3BBZA

Structure of the nucleocapsid-binding domain from the mumps virus phosphoprotein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
48
structure length
48
Chain Sequence
GQKVMITKMITDSVANPQMKQAFEQRLAKASTEDALNDIKRDIIRSAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the nucleocapsid-binding domain from the mumps virus polymerase; an example of protein folding induced by crystallization
pubmed doi rcsb
source organism Mumps virus
molecule tags Viral protein, replication
molecule keywords P protein
total genus 20
structure length 48
sequence length 48
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 3bbzA00
3LCVB 2K9DA 1ZMUA 1KYIA 1WJ7A 2MROB 1TR8A 2QHOB 2L2DA 1G3IA 1G4AE 1DO0A 5DFLA 2H5XA 2DI0A 3T6PA 1ZMWA 4G3OA 2B3TA 2JY5A 1ZMVA 2DAEA 2JZ1A 3B89A 2OOAA 4DBGB 1BVSA 1PGYA 2EKKA 2LVPC 2ZTDA 4HEOA 2JUJA 2LVAA 3FE3A 3FRHA 1VEKA 2LVQD 1HJPA 1OKSA 2HAKA 1VDLA 3BBZA 4F1IA 1JR3E 1HT2E 1VQ1A 1WGNA 2OOBA 2BWEA 2DAKA 3GLGE 1R4GA 2DKLA 3H4JA 2R0IA 2LVNC 2L4EA 2O25A 1E94E 1WGLA 2KHHA 2RRUA 1OQYA 1NV8A 1DV0A 2WZJA 1WR1B 3GLFE 1XXHE 1IM2A 1QZEA 2CP8A 1Q02A 2DAGA 2K0BX 3F92A 2QNJA 2ZTCA 1SG9A 4R71A 2JY8A 1T43A 2EJSA 1UFZA 1DO2A 1V92A 1VEJA 1F4IA 1G41A 3GLIE 3MMPA 1WIVA 1WHCA 1IFYA 2MGWA 3E46A 1NV9A 2EKFA 2JY6B 1EFUB 3K9OA 1HQYE 2MJ5B 1ZV1A 2HWJA 1HT1E 1IXSA 2JP7A 4WP2A 1GO5A 2MR9A 2QSFX 3K9PA 1VEGA 2DAIA 2JZ0A 2LVOC 2JNHA 2OO9A 2DZLA 1OAIA 4GEWA 2DAMA 3LCUA 1AIPC 1CUKA 3FRIA 2KNZA 2G3QA 2L4FA 3IECA 2BWBA 3GLHE 1C7YA 3E21A 4Q7JA 2DNAA 2LTUA 1XB2B 1T6OA 1Y8GA 3IHPA 4F2LA 1P3QQ 1VG5A 2CWBA 2JY7A 1OTRA 2LBCA 4UN2B 5JI2E 2KNAA 2DENA 2DHYA 1A5TA 2KNVA 1YLAA 1TTEA 1MN3A
chains in the Genus database with same CATH superfamily
3T1YM 2FFJA 4LF6M 2LHCA 3LMMA 2XF3A 3AOEA 3FTCA 4CIZA 1V34A 1SXJC 5FSWA 1L2CA 4JI4M 3KW6A 4I8OA 3GRYA 3K2LA 4G4QA 2A5YB 1HR0M 4LF4M 3U61A 3QYBA 4GITA 4OVZA 4AG5A 1DO0A 3U5ZA 1XXHB 1XXHA 5DFLA 4IJEA 4FWHA 4LRSA 8CATA 3SBJA 4IBKA 1OIZA 4DV2M 1GABA 4JXJA 5FLXS 2F5SA 2B3TA 4FVMA 2JY5A 5EP3A 2F5PA 4K0KM 1ZMVA 2DAEA 3B89A 4QHTA 3VK7A 3GLIA 2Z8YM 1V33A 2C96A 4FWDA 1TDHA 2EUCA 2J7OA 2R62A 4DR3M 4B7HA 4XGIA 1Z59A 2UUAM 2JUJA 2LVAA 3MK6A 3WHLA 5C1BA 1IXSB 3VKGA 1PJTA 3J7AS 3DA1A 2ZBKB 2HAKA 2R4EA 1GJSA 3W0FA 2V1CA 3M0EA 4GH9A 3SFZA 2CHVA 4OX9M 2E5LM 3AL0C 2L7IA 2YR0A 4EIWA 3AOEC 3I01M 2QQ8A 4AKIA 3HJQA 2XLJA 4BLCA 3DFZA 3L25A 2L4EA 3U6OA 2CHGA 1D0MA 1WXQA 3J81S 4LF9M 5BPVA 4LJ9A 3TWLA 3FYCA 4FCWA 4LJ6A 3GP1A 2YNMD 1WR1B 1IXRC 1IM2A 1QZEA 3L27A 4L4UA 1Q02A 3GPXA 2DAGA 5KQDA 4OVZB 1J7KA 2Z7JA 1SG9A 4WW0A 1LTMA 4AI6A 1EE8A 3W67A 1DGHB 1UM8A 3KDSE 1V92A 4IBCA 5EQTA 1QUSA 3LVWA 1JB0F 4DV3M 2QPAA 4AKGA 4HLQA 4JI0M 1PJQA 5BR8M 5IT9S 3JR5A 