3BBZA

Structure of the nucleocapsid-binding domain from the mumps virus phosphoprotein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
48
structure length
48
Chain Sequence
GQKVMITKMITDSVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein, replication
molecule keywords P protein
publication title Structure of the nucleocapsid-binding domain from the mumps virus polymerase; an example of protein folding induced by crystallization
pubmed doi rcsb
source organism Mumps virus
total genus 20
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3bbzA00
1DO2A 1EFUB 1ZV1A 4HEOA 1VEKA 1XB2B 1G41A 3H4JA 2QHOB 1SG9A 1A5TA 3FRHA 2DZLA 3GLIE 1ZMWA 2DENA 1CUKA 3LCUA 4R71A 2L4EA 1ZMUA 2K9DA 1TTEA 2JNHA 3IHPA 4UN2B 3K9PA 1KYIA 2DAMA 2K0BX 2BWBA 2DAEA 2DI0A 1DV0A 1WGNA 2DAIA 1AIPC 5JI2E 1VEJA 5DFLA 1HT1E 2ZTCA 1WJ7A 1OQYA 1T43A 1IFYA 2OOBA 2JY5A 2O25A 2KNVA 3BBZA 1NV8A 2H5XA 3E21A 2CWBA 2LVQD 2HAKA 4Q7JA 2KNZA 1G4AE 1R4GA 1JR3E 2QNJA 3T6PA 1WGLA 2L4FA 2LTUA 2LVPC 1Y8GA 2DAGA 1IXSA 4WP2A 2QSFX 1IM2A 1VEGA 2B3TA 1VDLA 2MROB 1OAIA 4F1IA 2JP7A 4F2LA 2JZ1A 2JY7A 2KNAA 3B89A 1WHCA 2G3QA 1ZMVA 1GO5A 1OTRA 2R0IA 2MGWA 2ZTDA 2RRUA 2MR9A 2EKFA 3GLFE 3F92A 2LVOC 2JUJA 1VG5A 1V92A 1BVSA 1NV9A 2DHYA 1OKSA 1PGYA 3E46A 2DKLA 1C7YA 2HWJA 3IECA 2JY6B 1G3IA 3K9OA 2CP8A 2LVAA 2JY8A 4G3OA 1F4IA 1HT2E 2LBCA 2WZJA 1DO0A 1Q02A 1P3QQ 2KHHA 3LCVB 2DNAA 1E94E 1UFZA 3GLHE 2JZ0A 1MN3A 3GLGE 2L2DA 1WR1B 1YLAA 3MMPA 3FRIA 4GEWA 2LVNC 2OOAA 1T6OA 1HQYE 1XXHE 4DBGB 2MJ5B 1HJPA 1TR8A 3FE3A 2EJSA 2BWEA 1VQ1A 2DAKA 1WIVA 2EKKA 1QZEA 2OO9A
chains in the Genus database with same CATH superfamily
1DO2A 2XGNA 1HR0M 1EFUB 1MJGM 1ZV1A 1Z6TA 4JI1M 4HEOA 1YUBA 3CF6E 4D82A 3GRVA 2QHOB 1PJSA 3I4YA 4GC9A 1A5TA 3FRHA 3GP1A 4AQYM 1GL6A 5H37D 1W5SA 2KDLA 3GQ5A 4FCVA 1K3WA 2DENA 4QHTA 1XMOM 1CUKA 1LV7A 1GJTA 1TDZA 4FWHA 4L78A 3ZH9B 3DOAA 2R45A 4GITA 2CEAA 5ITRA 2K9DA 2JNHA 5FSWA 5KQDA 3WHKA 5KPRA 3K9PA 2LHGA 3GLFB 1J09A 5DNYA 2DAMA 1R2YA 4LJ7A 4QHSA 3EIEA 4Y28F 3TL4X 3SBJA 3SAWA 3KDSE 3U60A 2N35A 1OIZA 4IBCA 4M9XA 3L25A 5JI2E 4X62M 3RGPA 4LF9M 4XGIA 3PFIA 3AOEA 4JXJA 4GMQA 2VIIA 4JI4M 2UU9M 3FUVA 1NVMA 5FTKA 3TWKA 4KHPM 3KS4A 3Q8XA 2J7NA 1NHWC 2QENA 2LVQD 3NBXX 3A42A 2QPAA 4KODA 4X66M 2KNZA 3GLIB 2DVWB 4PDGA 2XSZD 3WHLA 3QYBA 1X37A 2C96A 4B3MM 2KZUA 2Q2EB 1Y8GA 2DWLA 1IXSA 1S3SA 2YR0A 2ZM6M 2I7PA 1N77A 2Z3XA 3ILKA 4NL4H 4DR6M 2LH0A 1XXHB 3VKGA 1KSFX 1D0LA 1OFIA 4OVZB 4P16A 3KSXA 3AL0C 2NQ8C 3U5ZB 3U6PA 4F1IA 3TQSA 2L6OA 1L8QA 3BOSA 4XBOA 4NXMM 4MGZE 1JR3A 2KNAA 5GKNA 5C1BA 4G4RA 3FKEA 4CISA 3UZUA 3KS8A 3ZQJA 1QQWA 1QVRA 2R0IA 4JI8M 2XF3A 4HL4A 3VLFB 4IBBA 2ZTDA 3B7ZA 2FFJA 3IG8A 