3BBZA

Structure of the nucleocapsid-binding domain from the mumps virus phosphoprotein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
48
structure length
48
Chain Sequence
GQKVMITKMITDSVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords P protein
publication title Structure of the nucleocapsid-binding domain from the mumps virus polymerase; an example of protein folding induced by crystallization
pubmed doi rcsb
source organism Mumps virus
molecule tags Viral protein, replication
total genus 20
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3bbzA00
3E21A 1G4AE 2DAIA 2JY8A 4GEWA 1F4IA 2JZ1A 3E46A 2LVNC 1WHCA 1OAIA 1OKSA 3B89A 1KYIA 2L4EA 4Q7JA 1TR8A 1HT1E 2G3QA 2KNAA 1MN3A 1T6OA 2L2DA 1ZV1A 1IM2A 3GLFE 2MROB 1SG9A 1NV8A 1JR3E 1C7YA 2DAMA 2KNVA 1QZEA 1DO0A 1VEGA 1ZMWA 2H5XA 1DV0A 4F1IA 3LCVB 2R0IA 1WJ7A 3GLHE 1G3IA 3MMPA 3FRHA 2DAKA 1IXSA 2EKFA 1ZMVA 3H4JA 1OQYA 2DNAA 1WGNA 2MJ5B 2O25A 3IHPA 2L4FA 1P3QQ 2DAEA 1R4GA 2MR9A 2JY6B 1BVSA 2LVOC 1HJPA 2RRUA 2QNJA 3IECA 2LTUA 1A5TA 3FE3A 3GLGE 2WZJA 1HQYE 1G41A 2JNHA 2MGWA 1XXHE 1ZMUA 2JP7A 2CP8A 1VQ1A 2ZTCA 2ZTDA 3F92A 2DHYA 4G3OA 1EFUB 1WGLA 1CUKA 2EKKA 2DI0A 2LVAA 2QHOB 3FRIA 1IFYA 1WR1B 2JY5A 4F2LA 2HAKA 1NV9A 3K9PA 2QSFX 1VDLA 5DFLA 1XB2B 1HT2E 5JI2E 4WP2A 1DO2A 1Y8GA 2BWEA 2OO9A 3BBZA 2B3TA 2CWBA 1YLAA 1PGYA 1TTEA 2K9DA 1E94E 2EJSA 1V92A 2LVPC 1Q02A 2DZLA 1VEKA 3T6PA 2JUJA 2DKLA 4UN2B 3K9OA 1AIPC 2LVQD 2KNZA 1GO5A 1T43A 1UFZA 2DENA 1VG5A 1VEJA 1WIVA 4HEOA 2BWBA 3GLIE 2KHHA 2DAGA 2JZ0A 2HWJA 1OTRA 2K0BX 3LCUA 2JY7A 4DBGB 2OOAA 4R71A 2OOBA 2LBCA
chains in the Genus database with same CATH superfamily
3E21A 1J09A 1G4AE 4A3VB 1K3WA 4QNRA 4GEWA 1GVNA 1G59A 3B74A 2XLJA 1XXHA 2LVNC 4AKHA 1EE8A 4CIZA 3GPUA 4ZPXA 5ITUA 2F5NA 2CUZA 1KYIA 4I4LA 2W82A 3E4RA 3AV0A 1L2CA 2UUAM 4G4QA 3HWSA 1W5SA 2Y0TA 2UUBM 4D81A 3U60B 3FTFA 1IY1A 4NC6A 1QUTA 3HU1A 4B3TM 3GP1A 3FUWA 5FSWA 4JV5M 2Z4RA 1IBKM 1N75A 1E9RA 4BBAA 3B7ZA 2UXBM 3W0LB 2KNVA 1QZEA 1MJGM 4M9XA 3KOZE 3SAWA 5C1BA 4LJ6A 4GH9A 1DV0A 4WURA 1SXJE 3LCVB 4DR2M 3HU2A 1Q39A 1WJ7A 3HHZA 1SXJC 3U6PA 4JI1M 1G3IA 3GRUA 3U5ZA 1L8QA 4GC9A 4LJ4A 3VDPA 2XSZD 2KEBA 3TPZA 2QCUA 1IN8A 2KXEA 3FKEA 1J5EM 5FTJA 1WGNA 2MJ5B 4L6V6 4XK8F 3SARA 4AKGA 4QOSA 3IHPA 2L4FA 2DAEA 1IXZA 1Z6TA 2DWZB 2QZ4A 4LY6A 3J7AS 1NVMA 4JI0M 4OU7A 1XNRM 2RRUA 1BVSA 3GO8A 1XMOM 2QNJA 2CHVA 4G4NA 1A5TA 3LMMA 3MK6A 1IY0A 1TH4A 3HZJA 5IREB 4CGYB 1G41A 2JNHA 4NSRA 4JXJA 4LFAM 4PDGA 1FNNA 1OFHA 3M7GA 1LTMA 4JN6A 2QPAA 4LF5M 3PNVA 1VQ1A 1HNZM 4FCTA 3AFHA 5EXPA 4IBBA 3WHLA 2FH0A 4DUZM 4FCWA 3F92A 4G3OA 3J27B 4RNAA 4Z6YA 5DNYA 4L16A 4DR6M 3FRIA 3T1HM 1IFYA 3ZH9B 1T3TA 3JR4A 1QQWA 