3J27B

Cryoem structure of dengue virus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
SVALVPHVGMGLETATETWMSSEGAWKHAQRIETWILRHPGFTIMAAILAYTIGTTHFQRALIFILLTAVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the mature dengue virus at 3.5-A resolution.
pubmed doi rcsb
molecule keywords Envelope protein E
molecule tags Virus
total genus 19
structure length 72
sequence length 72
chains with identical sequence D, F
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01004 Flavi_M Flavivirus envelope glycoprotein M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.970 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j27B00
5IREB 5H37D 5IZ7D 3J2PB 3J27B
chains in the Genus database with same CATH superfamily
4DR1M 5KPRA 3VFDA 2CHQA 2KZSA 4HEOA 4FCVA 2HKJA 1CUKA 1H6UA 3GLHB 3I01M 4I81A 3GLIE 3FYCA 4IJFA 2OO9A 1IN7A 3E4RA 2O25A 2K0BX 2CE7A 4XBOA 3K92A 2UUCM 4LRSA 8CATA 4DV2M 2F5SA 5EQTA 1J5EM 3VKGA 2JP7A 3U6MA 2QQ8A 3K9OA 3GPUA 2A5YB 1XC8A 3NBIA 3AJIB 2X4AA 4R7GA 2JZ0A 1WGNA 3RE8A 1K3WA 4PD2A 3SARA 3TPZA 3W68A 3SFZA 1OKSA 3F92A 1IXSB 2GQFA 1MN3A 4WURA 5EJCA 3JR4A 3HHWA 4LG2A 4GKKM 1NY5A 1WIVA 4NXMM 1MU5A 2JUJA 4FW9A 4LF5M 2HCBA 2K9DA 4Q7JA 1Q39A 2M60A 1VEJA 3BBZA 3FUUA 3FUVA 1TR8A 2YR0A 4LFBM 2WZJA 1WR1B 1A5TA 4OVZB 2N35A 1TH2A 3MMPA 3C58A 2FH0A 1PGYA 2DKLA 1L1ZA 2Z4SA 2QP9X 1IN6A 5EP3A 1FNNA 2HL7A 4I8OA 3U6CA 4B7HA 2I7NA 1DGHB 4B7GA 4FD2A 3MHVC 4NXNM 2LHCA 2JY8A 4G4RA 2L2DA 4P16A 2ZAOA 3I4VA 2D7HA 1GL6A 2L4FA 5DFLA 2DZLA 4W5WA 1TGUA 4MGIE 2LVNC 3GLFB 2CUZA 2KHHA 2R4EA 3KOWE 2R62A 2MJ5B 1PJSA 3GLHE 4R3DA 4MM3B 1HNWM 2YNMD 2MH8A 3GPPA 2CHVA 1QUTA 2DZOB 4IBGA 3GLIA 1IN5A 4QHSA 2X8AA 3VK8A 4IBKA 1GLNA 5FLXS 3PFIA 2KA6B 3TE6A 2RKOA 4LF9M 4G3OA 3KDSE 4FWGA 5ITUA 3RFWA 3B7ZA 3GPXA 3FTCA 4D80A 3I4YA 4X66M 3U6EA 2F5OA 4B3RM 5DYIA 3H4JA 2Y20A 4G4QA 3U6OA 1KSFX 1QAOA 1LTMA 2D7EA 3T1HM 1VDLA 4LJ8A 4M9SA 1L2CA 1NV8A 3GO8A 3I04M 2OQ4A 2UXBM 4XK8F 1NNUC 1G59A 2P5TA 2DNAA 2KNZA 1TH3A 1Z5AA 3LW5F 3LVWA 4CIZA 3OTOM 1PM5A 2QBYA 4NRWA 3U5ZA 1NY6A 3FUWA 2I7PA 2E5LM 1QAQA 2ZM6M 1QAMA 2VIIA 4OX9M 2JA2A 5IWAM 2WSEF 3K2LA 2O5RA 3WHKA 1TF0B 3SATA 2DAKA 4FCWA 4B08A 4G4OA 1L1TA 1OAOC 2JWSA 1RU3A 2CV0A 3KOXE 1AUAA 3U6LA 4DR6M 5EXTA 1S3SA 5GKNA 2UUBM 2OOAA 3KP0E 4GKJM 2XH9A 1XNRM 3D8BA 4JI1M 3GLFE 5LMUM 4X62M 4PDIA 5JI3E 4QOSA 1YE9A 4DR5M 4PT5A 1EE8A 4LJAA 1OIPA 4B3TM 2L09A 1KYIA 3RGSA 2RGOA 5FTJA 1SXJB 2QCUA 5C18A 3GLHA 3J2PB 4LGYA 5BR8M 3U6QA 1PJTA 4JI2M 2LVOC 1NHGC 3HJQA 1ZAEA 2DWNA 1OFIA 2FFJA 2V1CA 2XLJA 3KVWA 4IBIA 1T6OA 1QZEA 4MGHA 3TWKA 4LF7M 4QHTA 4NSOB 3J81S 1SXJC 1WHCA 4OU7A 2CV1A 4NOOB 3TWLA 2EUCA 3HU1A 1G3IA 2DAEA 1IXSA 3GQ3A 1SXJD 4UN2B 3KXEC 3J7AS 4Z8XA 1IQPA 2KXEA 2F4VM 2Z4RA 1IM2A 2R0IA 3J7BA 2UXCM 3U6SA 2QHOB 3AFHA 2C98A 3DZDA 4QNMA 2CHGA 2QZ4A 1EFUB 1OFHA 3W67A 4LCBA 3CTWB 3HX3A 4OVZA 3TQSA 1OJLA 2R6FA 3UK6A 3GRVA 3UJNA 3LCUA 4MGKE 4S12A 4MH0E 1ZMWA 2KRKA 1IBLM 1OTRA 4R71A 4JI3M 2VQEM 1VQ1A 4FWDA 4TUWA 3AKZA 4G6ZA 1DGHA 4I4LA 1R2ZA 1JQJC 1IY1A 1DGGA 1QZMA 2D7GA 3HZJA 3HY5A 5EXXA 4JI8M 2B3TA 1IFYA 1N34M 2FE8A 2L7HA 4IBBA 3V76A 2OPFA 1Q02A 4GHLA 1R7RA 2LNHC 1GO5A 1NJGA 4LF6M 2R18A 2JY7A 4AZFA 2LHGA 3GLGB 1GKIA 2DENA 2R4JA 3GLFA 4AQYM 2Z8YM 1VG5A 2HWJA 1SXJE 2XSZA 4Z6YA 3KSXA 2UXDM 1XHBA 2VQFM 1TTEA 4L8RC 4M9XA 3T1YM 1UM8A 1IY2A 2V1UA 2DHYA 3PNYA 1G71A 4M0DA 1E32A 1QVRA 3LCVB 3SAUA 4KHPM 1NO1A 3LMMA 4LY6A 2Z3XA 1OAIA 3ZQJA 4BBAA 3KW6A 2CEAA 5FSWA 3Q8XA 3U61B 4REZA 1QDRA 2KW0A 4DR3M 1N36M 1HJPA 1D0LA 1E94E 1PJQA 4LJ7A 3PNVA 1V33A 1TH4A 3SHFA 3HHZA 3SHGB 