4ZPXA 3SFZA 5FTLA 1IBKM 2EKFA 1L1ZA 1LTMA 3M0EA 4LG2A 2XZFA 4LRTA 1VG5A 1Z5BA 3GQ4A 2GQFA 1IN4A 1OKSA 2CHQA 1PGYA 1IXZA 2DKLA 2FE8A 2KRUA 3D8LA 3E46A 1C7YA 2KRKA 2O5RA 2QBYA 4LJAA 3HHWA 3U6DA 1QUTA 3CTWB 1Z5AA 4RF0A 4B7FA 2Y20A 2RKOA 1F4IA 3A46A 1HT2E 2BNKA 2HCBA 2OQ4A 1GVNA 1N32M 4YHHM 5EXPA 2KHHA 2R18A 3B7QA 2CUZA 1DGHA 1W5TA 4L4UA 3U61A 2G5GX 3TWLA 5KQ8A 1EE8A 3HWSA 2L2DA 4M0WA 3GO8A 4LF6M 5LMNM 4HLQA 4DR5M 1WR1B 4JI6M 2CFOA 2L7HA 3SMPA 4AG6A 3U6EA 2LVNC 2OOAA 3PNYA 3HU2A 2R4EA 2ZANA 1MU5A 2FS1A 4DBGB 4LFAM 2UUCM 5EJCA 4BB9A 2BWEA 2FH0A 4L8RC 2JXNA 2DAKA 2O01F 2D7GA 3LW5F 3HGIA 1GABA 3GLHA 3GLGA 3GPXA 1IBLM 1GKIA 2DWZB 3L2AA 1OJLA 1XB2B 1G41A 1OIPA 1SXJB 1UM8A 3H4JA 3NWLA 4W5WA 1SXJC 4DV2M 3THGA 1SG9A 1D0KA 2UXCM 2XFTA 3T1YM 3J81S 2CHVA 4JV5M 3FTCA 3KP0E 4IJEA 3GLIE 4IBIA 3PXGA 2LHCA 3C3DA 2ZBKB 4JN6A 1NNJA 4BLCA 1JQJC 3K8ZA 4MGIE 1TDHA 5ITUA 2L4EA 2QZ4A 1IN5A 3QYEA 2HHHM 1TTEA 3RFWA 4S12A 3FTEA 1T3TA 1IY0A 4IBGA 1N78A 2CE7A 2K0BX 2BWBA 4G4QA 3U6CA 4DV7M 3I51A 3FYCA 5FTJA 1K82A 2C5RA 3SARA 4IBEA 4LF4M 1DV0A 1AIPC 3JR5A 1E32A 1J5EM 4LGMA 1R7RA 4QNMA 4Z8XA 5E26A 1TF0B 1DGGA 1E9SA 4M0DA 3I01M 5ITTA 3BBZA 2KNVA 3J2PB 3L27A 2H5XA 2W82A 4RNAA 4XK8F 5FTNA 3JR4A 2DWNA 2E5LM 2HAKA 2VQEM 4GH9A 2V6ZM 3CGWA 2K47A 1G4AE 2LWXA 4CGYB 3U60B 4AKGA 1J7KA 1PJIA 2LVPC 1PJQA 3FUUA 1QZMA 2V1CA 1IM2A 2M5ZA 3AOEC 4LCBA 4WP2A 5IZ7D 3HHZA 1VEGA 2B3TA 3HJQA 4EIWA 4JI7M 4CHTB 3VK7A 2DXIA 3FTFA 2VDBB 2D7EA 2HL7A 4QNRA 5LMUM 2JP7A 3KW6A 2UUAM 2C9CA 2JY7A 3B74A 3VFDA 2G3QA 4D80A 3HU3A 2F5OA 3B9PA 3HJSA 1IQPA 7CATA 2MR9A 2ZAMA 2APLA 3HU1A 3GPYA 4MB7A 3KFUG 3W68A 1QDRA 5ITXE 2DWMA 2JUJA 2C99A 3CF0A 3UK6A 4ANRA 2R46A 3T38A 4JI2M 2DHYA 1FJGM 2J5YA 3W0FA 1N36M 1IN8A 3LQQA 2CP8A 4LJ8A 1SXJE 3TWMA 3GRYA 1QAMA 1R2ZA 1WXQA 2LBCA 1I94M 5L8RF 1IN6A 1DO0A 2H1RA 1P3QQ 3I04M 3GLFA 3HHYA 4D81A 4GKKM 1ZQ9A 3LCVB 2P5TA 2EUCA 2VF8A 4R3DA 3AKZA 2KA6B 3J80S 3VDUA 5BPVA 4GKJM 2QBYB 3M7GA 1NY5A 4G4OA 4FW9A 3D8BA 4L16A 4CJ6A 2YNMD 2DZOB 4LY6A 3M6AA 2RGOA 1L1TA 1T6OA 4MGYE 1XNQM 2EA0A 3FE3A 3KOXE 3RE8A 2F4VM 2XLJA 2R65A 4JI3M 2OO9A 2DHRA 3HKPA 4OX9M 5KPTA 1XHBA 3A98B 2QCUA 3W67A 2EO2A 3VKHA 2Y21A 1ZAEA 3GPPA 3ZC7B 3UMMA 1QANA 1XXHA 3DZDA 3LQRA 4OVZA 4KO8A 4FWDA 4AW4A 3GRUA 5FTMA 2DZLA 3U5ZA 1QYRA 1ZMWA 3LCUA 4DV5M 1N75A 2KW0A 4NRVA 3GLHB 4R71A 2GNOA 1QAOA 4B08A 4TUWA 1ZMUA 4AG5A 4GIPA 4X64M 3HX3A 1TGUA 3A45A 5EP1A 2XZUA 3BXWA 1KYIA 4LF8M 3FTDA 3SYKA 1QDTA 2F5NA 2UXDM 4NSOB 1IY1A 2DAEA 2DI0A 2C98A 1N33M 1K3XA 3KOYE 3KOZE 1KFVA 5DFLA 5C18A 1HT1E 1V34A 3L29A 2ZTCA 4GHAA 4AKIA 1H6UA 1WJ7A 4PCZA 1OQYA 1TH2A 1D2NA 2CHGA 1T43A 3TPZA 4A3VB 4DV6M 2OOBA 3B7NA 3HJ8A 5ITYA 4I81A 2KXEA 4DUZM 