4DUZM 3E46A 3GPUA 4PDGA 3HU2A 2QBYB 4Z8XA 2JWSA 1HQYE 3I04M 2YQZA 2FS1A 3HX3A 1JR3A 1R2YA 2VF8A 3Q8GA 1IXSA 3L26A 1TGUA 4WP2A 1GO5A 4QNMA 1W5TA 1QDRA 3AJIB 4DV4M 2L6OA 1SXJE 2DAIA 3AFHA 4X62M 4S12A 1OAIA 2APLA 3ZH9B 2DAMA 1FNNA 2V6ZM 3IG5A 3KOYE 4L15A 4KODA 3M6AA 4QNRA 2L4FA 5ITXE 3GLFB 4PD2A 1K82A 3CGWA 3KOWE 2YFQA 2ERCA 1C7YA 4L78A 2CV0A 3KVWA 2K6BA 2LTUA 1SXJB 2KRKA 4DV6M 4JI7M 4F2LA 3FUUA 3L29A 3I4VA 1VDDA 1IXZA 2QBYA 3HU1A 1L8QA 1NJFA 2JXNA 4R7GA 3D8LA 2DZNB 2CRUA 3TWKA 2KZSA 4JI8M 1IBLM 4UN2B 2DWLA 2L09A 1SXJA 2KNAA 3ZC7B 3KP1E 2DHYA 3U61B 3HHXA 3JR4A 3U60B 2WSFF 3SMSA 3UGJA 1HNWM 4PDIA 4IBJA 4BB9A 1MX0A 4GRIA 3DOAA 1NHWC 2WSCF 1Z5CA 3C58A 3VDUA 3FUTA 2K9DA 1ZMUA 1KYIA 3I4YA 1K3XA 1L2BA 2F5QA 1N32M 5ITTA 2MROB 1L1ZA 1XNQM 3FTEA 1IN6A 2EO2A 4HL4A 3GQ3A 3MHVC 4NC6A 3V76A 1G59A 1ZQ9A 1G3IA 1G4AE 2G5GX 3A42A 1PJIA 4DR7M 3D8BA 1IN8A 1PJJA 3T6PA 1LV7A 2RGHA 1HNZM 1YSYA 2JZ1A 1N34M 5F3WA 3UJNA 2R4JA 1D0LA 4DBGB 1PGYA 3HHWA 2EKKA 3L2AA 1IN4A 4LJ5A 3FE3A 5GKNA 1X37A 1YUBA 2H1RA 2XSZD 5EXXA 4LZJA 5IZ7D 2LVQD 3A45A 1OKSA 2O5RA 5ITQA 1NY6A 3J27B 4GKKM 3BBZA 2R46A 3SAVA 1JR3E 2HL7A 1D2NA 2X8AA 4RF1A 2BWEA 3VKHA 2DAKA 2WSEF 4NOOB 2VF7A 2F5NA 1OIPA 1OFHA 1NO1A 1Z5BA 2DKLA 3SASA 3TL4X 3K8ZA 5EXSA 3U6MA 2C9OA 2LHGA 1IN7A 2LH0A 5ITXA 2VDBB 3K1JA 2L7HA 4OW0A 2J5YA 3A98B 1GLNA 2KHHA 1NVMA 2XSZA 1TF0B 3FUXA 3CF6E 1N36M 3OTOM 1XXHE 2CP8A 1J09A 2J7NA 4BBAA 4NSRA 5IWAM 1IBKM 2QNJA 3HZJA 4LFCM 2DWNA 1N78A 4MGIE 2O01F 3R8FA 3FTDA 4A3VB 4IJFA 2G8LA 1WIVA 5EXPA 3AKZA 3HU3A 4GC5A 4DV5M 2ZANA 4GC9A 1OJLA 2M5ZA 5DNYA 4LY6A 4KO8A 3VK8A 3KXEC 4REZA 2I7NA 1HT1E 4QHSA 4X65M 2QSFX 1QQWA 2FH0A 4KLNA 2CV1A 1VEGA 3LVVA 2OPFA 3SATA 4B3SM 2DZLA 4ZPXA 3AOGA 4YY3M 1L1TA 4XK8F 1KFVA 2XGNA 1AIPC 4G4RA 4KHPM 3I51A 2LNHC 5ITRA 2BWBA 4P17A 4M9ZA 2RGOA 4LCBA 4AG6A 5C18A 2VQFM 1QVRA 1R2ZA 2DNAA 2EA0A 3HJ8A 1IY1A 1T6OA 2D7GA 3FYDA 4ITQA 3GLHA 3W68A 1VG5A 2QENA 5L8RF 2CWBA 2JY7A 4LJ8A 2I7PA 1XC8A 1XHBA 1Z6TA 3ZCBB 2R6FA 4G4OA 1GKIA 4CGYB 1Q39A 1DGHA 2LBCA 1XMOM 3QAUA 2XZUA 3TQSA 3U6LA 1N77A 1GL7A 3GRVA 2Y21A 2UUCM 4LF7M 3GLGA 5LMUM 2N35A 4FWGA 3HY5A 4WURA 4DV0M 2Z4RA 4G4NA 1GVNA 2HHHM 5E6JA 3WHKA 4DR2M 2XEPA 3VLFB 1E32A 3T1HM 1WJ7A 3FUWA 1OFIA 4MGZE 4IBFA 4GHAA 3SYLA 3GRUA 3ZQJA 2Y20A 2FE8A 5KO3A 4JI6M 2D7EA 1HQCA 4GMQA 3M7GA 5EP2A 3U60A 3CF0A 4IBEA 4LGYA 3RE8A 4GKJM 4I4LA 4M0WA 1DGBA 1ZMWA 3HKPA 2FNAA 2QZ4A 4B3RM 5A2QS 1N33M 2M60A 4JI5M 2OOAA 3BXWA 5EJCA 3SYKA 4IBGA 4AZFA 1TDZA 2ZTDA 4LJ7A 2UU9M 2R44A 3FRHA 4FW9A 1VEKA 3LQRA 3KOXE 3LQQA 4IBDA 1HJPA 1MU5A 1ZAEA 2CE7A 1KSFX 3PVSA 1PJSA 3C9PA 2GNOA 4MB7A 4F1IA 3IG8A 1PM5A 1VQ1A 1WGNA 2CV2A 1GJTA 1GL6A 3T38A 2R18A 4PCZA 4LF8M 2X49A 