3J27B

Cryoem structure of dengue virus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
SVALVPHVGMGLETATETWMSSEGAWKHAQRIETWILRHPGFTIMAAILAYTIGTTHFQRALIFILLTAVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope protein E
publication title Cryo-EM structure of the mature dengue virus at 3.5-A resolution.
pubmed doi rcsb
molecule tags Virus
total genus 19
structure length 72
sequence length 72
chains with identical sequence D, F
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01004 Flavi_M Flavivirus envelope glycoprotein M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.970 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3j27B00
3J2PB 5IREB 5IZ7D 3J27B 5H37D
chains in the Genus database with same CATH superfamily
2QCUA 1MJGM 1OAIA 4NOOB 2L4EA 1PJQA 4DR1M 1J7KA 4ZPXA 2L7IA 3GRYA 3HJQA 4IBKA 1DGGA 3HJSA 3U6MA 4JI5M 3FYCA 4NXMM 1H6UA 2KA6B 1N33M 1KYIA 1TF0B 3AOEC 1XC8A 2L7HA 3KSXA 2DI0A 3CGWA 2BWEA 4IBDA 4RF1A 4LFAM 1E9SA 2GNOA 2O5RA 4PCZA 3J81S 3GQ4A 1XMQM 2UU9M 1X37A 3TWKA 3U6CA 3TWMA 1MN3A 1A5TA 2WSCF 3AOEA 3L28A 4R7GA 1ZMVA 1TDZA 4OVZA 1TTEA 2LNHC 1Y8GA 2DAKA 1G41A 5GKNA 2HKJA 3HY5A 4NL4H 2LHCA 4JV5M 3KOYE 1QAMA 5FTLA 4MM3B 4FCWA 2LTUA 3J27B 2CE7A 2DWLA 4NC6A 3AFHA 4DV6M 1ZMUA 3DFZA 4L8RC 3L27A 3CF2A 3GQ5A 1IXZA 4LZZA 3U5ZB 1XXHE 1RU3A 4G3OA 2K6BA 4DUYM 3U6OA 4HLQA 3KFUG 3E4RA 2R18A 1SXJD 3GO8A 2KNVA 2ZBKB 3IECA 3M6AA 1SXJB 1IN8A 1QZMA 1T6OA 4GKKM 4DR6M 2LVOC 5ITQA 1J09A 4FCVA 1IBMM 4P17A 3GLIA 1N77A 2J7NA 1Z6TA 3C3DA 1I4WA 2YNMD 2DWMA 1IM2A 4CISA 5DYIA 2C5RA 2G3QA 2M60A 2R0IA 3T38A 3GPXA 3HHWA 2C98A 2Y21A 1QAQA 1WR1B 1NO1A 1OIPA 2Y0TA 4GC5A 1NJGA 5EP3A 3KS4A 4LF4M 2UUCM 4B3SM 5FTKA 4RNAA 4FVMA 4M0WA 4NRWA 4IBEA 5E6JA 4S12A 4G4QA 2XZFA 3GLGA 3HHZA 4JI4M 2CFOA 1R2ZA 2OO9A 4JYAM 1PGYA 2OPFA 3GRVA 3VFDA 4DUZM 1TH2A 1D0LA 4GEWA 1HR0M 4X65M 2EKFA 1IXRC 1QQWA 3L29A 4IJFA 3SC3A 1YSYA 1L2BA 2XZUA 1E9RA 2DAIA 3GLFB 2KRUA 2I7PA 2ZAOA 3W0LB 4LJ5A 1XXHB 2M5ZA 3CF6E 2V1UA 3HJ8A 5EXSA 1K82A 2OQ4A 3WHKA 4Z8XA 1LV7A 3SHGB 1WXQA 4LF9M 1GJSA 3IG8A 3FUXA 1PJJA 2W82A 1E94E 1G3IA 5IZ7D 3LW5F 1IQPA 4LJ6A 1N32M 1IXSA 4L16A 4AZFA 3FUVA 2DAEA 3GLHE 4II7A 4KLNA 1Z59A 1Q02A 3RGSA 3E46A 3W67A 4JI1M 2CV2A 4CJ6A 1GJTA 4A3VB 5EQTA 3GPPA 4NRVA 3SARA 3ZCBB 3H4MA 4QHTA 1HT1E 3WHLA 5ITXE 3DOAA 2F5SA 1AIPC 2Y0QA 1DGHA 3QAUA 3IG5A 4DV3M 1R2YA 2R46A 2UXBM 2I7NA 3QWLA 3VLFB 2CP8A 2L2DA 2CHQA 3HZJA 3Q8XA 4WP2A 3B74A 1L1ZA 2UUBM 2RGHA 4OX9M 4L4UA 3R9XB 4AQYM 5F3WA 4JI2M 3KS8A 4FWHA 1DO2A 3MMPA 4LJ4A 1IN4A 1L2CA 2F5PA 4LF5M 4KHPM 4IBCA 2RRUA 1WGLA 4LF7M 2BJWA 1NV8A 1PJTA 3I4VA 3M7GA 4JXJA 4B08A 3J2PB 1HNXM 1NSFA 1EE8A 2EJSA 3JR4A 3VKHA 1ORYB 1S3SA 2KZUA 5FSWA 1TR8A 3HWSA 3GPYA 3VK8A 4LFCM 2RGOA 3SMSA 3ZQJA 4AG6A 4PDIA 1Q3BA 3KSJA 2R62A 3GLHB 3LMMA 1AUAA 3FTEA 1FNNA 1HQCA 2KZSA 1LTMA 2ERCA 3FUTA 3E21A 4DV4M 2JXNA 3CTWB 2QBYA 2DENA 4FD2A 3HKPA 4DV2M 3I4YA 2DZOB 2R65A 1IN5A 1R5LA 1GO5A 2XSZA 2NQ8C 4K0KM 2KDLA 2MROB 3FUUA 2QENA 1UFZA 1KFVA 4M9SA 3FUWA 3AOGA 2CHVA 1IFYA 2C96A 5KO3A 2JNHA 3JR5A 2C9CA 3AV0A 4JI8M 1G4AE 1WGNA 1OFHA 2FOIC 1BVSA 2X49A 4W5WA 1Z5CA 1QUTA 3HX3A 2F5OA 4IIWA 1PRBA 1EIJA 4EIWA 2RKOA 2QSFX 1MX0A 3U60A 1VDLA 2FNAA 3GLIE 4B3TM 4HL4A 1D0KA 1R4GA 1TGUA 4PT5A 5FTMA 5FLXS 5EXPA 2MGWA 3PVSA 1ZV1A 3CF0A 3NWLA 2CRUA 1GABA 1IN6A 2OOAA 2ZANA 1FJGM 1G8PA 1NHGC 3K9OA 2L4FA 2DAGA 1VEGA 3A42A 4BB9A 5EP4A 4RKUF 2Z4SA 3GRRA 4OVZB 1TDHA 1V92A 1IY1A 4MGIE 3GLGE 4LF6M 4QHSA 4MGHA 2Z8YM 3M0EA 3GPUA 3PNYA 4F1IA 4JN6A 4DV5M 1XNQM 3KDSE 3MK6A 3K9PA 4LF8M 4DV1M 1IN7A 1NY6A 