3BBZA

Structure of the nucleocapsid-binding domain from the mumps virus phosphoprotein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
48
structure length
48
Chain Sequence
GQKVMITKMITDSVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords P protein
publication title Structure of the nucleocapsid-binding domain from the mumps virus polymerase; an example of protein folding induced by crystallization
pubmed doi rcsb
source organism Mumps virus
molecule tags Viral protein, replication
total genus 20
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3bbzA00
1XXHE 1C7YA 4Q7JA 1EFUB 1VEKA 1KYIA 1OAIA 2KNZA 2B3TA 1TTEA 4DBGB 1MN3A 1P3QQ 3E46A 1ZMUA 1JR3E 1XB2B 2MROB 2DAGA 1A5TA 3H4JA 2L4EA 2CP8A 3BBZA 2JNHA 4GEWA 3K9PA 1CUKA 2O25A 2HWJA 2JY7A 2QSFX 1VQ1A 1F4IA 2DAEA 2EJSA 2DNAA 1ZMWA 2MJ5B 2LVAA 4F2LA 3IECA 1IFYA 2MGWA 1WJ7A 1DO2A 4F1IA 2DAKA 2KHHA 1DO0A 2OO9A 1NV9A 2LVPC 2DAMA 1HT1E 5JI2E 1SG9A 2R0IA 3GLHE 2DZLA 2EKKA 3GLGE 1UFZA 3F92A 3FE3A 3B89A 2G3QA 1T6OA 1HJPA 4G3OA 1G4AE 2JP7A 2DENA 2KNAA 2MR9A 2ZTDA 4R71A 1WIVA 2LVQD 1GO5A 1WGLA 2LVNC 1V92A 1WR1B 4WP2A 2JY6B 2L4FA 2LTUA 2EKFA 2OOBA 1QZEA 2RRUA 2JUJA 3T6PA 2QHOB 1E94E 1DV0A 1OKSA 1IXSA 2JZ0A 1G3IA 1ZMVA 1VG5A 1AIPC 1OTRA 1WHCA 1NV8A 1T43A 1Y8GA 2DHYA 3K9OA 2DI0A 1VEGA 2KNVA 2CWBA 2OOAA 2JZ1A 2H5XA 1G41A 2L2DA 3LCVB 2LVOC 1WGNA 2ZTCA 3GLIE 1YLAA 2HAKA 2BWBA 3GLFE 4HEOA 1R4GA 3FRIA 1ZV1A 2JY8A 2JY5A 3FRHA 3IHPA 1OQYA 2LBCA 3LCUA 2BWEA 1BVSA 2DKLA 3E21A 2K0BX 1Q02A 1HT2E 4UN2B 1TR8A 2K9DA 1VDLA 1PGYA 1IM2A 3MMPA 2DAIA 2WZJA 1HQYE 5DFLA 2QNJA 1VEJA
chains in the Genus database with same CATH superfamily
4JI2M 1C7YA 1OAIA 2KNZA 5FTNA 3J81S 3GQ3A 3GLFA 2EUCA 1IY1A 4S12A 4B3MM 1MN3A 2C5RA 2Z4SA 3SAVA 1QANA 3AV0A 1ZAEA 2ERCA 3E46A 2JA2A 2KRKA 1TGUA 3GPYA 1JR3E 2L09A 2ZAOA 3K92A 4IBIA 3Q8GA 4II7A 1PJJA 1HNXM 5EQTA 2G5GX 2VQEM 2E5LM 3ZQJA 3U6QA 4CHTB 1VQ1A 1F4IA 3QYBA 2FFJA 3E4RA 3GLHB 1DGHA 2DNAA 1V33A 2QPAA 3TL4X 3W0LB 2LVAA 4GKKM 2FH0A 2KA6B 1ORYB 2R4EA 3DA1A 3UK6A 1IFYA 3R8FA 5DYIA 1Q3BA 2UU9M 1WJ7A 1DO2A 1TDHA 3HJQA 3NBIA 2BJVA 1IN8A 1PM5A 3U6EA 3QWLA 4QNMA 3A98B 2LVPC 2XFSA 3WHLA 2DAMA 2YNMD 4JI1M 1TH3A 4GKJM 1MJGM 1NJFA 1Z5BA 4L15A 1PRBA 1NJGA 2EKKA 5FTKA 4AI6A 3GLGE 2R4JA 1UFZA 4DV7M 1GKIA 4GC9A 4I5SA 3FTCA 2G3QA 1K82A 1W5TA 4B3RM 1HJPA 2DWLA 4JI5M 1IBKM 3W68A 4MB7A 3U6CA 1EE8A 5ITTA 1QDRA 4M9SA 2YFQA 4R3DA 4B3SM 4WP2A 3SMSA 1QAMA 4A3VB 1IBMM 2Q2EB 4IJFA 4NC6A 4BB9A 2CE7A 5EXPA 4MH0E 2DZNB 2JUJA 1TH4A 2QHOB 3T6PA 3U6SA 2KDLA 2JWSA 3U6DA 3U5ZB 1VG5A 1AIPC 1SXJD 4B7GA 2OPFA 2ZANA 1WHCA 2DHYA 1OFHA 2R44A 2XH9A 2CWBA 1EIJA 4FWDA 1D0MA 4FW9A 2F4VM 1NY6A 3KDSE 1WXQA 1R6BX 