1IBMM 4FD2A 4B7FA 2OQ4A 3H4JA 3KS8A 4IBIA 3VFDA 3J7BA 3U5ZB 2LVNC 4QOSA 2XFSA 2W82A 3PXGA 3GLHB 2O25A 4AKHA 3T15A 4DR1M 3A46A 2P5TA 2RRUA 2XFTA 1OQYA 4P16A 4LFAM 3EIEA 3Q8XA 3GLFE 3B7NA 2LXEA 4D80A 3TWMA 2Z4SA 2K0BX 4L16A 2HKJA 4RF0A 4MGYE 2ZTCA 4JI1M 4CHTB 4Y28F 4YHHM 1XWIA 4R71A 2VIIA 4DV7M 3B7ZA 2JY8A 4FCVA 1C1KA 2EJSA 4AW4A 2GQFA 3U6PA 1UFZA 4IBBA 1VEJA 4Z6YA 1I4WA 3LW5F 3FD9A 1QYRA 1TH3A 3SARA 4DV1M 3H4MA 3MMPA 3NBXX 3PNYA 1QAQA 1WHCA 1E9SA 1OAOC 3C3EA 4NL4H 2VQEM 2LWXA 1IFYA 3U6QA 3FKEA 1IN5A 2JY6B 3KS4A 4G6ZA 1EFUB 4M0DA 3TPZA 2MJ5B 4JV5M 2HWJA 3KFUG 2FOIC 3UMMA 2KZUA 3QYEA 2JP7A 1HNXM 4II7A 4B3MM 3J2PB 7CATA 3KSJA 2XH9A 2LVOC 2CFOA 3UK6A 2DZOB 1R5LA 4GEWA 3BOSA 1ORYB 1I94M 3E4RA 4LF5M 3KSXA 2KNZA 2G3QA 3GQ4A 2UXCM 3GPYA 3U6CA 3PFIA 3GLHE 5ITUA 4DUYM 1EIJA 2BJVA 4JI2M 4NXNM 4LRTA 1J5EM 1XB2B 4L6V6 1L2DA 5KPZA 2F4VM 2C98A 1P3QQ 2BJWA 3ILKA 3NBIA 3GLGB 1JR3D 3VDPA 2DWMA 2CUZA 2ZAMA 3J80S 3NWLA 1Z5AA 3B9PA 4FCTA 1T3TA 1PRBA 5JI2E 5DYIA 4LGMA 3PNVA 2Z3XA 1N75A 4X64M 5LMNM 2UXBM 3U6SA 2KNVA 1YLAA 1NY5A 4LJAA 5EP4A 4GHLA 1MN3A 5ITYA 2Y0QA 5IREB 4D81A 4JYAM 3GRRA 4L8RC 3LCVB 4RKUF 4MGKE 3DZDA 2KXEA 3L28A 2DXIA 3KP0E 4MGHA 1QZMA 3HWSA 3AV0A 4GIPA 5KPTA 5KQ8A 1TR8A 4KT0F 2QHOB 2L2DA 1IY2A 4XBOA 1QAMA 1R7RA 2D7HA 2XZFA 5E26A 1Q3CA 2BNKA 1XNRM 1S3SA 2CEAA 2H5XA 2DI0A 1YE9A 3SHFA 4G3OA 1H6UA 2QCUA 1NHGC 3QWLA 3SHGB 2DWZB 5KPRA 1BVSA 3HHZA 2LVPC 5EP1A 5EXTA 4HEOA 2UUBM 4M9SA 1TH2A 1R6BX 4LZZA 1K3WA 2F5OA 3HJSA 4JI3M 1NNJA 1TH4A 1VDLA 2C99A 1Q3BA 3MJ5A 3U6EA 1HT2E 4IIWA 2OOBA 4TUWA 3B7QA 4NXMM 3GLGE 2ZAOA 3FTFA 4RNAA 4I5SA 1R4GA 2HCBA 4JN6A 3SAUA 2R0IA 2CHQA 3B74A 3W0LB 3HGIA 1E94E 3RGPA 3TE6A 4LFBM 4LJ4A 1WGLA 2NQ8C 1E9RA 4AQYM 3U6DA 1NV8A 1D0KA 2KDLA 4CJ6A 2WZJA 1DV0A 4DR4M 4MH0E 2KW0A 3SC3A 3F92A 4B08A 1G8PA 1QANA 1T43A 2K47A 2Y0TA 5FTLA 4MM3B 1DO2A 3E9SA 5FTJA 5FTNA 3UZUA 3R9XB 1MJGM 1F4IA 1G41A 3GLIE 2KEBA 2RKOA 4NRWA 3EIHA 4W5WA 3SMPA 4PT5A 1NSFA 3RFWA 2QP9X 3FUVA 1FJGM 1DGFA 1DGGA 1JQJC 2MGWA 3GPPA 1NV9A 2EKFA 2JA2A 3K9OA 4I81A 5DYGA 4QOZC 1ZV1A 5FTKA 4DR6M 3KOZE 3RGSA 4ANRA 2MR9A 4R3DA 2AHMA 3HHYA 3JAMS 1NNUC 3K9PA 5H37D 1QUTA 2JZ0A 1QDTA 4B7GA 3THGA 2JNHA 1SXJD 2OO9A 4NSOB 4DR5M 4CISA 1IY0A 3LCUA 1QAOA 1G71A 1CUKA 3FRIA 3IECA 3SAWA 3GLFA 4B3TM 3K92A 3GLIB 3GO8A 5FTMA 3CF2A 5JI3E 3E21A 4Q7JA 4M9XA 1Y8GA 3CTWB 2C9CA 3IHPA 2V1UA 2Q2EB 1NJGA 1IQPA 2DVWB 4NRVA 2ZM6M 1RU3A 2KRUA 2MH8A 2R65A 2R45A 2X4AA 4LG2A 1OTRA 4OU7A 2UXDM 1AUAA 2KA6B 2DENA 4D82A 4X66M 2DHRA 2C5RA 1A5TA 3GQ5A 1TTEA 3C3DA 1W5SA 1XMQM
chains in the Genus database with same CATH topology