3QYEA 1NJFA 2CFOA 4LF8M 2HAKA 2E5LM 4PCZA 2JA2A 2Z8YM 3L25A 3BOSA 3KP1E 3L28A 1NHGC 4GIPA 5JI2E 2DXIA 3U6EA 2XFTA 3AOEA 1XHBA 2Q2EB 2CWBA 1D0MA 1TH3A 2WSEF 3A45A 1TGUA 4II7A 4MGIE 1SXJA 4IJFA 2YNMD 1VEKA 2OPFA 2V1CA 4R3DA 1WXQA 2RKOA 4X62M 4R7GA 2QBYA 4HLQA 2Y0QA 3KVWA 4UN2B 3SASA 1AIPC 3GQ3A 1GO5A 4L4UA 3SBJA 1UFZA 4PD2A 1VG5A 3IG8A 4MM3B 1LV7A 3HKPA 1VEJA 1WIVA 4GC5A 5H37D 3UJNA 4JI5M 4LF7M 4LFBM 3GPYA 3ZQJA 2JZ0A 4DR3M 4LJAA 4ITQA 1QAQA 4JI4M 5A2QS 1OTRA 5FTMA 3GPPA 3ILKA 1NY6A 2LNHC 2OOBA 1IN4A 2NQ8C 1PM5A 3PXGA 4IBGA 2DAIA 2R62A 5E26A 1VDDA 2JZ1A 4JI8M 4M0WA 1N33M 1WHCA 1OAIA 1OKSA 2C9CA 3NWLA 4CHTB 1JB0F 2DWNA 3SMSA 3GLFB 2JXNA 1PJSA 1IN5A 1TR8A 2R4EA 1Q3BA 1JR3D 4CISA 3SMPA 1IN7A 1HQCA 5KPZA 1PJQA 4FW9A 3U6LA 2XFSA 4I5SA 1XC8A 1ZV1A 3KOWE 3J81S 1HNXM 5KQ8A 1YE9A 3GRRA 3I4VA 2YFQA 3FUTA 3SAUA 4BLCA 1HR0M 4FCVA 2R65A 1QZMA 3U6SA 1C7YA 3GLHB 4RKUF 1NY5A 2R46A 3RFWA 2VIIA 3A98B 4LJ8A 4OW0A 1GABA 4IBDA 4MH0E 2F5OA 1D0KA 4NRVA 1ZAEA 1DGHB 2L7IA 3HJ8A 3D8LA 2CEAA 3FRHA 3KDSE 3MMPA 3ZCBB 3L26A 2FFJA 4B7FA 5C18A 1Z5CA 3SHFA 3VFDA 4DV2M 1L1TA 4DR4M 2VF8A 1OQYA 3HX3A 2KZUA 2QQ8A 2ZM6M 5ITYA 4G4OA 3JR5A 4NXMM 2O25A 3GLGB 4EIWA 1P3QQ 2M60A 2XF3A 4LRTA 2XEPA 3MJ5A 3C3DA 4MGZE 2JY6B 2LVOC 1QDRA 4B3SM 1R6BX 2XGNA 3DZDA 4MB7A 3U6QA 2LTUA 2R44A 3LVVA 2KRKA 5GKNA 4I8OA 5ITXE 2VDBB 3H4MA 3AOEC 4D82A 3SFZA 4LJ7A 2QENA 4KLNA 2F5QA 3M0EA 3JAMS 2AHMA 1GLNA 3THGA 3TE6A 4OVZA 2L09A 2ZTCA 4NXNM 4QHSA 3UMMA 3A46A 4DV6M 4LF6M 1TDHA 2H1RA 1WGLA 4DV3M 1NNJA 2FS1A 2EA0A 1WR1B 2CE7A 2BNKA 3TWKA 2R18A 4F2LA 3DFZA 2QSFX 1VDLA 1N34M 5DFLA 1R2YA 2XSZA 2C5RA 5FTKA 4P16A 2CHGA 4IBEA 1IN6A 1QDTA 4WP2A 3U60A 1IXSB 2OO9A 3BBZA 2LHGA 2UU9M 2LH0A 1QAOA 3I51A 3OTOM 1YLAA 2K6BA 2LVPC 3QAUA 1R5LA 3HHYA 3T6PA 1UM8A 4IBIA 4XGIA 4L8RC 1QANA 4L78A 3KFUG 1OFIA 1C1KA 1QUSA 3HJSA 3GLIB 2DWLA 1N78A 2DKLA 2X4AA 2KW0A 4D80A 2LVQD 3KXEC 4FWHA 1T43A 1PJIA 3I04M 3T38A 3W68A 2UXDM 1GJTA 2KDLA 3C3EA 5ITRA 4GHAA 3VKHA 2BWBA 5DYGA 3C9PA 4B7HA 3RE8A 2V6ZM 3I4YA 3D8BA 3U61B 2C98A 3AL0C 1OIZA 3UGJA 3B9PA 3TQSA 1NNUC 3VK7A 4GRIA 2JY7A 1GL6A 3RGPA 4R71A 4NRWA 5ITXA 3AOGA 1I94M 2N35A 1HNWM 2JY8A 4PDIA 1E32A 3CF2A 3E46A 4NSOB 1F4IA 3AJIB 5ITTA 4M9SA 1Z59A 3KS4A 3KSXA 2ERCA 3B89A 4Q7JA 4LZZA 3BXWA 1IY2A 4REZA 4CJ6A 4OX9M 1XNQM 2KNAA 1QVRA 5KQDA 4JI3M 1MU5A 3R8FA 1T6OA 3Q8GA 2L2DA 1G71A 1IM2A 4FWDA 1TDZA 3GLFE 2JWSA 4DR7M 3IG5A 4IBFA 1L2DA 1X37A 4LF9M 4JI2M 2MROB 1SG9A 1NV8A 2DZOB 1H6UA 3ZC7B 5EJCA 4DV7M 1QYRA 4IJEA 3U6MA 1G8PA 3KS8A 1Z5AA 2H5XA 3CGWA 5EP2A 3PFIA 5KPTA 4F1IA 2CV0A 2UXCM 3TWMA 3EIEA 3GLHE 5FLXS 4JI7M 4G6ZA 3J7BA 3SATA 3UZUA 4G4RA 2WSFF 1YUBA 1ZMVA 2KZSA 1K82A 1D2NA 3LW5F 2YR0A 