3SYLA 3U61B 1L2CA 4FCVA 2FS1A 2ZBKB 4NOOB 1L1ZA 4DV1M 3GLFE 2EO2A 4FWGA 2LHCA 4HEOA 3B9PA 2Z3XA 2QBYB 2Z4RA 3OTOM 2RGHA 3VK8A 3FRHA 3IHPA 4B3TM 2DKLA 2L7IA 1XXHB 4XK8F 4DUYM 3M6AA 3KS8A 2AHMA 1H6UA 4FCWA 4NRVA 5DYGA 3VFDA 1PGYA 3MMPA 4ZPXA 2GNOA 3BXWA 4IBCA 4IBFA 3UMMA 2K47A 3KOWE 3GPPA 5DFLA 3VLFB 2R18A 4CGYB 2CHGA 3K8ZA 4QOSA 2UUAM 2X4AA 4L16A 4IBKA 4W5WA 2B3TA 4LF7M 3TWKA 2CRUA 3FTEA 4LF9M 4DBGB 3A46A 3FUVA 3RGPA 5KPTA 3FUTA 3GPUA 1P3QQ 4AW4A 1NY5A 1YUBA 3KSXA 3I51A 4AKHA 4LGYA 3KOXE 2CUZA 5ITYA 4JI8M 4JN6A 3TWMA 2MROB 2D7HA 2N35A 3GRUA 4GRIA 4RNAA 3IG8A 3B74A 3U61A 3CF6E 4GIPA 4QHSA 2CV0A 1A5TA 5EXTA 2L4EA 2LHGA 3SMPA 1FJGM 4GH9A 1IBLM 1NO1A 3BBZA 4NSRA 1E9SA 3T1HM 2QBYA 2VIIA 4GEWA 4IIWA 2KRUA 3EIHA 1QAQA 3GRVA 1SXJA 3J27B 4G4NA 1RU3A 1AUAA 1DGGA 3U60A 2EJSA 3FKEA 2D7GA 2KZSA 1ZMWA 2MJ5B 1XXHA 3IECA 2MH8A 4LJ5A 4I81A 2VQFM 4OX9M 5KQDA 1QUTA 3CGWA 3RGSA 5EP4A 1NV9A 2J5YA 4PDGA 5IWAM 4JI7M 4LG2A 2L6OA 1R2YA 7CATA 1HT1E 1LV7A 2O5RA 5EP1A 5FSWA 1XMQM 1SG9A 2R0IA 1OIZA 2R6FA 3AOEC 3DZDA 3GLHE 2DZLA 4WURA 4NXMM 5FTMA 2XEPA 4XBOA 2VF8A 3MK6A 3FE3A 1OFIA 2CHVA 1G4AE 4LJ6A 4LZZA 3T1YM 2JP7A 2F5QA 3KOYE 2DENA 1XHBA 2KNAA 5FLXS 2RGOA 2C96A 2ZTDA 3C3EA 4AG6A 4G4QA 4CIZA 3VKHA 2M5ZA 1V92A 1WR1B 4JI4M 1JR3D 2JY6B 4IBEA 4AKGA 3WHKA 3LVVA 2RRUA 4K0KM 4JI6M 4DV6M 1DV0A 1HQCA 1GL7A 4AKIA 1L2BA 3KS4A 1NV8A 1T43A 2LH0A 2CHQA 3HX3A 1L1TA 5L8RF 3T15A 3LW5F 1E32A 2FE8A 3AOGA 4JI3M 1N33M 3KP1E 3C3DA 4GHAA 2QQ8A 2ZM6M 1N78A 1L8QA 1G8PA 1G41A 2L2DA 3LCVB 1QUSA 2LVOC 1WGNA 2WSFF 4L8RC 2KXEA 1D2NA 3L28A 4FWHA 2DHRA 3I4YA 2QCUA 4MGKE 3SC3A 4LF6M 4YHHM 3HGIA 4DR1M 1IN5A 1KSFX 1D0KA 4NRWA 4PT5A 4LF5M 4DUZM 2XZFA 3FYCA 2LBCA 2BWEA 3KSJA 4M9XA 4LJ4A 2CFOA 3PNVA 3HU1A 4D81A 3E21A 4OVZB 1LTMA 5BPVA 2XSZD 2HKJA 3IG5A 1HT2E 4RF0A 3HJSA 2J7NA 3HWSA 2XLJA 1VDLA 3H4MA 2Z8YM 1K3XA 2DAIA 2Y20A 5H37D 3SFZA 5EXXA 5IZ7D 4PDIA 3B7QA 5KO3A 1XC8A 1N34M 5DNYA 3CTWB 3W0FA 2HCBA 1IQPA 1QQWA 1GABA 3KXEC 2QNJA 1VEJA 3SATA 1XXHE 4ANRA 2V1UA 1S3SA 2H1RA 4Q7JA 5F3WA 3RE8A 1DGBA 1KYIA 2FOIC 3MHVC 4KT0F 3GLIA 4KHPM 3Q8XA 3U6OA 1SXJB 1TTEA 1J5EM 3U60B 2KZUA 4MGIE 3VDPA 3AL0C 2APLA 1NHWC 5E26A 4BLCA 3K2LA 1Q3CA 4Z6YA 3J80S 5BR8M 3AKZA 1XB2B 4P16A 2C9CA 4LGMA 4AZFA 1R2ZA 2I7PA 3JAMS 4QOZC 4CJ6A 4M0WA 2CP8A 2ZAMA 3M7GA 2RKOA 1J7KA 4L78A 1IN6A 2JNHA 3HHZA 3K9PA 3LQQA 1CUKA 2NQ8C 4RF1A 2JY7A 5EP3A 1TF0B 2DAEA 3R9XB 4MM3B 2FNAA 1MX0A 1UM8A 5E6JA 4MGYE 3HHWA 4OVZA 4CISA 4DV0M 2BJWA 4QNRA 3PXGA 1IY2A 3DOAA 2UUBM 2Y0TA 4F1IA 4GHLA 2DAKA 4NL4H 1NVMA 1PJTA 2F5PA 4M9ZA 3SHGB 2QZ4A 1NHGC 5A2QS 1XNRM 4NSOB 5JI2E 4DR5M 2KW0A 3L27A 2K6BA 3PVSA 5LMUM 3B89A 2Z7JA 3KOZE 4I8OA 2M60A 5KPZA 2OQ4A 2DWMA 