1QDTA 3B74A 3KSJA 1XB2B 4GEWA 3LQRA 3Q8GA 4IBCA 2BWEA 4IJEA 4EIWA 3A42A 4L16A 4CHTB 4X64M 4PDGA 1ZV1A 3PXGA 3EIEA 3VK7A 3FRIA 3GRUA 2AHMA 3C9PA 3KS4A 4GH9A 4GITA 5FTKA 2H1RA 3SBJA 1XXHB 3CGWA 2JXNA 3B89A 2VDBB 4OW0A 4GRIA 2BNKA 2XGNA 1L2BA 4ITQA 2DAIA 3QAUA 4LRTA 4L78A 1JR3E 2XSZD 4RF1A 3NWLA 2DZNB 1K3XA 3AV0A 4DV1M 3L2AA 3GRYA 4QOZC 2ZTDA 4K0KM 4FWHA 4L6V6 3MJ5A 1G41A 4FCTA 3GLGE 4X65M 1I94M 2R44A 1MJGM 3U60A 3U6PA 2C9CA 2ZANA 5FTLA 1Z6TA 4IBFA 3KOYE 3QYBA 1IXZA 4LJ6A 4AG5A 5IT9S 3SASA 3T38A 1SXJA 3AOEC 4JXJA 1D0MA 1NSFA 3R8FA 2FS1A 4QNRA 3A46A 1IN8A 2LTUA 2ERCA 3IHPA 2DWLA 1YUBA 2JY6B 3GRRA 3SC3A 3KFUG 1HQCA 1PJIA 1TDZA 1Z5BA 4KO8A 4NSRA 1NNJA 1V34A 2J7OA 3U60B 2GNOA 1GJSA 3QYEA 2JNHA 4DV6M 4DV5M 4ANRA 1DGBA 2F5QA 1SG9A 1TDHA 3MK6A 5KQ8A 4LFCM 4RNAA 2L7IA 2V6ZM 2CV2A 5KPTA 2R45A 2R65A 2CP8A 7CATA 3KOZE 3UMMA 3HJ8A 3SAVA 2MR9A 4NC6A 1BVSA 4WW0A 5LMNM 1XXHE 3UZUA 3C3DA 3TL4X 1WXQA 2XF3A 3CF2A 3J27B 2WSFF 3WHLA 4WP2A 3VDPA 2W82A 1R6BX 2Y0TA 4AKGA 3HU2A 2C99A 4LJ9A 1EIJA 4JN6A 3DOAA 1HQYE 1JR3A 2VF7A 3W0FA 2H5XA 4KLNA 1QANA 1HT2E 3IG5A 1R2YA 4LJ5A 2ZAMA 4JI7M 1GVNA 1ZQ9A 1E9RA 1UFZA 2EKKA 3KP1E 1PJJA 5KO3A 1IN4A 3AL0C 3GLGA 2LVAA 1YSYA 3GQ5A 2EO2A 1PRBA 2BJVA 3GPYA 5H37D 2CRUA 2J7NA 1R4GA 4RKUF 4DUYM 5A2QS 1NJFA 1XMOM 1VEKA 4MGYE 4LZJA 4AKHA 4AKIA 2EJSA 1X37A 2C96A 3K8ZA 2LVPC 3L28A 2L4EA 1N75A 3HHXA 1R5LA 4KT0F 3SYKA 3E21A 1FJGM 2O01F 3E9SA 1MX0A 1Z5CA 1W5SA 2DWMA 2DWZB 2WSCF 3JAMS 1J09A 5EP4A 2X49A 3H4MA 4DR4M 2XFSA 4IBJA 3U61A 1IBMM 3E46A 2K6BA 3ZC7B 2RGHA 2DHRA 3LQQA 5FTNA 2LVQD 3HU3A 4GHAA 1DGFA 1W5TA 4DV4M 4L15A 2KDLA 2XZUA 1JR3D 3PVSA 3ZCBB 4AW4A 1DO2A 2HAKA 1K82A 4AI6A 2G3QA 4GMQA 1XXHA 2K47A 5ITTA 2G8LA 4XGIA 4BB9A 4II7A 2LBCA 1GL7A 4CJ6A 5F3WA 1GABA 4JI5M 2ZTCA 3FTEA 1OQYA 2YFQA 3EIHA 5JI2E 1Z59A 3HKPA 3K9PA 1T43A 1V92A 3B7QA 4F1IA 5ITXE 3A45A 4A3VB 3KS8A 4NRVA 1NV9A 2CFOA 4JI6M 1AIPC 3AOEA 3I51A 5KPZA 4B3MM 4G4NA 3T15A 2EA0A 2MROB 2CWBA 3BOSA 3UGJA 3M6AA 4BLCA 3L27A 3IECA 4LFAM 1HNZM 2KNVA 3L25A 1T3TA 4JV5M 4MGZE 2F5NA 4GC9A 3HGIA 1N78A 2JY5A 2QENA 4B7FA 1XWIA 3TWMA 5C1BA 1G4AE 3CF0A 2KNAA 3SMPA 4M9ZA 2QSFX 4DBGB 2M5ZA 3L29A 4FVMA 3C3EA 2UU9M 1I4WA 4NL4H 4LF8M 1OIZA 2KEBA 4L4UA 4D81A 4IBEA 4YY3M 1XMQM 1LV7A 4JYAM 3D8LA 1QUSA 4Y28F 3B7NA 5E6JA 5EP2A 2Q2EB 1VDDA 2UUAM 2QPAA 3SYLA 1DO0A 2L6OA 5ITYA 3NBXX 1ORYB 2DAGA 2XEPA 3M7GA 4PCZA 2DI0A 1Q3CA 4LJ4A 5FTMA 2Y21A 3K1JA 3BXWA 3GP1A 1C7YA 2DAMA 3ILKA 2BWBA 2JZ1A 3LVVA 4HLQA 1VEGA 2QNJA 3FTFA 1G8PA 5DNYA 2XZFA 4I5SA 2LXEA 4CISA 4LF4M 4IBDA 4DV0M 4D82A 4DV3M 4DR2M 4IIWA 3GLIB 3VKHA 3CF6E 3GQ4A 4MB7A 4RF0A 4DV7M 1L2DA 1IY0A 4YHHM 2RRUA 2BJWA 1ZMVA 2LWXA 1HR0M 4LGMA 5EXPA 3HJSA 5IZ7D 1ZMUA 3R9XB 3J80S 3W0LB 5ITXA 1N33M 1C1KA 1F4IA 5EXSA 1IXRC 3DA1A 2KZUA 3FKEA 1NHWC 3A98B 3AOGA 3M0EA 2HHHM 1D2NA 2APLA 4HL4A 1NVMA 4JI4M 2FOIC 3ZH9B 1QQWA 1IBKM 2R46A 3VDUA 1WJ7A 4GIPA 1WGLA 2KRUA 2DVWB 5E26A 2VF8A 5EP1A 2QBYB 1Y8GA 2XFTA 3FYDA 3RGPA 3U6DA 4LZZA 2MGWA 3FE3A 1P3QQ 4KODA 5IREB 3T6PA 4F2LA 3U5ZB 2F5PA 2Z7JA 1J7KA 1HT1E 1XNQM 1Q3BA 4B3SM 3FTDA 1JB0F 1L8QA 3DFZA 2ZBKB 2NQ8C 3THGA 5L8RF 2LH0A 1QYRA 1E9SA 3L26A 3IG8A 3FUTA 1HNXM 2J5YA 2Y0QA 4DUZM 4ZPXA 3VLFB 3B9PA 3FD9A 5ITQA 2OOBA 1D0KA 3HWSA 3HHYA 5BPVA 4GC5A 1N32M 1YLAA 3SMSA 2DXIA 5DYGA 1N77A 3FUXA 2C9OA 4M0WA 2YQZA 4P17A 4CGYB 5KQDA 4AG6A 3JR5A 2EKFA 1KFVA 4DR7M 2C5RA 3QWLA 2G5GX 3SAWA 5ITRA 4JI0M 1DV0A 2FNAA 1GJTA 3FRHA
chains in the Genus database with same CATH topology