2HKJA 2C9OA 2R45A 1R7RA 3KP0E 2D7GA 1YSYA 3T1YM 5BPVA 2V1UA 1V34A 3SYLA 3DA1A 2KRUA 4B3RM 4M9ZA 3SHGB 1I4WA 2Z3XA 1MX0A 1JR3A 1XXHB 2X49A 3DOAA 3FYCA 1J7KA 1HJPA 3KOYE 4KHPM 4X66M 2Z7JA 2J5YA 2R4JA 3FE3A 4FWGA 3GLGE 3Q8XA 2ZAOA 3SYKA 1HQYE 3K92A 3HJQA 4YY3M 2MGWA 2G8LA 4LGMA 3TWLA 1ZMUA 2C99A 5FTLA 2HL7A 3QYBA 4QNMA 4L15A 2VF7A 1N36M 4M0DA 3PNYA 3HHXA 4LF4M 4W5WA 1EFUB 1CUKA 2EKKA 4MGYE 2DI0A 2QHOB 2DWMA 3L27A 2JY5A 1KSFX 3K1JA 4Y28F 1TF0B 3K9PA 4NOOB 4QHTA 3GLFA 1NJGA 4LCBA 2CV1A 3CF6E 4QOZC 2LXEA 2J7OA 1XB2B 1HT2E 5EXXA 3U5ZB 3VK8A 4WW0A 4KT0F 3SAVA 2B3TA 3AKZA 3KSJA 1PGYA 3HU3A 1E9SA 1QAMA 2M5ZA 4LJ9A 4DR5M 1RU3A 1V92A 3L29A 2D7HA 4AG6A 4ANRA 2J7NA 4DV4M 1Q02A 2DZLA 3GLHA 3A42A 3KW6A 2XZFA 2CRUA 2JUJA 1L2BA 2X8AA 1D0LA 3B7QA 2ZANA 3PVSA 3VLFB 4X64M 2DENA 3U6DA 1PJJA 1V33A 1Z5BA 2L6OA 1DGHA 3HGIA 4HEOA 4AKIA 1L1ZA 2FNAA 2CV2A 5EXSA 4GMQA 4I81A 4AW4A 1JQJC 2KHHA 1GL7A 2DAGA 3GLIE 3HY5A 5EP1A 3K8ZA 2HWJA 1KFVA 2APLA 4MGHA 4TUWA 3B7NA 3GQ4A 2FOIC 4X65M 3LCUA 4KO8A 2EUCA 4FVMA 3GLGA 3U6CA 4LRSA 2O5RA 2WSCF 5EQTA 5E6JA 3CF0A 2L4EA 1HT1E 2G3QA 5BR8M 2VQEM 1ORYB 3M6AA 3L2AA 2MH8A 5L8RF 4GHLA 1MN3A 3LQRA 3I01M 3K2LA 2GQFA 2Y21A 4FD2A 4MGKE 2EO2A 3FUVA 3LQQA 3TL4X 1N32M 1DGFA 1SXJB 4DV1M 2KA6B 1JR3E 3GRYA 1DGBA 3V76A 2A5YB 4S12A 2DAMA 2LWXA 4GITA 1OIPA 2BJVA 4AQYM 2XZUA 1DO0A 1VEGA 1ZMWA 2QBYB 3VKGA 2O01F 5IWAM 4K0KM 4LG2A 5EXTA 1FJGM 1W5TA 3VDUA 2R0IA 3W67A 1NO1A 4PT5A 2K47A 1NSFA 3HHWA 4AZFA 4Z8XA 2DAKA 1IXSA 1Q3CA 2EKFA 4RF1A 3J80S 1S3SA 5ITQA 3H4JA 2DNAA 5LMUM 1EIJA 3SC3A 5KO3A 3FTDA 3FUUA 4KODA 3C58A 3FTCA 2F4VM 2F5PA 3CTWB 5DYIA 5EP4A 3GQ5A 4P17A 1R4GA 1IBMM 3FTEA 3EIHA 2RGOA 1AUAA 2MR9A 4GKJM 2DZNB 1SXJD 3GLIA 3IECA 2DVWB 4GKKM 1TH2A 4DV0M 3MHVC 4RF0A 2Y20A 2VQFM 4DV5M 4DR1M 2WZJA 4IBKA 3E9SA 5KPRA 3W0FA 2DHRA 2CHQA 3QWLA 4LJ5A 1XXHE 4AG5A 4YHHM 2XH9A 4B08A 2JP7A 1IXRC 2CP8A 2RGHA 4IIWA 3U61A 3T15A 2I7NA 2LHCA 3FYDA 3LVWA 1GJSA 1XMQM 2ZTDA 1PJTA 2DHYA 4LFCM 4AI6A 4NL4H 2D7EA 2LVAA 1NHWC 3FD9A 8CATA 3WHKA 1XWIA 1DGGA 1NV9A 3NBXX 2F5SA 3R9XB 5FTNA 5EP3A 7CATA 4DUYM 3U6OA 4IBJA 2BJWA 3UK6A 1R2ZA 1GKIA 1IBLM 1DO2A 1Y8GA 2BWEA 2R6FA 4IBCA 3J2PB 4LGYA 4B3MM 1N77A 2K9DA 1TTEA 2FE8A 1E94E 2EJSA 2P5TA 4B7GA 3KOXE 3GPXA 2C96A 1ZQ9A 1PRBA 4BB9A 2QP9X 1K3XA 2I7PA 2UUCM 4HL4A 3RGSA 5F3WA 2ZAMA 5IT9S 3K9OA 1IQPA 2G5GX 2ZBKB 3NBIA 1OJLA 2KNZA 5IZ7D 2HCBA 3FUXA 2YQZA 3GRVA 4JYAM 2L7HA 4LZJA 5LMNM 4JI6M 2HHHM 2K0BX 4XBOA 2Z4SA 2OQ4A 5JI3E 4OVZB 4DBGB 2OOAA 1OAOC 2LBCA 2GNOA
chains in the Genus database with same CATH topology
