1D0MA

The escherichia coli lytic transglycosylase slt35 in complex with bulgecin a and (glcnac)2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
publication title Crystallographic studies of the interactions of Escherichia coli lytic transglycosylase Slt35 with peptidoglycan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 110
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1d0mA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1d0mA02
2AUBA 1CJ6A 1GBYA 1VDTA 4DD9A 4NHPA 132LA 1JTTL 1XEKA 5KY1A 4LGKA 1CNSA 2N5ZA 1NDMC 1A4VA 2DKVA 1GB9A 4RW1A 4WM2A 4MR1A 4WL7A 3ATNA 4LT2A 3A6BY 2G4PA 1GBWA 3CSRA 1LHIA 3W6EA 1IO5A 1E8LA 1LZNA 1PS5A 1ZVHL 194LA 3WPJA 4Z3MA 5E4PA 1LOZA 2HU3A 5APFA 1D0MA 4ETAA 4HTNA 4XJHA 1B9OA 5LVJA 4J1AA 1BWHA 3RT5X 4HV2A 4PPOA 1YKYX 2W1XA 1YKZX 1NF5A 3W3EA 3AGGG 3VWOA 3WPKA 1GWDA 4TX7A 2CDSA 1LYYA 1DKKA 1VDSA 1HEWA 2BQDA 3GXRA 5FSTA 4C5FA 4NWEA 1GF6A 1DI5A 1DZBX 1LZ8A 3A93A 4FDYA 4OW1A 5M1YA 1JHLA 2BPUA 1B7LA 1HMLA 4L41A 5KXLA 3G3AB 1LJ4A 1CJ8A 1LMNA 1LMAA 1UCOA 1GXXA 1ZV5L 2BQMA 5D5CA 1BQLY 1LZBA 4A7DA 2MEAA 3WVYA 1GEZA 1EQ4A 1LSDA 1V7SA 1GF3A 1LJKA 2G4NA 2Z12A 3EXDA 5IELA 4PJ2C 1WTNA 4UWNA 2HECA 4G4HA 1LJHA 4OWBA 5LVKA 2H9KA 1HEMA 2W1YA 3OJPA 5LAGA 1GB7A 5LXWA 1HC0A 5I4WA 3TMXA 1VAUA 1AM7A 3CSQA 3A95A 1JSEA 1I56A 4WMGA 1JKCA 1GF5A 1GB0A 3ZVQA 1FLWA 1DI4A 1SLYA 4N0JA 3HBEX 2ZQ3A 1LTMA 1YANA 4M6DA 1IOSA 207LA 4H94A 4MSTA 2DQFC 4LYZA 1YKXX 3A96A 3TXEA 4H1PA 133LA 5APEA 1HSXA 3J4GA 4IASA 2DQDY 4WLYA 5EBHA 1LSGA 3P65A 135LA 4G4BA 1GFAA 1OUIA 3AZ6A 1BVKC 1XSFA 3CB7A 3W6DA 5C6JA 3FE0A 1LSPA 4DC4A 1F6RA 5KXPA 1VDPA 2XTHA 4WLXA 1LZ5A 2ZIJA 3SP3A 1B7QA 4N5RA 1CKCA 9LYZA 5KXTA 1OUAA 5HNLA 1LJIA 1UA6Y 1LZ9A 4GN3A 1GF7A 3A92A 1GE4A 1YL0X 1TDYA 4D9ZA 1OUDA 4HSFA 4XJIA 1LMOA 2EPEA 5DM9A 5C6LA 2Z2FA 2C8PA 2BQGA 4NHSA 2I26L 4NG8A 1IC7Y 4WG7A 4LT3A 1BWJA 