU A;  1MU5 A;  2HCB A;  3GP1 A;  1QVR A;  1C7Y A;  4JI0 M;  3DFZ A;  3GQ4 A;  4DR5 M;  3W68 A;  4X64 M;  1TTE A;  1HQY E;  2R0I A;  1PM5 A;  4ANR A;  4B3S M;  3FUT A;  2C96 A;  3FKE A;  3K2L A;  1AIP C;  4DV7 M;  5L8R F;  3EIE A;  1UM8 A;  3FUX A;  4I5S A;  2R44 A;  4JN6 A;  2RRU A;  4JI3 M;  4JI4 M;  1I94 M;  2CHQ A;  3DA1 A;  1NSF A;  2CV0 A;  2J7N A;  1OAI A;  4IBE A;  4B3M M;  3A46 A;  1L1Z A;  3IEC A;  3I51 A;  1YLA A;  3KP1 E;  1PJI A;  4GC5 A;  3QYE A;  3D8B A;  1G8P A;  4LJ7 A;  5A2Q S;  2DAI A;  1XC8 A;  3VLF B;  3K9P A;  3T15 A;  2AHM A;  1DO2 A;  5EP2 A;  4FCV A;  4W5W A;  3KS8 A;  1YE9 A;  2ZAO A;  4DV3 M;  1HR0 M;  2D7H A;  4LCB A;  1OKS A;  5KPR A;  2QBY B;  1V34 A;  1HNZ M;  2LVN C;  3SYK A;  4CJ6 A;  1EE8 A;  1H6U A;  2R4J A;  3FTE A;  2CWB A;  4HLQ A;  3HHZ A;  2KNA A;  2VDB B;  4HEO A;  3FUU A;  3B7Z A;  3FRH A;  1N75 A;  2R65 A;  1VQ1 A;  4LZJ A;  1NO1 A;  3A42 A;  3HU1 A;  4F2L A;  5FTJ A;  5JI3 E;  3SAT A;  3T1H M;  2QP9 X;  4G6Z A;  2E5L M;  1DO0 A;  8CAT A;  1HJP A;  4MB7 A;  4PDI A;  1C1K A;  1ZMV A;  2DVW B;  2DAK A;  3AL0 C;  1G71 A;  2KW0 A;  4BLC A;  3M6A A;  3HY5 A;  1XMQ M;  2RKO A;  4QHT A;  4NRV A;  1QDR A;  3DZD A;  1IBK M;  3SAS A;  3DOA A;  4FWH A;  2YQZ A;  4LF9 M;  1FJG M;  1HT2 E;  5FTM A;  4LF6 M;  1KFV A;  3UJN A;  5EP4 A;  2DNA A;  2VII A;  3PXG A;  2XZF A;  2HHH M;  4L15 A;  3TE6 A;  1Y8G A;  3KOW E;  3SAR A;  3E4R A;  2WSE F;  3EIH A;  1GAB A;  4L16 A;  1IQP A;  2KRU A;  4IBF A;  5EP1 A;  3U6M A;  5DYG A;  2UXB M;  4P17 A;  2X4A A;  1SXJ B;  1NJF A;  1R2Z A;  5ITQ A;  1XB2 B;  3U60 B;  3UZU A;  2EO2 A;  4AG6 A;  2QQ8 A;  3C58 A;  3TL4 X;  4AI6 A;  1BVS A;  1CUK A;  3SYL A;  1G4A E;  4NSO B;  1WHC A;  2X49 A;  3U6Q A;  4CIZ A;  5FSW A;  1QQW A;  4MH0 E;  2XF3 A;  3FTF A;  4G4Q A;  3HWS A;  1IN7 A;  2BWE A;  3GLG A;  4LF5 M;  2RGO A;  4TUW A;  2B3T A;  4X62 M;  2DKL A;  2L7H A;  2LXE A;  2CEA A;  4M9S A;  3ZC7 B;  4L8R C;  3VFD A;  1XNR M;  1D0K A;  1QZM A;  3FYC A;  3E21 A;  2HAK A;  4WP2 A;  4NC6 A;  3BBZ A;  2G3Q A;  1PJJ A;  3FYD A;  3RFW A;  