3LCVB 2K9DA 1ZMUA 1KYIA 1WJ7A 2MROB 1TR8A 2QHOB 2L2DA 1G3IA 1G4AE 1DO0A 5DFLA 2H5XA 2DI0A 3T6PA 1ZMWA 4G3OA 2B3TA 2JY5A 1ZMVA 2DAEA 2JZ1A 3B89A 2OOAA 4DBGB 1BVSA 1PGYA 2EKKA 2LVPC 2ZTDA 4HEOA 2JUJA 2LVAA 3FE3A 3FRHA 1VEKA 2LVQD 1HJPA 1OKSA 2HAKA 1VDLA 3BBZA 4F1IA 1JR3E 1HT2E 1VQ1A 1WGNA 2OOBA 2BWEA 2DAKA 3GLGE 1R4GA 2DKLA 3H4JA 2R0IA 2LVNC 2L4EA 2O25A 1E94E 1WGLA 2KHHA 2RRUA 1OQYA 1NV8A 1DV0A 2WZJA 1WR1B 3GLFE 1XXHE 1IM2A 1QZEA 2CP8A 1Q02A 2DAGA 2K0BX 3F92A 2QNJA 2ZTCA 1SG9A 4R71A 2JY8A 1T43A 2EJSA 1UFZA 1DO2A 1V92A 1VEJA 1F4IA 1G41A 3GLIE 3MMPA 1WIVA 1WHCA 1IFYA 2MGWA 3E46A 1NV9A 2EKFA 2JY6B 1EFUB 3K9OA 1HQYE 2MJ5B 1ZV1A 2HWJA 1HT1E 1IXSA 2JP7A 4WP2A 1GO5A 2MR9A 2QSFX 3K9PA 1VEGA 2DAIA 2JZ0A 2LVOC 2JNHA 2OO9A 2DZLA 1OAIA 4GEWA 2DAMA 3LCUA 1AIPC 1CUKA 3FRIA 2KNZA 2G3QA 2L4FA 3IECA 2BWBA 3GLHE 1C7YA 3E21A 4Q7JA 2DNAA 2LTUA 1XB2B 1T6OA 1Y8GA 3IHPA 4F2LA 1P3QQ 1VG5A 2CWBA 2JY7A 1OTRA 2LBCA 4UN2B 5JI2E 2KNAA 2DENA 2DHYA 1A5TA 2KNVA 1YLAA 1TTEA 1MN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LCV B;  2K9D A;  1ZMU A;  1KYI A;  1WJ7 A;  2MRO B;  1TR8 A;  2QHO B;  2L2D A;  1G3I A;  1G4A E;  1DO0 A;  5DFL A;  2H5X A;  2DI0 A;  3T6P A;  1ZMW A;  4G3O A;  2B3T A;  2JY5 A;  1ZMV A;  2DAE A;  2JZ1 A;  3B89 A;  2OOA A;  4DBG B;  1BVS A;  1PGY A;  2EKK A;  2LVP C;  2ZTD A;  4HEO A;  2JUJ A;  2LVA A;  3FE3 A;  3FRH A;  1VEK A;  2LVQ D;  1HJP A;  1OKS A;  2HAK A;  1VDL A;  3BBZ A;  4F1I A;  1JR3 E;  1HT2 E;  1VQ1 A;  1WGN A;  2OOB A;  2BWE A;  2DAK A;  3GLG E;  1R4G A;  2DKL A;  3H4J A;  2R0I A;  2LVN C;  2L4E A;  2O25 A;  1E94 E;  1WGL A;  2KHH A;  2RRU A;  1OQY A;  1NV8 A;  1DV0 A;  2WZJ A;  1WR1 B;  3GLF E;  1XXH E;  1IM2 A;  1QZE A;  2CP8 A;  1Q02 A;  2DAG A;  2K0B X;  3F92 A;  2QNJ A;  2ZTC A;  1SG9 A;  4R71 A;  2JY8 A;  1T43 A;  2EJS A;  1UFZ A;  1DO2 A;  1V92 A;  1VEJ A;  1F4I A;  1G41 A;  3GLI E;  3MMP A;  1WIV A;  1WHC A;  1IFY A;  2MGW A;  3E46 A;  1NV9 A;  2EKF A;  2JY6 B;  1EFU B;  3K9O A;  1HQY E;  2MJ5 B;  1ZV1 A;  2HWJ A;  1HT1 E;  1IXS A;  2JP7 A;  4WP2 A;  1GO5 A;  2MR9 A;  2QSF X;  3K9P A;  1VEG A;  2DAI A;  2JZ0 A;  2LVO C;  2JNH A;  2OO9 A;  2DZL A;  1OAI A;  4GEW A;  2DAM A;  3LCU A;  1AIP C;  1CUK A;  3FRI A;  2KNZ A;  2G3Q A;  2L4F A;  3IEC A;  2BWB A;  3GLH E;  1C7Y A;  3E21 A;  4Q7J A;  2DNA A;  2LTU A;  1XB2 B;  1T6O A;  1Y8G A;  3IHP A;  4F2L A;  1P3Q Q;  1VG5 A;  2CWB A;  2JY7 A;  1OTR A;  2LBC A;  4UN2 B;  5JI2 E;  2KNA A;  2DEN A;  2DHY A;  1A5T A;  2KNV A;  1YLA A;  1TTE A;  1MN3 A; 
#chains in the Genus database with same CATH topology