4DR1M 5KPRA 3VFDA 2CHQA 2KZSA 4FCVA 2HKJA 1H6UA 3GLHB 4I81A 3FYCA 4IJFA 1IN7A 3E4RA 2CE7A 4XBOA 3K92A 2UUCM 4LRSA 8CATA 4DV2M 2F5SA 5EQTA 1J5EM 3VKGA 3U6MA 3GPUA 2A5YB 1XC8A 3NBIA 3AJIB 2X4AA 4R7GA 3RE8A 1K3WA 4PD2A 3SARA 3TPZA 3SFZA 1IXSB 4WURA 5EJCA 3JR4A 3HHWA 4LG2A 4GKKM 1NY5A 4NXMM 1MU5A 4FW9A 4LF5M 2HCBA 1Q39A 2M60A 3FUUA 3FUVA 2YR0A 4LFBM 4OVZB 3C58A 1TH2A 1L1ZA 2Z4SA 2QP9X 1IN6A 5EP3A 1FNNA 2HL7A 4I8OA 3U6CA 4B7HA 2I7NA 1DGHB 4B7GA 4FD2A 3MHVC 4NXNM 4G4RA 4P16A 2ZAOA 3I4VA 2D7HA 1GL6A 4W5WA 1TGUA 4MGIE 3GLFB 2CUZA 2R4EA 3KOWE 2R62A 4R3DA 4MM3B 1HNWM 2YNMD 3GPPA 2CHVA 2DZOB 4IBGA 3GLIA 1IN5A 4QHSA 2X8AA 3VK8A 4IBKA 1GLNA 5FLXS 3PFIA 2KA6B 3TE6A 2RKOA 4LF9M 3KDSE 4FWGA 5ITUA 3RFWA 3GPXA 3FTCA 4D80A 3I4YA 4X66M 3U6EA 2F5OA 4B3RM 5DYIA 4G4QA 2Y20A 3U6OA 1KSFX 1QAOA 2D7EA 3T1HM 4M9SA 1L2CA 3GO8A 2OQ4A 2UXBM 1NNUC 1G59A 2P5TA 1TH3A 1Z5AA 3LVWA 1PM5A 2QBYA 3OTOM 4NRWA 3U5ZA 1NY6A 3FUWA 2I7PA 2E5LM 1QAQA 2ZM6M 1QAMA 2VIIA 4OX9M 2JA2A 5IWAM 3K2LA 2O5RA 3WHKA 3SATA 4B08A 4FCWA 4G4OA 1L1TA 2CV0A 3KOXE 3U6LA 4DR6M 5EXTA 1S3SA 5GKNA 2UUBM 3KP0E 4GKJM 2XH9A 1XNRM 3D8BA 4JI1M 5LMUM 4X62M 4PDIA 5JI3E 4QOSA 1YE9A 4DR5M 4PT5A 1EE8A 4LJAA 4B3TM 2L09A 1KYIA 3RGSA 2RGOA 5FTJA 1SXJB 2QCUA 5C18A 3GLHA 3J2PB 4LGYA 5BR8M 3U6QA 4JI2M 3HJQA 1NHGC 1ZAEA 2DWNA 1OFIA 2FFJA 2V1CA 2XLJA 3KVWA 4IBIA 4MGHA 3TWKA 4LF7M 4QHTA 4NSOB 3J81S 1SXJC 4OU7A 2CV1A 4NOOB 3TWLA 2EUCA 3HU1A 1G3IA 3GQ3A 1SXJD 3KXEC 3J7AS 4Z8XA 1IQPA 2KXEA 2F4VM 2Z4RA 1IM2A 3J7BA 2UXCM 3U6SA 3AFHA 2C98A 3DZDA 4QNMA 2CHGA 2QZ4A 1OFHA 4LCBA 3CTWB 4OVZA 3TQSA 3UK6A 1OJLA 3GRVA 3UJNA 4MGKE 4S12A 4MH0E 2KRKA 1IBLM 4JI3M 2VQEM 4FWDA 4TUWA 3AKZA 4G6ZA 1DGHA 4I4LA 1R2ZA 1JQJC 1IY1A 1DGGA 1QZMA 2D7GA 5EXXA 1K3XA 4JI8M 1N34M 2FE8A 2L7HA 4IBBA 2OPFA 4GHLA 1R7RA 2LNHC 1NJGA 4LF6M 2R18A 4AZFA 3GLGB 1GKIA 2R4JA 3GLFA 4AQYM 4Z6YA 2XSZA 1SXJE 2UXDM 3KSXA 1XHBA 2VQFM 4L8RC 4M9XA 3T1YM 1UM8A 1IY2A 2V1UA 3PNYA 4M0DA 1E32A 1QVRA 3SAUA 4KHPM 3LMMA 4LY6A 2Z3XA 4BBAA 3KW6A 2CEAA 5FSWA 3Q8XA 3U61B 4REZA 2KW0A 4DR3M 1N36M 4LJ7A 1E94E 3SHFA 3PNVA 1TH4A 3HHZA 3SHGB 3KSJA 4IBCA 4EIWA 3LQRA 4IJEA 3A42A 4L16A 4CHTB 4X64M 4PDGA 3PXGA 3EIEA 3VK7A 3GRUA 2AHMA 3KS4A 4GH9A 4GITA 5FTKA 2H1RA 3SBJA 1XXHB 4OW0A 4GRIA 2BNKA 2XGNA 1L2BA 4ITQA 4L78A 3QAUA 4LRTA 3R9XB 2XSZD 4RF1A 3NWLA 2DZNB 3AV0A 4DV1M 3L2AA 3GRYA 4QOZC 4K0KM 4FWHA 3MJ5A 1G41A 4FCTA 4X65M 1I94M 3U60A 3U6PA 2C9CA 2ZANA 5FTLA 1Z6TA 4IBFA 3KOYE 4AG5A 1IXZA 4LJ6A 5IT9S 3SASA 3T38A 1SXJA 3AOEC 4JXJA 1NSFA 3R8FA 4QNRA 3A46A 1IN8A 2ERCA 2DWLA 1YUBA 3GRRA 3SC3A 3KFUG 1HQCA 1PJIA 1TDZA 1Z5BA 4KO8A 4NSRA 1NNJA 2J7OA 3U60B 4DV6M 4DV5M 1DGBA 2F5QA 1TDHA 4LFCM 3MK6A 5KQ8A 4RNAA 2L7IA 2V6ZM 2CV2A 5KPTA 2R45A 2R65A 7CATA 3KOZE 3UMMA 3HJ8A 3SAVA 4WW0A 5LMNM 3UZUA 3TL4X 1WXQA 2XF3A 3CF2A 3J27B 3WHLA 3VDPA 2W82A 1R6BX 2Y0TA 4AKGA 3HU2A 2C99A 4LJ9A 4JN6A 3DOAA 1HQYE 1JR3A 3W0FA 4KLNA 1QANA 1HT2E 3IG5A 1R2YA 4LJ5A 2ZAMA 4JI7M 1GVNA 1ZQ9A 1E9RA 3KP1E 1PJJA 5KO3A 1IN4A 3AL0C 3GLGA 1YSYA 3GQ5A 2EO2A 3GPYA 2BJVA 5H37D 2J7NA 4DUYM 5A2QS 1NJFA 1XMOM 4MGYE 4LZJA 4AKHA 4AKIA 3K8ZA 1X37A 2C96A 3L28A 1N75A 3HHXA 3SYKA 1FJGM 3E9SA 1MX0A 1Z5CA 1W5SA 2DWMA 2DWZB 3JAMS 1J09A 5EP4A 2X49A 3H4MA 4DR4M 2XFSA 4IBJA 3U61A 1IBMM 3ZC7B 2RGHA 2DHRA 3LQQA 5FTNA 3HU3A 4GHAA 1DGFA 1W5TA 4DV4M 4L15A 2XZUA 1JR3D 3PVSA 3ZCBB 4AW4A 1DO2A 1K82A 4AI6A 4GMQA 1XXHA 2K47A 5ITTA 2G8LA 4XGIA 4BB9A 4II7A 5F3WA 1GL7A 4JI5M 3FTEA 2YFQA 3EIHA 5JI2E 1Z59A 3HKPA 5ITXE 3A45A 4A3VB 3KS8A 4NRVA 2CFOA 4JI6M 3AOEA 3I51A 5KPZA 4B3MM 4G4NA 3T15A 2EA0A 3BOSA 3UGJA 3M6AA 4BLCA 3L27A 4LFAM 1HNZM 3L25A 1T3TA 4JV5M 4MGZE 2F5NA 