1D0MA

The escherichia coli lytic transglycosylase slt35 in complex with bulgecin a and (glcnac)2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
322
structure length
312
Chain Sequence
b'MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
molecule tags Transferase
source organism Escherichia coli
publication title Crystallographic studies of the interactions of Escherichia coli lytic transglycosylase Slt35 with peptidoglycan.
pubmed doi rcsb
total genus 110
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1d0mA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1d0mA02
4LT0A 3TXIA 1VDSA 3TXKA 2Z2EA 3IJUA 3VWOA 1IOQA 3TXDA 1FKVA 3LYTA 2N5ZA 5ILFA 1T3PA 1YAPA 2IHLA 3WXTA 1UBZA 2YBJA 4IJ4A 2GV0A 2BQHA 3P4ZA 5APFA 1IC7Y 1C10A 5JENB 3W3EA 4WG7A 1UIBA 1LJNA 1NDGC 2BQEA 2PC2A 4PPOA 4OW1A 5KKIA 4ANRA 1GWDA 1OP9B 5APCA 1QIOA 4HV1A 4H9BA 1DKJA 4N9RA 3LZ2A 4H9CA 1RFPA 4Z46A 5C6IA 2W1YA 3P64A 1RE2A 4NSGA 3J6KA 3TXJA 4H93A 1IP2A 2MEFA 2LYMA 4QY9A 5J7CA 8LYZA 4H8YA 1JKCA 2MEAA 4H9EA 4H8XA 4XENA 4OWEA 1JHLA 1GAYA 3P65A 3ZVQA 3WPJA 4NWEA 1LHJA 1NBYC 1YL1X 4Z98A 1UIHA 1J1XY 3WXUA 4DDAA 1LJKA 4WL7A 4G4HA 3B0OA 1J1OY 1GE0A 3W6AA 1A2YC 4QEQA 3F6ZA 1QUTA 2DQEY 3HBHA 1YIKA 1EQ4A 2MEEA 2YDGA 3WMKA 3TMWA 2WARA 1UIEA 1LHMA 4HSFA 1WQNA 5L3IA 1JJ3A 2CJLA 4B49A 2F4GA 1QUSA 4WLDA 5I4WA 1IP3A 5E4PA 4N5RA 4I0CA 4MR1A 4YM8A 1XGPC 2ZYPA 5HMJA 1LJFA 4LYTA 1LMTA 1BWHA 4HTKA 4Z41A 3BKVA 1YANA 1LHLA 1YKXX 2Z19A 1LSZA 1ZMYL 4G49A 4WOAA 1NQIA 3WPLA 2DQDY 4WO9A 2MEIA 5LA5A 3AGIA 2Y8PA 3GXRA 1MLCE 3ATNA 3T6UA 3AGGG 1LSYA 3B72A 1FN5A 4PJ2C 2X0AA 1GBOA 5KXOA 2HEBA 2VB1A 2DQJY 3LYMA 4GN3A 1RCMA 1IEEA 4OOTA 2BQGA 4KXIA 4LFPA 4NGYA 4XADA 3WVYA 1LSNA 1LSCA 3WH1A 5KXYA 4NSIA 1GE3A 1B2KA 4OWCA 5I54A 1IWVA 1HFYA 2FYDA 1NBZC 4WLXA 1G7JC 3TMXA 1JTPL 1LKRA 4B4EA 5KXXA 1DQJC 1LSPA 1DXJA 3A94A 2XBRA 1IY3A 1VATA 4ETEA 1CJ6A 1NMMA 1LMNA 1GF0A 2LYZA 5M1YA 3J4GA 3ATOA 2DQHY 132LA 3WU7A 5KKJA 5F9XA 1B5ZA 2MEGA 3A8ZA 1LZNA 3WW6A 1IORA 3WUAA 1UCOA 1LMQA 5C6JA 4LT2A 4UWNA 1KXWA 2H5ZA 3CSQA 4LT3A 1TDYA 5ILCA 1IWXA 1KIPC 1LSEA 1IWZA 1WTMA 1LMAA 4DT3A 1GE2A 2EKSC 1VEDA 3G3AB 3WUMA 3CB7A 4YENA 1LZAA 5APDA 3RT5X 4ZEEA 4G9SA 1GF9A 2DBTA 3A3QA 4RLNA 2FBDA 5EBHA 1LZ1A 1LTMA 1W08A 1G7MC 2ZQ3A 3IJVA 1XGQC 1D6PA 3LHMA 1CJ8A 3HFMY 4H1PA 1IWUA 5LINA 5LVIA 2ZNXY 4MSTA 1IP5A 4I8SA 2Q0MX 4LT1A 4ETBA 2HU1A 1GFHA 1HELA 5KXPA 5KXZA 5IHGA 1BVXA 133LA 3HBEX 4GCCA 1KXYA 1OUFA 3LYZA 5B06A 5LA8A 5LIOA 1BQLY 1ZV5L 2D4IA 2CWIA 4HPIA 4NIJA 1WQOA 1HMKA 4RLMA 1JJ0A 3ULRA 1GF8A 2YVBA 3E3DA 5LVKA 4N1CC 1UIAA 5B05A 1CNSA 1LHHA 4NGLA 4YOPA 4OWBA 1FLQA 2BQOA 1JTOL 1HENA 2XJWA 3A91A 1B7MA 5KXKA 2Z18A 1QSAA 3T36A 1FLWA 3KAMA 1GFUA 2FYCA 2ZIKA 4II8A 5A3ZA 3AZ7A 1BHZA 4QGZA 4B1AA 2C8PA 2XTHA 1QTKA 1BVKC 1HFXA 1LZEA 1RI8B 1Z55A 1GF7A 2BQDA 2Z2FA 4H92A 4CFOA 5HQ1A 1GBZA 1GFAA 3D3DA 154LA 3P66A 4N8ZA 1B7RA 2I26L 1DPXA 1LZSA 1GB0A 4WM1A 1LMPA 3IWRA 5KXSA 1XGRC 1C45A 4H9IA 5F81A 1BB7A 1UIDA 1YROA 1EQ5A 3WU9A 3WUNA 1IR8A 3A96A 3AYQA 1B0DA 3CT0A 1H87A 1UIFA 1DI5A 1IR9A 2F2NA 1VDQA 2HEAA 2D4KA 1YILA 2ZIJA 3M3UA 1OUAA 4ETAA 4YEOA 1V7SA 1XEJA 1P2CC 1W6ZA 5FHWA 4R0FA 4C3WA 4DD7A 1OQMA 2BQIA 1JKAA 1CKGA 1IC4Y 208LA 1REMA 2CDSA 4NEBA 1LMCA 1N4FA 3SP3A 4CHXA 5KXTA 1DPWA 3AZ4A 5LVJA 1XEKA 1G7HC 1GAZA 2F4AA 4AXTA 1LZ9A 5KXWA 2BQFA 3WL2A 2YBIA 2Z38A 3AZ5A 1C43A 1GEZA 1LAAA 1XGTC 1TCYA 2BQKA 3BKHA 5I4XA 1GDXA 4J1BA 2C8OA 2DQAA 1LZTA 4EOFA 1JJ1A 1PZYA 1C08C 2BLYA 1XFPL 1IP1A 4LZTA 1GFTA 5II3A 1JITA 1XSFA 1BWIA 1BWJA 2MEHA 3MGWA 1WTNA 4J0LA 5FEKA 1LYSA 1DI4A 1HNLA 1DKKA 1RJCB 3N9AA 2D6BA 2HU3A 4NHQA 1WQPA 5B1FA 3CSZA 1LCNA 1HC0A 1GE4A 4FJRA 4PHIA 1JSFA 4WM5A 4LFXA 1T6VL 5F9UA 1CKFA 3W6CA 1LZRA 1CKDA 1EQEA 5L9JA 2I6ZA 1HFZA 4PRQA 1ZVYB 3A6CY 4ZFPA 5T3FA 1IOTA 1VDTA 2HUBA 1GB3A 1REZA 2W1XA 3TXBA 5DN4A 1KIQC 1IC5Y 4HTQA 1PS5A 3A34A 4EMNA 4D9ZA 1B9OA 3TXGA 1JEFA 1F0WA 5LYTA 3TMUA 1KIRC 2BLXA 4IASA 1VFBC 4E3UA 4HPEA 1BB5A 4GCFA 1DZBX 4HJZA 2H9KA 4RW1A 1TBYA 4WM4A 1GE1A 1F10A 3G3BB 3A92A 2DQFC 4NHTA 3W6FA 4RW2A 1IWTA 1LSGA 2A7DA 1H6MA 1YKZX 1I1ZA 2YBHA 4GLAA 2ZWBA 1HEQA 2LYOA 3W6EA 5HMVA 4DD2A 4NGKA 3RZ4A 2YSSC 1GFRA 2BPUA 4LYOA 1UIGA 1JWRA 3A3RX 1XEIA 4H94A 3ZEKA 4TSBA 1B7NA 4DD1A 1OUHA 2EPEA 2MEDA 5LXWA 3A93A 4LGKA 1QDTA 1I20A 1IVMA 1B7PA 1GPQC 1ALCA 4GN5C 2W1LA 4KPMA 1HHLA 4GCBA 4WO6A 1LSBA 5LVGA 1B7OA 3AB6A 1IP7A 4KL7A 1LZCA 1LYZA 3OK0A 1OUGA 4OOOA 1B7LA 4U3XB 5APEA 4B4JA 4ET8A 3AW6A 3EXDA 5FCPA 2BQMA 1IR7A 2G4QA 4WLYA 2BQLA 4MCKA 5D5FA 1JUGA 2EIZC 2HEFA 4ETDA 2HTXA 4GN4A 4BADA 4A7DA 1HEPA 2H9JA 1LJIA 2Z39A 3B0IA 4HV2A 207LA 3K3TA 1GFKA 2BQJA 1WQMA 2BAAA 4WM3A 4C5FA 3B0KA 4AGAA 3FI7A 4LYZA 1HSWA 1WVVA 3A95A 1CKHA 1BB6A 1B5VA 4WG1A 2LZTA 1LYOA 4XJBA 3RNXA 4XN6A 4M4OA 4ETCA 1LHKA 1LHIA 1IP4A 1HF4A 2ZILA 3P68A 4GCDA 4NGVA 5L3HA 4J7VA 1OUIA 4NFVA 1LSFA 1UICA 1WVUA 1FBIX 1GXV2 1GB2A 2B5ZA 4L41A 4DD9A 134LA 5F16A 4M6DA 1AM7A 4P2EA 3QNGA 5HNLA 4CFPA 1D0LA 1UUZC 3GXKA 1LSAA 1JTTL 1LPIA 1REYA 2YBLA 1JIYA 2LZ2A 4H9AA 5LVHA 1YAMA 4NGZA 4DD3A 3EO5A 1OUJA 5FSTA 2HEDA 4IATA 1G7LC 3WVXA 4XJFA 1KXXA 5KXNA 4HTNA 1V7TA 3RU5A 2F30A 2D91A 1HEMA 1HSXA 1IY4A 4WM2A 1DI3A 1YL0X 5C6LA 2BQAA 4BS7A 5AMYA 3TMVA 2LHMA 1JSEA 5F14A 2ZNWY 1LZGA 3AW7A 1IWWA 1I56A 1LSMA 3TXEA 1GBSA 4FDYA 5KXRA 5HLLA 4H91A 1QSWA 4HJVA 1AZFA 1F6RA 5IELA 1OUEA 5DN5A 2RSCA 1MELL 3WU8A 1QQYA 4H9FA 4Z3MA 1BGIA 1FDLY 4LYBA 1UC0A 5DLAA 3ZVQB 2HEEA 2IFFY 1HEOA 1FKQA 3AZ6A 5D5CA 2DKVA 1GFVA 4TTDA 2CGIA 1YQVY 1QDRA 1UACY 2I25L 1LZ8A 4QDNA 5A3EA 1LKSA 1LZ4A 1GDWA 4NGIA 3D9AC 1GHLA 4X3BA 3W6BA 5KY1A 1D0MA 1GB7A 1INUA 4DC4A 1FLYA 1F6SA 1LYYA 4LYMA 2EQLA 3LYOA 194LA 1WQRA 4O34A 6LYZA 1B7SA 4TSCA 1C7PA 5LAFA 3TXFA 4B4IA 6LYTA 1NDMC 1LZ6A 2BQBA 2Z12A 2YBNA 1LJGA 1VAUA 2W1MA 4NGJA 1B5YA 4W94A 1AT6A 3W6DA 2DQGY 1LJHA 1JKBA 1GB5A 1LOZA 1LZDA 4NSJA 3AGHA 4TX7A 4NGWA 1GBYA 1GF6A 1GF4A 1JPOA 2A7FA 2NWDX 3B6LA 4UWUA 1OUBA 4RDSA 1E8LA 153LA 5FDJA 4NWHA 1UA6Y 3QY4A 4DDCA 1IO5A 4XYYA 3A67Y 3A6BY 3EBAB 1GBXA 4H90A 1NF5A 3A90A 1LJJA 1AT5A 1GF5A 4G4BA 3FE0A 4NHPA 4NHSA 1B5WA 4NG8A 1NWGA 1A4VA 1B5XA 2AUBA 5IDDA 1G7IC 2XBSA 2DQIY 4NY5A 3M18B 4XJGA 5I53A 5LYZA 4OWHA 1GFJA 2MEBA 4YF2A 4UWVA 4WM6A 1GEVA 4G4CA 2MECA 1IOSA 1AKIA 4R6CA 3CSRA 3WULA 2D4JA 1VDPA 1IP6A 1OUCA 1EL1A 1LSDA 4H9HA 1LJ4A 4XJHA 3EMSA 3WYHA 3CQLA 4XJDA 1YAOA 4J1AA 4DDBA 3CT5A 2ZYCA 4H8ZA 1C46A 1TAYA 1NHEA 1IWYA 1TEWA 4WL6A 5LYMA 1YKYX 4OWAA 1HERA 1LZ5A 1FLUA 3LN2A 1GBWA 5KXMA 1OUDA 4WLTA 1CJ9A 7LYZA 5B1GA 2DQCY 4CGEA 4PGJB 5LAGA 4TUNA 1ZVHL 4ZIXA 1GXXA 1SQ2L 3QE8A 2HECA 5HNCA 5KXLA 3HBDA 3TXHA 4HP0A 4WMGA 1D0KA 1QTEA 1WQQA 1LZBA 1IX0A 1IOCA 1O23A 1GD6A 4YEMA 1J1PY 4KT3A 4DYGA 3N9CA 4CJ2A 9LYZA 193LA 1GF3A 3RW8A 4PRUA 5B07A 1LJEA 4GLVA 1SLYA 1GFGA 1JKDA 5K7OA 1GB6A 4N1EI 135LA 1GB8A 4DD0A 4NG1A 4NSHA 5DL9A 3OJPA 4NGOA 2BQNA 5DM9A 4N0JA 3WW5A 4BAFA 4XJIA 5I4YA 4BAPA 4ET9A 1LMOA 5KJ9A 4GCEA 5B59A 1NKHA 1BB3A 2G4PA 3CT1A 1JISA 4W96A 5FELA 1GFEA 2FBBA 3WPKA 4ML7A 1LZYA 1CKCA 1B5UA 1REXA 3LZTA 1IIZA 1CJ7A 1D6QA 4TWSA 4NHIA 1BB4A 1YAQA 2G4NA 2Z37A 3AJNA 2BQCA 3N9EA 5I5QA 5E9RA 1HEWA 1XGUC 4DWXA 1HMLA 2ZQ4A 4LYCA 1GB9A 1LJ3A 4HJYA 1D9UA 1B7QA 4B0DA 2YBMA
chains in the Genus database with same CATH superfamily
4LT0A 3L28A 2Z2EA 3EIEA 3IJUA 3T1YM 1D3MA 1L04A 1YAPA 2IHLA 3WXTA 2EKKA 1UBZA 2DZNB 4B3TM 1SG9A 3A42A 3LCVB 4WG7A 2NQ8C 3FYDA 4LJ7A 1ZURA 2BJVA 5APCA 5ITTA 1JTMA 1DKJA 4LJAA 1CV0A 2RBPA 1RFPA 2EKFA 3LZ2A 1WGNA 4Z46A 2DKLA 4H93A 2MEFA 5J7CA 1WGLA 4LF9M 4H8YA 2RRUA 2DAKA 4E97A 1L2CA 1WXQA 5EP1A 1IY2A 3ZVQA 2BWEA 4IBIA 1QANA 1L45A 4W53A 1J1XY 4EKPA 3C9PA 4WL7A 3DOAA 4DUYM 1P46A 1CX7A 1T6HA 1L20A 1QUTA 2HUKA 1KW7A 4ZPXA 2WARA 4HSFA 5DYGA 1L69A 2F4GA 2VF7A 1IP3A 1L07A 246LA 1IXSB 5HMJA 1LMTA 189LA 262LA 1YKXX 2XFTA 4WOAA 1NQIA 1QAOA 5ITXA 2ZAOA 3GPYA 2KEBA 3OTOM 3AGGG 3B72A 4PJ2C 1DV0A 2DQJY 1QUDA 3QWLA 2UXBM 3FADA 4GN3A 4XADA 2ZTDA 4PCZA 167LA 1L80A 1LYIA 4OWCA 5I54A 4W59A 2FYDA 3T15A 1G7JC 4DJHA 1L94A 1JTPL 1N75A 1LSPA 4L16A 4LRTA 1DXJA 3A94A 2LWXA 2XBRA 4ETEA 1CJ6A 4W56A 5M1YA 3ATOA 2DQHY 1P37A 2ZAMA 4X65M 1LZNA 3WUAA 3IHPA 4UWNA 1KXWA 2H5ZA 1L99A 3FTDA 3SYLA 2EUCA 3F92A 1IWZA 143LA 1ZMVA 1LMAA 1GE2A 1XNRM 4QHSA 2EKSC 1L68A 3HT7A 113LA 215LA 1CUKA 4G9SA 4RLNA 1LTMA 1LGUA 3SFZA 2ZQ3A 115LA 2M5ZA 1TF0B 3HFMY 5LINA 2K47A 1XMOM 2JY8A 5LVIA 3FI5A 4MSTA 1IN5A 3HTGA 4LT1A 3LZMA 4GCCA 5B06A 5LA8A 1VEKA 3KFUG 1BQLY 3FUTA 1N32M 1QUOA 3VKHA 4HPIA 4NSOB 4LCBA 4I7OA 1L79A 1CNSA 4NGLA 4OWBA 2BQOA 1JTOL 2RBSA 2XJWA 3KOXE 1DYAA 4CHTB 3T36A 3KDSE 1D3NA 2ANVA 1NNUC 4JI4M 1C6AA 5A3ZA 2MR9A 2UXCM 3KSJA 2C8PA 4NL4H 1BVKC 1RI8B 4H92A 3CGWA 2ZTCA 4XBOA 1GBZA 2RBNA 1MJGM 2I26L 2UUBM 4S0WA 1YLAA 5F81A 1YROA 120LA 3WUNA 3A96A 3AYQA 4YXAC 1B0DA 3OE8A 5FTNA 1VDQA 3GUKA 3FUXA 2ZIJA 2HHHM 1OUAA 3J81S 1P2CC 1W6ZA 1L08A 1XWIA 3DKEX 4C3WA 4DD7A 1JKAA 208LA 2CDSA 1LMCA 1N4FA 4I7JA 5LVJA 1DPWA 1GAZA 3L29A 4NOOB 2CP8A 1LAAA 3DN6A 1C65A 1GDXA 3SB5A 1QTCA 5ITXE 1N77A 2BLYA 1CX6A 1XFPL 3MGWA 3ZH9B 1BWIA 4J0LA 184LA 1LYSA 1DI4A 212LA 1DKKA 2DAIA 1RJCB 221LA 3N9AA 4IJFA 4DQJA 5B1FA 4HEOA 4OW0A 4FJRA 4PHIA 1JTNA 3U60A 172LA 4S12A 1JSFA 1QT7A 3DMVA 3NBIA 186LA 3A98B 3W6CA 1JQJC 3IECA 1IOTA 4LF5M 2HUBA 3ODUA 4ARLA 2DZOB 4HTQA 1B9OA 1PJJA 1CV3A 1JEFA 4LF6M 1C62A 1TH4A 1KIRC 2BLXA 1BB5A 2RB0X 4RW1A 2DNAA 3C3DA 2R46A 4FWDA 3FTCA 4DV2M 1HQCA 1P3QQ 2A7DA 1YKZX 4GLAA 2ZWBA 5HMVA 3W6EA 127LA 4QHTA 4LYOA 3A3RX 4H94A 1T97A 185LA 4GHAA 1E32A 1UM8A 4PD2A 2EPEA 4DD1A 5LXWA 3A93A 1QDTA 1IVMA 3VW7A 4GN5C 4ARMB 5LVGA 1B7OA 1G0JA 1IP7A 2OTYX 1QUHA 4KL7A 1XNQM 1B7LA 4B4JA 2G3QA 3K8ZA 1EPYA 1NHBA 4WLYA 4P16A 2BQLA 5D5FA 3HT9A 2HEFA 4LZMA 3RE8A 4HV2A 4EKQA 4EXMA 3K3TA 4KLNA 4WW0A 1L57A 3AFHA 1WQMA 4AGAA 5F3WA 1C67A 1WVVA 3A95A 1CKHA 3U6OA 1IP4A 2JNHA 2Z7JA 2ZILA 1LLHA 1T3TA 1OUIA 4A3VB 3FD9A 1VDLA 1LSFA 3SBAA 3R8FA 4DR6M 3WHKA 1QT3A 228LA 3QNGA 1DYDA 1G1VA 3U5ZB 2MGWA 1LSAA 2YBLA 3UK6A 3HHWA 1OVKA 4NGZA 4LGYA 239LA 3GQ4A 5FSTA 2HEDA 4B3SM 1GJSA 4DWXA 1OIZA 231LA 2H5XA 1SXJC 2F30A 2B75A 4MH0E 4NRWA 1DI3A 3DN4A 5C6LA 3IG5A 2VF8A 1DO0A 1XJUA 2ZNWY 1IN6A 4D80A 4BB9A 2M60A 4FDYA 2VDBB 4HJVA 129LA 1OUEA 5DN5A 4DR3M 3WU8A 1QQYA 2HUMA 1C6EA 1OIPA 3HH3A 2BWBA 1R2ZA 4GC5A 2W82A 4LJ5A 8CATA 3TWMA 1FKQA 1QTZA 3AZ6A 1L1ZA 1IM2A 3TPZA 2CGIA 5KKIA 3H4JA 1UACY 1QZEA 1L05A 1LKSA 1TLAA 4X3BA 5KY1A 2DXIA 3D9AC 3HUAA 1GB7A 1LYYA 4M9ZA 2X8AA 3LYOA 4AW4A 4O34A 3U6EA 3IG8A 4M9SA 1C61A 4TSCA 1C7PA 3NBXX 1L11A 4W94A 4GITA 162LA 1VAUA 2W1MA 1B5YA 2DQGY 3SASA 1TH2A 4MGIE 3MHVC 1J5EM 1P64A 1GF6A 3AJIB 1JPOA 1L39A 2NWDX 4UWUA 3RZEA 1OV7A 153LA 1T43A 3SBJA 4RF1A 4YXCA 197LA 4DDCA 3QY4A 