 3T1Y M;  2FFJ A;  4LF6 M;  2LHC A;  3LMM A;  2XF3 A;  3AOE A;  3FTC A;  4CIZ A;  1V34 A;  1SXJ C;  5FSW A;  1L2C A;  4JI4 M;  3KW6 A;  4I8O A;  3GRY A;  3K2L A;  4G4Q A;  2A5Y B;  1HR0 M;  4LF4 M;  3U61 A;  3QYB A;  4GIT A;  4OVZ A;  4AG5 A;  1DO0 A;  3U5Z A;  1XXH B;  1XXH A;  5DFL A;  4IJE A;  4FWH A;  4LRS A;  8CAT A;  3SBJ A;  4IBK A;  1OIZ A;  4DV2 M;  1GAB A;  4JXJ A;  5FLX S;  2F5S A;  2B3T A;  4FVM A;  2JY5 A;  5EP3 A;  2F5P A;  4K0K M;  1ZMV A;  2DAE A;  3B89 A;  4QHT A;  3VK7 A;  3GLI A;  2Z8Y M;  1V33 A;  2C96 A;  4FWD A;  1TDH A;  2EUC A;  2J7O A;  2R62 A;  4DR3 M;  4B7H A;  4XGI A;  1Z59 A;  2UUA M;  2JUJ A;  2LVA A;  3MK6 A;  3WHL A;  5C1B A;  1IXS B;  3VKG A;  1PJT A;  3J7A S;  3DA1 A;  2ZBK B;  2HAK A;  2R4E A;  1GJS A;  3W0F A;  2V1C A;  3M0E A;  4GH9 A;  3SFZ A;  2CHV A;  4OX9 M;  2E5L M;  3AL0 C;  2L7I A;  2YR0 A;  4EIW A;  3AOE C;  3I01 M;  2QQ8 A;  4AKI A;  3HJQ A;  2XLJ A;  4BLC A;  3DFZ A;  3L25 A;  2L4E A;  3U6O A;  2CHG A;  1D0M A;  1WXQ A;  3J81 S;  4LF9 M;  5BPV A;  4LJ9 A;  3TWL A;  3FYC A;  4FCW A;  4LJ6 A;  3GP1 A;  2YNM D;  1WR1 B;  1IXR C;  1IM2 A;  1QZE A;  3L27 A;  4L4U A;  1Q02 A;  3GPX A;  2DAG A;  5KQD A;  4OVZ B;  1J7K A;  2Z7J A;  1SG9 A;  4WW0 A;  1LTM A;  4AI6 A;  1EE8 A;  3W67 A;  1DGH B;  1UM8 A;  3KDS E;  1V92 A;  4IBC A;  5EQT A;  1QUS A;  3LVW A;  1JB0 F;  4DV3 M;  2QPA A;  4AKG A;  4HLQ A;  4JI0 M;  1PJQ A;  5BR8 M;  5IT9 S;  3JR5 A;  4DUZ M;  3E46 A;  3GPU A;  4PDG A;  3HU2 A;  2QBY B;  4Z8X A;  2JWS A;  1HQY E;  3I04 M;  2YQZ A;  2FS1 A;  3HX3 A;  1JR3 A;  1R2Y A;  2VF8 A;  3Q8G A;  1IXS A;  3L26 A;  1TGU A;  4WP2 A;  1GO5 A;  4QNM A;  1W5T A;  1QDR A;  3AJI B;  4DV4 M;  2L6O A;  1SXJ E;  2DAI A;  3AFH A;  4X62 M;  4S12 A;  1OAI A;  2APL A;  3ZH9 B;  2DAM A;  1FNN A;  2V6Z M;  3IG5 A;  3KOY E;  4L15 A;  4KOD A;  3M6A A;  4QNR A;  2L4F A;  5ITX E;  3GLF B;  4PD2 A;  1K82 A;  3CGW A;  3KOW E;  2YFQ A;  2ERC A;  1C7Y A;  4L78 A;  2CV0 A;  3KVW A;  2K6B A;  2LTU A;  1SXJ B;  2KRK A;  4DV6 M;  4JI7 M;  4F2L A;  3FUU A;  3L29 A;  3I4V A;  1VDD A;  1IXZ A;  2QBY A;  3HU1 A;  1L8Q A;  1NJF A;  2JXN A;  4R7G A;  3D8L A;  2DZN B;  2CRU A;  3TWK A;  2KZS A;  4JI8 M;  1IBL M;  4UN2 B;  2DWL A;  2L09 A;  1SXJ A;  2KNA A;  3ZC7 B;  3KP1 E;  2DHY A;  3U61 B;  3HHX A;  3JR4 A;  3U60 B;  2WSF F;  3SMS A;  3UGJ A;  1HNW M;  4PDI A;  4IBJ A;  4BB9 A;  1MX0 A;  4GRI A;  3DOA A;  1NHW C;  2WSC F;  1Z5C A;  3C58 A;  3VDU A;  3FUT A;  2K9D A;  1ZMU A;  1KYI A;  3I4Y A;  1K3X A;  1L2B A;  2F5Q A;  1N32 M;  5ITT A;  2MRO B;  1L1Z A;  1XNQ M;  3FTE A;  1IN6 A;  2EO2 A;  4HL4 A;  3GQ3 A;  3MHV C;  4NC6 A;  3V76 A;  1G59 A;  1ZQ9 A;  1G3I A;  1G4A E;  2G5G X;  3A42 A;  1PJI A;  4DR7 M;  3D8B A;  1IN8 A;  1PJJ A;  3T6P A;  1LV7 A;  2RGH A;  1HNZ M;  1YSY A;  2JZ1 A;  1N34 