1NNUC 1NV8A 2Z8YM 3GQ3A 1TH4A 4PDIA 4G4NA 5EXXA 4Q7JA 4GRIA 2YQZA 3CF2A 2QNJA 3E4RA 3UJNA 1JR3E 1N34M 2L4FA 4B7HA 3ZCBB 5ITQA 4IIWA 2DAGA 3H4MA 2RGHA 2ZAOA 5EXSA 3SAVA 4RF1A 4LRSA 4X65M 3AOGA 2MROB 2WSCF 4B7GA 3U6QA 5DYGA 4IBKA 3FUTA 3KP1E 4MGKE 1E9RA 2V1UA 4BBAA 4YY3M 3B89A 1WHCA 4NOOB 1L2CA 2QP9X 1OTRA 2JWSA 2MGWA 4Z6YA 2RRUA 8CATA 1R5LA 3TE6A 4B3SM 2XFSA 3F92A 4LJ9A 4QOZC 2CV2A 4NRWA 4DR2M 2R6FA 1V92A 1HNXM 1BVSA 4LJ4A 4PD2A 3RGSA 4P17A 4LZJA 3IECA 1QUSA 4L6V6 4JYAM 4LFCM 4NC6A 2L7IA 3QAUA 1Q39A 4G3OA 5EP2A 3OTOM 2X4AA 4LJ6A 3DFZA 1L2BA 4FD2A 1PJTA 1Q02A 3C3EA 3U6OA 2UUBM 2FOIC 4WURA 1PJJA 1E94E 3GLHE 2JZ0A 3K92A 1IXSB 1MN3A 3GLGE 2KEBA 1GLNA 2Z4RA 5BR8M 1DGBA 3MK6A 1HQCA 3SC3A 3GRRA 3MMPA 5A2QS 2G8LA 2F5PA 4GEWA 3SHGB 1XC8A 4LGYA 1G59A 2Z4SA 3SYLA 2D7HA 3L28A 2MH8A 3J27B 1VDDA 1VQ1A 2R44A 3GPUA 1YE9A 3FD9A 1WIVA 4DR1M 1GJSA 1L2DA 4LFBM 2X49A 3VDPA 1VEKA 4CIZA 1Q3BA 1V33A 2VQFM 1OAOC 1TH3A 3EIHA 3NBIA 4B3RM 1R6BX 4NXNM 3C58A 1NHGC 1XNRM 1SXJD 5EXTA 4IJFA 1IY2A 2UXBM 3Q8GA 4DV1M 2K6BA 2X8AA 3LVWA 3QWLA 4DR7M 1JB0F 2HKJA 4MM3B 4REZA 4FVMA 4I8OA 3AFHA 3KXEC 1IN7A 1NO1A 2M60A 3E9SA 5KO3A 3IHPA 3SAUA 4K0KM 4UN2B 4LZZA 1D0MA 1QAQA 3AJIB 2I7NA 1G8PA 4GC5A 2OPFA 4LF5M 4DR4M 3C9PA 1EIJA 1DGHB 4MH0E 1I4WA 4DR3M 3U61B 3GLIA 1WGNA 2DAIA 1OFHA 4PT5A 2BJWA 1VEJA 1G71A 3V76A 1FNNA 4DUYM 4DV0M 1Z5CA 2LNHC 2R4JA 1IFYA 4KLNA 3MHVC 3I4VA 2JY5A 2O25A 2CV0A 4JI5M 3E21A 2CWBA 3PNVA 4LJ5A 4AI6A 4B3TM 1Q3CA 1R4GA 3T6PA 1GL7A 2CV1A 1WGLA 3T1HM 3GLGB 2DZNB 5F3WA 2LTUA 2F5SA 1IXRC 2WSEF 3K2LA 4IBFA 3FYDA 2Z7JA 4OU7A 1HNWM 5DYIA 2QSFX 5IT9S 3J7BA 3DA1A 4FWGA 3KSJA 1PM5A 1VDLA 1OAIA 4DV4M 3W0LB 3HY5A 3K1JA 2L09A 4F2LA 1MX0A 2XEPA 3HZJA 3AV0A 3JAMS 3R9XB 1Z59A 2JZ1A 3L26A 2A5YB 4FCTA 3U6MA 5JI3E 1NJFA 2FNAA 5EP3A 1ZMVA 3HHXA 1GO5A 2VF7A 1YSYA 3PVSA 4JI0M 3GLFE 2WSFF 2JA2A 1NJGA 2LVOC 2XH9A 3FUXA 3SATA 1HNZM 1XWIA 4I4LA 1C1KA 1NV9A 4R7GA 2AHMA 4OW0A 4FCWA 3KOWE 4ITQA 2HWJA 2JY6B 3MJ5A 5IWAM 2YFQA 3T15A 4WW0A 4RKUF 1G3IA 3K9OA 2LVAA 1JR3D 2JY8A 4L15A 4KT0F 5KPZA 3LVVA 4AKHA 1XMQM 4AZFA 2LXEA 2KZSA 2C9OA 2WZJA 5ITXA 1PRBA 5EQTA 4QOSA 1NSFA 1DGFA 2DNAA 4MGHA 1RU3A 1AUAA 1UFZA 2J7OA 4IBDA 3KVWA 5EP4A 5E6JA 1ORYB 4I5SA 4IBJA 4LF7M 5IREB 5FLXS 1IBMM 2QQ8A 2CRUA 1NY6A 4M9ZA 3LMMA 1YLAA 4NSRA 3U6LA 1SXJA 2Y0QA 4II7A 3FRIA 3SHFA 2R62A 2F5QA 3IG5A 1HQYE 1XXHE 2ERCA 3FUWA 4M9SA 3SMSA 2MJ5B 3UGJA 2Y0TA 3VK8A 3R8FA 1HJPA 1TR8A 2BJVA 2XSZA 2EJSA 3J7AS 4G6ZA 3SASA 4DV3M 3U6SA 2EKKA 1QZEA 4GHLA
chains in the Genus database with same CATH topology