1LZSA 1IP7A 1FLUA 3TXFA 1AT5A 2GV0A 1GE3A 2EKSC 4HPIA 4P2EA 134LA 1IP4A 1LZDA 1BB5A 1REMA 5K7OA 4NGKA 208LA 1IR8A 4GN5C 1JUGA 3WW6A 5ILCA 2FYCA 1LJNA 2H5ZA 3IJVA 4KT3A 4BAFA 3B0OA 2Y8PA 1YAPA 4Z46A 1AKIA 4NG1A 1BHZA 1QTKA 4H9FA 1LZ4A 1KXWA 1XEIA 3E3DA 1FDLY 1XFPL 1C46A 4KL7A 1GFUA 5FELA 1LSZA 1WQOA 1YIKA 1LSNA 1D6PA 2NWDX 4W96A 5T3FA 4B4JA 1HEOA 4BAPA 1GBXA 1B7MA 2Z38A 5LVGA 4N8ZA 4I8SA 1QSWA 3RNXA 4E3UA 5IDDA 1KIRC 1LMCA 1KXYA 2RSCA 2Q0MX 4NHQA 2Z19A 4NIJA 5FDJA 4Z41A 3TXBA 6LYTA 4ML7A 3TXJA 4GLAA 1XEJA 4N1EI 1GE1A 1EQEA 2FBBA 2YBNA 4LT1A 3TMWA 3W6CA 1JJ0A 1TAYA 3LYZA 1LSEA 4GCCA 4XN6A 4DT3A 1XGQC 2LHMA 3G3BB 5J7CA 3CT0A 4NSJA 1IP6A 1IC4Y 2G4QA 1F10A 2YBLA 1IP2A 1IVMA 1NWGA 1LZ6A 5L3IA 2F4GA 5JENB 5HQ1A 5LVHA 3LN2A 4J0LA 2XBRA 2F4AA 5I5QA 4WO6A 1IWXA 1UUZC 1UIHA 4C3WA 4XJGA 5I4XA 1H6MA 2YBIA 1IWZA 1JISA 1G7HC 2BQLA 4TWSA 3A34A 1G7MC 4PRQA 3A3QA 5B05A 1GF0A 2HTXA 3WW5A 1GHLA 2ZILA 4XJFA 1JTOL 5B06A 1T3PA 5B1GA 2HU1A 4OWHA 4PHIA 4R0FA 1RFPA 1FKVA 2MEDA 4PRUA 4LZTA 1LHKA 1B2KA 1IOTA 1VDQA 3D9AC 4W94A 1JKBA 3WUNA 4WM3A 3N9EA 4CHXA 1IWYA 4B4EA 1KXXA 1WQPA 3TXIA 2BQBA 4ZIXA 4KPMA 2Z39A 1IOCA 2HEAA 1KIPC 5APCA 3RW8A 3B0IA 1G7JC 4G4CA 3WPLA 1CKDA 2F2NA 4EMNA 2BQJA 1NQIA 1BWIA 4XJDA 4UWUA 4R6CA 3N9AA 5KJ9A 2A7DA 1GE0A 1OUCA 1YAQA 3T6UA 1KIQC 4DWXA 2IHLA 4DDBA 4NWHA 5LYZA 4G49A 2D6BA 1Z55A 5II3A 2LYZA 3A94A 1QDTA 4B0DA 5AMYA 1INUA 2LZ2A 4DD1A 2DQCY 5KXOA 3BKHA 1V7TA 5I53A 4DDCA 4WM5A 1MELL 2DQJY 2Z2EA 1LYZA 2MEIA 5KXYA 1P2CC 4CFOA 1DI3A 1LZCA 2DQAA 2BQFA 1DPWA 4GN4A 4YENA 4DDAA 2CJLA 1BB4A 3A91A 3W6BA 1JKAA 3J6KA 4AGAA 1NDGC 1HERA 2ZIKA 4WM4A 4YOPA 3ZVQB 1A2YC 2BQIA 4IJ4A 3LYOA 1OUGA 4NHIA 1GFHA 3EO5A 4TTDA 4WLDA 5LVIA 3TXHA 1LJJA 3RZ4A 1JJ1A 1LMTA 4BADA 4B1AA 3T36A 1J1OY 5F9UA 1GFEA 2BLYA 2BQNA 1YAOA 1D0LA 1W08A 153LA 2YVBA 3A8ZA 3LZTA 4H9HA 1HFZA 3N9CA 4NEBA 1ZVYB 1GE2A 5LIOA 