4XYYA 3A67Y 4NXMM 1GBXA 1Z5CA 4QOZC 3K9PA 4NHPA 1PRBA 3FE0A 4W55A 1NWGA 138LA 2AUBA 3NY8A 2XBSA 3M18B 2B74A 4EIWA 1L77A 1GFJA 4G4CA 1TTEA 4IAPA 4R6CA 3CSRA 148LE 2DAMA 3J2PB 1VDPA 4DV4M 1G71A 1YAOA 2KHHA 2F5QA 1ZAEA 1FLUA 173LA 1OUDA 4WLTA 1JR3E 1W5TA 4LDLA 4YY3M 4B3MM 3SHFA 4MGYE 3AKZA 3TXHA 2O01F 4KT3A 3M6AA 4DYGA 9LYZA 1N33M 3J7BA 3RW8A 4PRUA 1LJEA 1GFGA 1JKDA 3GRUA 135LA 1L60A 1GB8A 4NSHA 4L78A 4NGOA 2ZM6M 5DM9A 174LA 3WW5A 1K82A 4G4QA 4JI7M 1PJQA 2Q9EA 3AV0A 5B59A 1QS5A 1GABA 1JISA 4W96A 4WURA 2FBBA 3WPKA 4ML7A 2DWNA 3LZTA 1IIZA 1H6UA 4TWSA 4NHIA 1BB4A 1QVRA 4R71A 2L78A 3DMZA 3KP0E 1D2YA 3N9EA 5E9RA 1P2RA 1DYCA 169LA 1L83A 1VDSA 3TXKA 4IBGA 3L64A 3HT6A 195LA 1FKVA 2N5ZA 3HU3A 3U6QA 3MMPA 3DMXA 192LA 1EFUB 2L6OA 1L29A 5APFA 5JENB 260LA 2L7IA 1P56A 165LA 3HHYA 1L19A 2BQEA 1NDGC 2PC2A 157LA 4OX9M 1SX2A 131LA 1L28A 1TGUA 2F2QA 2LHCA 1L43A 4DAJA 4H9CA 1P6YA 2W1YA 3P64A 1RE2A 4NSGA 3J6KA 2CEAA 3TXJA 4QY9A 2LYMA 4M9XA 3BOSA 2B7XA 2MEAA 3U6MA 4H8XA 3P65A 1KS3A 4NWEA 1FJGM 1LHJA 4Z98A 2F5SA 4FVMA 3H4MA 4G4HA 1A2YC 5FTKA 4QEQA 1Z5AA 5DFLA 2DQEY 3HBHA 1C6JA 4I7NA 155LA 1UIEA 3K1JA 257LA 2B6XA 232LA 237LA 1KW5A 4I0CA 2ZYPA 1LGXA 1LJFA 4LYTA 3HDFA 4Z41A 2L4FA 1LI6A 2Z19A 2Q9DA 3WPLA 2DQDY 5LA5A 1SXJB 3GXRA 4W54A 112LA 1Q3CA 1L51A 3T6UA 4IBKA 4G4OA 1LSYA 1QAMA 251LA 5KXOA 2VB1A 109LA 4DR5M 1UFZA 2C99A 1XEPA 4NGYA 1LSNA 1LI3A 3V76A 1J09A 4MGKE 5ITYA 1IWVA 1HFYA 1NBZC 3TMXA 1L87A 1XMQM 5L8RF 1LKRA 241LA 1LGWA 5KXXA 1L98A 1DQJC 3ZQJA 3KXEC 1IY3A 1LMNA 2LYZA 1L13A 3J4GA 1AUAA 4DBGB 2CV1A 4DUZM 3WU7A 5KKJA 1LPYA 5F9XA 3FRHA 1B5ZA 1L41A 1UCOA 4LT2A 1C6KA 4I81A 2V6ZM 1KIPC 258LA 175LA 2O7AA 2CV2A 2RBQA 5EXPA 1L65A 3G3AB 3FUWA 3CB7A 4ZEEA 2UXDM 1GF9A 1L31A 1LYDA 2QQ8A 1D3JA 4EPFA 1CVKA 5EBHA 3CF2A 1LZ1A 1CU5A 1L33A 4M0DA 3IJVA 1D6PA 3GPUA 4IBBA 2DZLA 1IWUA 2ZNXY 1LYHA 5EQTA 3FKEA 1B6IA 2LXEA 2HU1A 1GFHA 5KXZA 133LA 3LYZA 1L18A 199LA 1T8AA 126LA 3AOGA 1ZV5L 2D4IA 2JWSA 2JZ0A 1JJ0A 3E3DA 5LVKA 1UIAA 108LA 1FLQA 3U6LA 253LA 1OV5A 1GO5A 1FLWA 4OU7A 5EXSA 3OE0A 4II8A 5LMUM 1BHZA 4QGZA 1E94E 1Z5BA 4D82A 3VLFB 1XB2B 1HFXA 5IHGA 1Z55A 5DYIA 2BQDA 2Z2FA 154LA 4JN6A 1GFAA 4Y28F 3QAKA 4N8ZA 2OU8A 1DPXA 1PQMA 1L76A 1GB0A 4JI8M 3PXGA 4AKHA 1LMPA 1XGRC 4L15A 3WU9A 1L92A 3SARA 1IR8A 1IXZA 4DR7M 2QPAA 3HY5A 1IR9A 2HEAA 2D4KA 1L01A 4DR1M 1YILA 4ETAA 1G1WA 1L44A 4GBRB 1XEJA 1LV7A 2J7OA 1CKGA 1REMA 1KSFX 3NY9A 1XEKA 1L56A 1NVMA 1WHCA 3C82A 4AXTA 1XXHA 2MH8A 2YBIA 3AZ5A 1C43A 2HKJA 2BQKA 2RH1A 2C8OA 4FW9A 2DQAA 4EOFA 1PZYA 1IY1A 2DWZB 1T8GA 3PNYA 1Z6TA 176LA 1XSFA 1BWJA 5FEKA 224LA 1HNLA 2XF3A 2XFSA 216LA 2HU3A 1WQPA 1HC0A 1GE4A 2V1CA 4KODA 4LFXA 220LA 1CKFA 1LZRA 2EA0A 1HFZA 3QYEA 1C6FA 4NSRA 1ZVYB 3K9OA 4ZFPA 4GC9A 2W1XA 1I94M 222LA 3GLGB 3TXBA 5DN4A 1KIQC 3DN2A 4D9ZA 1XHBA 1OVJA 1F0WA 1G59A 3TMUA 209LA 2JP7A 3M0EA 1VFBC 1L50A 4GCFA 1DZBX 2H9KA 4WM4A 1PQOA 1F10A 4I7RA 1L82A 196LA 5A2QS 4LDEA 3ZC7B 1CV6A 2RGOA 4DV7M 4JI0M 2YSSC 1C6LA 4W57A 3ZEKA 4I8OA 1B7NA 1NV9A 4XK8F 1L17A 1L61A 1C6HA 1HHLA 4WO6A 1L93A 4EKSA 1LYZA 3E9SA 2B6YA 3EXDA 1OQYA 1ZYTA 3VK7A 2BQMA 2J7NA 1L37A 4I7SA 4ETDA 4GN4A 2VQFM 4BADA 1HNZM 4A7DA 1HEPA 2H9JA 3W0LB 3B0IA 1EE8A 2BQJA 3FI7A 3GO8A 4AQYM 214LA 1HSWA 1GL6A 4LYZA 3DA1A 3G3XA 2LZTA 3HTBA 3RNXA 187LA 3HWSA 1SSYA 1LHIA 3HH4A 4GCDA 5L3HA 1L03A 4J7VA 4I7PA 1UICA 183LA 3B7NA 1GB2A 2B5ZA 3R9XB 3SYKA 4ARPA 2R62A 3VDPA 5F16A 1QT6A 2JXNA 2DAGA 4BBAA 3FTFA 1OWYA 1UUZC 3CDTA 3GXKA 1LPIA 1REYA 163LA 1QSQA 4DD3A 3C83A 1LYGA 2FS1A 1C63A 3WVXA 2JUJA 3DN3A 2F4VM 1C6GA 1V7TA 200LA 4Z6YA 4K5YA 259LA 1L48A 1DYEA 3GULA 3HUQA 3DN1A 1CV1A 255LA 1YL0X 5EXTA 3L27A 1G41A 2OPFA 4EKRA 4G6ZA 5KXRA 4RNAA 1QSWA 1AZFA 2C98A 3PFIA 4LG2A 3C7YA 2DHYA 3JAMS 1UC0A 217LA 3KOYE 2I7PA 5H37D 3W67A 3ZVQB 1QYRA 1VEJA 2IFFY 1HEOA 1C1KA 3DFZA 3GLIB 3HKPA 2XSZD 3HHZA 1LYEA 2EO2A 1QTHA 4G4NA 1GDWA 4DR4M 1GHLA 1XXHB 1NJFA 4LYMA 4XGIA 3GRRA 5FTMA 1WQRA 2F5NA 3TXFA 4Z8XA 4B4IA 1IN7A 1FNNA 2BQBA 3DNAA 4GRIA 2C9CA 2YBNA 3GUNA 3W68A 1AT6A 2QZ4A 4IBCA 1CUPA 1GB5A 1LOZA 1L8QA 1GBYA 1L63A 1GF4A 2A7FA 2RAZX 1E8LA 1T8FA 1HT1E 5FDJA 2LHGA 1UA6Y 1IO5A 4KO8A 3GLIA 3A6BY 1NF5A 3A90A 1GF5A 1L42A 2QARC 4NHSA 1HQYE 2IGCA 1GJTA 4JI5M 2K6BA 2XSZA 2XZFA 102LA 4JXJA 123LA 3GUOA 3WULA 2D4JA 2LBCA 2LVAA 3GQ3A 1IP6A 4H9HA 1XXHE 1G06A 3C7WA 3EMSA 4XJDA 2UUCM 3GLFE 5LZMA 3HHXA 3CT5A 4QNMA 1C6NA 1C46A 1J7KA 3GLHE 191LA 1C66A 1TAYA 5LYMA 1KY0A 5BR8M 4F1IA 1HNXM 2QB0B 3B7QA 2O25A 4PK0A 2DQCY 1L64A 1L66A 4PGJB 3UJNA 3PBLA 1N34M 150LA 4TUNA 4ARQB 2O4WA 2D7GA 5HNCA 252LA 1QSBA 1J1PY 2L09A 4ARJA 3HJSA 1ORYB 3U6SA 1GLNA 1PJIA 3JR5A 1GB6A 4JI6M 4DD0A 5DL9A 1C69A 2RAYX 2B3TA 1JQUA 4BAFA 1AIPC 4XJIA 1LMOA 1K28A 1SWZA 1NV8A 1GKIA 5KJ9A 4DKLA 1BB3A 3CT1A 2R45A 4LF7M 227LA 1L27A 2UU9M 3C8RA 1LZYA 151LA 1REXA 3LVVA 3B74A 1D6QA 1YAQA 2OQ4A 2Z37A 3AJNA 3VFDA 1HEWA 168LA 2KW0A 1GB9A 1LJ3A 4HJYA 2YBMA 2MROB 1V34A 3GQ5A 1IBMM 3U5ZA 1C7YA 3LYTA 3GP1A 3GRYA 240LA 1L26A 2YBJA 3HDEA 1L16A 3P4ZA 1Q3BA 1C10A 1KY1A 3W3EA 1I6SA 3K92A 1OKSA 1UIBA 2KZSA 1QAQA 201LA 4LZZA 4ANRA 1GWDA 1OP9B 1QIOA 5KQDA 1NO1A 2R4EA 3E4RA 4IBFA 4N9RA 1L85A 4B08A 182LA 5EP3A 139LA 1IP2A 8LYZA 1DGHA 2A4TA 4OWEA 3LQRA 3SATA 3WPJA 4PDIA 1NBYC 1RU3A 1YL1X 2LZMA 2Q2EB 3WXUA 4DDAA 1K3XA 1J1OY 4P17A 3W6AA 1HT2E 4AKIA 1SXJE 1YIKA 2JY6B 1EQ4A 4KT0F 2MEEA 2YDGA 3TMWA 4LFCM 1LHMA 5L3IA 1JJ3A 2CJLA 3HTFA 4WLDA 1QUSA 2WSFF 1VEGA 2XGNA 2RB2X 2XQOA 5E4PA 4N5RA 4MR1A 3D8LA 2ZBKB 1L49A 3HT8A 3BKVA 2R0IA 1LHLA 4PJZA 1LSZA 1ZMYL 3FA0A 1D3FA 5KPRA 4B7FA 3HTDA 3AGIA 2XH9A 130LA 3ATNA 1FN5A 4F2LA 2X0AA 1GL7A 2J5YA 3GPXA 2B6TA 2KDLA 3UZUA 1IEEA 3KW6A 1L89A 4KXIA 4LFPA 3WVYA 1L30A 1LSCA 1DYBA 1CU3A 4NSIA 1DGBA 4L6V6 1B2KA 4LDOA 2OE7X 3B89A 188LA 4B4EA 1SX7A 2B70A 3CF0A 4GMQA 234LA 1NMMA 2YFQA 1MU5A 3HZJA 1L2BA 132LA 1C6CA 2QNJA 3A8ZA 3WW6A 141LA 5C6JA 1IORA 2HCBA 4ZPUA 3CSQA 3BXWA 2QBYA 5ILCA 2CUZA 1LSEA 1WTMA 4I7LA 1PQJA 4ARMA 3WUMA 5APDA 1LZAA 3RT5X 3A3QA 2FBDA 1W08A 4W58A 1VDDA 3SN6R 1CJ8A 3I01M 1NJGA 3FYCA 2UUAM 1L47A 1IQPA 4GKKM 1L84A 1IP5A 5KXPA 1ZQ9A 1BVXA 1L81A 5LIOA 3GLGA 4NIJA 4I4LA 1HMKA 4RKUF 261LA 2OE9X 1GF8A 3ULRA 2YVBA 1LHHA 2OEAX 4YOPA 1PJSA 1HENA 3A91A 1IN8A 4D81A 2L4EA 1QSAA 3KAMA 3J80S 2KNZA 2OOAA 1L90A 4B1AA 1L12A 3HWLA 4B7GA 1XC8A 2XTHA 1QTKA 5II3A 1LZEA 1GF7A 210LA 1B7RA 1ZMUA 2YQZA 5IREB 1LZSA 3CDQA 198LA 1T6OA 3HU2A 164LA 2WZJA 3QYBA 5ITQA 7LZMA 5IT9S 1C45A 4H9IA 2VIIA 1BB7A 1UIDA 4BLCA 3MK6A 2CUUA 1DGGA 3I04M 1H87A 3CT0A 3L2AA 1DI5A 225LA 5GKNA 1VG5A 2F2NA 3I51A 1OVHA 1V7SA 5FHWA 1ZMWA 1OQMA 4CHXA 1IC4Y 1OAIA 205LA 5KXTA 3SP3A 2N35A 1LWKA 4W5WA 3AZ4A 1L32A 1G7HC 4EPIA 1SWYA 3LMMA 1WIVA 3WL2A 5FTLA 2Z38A 1QT4A 1ZV1A 5FSWA 3K2LA 4CIZA 4J1BA 1DYGA 3U6DA 2C96A 1GFTA 1WTNA 2B73A 218LA 4GHLA 4WM5A 2X4AA 5F9UA 2F5OA 2R18A 4DQ5A 1CKDA 1EQEA 3C7ZA 4AI6A 4PRQA 1K3WA 3A6CY 5T3FA 1VDTA 1GB3A 1Z59A 4R7GA 1CV5A 3SMPA 1IC5Y 1PS5A 3GUPA 1G0PA 3TXGA 5EXXA 2RBOA 4JI1M 4IASA 4ARQA 4E3UA 3G3VA 4HPEA 4HJZA 1TBYA 140LA 1JB0F 3A92A 1DYFA 4MGZE 2Z4SA 1I1ZA 1L74A 7CATA 4NGKA 1PQIA 1GFRA 2BPUA 1UIGA 2B6WA 1IXSA 4K0KM 3LW5F 250LA 1QQWA 2MEDA 2F32A 4LGKA 2QHOB 1GPQC 3KSXA 1ALCA 2W1LA 1L10A 4GCBA 3THGA 1LSBA 3OK0A 1ZWNA 2C5RA 4OOOA 3KOWE 5APEA 4ET8A 142LA 4I7TA 2F47A 4MM3B 5FCPA 1IR7A 4GRVA 5KPZA 4B7HA 4II7A 152LA 2HTXA 4LFBM 2LCBA 1GVNA 2Z39A 4C5FA 4WM3A 190LA 207LA 2P5TA 1GFKA 4OVZB 1X37A 4WG1A 1I4WA 1LYOA 1CU2A 103LA 4XN6A 4ETCA 2H1RA 1LHKA 4M4OA 1HF4A 2FFJA 3P68A 4NGVA 1CUQA 3CF6E 4NFVA 3EMLA 1VQ1A 1WVUA 1SXJA 3W0FA 2KXEA 4L41A 134LA 3U61B 3C58A 4CFPA 1D0LA 3Q8XA 3HU8A 1QS9A 2LZ2A 4H9AA 3TQSA 177LA 2DI0A 4NRVA 3C8SA 1OUJA 4IATA 2FOIC 3E46A 4XJFA 2O5RA 5KXNA 2FE8A 3HGIA 3RU5A 1LW9A 2D91A 1HEMA 4LJ6A 1HSXA 4OO9A 4LJ9A 2APLA 2K0BX 1L0JA 4BS7A 5AMYA 2LHMA 2HWJA 1JSEA 4IBEA 1HNWM 1LZGA 1I56A 3SB8A 3SAVA 1LSMA 3TXEA 3KOZE 3SB6A 3RGSA 1DGHB 3ILKA 1C6MA 1JR3D 5IELA 2RSCA 1MELL 1Y8GA 4QNRA 1E9RA 2WSCF 2G5GX 2KNAA 4DV1M 4H9FA 1OYUA 2B72A 247LA 1L97A 5IZ7D 110LA 2WSEF 5D5CA 2DKVA 1GFVA 2ERCA 1L2DA 1YQVY 1LZ8A 5FTJA 230LA 3FUUA 3GPPA 1D0MA 1C64A 1L54A 4X64M 4DC4A 1FLYA 1F6SA 2EQLA 4G3OA 2JA2A 3Q8GA 6LYZA 4R3DA 3MJ5A 245LA 1L06A 6LYTA 4NGJA 1LZ6A 3W6DA 4PT5A 2Z4RA 1LJHA 5LMNM 2BNKA 3D8BA 1LZDA 4NGWA 3DZDA 2BJWA 3QAUA 1L70A 1G0GA 4DV0M 4DV6M 2L7HA 4NWHA 233LA 5JI2E 4GKJM 3GUJA 1G0KA 4H90A 4DV5M 4PDGA 1L38A 1LJJA 2DHRA 2JZ1A 1AT5A 2ZANA 3F9LA 4G4BA 4LJ8A 1B5XA 1C6QA 2CE7A 3DN8A 5IDDA 4NY5A 2DQIY 4XJGA 5EP4A 4L8RC 1F4IA 1QT5A 5LYZA 4OWHA 213LA 4YF2A 2MEBA 4UWVA 4WM6A 1TDZA 3T38A 1AKIA 3LVWA 2MJ5B 3T6PA 4AKGA 2OU9A 1LSDA 4XJHA 1G0LA 3WYHA 3CQLA 2HAKA 3KVWA 1PGYA 146LA 4H8ZA 3FTEA 1TEWA 1NHEA 3PNVA 1IWYA 1YKYX 1HERA 1LZ5A 2K9DA 5KXMA 5DNYA 1CJ9A 7LYZA 5B1GA 1L25A 226LA 3G3WA 2Z8YM 1SQ2L 3QE8A 2HECA 1D9WA 104LA 3HBDA 4WMGA 1LZBA 1IX0A 2EJSA 3D4SA 1GD6A 3N9CA 2VQEM 1C6IA 244LA 3HUKA 193LA 2CFOA 4GLVA 1SLYA 5K7OA 4N1EI 1L52A 4NG1A 144LA 1QZMA 1CTWA 3OJPA 4I5SA 2Y21A 5I4YA 4ET9A 3HJQA 1NKHA 3UONA 3CTWB 2C9OA 1GFEA 5FELA 3HX3A 1CJ7A 2G4NA 2BQCA 2GNOA 1XGUC 3SC3A 1HMLA 156LA 5BPVA 2ZQ4A 243LA 4WM2A 4B0DA 1B7QA 2KA6B 2Y20A 1QUGA 3TXIA 2LTUA 3C3EA 3GLFB 1QTVA 2CHGA 3VWOA 1IOQA 1S3SA 3TXDA 5ILFA 4W51A 1TR8A 107LA 180LA 1C6TA 1T3PA 3C8QA 4I7QA 4IJ4A 1P36A 2BQHA 2RKOA 2GV0A 1IC7Y 3BBZA 1C6PA 1LJNA 4PPOA 4OW1A 2OO9A 1L95A 2R65A 1NY5A 4H9BA 4HV1A 5IWAM 4IBDA 1L24A 1L23A 5C6IA 3SB9A 4FWGA 3GUMA 1JKCA 1L59A 4H9EA 4XENA 4I7KA 1JHLA 1C6DA 1GAYA 5E26A 1WJ7A 1UIHA 2LH0A 3AOEC 3E21A 1HJPA 1MN3A 147LA 1LJKA 3B0OA 1OAOC 1GE0A 1L21A 118LA 3F6ZA 3WMKA 4HLQA 3HU9A 1N36M 1IY0A 3U61A 1WQNA 2QCUA 4B49A 5I4WA 5C1BA 3TL4X 3UMMA 4YM8A 1XGPC 2RGHA 1BWHA 4HTKA 1WR1B 1YANA 5EP2A 1P7SA 4G49A 1OJLA 1NSFA 3U6CA 4WO9A 2MEIA 158LA 1N78A 2Y8PA 4DR2M 1MLCE 3NWLA 1L71A 1GBOA 2HEBA 3PVSA 3LYMA 1R5LA 1C68A 1RCMA 4OOTA 2BQGA 5FLXS 1PQDA 3WH1A 5KXYA 2HULA 2X49A 1GE3A 4YX7C 1OFIA 1L91A 3TE6A 4WLXA 114LA 4IBJA 4JV5M 4IJEA 3U60B 3NYAA 1MX0A 5JI3E 1L58A 1VATA 1GF0A 128LA 3RUNA 1D2WA 1WTHA 1G8PA 1L14A 125LA 2MEGA 2ANXA 1YSYA 1LMQA 4LT3A 1TDYA 4W52A 1IWXA 3KP1E 4GH9A 3VK8A 4DT3A 254LA 1L09A 4X66M 2CWBA 1VEDA 1G3IA 4YENA 2DBTA 3I4VA 3K2RA 1G7MC 1KYIA 2G8LA 2LVQD 1XGQC 3SHGB 3LHMA 4B3RM 149LA 4H1PA 4I8SA 2Q0MX 4QOSA 4ETBA 1HELA 3CDVA 3HBEX 1YE9A 1KXYA 1OUFA 4JI3M 4RLMA 2CWIA 1WQOA 5KO3A 2B6ZA 4IIWA 4N1CC 5B05A 3CDOA 249LA 3HU1A 4HL4A 1B7MA 5KXKA 2Z18A 3SAUA 1L1TA 1GFUA 1HR0M 2FYCA 2ZIKA 3AZ7A 1QTBA 2L2DA 4LJ4A 1NY6A 4JI2M 5HQ1A 4CFOA 3RGPA 3D3DA 3P66A 1EIJA 1TDHA 5ITRA 1L46A 1L86A 160LA 4WM1A 3M7GA 1IXRC 2QSFX 3IWRA 5KXSA 1C6BA 1EQ5A 2F5PA 1UIFA 4YHHM 4G4RA 3M3UA 1G0QA 2KRUA 4YEOA 4R0FA 2BQIA 4DQ7A 