M;  5F3W A;  3UJN A;  2R4J A;  1D0L A;  4DBG B;  1PGY A;  3HHW A;  2EKK A;  3L2A A;  1IN4 A;  4LJ5 A;  3FE3 A;  5GKN A;  1X37 A;  1YUB A;  2H1R A;  2XSZ D;  5EXX A;  4LZJ A;  5IZ7 D;  2LVQ D;  3A45 A;  1OKS A;  2O5R A;  5ITQ A;  1NY6 A;  3J27 B;  4GKK M;  3BBZ A;  2R46 A;  3SAV A;  1JR3 E;  2HL7 A;  1D2N A;  2X8A A;  4RF1 A;  2BWE A;  3VKH A;  2DAK A;  2WSE F;  4NOO B;  2VF7 A;  2F5N A;  1OIP A;  1OFH A;  1NO1 A;  1Z5B A;  2DKL A;  3SAS A;  3TL4 X;  3K8Z A;  5EXS A;  3U6M A;  2C9O A;  2LHG A;  1IN7 A;  2LH0 A;  5ITX A;  2VDB B;  3K1J A;  2L7H A;  4OW0 A;  2J5Y A;  3A98 B;  1GLN A;  2KHH A;  1NVM A;  2XSZ A;  1TF0 B;  3FUX A;  3CF6 E;  1N36 M;  3OTO M;  1XXH E;  2CP8 A;  1J09 A;  2J7N A;  4BBA A;  4NSR A;  5IWA M;  1IBK M;  2QNJ A;  3HZJ A;  4LFC M;  2DWN A;  1N78 A;  4MGI E;  2O01 F;  3R8F A;  3FTD A;  4A3V B;  4IJF A;  2G8L A;  1WIV A;  5EXP A;  3AKZ A;  3HU3 A;  4GC5 A;  4DV5 M;  2ZAN A;  4GC9 A;  1OJL A;  2M5Z A;  5DNY A;  4LY6 A;  4KO8 A;  3VK8 A;  3KXE C;  4REZ A;  2I7N A;  1HT1 E;  4QHS A;  4X65 M;  2QSF X;  1QQW A;  2FH0 A;  4KLN A;  2CV1 A;  1VEG A;  3LVV A;  2OPF A;  3SAT A;  4B3S M;  2DZL A;  4ZPX A;  3AOG A;  4YY3 M;  1L1T A;  4XK8 F;  1KFV A;  2XGN A;  1AIP C;  4G4R A;  4KHP M;  3I51 A;  2LNH C;  5ITR A;  2BWB A;  4P17 A;  4M9Z A;  2RGO A;  4LCB A;  4AG6 A;  5C18 A;  2VQF M;  1QVR A;  1R2Z A;  2DNA A;  2EA0 A;  3HJ8 A;  1IY1 A;  1T6O A;  2D7G A;  3FYD A;  4ITQ A;  3GLH A;  3W68 A;  1VG5 A;  2QEN A;  5L8R F;  2CWB A;  2JY7 A;  4LJ8 A;  2I7P A;  1XC8 A;  1XHB A;  1Z6T A;  3ZCB B;  2R6F A;  4G4O A;  1GKI A;  4CGY B;  1Q39 A;  1DGH A;  2LBC A;  1XMO M;  3QAU A;  2XZU A;  3TQS A;  3U6L A;  1N77 A;  1GL7 A;  3GRV A;  2Y21 A;  2UUC M;  4LF7 M;  3GLG A;  5LMU M;  2N35 A;  4FWG A;  3HY5 A;  4WUR A;  4DV0 M;  2Z4R A;  4G4N A;  1GVN A;  2HHH M;  5E6J A;  3WHK A;  4DR2 M;  2XEP A;  3VLF B;  1E32 A;  3T1H M;  1WJ7 A;  3FUW A;  1OFI A;  4MGZ E;  4IBF A;  4GHA A;  3SYL A;  3GRU A;  3ZQJ A;  2Y20 A;  2FE8 A;  5KO3 A;  4JI6 M;  2D7E A;  1HQC A;  4GMQ A;  3M7G A;  5EP2 A;  3U60 A;  3CF0 A;  4IBE A;  4LGY A;  3RE8 A;  4GKJ M;  4I4L A;  4M0W A;  1DGB A;  1ZMW A;  3HKP A;  2FNA A;  2QZ4 A;  4B3R M;  5A2Q S;  1N33 M;  2M60 A;  4JI5 M;  2OOA A;  3BXW A;  5EJC A;  3SYK A;  4IBG A;  4AZF A;  1TDZ A;  2ZTD A;  4LJ7 A;  2UU9 M;  2R44 A;  3FRH A;  4FW9 A;  1VEK A;  3LQR A;  3KOX E;  3LQQ A;  4IBD A;  1HJP A;  1MU5 A;  1ZAE A;  2CE7 A;  1KSF X;  3PVS A;  1PJS A;  3C9P A;  2GNO A;  4MB7 A;  4F1I A;  3IG8 A;  1PM5 A;  1VQ1 A;  1WGN A;  2CV2 A;  1GJT A;  1GL6 A;  3T38 A;  2R18 A;  4PCZ A;  4LF8 M;  2X49 A;  1IBM M;  4FD2 A;  4B7F A;  2OQ4 A;  3H4J A;  