4M4OA 4TSCA 5KXWA 5A3ZA 1GB6A 5FCPA 4H9IA 1EQ5A 1JEFA 3AW7A 1B0DA 1BVXA 4TUNA 2BQKA 5APDA 1WVUA 4GCBA 5I54A 1RCMA 4ANRA 1WQQA 3WXTA 2ZYCA 1TCYA 2Z37A 1LHHA 4WM1A 5LINA 1B5WA 1LHMA 5KXKA 5B59A 3AB6A 3M3UA 4H91A 4NGLA 4XYYA 1B5XA 3TMVA 5F14A 4N1CC 1LCNA 1IR7A 1HFYA 2MEFA 2DQEY 3EMSA 1GFRA 1F0WA 1IP5A 1GB8A 1BGIA 1C08C 3A3RX 3HFMY 4GLVA 4H9CA 4MCKA 3ZEKA 154LA 4OWCA 1IP3A 2CWIA 1LJ3A 1REZA 2ZNXY 1IWTA 3TXDA 3WVXA 1C45A 1GBZA 4XADA 1DXJA 5DLAA 3CQLA 8LYZA 5B1FA 1HFXA 4YM8A 5L3HA 1LJEA 2EQLA 1IWWA 193LA 3AZ5A 3ATOA 1GDWA 2Z18A 1AZFA 3P68A 1D0KA 4LYTA 1IR9A 1QSAA 4LFXA 1IY3A 1JJ3A 1OUHA 4WO9A 1LZTA 1LAAA 1LZYA 5F9XA 2D4KA 4HTKA 4ETDA 4LT0A 1WQRA 4NSHA 4HJVA 3RU5A 5C6IA 1D9UA 3WU9A 1LMPA 3M18B 4HJYA 1LZEA 2I25L 1SQ2L 4H9EA 1GXV2 2MEGA 1ALCA 1IC5Y 1LHLA 4WOAA 5KXNA 1VFBC 2BLXA 2DBTA 4O34A 4RLMA 2B5ZA 4DYGA 1CKFA 1LSBA 5DL9A 4QEQA 2BAAA 1GF8A 1IWVA 2EIZC 4UWVA 3WMKA 3QY4A 4EOFA 1XGTC 2HUBA 2CGIA 5HLLA 4CJ2A 3ULRA 4NGIA 4NHTA 1LJFA 1J1XY 2F30A 1HSWA 1LSCA 1NMMA 3A67Y 5LA5A 1GFJA 4FJRA 4ZFPA 1GD6A 1BB7A 1T6VL 4H93A 1LKSA 1OUBA 2ZYPA 3CT1A 2MECA 1FLYA 2YBJA 4G9SA 1LZAA 1UICA 1XGPC 3B72A 3MGWA 4CFPA 4J7VA 1EL1A 1GAYA 1GBOA 3OK0A 3AGIA 1NBYC 4QGZA 2ZWBA 4RLNA 3WXUA 1LHJA 4ETCA 1DPXA 1JPOA 5B07A 1JSFA 2C8OA 1OUFA 1CJ9A 1B7RA 1IOQA 2D4IA 1UIFA 1QUTA 1IIZA 2LYOA 1WTMA 5KXRA 1BB3A 3LZ2A 2XJWA 4OOOA 1GAZA 1B7SA 1H87A 2DQGY 1I1ZA 2H9JA 4Z98A 4AXTA 1NHEA 2ZNWY 1N4FA 1BB6A 2YSSC 3AGHA 4YF2A 4CGEA 5DN4A 1IORA 3WUAA 3HBHA 1B5ZA 2I6ZA 2D4JA 1TEWA 3WYHA 4ET9A 1JITA 4HPEA 1LSYA 4NGVA 1B7OA 3LYMA 5HMVA 4ZEEA 2MEHA 3TXKA 3AJNA 3W6FA 1WQMA 1FBIX 3P4ZA 1GFKA 4H92A 4XJBA 2HEEA 1FN5A 1GFTA 2LYMA 5KXMA 4B49A 1GEVA 1LZRA 1GB2A 2YDGA 4WLTA 3IWRA 5F16A 3WUMA 2BQHA 3TXGA 4DD2A 4BS7A 1LSMA 1VEDA 2XBSA 4DD7A 1YQVY 1XGRC 1HF4A 4B4IA 1HHLA 1QDRA 1C7PA 3LYTA 1UIBA 3D3DA 1RI8B 4NY5A 4ETBA 4NSIA 2A7FA 3AYQA 1WVVA 