235LA 4FD2A 4NEBA 1L0KA 5KQ8A 2F4AA 4NC6A 3WHLA 1IBLM 1LZ9A 5KXWA 2BQFA 3JR6A 5C18A 2Y0TA 1XJTA 1GEZA 3U6PA 1XGTC 1TCYA 3OE9A 3BKHA 5I4XA 1LZTA 1JJ1A 1C08C 2JY5A 1IP1A 4KHPM 3HJ8A 4LZTA 1DGFA 1JITA 1OWZA 2MEHA 1QT8A 2CHVA 3C81A 3DN0A 3VKGA 3A46A 2D6BA 2R6FA 1L36A 4NHQA 4GEWA 1LCNA 1LWGA 2JY7A 3CSZA 3SBBC 3GRVA 1E9SA 1T6VL 1L67A 2O79A 5L9JA 2I6ZA 4AZFA 1REZA 3LCUA 4M0WA 4EMNA 3A34A 256LA 3FE3A 4FCVA 3L26A 2NTGA 5LYTA 4FWHA 3GLFA 1P3NA 2AHMA 2DVWB 5KPTA 3W6FA 1GE1A 3G3BB 4NHTA 2DQFC 2QENA 4RW2A 1IWTA 1LSGA 2KZUA 1L62A 1BVSA 1H6MA 2YBHA 2V1UA 4LRSA 2LVOC 1IFYA 1HEQA 4RF0A 1G07A 2XEPA 2LYOA 4DD2A 3RZ4A 3ZCBB 1JWRA 5ITUA 1XEIA 1L35A 4TSBA 2HL7A 1OUHA 3RFWA 4Q7JA 2OTZX 1KNIA 1I20A 3TWKA 2Z6BA 1B7PA 4KPMA 3AB6A 1NHGC 170LA 1LZCA 1R7RA 1L75A 1PJTA 1OUGA 2LVPC 4U3XB 1IBKM 3AW6A 3V2YA 2QBYB 2G4QA 4I7MA 4MCKA 1JUGA 2EIZC 3PDSA 4L4UA 166LA 1LJIA 3W6BA 2BAAA 3B0KA 1BB6A 1B5VA 3B9PA 1L53A 4XJBA 1OFHA 2QP9X 1PM5A 4CJ6A 2R4JA 4LZJA 1P2LA 1FBIX 1GXV2 3KS8A 4DD9A 1V92A 2KRKA 1L96A 4M6DA 1AM7A 4P2EA 5HNLA 3GLIE 223LA 4DV3M 4AG6A 1JTTL 1NNJA 1JIYA 2OU0X 181LA 5LVHA 1SXJD 1YAMA 1L15A 3EO5A 6LZMA 1G7LC 1KXXA 1CU0A 2LC9A 1QTDA 3L25A 4HTNA 1L02A 1IY4A 4WP2A 2CRUA 3FRIA 3SMSA 2BQAA 2XLJA 3TMVA 3GLHB 5F14A 3LQQA 3JR4A 1L40A 3AW7A 4ITQA 1IWWA 3GUIA 1GBSA 3HH5A 5HLLA 4H91A 1F6RA 3V2WA 238LA 4Z3MA 1BGIA 1FDLY 4LYBA 1IN4A 3T1HM 1DO2A 5DLAA 2HEEA 2OE4X 3VDUA 1L72A 2RBRA 3EIHA 4X62M 4TTDA 159LA 2I25L 1QDRA 1CU6A 4QDNA 5A3EA 1LZ4A 4NGIA 145LA 2R44A 2LVNC 2FH0A 1INUA 3SB7A 1R6BX 194LA 2DWMA 119LA 1CV4A 4TUWA 3J27B 2E5LM 1B7SA 1W5SA 1P5CA 2DWLA 5LAFA 1NDMC 2Z12A 1LJGA 4LF8M 1D2NA 1L00A 1JKBA 2D7EA 206LA 4TX7A 1R4GA 3AGHA 2LNHC 2Y0QA 3TWLA 178LA 2GQFA 4NSJA 1OTRA 3B6LA 2XZUA 2NTHA 1OUBA 3F8VA 4RDSA 248LA 3UGJA 1L22A 1L55A 2D7HA 211LA 3EBAB 4LY6A 5E6JA 1KFVA 1B5WA 4NG8A 1NHWC 1A4VA 5EJCA 171LA 3SAWA 2A5YB 1G7IC 3CDRA 2CHQA 4FCWA 2OOBA 5I53A 4EJ4A 4AQNA 1V33A 1SSWA 1GEVA 4LF4M 2MECA 1IOSA 111LA 2I7NA 3GLHA 3AL0C 3A45A 4MGHA 1TH3A 1L88A 1OUCA 4MB7A 4GIPA 1EL1A 2YR0A 236LA 1LJ4A 2FNAA 1R2YA 3J7AS 3L2XA 1G0MA 1C60A 4J1AA 4LGMA 1YUBA 3B7ZA 4DDBA 3HH6A 4LFAM 2ZYCA 3C80A 4REZA 2DENA 4WL6A 5I14A 4OWAA 3LN2A 1GBWA 4CGYB 1L34A 3OE6A 2KNVA 242LA 4CGEA 5LAGA 1ZVHL 4NXNM 1GXXA 229LA 4ZIXA 2DAEA 1LYFA 5KXLA 3FUVA 4HP0A 1D0KA 1QTEA 1WQQA 1O23A 4CJ2A 1IOCA 4YEMA 2CV0A 1Q39A 1GF3A 5B07A 1LYJA 137LA 1JR3A 2RB1X 4FCTA 2BQNA 2YNMD 4N0JA 1PQKA 4BAPA 1G4AE 4OVZA 4GCEA 2G4PA 2Z3XA 1LI2A 1L73A 161LA 219LA 4CISA 4UN2B 1CKCA 1B5UA 122LA 3KS4A 3AOEA 1A5TA 3I4YA 5I5QA 4JYAM 1Q02A 4LYCA 3GLGE 1D9UA 4AG5A
chains in the Genus database with same CATH topology
4LT0A 2Z2EA 3IJUA 1D3MA 1L04A 1YAPA 2IHLA 3WXTA 1UBZA 4WG7A 1ZURA 5APCA 1JTMA 1DKJA 2RBPA 1CV0A 3LZ2A 1RFPA 4Z46A 4H93A 2MEFA 5J7CA 4H8YA 4E97A 3ZVQA 1L45A 4W53A 1J1XY 4EKPA 4WL7A 1P46A 1CX7A 1T6HA 1L20A 1QUTA 2HUKA 1KW7A 2WARA 4HSFA 1L69A 2F4GA 1IP3A 1L07A 246LA 5HMJA 1LMTA 189LA 262LA 1YKXX 4WOAA 1NQIA 3AGGG 3B72A 4PJ2C 2DQJY 1QUDA 3FADA 4GN3A 4XADA 167LA 1L80A 1LYIA 4OWCA 5I54A 4W59A 2FYDA 1G7JC 4DJHA 1L94A 1JTPL 1LSPA 1DXJA 3A94A 2XBRA 4ETEA 1CJ6A 4W56A 5M1YA 3ATOA 2DQHY 1P37A 1LZNA 3WUAA 4UWNA 1KXWA 2H5ZA 1L99A 1IWZA 143LA 1LMAA 1GE2A 2EKSC 1L68A 3HT7A 113LA 215LA 4G9SA 4RLNA 1LTMA 1LGUA 2ZQ3A 115LA 3HFMY 5LINA 5LVIA 3FI5A 4MSTA 3HTGA 4LT1A 3LZMA 4GCCA 5B06A 5LA8A 1BQLY 4HPIA 1QUOA 4I7OA 1L79A 1CNSA 4NGLA 4OWBA 2BQOA 1JTOL 2RBSA 2XJWA 1DYAA 3T36A 1D3NA 2ANVA 1C6AA 5A3ZA 2C8PA 1BVKC 1RI8B 4H92A 1GBZA 2RBNA 2I26L 4S0WA 5F81A 1YROA 120LA 3WUNA 3A96A 3AYQA 4YXAC 1B0DA 3OE8A 3GUKA 1VDQA 2ZIJA 1OUAA 1P2CC 1W6ZA 1L08A 3DKEX 4C3WA 4DD7A 1JKAA 208LA 2CDSA 1LMCA 1N4FA 4I7JA 5LVJA 1DPWA 1GAZA 1LAAA 3DN6A 1C65A 1GDXA 3SB5A 1QTCA 2BLYA 1CX6A 1XFPL 3MGWA 1BWIA 4J0LA 184LA 1LYSA 1DI4A 212LA 1DKKA 1RJCB 221LA 3N9AA 4DQJA 5B1FA 4FJRA 4PHIA 1JTNA 172LA 1JSFA 1QT7A 3DMVA 186LA 3W6CA 1IOTA 2HUBA 3ODUA 4ARLA 4HTQA 1B9OA 1CV3A 1JEFA 1C62A 1KIRC 2BLXA 1BB5A 2RB0X 4RW1A 2A7DA 1YKZX 4GLAA 2ZWBA 5HMVA 3W6EA 127LA 4LYOA 3A3RX 4H94A 1T97A 185LA 4DD1A 2EPEA 5LXWA 3A93A 1QDTA 1IVMA 3VW7A 4GN5C 4ARMB 5LVGA 1B7OA 1G0JA 1IP7A 2OTYX 1QUHA 4KL7A 1B7LA 4B4JA 1EPYA 1NHBA 4WLYA 2BQLA 5D5FA 3HT9A 2HEFA 4LZMA 4HV2A 4EKQA 4EXMA 3K3TA 1L57A 1WQMA 4AGAA 1C67A 1WVVA 3A95A 1CKHA 1IP4A 2ZILA 1LLHA 1OUIA 1LSFA 3SBAA 1QT3A 228LA 3QNGA 1DYDA 1G1VA 1LSAA 2YBLA 1OVKA 4NGZA 239LA 5FSTA 2HEDA 231LA 2F30A 2B75A 1DI3A 3DN4A 5C6LA 1XJUA 2ZNWY 4FDYA 4HJVA 129LA 1OUEA 5DN5A 3WU8A 1QQYA 2HUMA 1C6EA 3HH3A 1FKQA 1QTZA 3AZ6A 2CGIA 5KKIA 1UACY 1L05A 1TLAA 1LKSA 4X3BA 5KY1A 3D9AC 3HUAA 1GB7A 1LYYA 3LYOA 4O34A 1C61A 4TSCA 1C7PA 1L11A 4W94A 1VAUA 162LA 2W1MA 1B5YA 2DQGY 1P64A 1GF6A 3RZEA 1JPOA 1L39A 2NWDX 4UWUA 1OV7A 153LA 4YXCA 197LA 4DDCA 3QY4A 4XYYA 3A67Y 1GBXA 4NHPA 3FE0A 4W55A 1NWGA 138LA 2AUBA 3NY8A 2XBSA 3M18B 2B74A 1L77A 1GFJA 4G4CA 4IAPA 4R6CA 3CSRA 148LE 1VDPA 1YAOA 1FLUA 173LA 1OUDA 4WLTA 4LDLA 3TXHA 4KT3A 4DYGA 9LYZA 3RW8A 4PRUA 1LJEA 1GFGA 1JKDA 135LA 1L60A 1GB8A 4NSHA 4NGOA 5DM9A 174LA 3WW5A 2Q9EA 5B59A 1QS5A 1JISA 4W96A 2FBBA 3WPKA 4ML7A 3LZTA 1IIZA 4TWSA 4NHIA 1BB4A 2L78A 3DMZA 3N9EA 1D2YA 5E9RA 1P2RA 169LA 1DYCA 1L83A 1VDSA 3TXKA 3L64A 3HT6A 195LA 1FKVA 2N5ZA 3DMXA 192LA 5APFA 1L29A 5JENB 260LA 1P56A 165LA 1L19A 2BQEA 1NDGC 2PC2A 157LA 1SX2A 131LA 1L28A 2F2QA 1L43A 4DAJA 4H9CA 1P6YA 2W1YA 3P64A 1RE2A 4NSGA 3J6KA 3TXJA 4QY9A 2LYMA 2B7XA 2MEAA 4H8XA 3P65A 1KS3A 4NWEA 1LHJA 4Z98A 4G4HA 1A2YC 4QEQA 3HBHA 2DQEY 1C6JA 4I7NA 155LA 1UIEA 257LA 2B6XA 232LA 237LA 1KW5A 4I0CA 2ZYPA 1LGXA 1LJFA 4LYTA 3HDFA 4Z41A 1LI6A 2Z19A 2Q9DA 3WPLA 2DQDY 5LA5A 3GXRA 4W54A 112LA 1L51A 3T6UA 1LSYA 251LA 5KXOA 2VB1A 109LA 1XEPA 4NGYA 1LSNA 1LI3A 1IWVA 1HFYA 1NBZC 3TMXA 1L87A 241LA 1LKRA 1LGWA 5KXXA 1L98A 1DQJC 1IY3A 1LMNA 2LYZA 1L13A 3J4GA 3WU7A 5KKJA 1LPYA 5F9XA 1B5ZA 1L41A 1UCOA 4LT2A 1C6KA 1KIPC 258LA 175LA 2O7AA 2RBQA 1L65A 3G3AB 3CB7A 4ZEEA 1GF9A 1L31A 1LYDA 1D3JA 4EPFA 1CVKA 5EBHA 1LZ1A 1CU5A 1L33A 3IJVA 1D6PA 1IWUA 2ZNXY 1LYHA 1B6IA 2HU1A 1GFHA 5KXZA 133LA 3LYZA 2D4IA 199LA 1L18A 126LA 1T8AA 1ZV5L 1JJ0A 3E3DA 5LVKA 1UIAA 108LA 1FLQA 253LA 1OV5A 1FLWA 3OE0A 4II8A 4QGZA 1BHZA 1HFXA 5IHGA 1Z55A 2BQDA 2Z2FA 154LA 1GFAA 3QAKA 4N8ZA 2OU8A 1DPXA 1PQMA 1L76A 1GB0A 1LMPA 1XGRC 3WU9A 1L92A 1IR8A 1IR9A 2HEAA 2D4KA 1L01A 1YILA 4ETAA 1G1WA 1L44A 4GBRB 1XEJA 1CKGA 1REMA 3NY9A 1XEKA 1L56A 4AXTA 3C82A 2YBIA 3AZ5A 1C43A 2BQKA 2RH1A 2C8OA 2DQAA 4EOFA 1PZYA 1T8GA 176LA 1XSFA 1BWJA 5FEKA 224LA 1HNLA 216LA 2HU3A 1WQPA 1HC0A 1GE4A 4LFXA 220LA 1CKFA 1LZRA 1HFZA 1C6FA 1ZVYB 4ZFPA 2W1XA 222LA 3TXBA 5DN4A 1KIQC 3DN2A 4D9ZA 1OVJA 1F0WA 3TMUA 209LA 1VFBC 1L50A 4GCFA 1DZBX 2H9KA 4WM4A 1PQOA 1F10A 4I7RA 1L82A 196LA 4LDEA 1CV6A 2YSSC 1C6LA 4W57A 3ZEKA 1B7NA 1L17A 1L61A 1C6HA 1HHLA 4WO6A 1L93A 4EKSA 1LYZA 2B6YA 3EXDA 1ZYTA 2BQMA 1L37A 4I7SA 4ETDA 4GN4A 4BADA 4A7DA 1HEPA 2H9JA 3B0IA 2BQJA 3FI7A 4LYZA 214LA 1HSWA 3G3XA 2LZTA 3HTBA 3RNXA 187LA 1SSYA 1LHIA 3HH4A 4GCDA 5L3HA 1L03A 4J7VA 4I7PA 1UICA 183LA 1GB2A 2B5ZA 4ARPA 5F16A 1QT6A 1UUZC 1OWYA 3CDTA 3GXKA 1LPIA 1REYA 163LA 1QSQA 4DD3A 3C83A 1LYGA 1C63A 3WVXA 3DN3A 1C6GA 1V7TA 200LA 4K5YA 259LA 1L48A 1DYEA 3GULA 3HUQA 3DN1A 1CV1A 255LA 1YL0X 4EKRA 5KXRA 1QSWA 1AZFA 3C7YA 1UC0A 217LA 3ZVQB 2IFFY 1HEOA 1LYEA 1QTHA 1GDWA 1GHLA 4LYMA 1WQRA 3TXFA 4B4IA 3DNAA 2BQBA 3GUNA 2YBNA 1AT6A 1CUPA 1GB5A 1LOZA 1GBYA 1L63A 1GF4A 2A7FA 2RAZX 1E8LA 1T8FA 5FDJA 1UA6Y 1IO5A 3A6BY 1NF5A 3A90A 1GF5A 1L42A 2QARC 4NHSA 2IGCA 102LA 123LA 3GUOA 3WULA 2D4JA 1IP6A 4H9HA 1G06A 3C7WA 3EMSA 4XJDA 5LZMA 3CT5A 1C6NA 1C46A 1TAYA 191LA 1C66A 5LYMA 1KY0A 2QB0B 4PK0A 2DQCY 1L64A 4PGJB 1L66A 4ARQB 3PBLA 150LA 4TUNA 2O4WA 5HNCA 252LA 1QSBA 1J1PY 4ARJA 1GB6A 4DD0A 5DL9A 1C69A 2RAYX 1JQUA 4BAFA 4XJIA 1LMOA 1K28A 1SWZA 5KJ9A 4DKLA 1BB3A 3CT1A 227LA 1L27A 3C8RA 1LZYA 151LA 1REXA 1D6QA 1YAQA 3AJNA 2Z37A 1HEWA 168LA 1GB9A 1LJ3A 4HJYA 2YBMA 3LYTA 240LA 1L26A 2YBJA 3HDEA 1L16A 3P4ZA 1C10A 1KY1A 3W3EA 1I6SA 1UIBA 201LA 4ANRA 1GWDA 1OP9B 1QIOA 4N9RA 1L85A 182LA 139LA 1IP2A 8LYZA 2A4TA 4OWEA 3WPJA 1NBYC 1YL1X 2LZMA 3WXUA 4DDAA 1J1OY 3W6AA 1YIKA 1EQ4A 2MEEA 2YDGA 3TMWA 1LHMA 5L3IA 1JJ3A 2CJLA 3HTFA 4WLDA 1QUSA 2RB2X 2XQOA 5E4PA 4N5RA 4MR1A 1L49A 3HT8A 3BKVA 1LHLA 4PJZA 1LSZA 1ZMYL 3FA0A 1D3FA 3HTDA 3AGIA 130LA 3ATNA 1FN5A 2X0AA 2B6TA 1IEEA 1L89A 4KXIA 4LFPA 3WVYA 1L30A 1LSCA 1DYBA 1CU3A 4NSIA 1B2KA 4LDOA 2OE7X 188LA 4B4EA 1SX7A 2B70A 234LA 1NMMA 132LA 1C6CA 3A8ZA 3WW6A 141LA 5C6JA 1IORA 4ZPUA 3CSQA 5ILCA 1LSEA 1WTMA 4I7LA 1PQJA 4ARMA 3WUMA 5APDA 1LZAA 3RT5X 3A3QA 2FBDA 1W08A 4W58A 3SN6R 1CJ8A 1L47A 1L84A 1IP5A 5KXPA 1BVXA 1L81A 5LIOA 4NIJA 1HMKA 261LA 2OE9X 3ULRA 1GF8A 2YVBA 1LHHA 2OEAX 4YOPA 1HENA 3A91A 1QSAA 3KAMA 1L90A 4B1AA 1L12A 3HWLA 2XTHA 1QTKA 5II3A 1LZEA 1GF7A 210LA 1B7RA 1LZSA 3CDQA 198LA 164LA 7LZMA 1C45A 4H9IA 1BB7A 1UIDA 2CUUA 3CT0A 1H87A 1DI5A 225LA 2F2NA 1OVHA 1V7SA 5FHWA 1OQMA 4CHXA 1IC4Y 205LA 5KXTA 3SP3A 1LWKA 3AZ4A 1L32A 1G7HC 4EPIA 1SWYA 3WL2A 2Z38A 1QT4A 4J1BA 1DYGA 1GFTA 1WTNA 2B73A 218LA 4WM5A 5F9UA 4DQ5A 1CKDA 1EQEA 3C7ZA 4PRQA 3A6CY 5T3FA 1VDTA 1GB3A 1CV5A 1IC5Y 1PS5A 3GUPA 1G0PA 3TXGA 2RBOA 4IASA 4ARQA 4E3UA 3G3VA 4HPEA 4HJZA 1TBYA 140LA 3A92A 1DYFA 1I1ZA 1L74A 4NGKA 1PQIA 1GFRA 2BPUA 1UIGA 2B6WA 250LA 2MEDA 2F32A 4LGKA 1GPQC 1ALCA 2W1LA 1L10A 4GCBA 1LSBA 3OK0A 1ZWNA 4OOOA 5APEA 4ET8A 142LA 4I7TA 2F47A 5FCPA 1IR7A 4GRVA 152LA 2HTXA 2LCBA 2Z39A 4C5FA 4WM3A 190LA 207LA 1GFKA 4WG1A 1LYOA 1CU2A 103LA 4XN6A 4ETCA 1LHKA 4M4OA 1HF4A 3P68A 4NGVA 1CUQA 4NFVA 3EMLA 1WVUA 4L41A 134LA 4CFPA 1D0LA 3HU8A 1QS9A 2LZ2A 4H9AA 177LA 3C8SA 1OUJA 4IATA 4XJFA 5KXNA 3RU5A 1LW9A 2D91A 1HEMA 1HSXA 4OO9A 1L0JA 4BS7A 5AMYA 2LHMA 1JSEA 1LZGA 1I56A 3SB8A 1LSMA 3TXEA 3SB6A 1C6MA 5IELA 2RSCA 1MELL 4H9FA 1OYUA 2B72A 247LA 1L97A 110LA 5D5CA 2DKVA 1GFVA 1YQVY 1LZ8A 230LA 1D0MA 1C64A 1L54A 4DC4A 1FLYA 1F6SA 2EQLA 6LYZA 245LA 1L06A 6LYTA 4NGJA 1LZ6A 3W6DA 1LJHA 1LZDA 4NGWA 1L70A 1G0GA 4NWHA 233LA 3GUJA 1G0KA 4H90A 1L38A 1LJJA 1AT5A 4G4BA 3F9LA 1B5XA 1C6QA 3DN8A 5IDDA 4NY5A 2DQIY 4XJGA 1QT5A 5LYZA 4OWHA 213LA 4YF2A 2MEBA 4UWVA 4WM6A 1AKIA 2OU9A 1LSDA 4XJHA 1G0LA 3WYHA 3CQLA 146LA 4H8ZA 1TEWA 1NHEA 1IWYA 1YKYX 1HERA 1LZ5A 5KXMA 1CJ9A 7LYZA 5B1GA 1L25A 226LA 3G3WA 1SQ2L 3QE8A 2HECA 1D9WA 104LA 3HBDA 4WMGA 1LZBA 1IX0A 3D4SA 1GD6A 3N9CA 244LA 1C6IA 3HUKA 193LA 4GLVA 1SLYA 5K7OA 4N1EI 1L52A 4NG1A 144LA 1CTWA 3OJPA 5I4YA 4ET9A 1NKHA 3UONA 5FELA 1GFEA 1CJ7A 2G4NA 2BQCA 1XGUC 156LA 1HMLA 2ZQ4A 4DWXA 4B0DA 243LA 4WM2A 1B7QA 1QUGA 3TXIA 1QTVA 3VWOA 1IOQA 3TXDA 5ILFA 4W51A 107LA 180LA 1C6TA 1T3PA 3C8QA 