4DR1 M;  4DR3 M;  3FD9 A;  2JY7 A;  2LBC A;  1QAM A;  3SFZ A;  2O01 F;  3GLG B;  4Z8X A;  1OIP A;  1Z5A A;  4WW0 A;  1EIJ A;  4MGY E;  1DGH B;  2EUC A;  1QAQ A;  4QOS A;  3JR5 A;  3ZCB B;  4GMQ A;  1Q3B A;  3U6C A;  4GIP A;  1TDH A;  1HNW M;  3VKH A;  4G4N A;  2L09 A;  2Z8Y M;  2DEN A;  5KO3 A;  3U6L A;  1XNQ M;  4RNA A;  2J5Y A;  1DGH A;  3TWM A;  1OJL A;  1E9S A;  1K3X A;  2R4E A;  5EXT A;  2WSF F;  2DHY A;  1TGU A;  1IXZ A;  5H37 D;  3MK6 A;  4FCW A;  1ORY B;  2JUJ A;  4LF4 M;  2G8L A;  3NBX X;  1R6B X;  3KOX E;  4M9Z A;  4REZ A;  3SBJ A;  4M0D A;  2LH0 A;  1OAO C;  3A45 A;  1HT1 E;  4UN2 B;  5LMU M;  3GRV A;  4D80 A;  5KQ8 A;  1YUB A;  3VDU A;  3AOE C;  4G3O A;  1V92 A;  2DWN A;  1SXJ C;  4JXJ A;  4P16 A;  4AZF A;  3NBI A;  4AW4 A;  3T6P A;  3GPY A;  1GVN A;  3K8Z A;  2Z3X A;  1DV0 A;  1PGY A;  2JA2 A;  2JWS A;  2D7E A;  1VEG A;  5ITU A;  5FLX S;  4I81 A;  2YR0 A;  5FTN A;  2F5O A;  1IN5 A;  4XK8 F;  3IG8 A;  3OTO M;  4LRT A;  3FUW A;  4G4R A;  1OQY A;  1DGB A;  3TWK A;  4B3R M;  2LHG A;  4G4O A;  2JY8 A;  1OTR A;  4FVM A;  2LWX A;  5F3W A;  1J09 A;  5FTK A;  3GLH A;  4MGH A;  4AKG A;  2VF8 A;  3I01 M;  3GLI A;  5EP3 A;  3J7B A;  4DR4 M;  3UK6 A;  4MGK E;  3CTW B;  3HKP A;  3SAU A;  2DAM A;  1QDT A;  1D2N A;  2QCU A;  3J27 B;  1IBL M;  3LVW A;  1W5S A;  1GLN A;  2QEN A;  2QHO B;  3AKZ A;  3LMM A;  1VDL A;  2OOB A;  3HU2 A;  4IBI A;  3BOS A;  2R18 A;  1ZAE A;  4QNR A;  3PVS A;  4LJ6 A;  2Y21 A;  3W0F A;  2VQF M;  4EIW A;  2ZAM A;  3FE3 A;  3L29 A;  2F5Q A;  1DGF A;  2K47 A;  1UFZ A;  4GC9 A;  2C99 A;  3AOE A;  2C5R A;  4OU7 A;  1JQJ C;  3U6O A;  3E46 A;  4IIW A;  2O5R A;  3M0E A;  2CV2 A;  4AQY M;  1YSY A;  1WR1 B;  1Q39 A;  2FNA A;  4FWD A;  2R46 A;  3SAV A;  3QWL A;  4QNM A;  4WUR A;  3R9X B;  1NNU C;  3I4V A;  3E9S A;  3AJI B;  3J2P B;  3RGS A;  5KQD A;  1IFY A;  2H1R A;  2V1C A;  1WGL A;  2XSZ D;  4RF0 A;  2UUB M;  3C9P A;  2CV1 A;  4D81 A;  3GPP A;  1PJQ A;  2V6Z M;  3Q8X A;  2XFS A;  1ZQ9 A;  4OVZ B;  4NL4 H;  1MN3 A;  4FWG A;  4XGI A;  3AV0 A;  4KHP M;  1K3W A;  2BJW A;  3T1Y M;  