4ET8A 4X3BA 4YEMA 4DD0A 1AT6A 3CT5A 2W1LA 2X0AA 1HELA 1GB5A 2YBMA 4HTQA 5F81A 3AZ7A 5KKIA 1B7PA 4XENA 3LHMA 1G7LC 4QY9A 5ILFA 2FBDA 1B7NA 1REYA 3WH1A 1GF9A 1OUJA 4TSBA 1IWUA 1UBZA 2WARA 5LA8A 1YILA 4NSGA 5FHWA 3WL2A 1LYOA 1YROA 3QE8A 1CJ7A 1JWRA 4LYBA 1LSAA 1ZMYL 3K3TA 1IP1A 4NFVA 4OWAA 2HEBA 3HBDA 3WULA 4RDSA 2DQHY 1UIDA 1LJGA 1LYSA 1IX0A 1O23A 4YEOA 1LPIA 5DN5A 3WU8A 1UC0A 4LYCA 5KKJA 5KXXA 1HENA 4IATA 4H8XA 1WQNA 3TMUA 1JKDA 2BQCA 2MEBA 1RE2A 1YAMA 4NGWA 1LMQA 3KAMA 5KXSA 5IHGA 3IJUA 3W6AA 1GFGA 1LKRA 5HNCA 1CKHA 1FLQA 2YBHA 1JIYA 1PZYA 1GF4A 3AW6A 2ZQ4A 3CSZA 1LZ1A 1VATA 4ETEA 4HV1A 4HP0A 1NKHA 1XGUC 4NGJA 1NBZC 1UIEA 2LZTA 2FYDA 2BQEA 2BQAA 5LYMA 1UIAA 1GDXA 4GCEA 2D91A 4WM6A 2W1MA 4OOTA 1W6ZA 2HEDA 1GB3A 4RW2A 1OUEA 1I20A 4N9RA 5A3EA 5I4YA 2IFFY 1IY4A 1J1PY 1D6QA 1LZGA 1F6SA 1IEEA 4H9BA 4NGOA 1HEPA 7LYZA 2DQIY 1G7IC 4GCFA 3FI7A 1TBYA 1OQMA 4LFPA 3A90A 4NGZA 4H90A 3BKVA 1C10A 5FEKA 4WG1A 3WU7A 1CKGA 4GCDA 3P66A 5L9JA 3GXKA 1RJCB 1REXA 4WL6A 6LYZA 2PC2A 4H8YA 4I0CA 1HNLA 3AZ4A 3EBAB 4II8A 4DD3A 1HMKA 1GBSA 1UACY 1YL1X 2MEEA 1FKQA 3F6ZA 4LYMA 4PGJB 3B0KA 4KXIA 2VB1A 1B5UA 3B6LA 4H9AA 1B5YA 1C43A 1GFVA 4J1BA 4U3XB 5KXZA 4NGYA 1MLCE 2HEFA 1GPQC 5D5FA 4QDNA 4H8ZA 1QTEA 1LSFA 4LYOA 5LAFA 1QIOA 1QQYA 1UIGA 1HEQA 4OWEA 1QUSA 1JTPL 3QNGA 3A6CY 4HJZA 5HMJA 1DKJA 1B5VA 5LYTA 3P64A 2BQOA 5E9RA 1OP9B 1DQJC
chains in the Genus database with same CATH superfamily
2AUBA 2DWZB 1L30A 4Q7JA 4GBRB 4NHPA 1C6HA 2LHGA 4LGKA 4R71A 1L13A 4RW1A 1GB9A 2OTYX 4MR1A 4MH0E 1D2NA 2NTHA 3ATNA 1PQIA 102LA 4I8OA 3GLGE 1GBWA 2Z3XA 1IO5A 1CV6A 3IG8A 194LA 3WPJA 4MM3B 3GUJA 4GKJM 4R7GA 3PFIA 123LA 3RT5X 2RB0X 5KQDA 4PPOA 2Z4SA 3CTWB 2W1XA 2XZUA 3AGGG 2GNOA 1IQPA 2DENA 1Q02A 3GXRA 5FSTA 3HTBA 4I7QA 1IM2A 1LZ8A 158LA 1HNWM 1L92A 3RFWA 4P16A 5KXLA 2QNJA 3G3AB 1LMNA 1LMAA 163LA 4IBJA 1H6UA 4K5YA 2KA6B 2A4TA 2Z12A 4AG6A 4UWNA 4LJAA 1R7RA 4FW9A 1HEMA 5I4WA 3TMXA 4LZJA 4B08A 1S3SA 4WMGA 1GF5A 1GB0A 1L74A 4N0JA 4LGMA 173LA 3HBEX 2RAYX 3GO8A 4DBGB 2F5SA 3HX3A 1L89A 2DZNB 3J4GA 2KRUA 1I94M 3LW5F 3LQQA 1OUIA 3DKEX 1BVKC 3CB7A 1HT2E 4LDOA 2FFJA 3M0EA 196LA 3MHVC 2G8LA 1C6BA 1B7QA 2W82A 4P17A 4N5RA 3SATA 1LJIA 1UA6Y 3HH6A 3L2AA 1GF7A 1GE4A 1G0QA 4D9ZA 1N34M 1PJTA 5IWAM 2ZAOA 2Z2FA 2RAZX 2C8PA 1IBLM 4W57A 3A45A 4NG8A 4NSRA 1IC7Y 4WG7A 2OOBA 1CV3A 1AT5A 1TF0B 1L87A 1L47A 3ZCBB 3K8ZA 169LA 242LA 1LZDA 4GHAA 1NSFA 3AJIB 1JUGA 1L86A 3HU9A 2DAMA 2FYCA 1T8AA 4FWGA 3B0OA 1L64A 2Y0QA 1AKIA 2YR0A 2B6TA 1XEIA 3E3DA 1C46A 1WQOA 2LVNC 4DAJA 2Z38A 1N33M 5LVGA 1L41A 3CF0A 2MGWA 4I8SA 5IDDA 1LMCA 2RSCA 4NHQA 3FUUA 4NIJA 5FDJA 4L6V6 1LYEA 177LA 1L52A 1L55A 4HL4A 2DWNA 2YBNA 3W6CA 1LGXA 1TAYA 4XN6A 3U6OA 3KFUG 1R5LA 2G4QA 4JI5M 1F10A 1IP2A 3GUMA 1NWGA 4AI6A 205LA 4DV2M 256LA 2QCUA 1MN3A 5LVHA 2OU8A 4J0LA 3B7NA 5I5QA 3HHYA 4DV3M 1LW9A 4I7OA 4XJGA 2OQ4A 183LA 4CISA 1L81A 2R4EA 1G7MC 3HHWA 1ZV1A 5B05A 4OX9M 2QBYA 2HTXA 1GHLA 5B06A 2LVAA 2HU1A 4R0FA 3C81A 4W94A 1T6OA 1NV9A 1XXHE 3E46A 1SG9A 1IWYA 1KXXA 3UMMA 1L27A 4KPMA 1IOCA 1SXJC 1WHCA 5ITXE 2OPFA 201LA 1BWIA 4UWUA 4R6CA 1NY6A 5EXPA 2RB2X 2F5PA 4DWXA 2XF3A 228LA 2IHLA 2D6BA 5II3A 2LYZA 1L50A 3A94A 1QDTA 4B0DA 1LYJA 4DD1A 1P3NA 2DQCY 5KXOA 1YE9A 1XNRM 1MELL 1TDHA 2JY5A 1DGBA 1P2CC 4CFOA 1X37A 3KW6A 3FTDA 4GN4A 4IJFA 4LGYA 3W6BA 4AGAA 5EXTA 4YOPA 5FTKA 4WM4A 1L07A 4WLDA 1VDLA 1GFHA 3RZ4A 2VIIA 1J1OY 2OU0X 3C8RA 1LI2A 2BQNA 4W58A 2LVOC 3DZDA 2YVBA 3F9LA 4H9HA 1KSFX 165LA 1GE2A 4W54A 1P6YA 1L26A 4TSCA 4I7MA 3JR6A 1B0DA 1HJPA 3VLFB 1R2YA 3A46A 1WIVA 4ANRA 2BWEA 3HU2A 3SBJA 4WM1A 1B5WA 5B59A 1TTEA 2R65A 2OE9X 4H91A 3VFDA 5F14A 4N1CC 2DQEY 1GFRA 4LF8M 1IP5A 4MCKA 1BGIA 3A3RX 3LCVB 2RGHA 3HFMY 1L99A 3ZEKA 1L70A 2HAKA 4EXMA 2B7XA 1IP3A 2CWIA 1B6IA 3TXDA 1DXJA 