3KS8 A;  4IBI A;  3VFD A;  3J7B A;  3U5Z B;  2LVN C;  4QOS A;  2XFS A;  2W82 A;  3PXG A;  3GLH B;  2O25 A;  4AKH A;  3T15 A;  4DR1 M;  3A46 A;  2P5T A;  2RRU A;  2XFT A;  1OQY A;  4P16 A;  4LFA M;  3EIE A;  3Q8X A;  3GLF E;  3B7N A;  2LXE A;  4D80 A;  3TWM A;  2Z4S A;  2K0B X;  4L16 A;  2HKJ A;  4RF0 A;  4MGY E;  2ZTC A;  4JI1 M;  4CHT B;  4Y28 F;  4YHH M;  1XWI A;  4R71 A;  2VII A;  4DV7 M;  3B7Z A;  2JY8 A;  4FCV A;  1C1K A;  2EJS A;  4AW4 A;  2GQF A;  3U6P A;  1UFZ A;  4IBB A;  1VEJ A;  4Z6Y A;  1I4W A;  3LW5 F;  3FD9 A;  1QYR A;  1TH3 A;  3SAR A;  4DV1 M;  3H4M A;  3MMP A;  3NBX X;  3PNY A;  1QAQ A;  1WHC A;  1E9S A;  1OAO C;  3C3E A;  4NL4 H;  2VQE M;  2LWX A;  1IFY A;  3U6Q A;  3FKE A;  1IN5 A;  2JY6 B;  3KS4 A;  4G6Z A;  1EFU B;  4M0D A;  3TPZ A;  2MJ5 B;  4JV5 M;  2HWJ A;  3KFU G;  2FOI C;  3UMM A;  2KZU A;  3QYE A;  2JP7 A;  1HNX M;  4II7 A;  4B3M M;  3J2P B;  7CAT A;  3KSJ A;  2XH9 A;  2LVO C;  2CFO A;  3UK6 A;  2DZO B;  1R5L A;  4GEW A;  3BOS A;  1ORY B;  1I94 M;  3E4R A;  4LF5 M;  3KSX A;  2KNZ A;  2G3Q A;  3GQ4 A;  2UXC M;  3GPY A;  3U6C A;  3PFI A;  3GLH E;  5ITU A;  4DUY M;  1EIJ A;  2BJV A;  4JI2 M;  4NXN M;  4LRT A;  1J5E M;  1XB2 B;  4L6V 6;  1L2D A;  5KPZ A;  2F4V M;  2C98 A;  1P3Q Q;  2BJW A;  3ILK A;  3NBI A;  3GLG B;  1JR3 D;  3VDP A;  2DWM A;  2CUZ A;  2ZAM A;  3J80 S;  3NWL A;  1Z5A A;  3B9P A;  4FCT A;  1T3T A;  1PRB A;  5JI2 E;  5DYI A;  4LGM A;  3PNV A;  2Z3X A;  1N75 A;  4X64 M;  5LMN M;  2UXB M;  3U6S A;  2KNV A;  1YLA A;  1NY5 A;  4LJA A;  5EP4 A;  4GHL A;  1MN3 A;  5ITY A;  2Y0Q A;  5IRE B;  4D81 A;  4JYA M;  3GRR A;  4L8R C;  3LCV B;  4RKU F;  4MGK E;  3DZD A;  2KXE A;  3L28 A;  2DXI A;  3KP0 E;  4MGH A;  1QZM A;  3HWS A;  3AV0 A;  4GIP A;  5KPT A;  5KQ8 A;  1TR8 A;  4KT0 F;  2QHO B;  2L2D A;  1IY2 A;  4XBO A;  1QAM A;  1R7R A;  2D7H A;  2XZF A;  5E26 A;  1Q3C A;  2BNK A;  1XNR M;  1S3S A;  2CEA A;  2H5X A;  2DI0 A;  1YE9 A;  3SHF A;  4G3O A;  1H6U A;  2QCU A;  1NHG C;  3QWL A;  3SHG B;  2DWZ B;  5KPR A;  1BVS A;  3HHZ A;  2LVP C;  5EP1 A;  5EXT A;  4HEO A;  2UUB M;  4M9S A;  1TH2 A;  1R6B X;  4LZZ A;  1K3W A;  2F5O A;  3HJS A;  4JI3 M;  1NNJ A;  1TH4 A;  1VDL A;  2C99 A;  1Q3B A;  3MJ5 A;  3U6E A;  1HT2 E;  4IIW A;  2OOB A;  4TUW A;  3B7Q A;  4NXM M;  3GLG E;  2ZAO A;  3FTF A;  4RNA A;  4I5S A;  1R4G A;  2HCB A;  4JN6 A;  3SAU A;  2R0I A;  2CHQ A;  3B74 A;  3W0L B;  3HGI A;  1E94 E;  3RGP A;  3TE6 A;  4LFB M;  4LJ4 A;  1WGL A;  2NQ8 C;  1E9R A;  4AQY M;  3U6D A;  1NV8 A;  1D0K A;  2KDL A;  4CJ6 A;  2WZJ A;  1DV0 A;  4DR4 M;  4MH0 E;  2KW0 A;  3SC3 A;  3F92 A;  4B08 A;  1G8P A;  1QAN A;  1T43 A;  2K47 A;  