4I7QA 4IJ4A 1P36A 2BQHA 2GV0A 1IC7Y 1C6PA 1LJNA 4PPOA 4OW1A 1L95A 4HV1A 4H9BA 1L23A 1L24A 5C6IA 3SB9A 3GUMA 1JKCA 1L59A 4H9EA 4XENA 4I7KA 1JHLA 1C6DA 1GAYA 1UIHA 147LA 1LJKA 3B0OA 1GE0A 1L21A 118LA 3F6ZA 3WMKA 3HU9A 1WQNA 4B49A 5I4WA 4YM8A 1XGPC 1BWHA 4HTKA 1YANA 1P7SA 4G49A 4WO9A 2MEIA 158LA 2Y8PA 1MLCE 1L71A 1GBOA 2HEBA 3LYMA 1C68A 1RCMA 4OOTA 2BQGA 1PQDA 3WH1A 5KXYA 2HULA 1GE3A 4YX7C 1L91A 4WLXA 114LA 3NYAA 1L58A 1VATA 1GF0A 128LA 3RUNA 1D2WA 1WTHA 1L14A 125LA 2MEGA 2ANXA 1LMQA 4LT3A 1TDYA 4W52A 1IWXA 4DT3A 254LA 1L09A 1VEDA 4YENA 2DBTA 3K2RA 1G7MC 1XGQC 3LHMA 149LA 4H1PA 4I8SA 2Q0MX 4ETBA 1HELA 3CDVA 3HBEX 1KXYA 1OUFA 4RLMA 2CWIA 1WQOA 2B6ZA 4N1CC 5B05A 3CDOA 249LA 1B7MA 5KXKA 2Z18A 1GFUA 2FYCA 2ZIKA 3AZ7A 1QTBA 5HQ1A 4CFOA 3D3DA 3P66A 1L46A 1L86A 160LA 4WM1A 3IWRA 5KXSA 1C6BA 1EQ5A 1UIFA 3M3UA 1G0QA 4YEOA 4R0FA 2BQIA 4DQ7A 235LA 4NEBA 1L0KA 2F4AA 1LZ9A 5KXWA 2BQFA 3JR6A 1XJTA 1GEZA 1XGTC 3OE9A 1TCYA 3BKHA 5I4XA 1LZTA 1JJ1A 1C08C 1IP1A 4LZTA 1JITA 1OWZA 2MEHA 1QT8A 3C81A 3DN0A 2D6BA 4NHQA 1L36A 3CSZA 1LCNA 1LWGA 3SBBC 1T6VL 1L67A 2O79A 5L9JA 2I6ZA 1REZA 4EMNA 3A34A 256LA 2NTGA 5LYTA 1P3NA 3W6FA 1GE1A 3G3BB 4NHTA 2DQFC 4RW2A 1IWTA 1LSGA 1L62A 1H6MA 2YBHA 1HEQA 1G07A 2LYOA 4DD2A 3RZ4A 1JWRA 1XEIA 1L35A 4TSBA 1OUHA 2OTZX 1KNIA 1I20A 2Z6BA 1B7PA 4KPMA 3AB6A 170LA 1LZCA 1L75A 1OUGA 4U3XB 3AW6A 3V2YA 2G4QA 4I7MA 4MCKA 1JUGA 2EIZC 3PDSA 166LA 1LJIA 3W6BA 2BAAA 3B0KA 1BB6A 1B5VA 1L53A 4XJBA 1P2LA 1FBIX 1GXV2 4DD9A 1L96A 4M6DA 1AM7A 4P2EA 5HNLA 223LA 1JTTL 1JIYA 2OU0X 181LA 5LVHA 1YAMA 1L15A 3EO5A 6LZMA 1G7LC 1KXXA 1CU0A 2LC9A 1QTDA 4HTNA 1L02A 1IY4A 2BQAA 3TMVA 5F14A 1L40A 3AW7A 1IWWA 3GUIA 1GBSA 3HH5A 5HLLA 4H91A 1F6RA 3V2WA 238LA 4Z3MA 1BGIA 1FDLY 4LYBA 5DLAA 2HEEA 2OE4X 1L72A 2RBRA 4TTDA 159LA 2I25L 1QDRA 1CU6A 4QDNA 5A3EA 1LZ4A 4NGIA 145LA 1INUA 3SB7A 194LA 119LA 1CV4A 1B7SA 1P5CA 5LAFA 1NDMC 2Z12A 1LJGA 1L00A 1JKBA 206LA 4TX7A 4NSJA 3AGHA 178LA 3B6LA 2NTHA 1OUBA 3F8VA 4RDSA 248LA 1L22A 1L55A 211LA 3EBAB 1B5WA 4NG8A 1A4VA 171LA 1G7IC 3CDRA 5I53A 4EJ4A 4AQNA 1SSWA 1GEVA 2MECA 111LA 1IOSA 1L88A 1OUCA 1EL1A 236LA 1LJ4A 3L2XA 1G0MA 1C60A 4J1AA 4DDBA 3HH6A 2ZYCA 3C80A 4WL6A 5I14A 4OWAA 3LN2A 1GBWA 1L34A 3OE6A 242LA 4CGEA 5LAGA 1ZVHL 4ZIXA 1GXXA 229LA 1LYFA 5KXLA 4HP0A 1D0KA 1QTEA 1WQQA 1O23A 4CJ2A 1IOCA 4YEMA 1GF3A 5B07A 1LYJA 137LA 2RB1X 2BQNA 4N0JA 1PQKA 4BAPA 4GCEA 2G4PA 1LI2A 1L73A 161LA 219LA 1CKCA 1B5UA 122LA 5I5QA 4LYCA 1D9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LT0 A;  3TXI A;  1VDS A;  3TXK A;  2Z2E A;  3IJU A;  3VWO A;  1IOQ A;  3TXD A;  1FKV A;  3LYT A;  2N5Z A;  5ILF A;  1T3P A;  1YAP A;  2IHL A;  3WXT A;  1UBZ A;  2YBJ A;  4IJ4 A;  2GV0 A;  2BQH A;  3P4Z A;  5APF A;  1IC7 Y;  1C10 A;  5JEN B;  3W3E A;  4WG7 A;  1UIB A;  1LJN A;  1NDG C;  2BQE A;  2PC2 A;  4PPO A;  4OW1 A;  5KKI A;  4ANR A;  1GWD A;  1OP9 B;  5APC A;  1QIO A;  4HV1 A;  4H9B A;  1DKJ A;  4N9R A;  3LZ2 A;  4H9C A;  1RFP A;  4Z46 A;  5C6I A;  2W1Y A;  3P64 A;  1RE2 A;  4NSG A;  3J6K A;  3TXJ A;  4H93 A;  1IP2 A;  2MEF A;  2LYM A;  4QY9 A;  5J7C A;  8LYZ A;  4H8Y A;  1JKC A;  2MEA A;  4H9E A;  4H8X A;  4XEN A;  4OWE A;  1JHL A;  1GAY A;  3P65 A;  3ZVQ A;  3WPJ A;  4NWE A;  1LHJ A;  1NBY C;  1YL1 X;  4Z98 A;  1UIH A;  1J1X Y;  3WXU A;  4DDA A;  1LJK A;  4WL7 A;  4G4H A;  3B0O A;  1J1O Y;  1GE0 A;  3W6A A;  1A2Y C;  4QEQ A;  3F6Z A;  1QUT A;  2DQE Y;  3HBH A;  1YIK A;  1EQ4 A;  2MEE A;  2YDG A;  3WMK A;  3TMW A;  2WAR A;  1UIE A;  1LHM A;  4HSF A;  1WQN A;  5L3I A;  1JJ3 A;  2CJL A;  4B49 A;  2F4G A;  1QUS A;  4WLD A;  5I4W A;  1IP3 A;  5E4P A;  4N5R A;  4I0C A;  4MR1 A;  4YM8 A;  1XGP C;  2ZYP A;  5HMJ A;  1LJF A;  4LYT A;  1LMT A;  1BWH A;  4HTK A;  4Z41 A;  3BKV A;  1YAN A;  1LHL A;  1YKX X;  2Z19 A;  1LSZ A;  1ZMY L;  4G49 A;  4WOA A;  1NQI A;  3WPL A;  2DQD Y;  4WO9 A;  2MEI A;  5LA5 A;  3AGI A;  2Y8P A;  3GXR A;  1MLC E;  3ATN A;  3T6U A;  3AGG G;  1LSY A;  3B72 A;  1FN5 A;  4PJ2 C;  2X0A A;  1GBO A;  5KXO A;  2HEB A;  2VB1 A;  2DQJ Y;  3LYM A;  4GN3 A;  1RCM A;  1IEE A;  4OOT A;  2BQG A;  4KXI A;  4LFP A;  4NGY A;  4XAD A;  3WVY A;  1LSN A;  1LSC A;  3WH1 A;  5KXY A;  4NSI A;  1GE3 A;  1B2K A;  4OWC A;  5I54 A;  1IWV A;  1HFY A;  2FYD A;  1NBZ C;  4WLX A;  1G7J C;  3TMX A;  1JTP L;  1LKR A;  4B4E A;  5KXX A;  1DQJ C;  1LSP A;  1DXJ A;  3A94 A;  2XBR A;  1IY3 A;  1VAT A;  4ETE A;  1CJ6 A;  1NMM A;  1LMN A;  1GF0 A;  2LYZ A;  5M1Y A;  3J4G A;  3ATO A;  2DQH Y;  132L A;  3WU7 A;  5KKJ A;  5F9X A;  1B5Z A;  2MEG A;  3A8Z A;  1LZN A;  3WW6 A;  1IOR A;  3WUA A;  1UCO A;  1LMQ A;  5C6J A;  4LT2 A;  4UWN A;  1KXW A;  2H5Z A;  3CSQ A;  4LT3 A;  1TDY A;  5ILC A;  1IWX A;  1KIP C;  1LSE A;  1IWZ A;  1WTM A;  1LMA A;  4DT3 A;  1GE2 A;  2EKS C;  1VED A;  3G3A B;  3WUM A;  3CB7 A;  4YEN A;  1LZA A;  5APD A;  3RT5 X;  4ZEE A;  4G9S A;  1GF9 A;  2DBT A;  3A3Q A;  4RLN A;  2FBD A;  5EBH A;  1LZ1 A;  1LTM A;  1W08 A;  1G7M C;  2ZQ3 A;  3IJV A;  1XGQ C;  1D6P A;  3LHM A;  1CJ8 A;  3HFM Y;  4H1P A;  1IWU A;  5LIN A;  5LVI A;  2ZNX Y;  4MST A;  1IP5 A;  4I8S A;  2Q0M X;  4LT1 A;  4ETB A;  2HU1 A;  1GFH A;  1HEL A;  5KXP A;  5KXZ A;  5IHG A;  1BVX A;  133L A;  3HBE X;  4GCC A;  1KXY A;  1OUF A;  3LYZ A;  5B06 A;  5LA8 A;  5LIO A;  1BQL Y;  1ZV5 L;  2D4I A;  2CWI A;  4HPI A;  4NIJ A;  1WQO A;  1HMK A;  4RLM A;  1JJ0 A;  3ULR A;  1GF8 A;  2YVB A;  3E3D A;  5LVK A;  4N1C C;  1UIA A;  5B05 A;  1CNS A;  1LHH A;  4NGL A;  4YOP A;  4OWB A;  1FLQ A;  2BQO A;  1JTO L;  1HEN A;  2XJW A;  3A91 A;  1B7M A;  5KXK A;  2Z18 A;  1QSA A;  3T36 A;  1FLW A;  3KAM A;  1GFU A;  2FYC A;  2ZIK A;  4II8 A;  5A3Z A;  3AZ7 A;  1BHZ A;  4QGZ A;  4B1A A;  2C8P A;  2XTH A;  1QTK A;  1BVK C;  1HFX A;  1LZE A;  1RI8 B;  1Z55 A;  1GF7 A;  2BQD A;  2Z2F A;  4H92 A;  4CFO A;  5HQ1 A;  1GBZ A;  1GFA A;  3D3D A;  154L A;  3P66 A;  4N8Z A;  1B7R A;  2I26 L;  1DPX A;  1LZS A;  1GB0 A;  4WM1 A;  1LMP A;  3IWR A;  5KXS A;  1XGR C;  1C45 A;  4H9I A;  5F81 A;  1BB7 A;  1UID A;  1YRO A;  1EQ5 A;  3WU9 A;  3WUN A;  1IR8 A;  3A96 A;  3AYQ A;  1B0D A;  3CT0 A;  1H87 A;  1UIF A;  1DI5 A;  1IR9 A;  2F2N A;  1VDQ A;  2HEA A;  2D4K A;  1YIL A;  2ZIJ A;  3M3U A;  1OUA A;  4ETA A;  4YEO A;  1V7S A;  1XEJ A;  1P2C C;  1W6Z A;  5FHW A;  4R0F A;  4C3W A;  4DD7 A;  1OQM A;  2BQI A;  1JKA A;  1CKG A;  1IC4 Y;  208L A;  1REM A;  2CDS A;  4NEB A;  1LMC A;  1N4F A;  3SP3 A;  4CHX A;  5KXT A;  1DPW A;  3AZ4 A;  5LVJ A;  1XEK A;  1G7H C;  1GAZ A;  2F4A A;  4AXT A;  1LZ9 A;  5KXW A;  2BQF A;  3WL2 A;  2YBI A;  2Z38 A;  3AZ5 A;  1C43 A;  1GEZ A;  1LAA A;  1XGT C;  1TCY A;  2BQK A;  3BKH A;  5I4X A;  1GDX A;  4J1B A;  2C8O A;  2DQA A;  1LZT A;  4EOF A;  1JJ1 A;  1PZY A;  1C08 C;  2BLY A;  1XFP L;  1IP1 A;  4LZT A;  1GFT A;  5II3 A;  1JIT A;  1XSF A;  1BWI A;  1BWJ A;  2MEH A;  3MGW A;  1WTN A;  4J0L A;  5FEK A;  1LYS A;  1DI4 A;  1HNL A;  1DKK A;  1RJC B;  3N9A A;  2D6B A;  2HU3 A;  4NHQ A;  1WQP A;  5B1F A;  3CSZ A;  1LCN A;  1HC0 A;  1GE4 A;  4FJR A;  4PHI A;  1JSF A;  4WM5 A;  4LFX A;  1T6V L;  5F9U A;  1CKF A;  3W6C A;  1LZR A;  1CKD A;  1EQE A;  5L9J A;  2I6Z A;  1HFZ A;  4PRQ A;  1ZVY B;  3A6C Y;  4ZFP A;  5T3F A;  1IOT A;  1VDT A;  2HUB A;  1GB3 A;  1REZ A;  2W1X A;  3TXB A;  5DN4 A;  1KIQ C;  1IC5 Y;  4HTQ A;  1PS5 A;  3A34 A;  4EMN A;  4D9Z A;  1B9O A;  3TXG A;  1JEF A;  1F0W A;  5LYT A;  3TMU A;  1KIR C;  2BLX A;  4IAS A;  1VFB C;  4E3U A;  4HPE A;  1BB5 A;  4GCF A;  1DZB X;  4HJZ A;  2H9K A;  4RW1 A;  1TBY A;  4WM4 A;  1GE1 A;  1F10 A;  3G3B B;  3A92 A;  2DQF C;  4NHT A;  3W6F A;  4RW2 A;  1IWT A;  1LSG A;  2A7D A;  1H6M A;  1YKZ X;  1I1Z A;  2YBH A;  4GLA A;  2ZWB A;  1HEQ A;  2LYO A;  3W6E A;  5HMV A;  4DD2 A;  4NGK A;  3RZ4 A;  2YSS C;  1GFR A;  2BPU A;  4LYO A;  1UIG A;  1JWR A;  3A3R X;  1XEI A;  4H94 A;  3ZEK A;  4TSB A;  1B7N A;  4DD1 A;  1OUH A;  2EPE A;  2MED A;  5LXW A;  3A93 A;  4LGK A;  1QDT A;  1I20 A;  1IVM A;  1B7P A;  1GPQ C;  1ALC A;  4GN5 C;  2W1L A;  4KPM A;  1HHL A;  4GCB A;  4WO6 A;  1LSB A;  5LVG A;  1B7O A;  3AB6 A;  1IP7 A;  4KL7 A;  1LZC A;  1LYZ A;  3OK0 A;  1OUG A;  4OOO A;  1B7L A;  4U3X B;  5APE A;  4B4J A;  4ET8 A;  3AW6 A;  3EXD A;  5FCP A;  2BQM A;  1IR7 A;  2G4Q A;  4WLY A;  2BQL A;  4MCK A;  5D5F A;  1JUG A;  2EIZ C;  2HEF A;  4ETD A;  2HTX A;  4GN4 A;  4BAD A;  4A7D A;  1HEP A;  2H9J A;  1LJI A;  2Z39 A;  3B0I A;  4HV2 A;  207L A;  3K3T A;  1GFK A;  2BQJ A;  1WQM A;  2BAA A;  4WM3 A;  4C5F A;  3B0K A;  4AGA A;  3FI7 A;  4LYZ A;  1HSW A;  1WVV A;  3A95 A;  1CKH A;  1BB6 A;  1B5V A;  4WG1 A;  2LZT A;  1LYO A;  4XJB A;  3RNX A;  4XN6 A;  4M4O A;  4ETC A;  1LHK A;  1LHI A;  1IP4 A;  1HF4 A;  2ZIL A;  3P68 A;  4GCD A;  4NGV A;  5L3H A;  4J7V A;  1OUI A;  4NFV A;  1LSF A;  1UIC A;  1WVU A;  1FBI X;  1GXV 2;  1GB2 A;  2B5Z A;  4L41 A;  4DD9 A;  134L A;  5F16 A;  4M6D A;  1AM7 A;  4P2E A;  3QNG A;  5HNL A;  4CFP A;  1D0L A;  1UUZ C;  3GXK A;  1LSA A;  1JTT L;  1LPI A;  1REY A;  2YBL A;  1JIY A;  2LZ2 A;  4H9A A;  5LVH A;  1YAM A;  4NGZ A;  4DD3 A;  3EO5 A;  1OUJ A;  5FST A;  2HED A;  4IAT A;  1G7L C;  3WVX A;  4XJF A;  1KXX A;  5KXN A;  4HTN A;  1V7T A;  3RU5 A;  2F30 A;  2D91 A;  1HEM A;  1HSX A;  1IY4 A;  4WM2 A;  1DI3 A;  1YL0 X;  5C6L A;  2BQA A;  4BS7 A;  5AMY A;  3TMV A;  2LHM A;  1JSE A;  5F14 A;  2ZNW Y;  1LZG A;  3AW7 A;  1IWW A;  1I56 A;  1LSM A;  3TXE A;  1GBS A;  4FDY A;  5KXR A;  5HLL A;  4H91 A;  1QSW A;  4HJV A;  1AZF A;  1F6R A;  5IEL A;  1OUE A;  5DN5 A;  2RSC A;  1MEL L;  3WU8 A;  1QQY A;  4H9F A;  4Z3M A;  1BGI A;  1FDL Y;  4LYB A;  1UC0 A;  5DLA A;  3ZVQ B;  2HEE A;  2IFF Y;  1HEO A;  1FKQ A;  3AZ6 A;  5D5C A;  2DKV A;  1GFV A;  4TTD A;  2CGI A;  1YQV Y;  1QDR A;  1UAC Y;  2I25 L;  1LZ8 A;  4QDN A;  5A3E A;  1LKS A;  1LZ4 A;  1GDW A;  4NGI A;  3D9A C;  1GHL A;  4X3B A;  3W6B A;  5KY1 A;  1D0M A;  1GB7 A;  1INU A;  4DC4 A;  1FLY A;  1F6S A;  1LYY A;  4LYM A;  2EQL A;  3LYO A;  194L A;  1WQR A;  4O34 A;  6LYZ A;  1B7S A;  4TSC A;  1C7P A;  5LAF A;  3TXF A;  4B4I A;  6LYT A;  1NDM C;  1LZ6 A;  2BQB A;  2Z12 A;  2YBN A;  1LJG A;  1VAU A;  2W1M A;  4NGJ A;  1B5Y A;  4W94 A;  1AT6 A;  3W6D A;  2DQG Y;  1LJH A;  1JKB A;  1GB5 A;  1LOZ A;  1LZD A;  4NSJ A;  3AGH A;  4TX7 A;  4NGW A;  1GBY A;  1GF6 A;  1GF4 A;  1JPO A;  2A7F A;  2NWD X;  3B6L A;  4UWU A;  1OUB A;  4RDS A;  1E8L A;  153L A;  5FDJ A;  4NWH A;  1UA6 Y;  3QY4 A;  4DDC A;  1IO5 A;  4XYY A;  3A67 Y;  3A6B Y;  3EBA B;  1GBX A;  4H90 A;  1NF5 A;  3A90 A;  1LJJ A;  1AT5 A;  1GF5 A;  4G4B A;  3FE0 A;  4NHP A;  4NHS A;  1B5W A;  4NG8 A;  1NWG A;  1A4V A;  1B5X A;  2AUB A;  5IDD A;  1G7I C;  2XBS A;  2DQI Y;  4NY5 A;  3M18 B;  4XJG A;  5I53 A;  5LYZ A;  4OWH A;  1GFJ A;  2MEB A;  4YF2 A;  4UWV A;  4WM6 A;  1GEV A;  4G4C A;  2MEC A;  1IOS A;  1AKI A;  4R6C A;  3CSR A;  3WUL A;  2D4J A;  1VDP A;  1IP6 A;  1OUC A;  1EL1 A;  1LSD A;  4H9H A;  1LJ4 A;  4XJH A;  3EMS A;  3WYH A;  3CQL A;  4XJD A;  1YAO A;  4J1A A;  4DDB A;  3CT5 A;  2ZYC A;  4H8Z A;  1C46 A;  1TAY A;  1NHE A;  1IWY A;  1TEW A;  4WL6 A;  5LYM A;  1YKY X;  4OWA A;  1HER A;  1LZ5 A;  1FLU A;  3LN2 A;  1GBW A;  5KXM A;  1OUD A;  4WLT A;  1CJ9 A;  7LYZ A;  5B1G A;  2DQC Y;  4CGE A;  4PGJ B;  5LAG A;  4TUN A;  1ZVH L;  4ZIX A;  1GXX A;  1SQ2 L;  3QE8 A;  2HEC A;  5HNC A;  5KXL A;  3HBD A;  3TXH A;  4HP0 A;  4WMG A;  1D0K A;  1QTE A;  1WQQ A;  1LZB A;  1IX0 A;  1IOC A;  1O23 A;  1GD6 A;  4YEM A;  1J1P Y;  4KT3 A;  4DYG A;  3N9C A;  4CJ2 A;  9LYZ A;  193L A;  1GF3 A;  3RW8 A;  4PRU A;  5B07 A;  1LJE A;  4GLV A;  1SLY A;  1GFG A;  1JKD A;  5K7O A;  1GB6 A;  4N1E I;  135L A;  1GB8 A;  4DD0 A;  4NG1 A;  4NSH A;  5DL9 A;  3OJP A;  4NGO A;  2BQN A;  5DM9 A;  4N0J A;  3WW5 A;  4BAF A;  4XJI A;  5I4Y A;  4BAP A;  4ET9 A;  1LMO A;  5KJ9 A;  4GCE A;  5B59 A;  1NKH A;  1BB3 A;  2G4P A;  3CT1 A;  1JIS A;  4W96 A;  5FEL A;  1GFE A;  2FBB A;  3WPK A;  4ML7 A;  1LZY A;  1CKC A;  1B5U A;  1REX A;  3LZT A;  1IIZ A;  1CJ7 A;  1D6Q A;  4TWS A;  4NHI A;  1BB4 A;  1YAQ A;  2G4N A;  2Z37 A;  3AJN A;  2BQC A;  3N9E A;  5I5Q A;  5E9R A;  1HEW A;  1XGU C;  4DWX A;  1HML A;  2ZQ4 A;  4LYC A;  1GB9 A;  1LJ3 A;  4HJY A;  1D9U A;  1B7Q A;  4B0D A;  2YBM A; 
#chains in the Genus database with same CATH topology
 4LT0 A;  3L28 A;  2Z2E A;  3EIE A;  3IJU A;  3T1Y M;  1D3M A;  1L04 A;  1YAP A;  2IHL A;  3WXT A;  2EKK A;  1UBZ A;  2DZN B;  4B3T M;  1SG9 A;  3A42 A;  3LCV B;  4WG7 A;  2NQ8 C;  3FYD A;  4LJ7 A;  1ZUR A;  2BJV A;  5APC A;  5ITT A;  1JTM A;  1DKJ A;  4LJA A;  1CV0 A;  2RBP A;  1RFP A;  2EKF A;  3LZ2 A;  1WGN A;  4Z46 A;  2DKL A;  4H93 A;  2MEF A;  5J7C A;  1WGL A;  4LF9 M;  4H8Y A;  2RRU A;  2DAK A;  4E97 A;  1L2C A;  1WXQ A;  5EP1 A;  1IY2 A;  3ZVQ A;  2BWE A;  4IBI A;  1QAN A;  1L45 A;  4W53 A;  1J1X Y;  4EKP A;  3C9P A;  4WL7 A;  3DOA A;  4DUY M;  1P46 A;  1CX7 A;  1T6H A;  1L20 A;  1QUT A;  2HUK A;  1KW7 A;  4ZPX A;  2WAR A;  4HSF A;  5DYG A;  1L69 A;  2F4G A;  2VF7 A;  1IP3 A;  1L07 A;  246L A;  1IXS B;  5HMJ A;  1LMT A;  189L A;  262L A;  1YKX X;  2XFT A;  4WOA A;  1NQI A;  1QAO A;  5ITX A;  2ZAO A;  3GPY A;  2KEB A;  3OTO M;  3AGG G;  3B72 A;  4PJ2 C;  1DV0 A;  2DQJ Y;  1QUD A;  3QWL A;  2UXB M;  3FAD A;  4GN3 A;  4XAD A;  2ZTD A;  4PCZ A;  167L A;  1L80 A;  1LYI A;  4OWC A;  5I54 A;  4W59 A;  2FYD A;  3T15 A;  1G7J C;  4DJH A;  1L94 A;  1JTP L;  1N75 A;  1LSP A;  4L16 A;  4LRT A;  1DXJ A;  3A94 A;  2LWX A;  2XBR A;  4ETE A;  1CJ6 A;  4W56 A;  5M1Y A;  3ATO A;  2DQH Y;  1P37 A;  2ZAM A;  4X65 M;  1LZN A;  3WUA A;  3IHP A;  4UWN A;  1KXW A;  2H5Z A;  1L99 A;  3FTD A;  3SYL A;  2EUC A;  3F92 A;  1IWZ A;  143L A;  1ZMV A;  1LMA A;  1GE2 A;  1XNR M;  4QHS A;  2EKS C;  1L68 A;  3HT7 A;  113L A;  215L A;  1CUK A;  4G9S A;  4RLN A;  1LTM A;  1LGU A;  3SFZ A;  2ZQ3 A;  115L A;  2M5Z A;  1TF0 B;  3HFM Y;  5LIN A;  2K47 A;  1XMO M;  2JY8 A;  5LVI A;  3FI5 A;  4MST A;  1IN5 A;  3HTG A;  4LT1 A;  3LZM A;  4GCC A;  5B06 A;  5LA8 A;  1VEK A;  3KFU G;  1BQL Y;  3FUT A;  1N32 M;  1QUO A;  3VKH A;  4HPI A;  4NSO B;  4LCB A;  4I7O A;  1L79 A;  1CNS A;  4NGL A;  4OWB A;  2BQO A;  1JTO L;  2RBS A;  2XJW A;  3KOX E;  1DYA A;  4CHT B;  3T36 A;  3KDS E;  1D3N A;  2ANV A;  1NNU C;  4JI4 M;  1C6A A;  5A3Z A;  2MR9 A;  2UXC M;  3KSJ A;  2C8P A;  4NL4 H;  1BVK C;  1RI8 B;  4H92 A;  3CGW A;  2ZTC A;  4XBO A;  1GBZ A;  2RBN A;  1MJG M;  2I26 L;  2UUB M;  4S0W A;  1YLA A;  5F81 A;  1YRO A;  120L A;  3WUN A;  3A96 A;  3AYQ A;  4YXA C;  1B0D A;  3OE8 A;  5FTN A;  1VDQ A;  3GUK A;  3FUX A;  2ZIJ A;  2HHH M;  1OUA A;  3J81 S;  1P2C C;  1W6Z A;  1L08 A;  1XWI A;  3DKE X;  4C3W A;  4DD7 A;  1JKA A;  208L A;  2CDS A;  1LMC A;  1N4F A;  4I7J A;  5LVJ A;  1DPW A;  1GAZ A;  3L29 A;  4NOO B;  2CP8 A;  1LAA A;  3DN6 A;  1C65 A;  1GDX A;  3SB5 A;  1QTC A;  5ITX E;  1N77 A;  2BLY A;  1CX6 A;  1XFP L;  3MGW A;  3ZH9 B;  1BWI A;  4J0L A;  184L A;  1LYS A;  1DI4 A;  212L A;  1DKK A;  2DAI A;  1RJC B;  221L A;  3N9A A;  4IJF A;  4DQJ A;  5B1F A;  4HEO A;  4OW0 A;  4FJR A;  4PHI A;  1JTN A;  3U60 A;  172L A;  4S12 A;  1JSF A;  1QT7 A;  3DMV A;  3NBI A;  186L A;  3A98 B;  3W6C A;  1JQJ C;  3IEC A;  1IOT A;  4LF5 M;  2HUB A;  3ODU A;  4ARL A;  2DZO B;  4HTQ A;  1B9O A;  1PJJ A;  1CV3 A;  1JEF A;  4LF6 M;  1C62 A;  1TH4 A;  1KIR C;  2BLX A;  1BB5 A;  2RB0 X;  4RW1 A;  2DNA A;  3C3D A;  2R46 A;  4FWD A;  3FTC A;  4DV2 M;  1HQC A;  1P3Q Q;  2A7D A;  1YKZ X;  4GLA A;  2ZWB A;  5HMV A;  3W6E A;  127L A;  4QHT A;  4LYO A;  3A3R X;  4H94 A;  1T97 A;  185L A;  4GHA A;  1E32 A;  1UM8 A;  4PD2 A;  2EPE A;  4DD1 A;  5LXW A;  3A93 A;  1QDT A;  1IVM A;  3VW7 A;  4GN5 C;  4ARM B;  5LVG A;  1B7O A;  1G0J A;  1IP7 A;  2OTY X;  1QUH A;  4KL7 A;  1XNQ M;  1B7L A;  4B4J A;  2G3Q A;  3K8Z A;  1EPY A;  1NHB A;  4WLY A;  4P16 A;  2BQL A;  5D5F A;  3HT9 A;  2HEF A;  4LZM A;  3RE8 A;  4HV2 A;  4EKQ A;  4EXM A;  3K3T A;  4KLN A;  4WW0 A;  1L57 A;  3AFH A;  1WQM A;  4AGA A;  5F3W A;  1C67 A;  1WVV A;  3A95 A;  1CKH A;  3U6O A;  1IP4 A;  2JNH A;  2Z7J A;  2ZIL A;  1LLH A;  1T3T A;  1OUI A;  4A3V B;  3FD9 A;  1VDL A;  1LSF A;  3SBA A;  3R8F A;  4DR6 M;  3WHK A;  1QT3 A;  228L A;  3QNG A;  1DYD A;  1G1V A;  3U5Z B;  2MGW A;  1LSA A;  2YBL A;  3UK6 A;  3HHW A;  1OVK A;  4NGZ A;  4LGY A;  239L A;  3GQ4 A;  5FST A;  2HED A;  4B3S M;  1GJS A;  4DWX A;  1OIZ A;  231L A;  2H5X A;  1SXJ C;  2F30 A;  2B75 A;  4MH0 E;  4NRW A;  1DI3 A;  3DN4 A;  5C6L A;  3IG5 A;  2VF8 A;  1DO0 A;  1XJU A;  2ZNW Y;  1IN6 A;  4D80 A;  4BB9 A;  2M60 A;  4FDY A;  2VDB B;  4HJV A;  129L A;  1OUE A;  5DN5 A;  4DR3 M;  3WU8 A;  1QQY A;  2HUM A;  1C6E A;  1OIP A;  3HH3 A;  2BWB A;  1R2Z A;  4GC5 A;  2W82 A;  4LJ5 A;  8CAT A;  3TWM A;  1FKQ A;  1QTZ A;  3AZ6 A;  1L1Z A;  1IM2 A;  3TPZ A;  2CGI A;  5KKI A;  3H4J A;  1UAC Y;  1QZE A;  1L05 A;  1LKS A;  1TLA A;  4X3B A;  5KY1 A;  2DXI A;  3D9A C;  3HUA A;  1GB7 A;  1LYY A;  4M9Z A;  2X8A A;  3LYO A;  4AW4 A;  4O34 A;  3U6E A;  3IG8 A;  4M9S A;  1C61 A;  4TSC A;  1C7P A;  3NBX X;  1L11 A;  4W94 A;  4GIT A;  162L A;  1VAU A;  2W1M A;  1B5Y A;  2DQG Y;  3SAS A;  1TH2 A;  4MGI E;  3MHV C;  1J5E M;  1P64 A;  1GF6 A;  3AJI B;  1JPO A;  1L39 A;  2NWD X;  4UWU A;  3RZE A;  1OV7 A;  153L A;  1T43 A;  3SBJ A;  4RF1 A;  4YXC A;  197L A;  4DDC A;  3QY4 A;  4XYY A;  3A67 Y;  4NXM M;  1GBX A;  1Z5C A;  4QOZ C;  3K9P A;  4NHP A;  1PRB A;  3FE0 A;  4W55 A;  1NWG A;  138L A;  2AUB A;  3NY8 A;  2XBS A;  3M18 B;  2B74 A;  4EIW A;  1L77 A;  1GFJ A;  4G4C A;  1TTE A;  4IAP A;  4R6C A;  3CSR A;  148L E;  2DAM A;  3J2P B;  1VDP A;  4DV4 M;  1G71 A;  1YAO A;  2KHH A;  2F5Q A;  1ZAE A;  1FLU A;  173L A;  1OUD A;  4WLT A;  1JR3 E;  1W5T A;  4LDL A;  4YY3 M;  4B3M M;  3SHF A;  4MGY E;  3AKZ A;  3TXH A;  2O01 F;  4KT3 A;  3M6A A;  4DYG A;  9LYZ A;  1N33 M;  3J7B A;  3RW8 A;  4PRU A;  1LJE A;  1GFG A;  1JKD A;  3GRU A;  135L A;  1L60 A;  1GB8 A;  4NSH A;  4L78 A;  4NGO A;  2ZM6 M;  5DM9 A;  174L A;  3WW5 A;  1K82 A;  4G4Q A;  4JI7 M;  1PJQ A;  2Q9E A;  3AV0 A;  5B59 A;  1QS5 A;  1GAB A;  1JIS A;  4W96 A;  4WUR A;  2FBB A;  3WPK A;  4ML7 A;  2DWN A;  3LZT A;  1IIZ A;  1H6U A;  4TWS A;  4NHI A;  1BB4 A;  1QVR A;  4R71 A;  2L78 A;  3DMZ A;  3KP0 E;  1D2Y A;  3N9E A;  5E9R A;  1P2R A;  1DYC A;  169L A;  1L83 A;  1VDS A;  3TXK A;  4IBG A;  3L64 A;  3HT6 A;  195L A;  1FKV A;  2N5Z A;  3HU3 A;  3U6Q A;  3MMP A;  3DMX A;  192L A;  1EFU B;  2L6O A;  1L29 A;  5APF A;  5JEN B;  260L A;  2L7I A;  1P56 A;  165L A;  3HHY A;  1L19 A;  2BQE A;  1NDG C;  2PC2 A;  157L A;  4OX9 M;  1SX2 A;  131L A;  1L28 A;  1TGU A;  2F2Q A;  2LHC A;  1L43 A;  4DAJ A;  4H9C A;  1P6Y A;  2W1Y A;  3P64 A;  1RE2 A;  4NSG A;  3J6K A;  2CEA A;  3TXJ A;  4QY9 A;  2LYM A;  4M9X A;  3BOS A;  2B7X A;  2MEA A;  3U6M A;  4H8X A;  3P65 A;  1KS3 A;  4NWE A;  1FJG M;  1LHJ A;  4Z98 A;  2F5S A;  4FVM A;  3H4M A;  4G4H A;  1A2Y C;  5FTK A;  4QEQ A;  1Z5A A;  5DFL A;  2DQE Y;  3HBH A;  1C6J A;  4I7N A;  155L A;  1UIE A;  3K1J A;  257L A;  2B6X A;  232L A;  237L A;  1KW5 A;  4I0C A;  2ZYP A;  1LGX A;  1LJF A;  4LYT A;  3HDF A;  4Z41 A;  2L4F A;  1LI6 A;  2Z19 A;  2Q9D A;  3WPL A;  2DQD Y;  5LA5 A;  1SXJ B;  3GXR A;  4W54 A;  112L A;  1Q3C A;  1L51 A;  3T6U A;  4IBK A;  4G4O A;  1LSY A;  1QAM A;  251L A;  5KXO A;  2VB1 A;  109L A;  4DR5 M;  1UFZ A;  2C99 A;  1XEP A;  4NGY A;  1LSN A;  1LI3 A;  3V76 A;  1J09 A;  4MGK E;  5ITY A;  1IWV A;  1HFY A;  1NBZ C;  3TMX A;  1L87 A;  1XMQ M;  5L8R F;  1LKR A;  241L A;  1LGW A;  5KXX A;  1L98 A;  1DQJ C;  3ZQJ A;  3KXE C;  1IY3 A;  1LMN A;  2LYZ A;  1L13 A;  3J4G A;  1AUA A;  4DBG B;  2CV1 A;  4DUZ M;  3WU7 A;  5KKJ A;  1LPY A;  5F9X A;  3FRH A;  1B5Z A;  1L41 A;  1UCO A;  4LT2 A;  1C6K A;  4I81 A;  2V6Z M;  1KIP C;  258L A;  175L A;  2O7A A;  2CV2 A;  2RBQ A;  5EXP A;  1L65 A;  3G3A B;  3FUW A;  3CB7 A;  4ZEE A;  2UXD M;  1GF9 A;  1L31 A;  1LYD A;  2QQ8 A;  1D3J A;  4EPF A;  1CVK A;  5EBH A;  3CF2 A;  1LZ1 A;  1CU5 A;  1L33 A;  4M0D A;  3IJV A;  1D6P A;  3GPU A;  4IBB A;  2DZL A;  1IWU A;  2ZNX Y;  1LYH A;  5EQT A;  3FKE A;  1B6I A;  2LXE A;  2HU1 A;  1GFH A;  5KXZ A;  133L A;  3LYZ A;  1L18 A;  199L A;  1T8A A;  126L A;  3AOG A;  1ZV5 L;  2D4I A;  2JWS A;  2JZ0 A;  1JJ0 A;  3E3D A;  5LVK A;  1UIA A;  108L A;  1FLQ A;  3U6L A;  253L A;  1OV5 A;  1GO5 A;  1FLW A;  4OU7 A;  5EXS A;  3OE0 A;  4II8 A;  5LMU M;  1BHZ A;  4QGZ A;  1E94 E;  1Z5B A;  4D82 A;  3VLF B;  1XB2 B;  1HFX A;  5IHG A;  1Z55 A;  5DYI A;  2BQD A;  2Z2F A;  154L A;  4JN6 A;  1GFA A;  4Y28 F;  3QAK A;  4N8Z A;  2OU8 A;  1DPX A;  1PQM A;  1L76 A;  1GB0 A;  4JI8 M;  3PXG A;  4AKH A;  1LMP A;  1XGR C;  4L15 A;  3WU9 A;  1L92 A;  3SAR A;  1IR8 A;  1IXZ A;  4DR7 M;  2QPA A;  3HY5 A;  1IR9 A;  2HEA A;  2D4K A;  1L01 A;  4DR1 M;  1YIL A;  4ETA A;  1G1W A;  1L44 A;  4GBR B;  1XEJ A;  1LV7 A;  2J7O A;  1CKG A;  1REM A;  1KSF X;  3NY9 A;  1XEK A;  1L56 A;  1NVM A;  1WHC A;  3C82 A;  4AXT A;  1XXH A;  2MH8 A;  2YBI A;  3AZ5 A;  1C43 A;  2HKJ A;  