4IBJ A;  1GJT A;  2JP7 A;  5E26 A;  4CGY B;  3GLI B;  2P5T A;  3B89 A;  1Z59 A;  4B7G A;  1VG5 A;  1L8Q A;  2QNJ A;  3GRR A;  2DAE A;  3PFI A;  1L2C A;  3LCU A;  4GIT A;  2FH0 A;  3CGW A;  4LFC M;  3L27 A;  2KNV A;  2KXE A;  2R45 A;  2Z4R A;  1IN6 A;  3VK8 A;  1I4W A;  2DZL A;  2KRK A;  5C1B A;  1D0M A;  2DZO B;  4KO8 A;  3GQ3 A;  5FTL A;  2CE7 A;  2JY5 A;  1QUT A;  2N35 A;  4FD2 A;  3ZH9 B;  2DWM A;  3L26 A;  2I7P A;  1Z5C A;  2CRU A;  3TQS A;  3HX3 A;  4GEW A;  3UMM A;  5BPV A;  2M5Z A;  2L4E A;  1SXJ D;  2CUZ A;  2CP8 A;  1D0L A;  1QAO A;  4RF1 A;  3B7N A;  3KSJ A;  1JR3 D;  1XWI A;  1TH4 A;  1Z6T A;  5ITX A;  1N34 M;  2Z4S A;  2CHV A;  4AG5 A;  4I8O A;  1N32 M;  3THG A;  3MMP A;  2XLJ A;  3SAW A;  2GNO A;  1SXJ E;  1OFH A;  3LVV A;  3KS4 A;  3LCV B;  4DV4 M;  3V76 A;  4R71 A;  4QHS A;  1NJG A;  1MX0 A;  2DHR A;  3GRU A;  5ITT A;  2ZAN A;  1TF0 B;  1XXH A;  2KEB A;  1PRB A;  1MJG M;  2JZ1 A;  1PJS A;  1X37 A;  1LV7 A;  3LQQ A;  3A98 B;  1SG9 A;  3ILK A;  1E94 E;  3L2A A;  3HHY A;  3D8L A;  2Q2E B;  4IBB A;  4B7F A;  5ITX E;  4AKI A;  1S3S A;  2KDL A;  5ITR A;  3GLF B;  4NSR A;  2CHG A;  1NHW C;  4DV5 M;  3LW5 F;  1L2D A;  5KPT A;  4NXM M;  4L6V 6;  1R4G A;  4B3T M;  1NY5 A;  3L25 A;  5EXS A;  2LVO C;  3GLG E;  2LVP C;  4GHL A;  2VQE M;  4II7 A;  5DNY A;  3ZQJ A;  1N36 M;  2L6O A;  1GKI A;  2KA6 B;  1T3T A;  5LMN M;  4DV0 M;  3U6P A;  1L2B A;  2GQF A;  3KVW A;  3U61 A;  3W67 A;  4LJ5 A;  4K0K M;  1Q3C A;  2C98 A;  4MM3 B;  4PD2 A;  4JYA M;  1FNN A;  1WIV A;  4NOO B;  3SMS A;  2XEP A;  3GPU A;  1TH2 A;  5IWA M;  2A5Y B;  4JV5 M;  2MGW A;  2LVQ D;  4NRW A;  2ZBK B;  4XBO A;  2NQ8 C;  3GQ5 A;  2H5X A;  2ERC A;  4S12 A;  3U60 A;  4LFB M;  1HNX M;  2W82 A;  3F92 A;  3WHL A;  1R2Y A;  4IJE A;  3U5Z A;  3SHG B;  3WHK A;  2UXD M;  1GO5 A;  2OOA A;  3GO8 A;  4A3V B;  4X66 M;  3R8F A;  4IBC A;  4JI6 M;  2DWL A;  1NV9 A;  4GHA A;  4DR7 M;  1VEK A;  2HL7 A;  2ZTD A;  2DZN B;  4JI2 M;  1XMO M;  3Q8G A;  5ITY A;  2QZ4 A;  1IXR C;  3J80 S;  4QOZ C;  3KDS E;  4ZPX A;  4L78 A;  4LRS A;  3KW6 A;  3GLI E;  