2Y0T A;  5FTL A;  4MM3 B;  1DO2 A;  3E9S A;  5FTJ A;  5FTN A;  3UZU A;  3R9X B;  1MJG M;  1F4I A;  1G41 A;  3GLI E;  2KEB A;  2RKO A;  4NRW A;  3EIH A;  4W5W A;  3SMP A;  4PT5 A;  1NSF A;  3RFW A;  2QP9 X;  3FUV A;  1FJG M;  1DGF A;  1DGG A;  1JQJ C;  2MGW A;  3GPP A;  1NV9 A;  2EKF A;  2JA2 A;  3K9O A;  4I81 A;  5DYG A;  4QOZ C;  1ZV1 A;  5FTK A;  4DR6 M;  3KOZ E;  3RGS A;  4ANR A;  2MR9 A;  4R3D A;  2AHM A;  3HHY A;  3JAM S;  1NNU C;  3K9P A;  5H37 D;  1QUT A;  2JZ0 A;  1QDT A;  4B7G A;  3THG A;  2JNH A;  1SXJ D;  2OO9 A;  4NSO B;  4DR5 M;  4CIS A;  1IY0 A;  3LCU A;  1QAO A;  1G71 A;  1CUK A;  3FRI A;  3IEC A;  3SAW A;  3GLF A;  4B3T M;  3K92 A;  3GLI B;  3GO8 A;  5FTM A;  3CF2 A;  5JI3 E;  3E21 A;  4Q7J A;  4M9X A;  1Y8G A;  3CTW B;  2C9C A;  3IHP A;  2V1U A;  2Q2E B;  1NJG A;  1IQP A;  2DVW B;  4NRV A;  2ZM6 M;  1RU3 A;  2KRU A;  2MH8 A;  2R65 A;  2R45 A;  2X4A A;  4LG2 A;  1OTR A;  4OU7 A;  2UXD M;  1AUA A;  2KA6 B;  2DEN A;  4D82 A;  4X66 M;  2DHR A;  2C5R A;  1A5T A;  3GQ5 A;  1TTE A;  3C3D A;  1W5S A;  1XMQ M; 
#chains in the Genus database with same CATH homology
 3LCV B;  2K9D A;  1ZMU A;  1KYI A;  1WJ7 A;  2MRO B;  1TR8 A;  2QHO B;  2L2D A;  1G3I A;  1G4A E;  1DO0 A;  5DFL A;  2H5X A;  2DI0 A;  3T6P A;  1ZMW A;  4G3O A;  2B3T A;  2JY5 A;  1ZMV A;  2DAE A;  2JZ1 A;  3B89 A;  2OOA A;  4DBG B;  1BVS A;  1PGY A;  2EKK A;  2LVP C;  2ZTD A;  4HEO A;  2JUJ A;  2LVA A;  3FE3 A;  3FRH A;  1VEK A;  2LVQ D;  1HJP A;  1OKS A;  2HAK A;  1VDL A;  3BBZ A;  4F1I A;  1JR3 E;  1HT2 E;  1VQ1 A;  1WGN A;  2OOB A;  2BWE A;  2DAK A;  3GLG E;  1R4G A;  2DKL A;  3H4J A;  2R0I A;  2LVN C;  2L4E A;  2O25 A;  1E94 E;  1WGL A;  2KHH A;  2RRU A;  1OQY A;  1NV8 A;  1DV0 A;  2WZJ A;  1WR1 B;  3GLF E;  1XXH E;  1IM2 A;  1QZE A;  2CP8 A;  1Q02 A;  2DAG A;  2K0B X;  3F92 A;  2QNJ A;  2ZTC A;  1SG9 A;  4R71 A;  2JY8 A;  1T43 A;  2EJS A;  1UFZ A;  1DO2 A;  1V92 A;  1VEJ A;  1F4I A;  1G41 A;  3GLI E;  3MMP A;  1WIV A;  1WHC A;  1IFY A;  2MGW A;  3E46 A;  1NV9 A;  2EKF A;  2JY6 B;  1EFU B;  3K9O A;  1HQY E;  2MJ5 B;  1ZV1 A;  2HWJ A;  1HT1 E;  1IXS A;  2JP7 A;  4WP2 A;  1GO5 A;  2MR9 A;  2QSF X;  3K9P A;  1VEG A;  2DAI A;  2JZ0 A;  2LVO C;  2JNH A;  2OO9 A;  2DZL A;  1OAI A;  4GEW A;  2DAM A;  3LCU A;  1AIP C;  1CUK A;  3FRI A;  2KNZ A;  2G3Q A;  2L4F A;  3IEC A;  2BWB A;  3GLH E;  1C7Y A;  3E21 A;  4Q7J A;  2DNA A;  2LTU A;  1XB2 B;  1T6O A;  1Y8G A;  3IHP A;  4F2L A;  1P3Q Q;  1VG5 A;  2CWB A;  2JY7 A;  1OTR A;  2LBC A;  4UN2 B;  5JI2 E;  2KNA A;  2DEN A;  2DHY A;  1A5T A;  2KNV A;  1YLA A;  1TTE A;  1MN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...