3GLGA 4QHTA 2WSEF 1N32M 3KFUG 2I7NA 4X66M 3GRRA 2R62A 2MR9A 1TDZA 4R71A 1GVNA 2LVNC 5ITXA 5FTLA 1TH2A 2HHHM 2EKFA 3J7BA 8CATA 2CEAA 2P5TA 4LJ8A 2UXBM 1E94E 1GJTA 2JZ0A 4MGHA 3SARA 3C9PA 3GP1A 1OTRA 3C58A 4GITA 1HR0M 3A45A 2DVWB 3JR4A 3U6MA 4LF4M 5EXSA 1Q39A 2XGNA 2XZUA 2O01F 1GL6A 3PFIA 3L25A 1XMOM 2JZ1A 4Y28F 2YR0A 3THGA 2A5YB 4LZJA 4LRTA 3HZJA 4YY3M 2ZTCA 1QDTA 1YLAA 2V1CA 2HAKA 3FYDA 3DFZA 3W67A 4B08A 3GPXA 3GLIE 4OU7A 2DXIA 1R4GA 2C9OA 4G6ZA 1HNZM 1R7RA 3J7AS 3ZH9B 1ZV1A 4LFCM 3EIEA 1I94M 5ITQA 4TUWA 1JQJC 1FNNA 4HLQA 1W5SA 3LCUA 3SHFA 1Z6TA 3GRYA 5ITUA 4LF8M 3D8BA 3HJ8A 2X49A 2CV1A 1I4WA 3GLIB 4GMQA 4IJEA 1Q02A 4EIWA 4UN2B 4PD2A 3HHXA 1TR8A 2K9DA 3GQ5A 1QYRA 1DGFA 1XWIA 2WSCF 4M0DA 1XNQM 3CF2A 1V34A 2UUCM 3LVWA 4L6V6 3TPZA 4D82A 4P17A 5FTJA 2KEBA 2CV2A 2F5NA 1IXZA 1NSFA 3FTFA 1EFUB 1N75A 1VEKA 3GO8A 4JV5M 2LNHC 4G4OA 1L2DA 1E9RA 2XFTA 4BBAA 1K3WA 4FD2A 2XF3A 1X37A 1PJQA 2C98A 4LFBM 1OIPA 3AJIB 4IBGA 2F5SA 4LJ9A 4REZA 5LMNM 3V76A 1ZMUA 2DAGA 2JXNA 1IXSB 3HKPA 2QENA 4RKUF 4WW0A 3H4JA 4LRSA 5C18A 3VDUA 3BOSA 1QVRA 1SXJE 4FCTA 5GKNA 3RFWA 3HY5A 4AQYM 4X62M 4X65M 3KVWA 1MU5A 4XGIA 5ITXE 2O25A 2HWJA 3AOEA 2R45A 2QSFX 1J09A 5EJCA 4DV2M 2W82A 3CF0A 1C1KA 4B7HA 1G71A 3HU2A 3K1JA 3GLGB 4DR2M 4F2LA 2F5OA 2UXCM 4DV3M 2X8AA 3B7NA 2MGWA 3HU3A 4GC5A 1T3TA 2KHHA 2UXDM 1DO0A 1QZMA 4G4RA 2OO9A 4LFAM 3E9SA 3I04M 1OAOC 4I4LA 5IT9S 4JI0M 2L7HA 3UJNA 5ITRA 4JYAM 4IBDA 1SXJC 1NNJA 3KW6A 4OW0A 3JR5A 2HL7A 1JR3A 2R65A 3F92A 1HNWM 1GJSA 1IN4A 1PJSA 3GLHA 1T6OA 4NXNM 4G3OA 3FUWA 3U6PA 3VK7A 1Z59A 2QP9X 4ITQA 4DR4M 3ILKA 1R5LA 4PCZA 3U6LA 2LWXA 2VDBB 1PJIA 1GO5A 1WIVA 1Z5CA 2LVQD 1WGLA 3GQ4A 2DWZB 2L4FA 2LTUA 3TWLA 3I01M 1NNUC 2OOBA 1QZEA 1YSYA 2V6ZM 4DR6M 3NWLA 1OKSA 1IXSA 4LCBA 4IBBA 3GLFB 1G3IA 1ZMVA 2BNKA 4R7GA 1G59A 3T38A 1Y8GA 3MJ5A 3LQRA 1VDDA 3K9OA 2DI0A 3VKGA 3L2AA 1VEGA 2KNVA 4HL4A 3HHYA 3SBJA 3QYEA 2OOAA 5C1BA 4DV4M 4DR7M 1OJLA 4KO8A 3J2PB 1IN7A 3B7ZA 3L29A 2H5XA 3M0EA 4LY6A 1GLNA 4Z8XA 3FD9A 3UGJA 3SAWA 2D7EA 3NBXX 2BWBA 2DZOB 1YE9A 2XSZA 3A42A 3QAUA 5IREB 3TQSA 4B7FA 2C99A 1JB0F 3FRIA 2JY8A 2YQZA 3SASA 2JY5A 2Y21A 3FUUA 3U5ZA 4LJAA 2VF7A 1OQYA 3PNYA 1KFVA 3LMMA 1DGHB 1Z5AA 2Y0QA 5KPRA 1BVSA 5EP2A 2EA0A 3SAUA 4L4UA 3FTDA 4IBJA 3SYKA 4LJ7A 2J7OA 4D80A 3I4VA 2G8LA 2K0BX 4KODA 3ZC7B 4X64M 1IXRC 4FVMA 2DWNA 5KQ8A 4DV5M 5JI3E 1IM2A 2GQFA 3ZCBB 3KP0E 4AG5A 3L26A 4MGZE 2R46A 3AFHA 2WZJA 1N36M 4KLNA 1HQYE 1ZQ9A 3TE6A 1D0LA 2LXEA 3UZUA 1IY0A 4DR3M 3FUXA 3D8LA 1N77A 1QAOA 4JXJA
chains in the Genus database with same CATH topology