3GPX A;  1GJS A;  2XH9 A;  1WXQ A;  5DFL A;  2EKK A;  3GLH E;  4OW0 A;  1E9R A;  1VDD A;  5EXP A;  3GLF E;  1N78 A;  4BB9 A;  3KFU G;  4LJA A;  5EQT A;  4B08 A;  2XGN A;  3HHX A;  1G3I A;  4LGY A;  3SC3 A;  1E32 A;  4ITQ A;  5E6J A;  1Q02 A;  1ZV1 A;  2UUC M;  4DV6 M;  1T6O A;  4X65 M;  4DUY M;  3KOY E;  4KOD A;  4MGZ E;  1R5L A;  3U6E A;  4R3D A;  4LG2 A;  4JI5 M;  2CFO A;  2KNZ A;  4DV1 M;  3GLH B;  2KHH A;  1XHB A;  3IHP A;  4LFA M;  3VKG A;  3GLF A;  4CIS A;  4M0W A;  4LF8 M;  1F4I A;  2MRO B;  2ZM6 M;  3T38 A;  3VK7 A;  4FCT A;  1P3Q Q;  2J7O A;  1IXS A;  2JNH A;  4YY3 M;  1Z5B A;  4I4L A;  2UUA M;  2OQ4 A;  3K1J A;  2K6B A;  4B7H A;  1IN8 A;  2KZU A;  4RKU F;  2EJS A;  4DUZ M;  4CHT B;  1TH3 A;  1IXS B;  4JI1 M;  3UGJ A;  1L1T A;  1K82 A;  1VEJ A;  4KT0 F;  1QUS A;  3TWL A;  2FOI C;  1IY0 A;  5C18 A;  4IBD A;  1QYR A;  2C9C A;  3CF0 A;  3QAU A;  4IBK A;  2MR9 A;  2K9D A;  2YFQ A;  3FRI A;  3CF2 A;  1IY1 A;  1JB0 F;  1G41 A;  4GH9 A;  4Z6Y A;  3HGI A;  2BJV A;  3L28 A;  5EJC A;  2F4V M;  1OIZ A;  3M7G A;  5GKN A;  1NV8 A;  2XFT A;  1QAN A;  3HHW A;  2UU9 M;  4Y28 F;  2JXN A;  2F5N A;  3IG5 A;  1NHG C;  4LGM A;  3B74 A;  4F1I A;  4HL4 A;  3JAM S;  2QBY A;  1PJT A;  4YHH M;  2UXC M;  3C3D A;  2V1U A;  4OX9 M;  4FW9 A;  1NNJ A;  3RGP A;  2L7I A;  2Z7J A;  2L2D A;  4BBA A;  3W0L B;  3RE8 A;  2DI0 A;  2K0B X;  5KPZ A;  2R62 A;  7CAT A;  4R7G A;  4OVZ A;  1ZMW A;  3U6S A;  1IY2 A;  3FTD A;  3I4Y A;  3JR4 A;  3PNV A;  1N33 M;  3QYB A;  1OFI A;  2EKF A;  3PNY A;  5IT9 S;  1TDZ A;  2APL A;  3AOG A;  1T43 A;  1GL6 A;  1WGN A;  1WJ7 A;  2Y20 A;  3H4M A;  5JI2 E;  2C9O A;  3AFH A;  3KOZ E;  5IZ7 D;  3SMP A;  1IBM M;  1LTM A;  4JI7 M;  2HWJ A;  4IBG A;  4LF7 M;  3KP0 E;  1NY6 A;  3HJQ A;  3HJS A;  4Q7J A;  1W5T A;  4PCZ A;  2LTU A;  2DWZ B;  1ZMU A;  5DYI A;  2F5S A;  4MGI E;  1GL7 A;  2Y0Q A;  1N77 A;  4GKJ M;  2O25 A;  2X8A A;  4LJ4 A;  4KLN A;  1G59 A;  3U5Z B;  1RU3 A;  2FS1 A;  2G5G X;  2LNH C;  2LVA A;  2BWB A;  3LQR A;  4LZZ A;  3U6D A;  1SXJ A;  3B9P A;  3H4J A;  1XXH E;  1JR3 A;  3NWL A;  