2BQK A;  2RH1 A;  2C8O A;  4FW9 A;  2DQA A;  4EOF A;  1PZY A;  1IY1 A;  2DWZ B;  1T8G A;  3PNY A;  1Z6T A;  176L A;  1XSF A;  1BWJ A;  5FEK A;  224L A;  1HNL A;  2XF3 A;  2XFS A;  216L A;  2HU3 A;  1WQP A;  1HC0 A;  1GE4 A;  2V1C A;  4KOD A;  4LFX A;  220L A;  1CKF A;  1LZR A;  2EA0 A;  1HFZ A;  3QYE A;  1C6F A;  4NSR A;  1ZVY B;  3K9O A;  4ZFP A;  4GC9 A;  2W1X A;  1I94 M;  222L A;  3GLG B;  3TXB A;  5DN4 A;  1KIQ C;  3DN2 A;  4D9Z A;  1XHB A;  1OVJ A;  1F0W A;  1G59 A;  3TMU A;  209L A;  2JP7 A;  3M0E A;  1VFB C;  1L50 A;  4GCF A;  1DZB X;  2H9K A;  4WM4 A;  1PQO A;  1F10 A;  4I7R A;  1L82 A;  196L A;  5A2Q S;  4LDE A;  3ZC7 B;  1CV6 A;  2RGO A;  4DV7 M;  4JI0 M;  2YSS C;  1C6L A;  4W57 A;  3ZEK A;  4I8O A;  1B7N A;  1NV9 A;  4XK8 F;  1L17 A;  1L61 A;  1C6H A;  1HHL A;  4WO6 A;  1L93 A;  4EKS A;  1LYZ A;  3E9S A;  2B6Y A;  3EXD A;  1OQY A;  1ZYT A;  3VK7 A;  2BQM A;  2J7N A;  1L37 A;  4I7S A;  4ETD A;  4GN4 A;  2VQF M;  4BAD A;  1HNZ M;  4A7D A;  1HEP A;  2H9J A;  3W0L B;  3B0I A;  1EE8 A;  2BQJ A;  3FI7 A;  3GO8 A;  4AQY M;  214L A;  1HSW A;  1GL6 A;  4LYZ A;  3DA1 A;  3G3X A;  2LZT A;  3HTB A;  3RNX A;  187L A;  3HWS A;  1SSY A;  1LHI A;  3HH4 A;  4GCD A;  5L3H A;  1L03 A;  4J7V A;  4I7P A;  1UIC A;  183L A;  3B7N A;  1GB2 A;  2B5Z A;  3R9X B;  3SYK A;  4ARP A;  2R62 A;  3VDP A;  5F16 A;  1QT6 A;  2JXN A;  2DAG A;  4BBA A;  3FTF A;  1OWY A;  1UUZ C;  3CDT A;  3GXK A;  1LPI A;  1REY A;  163L A;  1QSQ A;  4DD3 A;  3C83 A;  1LYG A;  2FS1 A;  1C63 A;  3WVX A;  2JUJ A;  3DN3 A;  2F4V M;  1C6G A;  1V7T A;  200L A;  4Z6Y A;  4K5Y A;  259L A;  1L48 A;  1DYE A;  3GUL A;  3HUQ A;  3DN1 A;  1CV1 A;  255L A;  1YL0 X;  5EXT A;  3L27 A;  1G41 A;  2OPF A;  4EKR A;  4G6Z A;  5KXR A;  4RNA A;  1QSW A;  1AZF A;  2C98 A;  3PFI A;  4LG2 A;  3C7Y A;  2DHY A;  3JAM S;  1UC0 A;  217L A;  3KOY E;  2I7P A;  5H37 D;  3W67 A;  3ZVQ B;  1QYR A;  1VEJ A;  2IFF Y;  1HEO A;  1C1K A;  3DFZ A;  3GLI B;  3HKP A;  2XSZ D;  3HHZ A;  1LYE A;  2EO2 A;  1QTH A;  4G4N A;  1GDW A;  4DR4 M;  1GHL A;  1XXH B;  1NJF A;  4LYM A;  4XGI A;  3GRR A;  5FTM A;  1WQR A;  2F5N A;  3TXF A;  4Z8X A;  4B4I A;  1IN7 A;  1FNN A;  2BQB A;  3DNA A;  4GRI A;  2C9C A;  2YBN A;  3GUN A;  3W68 A;  1AT6 A;  2QZ4 A;  4IBC A;  1CUP A;  1GB5 A;  1LOZ A;  1L8Q A;  1GBY A;  1L63 A;  1GF4 A;  2A7F A;  2RAZ X;  1E8L A;  1T8F A;  1HT1 E;  5FDJ A;  2LHG A;  1UA6 Y;  1IO5 A;  4KO8 A;  3GLI A;  3A6B Y;  1NF5 A;  3A90 A;  1GF5 A;  1L42 A;  2QAR C;  4NHS A;  1HQY E;  2IGC A;  1GJT A;  4JI5 M;  2K6B A;  2XSZ A;  2XZF A;  102L A;  4JXJ A;  123L A;  3GUO A;  3WUL A;  2D4J A;  2LBC A;  2LVA A;  3GQ3 A;  1IP6 A;  4H9H A;  1XXH E;  1G06 A;  3C7W A;  3EMS A;  4XJD A;  2UUC M;  3GLF E;  5LZM A;  3HHX A;  3CT5 A;  4QNM A;  1C6N A;  1C46 A;  1J7K A;  3GLH E;  191L A;  1C66 A;  1TAY A;  5LYM A;  1KY0 A;  5BR8 M;  4F1I A;  1HNX M;  2QB0 B;  3B7Q A;  2O25 A;  4PK0 A;  2DQC Y;  1L64 A;  1L66 A;  4PGJ B;  3UJN A;  3PBL A;  1N34 M;  150L A;  4TUN A;  4ARQ B;  2O4W A;  2D7G A;  5HNC A;  252L A;  1QSB A;  1J1P Y;  2L09 A;  4ARJ A;  3HJS A;  1ORY B;  3U6S A;  1GLN A;  1PJI A;  3JR5 A;  1GB6 A;  4JI6 M;  4DD0 A;  5DL9 A;  1C69 A;  2RAY X;  2B3T A;  1JQU A;  4BAF A;  1AIP C;  4XJI A;  1LMO A;  1K28 A;  1SWZ A;  1NV8 A;  1GKI A;  5KJ9 A;  4DKL A;  1BB3 A;  3CT1 A;  2R45 A;  4LF7 M;  227L A;  1L27 A;  2UU9 M;  3C8R A;  1LZY A;  151L A;  1REX A;  3LVV A;  3B74 A;  1D6Q A;  1YAQ A;  2OQ4 A;  2Z37 A;  3AJN A;  3VFD A;  1HEW A;  168L A;  2KW0 A;  1GB9 A;  1LJ3 A;  4HJY A;  2YBM A;  2MRO B;  1V34 A;  3GQ5 A;  1IBM M;  3U5Z A;  1C7Y A;  3LYT A;  3GP1 A;  3GRY A;  240L A;  1L26 A;  2YBJ A;  3HDE A;  1L16 A;  3P4Z A;  1Q3B A;  1C10 A;  1KY1 A;  3W3E A;  1I6S A;  3K92 A;  1OKS A;  1UIB A;  2KZS A;  1QAQ A;  201L A;  4LZZ A;  4ANR A;  1GWD A;  1OP9 B;  1QIO A;  5KQD A;  1NO1 A;  2R4E A;  3E4R A;  4IBF A;  4N9R A;  1L85 A;  4B08 A;  182L A;  5EP3 A;  139L A;  1IP2 A;  8LYZ A;  1DGH A;  2A4T A;  4OWE A;  3LQR A;  3SAT A;  3WPJ A;  4PDI A;  1NBY C;  1RU3 A;  1YL1 X;  2LZM A;  2Q2E B;  3WXU A;  4DDA A;  1K3X A;  1J1O Y;  4P17 A;  3W6A A;  1HT2 E;  4AKI A;  1SXJ E;  1YIK A;  2JY6 B;  1EQ4 A;  4KT0 F;  2MEE A;  2YDG A;  3TMW A;  4LFC M;  1LHM A;  5L3I A;  1JJ3 A;  2CJL A;  3HTF A;  4WLD A;  1QUS A;  2WSF F;  1VEG A;  2XGN A;  2RB2 X;  2XQO A;  5E4P A;  4N5R A;  4MR1 A;  3D8L A;  2ZBK B;  1L49 A;  3HT8 A;  3BKV A;  2R0I A;  1LHL A;  4PJZ A;  1LSZ A;  1ZMY L;  3FA0 A;  1D3F A;  5KPR A;  4B7F A;  3HTD A;  3AGI A;  2XH9 A;  130L A;  3ATN A;  1FN5 A;  4F2L A;  2X0A A;  1GL7 A;  2J5Y A;  3GPX A;  2B6T A;  2KDL A;  3UZU A;  1IEE A;  3KW6 A;  1L89 A;  4KXI A;  4LFP A;  3WVY A;  1L30 A;  1LSC A;  1DYB A;  1CU3 A;  4NSI A;  1DGB A;  4L6V 6;  1B2K A;  4LDO A;  2OE7 X;  3B89 A;  188L A;  4B4E A;  1SX7 A;  2B70 A;  3CF0 A;  4GMQ A;  234L A;  1NMM A;  2YFQ A;  1MU5 A;  3HZJ A;  1L2B A;  132L A;  1C6C A;  2QNJ A;  3A8Z A;  3WW6 A;  141L A;  5C6J A;  1IOR A;  2HCB A;  4ZPU A;  3CSQ A;  3BXW A;  2QBY A;  5ILC A;  2CUZ A;  1LSE A;  1WTM A;  4I7L A;  1PQJ A;  4ARM A;  3WUM A;  5APD A;  1LZA A;  3RT5 X;  3A3Q A;  2FBD A;  1W08 A;  4W58 A;  1VDD A;  3SN6 R;  1CJ8 A;  3I01 M;  1NJG A;  3FYC A;  2UUA M;  1L47 A;  1IQP A;  4GKK M;  1L84 A;  1IP5 A;  5KXP A;  1ZQ9 A;  1BVX A;  1L81 A;  5LIO A;  3GLG A;  4NIJ A;  4I4L A;  1HMK A;  4RKU F;  261L A;  2OE9 X;  1GF8 A;  3ULR A;  2YVB A;  1LHH A;  2OEA X;  4YOP A;  1PJS A;  1HEN A;  3A91 A;  1IN8 A;  4D81 A;  2L4E A;  1QSA A;  3KAM A;  3J80 S;  2KNZ A;  2OOA A;  1L90 A;  4B1A A;  1L12 A;  3HWL A;  4B7G A;  1XC8 A;  2XTH A;  1QTK A;  5II3 A;  1LZE A;  1GF7 A;  210L A;  1B7R A;  1ZMU A;  2YQZ A;  5IRE B;  1LZS A;  3CDQ A;  198L A;  1T6O A;  3HU2 A;  164L A;  2WZJ A;  3QYB A;  5ITQ A;  7LZM A;  5IT9 S;  1C45 A;  4H9I A;  2VII A;  1BB7 A;  1UID A;  4BLC A;  3MK6 A;  2CUU A;  1DGG A;  3I04 M;  1H87 A;  3CT0 A;  3L2A A;  1DI5 A;  225L A;  5GKN A;  1VG5 A;  2F2N A;  3I51 A;  1OVH A;  1V7S A;  5FHW A;  1ZMW A;  1OQM A;  4CHX A;  1IC4 Y;  1OAI A;  205L A;  5KXT A;  3SP3 A;  2N35 A;  1LWK A;  4W5W A;  3AZ4 A;  1L32 A;  1G7H C;  4EPI A;  1SWY A;  3LMM A;  1WIV A;  3WL2 A;  5FTL A;  2Z38 A;  1QT4 A;  1ZV1 A;  5FSW A;  3K2L A;  4CIZ A;  4J1B A;  1DYG A;  3U6D A;  2C96 A;  1GFT A;  1WTN A;  2B73 A;  218L A;  4GHL A;  4WM5 A;  2X4A A;  5F9U A;  2F5O A;  2R18 A;  4DQ5 A;  1CKD A;  1EQE A;  3C7Z A;  4AI6 A;  4PRQ A;  1K3W A;  3A6C Y;  5T3F A;  1VDT A;  1GB3 A;  1Z59 A;  4R7G A;  1CV5 A;  3SMP A;  1IC5 Y;  1PS5 A;  3GUP A;  1G0P A;  3TXG A;  5EXX A;  2RBO A;  4JI1 M;  4IAS A;  4ARQ A;  4E3U A;  3G3V A;  4HPE A;  4HJZ A;  1TBY A;  140L A;  1JB0 F;  3A92 A;  1DYF A;  4MGZ E;  2Z4S A;  1I1Z A;  1L74 A;  7CAT A;  4NGK A;  1PQI A;  1GFR A;  2BPU A;  1UIG A;  2B6W A;  1IXS A;  4K0K M;  3LW5 F;  250L A;  1QQW A;  2MED A;  2F32 A;  4LGK A;  2QHO B;  1GPQ C;  3KSX A;  1ALC A;  2W1L A;  1L10 A;  4GCB A;  3THG A;  1LSB A;  3OK0 A;  1ZWN A;  2C5R A;  4OOO A;  3KOW E;  5APE A;  4ET8 A;  142L A;  4I7T A;  2F47 A;  4MM3 B;  5FCP A;  1IR7 A;  4GRV A;  5KPZ A;  4B7H A;  4II7 A;  152L A;  2HTX A;  4LFB M;  2LCB A;  1GVN A;  2Z39 A;  4C5F A;  4WM3 A;  190L A;  207L A;  2P5T A;  1GFK A;  4OVZ B;  1X37 A;  4WG1 A;  1I4W A;  1LYO A;  1CU2 A;  103L A;  4XN6 A;  4ETC A;  2H1R A;  1LHK A;  4M4O A;  1HF4 A;  2FFJ A;  3P68 A;  4NGV A;  1CUQ A;  3CF6 E;  4NFV A;  3EML A;  1VQ1 A;  1WVU A;  1SXJ A;  3W0F A;  2KXE A;  4L41 A;  134L A;  3U61 B;  3C58 A;  4CFP A;  1D0L A;  3Q8X A;  3HU8 A;  1QS9 A;  2LZ2 A;  4H9A A;  3TQS A;  177L A;  2DI0 A;  4NRV A;  3C8S A;  1OUJ A;  4IAT A;  2FOI C;  3E46 A;  4XJF A;  2O5R A;  5KXN A;  2FE8 A;  3HGI A;  3RU5 A;  1LW9 A;  2D91 A;  1HEM A;  4LJ6 A;  1HSX A;  4OO9 A;  4LJ9 A;  2APL A;  2K0B X;  1L0J A;  4BS7 A;  5AMY A;  2LHM A;  2HWJ A;  1JSE A;  4IBE A;  1HNW M;  1LZG A;  1I56 A;  3SB8 A;  3SAV A;  1LSM A;  3TXE A;  3KOZ E;  3SB6 A;  3RGS A;  1DGH B;  3ILK A;  1C6M A;  1JR3 D;  5IEL A;  2RSC A;  1MEL L;  1Y8G A;  4QNR A;  1E9R A;  2WSC F;  2G5G X;  2KNA A;  4DV1 M;  4H9F A;  1OYU A;  2B72 A;  247L A;  1L97 A;  5IZ7 D;  110L A;  2WSE F;  5D5C A;  2DKV A;  1GFV A;  2ERC A;  1L2D A;  1YQV Y;  1LZ8 A;  5FTJ A;  230L A;  3FUU A;  3GPP A;  1D0M A;  1C64 A;  1L54 A;  4X64 M;  4DC4 A;  1FLY A;  1F6S A;  2EQL A;  4G3O A;  2JA2 A;  3Q8G A;  6LYZ A;  4R3D A;  3MJ5 A;  245L A;  1L06 A;  6LYT A;  4NGJ A;  1LZ6 A;  3W6D A;  4PT5 A;  2Z4R A;  1LJH A;  5LMN M;  2BNK A;  3D8B A;  1LZD A;  4NGW A;  3DZD A;  2BJW A;  3QAU A;  1L70 A;  1G0G A;  4DV0 M;  4DV6 M;  2L7H A;  4NWH A;  233L A;  5JI2 E;  4GKJ M;  3GUJ A;  1G0K A;  4H90 A;  4DV5 M;  4PDG A;  1L38 A;  1LJJ A;  2DHR A;  2JZ1 A;  1AT5 A;  2ZAN A;  3F9L A;  4G4B A;  4LJ8 A;  1B5X A;  1C6Q A;  2CE7 A;  3DN8 A;  5IDD A;  4NY5 A;  2DQI Y;  4XJG A;  5EP4 A;  4L8R C;  1F4I A;  1QT5 A;  5LYZ A;  4OWH A;  213L A;  4YF2 A;  2MEB A;  4UWV A;  4WM6 A;  1TDZ A;  3T38 A;  1AKI A;  3LVW A;  2MJ5 B;  3T6P A;  4AKG A;  2OU9 A;  1LSD A;  4XJH A;  1G0L A;  3WYH A;  3CQL A;  2HAK A;  3KVW A;  1PGY A;  146L A;  4H8Z A;  3FTE A;  1TEW A;  1NHE A;  3PNV A;  1IWY A;  1YKY X;  1HER A;  1LZ5 A;  2K9D A;  5KXM A;  5DNY A;  1CJ9 A;  7LYZ A;  5B1G A;  1L25 A;  226L A;  3G3W A;  2Z8Y M;  1SQ2 L;  3QE8 A;  2HEC A;  1D9W A;  104L A;  3HBD A;  4WMG A;  1LZB A;  1IX0 A;  2EJS A;  3D4S A;  1GD6 A;  3N9C A;  2VQE M;  1C6I A;  244L A;  3HUK A;  193L A;  2CFO A;  4GLV A;  1SLY A;  5K7O A;  4N1E I;  1L52 A;  4NG1 A;  144L A;  1QZM A;  1CTW A;  3OJP A;  4I5S A;  2Y21 A;  5I4Y A;  4ET9 A;  3HJQ A;  1NKH A;  3UON A;  3CTW B;  2C9O A;  1GFE A;  5FEL A;  3HX3 A;  1CJ7 A;  2G4N A;  2BQC A;  2GNO A;  1XGU C;  3SC3 A;  1HML A;  156L A;  5BPV A;  2ZQ4 A;  243L A;  4WM2 A;  4B0D A;  1B7Q A;  2KA6 B;  2Y20 A;  1QUG A;  3TXI A;  2LTU A;  3C3E A;  3GLF B;  1QTV A;  2CHG A;  3VWO A;  1IOQ A;  1S3S A;  3TXD A;  5ILF A;  4W51 A;  1TR8 A;  107L A;  180L A;  1C6T A;  1T3P A;  3C8Q A;  4I7Q A;  4IJ4 A;  1P36 A;  2BQH A;  2RKO A;  2GV0 A;  1IC7 Y;  3BBZ A;  1C6P A;  1LJN A;  4PPO A;  4OW1 A;  2OO9 A;  1L95 A;  2R65 A;  1NY5 A;  4H9B A;  4HV1 A;  5IWA M;  4IBD A;  1L24 A;  1L23 A;  5C6I A;  3SB9 A;  4FWG A;  3GUM A;  1JKC A;  1L59 A;  4H9E A;  4XEN A;  4I7K A;  1JHL A;  1C6D A;  1GAY A;  5E26 A;  1WJ7 A;  1UIH A;  2LH0 A;  3AOE C;  3E21 A;  1HJP A;  1MN3 A;  147L A;  1LJK A;  3B0O A;  1OAO C;  1GE0 A;  1L21 A;  118L A;  3F6Z A;  3WMK A;  4HLQ A;  3HU9 A;  1N36 M;  1IY0 A;  3U61 A;  1WQN A;  