4GC9A 3HGIA 1N78A 2QENA 4B7FA 1XWIA 3TWMA 5C1BA 1G4AE 3CF0A 3SMPA 4M9ZA 2M5ZA 3L29A 4FVMA 2UU9M 1I4WA 4NL4H 4LF8M 2KEBA 4L4UA 4D81A 4IBEA 4YY3M 1XMQM 1LV7A 4JYAM 3D8LA 5EP2A 5E6JA 2UUAM 2Q2EB 1VDDA 2QPAA 3SYLA 1DO0A 2L6OA 5ITYA 1ORYB 2XEPA 3M7GA 4PCZA 1Q3CA 4LJ4A 5FTMA 2Y21A 3K1JA 3GP1A 3ILKA 4HLQA 3LVVA 3FTFA 1G8PA 5DNYA 2XZFA 4I5SA 2LXEA 4CISA 4LF4M 4IBDA 4DV0M 4D82A 4DV3M 4DR2M 4IIWA 3GLIB 3VKHA 3CF6E 3GQ4A 4MB7A 4RF0A 4DV7M 1L2DA 1IY0A 4YHHM 2BJWA 2LWXA 1HR0M 4LGMA 5EXPA 3HJSA 5IZ7D 3J80S 3W0LB 5ITXA 1N33M 1C1KA 5EXSA 1IXRC 3DA1A 2KZUA 3FKEA 1NHWC 3A98B 3AOGA 3M0EA 2HHHM 1D2NA 4HL4A 1NVMA 4JI4M 2FOIC 3ZH9B 1QQWA 1IBKM 2R46A 3VDUA 4GIPA 2KRUA 2DVWB 5E26A 5EP1A 2QBYB 3RGPA 2XFTA 3FYDA 3U6DA 4LZZA 5IREB 3U5ZB 4KODA 2F5PA 2Z7JA 1J7KA 1HT1E 1XNQM 1Q3BA 4B3SM 3FTDA 1L8QA 3DFZA 3THGA 2ZBKB 2NQ8C 2LH0A 1QYRA 1E9SA 3L26A 3IG8A 3FUTA 1HNXM 2Y0QA 4DUZM 4ZPXA 3VLFB 3B9PA 3FD9A 5ITQA 5BPVA 3HWSA 3HHYA 4GC5A 1N32M 3SMSA 2DXIA 5DYGA 1N77A 3FUXA 2C9OA 4M0WA 2YQZA 4CGYB 5KQDA 4AG6A 3JR5A 4DR7M 1KFVA 2C5RA 3QWLA 2G5GX 3SAWA 5ITRA 4JI0M 2FNAA 4LJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IRE B;  5H37 D;  5IZ7 D;  3J2P B;  3J27 B; 
#chains in the Genus database with same CATH topology
 4DR1 M;  5KPR A;  3VFD A;  2CHQ A;  2KZS A;  4HEO A;  4FCV A;  2HKJ A;  1CUK A;  1H6U A;  3GLH B;  3I01 M;  4I81 A;  3GLI E;  3FYC A;  4IJF A;  2OO9 A;  1IN7 A;  3E4R A;  2O25 A;  2K0B X;  2CE7 A;  4XBO A;  3K92 A;  2UUC M;  4LRS A;  8CAT A;  4DV2 M;  2F5S A;  5EQT A;  1J5E M;  3VKG A;  2JP7 A;  3U6M A;  2QQ8 A;  3K9O A;  3GPU A;  2A5Y B;  1XC8 A;  3NBI A;  3AJI B;  2X4A A;  4R7G A;  2JZ0 A;  1WGN A;  3RE8 A;  1K3W A;  4PD2 A;  3SAR A;  3TPZ A;  3W68 A;  3SFZ A;  1OKS A;  3F92 A;  1IXS B;  2GQF A;  1MN3 A;  4WUR A;  5EJC A;  3JR4 A;  3HHW A;  4LG2 A;  4GKK M;  1NY5 A;  1WIV A;  4NXM M;  1MU5 A;  2JUJ A;  4FW9 A;  4LF5 M;  2HCB A;  2K9D A;  4Q7J A;  1Q39 A;  2M60 A;  1VEJ A;  3BBZ A;  3FUU A;  3FUV A;  1TR8 A;  2YR0 A;  4LFB M;  2WZJ A;  1WR1 B;  1A5T A;  4OVZ B;  2N35 A;  1TH2 A;  3MMP A;  3C58 A;  2FH0 A;  1PGY A;  2DKL A;  1L1Z A;  2Z4S A;  2QP9 X;  1IN6 A;  5EP3 A;  1FNN A;  2HL7 A;  4I8O A;  3U6C A;  4B7H A;  2I7N A;  1DGH B;  4B7G A;  4FD2 A;  3MHV C;  4NXN M;  2LHC A;  2JY8 A;  4G4R A;  2L2D A;  4P16 A;  2ZAO A;  3I4V A;  2D7H A;  1GL6 A;  2L4F A;  5DFL A;  2DZL A;  4W5W A;  1TGU A;  4MGI E;  2LVN C;  3GLF B;  2CUZ A;  2KHH A;  2R4E A;  3KOW E;  2R62 A;  2MJ5 B;  1PJS A;  3GLH E;  4R3D A;  4MM3 B;  1HNW M;  2YNM D;  2MH8 A;  3GPP A;  2CHV A;  1QUT A;  2DZO B;  4IBG A;  3GLI A;  1IN5 A;  4QHS A;  2X8A A;  3VK8 A;  4IBK A;  1GLN A;  5FLX S;  3PFI A;  2KA6 B;  3TE6 A;  2RKO A;  4LF9 M;  4G3O A;  3KDS E;  4FWG A;  5ITU A;  3RFW A;  3B7Z A;  3GPX A;  3FTC A;  4D80 A;  3I4Y A;  4X66 M;  3U6E A;  2F5O A;  4B3R M;  5DYI A;  3H4J A;  2Y20 A;  4G4Q A;  3U6O A;  1KSF X;  1QAO A;  1LTM A;  2D7E A;  3T1H M;  1VDL A;  4LJ8 A;  4M9S A;  1L2C A;  1NV8 A;  3GO8 A;  3I04 M;  2OQ4 A;  2UXB M;  4XK8 F;  1NNU C;  1G59 A;  2P5T A;  2DNA A;  2KNZ A;  1TH3 A;  1Z5A A;  3LW5 F;  3LVW A;  4CIZ A;  3OTO M;  1PM5 A;  2QBY A;  4NRW A;  3U5Z A;  1NY6 A;  3FUW A;  2I7P A;  2E5L M;  1QAQ A;  2ZM6 M;  1QAM A;  2VII A;  4OX9 M;  2JA2 A;  5IWA M;  2WSE F;  3K2L A;  2O5R A;  3WHK A;  1TF0 B;  3SAT A;  2DAK A;  4FCW A;  4B08 A;  4G4O A;  1L1T A;  1OAO C;  2JWS A;  1RU3 A;  2CV0 A;  3KOX E;  1AUA A;  3U6L A;  4DR6 M;  5EXT A;  1S3S A;  5GKN A;  2UUB M;  2OOA A;  3KP0 E;  4GKJ M;  2XH9 A;  1XNR M;  3D8B