2C99A 4IBGA 4MGYE 5ITYA 2Q2EB 1VEJA 3A46A 3T15A 4BBAA 4DV7M 1NJFA 3HHYA 1OFIA 3TPZA 1G59A 1F4IA 2YQZA 4FCTA 1K3WA 1HT2E 5EP2A 3UJNA 4NSRA 4TUWA 3VDPA 1WHCA 1R7RA 3FTDA 1OKSA 5EP1A 2DVWB 2FFJA 4G6ZA 3SMPA 5EJCA 1YUBA 4GRIA 1N78A 2MH8A 2J5YA 2B3TA 3AJIB 1QUSA 1ZAEA 1TH4A 4G4NA 2CHGA 1N36M 2LVAA 2UXCM 3J80S 3NBIA 3UK6A 4G4RA 1XMOM 1SG9A 3F92A 5KQ8A 4LG2A 5IWAM 3U6EA 4ITQA 1QANA 5LMUM 3TL4X 1NHWC 4MH0E 2VF7A 2BWBA 3L26A 2F5QA 4IBFA 4OW0A 3DZDA 2FS1A 2EA0A 4MB7A 3L25A 4GHLA 1JR3A 4DR5M 3LCUA 1CUKA 1NY5A 2O25A 3SATA 4X66M 3U61A 4KODA 4OU7A 2CUZA 4B3RM 2L6OA 1NVMA 4GH9A 3EIEA 1OQYA 2HAKA 4X62M 3SAVA 2ZAMA 2CV0A 2D7HA 3EIHA 4FWDA 2LBCA 2LVQD 2KNAA 3PNVA 1PJSA 3TQSA 4KT0F 5KPZA 4YHHM 3SFZA 3I51A 3THGA 2HL7A 2KW0A 3LCVB 4IJEA 4I4LA 3W68A 2ZM6M 4R3DA 2K0BX 1P3QQ 4B7HA 2D7EA 2CEAA 4LRTA 5KPRA 1IY0A 3IHPA 2Z7JA 4B7FA 3T1YM 4DR7M 1W5TA 2XEPA 3TWLA 1W5SA 4QNMA 3FE3A 7CATA 1R6BX 1K3XA 3C58A 2KEBA 2KRKA 2XFTA 3NBXX 1UM8A 4REZA 4LGMA 3HU3A 3SYKA 2QZ4A 1DGHB 2A5YB 4F2LA 2DHYA 2LHGA 2JP7A 4LFBM 1DV0A 2GQFA 4D82A 4I5SA 1XHBA 2BNKA 3B7NA 3E9SA 5A2QS 2VF8A 1C7YA 2QHOB 1Z5AA 2Z4RA 3U6PA 1Q3CA 3FD9A 4IBJA 1N75A 4MGKE 4AI6A 2QNJA 3GLFA 2JY5A 1QVRA 3HU1A 4UN2B 2DAMA 1OJLA 5ITTA 2G8LA 2VDBB 3I04M 3LVWA 3OTOM 2UUAM 3W0FA 1D0MA 2N35A 2XLJA 3JAMS 4AG5A 5KQDA 4R71A 2EKKA 4YY3M 2QPAA 1C1KA 1VQ1A 4JI3M 1EFUB 5C1BA 1WJ7A 4NXNM 2R45A 3T1HM 3SYLA 2O01F 2XH9A 2G5GX 2JUJA 3FTCA 3TE6A 3SBJA 4IBIA 2JY7A 1I94M 3KOXE 2H1RA 2JZ1A 4LZJA 3U5ZA 3U6QA 1NNJA 1GLNA 5LMNM 1SXJC 3FYDA 2VIIA 4LY6A 2YFQA 3U6SA 2QQ8A 1QAOA 1VDDA 1YLAA 3LQQA 2XSZD 3VKGA 2CV1A 1SXJA 2WSEF 2UXDM 5E26A 2DXIA 2QBYB 2FH0A 3SAWA 5H37D 3RGPA 4LRSA 2H5XA 4LJ9A 1KSFX 2HWJA 1GL6A 1L8QA 2YR0A 3HU2A 3U6LA 4DV0M 2FE8A 3D8LA 3LVVA 4FW9A 1GVNA 1OTRA 4CGYB 4AKHA 2KNZA 1G71A 4BLCA 3U60B 3DA1A 5ITUA 1GKIA 2C9OA 2X8AA 5JI3E 3KP0E 2CWBA 4KO8A 2AHMA 2EO2A 1NV9A 1IBKM 2L09A 4JI0M 3ZH9B 5C18A 1XWIA 4L15A 1GL7A 3KVWA 2V1CA 1OIZA 3L2AA 4D80A 5IREB 3B7ZA 5BPVA 2R6FA 1TH3A 3VK7A 3ILKA 4L6V6 1D2NA 4XBOA 2J7OA 4MGZE 4PDGA 5BR8M 4GITA 4I8OA 3GLIB 3B89A 1XXHA 2DWNA 3I01M 4M9ZA 1JR3E 1XNRM 2X4AA 3R8FA 4GIPA 3V76A 2APLA 4LJ8A 2XGNA 5ITRA 2MR9A 3QYBA 4JI6M 1QDTA 4GC9A 2XFSA 3SAUA 3PFIA 4D81A 1DO0A 3QYEA 2WSFF 3GRUA 3BXWA 3KW6A 4HEOA 4LJ7A 3K92A 4RF0A 5KPTA 2F5NA 5FTNA 4XK8F 3FKEA 4G4OA 4DR2M 2VQEM 1T3TA 1DGFA 2XF3A 8CATA 3GLGB 1YE9A 5JI2E 3BOSA 4AKIA 3U6DA 2LVPC 4DBGB 1WIVA 3Q8GA 5L8RF 2LVNC 4M9XA 2Y20A 1HJPA 2EUCA 1IY2A 2OOBA 3UGJA 4B3MM 5EXTA 2JA2A 1V33A 5DYGA 2R44A 3MHVC 1PM5A 3AKZA 2HHHM 1DGBA 2KHHA 4WW0A 5IT9S 2DZLA 2E5LM 2QP9X 4GMQA 4CHTB 3MJ5A 4AKGA 2WZJA 3RE8A 3C9PA 1J5EM 5EXXA 1VG5A 4FWGA 3SASA 2JWSA 2R4EA 1ZMWA 2DKLA 3RFWA 3FRIA 4GKJM 1T43A 2LXEA 2P5TA 3GQ3A 4Q7JA 1HNZM 2BJVA 2D7GA 1V34A 1JR3D 3KOZE 2ZTCA 5DNYA 3J7BA 3AL0C 1IXSB 1NNUC 3LQRA 4CIZA 4NSOB 3VDUA 1Q39A 4B7GA 2VQFM 3FTFA 1HQYE 1MU5A 3K8ZA 4LCBA 4AW4A 3U61B 4DR3M 3UMMA 4L78A 4LJAA 2JY6B 3SHFA 3GLFE 1IBLM 2R4JA 2DNAA 4P16A 2DWZB 4Y28F 1L1TA 3C3EA 4IBBA 3GLHA 4X64M 3A45A 1ZQ9A 1QYRA 3B7QA 4M0DA 3PXGA 3UZUA 2JY8A 4ANRA 4PD2A 2KXEA 1JB0F 2MJ5B 3D8BA 2LWXA 3KOWE 3KP1E 4Z6YA 2Z3XA 1PJIA 4QNRA 4JI7M 4I81A 3J7AS 4LGYA 5DFLA 1QZEA 1XB2B 4WURA 1JQJC 4XGIA 3KXEC 3K2LA 3H4JA 2HCBA 5ITXA 1VEKA 2DZNB 1Z5BA 3HGIA 3T6PA 1HNWM 3ZC7B 5FTJA 3K1JA 1L2DA 3BBZA 4QOZC 2ZTDA 3GP1A 4QOSA 1QDRA 4DR4M 3HHXA 2LH0A 2V6ZM 1OAOC 2F4VM 3A98B 1SXJE 3B9PA 1N34M 2K9DA 4GHAA 1E32A 2DHRA 3FRHA 2JZ0A 2K47A
chains in the Genus database with same CATH topology