2QCU A;  4B49 A;  5I4W A;  5C1B A;  3TL4 X;  3UMM A;  4YM8 A;  1XGP C;  2RGH A;  1BWH A;  4HTK A;  1WR1 B;  1YAN A;  5EP2 A;  1P7S A;  4G49 A;  1OJL A;  1NSF A;  3U6C A;  4WO9 A;  2MEI A;  158L A;  1N78 A;  2Y8P A;  4DR2 M;  1MLC E;  3NWL A;  1L71 A;  1GBO A;  2HEB A;  3PVS A;  3LYM A;  1R5L A;  1C68 A;  1RCM A;  4OOT A;  2BQG A;  5FLX S;  1PQD A;  3WH1 A;  5KXY A;  2HUL A;  2X49 A;  1GE3 A;  4YX7 C;  1OFI A;  1L91 A;  3TE6 A;  4WLX A;  114L A;  4IBJ A;  4JV5 M;  4IJE A;  3U60 B;  3NYA A;  1MX0 A;  5JI3 E;  1L58 A;  1VAT A;  1GF0 A;  128L A;  3RUN A;  1D2W A;  1WTH A;  1G8P A;  1L14 A;  125L A;  2MEG A;  2ANX A;  1YSY A;  1LMQ A;  4LT3 A;  1TDY A;  4W52 A;  1IWX A;  3KP1 E;  4GH9 A;  3VK8 A;  4DT3 A;  254L A;  1L09 A;  4X66 M;  2CWB A;  1VED A;  1G3I A;  4YEN A;  2DBT A;  3I4V A;  3K2R A;  1G7M C;  1KYI A;  2G8L A;  2LVQ D;  1XGQ C;  3SHG B;  3LHM A;  4B3R M;  149L A;  4H1P A;  4I8S A;  2Q0M X;  4QOS A;  4ETB A;  1HEL A;  3CDV A;  3HBE X;  1YE9 A;  1KXY A;  1OUF A;  4JI3 M;  4RLM A;  2CWI A;  1WQO A;  5KO3 A;  2B6Z A;  4IIW A;  4N1C C;  5B05 A;  3CDO A;  249L A;  3HU1 A;  4HL4 A;  1B7M A;  5KXK A;  2Z18 A;  3SAU A;  1L1T A;  1GFU A;  1HR0 M;  2FYC A;  2ZIK A;  3AZ7 A;  1QTB A;  2L2D A;  4LJ4 A;  1NY6 A;  4JI2 M;  5HQ1 A;  4CFO A;  3RGP A;  3D3D A;  3P66 A;  1EIJ A;  1TDH A;  5ITR A;  1L46 A;  1L86 A;  160L A;  4WM1 A;  3M7G A;  1IXR C;  2QSF X;  3IWR A;  5KXS A;  1C6B A;  1EQ5 A;  2F5P A;  1UIF A;  4YHH M;  4G4R A;  3M3U A;  1G0Q A;  2KRU A;  4YEO A;  4R0F A;  2BQI A;  4DQ7 A;  235L A;  4FD2 A;  4NEB A;  1L0K A;  5KQ8 A;  2F4A A;  4NC6 A;  3WHL A;  1IBL M;  1LZ9 A;  5KXW A;  2BQF A;  3JR6 A;  5C18 A;  2Y0T A;  1XJT A;  1GEZ A;  3U6P A;  1XGT C;  1TCY A;  3OE9 A;  3BKH A;  5I4X A;  1LZT A;  1JJ1 A;  1C08 C;  2JY5 A;  1IP1 A;  4KHP M;  3HJ8 A;  4LZT A;  1DGF A;  1JIT A;  1OWZ A;  2MEH A;  1QT8 A;  2CHV A;  3C81 A;  3DN0 A;  3VKG A;  3A46 A;  2D6B A;  2R6F A;  1L36 A;  4NHQ A;  4GEW A;  1LCN A;  1LWG A;  2JY7 A;  3CSZ A;  3SBB C;  3GRV A;  1E9S A;  1T6V L;  1L67 A;  2O79 A;  5L9J A;  2I6Z A;  4AZF A;  1REZ A;  3LCU A;  4M0W A;  4EMN A;  3A34 A;  256L A;  3FE3 A;  4FCV A;  3L26 A;  2NTG A;  5LYT A;  4FWH A;  3GLF A;  1P3N A;  2AHM A;  2DVW B;  5KPT A;  3W6F A;  1GE1 A;  3G3B B;  4NHT A;  2DQF C;  2QEN A;  4RW2 A;  1IWT A;  1LSG A;  2KZU A;  1L62 A;  1BVS A;  1H6M A;  2YBH A;  2V1U A;  4LRS A;  2LVO C;  1IFY A;  1HEQ A;  4RF0 A;  1G07 A;  2XEP A;  2LYO A;  4DD2 A;  3RZ4 A;  3ZCB B;  1JWR A;  5ITU A;  1XEI A;  1L35 A;  4TSB A;  2HL7 A;  1OUH A;  3RFW A;  4Q7J A;  2OTZ X;  1KNI A;  1I20 A;  3TWK A;  2Z6B A;  1B7P A;  4KPM A;  3AB6 A;  1NHG C;  170L A;  1LZC A;  1R7R A;  1L75 A;  1PJT A;  1OUG A;  2LVP C;  4U3X B;  1IBK M;  3AW6 A;  3V2Y A;  2QBY B;  2G4Q A;  4I7M A;  4MCK A;  1JUG A;  2EIZ C;  3PDS A;  4L4U A;  166L A;  1LJI A;  3W6B A;  2BAA A;  3B0K A;  1BB6 A;  1B5V A;  3B9P A;  1L53 A;  4XJB A;  1OFH A;  2QP9 X;  1PM5 A;  4CJ6 A;  2R4J A;  4LZJ A;  1P2L A;  1FBI X;  1GXV 2;  3KS8 A;  4DD9 A;  1V92 A;  2KRK A;  1L96 A;  4M6D A;  1AM7 A;  4P2E A;  5HNL A;  3GLI E;  223L A;  4DV3 M;  4AG6 A;  1JTT L;  1NNJ A;  1JIY A;  2OU0 X;  181L A;  5LVH A;  1SXJ D;  1YAM A;  1L15 A;  3EO5 A;  6LZM A;  1G7L C;  1KXX A;  1CU0 A;  2LC9 A;  1QTD A;  3L25 A;  4HTN A;  1L02 A;  1IY4 A;  4WP2 A;  2CRU A;  3FRI A;  3SMS A;  2BQA A;  2XLJ A;  3TMV A;  3GLH B;  5F14 A;  3LQQ A;  3JR4 A;  1L40 A;  3AW7 A;  4ITQ A;  1IWW A;  3GUI A;  1GBS A;  3HH5 A;  5HLL A;  4H91 A;  1F6R A;  3V2W A;  238L A;  4Z3M A;  1BGI A;  1FDL Y;  4LYB A;  1IN4 A;  3T1H M;  1DO2 A;  5DLA A;  2HEE A;  2OE4 X;  3VDU A;  1L72 A;  2RBR A;  3EIH A;  4X62 M;  4TTD A;  159L A;  2I25 L;  1QDR A;  1CU6 A;  4QDN A;  5A3E A;  1LZ4 A;  4NGI A;  145L A;  2R44 A;  2LVN C;  2FH0 A;  1INU A;  3SB7 A;  1R6B X;  194L A;  2DWM A;  119L A;  1CV4 A;  4TUW A;  3J27 B;  2E5L M;  1B7S A;  1W5S A;  1P5C A;  2DWL A;  5LAF A;  1NDM C;  2Z12 A;  1LJG A;  4LF8 M;  1D2N A;  1L00 A;  1JKB A;  2D7E A;  206L A;  4TX7 A;  1R4G A;  3AGH A;  2LNH C;  2Y0Q A;  3TWL A;  178L A;  2GQF A;  4NSJ A;  1OTR A;  3B6L A;  2XZU A;  2NTH A;  1OUB A;  3F8V A;  4RDS A;  248L A;  3UGJ A;  1L22 A;  1L55 A;  2D7H A;  211L A;  3EBA B;  4LY6 A;  5E6J A;  1KFV A;  1B5W A;  4NG8 A;  1NHW C;  1A4V A;  5EJC A;  171L A;  3SAW A;  2A5Y B;  1G7I C;  3CDR A;  2CHQ A;  4FCW A;  2OOB A;  5I53 A;  4EJ4 A;  4AQN A;  1V33 A;  1SSW A;  1GEV A;  4LF4 M;  2MEC A;  1IOS A;  111L A;  2I7N A;  3GLH A;  3AL0 C;  3A45 A;  4MGH A;  1TH3 A;  1L88 A;  1OUC A;  4MB7 A;  4GIP A;  1EL1 A;  2YR0 A;  236L A;  1LJ4 A;  2FNA A;  1R2Y A;  3J7A S;  3L2X A;  1G0M A;  1C60 A;  4J1A A;  4LGM A;  1YUB A;  3B7Z A;  4DDB A;  3HH6 A;  4LFA M;  2ZYC A;  3C80 A;  4REZ A;  2DEN A;  4WL6 A;  5I14 A;  4OWA A;  3LN2 A;  1GBW A;  4CGY B;  1L34 A;  3OE6 A;  2KNV A;  242L A;  4CGE A;  5LAG A;  1ZVH L;  4NXN M;  1GXX A;  229L A;  4ZIX A;  2DAE A;  1LYF A;  5KXL A;  3FUV A;  4HP0 A;  1D0K A;  1QTE A;  1WQQ A;  1O23 A;  4CJ2 A;  1IOC A;  4YEM A;  2CV0 A;  1Q39 A;  1GF3 A;  5B07 A;  1LYJ A;  137L A;  1JR3 A;  2RB1 X;  4FCT A;  2BQN A;  2YNM D;  4N0J A;  1PQK A;  4BAP A;  1G4A E;  4OVZ A;  4GCE A;  2G4P A;  2Z3X A;  1LI2 A;  1L73 A;  161L A;  219L A;  4CIS A;  4UN2 B;  1CKC A;  1B5U A;  122L A;  3KS4 A;  3AOE A;  1A5T A;  3I4Y A;  5I5Q A;  4JYA M;  1Q02 A;  4LYC A;  3GLG E;  1D9U A;  4AG5 A; 
#chains in the Genus database with same CATH homology
 4LT0 A;  2Z2E A;  3IJU A;  1D3M A;  1L04 A;  1YAP A;  2IHL A;  3WXT A;  1UBZ A;  4WG7 A;  1ZUR A;  5APC A;  1JTM A;  1DKJ A;  2RBP A;  1CV0 A;  3LZ2 A;  1RFP A;  4Z46 A;  4H93 A;  2MEF A;  5J7C A;  4H8Y A;  4E97 A;  3ZVQ A;  1L45 A;  4W53 A;  1J1X Y;  4EKP A;  4WL7 A;  1P46 A;  1CX7 A;  1T6H A;  1L20 A;  1QUT A;  2HUK A;  1KW7 A;  2WAR A;  4HSF A;  1L69 A;  2F4G A;  1IP3 A;  1L07 A;  246L A;  5HMJ A;  1LMT A;  189L A;  262L A;  1YKX X;  4WOA A;  1NQI A;  3AGG G;  3B72 A;  4PJ2 C;  2DQJ Y;  1QUD A;  3FAD A;  4GN3 A;  4XAD A;  167L A;  1L80 A;  1LYI A;  4OWC A;  5I54 A;  4W59 A;  2FYD A;  1G7J C;  4DJH A;  1L94 A;  1JTP L;  1LSP A;  1DXJ A;  3A94 A;  2XBR A;  4ETE A;  1CJ6 A;  4W56 A;  5M1Y A;  3ATO A;  2DQH Y;  1P37 A;  1LZN A;  3WUA A;  4UWN A;  1KXW A;  2H5Z A;  1L99 A;  1IWZ A;  143L A;  1LMA A;  1GE2 A;  2EKS C;  1L68 A;  3HT7 A;  113L A;  215L A;  4G9S A;  4RLN A;  1LTM A;  1LGU A;  2ZQ3 A;  115L A;  3HFM Y;  5LIN A;  5LVI A;  3FI5 A;  4MST A;  3HTG A;  4LT1 A;  3LZM A;  4GCC A;  5B06 A;  5LA8 A;  1BQL Y;  4HPI A;  1QUO A;  4I7O A;  1L79 A;  1CNS A;  4NGL A;  4OWB A;  2BQO A;  1JTO L;  2RBS A;  2XJW A;  1DYA A;  3T36 A;  1D3N A;  2ANV A;  1C6A A;  5A3Z A;  2C8P A;  1BVK C;  1RI8 B;  4H92 A;  1GBZ A;  2RBN A;  2I26 L;  4S0W A;  5F81 A;  1YRO A;  120L A;  3WUN A;  3A96 A;  3AYQ A;  4YXA C;  1B0D A;  3OE8 A;  3GUK A;  1VDQ A;  2ZIJ A;  1OUA A;  1P2C C;  1W6Z A;  1L08 A;  3DKE X;  4C3W A;  4DD7 A;  1JKA A;  208L A;  2CDS A;  1LMC A;  1N4F A;  4I7J A;  5LVJ A;  1DPW A;  1GAZ A;  1LAA A;  3DN6 A;  1C65 A;  1GDX A;  3SB5 A;  1QTC A;  2BLY A;  1CX6 A;  1XFP L;  3MGW A;  1BWI A;  4J0L A;  184L A;  1LYS A;  1DI4 A;  212L A;  1DKK A;  1RJC B;  221L A;  3N9A A;  4DQJ A;  5B1F A;  4FJR A;  4PHI A;  1JTN A;  172L A;  1JSF A;  1QT7 A;  3DMV A;  186L A;  3W6C A;  1IOT A;  2HUB A;  3ODU A;  4ARL A;  4HTQ A;  1B9O A;  1CV3 A;  1JEF A;  1C62 A;  1KIR C;  2BLX A;  1BB5 A;  2RB0 X;  4RW1 A;  2A7D A;  1YKZ X;  4GLA A;  2ZWB A;  5HMV A;  3W6E A;  127L A;  4LYO A;  3A3R X;  4H94 A;  1T97 A;  185L A;  4DD1 A;  2EPE A;  5LXW A;  3A93 A;  1QDT A;  1IVM A;  3VW7 A;  4GN5 C;  4ARM B;  5LVG A;  1B7O A;  1G0J A;  1IP7 A;  2OTY X;  1QUH A;  4KL7 A;  1B7L A;  4B4J A;  1EPY A;  1NHB A;  4WLY A;  2BQL A;  5D5F A;  3HT9 A;  2HEF A;  4LZM A;  4HV2 A;  4EKQ A;  4EXM A;  3K3T A;  1L57 A;  1WQM A;  4AGA A;  1C67 A;  1WVV A;  3A95 A;  1CKH A;  1IP4 A;  2ZIL A;  1LLH A;  1OUI A;  1LSF A;  3SBA A;  1QT3 A;  228L A;  3QNG A;  1DYD A;  1G1V A;  1LSA A;  2YBL A;  1OVK A;  4NGZ A;  239L A;  5FST A;  2HED A;  231L A;  2F30 A;  2B75 A;  1DI3 A;  3DN4 A;  5C6L A;  1XJU A;  2ZNW Y;  4FDY A;  4HJV A;  129L A;  1OUE A;  5DN5 A;  3WU8 A;  1QQY A;  2HUM A;  1C6E A;  3HH3 A;  1FKQ A;  1QTZ A;  3AZ6 A;  2CGI A;  5KKI A;  1UAC Y;  1L05 A;  1TLA A;  1LKS A;  4X3B A;  5KY1 A;  3D9A C;  3HUA A;  1GB7 A;  1LYY A;  3LYO A;  4O34 A;  1C61 A;  4TSC A;  1C7P A;  1L11 A;  4W94 A;  1VAU A;  162L A;  2W1M A;  1B5Y A;  2DQG Y;  1P64 A;  1GF6 A;  3RZE A;  1JPO A;  1L39 A;  2NWD X;  4UWU A;  1OV7 A;  153L A;  4YXC A;  197L A;  4DDC A;  3QY4 A;  4XYY A;  3A67 Y;  1GBX A;  4NHP A;  3FE0 A;  4W55 A;  1NWG A;  138L A;  2AUB A;  3NY8 A;  2XBS A;  3M18 B;  2B74 A;  1L77 A;  1GFJ A;  4G4C A;  4IAP A;  4R6C A;  3CSR A;  148L E;  1VDP A;  1YAO A;  1FLU A;  173L A;  1OUD A;  4WLT A;  4LDL A;  3TXH A;  4KT3 A;  4DYG A;  9LYZ A;  3RW8 A;  4PRU A;  1LJE A;  1GFG A;  1JKD A;  135L A;  1L60 A;  1GB8 A;  4NSH A;  4NGO A;  5DM9 A;  174L A;  3WW5 A;  2Q9E A;  5B59 A;  1QS5 A;  1JIS A;  4W96 A;  2FBB A;  3WPK A;  4ML7 A;  3LZT A;  1IIZ A;  4TWS A;  4NHI A;  1BB4 A;  2L78 A;  3DMZ A;  3N9E A;  1D2Y A;  5E9R A;  1P2R A;  169L A;  1DYC A;  1L83 A;  1VDS A;  3TXK A;  3L64 A;  3HT6 A;  195L A;  1FKV A;  2N5Z A;  3DMX A;  192L A;  5APF A;  1L29 A;  5JEN B;  260L A;  1P56 A;  165L A;  1L19 A;  2BQE A;  1NDG C;  2PC2 A;  157L A;  1SX2 A;  131L A;  1L28 A;  2F2Q A;  1L43 A;  4DAJ A;  4H9C A;  1P6Y A;  2W1Y A;  3P64 A;  1RE2 A;  4NSG A;  3J6K A;  3TXJ A;  4QY9 A;  2LYM A;  2B7X A;  2MEA A;  4H8X A;  3P65 A;  1KS3 A;  4NWE A;  1LHJ A;  4Z98 A;  4G4H A;  1A2Y C;  4QEQ A;  3HBH A;  2DQE Y;  1C6J A;  4I7N A;  155L A;  1UIE A;  257L A;  2B6X A;  232L A;  237L A;  1KW5 A;  4I0C A;  2ZYP A;  1LGX A;  1LJF A;  4LYT A;  3HDF A;  4Z41 A;  1LI6 A;  2Z19 A;  2Q9D A;  3WPL A;  2DQD Y;  5LA5 A;  3GXR A;  4W54 A;  112L A;  1L51 A;  3T6U A;  1LSY A;  251L A;  5KXO A;  2VB1 A;  109L A;  1XEP A;  4NGY A;  1LSN A;  1LI3 A;  1IWV A;  1HFY A;  1NBZ C;  3TMX A;  1L87 A;  241L A;  1LKR A;  1LGW A;  5KXX A;  1L98 A;  1DQJ C;  1IY3 A;  1LMN A;  2LYZ A;  1L13 A;  3J4G A;  3WU7 A;  5KKJ A;  1LPY A;  5F9X A;  1B5Z A;  1L41 A;  1UCO A;  4LT2 A;  1C6K A;  1KIP C;  258L A;  175L A;  2O7A A;  2RBQ A;  1L65 A;  3G3A B;  3CB7 A;  4ZEE A;  1GF9 A;  1L31 A;  1LYD A;  1D3J A;  4EPF A;  1CVK A;  5EBH A;  1LZ1 A;  1CU5 A;  1L33 A;  3IJV A;  1D6P A;  1IWU A;  2ZNX Y;  1LYH A;  1B6I A;  2HU1 A;  1GFH A;  5KXZ A;  133L A;  