A;  4JI1 M;  3GLF E;  5LMU M;  4X62 M;  4PDI A;  5JI3 E;  4QOS A;  1YE9 A;  4DR5 M;  4PT5 A;  1EE8 A;  4LJA A;  1OIP A;  4B3T M;  2L09 A;  1KYI A;  3RGS A;  2RGO A;  5FTJ A;  1SXJ B;  2QCU A;  5C18 A;  3GLH A;  3J2P B;  4LGY A;  5BR8 M;  3U6Q A;  1PJT A;  4JI2 M;  2LVO C;  1NHG C;  3HJQ A;  1ZAE A;  2DWN A;  1OFI A;  2FFJ A;  2V1C A;  2XLJ A;  3KVW A;  4IBI A;  1T6O A;  1QZE A;  4MGH A;  3TWK A;  4LF7 M;  4QHT A;  4NSO B;  3J81 S;  1SXJ C;  1WHC A;  4OU7 A;  2CV1 A;  4NOO B;  3TWL A;  2EUC A;  3HU1 A;  1G3I A;  2DAE A;  1IXS A;  3GQ3 A;  1SXJ D;  4UN2 B;  3KXE C;  3J7A S;  4Z8X A;  1IQP A;  2KXE A;  2F4V M;  2Z4R A;  1IM2 A;  2R0I A;  3J7B A;  2UXC M;  3U6S A;  2QHO B;  3AFH A;  2C98 A;  3DZD A;  4QNM A;  2CHG A;  2QZ4 A;  1EFU B;  1OFH A;  3W67 A;  4LCB A;  3CTW B;  3HX3 A;  4OVZ A;  3TQS A;  1OJL A;  2R6F A;  3UK6 A;  3GRV A;  3UJN A;  3LCU A;  4MGK E;  4S12 A;  4MH0 E;  1ZMW A;  2KRK A;  1IBL M;  1OTR A;  4R71 A;  4JI3 M;  2VQE M;  1VQ1 A;  4FWD A;  4TUW A;  3AKZ A;  4G6Z A;  1DGH A;  4I4L A;  1R2Z A;  1JQJ C;  1IY1 A;  1DGG A;  1QZM A;  2D7G A;  3HZJ A;  3HY5 A;  5EXX A;  4JI8 M;  2B3T A;  1IFY A;  1N34 M;  2FE8 A;  2L7H A;  4IBB A;  3V76 A;  2OPF A;  1Q02 A;  4GHL A;  1R7R A;  2LNH C;  1GO5 A;  1NJG A;  4LF6 M;  2R18 A;  2JY7 A;  4AZF A;  2LHG A;  3GLG B;  1GKI A;  2DEN A;  2R4J A;  3GLF A;  4AQY M;  2Z8Y M;  1VG5 A;  2HWJ A;  1SXJ E;  2XSZ A;  4Z6Y A;  3KSX A;  2UXD M;  1XHB A;  2VQF M;  1TTE A;  4L8R C;  4M9X A;  3T1Y M;  1UM8 A;  1IY2 A;  2V1U A;  2DHY A;  3PNY A;  1G71 A;  4M0D A;  1E32 A;  1QVR A;  3LCV B;  3SAU A;  4KHP M;  1NO1 A;  3LMM A;  4LY6 A;  2Z3X A;  1OAI A;  3ZQJ A;  4BBA A;  3KW6 A;  2CEA A;  5FSW A;  3Q8X A;  3U61 B;  4REZ A;  1QDR A;  2KW0 A;  4DR3 M;  1N36 M;  1HJP A;  1D0L A;  1E94 E;  1PJQ A;  4LJ7 A;  3PNV A;  1V33 A;  1TH4 A;  3SHF A;  3HHZ A;  3SHG B;  1QDT A;  3B74 A;  3KSJ A;  1XB2 B;  4GEW A;  3LQR A;  3Q8G A;  4IBC A;  2BWE A;  4IJE A;  4EIW A;  3A42 A;  4L16 A;  4CHT B;  4X64 M;  4PDG A;  1ZV1 A;  3PXG A;  3EIE A;  3VK7 A;  3FRI A;  3GRU A;  2AHM A;  3C9P A;  3KS4 A;  4GH9 A;  4GIT A;  5FTK A;  2H1R A;  3SBJ A;  1XXH B;  3CGW A;  2JXN A;  3B89 A;  2VDB B;  4OW0 A;  4GRI A;  2BNK A;  2XGN A;  1L2B A;  4ITQ A;  2DAI A;  3QAU A;  4LRT A;  4L78 A;  1JR3 E;  2XSZ D;  4RF1 A;  3NWL A;  2DZN B;  1K3X A;  3AV0 A;  4DV1 M;  3L2A A;  3GRY A;  4QOZ C;  2ZTD A;  4K0K M;  4FWH A;  4L6V 6;  3MJ5 A;  1G41 A;  4FCT A;  3GLG E;  4X65 M;  1I94 M;  2R44 A;  1MJG M;  3U60 A;  3U6P A;  2C9C A;  2ZAN A;  5FTL A;  1Z6T A;  4IBF A;  3KOY E;  3QYB A;  1IXZ A;  4LJ6 A;  4AG5 A;  5IT9 S;  3SAS A;  3T38 A;  1SXJ A;  3AOE C;  4JXJ A;  1D0M A;  1NSF A;  3R8F A;  2FS1 A;  4QNR A;  3A46 A;  1IN8 A;  2LTU A;  2ERC A;  3IHP A;  2DWL A;  1YUB A;  2JY6 B;  3GRR A;  3SC3 A;  3KFU G;  1HQC A;  1PJI A;  1TDZ A;  1Z5B A;  4KO8 A;  4NSR A;  1NNJ A;  1V34 A;  2J7O A;  3U60 B;  2GNO A;  1GJS A;  3QYE A;  2JNH A;  4DV6 M;  4DV5 M;  4ANR A;  1DGB A;  2F5Q A;  1SG9 A;  1TDH A;  3MK6 A;  5KQ8 A;  4LFC M;  4RNA A;  2L7I A;  2V6Z M;  2CV2 A;  5KPT A;  2R45 A;  2R65 A;  2CP8 A;  7CAT A;  3KOZ E;  3UMM A;  3HJ8 A;  3SAV A;  2MR9 A;  4NC6 A;  1BVS A;  4WW0 A;  5LMN M;  1XXH E;  3UZU A;  3C3D A;  3TL4 X;  1WXQ A;  2XF3 A;  3CF2 A;  3J27 B;  2WSF F;  3WHL A;  4WP2 A;  3VDP A;  2W82 A;  1R6B X;  2Y0T A;  4AKG A;  3HU2 A;  2C99 A;  4LJ9 A;  1EIJ A;  4JN6 A;  3DOA A;  1HQY E;  1JR3 A;  2VF7 A;  3W0F A;  2H5X A;  4KLN A;  1QAN A;  1HT2 E;  3IG5 A;  1R2Y A;  4LJ5 A;  2ZAM