2QCUA 4NOOB 4DR1M 1J7KA 4ZPXA 2L7IA 3GRYA 3HJQA 4IBKA 1DGGA 3HJSA 3U6MA 4JI5M 3FYCA 4NXMM 1H6UA 2KA6B 1N33M 1KYIA 3AOEC 1XC8A 2L7HA 3KSXA 4IBDA 4RF1A 3UMMA 3GLFB 4LFAM 2UU9M 1E9SA 2O5RA 4PCZA 3J81S 3GQ4A 1XMQM 1X37A 3TWKA 3U6CA 3TWMA 3AOEA 3L28A 4R7GA 1TDZA 4OVZA 2LNHC 1G41A 5GKNA 2HKJA 4NL4H 4JV5M 3KOYE 1QAMA 5FTLA 4MM3B 4FCWA 3J27B 2CE7A 2DWLA 3AFHA 4DV6M 3DFZA 4L8RC 3L27A 3CF2A 3GQ5A 1IXZA 4LZZA 3U5ZB 4DUYM 3U6OA 4HLQA 3KFUG 3E4RA 2R18A 1SXJD 3GO8A 2ZBKB 3M6AA 1SXJB 1IN8A 1QZMA 4GKKM 4DR6M 5ITQA 1J09A 4FCVA 1IBMM 3GLIA 1N77A 2J7NA 1Z6TA 2DWMA 1I4WA 2YNMD 1IM2A 4CISA 5DYIA 2C5RA 2M60A 3GPXA 3T38A 3HHWA 2C98A 2Y21A 1QAQA 2Y0TA 4GC5A 1NJGA 5EP3A 3KS4A 4LF4M 2UUCM 4B3SM 5FTKA 4RNAA 4FVMA 4M0WA 4NRWA 4IBEA 5E6JA 4S12A 4G4QA 2XZFA 3GLGA 3HHZA 4JI4M 2CFOA 1R2ZA 4JYAM 2OPFA 3GRVA 3VFDA 4DUZM 1TH2A 1HR0M 4X65M 1IXRC 1QQWA 3L29A 4IJFA 3SC3A 1YSYA 1L2BA 2XZUA 1E9RA 2KRUA 2I7PA 2ZAOA 3W0LB 4LJ5A 1XXHB 2M5ZA 3CF6E 2V1UA 3HJ8A 5EXSA 1K82A 2OQ4A 3WHKA 4Z8XA 1LV7A 3SHGB 1WXQA 4LF9M 3IG8A 3FUXA 1PJJA 2W82A 1E94E 1G3IA 5IZ7D 1IQPA 4LJ6A 1N32M 4L16A 4AZFA 3FUVA 4KLNA 4II7A 1Z59A 3RGSA 4JI1M 2CV2A 4A3VB 5EQTA 3GPPA 4NRVA 3SARA 3ZCBB 3H4MA 4QHTA 1HT1E 3WHLA 5ITXE 3DOAA 2F5SA 2Y0QA 1DGHA 3QAUA 3IG5A 4DV3M 1R2YA 2R46A 2UXBM 2I7NA 3QWLA 3VLFB 1L1ZA 2CHQA 3Q8XA 2UUBM 4OX9M 2RGHA 4L4UA 3R9XB 4AQYM 5F3WA 4JI2M 3KS8A 4FWHA 1DO2A 4LJ4A 1IN4A 1L2CA 2F5PA 4LF5M 4KHPM 4IBCA 4LF7M 2BJWA 3I4VA 3M7GA 4B08A 4JXJA 3J2PB 1HNXM 1NSFA 1EE8A 3VKHA 1ORYB 1S3SA 2KZUA 5FSWA 3HWSA 3GPYA 3VK8A 4LFCM 2RGOA 3SMSA 4AG6A 4PDIA 1Q3BA 3KSJA 2R62A 3GLHB 3LMMA 3FTEA 1FNNA 1HQCA 2KZSA 2ERCA 3FUTA 4DV4M 3CTWB 2QBYA 4FD2A 3HKPA 4DV2M 3I4YA 2DZOB 2R65A 1IN5A 2XSZA 2NQ8C 4K0KM 3FUUA 2QENA 1KFVA 4M9SA 3FUWA 3AOGA 2CHVA 2C96A 5KO3A 3JR5A 2C9CA 3AV0A 4JI8M 1G4AE 2X49A 1OFHA 2FOIC 4W5WA 1Z5CA 2F5OA 4IIWA 4EIWA 2RKOA 3U60A 1MX0A 2FNAA 4B3TM 4HL4A 1TGUA 5FTMA 4PT5A 5FLXS 5EXPA 3PVSA 3CF0A 3NWLA 1IN6A 2ZANA 1FJGM 1G8PA 1NHGC 4BB9A 3A42A 5EP4A 2Z4SA 3GRRA 4OVZB 1TDHA 1IY1A 4MGIE 4LF6M 4QHSA 4MGHA 3M0EA 3GPUA 3PNYA 1XNQM 4JN6A 4DV5M 3KDSE 3MK6A 4LF8M 4DV1M 1IN7A 1NY6A 2C99A 4IBGA 4MGYE 5ITYA 2Q2EB 3A46A 3T15A 4BBAA 4DV7M 1NJFA 3HHYA 1OFIA 3TPZA 1G59A 2YQZA 4FCTA 1K3WA 1HT2E 5EP2A 3UJNA 4NSRA 4TUWA 3VDPA 1R7RA 3FTDA 5EP1A 2DVWB 2FFJA 4G6ZA 3SMPA 5EJCA 1YUBA 4GRIA 1N78A 3AJIB 1ZAEA 1TH4A 4G4NA 2CHGA 1N36M 2UXCM 3J80S 3NBIA 3UK6A 4G4RA 1XMOM 4LG2A 5KQ8A 5IWAM 3U6EA 4ITQA 1QANA 5LMUM 3TL4X 1NHWC 4MH0E 3L26A 2F5QA 4IBFA 4OW0A 3DZDA 2EA0A 3L25A 4MB7A 4GHLA 1JR3A 4DR5M 1NY5A 3SATA 4X66M 3U61A 4KODA 2CUZA 4B3RM 2L6OA 1NVMA 4GH9A 3EIEA 4X62M 3SAVA 2ZAMA 2CV0A 2D7HA 3EIHA 4FWDA 3PNVA 3TQSA 5KPZA 4YHHM 3SFZA 3I51A 3THGA 2HL7A 2KW0A 4IJEA 4I4LA 2ZM6M 4R3DA 4B7HA 2D7EA 2CEAA 4LRTA 5KPRA 1IY0A 2Z7JA 4B7FA 3T1YM 4DR7M 1W5TA 2XEPA 3TWLA 1W5SA 4QNMA 7CATA 1K3XA 1R6BX 3C58A 2KEBA 2KRKA 2XFTA 4REZA 1UM8A 4LGMA 3HU3A 3SYKA 2QZ4A 1DGHB 2A5YB 4LFBM 4D82A 4I5SA 1XHBA 2BNKA 3E9SA 5A2QS 1Z5AA 2Z4RA 3U6PA 1Q3CA 3FD9A 4IBJA 1N75A 4MGKE 4AI6A 3GLFA 1QVRA 3HU1A 1OJLA 5ITTA 2G8LA 3LVWA 3OTOM 2UUAM 3W0FA 2XLJA 3JAMS 4AG5A 5KQDA 4YY3M 2QPAA 1C1KA 4JI3M 5C1BA 4NXNM 2R45A 3T1HM 3SYLA 2XH9A 2G5GX 3FTCA 3TE6A 3SBJA 4IBIA 1I94M 3KOXE 2H1RA 4LZJA 3U5ZA 3U6QA 1NNJA 1GLNA 5LMNM 1SXJC 3FYDA 2VIIA 4LY6A 2YFQA 3U6SA 1QAOA 1VDDA 3LQQA 2XSZD 3VKGA 2CV1A 1SXJA 2UXDM 5E26A 2DXIA 2QBYB 3SAWA 5H37D 3RGPA 4LRSA 4LJ9A 1KSFX 1GL6A 1L8QA 2YR0A 3HU2A 3U6LA 4DV0M 2FE8A 3D8LA 3LVVA 4FW9A 1GVNA 4CGYB 4AKHA 4BLCA 3U60B 3DA1A 5ITUA 1GKIA 2C9OA 2X8AA 5JI3E 3KP0E 4KO8A 2AHMA 2EO2A 1IBKM 2L09A 4JI0M 3ZH9B 5C18A 1XWIA 4L15A 1GL7A 3KVWA 