1DO2A 1EFUB 1ZV1A 4HEOA 1VEKA 1XB2B 1G41A 3H4JA 2QHOB 1SG9A 1A5TA 3FRHA 2DZLA 3GLIE 1ZMWA 2DENA 1CUKA 3LCUA 4R71A 2L4EA 1ZMUA 2K9DA 1TTEA 2JNHA 3IHPA 4UN2B 3K9PA 1KYIA 2DAMA 2K0BX 2BWBA 2DAEA 2DI0A 1DV0A 1WGNA 2DAIA 1AIPC 5JI2E 1VEJA 5DFLA 1HT1E 2ZTCA 1WJ7A 1OQYA 1T43A 1IFYA 2OOBA 2JY5A 2O25A 2KNVA 3BBZA 1NV8A 2H5XA 3E21A 2CWBA 2LVQD 2HAKA 4Q7JA 2KNZA 1G4AE 1R4GA 1JR3E 2QNJA 3T6PA 1WGLA 2L4FA 2LTUA 2LVPC 1Y8GA 2DAGA 1IXSA 4WP2A 2QSFX 1IM2A 1VEGA 2B3TA 1VDLA 2MROB 1OAIA 4F1IA 2JP7A 4F2LA 2JZ1A 2JY7A 2KNAA 3B89A 1WHCA 2G3QA 1ZMVA 1GO5A 1OTRA 2R0IA 2MGWA 2ZTDA 2RRUA 2MR9A 2EKFA 3GLFE 3F92A 2LVOC 2JUJA 1VG5A 1V92A 1BVSA 1NV9A 2DHYA 1OKSA 1PGYA 3E46A 2DKLA 1C7YA 2HWJA 3IECA 2JY6B 1G3IA 3K9OA 2CP8A 2LVAA 2JY8A 4G3OA 1F4IA 1HT2E 2LBCA 2WZJA 1DO0A 1Q02A 1P3QQ 2KHHA 3LCVB 2DNAA 1E94E 1UFZA 3GLHE 2JZ0A 1MN3A 3GLGE 2L2DA 1WR1B 1YLAA 3MMPA 3FRIA 4GEWA 2LVNC 2OOAA 1T6OA 1HQYE 1XXHE 4DBGB 2MJ5B 1HJPA 1TR8A 3FE3A 2EJSA 2BWEA 1VQ1A 2DAKA 1WIVA 2EKKA 1QZEA 2OO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DO2 A;  1EFU B;  1ZV1 A;  4HEO A;  1VEK A;  1XB2 B;  1G41 A;  3H4J A;  2QHO B;  1SG9 A;  1A5T A;  3FRH A;  2DZL A;  3GLI E;  1ZMW A;  2DEN A;  1CUK A;  3LCU A;  4R71 A;  2L4E A;  1ZMU A;  2K9D A;  1TTE A;  2JNH A;  3IHP A;  4UN2 B;  3K9P A;  1KYI A;  2DAM A;  2K0B X;  2BWB A;  2DAE A;  2DI0 A;  1DV0 A;  1WGN A;  2DAI A;  1AIP C;  5JI2 E;  1VEJ A;  5DFL A;  1HT1 E;  2ZTC A;  1WJ7 A;  1OQY A;  1T43 A;  1IFY A;  2OOB A;  2JY5 A;  2O25 A;  2KNV A;  3BBZ A;  1NV8 A;  2H5X A;  3E21 A;  2CWB A;  2LVQ D;  2HAK A;  4Q7J A;  2KNZ A;  1G4A E;  1R4G A;  1JR3 E;  2QNJ A;  3T6P A;  1WGL A;  2L4F A;  2LTU A;  2LVP C;  1Y8G A;  2DAG A;  1IXS A;  4WP2 A;  2QSF X;  1IM2 A;  1VEG A;  2B3T A;  1VDL A;  2MRO B;  1OAI A;  4F1I A;  2JP7 A;  4F2L A;  2JZ1 A;  2JY7 A;  2KNA A;  3B89 A;  1WHC A;  2G3Q A;  1ZMV A;  1GO5 A;  1OTR A;  2R0I A;  2MGW A;  2ZTD A;  2RRU A;  2MR9 A;  2EKF A;  3GLF E;  3F92 A;  2LVO C;  2JUJ A;  1VG5 A;  1V92 A;  1BVS A;  1NV9 A;  2DHY A;  1OKS A;  1PGY A;  3E46 A;  2DKL A;  1C7Y A;  2HWJ A;  3IEC A;  2JY6 B;  1G3I A;  3K9O A;  2CP8 A;  2LVA A;  2JY8 A;  4G3O A;  1F4I A;  1HT2 E;  2LBC A;  2WZJ A;  1DO0 A;  1Q02 A;  1P3Q Q;  2KHH A;  3LCV B;  2DNA A;  1E94 E;  1UFZ A;  3GLH E;  2JZ0 A;  1MN3 A;  3GLG E;  2L2D A;  1WR1 B;  1YLA A;  3MMP A;  3FRI A;  4GEW A;  2LVN C;  2OOA A;  1T6O A;  1HQY E;  1XXH E;  4DBG B;  2MJ5 B;  1HJP A;  1TR8 A;  3FE3 A;  2EJS A;  2BWE A;  1VQ1 A;  2DAK A;  1WIV A;  2EKK A;  1QZE A;  2OO9 A; 
#chains in the Genus database with same CATH topology