1XXHE 1C7YA 4Q7JA 1EFUB 1VEKA 1KYIA 1OAIA 2KNZA 2B3TA 1TTEA 4DBGB 1MN3A 1P3QQ 3E46A 1ZMUA 1JR3E 1XB2B 2MROB 2DAGA 1A5TA 3H4JA 2L4EA 2CP8A 3BBZA 2JNHA 4GEWA 3K9PA 1CUKA 2O25A 2HWJA 2JY7A 2QSFX 1VQ1A 1F4IA 2DAEA 2EJSA 2DNAA 1ZMWA 2MJ5B 2LVAA 4F2LA 3IECA 1IFYA 2MGWA 1WJ7A 1DO2A 4F1IA 2DAKA 2KHHA 1DO0A 2OO9A 1NV9A 2LVPC 2DAMA 1HT1E 5JI2E 1SG9A 2R0IA 3GLHE 2DZLA 2EKKA 3GLGE 1UFZA 3F92A 3FE3A 3B89A 2G3QA 1T6OA 1HJPA 4G3OA 1G4AE 2JP7A 2DENA 2KNAA 2MR9A 2ZTDA 4R71A 1WIVA 2LVQD 1GO5A 1WGLA 2LVNC 1V92A 1WR1B 4WP2A 2JY6B 2L4FA 2LTUA 2EKFA 2OOBA 1QZEA 2RRUA 2JUJA 3T6PA 2QHOB 1E94E 1DV0A 1OKSA 1IXSA 2JZ0A 1G3IA 1ZMVA 1VG5A 1AIPC 1OTRA 1WHCA 1NV8A 1T43A 1Y8GA 2DHYA 3K9OA 2DI0A 1VEGA 2KNVA 2CWBA 2OOAA 2JZ1A 2H5XA 1G41A 2L2DA 3LCVB 2LVOC 1WGNA 2ZTCA 3GLIE 1YLAA 2HAKA 2BWBA 3GLFE 4HEOA 1R4GA 3FRIA 1ZV1A 2JY8A 2JY5A 3FRHA 3IHPA 1OQYA 2LBCA 3LCUA 2BWEA 1BVSA 2DKLA 3E21A 2K0BX 1Q02A 1HT2E 4UN2B 1TR8A 2K9DA 1VDLA 1PGYA 1IM2A 3MMPA 2DAIA 2WZJA 1HQYE 5DFLA 2QNJA 1VEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XXH E;  1C7Y A;  4Q7J A;  1EFU B;  1VEK A;  1KYI A;  1OAI A;  2KNZ A;  2B3T A;  1TTE A;  4DBG B;  1MN3 A;  1P3Q Q;  3E46 A;  1ZMU A;  1JR3 E;  1XB2 B;  2MRO B;  2DAG A;  1A5T A;  3H4J A;  2L4E A;  2CP8 A;  3BBZ A;  2JNH A;  4GEW A;  3K9P A;  1CUK A;  2O25 A;  2HWJ A;  2JY7 A;  2QSF X;  1VQ1 A;  1F4I A;  2DAE A;  2EJS A;  2DNA A;  1ZMW A;  2MJ5 B;  2LVA A;  4F2L A;  3IEC A;  1IFY A;  2MGW A;  1WJ7 A;  1DO2 A;  4F1I A;  2DAK A;  2KHH A;  1DO0 A;  2OO9 A;  1NV9 A;  2LVP C;  2DAM A;  1HT1 E;  5JI2 E;  1SG9 A;  2R0I A;  3GLH E;  2DZL A;  2EKK A;  3GLG E;  1UFZ A;  3F92 A;  3FE3 A;  3B89 A;  2G3Q A;  1T6O A;  1HJP A;  4G3O A;  1G4A E;  2JP7 A;  2DEN A;  2KNA A;  2MR9 A;  2ZTD A;  4R71 A;  1WIV A;  2LVQ D;  1GO5 A;  1WGL A;  2LVN C;  1V92 A;  1WR1 B;  4WP2 A;  2JY6 B;  2L4F A;  2LTU A;  2EKF A;  2OOB A;  1QZE A;  2RRU A;  2JUJ A;  3T6P A;  2QHO B;  1E94 E;  1DV0 A;  1OKS A;  1IXS A;  2JZ0 A;  1G3I A;  1ZMV A;  1VG5 A;  1AIP C;  1OTR A;  1WHC A;  1NV8 A;  1T43 A;  1Y8G A;  2DHY A;  3K9O A;  2DI0 A;  1VEG A;  2KNV A;  2CWB A;  2OOA A;  2JZ1 A;  2H5X A;  1G41 A;  2L2D A;  3LCV B;  2LVO C;  1WGN A;  2ZTC A;  3GLI E;  1YLA A;  2HAK A;  2BWB A;  3GLF E;  4HEO A;  1R4G A;  3FRI A;  1ZV1 A;  2JY8 A;  2JY5 A;  3FRH A;  3IHP A;  1OQY A;  2LBC A;  3LCU A;  2BWE A;  1BVS A;  2DKL A;  3E21 A;  2K0B X;  1Q02 A;  1HT2 E;  4UN2 B;  1TR8 A;  2K9D A;  1VDL A;  1PGY A;  1IM2 A;  3MMP A;  2DAI A;  2WZJ A;  1HQY E;  5DFL A;  2QNJ A;  1VEJ A; 
#chains in the Genus database with same CATH topology