2V1CA 3L2AA 5BPVA 4D80A 5IREB 3VK7A 1TH3A 3ILKA 4XBOA 1D2NA 4PDGA 2J7OA 4MGZE 2DWNA 5BR8M 4GITA 4I8OA 3GLIB 1XXHA 4M9ZA 1XNRM 2X4AA 3R8FA 4GIPA 4LJ8A 2XGNA 5ITRA 4JI6M 4GC9A 2XFSA 3SAUA 3PFIA 4D81A 1DO0A 4OU7A 3KW6A 3GRUA 4RF0A 5KPTA 3JR4A 4LJ7A 3K92A 2F5NA 5FTNA 3FKEA 4G4OA 4DR2M 2VQEM 1T3TA 1DGFA 2XF3A 8CATA 3GLGB 1YE9A 5JI2E 3BOSA 4AKIA 3U6DA 4M9XA 2Y20A 2EUCA 1IY2A 3UGJA 4B3MM 5EXTA 2JA2A 5DYGA 3MHVC 1PM5A 3AKZA 2HHHM 1DGBA 4WW0A 5IT9S 2E5LM 2QP9X 4GMQA 4CHTB 3MJ5A 4AKGA 3RE8A 1J5EM 5EXXA 4FWGA 3SASA 2R4EA 3RFWA 4GKJM 2LXEA 2P5TA 3GQ3A 1HNZM 2BJVA 2D7GA 1JR3D 3KOZE 5DNYA 3AL0C 3J7BA 1IXSB 1NNUC 3LQRA 4NSOB 3VDUA 1Q39A 4B7GA 2VQFM 3FTFA 1HQYE 1MU5A 3K8ZA 4LCBA 4AW4A 3U61B 4DR3M 4L78A 4LJAA 3SHFA 1IBLM 2R4JA 4P16A 2DWZB 1L1TA 4IBBA 3GLHA 4X64M 3A45A 1ZQ9A 1QYRA 4M0DA 3PXGA 3UZUA 4PD2A 2KXEA 3D8BA 3KOWE 3KP1E 2LWXA 4Z6YA 2Z3XA 1PJIA 4QNRA 4JI7M 4I81A 3J7AS 4LGYA 4WURA 1JQJC 4XGIA 3KXEC 3K2LA 2HCBA 5ITXA 2DZNB 1Z5BA 3HGIA 1HNWM 3ZC7B 5FTJA 3K1JA 1L2DA 4QOZC 3GP1A 4QOSA 4DR4M 3HHXA 2LH0A 2V6ZM 2F4VM 3A98B 1SXJE 3B9PA 1N34M 4GHAA 1E32A 2DHRA 2K47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J2P B;  5IRE B;  5IZ7 D;  3J27 B;  5H37 D; 
#chains in the Genus database with same CATH topology
 2QCU A;  1MJG M;  1OAI A;  4NOO B;  2L4E A;  1PJQ A;  4DR1 M;  1J7K A;  4ZPX A;  2L7I A;  3GRY A;  3HJQ A;  4IBK A;  1DGG A;  3HJS A;  3U6M A;  4JI5 M;  3FYC A;  4NXM M;  1H6U A;  2KA6 B;  1N33 M;  1KYI A;  1TF0 B;  3AOE C;  1XC8 A;  2L7H A;  3KSX A;  2DI0 A;  3CGW A;  2BWE A;  4IBD A;  4RF1 A;  4LFA M;  1E9S A;  2GNO A;  2O5R A;  4PCZ A;  3J81 S;  3GQ4 A;  1XMQ M;  2UU9 M;  1X37 A;  3TWK A;  3U6C A;  3TWM A;  1MN3 A;  1A5T A;  2WSC F;  3AOE A;  3L28 A;  4R7G A;  1ZMV A;  1TDZ A;  4OVZ A;  1TTE A;  2LNH C;  1Y8G A;  2DAK A;  1G41 A;  5GKN A;  2HKJ A;  3HY5 A;  4NL4 H;  2LHC A;  4JV5 M;  3KOY E;  1QAM A;  5FTL A;  4MM3 B;  4FCW A;  2LTU A;  3J27 B;  2CE7 A;  2DWL A;  4NC6 A;  3AFH A;  4DV6 M;  1ZMU A;  3DFZ A;  4L8R C;  3L27 A;  3CF2 A;  3GQ5 A;  1IXZ A;  4LZZ A;  3U5Z B;  1XXH E;  1RU3 A;  4G3O A;  2K6B A;  4DUY M;  3U6O A;  4HLQ A;  3KFU G;  3E4R A;  2R18 A;  1SXJ D;  3GO8 A;  2KNV A;  2ZBK B;  3IEC A;  3M6A A;  1SXJ B;  1IN8 A;  1QZM A;  1T6O A;  4GKK M;  4DR6 M;  2LVO C;  5ITQ A;  1J09 A;  4FCV A;  1IBM M;  4P17 A;  3GLI A;  1N77 A;  2J7N A;  1Z6T A;  3C3D A;  1I4W A;  2YNM D;  2DWM A;  1IM2 A;  4CIS A;  5DYI A;  2C5R A;  2G3Q A;  2M60 A;  2R0I A;  3T38 A;  3GPX A;  3HHW A;  2C98 A;  2Y21 A;  1QAQ A;  1WR1 B;  1NO1 A;  1OIP A;  2Y0T A;  4GC5 A;  1NJG A;  5EP3 A;  3KS4 A;  4LF4 M;  2UUC M;  4B3S M;  5FTK A;  4RNA A;  4FVM A;  4M0W A;  4NRW A;  4IBE A;  5E6J A;  4S12 A;  4G4Q A;  2XZF A;  3GLG A;  3HHZ A;  4JI4 M;  2CFO A;  1R2Z A;  2OO9 A;  4JYA M;  1PGY A;  2OPF A;  3GRV A;  3VFD A;  4DUZ M;  1TH2 A;  1D0L A;  4GEW A;  1HR0 M;  4X65 M;  2EKF A;  1IXR C;  1QQW A;  3L29 A;  4IJF A;  3SC3 A;  1YSY A;  1L2B A;  2XZU A;  1E9R A;  2DAI A;  3GLF B;  2KRU A;  2I7P A;  2ZAO A;  3W0L B;  4LJ5 A;  1XXH B;  2M5Z A;  3CF6 E;  2V1U A;  3HJ8 A;  5EXS A;  1K82 A;  2OQ4 A;  3WHK A;  4Z8X A;  1LV7 A;  3SHG B;  1WXQ A;  4LF9 M;  1GJS A;  3IG8 A;  3FUX A;  1PJJ A;  2W82 A;  1E94 E;  1G3I A;  5IZ7 D;  3LW5 F;  1IQP A;  4LJ6 A;  1N32 M;  1IXS A;  4L16 A;  4AZF A;  3FUV A;  2DAE A;  3GLH E;  4II7 A;  4KLN A;  1Z59 A;  1Q02 A;  3RGS A;  3E46 A;  3W67 A;  4JI1 M;  2CV2 A;  4CJ6 A;  1GJT A;  4A3V B;  5EQT A;  3GPP A;  4NRV A;  3SAR A;  3ZCB B;  3H4M A;  4QHT A;  1HT1 E;  3WHL A;  5ITX