 1DO2 A;  2XGN A;  1HR0 M;  1EFU B;  1MJG M;  1ZV1 A;  1Z6T A;  4JI1 M;  4HEO A;  1YUB A;  3CF6 E;  4D82 A;  3GRV A;  2QHO B;  1PJS A;  3I4Y A;  4GC9 A;  1A5T A;  3FRH A;  3GP1 A;  4AQY M;  1GL6 A;  5H37 D;  1W5S A;  2KDL A;  3GQ5 A;  4FCV A;  1K3W A;  2DEN A;  4QHT A;  1XMO M;  1CUK A;  1LV7 A;  1GJT A;  1TDZ A;  4FWH A;  4L78 A;  3ZH9 B;  3DOA A;  2R45 A;  4GIT A;  2CEA A;  5ITR A;  2K9D A;  2JNH A;  5FSW A;  5KQD A;  3WHK A;  5KPR A;  3K9P A;  2LHG A;  3GLF B;  1J09 A;  5DNY A;  2DAM A;  1R2Y A;  4LJ7 A;  4QHS A;  3EIE A;  4Y28 F;  3TL4 X;  3SBJ A;  3SAW A;  3KDS E;  3U60 A;  2N35 A;  1OIZ A;  4IBC A;  4M9X A;  3L25 A;  5JI2 E;  4X62 M;  3RGP A;  4LF9 M;  4XGI A;  3PFI A;  3AOE A;  4JXJ A;  4GMQ A;  2VII A;  4JI4 M;  2UU9 M;  3FUV A;  1NVM A;  5FTK A;  3TWK A;  4KHP M;  3KS4 A;  3Q8X A;  2J7N A;  1NHW C;  2QEN A;  2LVQ D;  3NBX X;  3A42 A;  2QPA A;  4KOD A;  4X66 M;  2KNZ A;  3GLI B;  2DVW B;  4PDG A;  2XSZ D;  3WHL A;  3QYB A;  1X37 A;  2C96 A;  4B3M M;  2KZU A;  2Q2E B;  1Y8G A;  2DWL A;  1IXS A;  1S3S A;  2YR0 A;  2ZM6 M;  2I7P A;  1N77 A;  2Z3X A;  3ILK A;  4NL4 H;  4DR6 M;  2LH0 A;  1XXH B;  3VKG A;  1KSF X;  1D0L A;  1OFI A;  4OVZ B;  4P16 A;  3KSX A;  3AL0 C;  2NQ8 C;  3U5Z B;  3U6P A;  4F1I A;  3TQS A;  2L6O A;  1L8Q A;  3BOS A;  4XBO A;  4NXM M;  4MGZ E;  1JR3 A;  2KNA A;  5GKN A;  5C1B A;  4G4R A;  3FKE A;  4CIS A;  3UZU A;  3KS8 A;  3ZQJ A;  1QQW A;  1QVR A;  2R0I A;  4JI8 M;  2XF3 A;  4HL4 A;  3VLF B;  4IBB A;  2ZTD A;  3B7Z A;  2FFJ A;  3IG8 A;  4ZPX A;  3SFZ A;  5FTL A;  1IBK M;  2EKF A;  1L1Z A;  1LTM A;  3M0E A;  4LG2 A;  2XZF A;  4LRT A;  1VG5 A;  1Z5B A;  3GQ4 A;  2GQF A;  1IN4 A;  1OKS A;  2CHQ A;  1PGY A;  1IXZ A;  2DKL A;  2FE8 A;  2KRU A;  3D8L A;  3E46 A;  1C7Y A;  2KRK A;  2O5R A;  2QBY A;  4LJA A;  3HHW A;  3U6D A;  1QUT A;  3CTW B;  1Z5A A;  4RF0 A;  4B7F A;  2Y20 A;  2RKO A;  1F4I A;  3A46 A;  1HT2 E;  2BNK A;  2HCB A;  2OQ4 A;  1GVN A;  1N32 M;  4YHH M;  5EXP A;  2KHH A;  2R18 A;  3B7Q A;  2CUZ A;  1DGH A;  1W5T A;  4L4U A;  3U61 A;  2G5G X;  3TWL A;  5KQ8 A;  1EE8 A;  3HWS A;  2L2D A;  4M0W A;  3GO8 A;  4LF6 M;  5LMN M;  4HLQ A;  4DR5 M;  1WR1 B;  4JI6 M;  2CFO A;  2L7H A;  3SMP A;  4AG6 A;  3U6E A;  2LVN C;  2OOA A;  3PNY A;  3HU2 A;  2R4E A;  2ZAN A;  1MU5 A;  2FS1 A;  4DBG B;  4LFA M;  2UUC M;  5EJC A;  4BB9 A;  2BWE A;  2FH0 A;  4L8R C;  2JXN A;  2DAK A;  2O01 F;  2D7G A;  3LW5 F;  3HGI A;  1GAB A;  3GLH A;  3GLG A;  3GPX A;  1IBL M;  1GKI A;  2DWZ B;  3L2A A;  1OJL A;  1XB2 B;  1G41 A;  1OIP A;  1SXJ B;  1UM8 A;  3H4J A;  3NWL A;  4W5W A;  1SXJ C;  4DV2 M;  3THG A;  1SG9 A;  1D0K A;  2UXC M;  2XFT A;  3T1Y M;  3J81 S;  2CHV A;  4JV5 M;  3FTC A;  3KP0 E;  4IJE A;  3GLI E;  4IBI A;  3PXG A;  2LHC A;  3C3D A;  2ZBK B;  4JN6 A;  1NNJ A;  4BLC A;  1JQJ C;  3K8Z A;  4MGI E;  1TDH A;  5ITU