3LYZ A;  2D4I A;  199L A;  1L18 A;  126L A;  1T8A A;  1ZV5 L;  1JJ0 A;  3E3D A;  5LVK A;  1UIA A;  108L A;  1FLQ A;  253L A;  1OV5 A;  1FLW A;  3OE0 A;  4II8 A;  4QGZ A;  1BHZ A;  1HFX A;  5IHG A;  1Z55 A;  2BQD A;  2Z2F A;  154L A;  1GFA A;  3QAK A;  4N8Z A;  2OU8 A;  1DPX A;  1PQM A;  1L76 A;  1GB0 A;  1LMP A;  1XGR C;  3WU9 A;  1L92 A;  1IR8 A;  1IR9 A;  2HEA A;  2D4K A;  1L01 A;  1YIL A;  4ETA A;  1G1W A;  1L44 A;  4GBR B;  1XEJ A;  1CKG A;  1REM A;  3NY9 A;  1XEK A;  1L56 A;  4AXT A;  3C82 A;  2YBI A;  3AZ5 A;  1C43 A;  2BQK A;  2RH1 A;  2C8O A;  2DQA A;  4EOF A;  1PZY A;  1T8G A;  176L A;  1XSF A;  1BWJ A;  5FEK A;  224L A;  1HNL A;  216L A;  2HU3 A;  1WQP A;  1HC0 A;  1GE4 A;  4LFX A;  220L A;  1CKF A;  1LZR A;  1HFZ A;  1C6F A;  1ZVY B;  4ZFP A;  2W1X A;  222L A;  3TXB A;  5DN4 A;  1KIQ C;  3DN2 A;  4D9Z A;  1OVJ A;  1F0W A;  3TMU A;  209L A;  1VFB C;  1L50 A;  4GCF A;  1DZB X;  2H9K A;  4WM4 A;  1PQO A;  1F10 A;  4I7R A;  1L82 A;  196L A;  4LDE A;  1CV6 A;  2YSS C;  1C6L A;  4W57 A;  3ZEK A;  1B7N A;  1L17 A;  1L61 A;  1C6H A;  1HHL A;  4WO6 A;  1L93 A;  4EKS A;  1LYZ A;  2B6Y A;  3EXD A;  1ZYT A;  2BQM A;  1L37 A;  4I7S A;  4ETD A;  4GN4 A;  4BAD A;  4A7D A;  1HEP A;  2H9J A;  3B0I A;  2BQJ A;  3FI7 A;  4LYZ A;  214L A;  1HSW A;  3G3X A;  2LZT A;  3HTB A;  3RNX A;  187L A;  1SSY A;  1LHI A;  3HH4 A;  4GCD A;  5L3H A;  1L03 A;  4J7V A;  4I7P A;  1UIC A;  183L A;  1GB2 A;  2B5Z A;  4ARP A;  5F16 A;  1QT6 A;  1UUZ C;  1OWY A;  3CDT A;  3GXK A;  1LPI A;  1REY A;  163L A;  1QSQ A;  4DD3 A;  3C83 A;  1LYG A;  1C63 A;  3WVX A;  3DN3 A;  1C6G A;  1V7T A;  200L A;  4K5Y A;  259L A;  1L48 A;  1DYE A;  3GUL A;  3HUQ A;  3DN1 A;  1CV1 A;  255L A;  1YL0 X;  4EKR A;  5KXR A;  1QSW A;  1AZF A;  3C7Y A;  1UC0 A;  217L A;  3ZVQ B;  2IFF Y;  1HEO A;  1LYE A;  1QTH A;  1GDW A;  1GHL A;  4LYM A;  1WQR A;  3TXF A;  4B4I A;  3DNA A;  2BQB A;  3GUN A;  2YBN A;  1AT6 A;  1CUP A;  1GB5 A;  1LOZ A;  1GBY A;  1L63 A;  1GF4 A;  2A7F A;  2RAZ X;  1E8L A;  1T8F A;  5FDJ A;  1UA6 Y;  1IO5 A;  3A6B Y;  1NF5 A;  3A90 A;  1GF5 A;  1L42 A;  2QAR C;  4NHS A;  2IGC A;  102L A;  123L A;  3GUO A;  3WUL A;  2D4J A;  1IP6 A;  4H9H A;  1G06 A;  3C7W A;  3EMS A;  4XJD A;  5LZM A;  3CT5 A;  1C6N A;  1C46 A;  1TAY A;  191L A;  1C66 A;  5LYM A;  1KY0 A;  2QB0 B;  4PK0 A;  2DQC Y;  1L64 A;  4PGJ B;  1L66 A;  4ARQ B;  3PBL A;  150L A;  4TUN A;  2O4W A;  5HNC A;  252L A;  1QSB A;  1J1P Y;  4ARJ A;  1GB6 A;  4DD0 A;  5DL9 A;  1C69 A;  2RAY X;  1JQU A;  4BAF A;  4XJI A;  1LMO A;  1K28 A;  1SWZ A;  5KJ9 A;  4DKL A;  1BB3 A;  3CT1 A;  227L A;  1L27 A;  3C8R A;  1LZY A;  151L A;  1REX A;  1D6Q A;  1YAQ A;  3AJN A;  2Z37 A;  1HEW A;  168L A;  1GB9 A;  1LJ3 A;  4HJY A;  2YBM A;  3LYT A;  240L A;  1L26 A;  2YBJ A;  3HDE A;  1L16 A;  3P4Z A;  1C10 A;  1KY1 A;  3W3E A;  1I6S A;  1UIB A;  201L A;  4ANR A;  1GWD A;  1OP9 B;  1QIO A;  4N9R A;  1L85 A;  182L A;  139L A;  1IP2 A;  8LYZ A;  2A4T A;  4OWE A;  3WPJ A;  1NBY C;  1YL1 X;  2LZM A;  3WXU A;  4DDA A;  1J1O Y;  3W6A A;  1YIK A;  1EQ4 A;  2MEE A;  2YDG A;  3TMW A;  1LHM A;  5L3I A;  1JJ3 A;  2CJL A;  3HTF A;  4WLD A;  1QUS A;  2RB2 X;  2XQO A;  5E4P A;  4N5R A;  4MR1 A;  1L49 A;  3HT8 A;  3BKV A;  1LHL A;  4PJZ A;  1LSZ A;  1ZMY L;  3FA0 A;  1D3F A;  3HTD A;  3AGI A;  130L A;  3ATN A;  1FN5 A;  2X0A A;  2B6T A;  1IEE A;  1L89 A;  4KXI A;  4LFP A;  3WVY A;  1L30 A;  1LSC A;  1DYB A;  1CU3 A;  4NSI A;  1B2K A;  4LDO A;  2OE7 X;  188L A;  4B4E A;  1SX7 A;  2B70 A;  234L A;  1NMM A;  132L A;  1C6C A;  3A8Z A;  3WW6 A;  141L A;  5C6J A;  1IOR A;  4ZPU A;  3CSQ A;  5ILC A;  1LSE A;  1WTM A;  4I7L A;  1PQJ A;  4ARM A;  3WUM A;  5APD A;  1LZA A;  3RT5 X;  3A3Q A;  2FBD A;  1W08 A;  4W58 A;  3SN6 R;  1CJ8 A;  1L47 A;  1L84 A;  1IP5 A;  5KXP A;  1BVX A;  1L81 A;  5LIO A;  4NIJ A;  1HMK A;  261L A;  2OE9 X;  3ULR A;  1GF8 A;  2YVB A;  1LHH A;  2OEA X;  4YOP A;  1HEN A;  3A91 A;  1QSA A;  3KAM A;  1L90 A;  4B1A A;  1L12 A;  3HWL A;  2XTH A;  1QTK A;  5II3 A;  1LZE A;  1GF7 A;  210L A;  1B7R A;  1LZS A;  3CDQ A;  198L A;  164L A;  7LZM A;  1C45 A;  4H9I A;  1BB7 A;  1UID A;  2CUU A;  3CT0 A;  1H87 A;  1DI5 A;  225L A;  2F2N A;  1OVH A;  1V7S A;  5FHW A;  1OQM A;  4CHX A;  1IC4 Y;  205L A;  5KXT A;  3SP3 A;  1LWK A;  3AZ4 A;  1L32 A;  1G7H C;  4EPI A;  1SWY A;  3WL2 A;  2Z38 A;  1QT4 A;  4J1B A;  1DYG A;  1GFT A;  1WTN A;  2B73 A;  218L A;  4WM5 A;  5F9U A;  4DQ5 A;  1CKD A;  1EQE A;  3C7Z A;  4PRQ A;  3A6C Y;  5T3F A;  1VDT A;  1GB3 A;  1CV5 A;  1IC5 Y;  1PS5 A;  3GUP A;  1G0P A;  3TXG A;  2RBO A;  4IAS A;  4ARQ A;  4E3U A;  3G3V A;  4HPE A;  4HJZ A;  1TBY A;  140L A;  3A92 A;  1DYF A;  1I1Z A;  1L74 A;  4NGK A;  1PQI A;  1GFR A;  2BPU A;  1UIG A;  2B6W A;  250L A;  2MED A;  2F32 A;  4LGK A;  1GPQ C;  1ALC A;  2W1L A;  1L10 A;  4GCB A;  1LSB A;  3OK0 A;  1ZWN A;  4OOO A;  5APE A;  4ET8 A;  142L A;  4I7T A;  2F47 A;  5FCP A;  1IR7 A;  4GRV A;  152L A;  2HTX A;  2LCB A;  2Z39 A;  4C5F A;  4WM3 A;  190L A;  207L A;  1GFK A;  4WG1 A;  1LYO A;  1CU2 A;  103L A;  4XN6 A;  4ETC A;  1LHK A;  4M4O A;  1HF4 A;  3P68 A;  4NGV A;  1CUQ A;  4NFV A;  3EML A;  1WVU A;  4L41 A;  134L A;  4CFP A;  1D0L A;  3HU8 A;  1QS9 A;  2LZ2 A;  4H9A A;  177L A;  3C8S A;  1OUJ A;  4IAT A;  4XJF A;  5KXN A;  3RU5 A;  1LW9 A;  2D91 A;  1HEM A;  1HSX A;  4OO9 A;  1L0J A;  4BS7 A;  5AMY A;  2LHM A;  1JSE A;  1LZG A;  1I56 A;  3SB8 A;  1LSM A;  3TXE A;  3SB6 A;  1C6M A;  5IEL A;  2RSC A;  1MEL L;  4H9F A;  1OYU A;  2B72 A;  247L A;  1L97 A;  110L A;  5D5C A;  2DKV A;  1GFV A;  1YQV Y;  1LZ8 A;  230L A;  1D0M A;  1C64 A;  1L54 A;  4DC4 A;  1FLY A;  1F6S A;  2EQL A;  6LYZ A;  245L A;  1L06 A;  6LYT A;  4NGJ A;  1LZ6 A;  3W6D A;  1LJH A;  1LZD A;  4NGW A;  1L70 A;  1G0G A;  4NWH A;  233L A;  3GUJ A;  1G0K A;  4H90 A;  1L38 A;  1LJJ A;  1AT5 A;  4G4B A;  3F9L A;  1B5X A;  1C6Q A;  3DN8 A;  5IDD A;  4NY5 A;  2DQI Y;  4XJG A;  1QT5 A;  5LYZ A;  4OWH A;  213L A;  4YF2 A;  2MEB A;  4UWV A;  4WM6 A;  1AKI A;  2OU9 A;  1LSD A;  4XJH A;  1G0L A;  3WYH A;  3CQL A;  146L A;  4H8Z A;  1TEW A;  1NHE A;  1IWY A;  1YKY X;  1HER A;  1LZ5 A;  5KXM A;  1CJ9 A;  7LYZ A;  5B1G A;  1L25 A;  226L A;  3G3W A;  1SQ2 L;  3QE8 A;  2HEC A;  1D9W A;  104L A;  3HBD A;  4WMG A;  1LZB A;  1IX0 A;  3D4S A;  1GD6 A;  3N9C A;  244L A;  1C6I A;  3HUK A;  193L A;  4GLV A;  1SLY A;  5K7O A;  4N1E I;  1L52 A;  4NG1 A;  144L A;  1CTW A;  3OJP A;  5I4Y A;  4ET9 A;  1NKH A;  3UON A;  5FEL A;  1GFE A;  1CJ7 A;  2G4N A;  2BQC A;  1XGU C;  156L A;  1HML A;  2ZQ4 A;  4DWX A;  4B0D A;  243L A;  4WM2 A;  1B7Q A;  1QUG A;  3TXI A;  1QTV A;  3VWO A;  1IOQ A;  3TXD A;  5ILF A;  4W51 A;  107L A;  180L A;  1C6T A;  1T3P A;  3C8Q A;  4I7Q A;  4IJ4 A;  1P36 A;  2BQH A;  2GV0 A;  1IC7 Y;  1C6P A;  1LJN A;  4PPO A;  4OW1 A;  1L95 A;  4HV1 A;  4H9B A;  1L23 A;  1L24 A;  5C6I A;  3SB9 A;  3GUM A;  1JKC A;  1L59 A;  4H9E A;  4XEN A;  4I7K A;  1JHL A;  1C6D A;  1GAY A;  1UIH A;  147L A;  1LJK A;  3B0O A;  1GE0 A;  1L21 A;  118L A;  3F6Z A;  3WMK A;  3HU9 A;  1WQN A;  4B49 A;  5I4W A;  4YM8 A;  1XGP C;  1BWH A;  4HTK A;  1YAN A;  1P7S A;  4G49 A;  4WO9 A;  2MEI A;  158L A;  2Y8P A;  1MLC E;  1L71 A;  1GBO A;  2HEB A;  3LYM A;  1C68 A;  1RCM A;  4OOT A;  2BQG A;  1PQD A;  3WH1 A;  5KXY A;  2HUL A;  1GE3 A;  4YX7 C;  1L91 A;  4WLX A;  114L A;  3NYA A;  1L58 A;  1VAT A;  1GF0 A;  128L A;  3RUN A;  1D2W A;  1WTH A;  1L14 A;  125L A;  2MEG A;  2ANX A;  1LMQ A;  4LT3 A;  1TDY A;  4W52 A;  1IWX A;  4DT3 A;  254L A;  1L09 A;  1VED A;  4YEN A;  2DBT A;  3K2R A;  1G7M C;  1XGQ C;  3LHM A;  149L A;  4H1P A;  4I8S A;  2Q0M X;  4ETB A;  1HEL A;  3CDV A;  3HBE X;  1KXY A;  1OUF A;  4RLM A;  2CWI A;  1WQO A;  2B6Z A;  4N1C C;  5B05 A;  3CDO A;  249L A;  1B7M A;  5KXK A;  2Z18 A;  1GFU A;  2FYC A;  2ZIK A;  3AZ7 A;  1QTB A;  5HQ1 A;  4CFO A;  3D3D A;  3P66 A;  1L46 A;  1L86 A;  160L A;  4WM1 A;  3IWR A;  5KXS A;  1C6B A;  1EQ5 A;  1UIF A;  3M3U A;  1G0Q A;  4YEO A;  4R0F A;  2BQI A;  4DQ7 A;  235L A;  4NEB A;  1L0K A;  2F4A A;  1LZ9 A;  5KXW A;  2BQF A;  3JR6 A;  1XJT A;  1GEZ A;  1XGT C;  3OE9 A;  1TCY A;  3BKH A;  5I4X A;  1LZT A;  1JJ1 A;  1C08 C;  1IP1 A;  4LZT A;  1JIT A;  1OWZ A;  2MEH A;  1QT8 A;  3C81 A;  3DN0 A;  2D6B A;  4NHQ A;  1L36 A;  3CSZ A;  1LCN A;  1LWG A;  3SBB C;  1T6V L;  1L67 A;  2O79 A;  5L9J A;  2I6Z A;  1REZ A;  4EMN A;  3A34 A;  256L A;  2NTG A;  5LYT A;  1P3N A;  3W6F A;  1GE1 A;  3G3B B;  4NHT A;  2DQF C;  4RW2 A;  1IWT A;  1LSG A;  1L62 A;  1H6M A;  2YBH A;  1HEQ A;  1G07 A;  2LYO A;  4DD2 A;  3RZ4 A;  1JWR A;  1XEI A;  1L35 A;  4TSB A;  1OUH A;  2OTZ X;  1KNI A;  1I20 A;  2Z6B A;  1B7P A;  4KPM A;  3AB6 A;  170L A;  1LZC A;  1L75 A;  1OUG A;  4U3X B;  3AW6 A;  3V2Y A;  2G4Q A;  4I7M A;  4MCK A;  1JUG A;  2EIZ C;  3PDS A;  166L A;  1LJI A;  3W6B A;  2BAA A;  3B0K A;  1BB6 A;  1B5V A;  1L53 A;  4XJB A;  1P2L A;  1FBI X;  1GXV 2;  4DD9 A;  1L96 A;  4M6D A;  1AM7 A;  4P2E A;  5HNL A;  223L A;  1JTT L;  1JIY A;  2OU0 X;  181L A;  5LVH A;  1YAM A;  1L15 A;  3EO5 A;  6LZM A;  1G7L C;  1KXX A;  1CU0 A;  2LC9 A;  1QTD A;  4HTN A;  1L02 A;  1IY4 A;  2BQA A;  3TMV A;  5F14 A;  1L40 A;  3AW7 A;  1IWW A;  3GUI A;  1GBS A;  3HH5 A;  5HLL A;  4H91 A;  1F6R A;  3V2W A;  238L A;  4Z3M A;  1BGI A;  1FDL Y;  4LYB A;  5DLA A;  2HEE A;  2OE4 X;  1L72 A;  2RBR A;  4TTD A;  159L A;  2I25 L;  1QDR A;  1CU6 A;  4QDN A;  5A3E A;  1LZ4 A;  4NGI A;  145L A;  1INU A;  3SB7 A;  194L A;  119L A;  1CV4 A;  1B7S A;  1P5C A;  5LAF A;  1NDM C;  2Z12 A;  1LJG A;  1L00 A;  1JKB A;  206L A;  4TX7 A;  4NSJ A;  3AGH A;  178L A;  3B6L A;  2NTH A;  1OUB A;  3F8V A;  4RDS A;  248L A;  1L22 A;  1L55 A;  211L A;  3EBA B;  1B5W A;  4NG8 A;  1A4V A;  171L A;  1G7I C;  3CDR A;  5I53 A;  4EJ4 A;  4AQN A;  1SSW A;  1GEV A;  2MEC A;  111L A;  1IOS A;  1L88 A;  1OUC A;  1EL1 A;  236L A;  1LJ4 A;  3L2X A;  1G0M A;  1C60 A;  4J1A A;  4DDB A;  3HH6 A;  2ZYC A;  3C80 A;  4WL6 A;  5I14 A;  4OWA A;  3LN2 A;  1GBW A;  1L34 A;  3OE6 A;  242L A;  4CGE A;  5LAG A;  1ZVH L;  4ZIX A;  1GXX A;  229L A;  1LYF A;  5KXL A;  4HP0 A;  1D0K A;  1QTE A;  1WQQ A;  1O23 A;  4CJ2 A;  1IOC A;  4YEM A;  1GF3 A;  5B07 A;  1LYJ A;  137L A;  2RB1 X;  2BQN A;  4N0J A;  1PQK A;  4BAP A;  4GCE A;  2G4P A;  1LI2 A;  1L73 A;  161L A;  219L A;  1CKC A;  1B5U A;  122L A;  5I5Q A;  4LYC A;  1D9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...