E;  3DOA A;  2F5S A;  1AIP C;  2Y0Q A;  1DGH A;  3QAU A;  3IG5 A;  4DV3 M;  1R2Y A;  2R46 A;  2UXB M;  2I7N A;  3QWL A;  3VLF B;  2CP8 A;  2L2D A;  2CHQ A;  3HZJ A;  3Q8X A;  4WP2 A;  3B74 A;  1L1Z A;  2UUB M;  2RGH A;  4OX9 M;  4L4U A;  3R9X B;  4AQY M;  5F3W A;  4JI2 M;  3KS8 A;  4FWH A;  1DO2 A;  3MMP A;  4LJ4 A;  1IN4 A;  1L2C A;  2F5P A;  4LF5 M;  4KHP M;  4IBC A;  2RRU A;  1WGL A;  4LF7 M;  2BJW A;  1NV8 A;  1PJT A;  3I4V A;  3M7G A;  4JXJ A;  4B08 A;  3J2P B;  1HNX M;  1NSF A;  1EE8 A;  2EJS A;  3JR4 A;  3VKH A;  1ORY B;  1S3S A;  2KZU A;  5FSW A;  1TR8 A;  3HWS A;  3GPY A;  3VK8 A;  4LFC M;  2RGO A;  3SMS A;  3ZQJ A;  4AG6 A;  4PDI A;  1Q3B A;  3KSJ A;  2R62 A;  3GLH B;  3LMM A;  1AUA A;  3FTE A;  1FNN A;  1HQC A;  2KZS A;  1LTM A;  2ERC A;  3FUT A;  3E21 A;  4DV4 M;  2JXN A;  3CTW B;  2QBY A;  2DEN A;  4FD2 A;  3HKP A;  4DV2 M;  3I4Y A;  2DZO B;  2R65 A;  1IN5 A;  1R5L A;  1GO5 A;  2XSZ A;  2NQ8 C;  4K0K M;  2KDL A;  2MRO B;  3FUU A;  2QEN A;  1UFZ A;  1KFV A;  4M9S A;  3FUW A;  3AOG A;  2CHV A;  1IFY A;  2C96 A;  5KO3 A;  2JNH A;  3JR5 A;  2C9C A;  3AV0 A;  4JI8 M;  1G4A E;  1WGN A;  1OFH A;  2FOI C;  1BVS A;  2X49 A;  4W5W A;  1Z5C A;  1QUT A;  3HX3 A;  2F5O A;  4IIW A;  1PRB A;  1EIJ A;  4EIW A;  2RKO A;  2QSF X;  1MX0 A;  3U60 A;  1VDL A;  2FNA A;  3GLI E;  4B3T M;  4HL4 A;  1D0K A;  1R4G A;  1TGU A;  4PT5 A;  5FTM A;  5FLX S;  5EXP A;  2MGW A;  3PVS A;  1ZV1 A;  3CF0 A;  3NWL A;  2CRU A;  1GAB A;  1IN6 A;  2OOA A;  2ZAN A;  1FJG M;  1G8P A;  1NHG C;  3K9O A;  2L4F A;  2DAG A;  1VEG A;  3A42 A;  4BB9 A;  5EP4 A;  4RKU F;  2Z4S A;  3GRR A;  4OVZ B;  1TDH A;  1V92 A;  1IY1 A;  4MGI E;  3GLG E;  4LF6 M;  4QHS A;  4MGH A;  2Z8Y M;  3M0E A;  3GPU A;  3PNY A;  4F1I A;  4JN6 A;  4DV5 M;  1XNQ M;  3KDS E;  3MK6 A;  3K9P A;  4LF8 M;  4DV1 M;  1IN7 A;  1NY6 A;  2C99 A;  4IBG A;  4MGY E;  5ITY A;  2Q2E B;  1VEJ A;  3A46 A;  3T15 A;  4BBA A;  4DV7 M;  1NJF A;  3HHY A;  1OFI A;  3TPZ A;  1G59 A;  1F4I A;  2YQZ A;  4FCT A;  1K3W A;  1HT2 E;  5EP2 A;  3UJN A;  4NSR A;  4TUW A;  3VDP A;  1WHC A;  1R7R A;  3FTD A;  1OKS A;  5EP1 A;  2DVW B;  2FFJ A;  4G6Z A;  3SMP A;  5EJC A;  1YUB A;  4GRI A;  1N78 A;  2MH8 A;  2J5Y A;  2B3T A;  3AJI B;  1QUS A;  1ZAE A;  1TH4 A;  4G4N A;  2CHG A;  1N36 M;  2LVA A;  2UXC M;  3J80 S;  3NBI A;  3UK6 A;  4G4R A;  1XMO M;  1SG9 A;  3F92 A;  5KQ8 A;  4LG2 A;  5IWA M;  3U6E A;  4ITQ A;  1QAN A;  5LMU M;  3TL4 X;  1NHW C;  4MH0 E;  2VF7 A;  2BWB A;  3L26 A;  2F5Q A;  4IBF A;  4OW0 A;  3DZD A;  2FS1 A;  2EA0 A;  4MB7 A;  3L25 A;  4GHL A;  1JR3 A;  4DR5 M;  3LCU A;  1CUK A;  1NY5 A;  2O25 A;  3SAT A;  4X66 M;  3U61 A;  4KOD A;  4OU7 A;  2CUZ A;  4B3R M;  2L6O A;  1NVM A;  4GH9 A;  3EIE A;  1OQY A;  2HAK A;  4X62 M;  3SAV A;  2ZAM A;  2CV0 A;  2D7H A;  3EIH A;  4FWD A;  2LBC A;  2LVQ D;  2KNA A;  3PNV A;  1PJS A;  3TQS A;  4KT0 F;  5KPZ A;  4YHH M;  3SFZ A;  3I51 A;  3THG A;  2HL7 A;  2KW0 A;  3LCV B;  4IJE A;  4I4L A;  3W68 A;  2ZM6 M;  4R3D A;  2K0B X;  1P3Q Q;  4B7H A;  2D7E A;  2CEA A;  4LRT A;  5KPR A;  1IY0 A;  3IHP A;  2Z7J A;  4B7F A;  3T1Y M;  4DR7 M;  1W5T A;  2XEP A;  3TWL A;  1W5S A;  4QNM A;  3FE3 A;  7CAT A;  1R6B X;  1K3X A;  3C58 A;  2KEB A;  2KRK A;  2XFT A;  3NBX X;  1UM8 A;  4REZ A;  4LGM A;  3HU3 A;  3SYK A;  2QZ4 A;  1DGH B;  2A5Y B;  4F2L A;  2DHY A;  2LHG A;  2JP7 A;  4LFB M;  1DV0 A;  2GQF A;  4D82 A;  4I5S A;  1XHB A;  2BNK A;  3B7N A;  3E9S A;  5A2Q S;  2VF8 A;  1C7Y A;  2QHO B;  1Z5A A;  2Z4R A;  3U6P