A;  2L4E A;  2QZ4 A;  1IN5 A;  3QYE A;  2HHH M;  1TTE A;  3RFW A;  4S12 A;  3FTE A;  1T3T A;  1IY0 A;  4IBG A;  1N78 A;  2CE7 A;  2K0B X;  2BWB A;  4G4Q A;  3U6C A;  4DV7 M;  3I51 A;  3FYC A;  5FTJ A;  1K82 A;  2C5R A;  3SAR A;  4IBE A;  4LF4 M;  1DV0 A;  1AIP C;  3JR5 A;  1E32 A;  1J5E M;  4LGM A;  1R7R A;  4QNM A;  4Z8X A;  5E26 A;  1TF0 B;  1DGG A;  1E9S A;  4M0D A;  3I01 M;  5ITT A;  3BBZ A;  2KNV A;  3J2P B;  3L27 A;  2H5X A;  2W82 A;  4RNA A;  4XK8 F;  5FTN A;  3JR4 A;  2DWN A;  2E5L M;  2HAK A;  2VQE M;  4GH9 A;  2V6Z M;  3CGW A;  2K47 A;  1G4A E;  2LWX A;  4CGY B;  3U60 B;  4AKG A;  1J7K A;  1PJI A;  2LVP C;  1PJQ A;  3FUU A;  1QZM A;  2V1C A;  1IM2 A;  2M5Z A;  3AOE C;  4LCB A;  4WP2 A;  5IZ7 D;  3HHZ A;  1VEG A;  2B3T A;  3HJQ A;  4EIW A;  4JI7 M;  4CHT B;  3VK7 A;  2DXI A;  3FTF A;  2VDB B;  2D7E A;  2HL7 A;  4QNR A;  5LMU M;  2JP7 A;  3KW6 A;  2UUA M;  2C9C A;  2JY7 A;  3B74 A;  3VFD A;  2G3Q A;  4D80 A;  3HU3 A;  2F5O A;  3B9P A;  3HJS A;  1IQP A;  7CAT A;  2MR9 A;  2ZAM A;  2APL A;  3HU1 A;  3GPY A;  4MB7 A;  3KFU G;  3W68 A;  1QDR A;  5ITX E;  2DWM A;  2JUJ A;  2C99 A;  3CF0 A;  3UK6 A;  4ANR A;  2R46 A;  3T38 A;  4JI2 M;  2DHY A;  1FJG M;  2J5Y A;  3W0F A;  1N36 M;  1IN8 A;  3LQQ A;  2CP8 A;  4LJ8 A;  1SXJ E;  3TWM A;  3GRY A;  1QAM A;  1R2Z A;  1WXQ A;  2LBC A;  1I94 M;  5L8R F;  1IN6 A;  1DO0 A;  2H1R A;  1P3Q Q;  3I04 M;  3GLF A;  3HHY A;  4D81 A;  4GKK M;  1ZQ9 A;  3LCV B;  2P5T A;  2EUC A;  2VF8 A;  4R3D A;  3AKZ A;  2KA6 B;  3J80 S;  3VDU A;  5BPV A;  4GKJ M;  2QBY B;  3M7G A;  1NY5 A;  4G4O A;  4FW9 A;  3D8B A;  4L16 A;  4CJ6 A;  2YNM D;  2DZO B;  4LY6 A;  3M6A A;  2RGO A;  1L1T A;  1T6O A;  4MGY E;  1XNQ M;  2EA0 A;  3FE3 A;  3KOX E;  3RE8 A;  2F4V M;  2XLJ A;  2R65 A;  4JI3 M;  2OO9 A;  2DHR A;  3HKP A;  4OX9 M;  5KPT A;  1XHB A;  3A98 B;  2QCU A;  3W67 A;  2EO2 A;  3VKH A;  2Y21 A;  1ZAE A;  3GPP A;  3ZC7 B;  3UMM A;  1QAN A;  1XXH A;  3DZD A;  3LQR A;  4OVZ A;  4KO8 A;  4FWD A;  4AW4 A;  3GRU A;  5FTM A;  2DZL A;  3U5Z A;  1QYR A;  1ZMW A;  3LCU A;  4DV5 M;  1N75 A;  2KW0 A;  4NRV A;  3GLH B;  4R71 A;  2GNO A;  1QAO A;  4B08 A;  4TUW A;  1ZMU A;  4AG5 A;  4GIP A;  4X64 M;  3HX3 A;  1TGU A;  3A45 A;  5EP1 A;  2XZU A;  3BXW A;  1KYI A;  4LF8 M;  3FTD A;  3SYK A;  1QDT A;  2F5N A;  2UXD M;  4NSO B;  1IY1 A;  2DAE A;  2DI0 A;  2C98 A;  1N33 M;  1K3X A;  3KOY E;  3KOZ E;  1KFV A;  5DFL A;  5C18 A;  1HT1 E;  1V34 A;  3L29 A;  2ZTC A;  4GHA A;  4AKI A;  1H6U A;  1WJ7 A;  4PCZ A;  1OQY A;  1TH2 A;  1D2N A;  2CHG A;  1T43 A;  3TPZ A;  4A3V B;  4DV6 M;  2OOB A;  3B7N A;  3HJ8 A;  5ITY A;  4I81 A;  2KXE A;  