 4JI2 M;  1C7Y A;  1OAI A;  2KNZ A;  5FTN A;  3J81 S;  3GQ3 A;  3GLF A;  2EUC A;  1IY1 A;  4S12 A;  4B3M M;  1MN3 A;  2C5R A;  2Z4S A;  3SAV A;  1QAN A;  3AV0 A;  1ZAE A;  2ERC A;  3E46 A;  2JA2 A;  2KRK A;  1TGU A;  3GPY A;  1JR3 E;  2L09 A;  2ZAO A;  3K92 A;  4IBI A;  3Q8G A;  4II7 A;  1PJJ A;  1HNX M;  5EQT A;  2G5G X;  2VQE M;  2E5L M;  3ZQJ A;  3U6Q A;  4CHT B;  1VQ1 A;  1F4I A;  3QYB A;  2FFJ A;  3E4R A;  3GLH B;  1DGH A;  2DNA A;  1V33 A;  2QPA A;  3TL4 X;  3W0L B;  2LVA A;  4GKK M;  2FH0 A;  2KA6 B;  1ORY B;  2R4E A;  3DA1 A;  3UK6 A;  1IFY A;  3R8F A;  5DYI A;  1Q3B A;  2UU9 M;  1WJ7 A;  1DO2 A;  1TDH A;  3HJQ A;  3NBI A;  2BJV A;  1IN8 A;  1PM5 A;  3U6E A;  3QWL A;  4QNM A;  3A98 B;  2LVP C;  2XFS A;  3WHL A;  2DAM A;  2YNM D;  4JI1 M;  1TH3 A;  4GKJ M;  1MJG M;  1NJF A;  1Z5B A;  4L15 A;  1PRB A;  1NJG A;  2EKK A;  5FTK A;  4AI6 A;  3GLG E;  2R4J A;  1UFZ A;  4DV7 M;  1GKI A;  4GC9 A;  4I5S A;  3FTC A;  2G3Q A;  1K82 A;  1W5T A;  4B3R M;  1HJP A;  2DWL A;  4JI5 M;  1IBK M;  3W68 A;  4MB7 A;  3U6C A;  1EE8 A;  5ITT A;  1QDR A;  4M9S A;  2YFQ A;  4R3D A;  4B3S M;  4WP2 A;  3SMS A;  1QAM A;  4A3V B;  1IBM M;  2Q2E B;  4IJF A;  4NC6 A;  4BB9 A;  2CE7 A;  5EXP A;  4MH0 E;  2DZN B;  2JUJ A;  1TH4 A;  2QHO B;  3T6P A;  3U6S A;  2KDL A;  2JWS A;  3U6D A;  3U5Z B;  1VG5 A;  1AIP C;  1SXJ D;  4B7G A;  2OPF A;  2ZAN A;  1WHC A;  2DHY A;  1OFH A;  2R44 A;  2XH9 A;  2CWB A;  1EIJ A;  4FWD A;  1D0M A;  4FW9 A;  2F4V M;  1NY6 A;  3KDS E;  1WXQ A;  1R6B X;  3SYL A;  3U61 B;  1L2C A;  4FCV A;  2FS1 A;  2ZBK B;  4NOO B;  1L1Z A;  4DV1 M;  3GLF E;  2EO2 A;  4FWG A;  2LHC A;  4HEO A;  3B9P A;  2Z3X A;  2QBY B;  2Z4R A;  3OTO M;  2RGH A;  3VK8 A;  3FRH A;  3IHP A;  4B3T M;  2DKL A;  2L7I A;  1XXH B;  4XK8 F;  4DUY M;  3M6A A;  3KS8 A;  2AHM A;  1H6U A;  4FCW A;  4NRV A;  5DYG A;  3VFD A;  1PGY A;  3MMP A;  4ZPX A;  2GNO A;  3BXW A;  4IBC A;  4IBF A;  3UMM A;  2K47 A;  3KOW E;  3GPP A;  5DFL A;  3VLF B;  2R18 A;  4CGY B;  2CHG A;  3K8Z A;  4QOS A;  2UUA M;  2X4A A;  4L16 A;  4IBK A;  4W5W A;  2B3T A;  4LF7 M;  3TWK A;  2CRU A;  3FTE A;  4LF9 M;  4DBG B;  3A46 A;  3FUV A;  3RGP A;  5KPT A;  3FUT A;  3GPU A;  1P3Q Q;  4AW4 A;  1NY5 A;  1YUB A;  3KSX A;  3I51 A;  4AKH A;  4LGY A;  3KOX E;  2CUZ A;  5ITY A;  4JI8 M;  4JN6 A;  3TWM A;  2MRO B;  2D7H A;  2N35 A;  3GRU A;  4GRI A;  4RNA A;  3IG8 A;  3B74 A;  3U61 A;  3CF6 E;  4GIP A;  4QHS A;  2CV0 A;  1A5T A;  5EXT A;  2L4E A;  2LHG A;  3SMP A;  1FJG M;  4GH9 A;  1IBL M;  1NO1 A;  3BBZ A;  4NSR A;  1E9S A;  3T1H M;  2QBY A;  2VII A;  4GEW A;  4IIW A;  2KRU A;  3EIH A;  1QAQ A;  3GRV A;  1SXJ A;  3J27 B;  4G4N A;  1RU3 A;  1AUA A;  1DGG A;  3U60 A;  2EJS A;  3FKE A;  2D7G A;  2KZS A;  1ZMW A;  2MJ5 B;  1XXH A;  3IEC A;  2MH8 A;  4LJ5 A;  4I81 A;  2VQF M;  4OX9 M;  5KQD A;  1QUT A;  