A;  1Q3C A;  3FD9 A;  4IBJ A;  1N75 A;  4MGK E;  4AI6 A;  2QNJ A;  3GLF A;  2JY5 A;  1QVR A;  3HU1 A;  4UN2 B;  2DAM A;  1OJL A;  5ITT A;  2G8L A;  2VDB B;  3I04 M;  3LVW A;  3OTO M;  2UUA M;  3W0F A;  1D0M A;  2N35 A;  2XLJ A;  3JAM S;  4AG5 A;  5KQD A;  4R71 A;  2EKK A;  4YY3 M;  2QPA A;  1C1K A;  1VQ1 A;  4JI3 M;  1EFU B;  5C1B A;  1WJ7 A;  4NXN M;  2R45 A;  3T1H M;  3SYL A;  2O01 F;  2XH9 A;  2G5G X;  2JUJ A;  3FTC A;  3TE6 A;  3SBJ A;  4IBI A;  2JY7 A;  1I94 M;  3KOX E;  2H1R A;  2JZ1 A;  4LZJ A;  3U5Z A;  3U6Q A;  1NNJ A;  1GLN A;  5LMN M;  1SXJ C;  3FYD A;  2VII A;  4LY6 A;  2YFQ A;  3U6S A;  2QQ8 A;  1QAO A;  1VDD A;  1YLA A;  3LQQ A;  2XSZ D;  3VKG A;  2CV1 A;  1SXJ A;  2WSE F;  2UXD M;  5E26 A;  2DXI A;  2QBY B;  2FH0 A;  3SAW A;  5H37 D;  3RGP A;  4LRS A;  2H5X A;  4LJ9 A;  1KSF X;  2HWJ A;  1GL6 A;  1L8Q A;  2YR0 A;  3HU2 A;  3U6L A;  4DV0 M;  2FE8 A;  3D8L A;  3LVV A;  4FW9 A;  1GVN A;  1OTR A;  4CGY B;  4AKH A;  2KNZ A;  1G71 A;  4BLC A;  3U60 B;  3DA1 A;  5ITU A;  1GKI A;  2C9O A;  2X8A A;  5JI3 E;  3KP0 E;  2CWB A;  4KO8 A;  2AHM A;  2EO2 A;  1NV9 A;  1IBK M;  2L09 A;  4JI0 M;  3ZH9 B;  5C18 A;  1XWI A;  4L15 A;  1GL7 A;  3KVW A;  2V1C A;  1OIZ A;  3L2A A;  4D80 A;  5IRE B;  3B7Z A;  5BPV A;  2R6F A;  1TH3 A;  3VK7 A;  3ILK A;  4L6V 6;  1D2N A;  4XBO A;  2J7O A;  4MGZ E;  4PDG A;  5BR8 M;  4GIT A;  4I8O A;  3GLI B;  3B89 A;  1XXH A;  2DWN A;  3I01 M;  4M9Z A;  1JR3 E;  1XNR M;  2X4A A;  3R8F A;  4GIP A;  3V76 A;  2APL A;  4LJ8 A;  2XGN A;  5ITR A;  2MR9 A;  3QYB A;  4JI6 M;  1QDT A;  4GC9 A;  2XFS A;  3SAU A;  3PFI A;  4D81 A;  1DO0 A;  3QYE A;  2WSF F;  3GRU A;  3BXW A;  3KW6 A;  4HEO A;  4LJ7 A;  3K92 A;  4RF0 A;  5KPT A;  2F5N A;  5FTN A;  4XK8 F;  3FKE A;  4G4O A;  4DR2 M;  2VQE M;  1T3T A;  1DGF A;  2XF3 A;  8CAT A;  3GLG B;  1YE9 A;  5JI2 E;  3BOS A;  4AKI A;  3U6D A;  2LVP C;  4DBG B;  1WIV A;  3Q8G A;  5L8R F;  2LVN C;  4M9X A;  2Y20 A;  1HJP A;  2EUC A;  1IY2 A;  2OOB A;  3UGJ A;  4B3M M;  5EXT A;  2JA2 A;  1V33 A;  5DYG A;  2R44 A;  3MHV C;  1PM5 A;  3AKZ A;  2HHH M;  1DGB A;  2KHH A;  4WW0 A;  5IT9 S;  2DZL A;  2E5L M;  2QP9 X;  4GMQ A;  4CHT B;  3MJ5 A;  4AKG A;  2WZJ A;  3RE8 A;  3C9P A;  1J5E M;  5EXX A;  1VG5 A;  4FWG A;  3SAS A;  2JWS A;  2R4E A;  1ZMW A;  2DKL A;  3RFW A;  3FRI A;  4GKJ M;  1T43 A;  2LXE A;  2P5T A;  3GQ3 A;  4Q7J A;  1HNZ M;  2BJV A;  2D7G A;  1V34 A;  1JR3 D;  3KOZ E;  2ZTC A;  5DNY A;  3J7B A;  3AL0 C;  1IXS B;  1NNU C;  3LQR A;  4CIZ A;  4NSO B;  3VDU A;  1Q39 A;  4B7G A;  2VQF M;  3FTF A;  1HQY E;  1MU5 A;  3K8Z A;  4LCB A;  4AW4 A;  3U61 B;  4DR3 M;  3UMM A;  4L78 A;  4LJA A;  2JY6 B;  3SHF A;  3GLF E;  1IBL M;  2R4J A;  2DNA A;  4P16 A;  2DWZ B;  4Y28 F;  1L1T A;  3C3E A;  4IBB A;  3GLH A;  4X64 M;  3A45 A;  1ZQ9 A;  1QYR A;  3B7Q A;  4M0D A;  3PXG A;  3UZU A;  2JY8 A;  4ANR A;  4PD2 A;  2KXE A;  1JB0 F;  2MJ5 B;  3D8B A;  2LWX A;  3KOW E;  3KP1 E;  4Z6Y A;  2Z3X A;  1PJI A;  4QNR A;  4JI7 M;  4I81 A;  3J7A S;  4LGY A;  5DFL A;  1QZE A;  1XB2 B;  4WUR A;  1JQJ C;  4XGI A;  3KXE C;  3K2L A;  3H4J A;  2HCB A;  5ITX A;  1VEK A;  2DZN B;  1Z5B A;  3HGI A;  3T6P A;  1HNW M;  3ZC7 B;  5FTJ A;  3K1J A;  1L2D A;  3BBZ A;  4QOZ C;  2ZTD A;  3GP1 A;  4QOS A;  1QDR A;  4DR4 M;  3HHX A;  2LH0 A;  2V6Z M;  1OAO C;  2F4V M;  3A98 B;  1SXJ E;  3B9P A;  1N34 M;  2K9D A;  4GHA A;  1E32 A;  2DHR A;  3FRH A;  2JZ0 A;  2K47 A; 
#chains in the Genus database with same CATH homology