4DUZ M;  1NNU C;  1NV8 A;  2Z8Y M;  3GQ3 A;  1TH4 A;  4PDI A;  4G4N A;  5EXX A;  4Q7J A;  4GRI A;  2YQZ A;  3CF2 A;  2QNJ A;  3E4R A;  3UJN A;  1JR3 E;  1N34 M;  2L4F A;  4B7H A;  3ZCB B;  5ITQ A;  4IIW A;  2DAG A;  3H4M A;  2RGH A;  2ZAO A;  5EXS A;  3SAV A;  4RF1 A;  4LRS A;  4X65 M;  3AOG A;  2MRO B;  2WSC F;  4B7G A;  3U6Q A;  5DYG A;  4IBK A;  3FUT A;  3KP1 E;  4MGK E;  1E9R A;  2V1U A;  4BBA A;  4YY3 M;  3B89 A;  1WHC A;  4NOO B;  1L2C A;  2QP9 X;  1OTR A;  2JWS A;  2MGW A;  4Z6Y A;  2RRU A;  8CAT A;  1R5L A;  3TE6 A;  4B3S M;  2XFS A;  3F92 A;  4LJ9 A;  4QOZ C;  2CV2 A;  4NRW A;  4DR2 M;  2R6F A;  1V92 A;  1HNX M;  1BVS A;  4LJ4 A;  4PD2 A;  3RGS A;  4P17 A;  4LZJ A;  3IEC A;  1QUS A;  4L6V 6;  4JYA M;  4LFC M;  4NC6 A;  2L7I A;  3QAU A;  1Q39 A;  4G3O A;  5EP2 A;  3OTO M;  2X4A A;  4LJ6 A;  3DFZ A;  1L2B A;  4FD2 A;  1PJT A;  1Q02 A;  3C3E A;  3U6O A;  2UUB M;  2FOI C;  4WUR A;  1PJJ A;  1E94 E;  3GLH E;  2JZ0 A;  3K92 A;  1IXS B;  1MN3 A;  3GLG E;  2KEB A;  1GLN A;  2Z4R A;  5BR8 M;  1DGB A;  3MK6 A;  1HQC A;  3SC3 A;  3GRR A;  3MMP A;  5A2Q S;  2G8L A;  2F5P A;  4GEW A;  3SHG B;  1XC8 A;  4LGY A;  1G59 A;  2Z4S A;  3SYL A;  2D7H A;  3L28 A;  2MH8 A;  3J27 B;  1VDD A;  1VQ1 A;  2R44 A;  3GPU A;  1YE9 A;  3FD9 A;  1WIV A;  4DR1 M;  1GJS A;  1L2D A;  4LFB M;  2X49 A;  3VDP A;  1VEK A;  4CIZ A;  1Q3B A;  1V33 A;  2VQF M;  1OAO C;  1TH3 A;  3EIH A;  3NBI A;  4B3R M;  1R6B X;  4NXN M;  3C58 A;  1NHG C;  1XNR M;  1SXJ D;  5EXT A;  4IJF A;  1IY2 A;  2UXB M;  3Q8G A;  4DV1 M;  2K6B A;  2X8A A;  3LVW A;  3QWL A;  4DR7 M;  1JB0 F;  2HKJ A;  4MM3 B;  4REZ A;  4FVM A;  4I8O A;  3AFH A;  3KXE C;  1IN7 A;  1NO1 A;  2M60 A;  3E9S A;  5KO3 A;  3IHP A;  3SAU A;  4K0K M;  4UN2 B;  4LZZ A;  1D0M A;  1QAQ A;  3AJI B;  2I7N A;  1G8P A;  4GC5 A;  2OPF A;  4LF5 M;  4DR4 M;  3C9P A;  1EIJ A;  1DGH B;  4MH0 E;  1I4W A;  4DR3 M;  3U61 B;  3GLI A;  1WGN A;  2DAI A;  1OFH A;  4PT5 A;  2BJW A;  1VEJ A;  1G71 A;  3V76 A;  1FNN A;  4DUY M;  4DV0 M;  1Z5C A;  2LNH C;  2R4J A;  1IFY A;  4KLN A;  3MHV C;  3I4V A;  2JY5 A;  2O25 A;  2CV0 A;  4JI5 M;  3E21 A;  2CWB A;  3PNV A;  4LJ5 A;  4AI6 A;  4B3T M;  1Q3C A;  1R4G A;  3T6P A;  1GL7 A;  2CV1 A;  1WGL A;  3T1H M;  3GLG B;  2DZN B;  5F3W A;  2LTU A;  2F5S A;  1IXR C;  2WSE F;  3K2L A;  4IBF A;  3FYD A;  2Z7J A;  4OU7 A;  1HNW M;  5DYI A;  2QSF X;  5IT9 S;  3J7B A;  3DA1 A;  4FWG A;  3KSJ A;  1PM5 A;  1VDL A;  1OAI A;  4DV4 M;  3W0L B;  3HY5 A;  3K1J A;  2L09 A;  4F2L A;  1MX0 A;  2XEP A;  3HZJ A;  3AV0 A;  3JAM S;  3R9X B;  1Z59 A;  2JZ1 A;  3L26 A;  2A5Y B;  4FCT A;  3U6M A;  5JI3 E;  1NJF A;  2FNA A;  