A;  4JI7 M;  1GVN A;  1ZQ9 A;  1E9R A;  1UFZ A;  2EKK A;  3KP1 E;  1PJJ A;  5KO3 A;  1IN4 A;  3AL0 C;  3GLG A;  2LVA A;  1YSY A;  3GQ5 A;  2EO2 A;  1PRB A;  2BJV A;  3GPY A;  5H37 D;  2CRU A;  2J7N A;  1R4G A;  4RKU F;  4DUY M;  5A2Q S;  1NJF A;  1XMO M;  1VEK A;  4MGY E;  4LZJ A;  4AKH A;  4AKI A;  2EJS A;  1X37 A;  2C96 A;  3K8Z A;  2LVP C;  3L28 A;  2L4E A;  1N75 A;  3HHX A;  1R5L A;  4KT0 F;  3SYK A;  3E21 A;  1FJG M;  2O01 F;  3E9S A;  1MX0 A;  1Z5C A;  1W5S A;  2DWM A;  2DWZ B;  2WSC F;  3JAM S;  1J09 A;  5EP4 A;  2X49 A;  3H4M A;  4DR4 M;  2XFS A;  4IBJ A;  3U61 A;  1IBM M;  3E46 A;  2K6B A;  3ZC7 B;  2RGH A;  2DHR A;  3LQQ A;  5FTN A;  2LVQ D;  3HU3 A;  4GHA A;  1DGF A;  1W5T A;  4DV4 M;  4L15 A;  2KDL A;  2XZU A;  1JR3 D;  3PVS A;  3ZCB B;  4AW4 A;  1DO2 A;  2HAK A;  1K82 A;  4AI6 A;  2G3Q A;  4GMQ A;  1XXH A;  2K47 A;  5ITT A;  2G8L A;  4XGI A;  4BB9 A;  4II7 A;  2LBC A;  1GL7 A;  4CJ6 A;  5F3W A;  1GAB A;  4JI5 M;  2ZTC A;  3FTE A;  1OQY A;  2YFQ A;  3EIH A;  5JI2 E;  1Z59 A;  3HKP A;  3K9P A;  1T43 A;  1V92 A;  3B7Q A;  4F1I A;  5ITX E;  3A45 A;  4A3V B;  3KS8 A;  4NRV A;  1NV9 A;  2CFO A;  4JI6 M;  1AIP C;  3AOE A;  3I51 A;  5KPZ A;  4B3M M;  4G4N A;  3T15 A;  2EA0 A;  2MRO B;  2CWB A;  3BOS A;  3UGJ A;  3M6A A;  4BLC A;  3L27 A;  3IEC A;  4LFA M;  1HNZ M;  2KNV A;  3L25 A;  1T3T A;  4JV5 M;  4MGZ E;  2F5N A;  4GC9 A;  3HGI A;  1N78 A;  2JY5 A;  2QEN A;  4B7F A;  1XWI A;  3TWM A;  5C1B A;  1G4A E;  3CF0 A;  2KNA A;  3SMP A;  4M9Z A;  2QSF X;  4DBG B;  2M5Z A;  3L29 A;  4FVM A;  3C3E A;  2UU9 M;  1I4W A;  4NL4 H;  4LF8 M;  1OIZ A;  2KEB A;  4L4U A;  4D81 A;  4IBE A;  4YY3 M;  1XMQ M;  1LV7 A;  4JYA M;  3D8L A;  1QUS A;  4Y28 F;  3B7N A;  5E6J A;  5EP2 A;  2Q2E B;  1VDD A;  2UUA M;  2QPA A;  3SYL A;  1DO0 A;  2L6O A;  5ITY A;  3NBX X;  1ORY B;  2DAG A;  2XEP A;  3M7G A;  4PCZ A;  2DI0 A;  1Q3C A;  4LJ4 A;  5FTM A;  2Y21 A;  3K1J A;  3BXW A;  3GP1 A;  1C7Y A;  2DAM A;  3ILK A;  2BWB A;  2JZ1 A;  3LVV A;  4HLQ A;  1VEG A;  2QNJ A;  3FTF A;  1G8P A;  5DNY A;  2XZF A;  4I5S A;  2LXE A;  4CIS A;  4LF4 M;  4IBD A;  4DV0 M;  4D82 A;  4DV3 M;  4DR2 M;  4IIW A;  3GLI B;  3VKH A;  3CF6 E;  3GQ4 A;  4MB7 A;  4RF0 A;  4DV7 M;  1L2D A;  1IY0 A;  4YHH M;  2RRU A;  2BJW A;  1ZMV A;  2LWX A;  1HR0 M;  4LGM A;  5EXP A;  3HJS A;  5IZ7 D;  1ZMU A;  3R9X B;  3J80 S;  3W0L B;  5ITX A;  1N33 M;  1C1K A;  1F4I A;  5EXS A;  1IXR C;  3DA1 A;  2KZU A;  3FKE A;  1NHW C;  3A98 B;  3AOG A;  3M0E A;  2HHH M;  1D2N A;  2APL A;  4HL4 A;  1NVM A;  4JI4 M;  2FOI C;  3ZH9 B;  1QQW A;  1IBK M;  2R46 A;  3VDU A;  1WJ7 A;  4GIP A;  1WGL A;  2KRU A;  2DVW B;  5E26 A;  2VF8 A;  5EP1 A;  2QBY B;  1Y8G A;  2XFT A;  3FYD A;  3RGP A;  3U6D A;  4LZZ A;  2MGW A;  3FE3 A;  1P3Q Q;  4KOD A;  5IRE B;  3T6P A;  4F2L A;  3U5Z B;  2F5P A;  2Z7J A;  1J7K A;  1HT1 E;  1XNQ M;  1Q3B A;  4B3S M;  3FTD A;  1JB0 F;  1L8Q A;  3DFZ A;  2ZBK B;  2NQ8 C;  3THG A;  5L8R F;  2LH0 A;  1QYR A;  1E9S A;  3L26 A;  3IG8 A;  3FUT A;  1HNX M;  2J5Y A;  2Y0Q A;  4DUZ M;  4ZPX A;  3VLF B;  3B9P A;  3FD9 A;  5ITQ A;  2OOB A;  1D0K A;  3HWS A;  3HHY A;  5BPV A;  4GC5 A;  1N32 M;  1YLA A;  3SMS A;  2DXI A;  5DYG A;  1N77 A;  3FUX A;  2C9O A;  4M0W A;  2YQZ A;  4P17 A;  4CGY B;  5KQD A;  4AG6 A;  3JR5 A;  2EKF A;  1KFV A;  4DR7 M;  2C5R A;  3QWL A;  2G5G X;  3SAW A;  5ITR A;  4JI0 M;  1DV0 A;  2FNA A;  1GJT A;  3FRH A; 
#chains in the Genus database with same CATH homology