5DLAA 2CEAA 5B1FA 1HFXA 4YM8A 5L3HA 3CGWA 2EQLA 3ATOA 1L16A 2X49A 4G6ZA 3L29A 1VEKA 1D0KA 3WHKA 1XC8A 4LYTA 1AUAA 1LZYA 1RU3A 3SHFA 210LA 1QAQA 3HWSA 2HULA 1WQRA 4UN2B 1OAOC 1LLHA 2BNKA 1C6QA 5C6IA 1P64A 1LMPA 3M18B 1L02A 2VQFM 4H9EA 1OIPA 1VFBC 139LA 3B7ZA 5DL9A 4QEQA 4UWVA 2EIZC 1GO5A 1XGTC 5KPTA 1VG5A 4CJ2A 3ULRA 2LH0A 4NHTA 2F30A 1HSWA 3KOZE 1BB7A 3DN0A 1T6VL 1SSWA 2LVPC 2DHYA 2MECA 5FTJA 5EJCA 2JA2A 1K28A 1G71A 3A42A 3B72A 4CFPA 4J7VA 1GAYA 1P2LA 1IN7A 3OK0A 1NBYC 2ZWBA 4GRVA 4S12A 3OE0A 4PDIA 1ZYTA 1OJLA 2QBYB 1JSFA 1OUFA 1IOQA 1UIFA 4OOOA 2APLA 119LA 1H87A 3U6CA 2KXEA 2DQGY 2UXDM 1I1ZA 4Z98A 3G3VA 2ZNWY 3GUPA 2BWBA 1BB6A 4YF2A 4CGEA 3WUAA 2UU9M 1G0GA 2I6ZA 2D4JA 3WYHA 2WSFF 2RRUA 1JITA 3LYMA 4I7PA 3OE6A 5KQ8A 3F8VA 220LA 2HKJA 2HEEA 3HHZA 1FN5A 1T6HA 1SX2A 3D4SA 5KXMA 3LZMA 3PBLA 1OVJA 2LBCA 232LA 246LA 3HUKA 1GB2A 2YDGA 4WP2A 1G0KA 4X62M 4L78A 1LSMA 1VEDA 4DR2M 238LA 1L0JA 1C61A 4ETBA 3CDVA 1NHWC 2Q2EB 4JN6A 3IHPA 3VDUA 152LA 2RH1A 4LJ4A 254LA 4FCTA 3T6PA 1HELA 5KKIA 1PQOA 1B7PA 3LHMA 1G7LC 2JY8A 4TSBA 1PQJA 5LA8A 3NBIA 149LA 1YILA 1L60A 125LA 1LYOA 5L8RF 3T15A 4AG5A 1L19A 1LSAA 1Q39A 4ARMA 3C82A 2DQHY 3SBAA 2KNAA 4YEOA 1IX0A 2DAEA 1CV5A 1O23A 3L2XA 2CHGA 2R46A 3L64A 5DN5A 1UC0A 1JTMA 3U5ZB 2CV0A 4H8XA 2DZOB 3KS8A 2YFQA 2HL7A 3LCUA 4IBCA 1JKDA 111LA 3FE3A 1YAMA 197LA 170LA 1LMQA 4ARPA 3GUOA 3W6AA 1LKRA 5ITTA 3UGJA 1CKHA 3SB7A 2QQ8A 1GF4A 3AW6A 2V1CA 2ZQ4A 249LA 1LZ1A 3BOSA 2MJ5B 3FUWA 1C6PA 2MH8A 1UIEA 1PJQA 5BPVA 2FYDA 4CJ6A 127LA 1L32A 4DV0M 2E5LM 2L2DA 1JR3A 1YSYA 1G0MA 4OOTA 3K2RA 5A3EA 1P36A 1J1PY 1LZGA 4H9BA 4TWSA 4GCFA 2Z8YM 1OQMA 3B89A 3BKVA 2FE8A 3HT9A 1CKGA 3WU7A 3GXKA 3QYEA 143LA 4MGZE 2OOAA 4IBGA 1L97A 1GBSA 1UACY 2EJSA 1YL1X 2QHOB 5KO3A 4KXIA 4U3XB 1GFVA 1ZMWA 3SB9A 4B3RM 2RBRA 1P5CA 1QTEA 5LAFA 1QQYA 4JXJA 4W52A 1JTPL 5DYIA 3QNGA 1QANA 1DKJA 1C6LA 