 2QCU A;  4NOO B;  4DR1 M;  1J7K A;  4ZPX A;  2L7I A;  3GRY A;  3HJQ A;  4IBK A;  1DGG A;  3HJS A;  3U6M A;  4JI5 M;  3FYC A;  4NXM M;  1H6U A;  2KA6 B;  1N33 M;  1KYI A;  3AOE C;  1XC8 A;  2L7H A;  3KSX A;  4IBD A;  4RF1 A;  3UMM A;  3GLF B;  4LFA M;  2UU9 M;  1E9S A;  2O5R A;  4PCZ A;  3J81 S;  3GQ4 A;  1XMQ M;  1X37 A;  3TWK A;  3U6C A;  3TWM A;  3AOE A;  3L28 A;  4R7G A;  1TDZ A;  4OVZ A;  2LNH C;  1G41 A;  5GKN A;  2HKJ A;  4NL4 H;  4JV5 M;  3KOY E;  1QAM A;  5FTL A;  4MM3 B;  4FCW A;  3J27 B;  2CE7 A;  2DWL A;  3AFH A;  4DV6 M;  3DFZ A;  4L8R C;  3L27 A;  3CF2 A;  3GQ5 A;  1IXZ A;  4LZZ A;  3U5Z B;  4DUY M;  3U6O A;  4HLQ A;  3KFU G;  3E4R A;  2R18 A;  1SXJ D;  3GO8 A;  2ZBK B;  3M6A A;  1SXJ B;  1IN8 A;  1QZM A;  4GKK M;  4DR6 M;  5ITQ A;  1J09 A;  4FCV A;  1IBM M;  3GLI A;  1N77 A;  2J7N A;  1Z6T A;  2DWM A;  1I4W A;  2YNM D;  1IM2 A;  4CIS A;  5DYI A;  2C5R A;  2M60 A;  3GPX A;  3T38 A;  3HHW A;  2C98 A;  2Y21 A;  1QAQ A;  2Y0T A;  4GC5 A;  1NJG A;  5EP3 A;  3KS4 A;  4LF4 M;  2UUC M;  4B3S M;  5FTK A;  4RNA A;  4FVM A;  4M0W A;  4NRW A;  4IBE A;  5E6J A;  4S12 A;  4G4Q A;  2XZF A;  3GLG A;  3HHZ A;  4JI4 M;  2CFO A;  1R2Z A;  4JYA M;  2OPF A;  3GRV A;  3VFD A;  4DUZ M;  1TH2 A;  1HR0 M;  4X65 M;  1IXR C;  1QQW A;  3L29 A;  4IJF A;  3SC3 A;  1YSY A;  1L2B A;  2XZU A;  1E9R A;  2KRU A;  2I7P A;  2ZAO A;  3W0L B;  4LJ5 A;  1XXH B;  2M5Z A;  3CF6 E;  2V1U A;  3HJ8 A;  5EXS A;  1K82 A;  2OQ4 A;  3WHK A;  4Z8X A;  1LV7 A;  3SHG B;  1WXQ A;  4LF9 M;  3IG8 A;  3FUX A;  1PJJ A;  2W82 A;  1E94 E;  1G3I A;  5IZ7 D;  1IQP A;  4LJ6 A;  1N32 M;  4L16 A;  4AZF A;  3FUV A;  4KLN A;  4II7 A;  1Z59 A;  3RGS A;  4JI1 M;  2CV2 A;  4A3V B;  5EQT A;  3GPP A;  4NRV A;  3SAR A;  3ZCB B;  3H4M A;  4QHT A;  1HT1 E;  3WHL A;  5ITX E;  3DOA A;  2F5S A;  2Y0Q A;  1DGH A;  3QAU A;  3IG5 A;  4DV3 M;  1R2Y A;  2R46 A;  2UXB M;  2I7N A;  3QWL A;  3VLF B;  1L1Z A;  2CHQ A;  3Q8X A;  2UUB M;  4OX9 M;  2RGH A;  4L4U A;  3R9X B;  4AQY M;  5F3W A;  4JI2 M;  3KS8 A;  4FWH A;  1DO2 A;  4LJ4 A;  1IN4 A;  1L2C A;  2F5P A;  4LF5 M;  4KHP M;  4IBC A;  4LF7 M;  2BJW A;  3I4V A;  3M7G A;  4B08 A;  4JXJ A;  3J2P B;  1HNX M;  1NSF A;  1EE8 A;  3VKH A;  1ORY B;  1S3S A;  2KZU A;  5FSW A;  3HWS A;  3GPY A;  3VK8 A;  4LFC M;  2RGO A;  3SMS A;  4AG6 A;  4PDI A;  1Q3B A;  3KSJ A;  2R62 A;  3GLH B;  3LMM A;  3FTE A;  1FNN A;  1HQC A;  2KZS A;  2ERC A;  3FUT A;  4DV4 M;  3CTW B;  2QBY A;  4FD2 A;  3HKP A;  4DV2 M;  3I4Y A;  2DZO B;  2R65 A;  1IN5 A;  2XSZ A;  2NQ8 C;  4K0K M;  3FUU A;  2QEN A;  1KFV A;  4M9S A;  3FUW A;  3AOG A;  2CHV A;  2C96 A;  5KO3 A;  3JR5 A;  2C9C A;  3AV0 A;  4JI8 M;  1G4A E;  2X49 A;  1OFH A;  2FOI C;  4W5W A;  1Z5C A;  2F5O A;  4IIW A;  4EIW A;  2RKO A;  3U60 A;  1MX0 A;  2FNA A;  4B3T M;  4HL4 A;  1TGU A;  5FTM A;  4PT5 A;  5FLX S;  5EXP A;  3PVS A;  3CF0 A;  3NWL A;  1IN6 A;  2ZAN A;  1FJG M;  1G8P A;  1NHG C;  4BB9 A;  3A42 A;  5EP4 A;  2Z4S A;  3GRR A;  4OVZ B;  1TDH A;  1IY1 A;  4MGI E;  4LF6 M;  4QHS A;  4MGH A;  3M0E A;  3GPU A;  3PNY A;  1XNQ M;  4JN6 A;  4DV5 M;  3KDS E;  3MK6 A;  4LF8 M;  4DV1 M;  1IN7 A;  1NY6 A;  2C99 A;  4IBG A;  4MGY E;  5ITY A;  2Q2E B;  3A46 A;  3T15 A;  4BBA A;  4DV7 M;  1NJF A;  3HHY A;  1OFI A;  3TPZ A;  1G59 A;  2YQZ A;  4FCT A;  1K3W A;  1HT2 E;  5EP2 A;  3UJN A;  4NSR A;  4TUW A;  3VDP A;  1R7R A;  3FTD A;  5EP1 A;  2DVW B;  2FFJ A;  4G6Z A;  3SMP A;  5EJC A;  1YUB A;  4GRI A;  1N78 A;  3AJI B;  1ZAE A;  1TH4 A;  4G4N A;  2CHG A;  1N36 M;  2UXC M;  3J80 S;  3NBI