 4DR1 M;  5KPR A;  3VFD A;  2CHQ A;  2KZS A;  4FCV A;  2HKJ A;  1H6U A;  3GLH B;  4I81 A;  3FYC A;  4IJF A;  1IN7 A;  3E4R A;  2CE7 A;  4XBO A;  3K92 A;  2UUC M;  4LRS A;  8CAT A;  4DV2 M;  2F5S A;  5EQT A;  1J5E M;  3VKG A;  3U6M A;  3GPU A;  2A5Y B;  1XC8 A;  3NBI A;  3AJI B;  2X4A A;  4R7G A;  3RE8 A;  1K3W A;  4PD2 A;  3SAR A;  3TPZ A;  3SFZ A;  1IXS B;  4WUR A;  5EJC A;  3JR4 A;  3HHW A;  4LG2 A;  4GKK M;  1NY5 A;  4NXM M;  1MU5 A;  4FW9 A;  4LF5 M;  2HCB A;  1Q39 A;  2M60 A;  3FUU A;  3FUV A;  2YR0 A;  4LFB M;  4OVZ B;  3C58 A;  1TH2 A;  1L1Z A;  2Z4S A;  2QP9 X;  1IN6 A;  5EP3 A;  1FNN A;  2HL7 A;  4I8O A;  3U6C A;  4B7H A;  2I7N A;  1DGH B;  4B7G A;  4FD2 A;  3MHV C;  4NXN M;  4G4R A;  4P16 A;  2ZAO A;  3I4V A;  2D7H A;  1GL6 A;  4W5W A;  1TGU A;  4MGI E;  3GLF B;  2CUZ A;  2R4E A;  3KOW E;  2R62 A;  4R3D A;  4MM3 B;  1HNW M;  2YNM D;  3GPP A;  2CHV A;  2DZO B;  4IBG A;  3GLI A;  1IN5 A;  4QHS A;  2X8A A;  3VK8 A;  4IBK A;  1GLN A;  5FLX S;  3PFI A;  2KA6 B;  3TE6 A;  2RKO A;  4LF9 M;  3KDS E;  4FWG A;  5ITU A;  3RFW A;  3GPX A;  3FTC A;  4D80 A;  3I4Y A;  4X66 M;  3U6E A;  2F5O A;  4B3R M;  5DYI A;  4G4Q A;  2Y20 A;  3U6O A;  1KSF X;  1QAO A;  2D7E A;  3T1H M;  4M9S A;  1L2C A;  3GO8 A;  2OQ4 A;  2UXB M;  1NNU C;  1G59 A;  2P5T A;  1TH3 A;  1Z5A A;  3LVW A;  1PM5 A;  2QBY A;  3OTO M;  4NRW A;  3U5Z A;  1NY6 A;  3FUW A;  2I7P A;  2E5L M;  1QAQ A;  2ZM6 M;  1QAM A;  2VII A;  4OX9 M;  2JA2 A;  5IWA M;  3K2L A;  2O5R A;  3WHK A;  3SAT A;  4B08 A;  4FCW A;  4G4O A;  1L1T A;  2CV0 A;  3KOX E;  3U6L A;  4DR6 M;  5EXT A;  1S3S A;  5GKN A;  2UUB M;  3KP0 E;  4GKJ M;  2XH9 A;  1XNR M;  3D8B A;  4JI1 M;  5LMU M;  4X62 M;  4PDI A;  5JI3 E;  4QOS A;  1YE9 A;  4DR5 M;  4PT5 A;  1EE8 A;  4LJA A;  4B3T M;  2L09 A;  1KYI A;  3RGS A;  2RGO A;  5FTJ A;  1SXJ B;  2QCU A;  5C18 A;  3GLH A;  3J2P B;  4LGY A;  5BR8 M;  3U6Q A;  4JI2 M;  3HJQ A;  1NHG C;  1ZAE A;  2DWN A;  1OFI A;  2FFJ A;  2V1C A;  2XLJ A;  3KVW A;  4IBI A;  4MGH A;  3TWK A;  4LF7 M;  4QHT A;  4NSO B;  3J81 S;  1SXJ C;  4OU7 A;  2CV1 A;  4NOO B;  3TWL A;  2EUC A;  3HU1 A;  1G3I A;  3GQ3 A;  1SXJ D;  3KXE C;  3J7A S;  4Z8X A;  1IQP A;  2KXE A;  2F4V M;  2Z4R A;  1IM2 A;  3J7B A;  2UXC M;  3U6S A;  3AFH A;  2C98 A;  3DZD A;  4QNM A;  2CHG A;  2QZ4 A;  1OFH A;  4LCB A;  3CTW B;  4OVZ A;  3TQS A;  3UK6 A;  1OJL A;  3GRV A;  3UJN A;  4MGK E;  4S12 A;  4MH0 E;  2KRK A;  1IBL M;  4JI3 M;  2VQE M;  4FWD A;  4TUW A;  3AKZ A;  4G6Z A;  1DGH A;  4I4L A;  1R2Z A;  1JQJ C;  1IY1 A;  1DGG A;  1QZM A;  2D7G A;  5EXX A;  1K3X A;  4JI8 M;  1N34 M;  2FE8 A;  2L7H A;  4IBB A;  2OPF A;  4GHL A;  1R7R A;  2LNH C;  1NJG A;  4LF6 M;  2R18 A;  4AZF A;  3GLG B;  1GKI A;  2R4J A;  3GLF A;  4AQY M;  4Z6Y A;  2XSZ A;  1SXJ E;  2UXD M;  3KSX A;  1XHB A;  2VQF M;  4L8R C;  4M9X A;  3T1Y M;  1UM8 A;  1IY2 A;  2V1U A;  3PNY A;  4M0D A;  1E32 A;  1QVR A;  3SAU A;  4KHP M;  3LMM A;  4LY6 A;  2Z3X A;  4BBA A;  3KW6 A;  2CEA A;  5FSW A;  3Q8X A;  3U61 B;  4REZ A;  2KW0 A;  4DR3 M;  1N36 M;  4LJ7 A;  1E94 E;  3SHF A;  3PNV A;  1TH4 A;  3HHZ A;  3SHG B;  3KSJ A;  4IBC A;  4EIW A;  3LQR A;  4IJE A;  3A42 A;  4L16 A;  4CHT B;  4X64 M;  4PDG A;  3PXG A;  3EIE A;  3VK7 A;  3GRU A;  2AHM A;  3KS4 A;  4GH9 A;  4GIT A;  5FTK A;  2H1R A;  3SBJ A;  1XXH B;  4OW0 A;  4GRI A;  2BNK A;  2XGN A;  1L2B A;  4ITQ A;  4L78 A;  3QAU A;  4LRT A;  3R9X B;  2XSZ D;  4RF1 A;  3NWL A;  2DZN B;  3AV0 A;  4DV1 M;  3L2A A;  3GRY A;  4QOZ C;  4K0K M;  4FWH A;  3MJ5 A;  1G41 A;  4FCT A;  4X65 M;  