3FUV A;  3MJ5 A;  3VDP A;  2R6F A;  3I04 M;  4JI8 M;  3K92 A;  2MJ5 B;  2RGH A;  1KYI A;  2QSF X;  2YNM D;  3J81 S;  1J7K A;  4M9X A;  3BXW A;  2BNK A;  1XXH B;  2Y0T A;  2ZTC A;  2M60 A;  2JZ0 A;  3HZJ A;  4L4U A;  4LJ9 A;  4DBG B;  1EFU B;  2KZS A;  2MH8 A;  2OO9 A;  3KXE C;  3B7Q A;  3GRY A;  4GKK M;  4LJ8 A;  2FFJ A;  3C3E A;  1AUA A;  5IRE B;  2EA0 A;  4NXN M;  3HU3 A;  4AKH A;  2XSZ A;  1IM2 A;  1JR3 E;  2DAG A;  2WSC F;  3J7A S;  4DV2 M;  1HQC A;  2L4F A;  3HJ8 A; 
#chains in the Genus database with same CATH homology
 3GLF E;  1MN3 A;  3E21 A;  2HAK A;  4WP2 A;  1G3I A;  2G3Q A;  3BBZ A;  2JP7 A;  1TR8 A;  1Q02 A;  1ZV1 A;  2JY6 B;  2JY7 A;  1T6O A;  1A5T A;  2LBC A;  1QZE A;  3B89 A;  1VG5 A;  2KNZ A;  2QNJ A;  2DAE A;  2KHH A;  3IHP A;  3K9O A;  3LCU A;  1F4I A;  2MRO B;  2KNV A;  2WZJ A;  1P3Q Q;  1IXS A;  2DEN A;  2JNH A;  2DZL A;  2JY5 A;  1C7Y A;  2DHY A;  2EJS A;  4GEW A;  2JUJ A;  1TTE A;  1HQY E;  2R0I A;  1VEJ A;  2L4E A;  2CP8 A;  1AIP C;  2RRU A;  2MR9 A;  1HT1 E;  2K9D A;  4UN2 B;  3FRI A;  3MMP A;  1G41 A;  4G3O A;  1V92 A;  1OAI A;  3LCV B;  3IEC A;  3T6P A;  1NV8 A;  1YLA A;  4R71 A;  1DV0 A;  1PGY A;  2DAI A;  4F1I A;  2JZ1 A;  1VEG A;  3K9P A;  1SG9 A;  1E94 E;  1DO2 A;  2L2D A;  1OQY A;  1OKS A;  2JY8 A;  2DI0 A;  2K0B X;  1OTR A;  1R4G A;  2LVN C;  1ZMW A;  2CWB A;  2EKF A;  2KNA A;  4HEO A;  2LVO C;  3GLG E;  2LVP C;  1T43 A;  1WGN A;  1WJ7 A;  5JI2 E;  3FRH A;  1VQ1 A;  4F2L A;  2HWJ A;  2DAM A;  1DO0 A;  4Q7J A;  2QHO B;  2LTU A;  1HJP A;  1VDL A;  2OOB A;  1ZMU A;  1ZMV A;  2DAK A;  1WIV A;  3FE3 A;  2O25 A;  1UFZ A;  2MGW A;  2LVQ D;  2LVA A;  2BWB A;  1HT2 E;  3H4J A;  2H5X A;  1XXH E;  2DNA A;  3E46 A;  1Y8G A;  3F92 A;  1WR1 B;  1GO5 A;  2OOA A;  2MJ5 B;  1KYI A;  2QSF X;  1XB2 B;  2ZTC A;  1NV9 A;  1VEK A;  2JZ0 A;  1BVS A;  1CUK A;  2ZTD A;  1G4A E;  1EFU B;  4DBG B;  1IFY A;  1WHC A;  2OO9 A;  1WGL A;  2BWE A;  3GLI E;  1IM2 A;  1JR3 E;  2B3T A;  2DAG A;  2DKL A;  5DFL A;  2EKK A;  2L4F A;  3GLH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...