3E21A 1G4AE 2DAIA 2JY8A 4GEWA 1F4IA 2JZ1A 3E46A 2LVNC 1WHCA 1OAIA 1OKSA 3B89A 1KYIA 2L4EA 4Q7JA 1TR8A 1HT1E 2G3QA 2KNAA 1MN3A 1T6OA 2L2DA 1ZV1A 1IM2A 3GLFE 2MROB 1SG9A 1NV8A 1JR3E 1C7YA 2DAMA 2KNVA 1QZEA 1DO0A 1VEGA 1ZMWA 2H5XA 1DV0A 4F1IA 3LCVB 2R0IA 1WJ7A 3GLHE 1G3IA 3MMPA 3FRHA 2DAKA 1IXSA 2EKFA 1ZMVA 3H4JA 1OQYA 2DNAA 1WGNA 2MJ5B 2O25A 3IHPA 2L4FA 1P3QQ 2DAEA 1R4GA 2MR9A 2JY6B 1BVSA 2LVOC 1HJPA 2RRUA 2QNJA 3IECA 2LTUA 1A5TA 3FE3A 3GLGE 2WZJA 1HQYE 1G41A 2JNHA 2MGWA 1XXHE 1ZMUA 2JP7A 2CP8A 1VQ1A 2ZTCA 2ZTDA 3F92A 2DHYA 4G3OA 1EFUB 1WGLA 1CUKA 2EKKA 2DI0A 2LVAA 2QHOB 3FRIA 1IFYA 1WR1B 2JY5A 4F2LA 2HAKA 1NV9A 3K9PA 2QSFX 1VDLA 5DFLA 1XB2B 1HT2E 5JI2E 4WP2A 1DO2A 1Y8GA 2BWEA 2OO9A 3BBZA 2B3TA 2CWBA 1YLAA 1PGYA 1TTEA 2K9DA 1E94E 2EJSA 1V92A 2LVPC 1Q02A 2DZLA 1VEKA 3T6PA 2JUJA 2DKLA 4UN2B 3K9OA 1AIPC 2LVQD 2KNZA 1GO5A 1T43A 1UFZA 2DENA 1VG5A 1VEJA 1WIVA 4HEOA 2BWBA 3GLIE 2KHHA 2DAGA 2JZ0A 2HWJA 1OTRA 2K0BX 3LCUA 2JY7A 4DBGB 2OOAA 4R71A 2OOBA 2LBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E21 A;  1G4A E;  2DAI A;  2JY8 A;  4GEW A;  1F4I A;  2JZ1 A;  3E46 A;  2LVN C;  1WHC A;  1OAI A;  1OKS A;  3B89 A;  1KYI A;  2L4E A;  4Q7J A;  1TR8 A;  1HT1 E;  2G3Q A;  2KNA A;  1MN3 A;  1T6O A;  2L2D A;  1ZV1 A;  1IM2 A;  3GLF E;  2MRO B;  1SG9 A;  1NV8 A;  1JR3 E;  1C7Y A;  2DAM A;  2KNV A;  1QZE A;  1DO0 A;  1VEG A;  1ZMW A;  2H5X A;  1DV0 A;  4F1I A;  3LCV B;  2R0I A;  1WJ7 A;  3GLH E;  1G3I A;  3MMP A;  3FRH A;  2DAK A;  1IXS A;  2EKF A;  1ZMV A;  3H4J A;  1OQY A;  2DNA A;  1WGN A;  2MJ5 B;  2O25 A;  3IHP A;  2L4F A;  1P3Q Q;  2DAE A;  1R4G A;  2MR9 A;  2JY6 B;  1BVS A;  2LVO C;  1HJP A;  2RRU A;  2QNJ A;  3IEC A;  2LTU A;  1A5T A;  3FE3 A;  3GLG E;  2WZJ A;  1HQY E;  1G41 A;  2JNH A;  2MGW A;  1XXH E;  1ZMU A;  2JP7 A;  2CP8 A;  1VQ1 A;  2ZTC A;  2ZTD A;  3F92 A;  2DHY A;  4G3O A;  1EFU B;  1WGL A;  1CUK A;  2EKK A;  2DI0 A;  2LVA A;  2QHO B;  3FRI A;  1IFY A;  1WR1 B;  2JY5 A;  4F2L A;  2HAK A;  1NV9 A;  3K9P A;  2QSF X;  1VDL A;  5DFL A;  1XB2 B;  1HT2 E;  5JI2 E;  4WP2 A;  1DO2 A;  1Y8G A;  2BWE A;  2OO9 A;  3BBZ A;  2B3T A;  2CWB A;  1YLA A;  1PGY A;  1TTE A;  2K9D A;  1E94 E;  2EJS A;  1V92 A;  2LVP C;  1Q02 A;  2DZL A;  1VEK A;  3T6P A;  2JUJ A;  2DKL A;  4UN2 B;  3K9O A;  1AIP C;  2LVQ D;  2KNZ A;  1GO5 A;  1T43 A;  1UFZ A;  2DEN A;  1VG5 A;  1VEJ A;  1WIV A;  4HEO A;  2BWB A;  3GLI E;  2KHH A;  2DAG A;  2JZ0 A;  2HWJ A;  1OTR A;  2K0B X;  3LCU A;  2JY7 A;  4DBG B;  2OOA A;  4R71 A;  2OOB A;  2LBC A; 
#chains in the Genus database with same CATH topology