1I94 M;  3U60 A;  3U6P A;  2C9C A;  2ZAN A;  5FTL A;  1Z6T A;  4IBF A;  3KOY E;  4AG5 A;  1IXZ A;  4LJ6 A;  5IT9 S;  3SAS A;  3T38 A;  1SXJ A;  3AOE C;  4JXJ A;  1NSF A;  3R8F A;  4QNR A;  3A46 A;  1IN8 A;  2ERC A;  2DWL A;  1YUB A;  3GRR A;  3SC3 A;  3KFU G;  1HQC A;  1PJI A;  1TDZ A;  1Z5B A;  4KO8 A;  4NSR A;  1NNJ A;  2J7O A;  3U60 B;  4DV6 M;  4DV5 M;  1DGB A;  2F5Q A;  1TDH A;  4LFC M;  3MK6 A;  5KQ8 A;  4RNA A;  2L7I A;  2V6Z M;  2CV2 A;  5KPT A;  2R45 A;  2R65 A;  7CAT A;  3KOZ E;  3UMM A;  3HJ8 A;  3SAV A;  4WW0 A;  5LMN M;  3UZU A;  3TL4 X;  1WXQ A;  2XF3 A;  3CF2 A;  3J27 B;  3WHL A;  3VDP A;  2W82 A;  1R6B X;  2Y0T A;  4AKG A;  3HU2 A;  2C99 A;  4LJ9 A;  4JN6 A;  3DOA A;  1HQY E;  1JR3 A;  3W0F A;  4KLN A;  1QAN A;  1HT2 E;  3IG5 A;  1R2Y A;  4LJ5 A;  2ZAM A;  4JI7 M;  1GVN A;  1ZQ9 A;  1E9R A;  3KP1 E;  1PJJ A;  5KO3 A;  1IN4 A;  3AL0 C;  3GLG A;  1YSY A;  3GQ5 A;  2EO2 A;  3GPY A;  2BJV A;  5H37 D;  2J7N A;  4DUY M;  5A2Q S;  1NJF A;  1XMO M;  4MGY E;  4LZJ A;  4AKH A;  4AKI A;  3K8Z A;  1X37 A;  2C96 A;  3L28 A;  1N75 A;  3HHX A;  3SYK A;  1FJG M;  3E9S A;  1MX0 A;  1Z5C A;  1W5S A;  2DWM A;  2DWZ B;  3JAM S;  1J09 A;  5EP4 A;  2X49 A;  3H4M A;  4DR4 M;  2XFS A;  4IBJ A;  3U61 A;  1IBM M;  3ZC7 B;  2RGH A;  2DHR A;  3LQQ A;  5FTN A;  3HU3 A;  4GHA A;  1DGF A;  1W5T A;  4DV4 M;  4L15 A;  2XZU A;  1JR3 D;  3PVS A;  3ZCB B;  4AW4 A;  1DO2 A;  1K82 A;  4AI6 A;  4GMQ A;  1XXH A;  2K47 A;  5ITT A;  2G8L A;  4XGI A;  4BB9 A;  4II7 A;  5F3W A;  1GL7 A;  4JI5 M;  3FTE A;  2YFQ A;  3EIH A;  5JI2 E;  1Z59 A;  3HKP A;  5ITX E;  3A45 A;  4A3V B;  3KS8 A;  4NRV A;  2CFO A;  4JI6 M;  3AOE A;  3I51 A;  5KPZ A;  4B3M M;  4G4N A;  3T15 A;  2EA0 A;  3BOS A;  3UGJ A;  3M6A A;  4BLC A;  3L27 A;  4LFA M;  1HNZ M;  3L25 A;  1T3T A;  4JV5 M;  4MGZ E;  2F5N A;  4GC9 A;  3HGI A;  1N78 A;  2QEN A;  4B7F A;  1XWI A;  3TWM A;  5C1B A;  1G4A E;  3CF0 A;  3SMP A;  4M9Z A;  2M5Z A;  3L29 A;  4FVM A;  2UU9 M;  1I4W A;  4NL4 H;  4LF8 M;  2KEB A;  4L4U A;  4D81 A;  4IBE A;  4YY3 M;  1XMQ M;  1LV7 A;  4JYA M;  3D8L A;  5EP2 A;  5E6J A;  2UUA M;  2Q2E B;  1VDD A;  2QPA A;  3SYL A;  1DO0 A;  2L6O A;  5ITY A;  1ORY B;  2XEP A;  3M7G A;  4PCZ A;  1Q3C A;  4LJ4 A;  5FTM A;  2Y21 A;  3K1J A;  3GP1 A;  3ILK A;  4HLQ A;  3LVV A;  3FTF A;  1G8P A;  5DNY A;  2XZF A;  4I5S A;  2LXE A;  4CIS A;  4LF4 M;  4IBD A;  4DV0 M;  4D82 A;  4DV3 M;  4DR2 M;  4IIW A;  3GLI B;  3VKH A;  3CF6 E;  3GQ4 A;  4MB7 A;  4RF0 A;  4DV7 M;  1L2D A;  1IY0 A;  4YHH M;  2BJW A;  2LWX A;  1HR0 M;  4LGM A;  5EXP A;  3HJS A;  5IZ7 D;  3J80 S;  3W0L B;  5ITX A;  1N33 M;  1C1K A;  5EXS A;  1IXR C;  3DA1 A;  2KZU A;  3FKE A;  1NHW C;  3A98 B;  3AOG A;  3M0E A;  2HHH M;  1D2N A;  4HL4 A;  1NVM A;  4JI4 M;  2FOI C;  3ZH9 B;  1QQW A;  1IBK M;  2R46 A;  3VDU A;  4GIP A;  2KRU A;  2DVW B;  5E26 A;  5EP1 A;  2QBY B;  3RGP A;  2XFT A;  3FYD A;  3U6D A;  4LZZ A;  5IRE B;  3U5Z B;  4KOD A;  2F5P A;  2Z7J A;  1J7K A;  1HT1 E;  1XNQ M;  1Q3B A;  4B3S M;  3FTD A;  1L8Q A;  3DFZ A;  3THG A;  2ZBK B;  2NQ8 C;  2LH0 A;  1QYR A;  1E9S A;  3L26 A;  3IG8 A;  3FUT A;  1HNX M;  2Y0Q A;  4DUZ M;  4ZPX A;  3VLF B;  3B9P A;  3FD9 A;  5ITQ A;  5BPV A;  3HWS A;  3HHY A;  4GC5 A;  1N32 M;  3SMS A;  2DXI A;  5DYG A;  1N77 A;  3FUX A;  2C9O A;  4M0W A;  2YQZ A;  4CGY B;  5KQD A;  4AG6 A;  3JR5 A;  4DR7 M;  1KFV A;  2C5R A;  3QWL A;  2G5G X;  3SAW A;  5ITR A;  4JI0 M;  2FNA A;  4LJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...