3CGW A;  3RGS A;  5EP4 A;  1NV9 A;  2J5Y A;  4PDG A;  5IWA M;  4JI7 M;  4LG2 A;  2L6O A;  1R2Y A;  7CAT A;  1HT1 E;  1LV7 A;  2O5R A;  5EP1 A;  5FSW A;  1XMQ M;  1SG9 A;  2R0I A;  1OIZ A;  2R6F A;  3AOE C;  3DZD A;  3GLH E;  2DZL A;  4WUR A;  4NXM M;  5FTM A;  2XEP A;  4XBO A;  2VF8 A;  3MK6 A;  3FE3 A;  1OFI A;  2CHV A;  1G4A E;  4LJ6 A;  4LZZ A;  3T1Y M;  2JP7 A;  2F5Q A;  3KOY E;  2DEN A;  1XHB A;  2KNA A;  5FLX S;  2RGO A;  2C96 A;  2ZTD A;  3C3E A;  4AG6 A;  4G4Q A;  4CIZ A;  3VKH A;  2M5Z A;  1V92 A;  1WR1 B;  4JI4 M;  1JR3 D;  2JY6 B;  4IBE A;  4AKG A;  3WHK A;  3LVV A;  2RRU A;  4K0K M;  4JI6 M;  4DV6 M;  1DV0 A;  1HQC A;  1GL7 A;  4AKI A;  1L2B A;  3KS4 A;  1NV8 A;  1T43 A;  2LH0 A;  2CHQ A;  3HX3 A;  1L1T A;  5L8R F;  3T15 A;  3LW5 F;  1E32 A;  2FE8 A;  3AOG A;  4JI3 M;  1N33 M;  3KP1 E;  3C3D A;  4GHA A;  2QQ8 A;  2ZM6 M;  1N78 A;  1L8Q A;  1G8P A;  1G41 A;  2L2D A;  3LCV B;  1QUS A;  2LVO C;  1WGN A;  2WSF F;  4L8R C;  2KXE A;  1D2N A;  3L28 A;  4FWH A;  2DHR A;  3I4Y A;  2QCU A;  4MGK E;  3SC3 A;  4LF6 M;  4YHH M;  3HGI A;  4DR1 M;  1IN5 A;  1KSF X;  1D0K A;  4NRW A;  4PT5 A;  4LF5 M;  4DUZ M;  2XZF A;  3FYC A;  2LBC A;  2BWE A;  3KSJ A;  4M9X A;  4LJ4 A;  2CFO A;  3PNV A;  3HU1 A;  4D81 A;  3E21 A;  4OVZ B;  1LTM A;  5BPV A;  2XSZ D;  2HKJ A;  3IG5 A;  1HT2 E;  4RF0 A;  3HJS A;  2J7N A;  3HWS A;  2XLJ A;  1VDL A;  3H4M A;  2Z8Y M;  1K3X A;  2DAI A;  2Y20 A;  5H37 D;  3SFZ A;  5EXX A;  5IZ7 D;  4PDI A;  3B7Q A;  5KO3 A;  1XC8 A;  1N34 M;  5DNY A;  3CTW B;  3W0F A;  2HCB A;  1IQP A;  1QQW A;  1GAB A;  3KXE C;  2QNJ A;  1VEJ A;  3SAT A;  1XXH E;  4ANR A;  2V1U A;  1S3S A;  2H1R A;  4Q7J A;  5F3W A;  3RE8 A;  1DGB A;  1KYI A;  2FOI C;  3MHV C;  4KT0 F;  3GLI A;  4KHP M;  3Q8X A;  3U6O A;  1SXJ B;  1TTE A;  1J5E M;  3U60 B;  2KZU A;  4MGI E;  3VDP A;  3AL0 C;  2APL A;  1NHW C;  5E26 A;  4BLC A;  3K2L A;  1Q3C A;  4Z6Y A;  3J80 S;  5BR8 M;  3AKZ A;  1XB2 B;  4P16 A;  2C9C A;  4LGM A;  4AZF A;  1R2Z A;  2I7P A;  3JAM S;  4QOZ C;  4CJ6 A;  4M0W A;  2CP8 A;  2ZAM A;  3M7G A;  2RKO A;  1J7K A;  4L78 A;  1IN6 A;  2JNH A;  3HHZ A;  3K9P A;  3LQQ A;  1CUK A;  2NQ8 C;  4RF1 A;  2JY7 A;  5EP3 A;  1TF0 B;  2DAE A;  3R9X B;  4MM3 B;  2FNA A;  1MX0 A;  1UM8 A;  5E6J A;  4MGY E;  3HHW A;  4OVZ A;  4CIS A;  4DV0 M;  2BJW A;  4QNR A;  3PXG A;  1IY2 A;  3DOA A;  2UUB M;  2Y0T A;  4F1I A;  4GHL A;  2DAK A;  4NL4 H;  1NVM A;  1PJT A;  2F5P A;  4M9Z A;  3SHG B;  2QZ4 A;  1NHG C;  5A2Q S;  1XNR M;  4NSO B;  5JI2 E;  4DR5 M;  2KW0 A;  3L27 A;  2K6B A;  3PVS A;  5LMU M;  3B89 A;  2Z7J A;  3KOZ E;  4I8O A;  2M60 A;  5KPZ A;  2OQ4 A;  2DWM