 3E21 A;  1J09 A;  1G4A E;  4A3V B;  1K3W A;  4QNR A;  4GEW A;  1GVN A;  1G59 A;  3B74 A;  2XLJ A;  1XXH A;  2LVN C;  4AKH A;  1EE8 A;  4CIZ A;  3GPU A;  4ZPX A;  5ITU A;  2F5N A;  2CUZ A;  1KYI A;  4I4L A;  2W82 A;  3E4R A;  3AV0 A;  1L2C A;  2UUA M;  4G4Q A;  3HWS A;  1W5S A;  2Y0T A;  2UUB M;  4D81 A;  3U60 B;  3FTF A;  1IY1 A;  4NC6 A;  1QUT A;  3HU1 A;  4B3T M;  3GP1 A;  3FUW A;  5FSW A;  4JV5 M;  2Z4R A;  1IBK M;  1N75 A;  1E9R A;  4BBA A;  3B7Z A;  2UXB M;  3W0L B;  2KNV A;  1QZE A;  1MJG M;  4M9X A;  3KOZ E;  3SAW A;  5C1B A;  4LJ6 A;  4GH9 A;  1DV0 A;  4WUR A;  1SXJ E;  3LCV B;  4DR2 M;  3HU2 A;  1Q39 A;  1WJ7 A;  3HHZ A;  1SXJ C;  3U6P A;  4JI1 M;  1G3I A;  3GRU A;  3U5Z A;  1L8Q A;  4GC9 A;  4LJ4 A;  3VDP A;  2XSZ D;  2KEB A;  3TPZ A;  2QCU A;  1IN8 A;  2KXE A;  3FKE A;  1J5E M;  5FTJ A;  1WGN A;  2MJ5 B;  4L6V 6;  4XK8 F;  3SAR A;  4AKG A;  4QOS A;  3IHP A;  2L4F A;  2DAE A;  1IXZ A;  1Z6T A;  2DWZ B;  2QZ4 A;  4LY6 A;  3J7A S;  1NVM A;  4JI0 M;  4OU7 A;  1XNR M;  2RRU A;  1BVS A;  3GO8 A;  1XMO M;  2QNJ A;  2CHV A;  4G4N A;  1A5T A;  3LMM A;  3MK6 A;  1IY0 A;  1TH4 A;  3HZJ A;  5IRE B;  4CGY B;  1G41 A;  2JNH A;  4NSR A;  4JXJ A;  4LFA M;  4PDG A;  1FNN A;  1OFH A;  3M7G A;  1LTM A;  4JN6 A;  2QPA A;  4LF5 M;  3PNV A;  1VQ1 A;  1HNZ M;  4FCT A;  3AFH A;  5EXP A;  4IBB A;  3WHL A;  2FH0 A;  4DUZ M;  4FCW A;  3F92 A;  4G3O A;  3J27 B;  4RNA A;  4Z6Y A;  5DNY A;  4L16 A;  4DR6 M;  3FRI A;  3T1H M;  1IFY A;  3ZH9 B;  1T3T A;  3JR4 A;  1QQW A;  3QYE A;  1NJF A;  2CFO A;  4LF8 M;  2HAK A;  2E5L M;  4PCZ A;  2JA2 A;  2Z8Y M;  3L25 A;  3BOS A;  3KP1 E;  3L28 A;  1NHG C;  4GIP A;  5JI2 E;  2DXI A;  3U6E A;  2XFT A;  3AOE A;  1XHB A;  2Q2E B;  2CWB A;  1D0M A;  1TH3 A;  2WSE F;  3A45 A;  1TGU A;  4II7 A;  4MGI E;  1SXJ A;  4IJF A;  2YNM D;  1VEK A;  2OPF A;  2V1C A;  4R3D A;  1WXQ A;  2RKO A;  4X62 M;  4R7G A;  2QBY A;  4HLQ A;  2Y0Q A;  3KVW A;  4UN2 B;  3SAS A;  1AIP C;  3GQ3 A;  1GO5 A;  4L4U A;  3SBJ A;  1UFZ A;  4PD2 A;  1VG5 A;  3IG8 A;  4MM3 B;  1LV7 A;  3HKP A;  1VEJ A;  1WIV A;  4GC5 A;  5H37 D;  3UJN A;  4JI5 M;  4LF7 M;  4LFB M;  3GPY A;  3ZQJ A;  2JZ0 A;  4DR3 M;  4LJA A;  4ITQ A;  1QAQ A;  4JI4 M;  5A2Q S;  1OTR A;  5FTM A;  3GPP A;  3ILK A;  1NY6 A;  2LNH C;  2OOB A;  1IN4 A;  2NQ8 C;  1PM5 A;  3PXG A;  4IBG A;  2DAI A;  2R62 A;  5E26 A;  1VDD A;  2JZ1 A;  4JI8 M;  4M0W A;  1N33 M;  1WHC A;  1OAI A;  1OKS A;  2C9C A;  3NWL A;  4CHT B;  1JB0 F;  2DWN A;  3SMS A;  3GLF B;  2JXN A;  1PJS A;  1IN5 A;  1TR8 A;  2R4E A;  1Q3B A;  1JR3 D;  4CIS A;  3SMP A;  1IN7 A;  1HQC A;  5KPZ A;  1PJQ A;  4FW9 A;  3U6L A;  2XFS A;  4I5S A;  1XC8 A;  1ZV1 A;  3KOW E;  3J81 S;  1HNX M;  5KQ8 A;  1YE9 A;  3GRR A;  3I4V A;  2YFQ A;  3FUT A;  3SAU A;  4BLC A;  1HR0 M;  4FCV A;  2R65 A;  1QZM A;  3U6S A;  1C7Y A;  3GLH B;  