A;  3UK6 A;  4G4R A;  1XMO M;  4LG2 A;  5KQ8 A;  5IWA M;  3U6E A;  4ITQ A;  1QAN A;  5LMU M;  3TL4 X;  1NHW C;  4MH0 E;  3L26 A;  2F5Q A;  4IBF A;  4OW0 A;  3DZD A;  2EA0 A;  3L25 A;  4MB7 A;  4GHL A;  1JR3 A;  4DR5 M;  1NY5 A;  3SAT A;  4X66 M;  3U61 A;  4KOD A;  2CUZ A;  4B3R M;  2L6O A;  1NVM A;  4GH9 A;  3EIE A;  4X62 M;  3SAV A;  2ZAM A;  2CV0 A;  2D7H A;  3EIH A;  4FWD A;  3PNV A;  3TQS A;  5KPZ A;  4YHH M;  3SFZ A;  3I51 A;  3THG A;  2HL7 A;  2KW0 A;  4IJE A;  4I4L A;  2ZM6 M;  4R3D A;  4B7H A;  2D7E A;  2CEA A;  4LRT A;  5KPR A;  1IY0 A;  2Z7J A;  4B7F A;  3T1Y M;  4DR7 M;  1W5T A;  2XEP A;  3TWL A;  1W5S A;  4QNM A;  7CAT A;  1K3X A;  1R6B X;  3C58 A;  2KEB A;  2KRK A;  2XFT A;  4REZ A;  1UM8 A;  4LGM A;  3HU3 A;  3SYK A;  2QZ4 A;  1DGH B;  2A5Y B;  4LFB M;  4D82 A;  4I5S A;  1XHB A;  2BNK A;  3E9S A;  5A2Q S;  1Z5A A;  2Z4R A;  3U6P A;  1Q3C A;  3FD9 A;  4IBJ A;  1N75 A;  4MGK E;  4AI6 A;  3GLF A;  1QVR A;  3HU1 A;  1OJL A;  5ITT A;  2G8L A;  3LVW A;  3OTO M;  2UUA M;  3W0F A;  2XLJ A;  3JAM S;  4AG5 A;  5KQD A;  4YY3 M;  2QPA A;  1C1K A;  4JI3 M;  5C1B A;  4NXN M;  2R45 A;  3T1H M;  3SYL A;  2XH9 A;  2G5G X;  3FTC A;  3TE6 A;  3SBJ A;  4IBI A;  1I94 M;  3KOX E;  2H1R A;  4LZJ A;  3U5Z A;  3U6Q A;  1NNJ A;  1GLN A;  5LMN M;  1SXJ C;  3FYD A;  2VII A;  4LY6 A;  2YFQ A;  3U6S A;  1QAO A;  1VDD A;  3LQQ A;  2XSZ D;  3VKG A;  2CV1 A;  1SXJ A;  2UXD M;  5E26 A;  2DXI A;  2QBY B;  3SAW A;  5H37 D;  3RGP A;  4LRS A;  4LJ9 A;  1KSF X;  1GL6 A;  1L8Q A;  2YR0 A;  3HU2 A;  3U6L A;  4DV0 M;  2FE8 A;  3D8L A;  3LVV A;  4FW9 A;  1GVN A;  4CGY B;  4AKH A;  4BLC A;  3U60 B;  3DA1 A;  5ITU A;  1GKI A;  2C9O A;  2X8A A;  5JI3 E;  3KP0 E;  4KO8 A;  2AHM A;  2EO2 A;  1IBK M;  2L09 A;  4JI0 M;  3ZH9 B;  5C18 A;  1XWI A;  4L15 A;  1GL7 A;  3KVW A;  2V1C A;  3L2A A;  5BPV A;  4D80 A;  5IRE B;  3VK7 A;  1TH3 A;  3ILK A;  4XBO A;  1D2N A;  4PDG A;  2J7O A;  4MGZ E;  2DWN A;  5BR8 M;  4GIT A;  4I8O A;  3GLI B;  1XXH A;  4M9Z A;  1XNR M;  2X4A A;  3R8F A;  4GIP A;  4LJ8 A;  2XGN A;  5ITR A;  4JI6 M;  4GC9 A;  2XFS A;  3SAU A;  3PFI A;  4D81 A;  1DO0 A;  4OU7 A;  3KW6 A;  3GRU A;  4RF0 A;  5KPT A;  3JR4 A;  4LJ7 A;  3K92 A;  2F5N A;  5FTN A;  3FKE A;  4G4O A;  4DR2 M;  2VQE M;  1T3T A;  1DGF A;  2XF3 A;  8CAT A;  3GLG B;  1YE9 A;  5JI2 E;  3BOS A;  4AKI A;  3U6D A;  4M9X A;  2Y20 A;  2EUC A;  1IY2 A;  3UGJ A;  4B3M M;  5EXT A;  2JA2 A;  5DYG A;  3MHV C;  1PM5 A;  3AKZ A;  2HHH M;  1DGB A;  4WW0 A;  5IT9 S;  2E5L M;  2QP9 X;  4GMQ A;  4CHT B;  3MJ5 A;  4AKG A;  3RE8 A;  1J5E M;  5EXX A;  4FWG A;  3SAS A;  2R4E A;  3RFW A;  4GKJ M;  2LXE A;  2P5T A;  3GQ3 A;  1HNZ M;  2BJV A;  2D7G A;  1JR3 D;  3KOZ E;  5DNY A;  3AL0 C;  3J7B A;  1IXS B;  1NNU C;  3LQR A;  4NSO B;  3VDU A;  1Q39 A;  4B7G A;  2VQF M;  3FTF A;  1HQY E;  1MU5 A;  3K8Z A;  4LCB A;  4AW4 A;  3U61 B;  4DR3 M;  4L78 A;  4LJA A;  3SHF A;  1IBL M;  2R4J A;  4P16 A;  2DWZ B;  1L1T A;  4IBB A;  3GLH A;  4X64 M;  3A45 A;  1ZQ9 A;  1QYR A;  4M0D A;  3PXG A;  3UZU A;  4PD2 A;  2KXE A;  3D8B A;  3KOW E;  3KP1 E;  2LWX A;  4Z6Y A;  2Z3X A;  1PJI A;  4QNR A;  4JI7 M;  4I81 A;  3J7A S;  4LGY A;  4WUR A;  1JQJ C;  4XGI A;  3KXE C;  3K2L A;  2HCB A;  5ITX A;  2DZN B;  1Z5B A;  3HGI A;  1HNW M;  3ZC7 B;  5FTJ A;  3K1J A;  1L2D A;  4QOZ C;  3GP1 A;  4QOS A;  4DR4 M;  3HHX A;  2LH0 A;  2V6Z M;  2F4V M;  3A98 B;  1SXJ E;  3B9P A;  1N34 M;  4GHA A;  1E32 A;  2DHR A;  2K47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...