A;  3GLG A;  4QHT A;  2WSE F;  1N32 M;  3KFU G;  2I7N A;  4X66 M;  3GRR A;  2R62 A;  2MR9 A;  1TDZ A;  4R71 A;  1GVN A;  2LVN C;  5ITX A;  5FTL A;  1TH2 A;  2HHH M;  2EKF A;  3J7B A;  8CAT A;  2CEA A;  2P5T A;  4LJ8 A;  2UXB M;  1E94 E;  1GJT A;  2JZ0 A;  4MGH A;  3SAR A;  3C9P A;  3GP1 A;  1OTR A;  3C58 A;  4GIT A;  1HR0 M;  3A45 A;  2DVW B;  3JR4 A;  3U6M A;  4LF4 M;  5EXS A;  1Q39 A;  2XGN A;  2XZU A;  2O01 F;  1GL6 A;  3PFI A;  3L25 A;  1XMO M;  2JZ1 A;  4Y28 F;  2YR0 A;  3THG A;  2A5Y B;  4LZJ A;  4LRT A;  3HZJ A;  4YY3 M;  2ZTC A;  1QDT A;  1YLA A;  2V1C A;  2HAK A;  3FYD A;  3DFZ A;  3W67 A;  4B08 A;  3GPX A;  3GLI E;  4OU7 A;  2DXI A;  1R4G A;  2C9O A;  4G6Z A;  1HNZ M;  1R7R A;  3J7A S;  3ZH9 B;  1ZV1 A;  4LFC M;  3EIE A;  1I94 M;  5ITQ A;  4TUW A;  1JQJ C;  1FNN A;  4HLQ A;  1W5S A;  3LCU A;  3SHF A;  1Z6T A;  3GRY A;  5ITU A;  4LF8 M;  3D8B A;  3HJ8 A;  2X49 A;  2CV1 A;  1I4W A;  3GLI B;  4GMQ A;  4IJE A;  1Q02 A;  4EIW A;  4UN2 B;  4PD2 A;  3HHX A;  1TR8 A;  2K9D A;  3GQ5 A;  1QYR A;  1DGF A;  1XWI A;  2WSC F;  4M0D A;  1XNQ M;  3CF2 A;  1V34 A;  2UUC M;  3LVW A;  4L6V 6;  3TPZ A;  4D82 A;  4P17 A;  5FTJ A;  2KEB A;  2CV2 A;  2F5N A;  1IXZ A;  1NSF A;  3FTF A;  1EFU B;  1N75 A;  1VEK A;  3GO8 A;  4JV5 M;  2LNH C;  4G4O A;  1L2D A;  1E9R A;  2XFT A;  4BBA A;  1K3W A;  4FD2 A;  2XF3 A;  1X37 A;  1PJQ A;  2C98 A;  4LFB M;  1OIP A;  3AJI B;  4IBG A;  2F5S A;  4LJ9 A;  4REZ A;  5LMN M;  3V76 A;  1ZMU A;  2DAG A;  2JXN A;  1IXS B;  3HKP A;  2QEN A;  4RKU F;  4WW0 A;  3H4J A;  4LRS A;  5C18 A;  3VDU A;  3BOS A;  1QVR A;  1SXJ E;  4FCT A;  5GKN A;  3RFW A;  3HY5 A;  4AQY M;  4X62 M;  4X65 M;  3KVW A;  1MU5 A;  4XGI A;  5ITX E;  2O25 A;  2HWJ A;  3AOE A;  2R45 A;  2QSF X;  1J09 A;  5EJC A;  4DV2 M;  2W82 A;  3CF0 A;  1C1K A;  4B7H A;  1G71 A;  3HU2 A;  3K1J A;  3GLG B;  4DR2 M;  4F2L A;  2F5O A;  2UXC M;  4DV3 M;  2X8A A;  3B7N A;  2MGW A;  3HU3 A;  4GC5 A;  1T3T A;  2KHH A;  2UXD M;  1DO0 A;  1QZM A;  4G4R A;  2OO9 A;  4LFA M;  3E9S A;  3I04 M;  1OAO C;  4I4L A;  5IT9 S;  4JI0 M;  2L7H A;  3UJN A;  5ITR A;  4JYA M;  4IBD A;  1SXJ C;  1NNJ A;  3KW6 A;  4OW0 A;  3JR5 A;  2HL7 A;  1JR3 A;  2R65 A;  3F92 A;  1HNW M;  1GJS A;  1IN4 A;  1PJS A;  3GLH A;  1T6O A;  4NXN M;  4G3O A;  3FUW A;  3U6P A;  3VK7 A;  1Z59 A;  2QP9 X;  4ITQ A;  4DR4 M;  3ILK A;  1R5L A;  4PCZ A;  3U6L A;  2LWX A;  2VDB B;  1PJI A;  1GO5 A;  1WIV A;  1Z5C A;  2LVQ D;  1WGL A;  3GQ4 A;  2DWZ B;  2L4F A;  2LTU A;  3TWL A;  3I01 M;  1NNU C;  2OOB A;  1QZE A;  1YSY A;  2V6Z M;  4DR6 M;  3NWL A;  1OKS A;  1IXS A;  4LCB A;  4IBB A;  3GLF B;  1G3I A;  1ZMV A;  2BNK