4RKU F;  1NY5 A;  2R46 A;  3RFW A;  2VII A;  3A98 B;  4LJ8 A;  4OW0 A;  1GAB A;  4IBD A;  4MH0 E;  2F5O A;  1D0K A;  4NRV A;  1ZAE A;  1DGH B;  2L7I A;  3HJ8 A;  3D8L A;  2CEA A;  3FRH A;  3KDS E;  3MMP A;  3ZCB B;  3L26 A;  2FFJ A;  4B7F A;  5C18 A;  1Z5C A;  3SHF A;  3VFD A;  4DV2 M;  1L1T A;  4DR4 M;  2VF8 A;  1OQY A;  3HX3 A;  2KZU A;  2QQ8 A;  2ZM6 M;  5ITY A;  4G4O A;  3JR5 A;  4NXM M;  2O25 A;  3GLG B;  4EIW A;  1P3Q Q;  2M60 A;  2XF3 A;  4LRT A;  2XEP A;  3MJ5 A;  3C3D A;  4MGZ E;  2JY6 B;  2LVO C;  1QDR A;  4B3S M;  1R6B X;  2XGN A;  3DZD A;  4MB7 A;  3U6Q A;  2LTU A;  2R44 A;  3LVV A;  2KRK A;  5GKN A;  4I8O A;  5ITX E;  2VDB B;  3H4M A;  3AOE C;  4D82 A;  3SFZ A;  4LJ7 A;  2QEN A;  4KLN A;  2F5Q A;  3M0E A;  3JAM S;  2AHM A;  1GLN A;  3THG A;  3TE6 A;  4OVZ A;  2L09 A;  2ZTC A;  4NXN M;  4QHS A;  3UMM A;  3A46 A;  4DV6 M;  4LF6 M;  1TDH A;  2H1R A;  1WGL A;  4DV3 M;  1NNJ A;  2FS1 A;  2EA0 A;  1WR1 B;  2CE7 A;  2BNK A;  3TWK A;  2R18 A;  4F2L A;  3DFZ A;  2QSF X;  1VDL A;  1N34 M;  5DFL A;  1R2Y A;  2XSZ A;  2C5R A;  5FTK A;  4P16 A;  2CHG A;  4IBE A;  1IN6 A;  1QDT A;  4WP2 A;  3U60 A;  1IXS B;  2OO9 A;  3BBZ A;  2LHG A;  2UU9 M;  2LH0 A;  1QAO A;  3I51 A;  3OTO M;  1YLA A;  2K6B A;  2LVP C;  3QAU A;  1R5L A;  3HHY A;  3T6P A;  1UM8 A;  4IBI A;  4XGI A;  4L8R C;  1QAN A;  4L78 A;  3KFU G;  1OFI A;  1C1K A;  1QUS A;  3HJS A;  3GLI B;  2DWL A;  1N78 A;  2DKL A;  2X4A A;  2KW0 A;  4D80 A;  2LVQ D;  3KXE C;  4FWH A;  1T43 A;  1PJI A;  3I04 M;  3T38 A;  3W68 A;  2UXD M;  1GJT A;  2KDL A;  3C3E A;  5ITR A;  4GHA A;  3VKH A;  2BWB A;  5DYG A;  3C9P A;  4B7H A;  3RE8 A;  2V6Z M;  3I4Y A;  3D8B A;  3U61 B;  2C98 A;  3AL0 C;  1OIZ A;  3UGJ A;  3B9P A;  3TQS A;  1NNU C;  3VK7 A;  4GRI A;  2JY7 A;  1GL6 A;  3RGP A;  4R71 A;  4NRW A;  5ITX A;  3AOG A;  1I94 M;  2N35 A;  1HNW M;  2JY8 A;  4PDI A;  1E32 A;  3CF2 A;  3E46 A;  4NSO B;  1F4I A;  3AJI B;  5ITT A;  4M9S A;  1Z59 A;  3KS4 A;  3KSX A;  2ERC A;  3B89 A;  4Q7J A;  4LZZ A;  3BXW A;  1IY2 A;  4REZ A;  4CJ6 A;  4OX9 M;  1XNQ M;  2KNA A;  1QVR A;  5KQD A;  4JI3 M;  1MU5 A;  3R8F A;  1T6O A;  3Q8G A;  2L2D A;  1G71 A;  1IM2 A;  4FWD A;  1TDZ A;  3GLF E;  2JWS A;  4DR7 M;  3IG5 A;  4IBF A;  1L2D A;  1X37 A;  4LF9 M;  4JI2 M;  2MRO B;  1SG9 A;  1NV8 A;  2DZO B;  1H6U A;  3ZC7 B;  5EJC A;  4DV7 M;  1QYR A;  4IJE A;  3U6M A;  1G8P A;  3KS8 A;  1Z5A A;  2H5X A;  3CGW A;  5EP2 A;  3PFI A;  5KPT A;  4F1I A;  2CV0 A;  2UXC M;  3TWM A;  3EIE A;  3GLH E;  5FLX S;  4JI7 M;  4G6Z A;  3J7B A;  3SAT A;  3UZU A;  4G4R A;  2WSF F;  1YUB A;  1ZMV A;  2KZS A;  1K82 A;  1D2N A;  3LW5 F;  2YR0 