5EP3 A;  1ZMV A;  3HHX A;  1GO5 A;  2VF7 A;  1YSY A;  3PVS A;  4JI0 M;  3GLF E;  2WSF F;  2JA2 A;  1NJG A;  2LVO C;  2XH9 A;  3FUX A;  3SAT A;  1HNZ M;  1XWI A;  4I4L A;  1C1K A;  1NV9 A;  4R7G A;  2AHM A;  4OW0 A;  4FCW A;  3KOW E;  4ITQ A;  2HWJ A;  2JY6 B;  3MJ5 A;  5IWA M;  2YFQ A;  3T15 A;  4WW0 A;  4RKU F;  1G3I A;  3K9O A;  2LVA A;  1JR3 D;  2JY8 A;  4L15 A;  4KT0 F;  5KPZ A;  3LVV A;  4AKH A;  1XMQ M;  4AZF A;  2LXE A;  2KZS A;  2C9O A;  2WZJ A;  5ITX A;  1PRB A;  5EQT A;  4QOS A;  1NSF A;  1DGF A;  2DNA A;  4MGH A;  1RU3 A;  1AUA A;  1UFZ A;  2J7O A;  4IBD A;  3KVW A;  5EP4 A;  5E6J A;  1ORY B;  4I5S A;  4IBJ A;  4LF7 M;  5IRE B;  5FLX S;  1IBM M;  2QQ8 A;  2CRU A;  1NY6 A;  4M9Z A;  3LMM A;  1YLA A;  4NSR A;  3U6L A;  1SXJ A;  2Y0Q A;  4II7 A;  3FRI A;  3SHF A;  2R62 A;  2F5Q A;  3IG5 A;  1HQY E;  1XXH E;  2ERC A;  3FUW A;  4M9S A;  3SMS A;  2MJ5 B;  3UGJ A;  2Y0T A;  3VK8 A;  3R8F A;  1HJP A;  1TR8 A;  2BJV A;  2XSZ A;  2EJS A;  3J7A S;  4G6Z A;  3SAS A;  4DV3 M;  3U6S A;  2EKK A;  1QZE A;  4GHL A; 
#chains in the Genus database with same CATH homology
 1DO2 A;  1EFU B;  1ZV1 A;  4HEO A;  1VEK A;  1XB2 B;  1G41 A;  3H4J A;  2QHO B;  1SG9 A;  1A5T A;  3FRH A;  2DZL A;  3GLI E;  1ZMW A;  2DEN A;  1CUK A;  3LCU A;  4R71 A;  2L4E A;  1ZMU A;  2K9D A;  1TTE A;  2JNH A;  3IHP A;  4UN2 B;  3K9P A;  1KYI A;  2DAM A;  2K0B X;  2BWB A;  2DAE A;  2DI0 A;  1DV0 A;  1WGN A;  2DAI A;  1AIP C;  5JI2 E;  1VEJ A;  5DFL A;  1HT1 E;  2ZTC A;  1WJ7 A;  1OQY A;  1T43 A;  1IFY A;  2OOB A;  2JY5 A;  2O25 A;  2KNV A;  3BBZ A;  1NV8 A;  2H5X A;  3E21 A;  2CWB A;  2LVQ D;  2HAK A;  4Q7J A;  2KNZ A;  1G4A E;  1R4G A;  1JR3 E;  2QNJ A;  3T6P A;  1WGL A;  2L4F A;  2LTU A;  2LVP C;  1Y8G A;  2DAG A;  1IXS A;  4WP2 A;  2QSF X;  1IM2 A;  1VEG A;  2B3T A;  1VDL A;  2MRO B;  1OAI A;  4F1I A;  2JP7 A;  4F2L A;  2JZ1 A;  2JY7 A;  2KNA A;  3B89 A;  1WHC A;  2G3Q A;  1ZMV A;  1GO5 A;  1OTR A;  2R0I A;  2MGW A;  2ZTD A;  2RRU A;  2MR9 A;  2EKF A;  3GLF E;  3F92 A;  2LVO C;  2JUJ A;  1VG5 A;  1V92 A;  1BVS A;  1NV9 A;  2DHY A;  1OKS A;  1PGY A;  3E46 A;  2DKL A;  1C7Y A;  2HWJ A;  3IEC A;  2JY6 B;  1G3I A;  3K9O A;  2CP8 A;  2LVA A;  2JY8 A;  4G3O A;  1F4I A;  1HT2 E;  2LBC A;  2WZJ A;  1DO0 A;  1Q02 A;  1P3Q Q;  2KHH A;  3LCV B;  2DNA A;  1E94 E;  1UFZ A;  3GLH E;  2JZ0 A;  1MN3 A;  3GLG E;  2L2D A;  1WR1 B;  1YLA A;  3MMP A;  3FRI A;  4GEW A;  2LVN C;  2OOA A;  1T6O A;  1HQY E;  1XXH E;  4DBG B;  2MJ5 B;  1HJP A;  1TR8 A;  3FE3 A;  2EJS A;  2BWE A;  1VQ1 A;  2DAK A;  1WIV A;  2EKK A;  1QZE A;  2OO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...