A;  4R7G A;  1G59 A;  3T38 A;  1Y8G A;  3MJ5 A;  3LQR A;  1VDD A;  3K9O A;  2DI0 A;  3VKG A;  3L2A A;  1VEG A;  2KNV A;  4HL4 A;  3HHY A;  3SBJ A;  3QYE A;  2OOA A;  5C1B A;  4DV4 M;  4DR7 M;  1OJL A;  4KO8 A;  3J2P B;  1IN7 A;  3B7Z A;  3L29 A;  2H5X A;  3M0E A;  4LY6 A;  1GLN A;  4Z8X A;  3FD9 A;  3UGJ A;  3SAW A;  2D7E A;  3NBX X;  2BWB A;  2DZO B;  1YE9 A;  2XSZ A;  3A42 A;  3QAU A;  5IRE B;  3TQS A;  4B7F A;  2C99 A;  1JB0 F;  3FRI A;  2JY8 A;  2YQZ A;  3SAS A;  2JY5 A;  2Y21 A;  3FUU A;  3U5Z A;  4LJA A;  2VF7 A;  1OQY A;  3PNY A;  1KFV A;  3LMM A;  1DGH B;  1Z5A A;  2Y0Q A;  5KPR A;  1BVS A;  5EP2 A;  2EA0 A;  3SAU A;  4L4U A;  3FTD A;  4IBJ A;  3SYK A;  4LJ7 A;  2J7O A;  4D80 A;  3I4V A;  2G8L A;  2K0B X;  4KOD A;  3ZC7 B;  4X64 M;  1IXR C;  4FVM A;  2DWN A;  5KQ8 A;  4DV5 M;  5JI3 E;  1IM2 A;  2GQF A;  3ZCB B;  3KP0 E;  4AG5 A;  3L26 A;  4MGZ E;  2R46 A;  3AFH A;  2WZJ A;  1N36 M;  4KLN A;  1HQY E;  1ZQ9 A;  3TE6 A;  1D0L A;  2LXE A;  3UZU A;  1IY0 A;  4DR3 M;  3FUX A;  3D8L A;  1N77 A;  1QAO A;  4JXJ A; 
#chains in the Genus database with same CATH homology
 1XXH E;  1C7Y A;  4Q7J A;  1EFU B;  1VEK A;  1KYI A;  1OAI A;  2KNZ A;  2B3T A;  1TTE A;  4DBG B;  1MN3 A;  1P3Q Q;  3E46 A;  1ZMU A;  1JR3 E;  1XB2 B;  2MRO B;  2DAG A;  1A5T A;  3H4J A;  2L4E A;  2CP8 A;  3BBZ A;  2JNH A;  4GEW A;  3K9P A;  1CUK A;  2O25 A;  2HWJ A;  2JY7 A;  2QSF X;  1VQ1 A;  1F4I A;  2DAE A;  2EJS A;  2DNA A;  1ZMW A;  2MJ5 B;  2LVA A;  4F2L A;  3IEC A;  1IFY A;  2MGW A;  1WJ7 A;  1DO2 A;  4F1I A;  2DAK A;  2KHH A;  1DO0 A;  2OO9 A;  1NV9 A;  2LVP C;  2DAM A;  1HT1 E;  5JI2 E;  1SG9 A;  2R0I A;  3GLH E;  2DZL A;  2EKK A;  3GLG E;  1UFZ A;  3F92 A;  3FE3 A;  3B89 A;  2G3Q A;  1T6O A;  1HJP A;  4G3O A;  1G4A E;  2JP7 A;  2DEN A;  2KNA A;  2MR9 A;  2ZTD A;  4R71 A;  1WIV A;  2LVQ D;  1GO5 A;  1WGL A;  2LVN C;  1V92 A;  1WR1 B;  4WP2 A;  2JY6 B;  2L4F A;  2LTU A;  2EKF A;  2OOB A;  1QZE A;  2RRU A;  2JUJ A;  3T6P A;  2QHO B;  1E94 E;  1DV0 A;  1OKS A;  1IXS A;  2JZ0 A;  1G3I A;  1ZMV A;  1VG5 A;  1AIP C;  1OTR A;  1WHC A;  1NV8 A;  1T43 A;  1Y8G A;  2DHY A;  3K9O A;  2DI0 A;  1VEG A;  2KNV A;  2CWB A;  2OOA A;  2JZ1 A;  2H5X A;  1G41 A;  2L2D A;  3LCV B;  2LVO C;  1WGN A;  2ZTC A;  3GLI E;  1YLA A;  2HAK A;  2BWB A;  3GLF E;  4HEO A;  1R4G A;  3FRI A;  1ZV1 A;  2JY8 A;  2JY5 A;  3FRH A;  3IHP A;  1OQY A;  2LBC A;  3LCU A;  2BWE A;  1BVS A;  2DKL A;  3E21 A;  2K0B X;  1Q02 A;  1HT2 E;  4UN2 B;  1TR8 A;  2K9D A;  1VDL A;  1PGY A;  1IM2 A;  3MMP A;  2DAI A;  2WZJ A;  1HQY E;  5DFL A;  2QNJ A;  1VEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...