A;  2HKJ A;  2C9O A;  2R45 A;  1R7R A;  3KP0 E;  2D7G A;  1YSY A;  3T1Y M;  5BPV A;  2V1U A;  1V34 A;  3SYL A;  3DA1 A;  2KRU A;  4B3R M;  4M9Z A;  3SHG B;  1I4W A;  2Z3X A;  1MX0 A;  1JR3 A;  1XXH B;  2X49 A;  3DOA A;  3FYC A;  1J7K A;  1HJP A;  3KOY E;  4KHP M;  4X66 M;  2Z7J A;  2J5Y A;  2R4J A;  3FE3 A;  4FWG A;  3GLG E;  3Q8X A;  2ZAO A;  3SYK A;  1HQY E;  3K92 A;  3HJQ A;  4YY3 M;  2MGW A;  2G8L A;  4LGM A;  3TWL A;  1ZMU A;  2C99 A;  5FTL A;  2HL7 A;  3QYB A;  4QNM A;  4L15 A;  2VF7 A;  1N36 M;  4M0D A;  3PNY A;  3HHX A;  4LF4 M;  4W5W A;  1EFU B;  1CUK A;  2EKK A;  4MGY E;  2DI0 A;  2QHO B;  2DWM A;  3L27 A;  2JY5 A;  1KSF X;  3K1J A;  4Y28 F;  1TF0 B;  3K9P A;  4NOO B;  4QHT A;  3GLF A;  1NJG A;  4LCB A;  2CV1 A;  3CF6 E;  4QOZ C;  2LXE A;  2J7O A;  1XB2 B;  1HT2 E;  5EXX A;  3U5Z B;  3VK8 A;  4WW0 A;  4KT0 F;  3SAV A;  2B3T A;  3AKZ A;  3KSJ A;  1PGY A;  3HU3 A;  1E9S A;  1QAM A;  2M5Z A;  4LJ9 A;  4DR5 M;  1RU3 A;  1V92 A;  3L29 A;  2D7H A;  4AG6 A;  4ANR A;  2J7N A;  4DV4 M;  1Q02 A;  2DZL A;  3GLH A;  3A42 A;  3KW6 A;  2XZF A;  2CRU A;  2JUJ A;  1L2B A;  2X8A A;  1D0L A;  3B7Q A;  2ZAN A;  3PVS A;  3VLF B;  4X64 M;  2DEN A;  3U6D A;  1PJJ A;  1V33 A;  1Z5B A;  2L6O A;  1DGH A;  3HGI A;  4HEO A;  4AKI A;  1L1Z A;  2FNA A;  2CV2 A;  5EXS A;  4GMQ A;  4I81 A;  4AW4 A;  1JQJ C;  2KHH A;  1GL7 A;  2DAG A;  3GLI E;  3HY5 A;  5EP1 A;  3K8Z A;  2HWJ A;  1KFV A;  2APL A;  4MGH A;  4TUW A;  3B7N A;  3GQ4 A;  2FOI C;  4X65 M;  3LCU A;  4KO8 A;  2EUC A;  4FVM A;  3GLG A;  3U6C A;  4LRS A;  2O5R A;  2WSC F;  5EQT A;  5E6J A;  3CF0 A;  2L4E A;  1HT1 E;  2G3Q A;  5BR8 M;  2VQE M;  1ORY B;  3M6A A;  3L2A A;  2MH8 A;  5L8R F;  4GHL A;  1MN3 A;  3LQR A;  3I01 M;  3K2L A;  2GQF A;  2Y21 A;  4FD2 A;  4MGK E;  2EO2 A;  3FUV A;  3LQQ A;  3TL4 X;  1N32 M;  1DGF A;  1SXJ B;  4DV1 M;  2KA6 B;  1JR3 E;  3GRY A;  1DGB A;  3V76 A;  2A5Y B;  4S12 A;  2DAM A;  2LWX A;  4GIT A;  1OIP A;  2BJV A;  4AQY M;  2XZU A;  1DO0 A;  1VEG A;  1ZMW A;  2QBY B;  3VKG A;  2O01 F;  5IWA M;  4K0K M;  4LG2 A;  5EXT A;  1FJG M;  1W5T A;  3VDU A;  2R0I A;  3W67 A;  1NO1 A;  4PT5 A;  2K47 A;  1NSF A;  3HHW A;  4AZF A;  4Z8X A;  2DAK A;  1IXS A;  1Q3C A;  2EKF A;  4RF1 A;  3J80 S;  1S3S A;  5ITQ A;  3H4J A;  2DNA A;  5LMU M;  1EIJ A;  3SC3 A;  5KO3 A;  3FTD A;  3FUU A;  4KOD A;  3C58 A;  3FTC A;  2F4V M;  2F5P A;  3CTW B;  5DYI A;  5EP4 A;  3GQ5 A;  4P17 A;  1R4G A;  1IBM M;  3FTE A;  3EIH A;  2RGO A;  1AUA A;  2MR9 A;  4GKJ M;  2DZN B;  1SXJ D;  3GLI A;  3IEC A;  2DVW B;  4GKK M;  1TH2 A;  4DV0 M;  3MHV C;  4RF0 A;  2Y20 A;  2VQF M;  4DV5 M;  4DR1 M;  2WZJ A;  4IBK A;  3E9S A;  5KPR A;  3W0F A;  2DHR A;  2CHQ A;  3QWL A;  4LJ5 A;  1XXH E;  4AG5 A;  4YHH M;  2XH9 A;  4B08 A;  2JP7 A;  1IXR C;  2CP8 A;  2RGH A;  4IIW A;  3U61 A;  3T15 A;  2I7N A;  2LHC A;  3FYD A;  3LVW A;  1GJS A;  1XMQ M;  2ZTD A;  1PJT A;  2DHY A;  4LFC M;  4AI6 A;  4NL4 H;  2D7E A;  2LVA A;  1NHW C;  3FD9 A;  8CAT A;  3WHK A;  1XWI A;  1DGG A;  1NV9 A;  3NBX X;  2F5S A;  3R9X B;  5FTN A;  5EP3 A;  7CAT A;  4DUY M;  3U6O A;  4IBJ A;  2BJW A;  3UK6 A;  1R2Z A;  1GKI A;  1IBL M;  1DO2 A;  1Y8G A;  2BWE A;  2R6F A;  4IBC A;  3J2P B;  4LGY A;  4B3M M;  1N77 A;  2K9D A;  1TTE A;  2FE8 A;  1E94 E;  2EJS A;  2P5T A;  4B7G A;  3KOX E;  3GPX A;  2C96 A;  1ZQ9 A;  1PRB A;  4BB9 A;  2QP9 X;  1K3X A;  2I7P A;  2UUC M;  4HL4 A;  3RGS A;  5F3W A;  2ZAM A;  5IT9 S;  3K9O A;  1IQP A;  2G5G X;  2ZBK B;  3NBI A;  1OJL A;  2KNZ A;  5IZ7 D;  2HCB A;  3FUX A;  2YQZ A;  3GRV A;  4JYA M;  2L7H A;  4LZJ A;  5LMN M;  4JI6 M;  2HHH M;  2K0B X;  4XBO A;  2Z4S A;  2OQ4 A;  5JI3 E;  4OVZ B;  4DBG B;  2OOA A;  1OAO C;  2LBC A;  2GNO A; 
#chains in the Genus database with same CATH homology
 3E21 A;  1G4A E;  2DAI A;  2JY8 A;  4GEW A;  1F4I A;  2JZ1 A;  3E46 A;  2LVN C;  1WHC A;  1OAI A;  1OKS A;  3B89 A;  1KYI A;  2L4E A;  4Q7J A;  1TR8 A;  1HT1 E;  2G3Q A;  2KNA A;  1MN3 A;  1T6O A;  2L2D A;  1ZV1 A;  1IM2 A;  3GLF E;  2MRO B;  1SG9 A;  1NV8 A;  1JR3 E;  1C7Y A;  2DAM A;  2KNV A;  1QZE A;  1DO0 A;  1VEG A;  1ZMW A;  2H5X A;  1DV0 A;  4F1I A;  3LCV B;  2R0I A;  1WJ7 A;  3GLH E;  1G3I A;  3MMP A;  3FRH A;  2DAK A;  1IXS A;  2EKF A;  1ZMV A;  3H4J A;  1OQY A;  2DNA A;  1WGN A;  2MJ5 B;  2O25 A;  3IHP A;  2L4F A;  1P3Q Q;  2DAE A;  1R4G A;  2MR9 A;  2JY6 B;  1BVS A;  2LVO C;  1HJP A;  2RRU A;  2QNJ A;  3IEC A;  2LTU A;  1A5T A;  3FE3 A;  3GLG E;  2WZJ A;  1HQY E;  1G41 A;  2JNH A;  2MGW A;  1XXH E;  1ZMU A;  2JP7 A;  2CP8 A;  1VQ1 A;  2ZTC A;  2ZTD A;  3F92 A;  2DHY A;  4G3O A;  1EFU B;  1WGL A;  1CUK A;  2EKK A;  2DI0 A;  2LVA A;  2QHO B;  3FRI A;  1IFY A;  1WR1 B;  2JY5 A;  4F2L A;  2HAK A;  1NV9 A;  3K9P A;  2QSF X;  1VDL A;  5DFL A;  1XB2 B;  1HT2 E;  5JI2 E;  4WP2 A;  1DO2 A;  1Y8G A;  2BWE A;  2OO9 A;  3BBZ A;  2B3T A;  2CWB A;  1YLA A;  1PGY A;  1TTE A;  2K9D A;  1E94 E;  2EJS A;  1V92 A;  2LVP C;  1Q02 A;  2DZL A;  1VEK A;  3T6P A;  2JUJ A;  2DKL A;  4UN2 B;  3K9O A;  1AIP C;  2LVQ D;  2KNZ A;  1GO5 A;  1T43 A;  1UFZ A;  2DEN A;  1VG5 A;  1VEJ A;  1WIV A;  4HEO A;  2BWB A;  3GLI E;  2KHH A;  2DAG A;  2JZ0 A;  2HWJ A;  1OTR A;  2K0B X;  3LCU A;  2JY7 A;  4DBG B;  2OOA A;  4R71 A;  2OOB A;  2LBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...