5LYTA 1CU2A 1L22A 2Q9EA 1L98A 4QHSA 175LA 4DV4M 1C6AA 3Q8GA 1JTTL 1CNSA 3QAKA 2XH9A 4W51A 1NJGA 4WL7A 1NHBA 5IT9S 4LT2A 1WXQA 3KDSE 3CSRA 1LHIA 1L33A 1PJJA 1LZNA 2OEAX 1E8LA 1ZVHL 2L78A 5E4PA 4EPIA 2HU3A 5APFA 1D0MA 1E9SA 4XJHA 1B9OA 3SB8A 4G4OA 4GMQA 185LA 3I01M 108LA 3CF2A 3GPXA 1C6NA 1YKZX 1G0LA 3VWOA 5IZ7D 107LA 4TX7A 1E32A 3T1HM 1LYYA 186LA 3FD9A 1QTCA 8CATA 1DI5A 1KW5A 2R4JA 2RKOA 1JHLA 4BLCA 114LA 1Z5CA 4L41A 1T43A 1LJ4A 1T8FA 1ZV5L 4MGKE 1BQLY 1LZBA 1NVMA 1OAIA 1GEZA 4FWHA 1GF3A 1LJKA 2JP7A 1ZWNA 2G4NA 3EXDA 5IELA 4LZMA 2X8AA 4L4UA 2C9OA 2HECA 4G4HA 3C3EA 5LVKA 1LWKA 5LAGA 2B73A 1HC0A 3CSQA 3DMXA 1JKCA 2QPAA 1L88A 3ZVQA 5E6JA 2ZQ3A 1XB2B 1SWZA 2JY6B 1IOSA 1L96A 4Z6YA 4ITQA 2DQFC 4NRWA 1G1WA 2OU9A 3A96A 4S0WA 4H1PA 3TXEA 5APEA 4ARMB 1EFUB 1D3NA 2B72A 3P65A 4G4BA 1SXJA 3D8BA 5C6JA 1XSFA 3TL4X 3DA1A 1QS9A 4IBIA 1F6RA 5KXPA 1LZ5A 3SP3A 1CKCA 4G4RA 1L35A 3GUIA 1LZ9A 1D3JA 4IIWA 4ARQA 1QT5A 1OUDA 4XJIA 245LA 3HT7A 2RB1X 1WJ7A 1CV0A 5H37D 4LT3A 3CF6E 1IP7A 3EIHA 1MU5A 3FUVA 1XMOM 2EKSC 2GV0A 2QARC 1IP4A 3DMZA 240LA 1C60A 4NGKA 1LWGA 1IR8A 4GN5C 4LCBA 3WW6A 4W56A 2H5ZA 2Y8PA 4QOSA 1DYDA 1BHZA 4H9FA 4LZZA 2JNHA 1XFPL 4KL7A 2NWDX 4B4JA 4NSOB 4W96A 1HEOA 1GBXA 146LA 1QAOA 150LA 3RNXA 2B6XA 3W68A 2Z19A 2XFTA 3TXJA 3B74A 1L93A 4N1EI 2DAIA 4GC5A 4LT1A 1C65A 3MMPA 1JJ0A 1L90A 3LYZA 4DT3A 2O4WA 3G3BB 3I4YA 2L4EA 236LA 1G06A 1IVMA 1L31A 1WR1B 3HJQA 3RUNA 1SWYA 3GRVA 4I7NA 5HQ1A 2XBRA 4WO6A 184LA 1IWXA 3OTOM 1DGFA 1DYBA 4JI2M 5I4XA 2YBIA 1IWZA 1JISA 1CUKA 1C6IA 1GF0A 3WW5A 2ANVA 3FYDA 5B1GA 1TR8A 1Y8GA 2JUJA 2B6WA 4PHIA 5FELA 1RFPA 109LA 2MEDA 1QTHA 4LZTA 3WUNA 4KODA 1CV4A 1JQUA 1QUDA 5APCA 3RW8A 2F2NA 1NQIA 2R45A 1KNIA 1PRBA 2CWBA 2O25A 1L0KA 2A7DA 1MJGM 4XGIA 1KW7A 4M9ZA 4NWHA 2DAKA 3TE6A 3DN8A 144LA 1INUA 2LZ2A 2KZUA 3KOXE 3SASA 3DOAA 3KP1E 2I7NA 156LA 2ZTDA 2ZTCA 2Z2EA 4PJZA 4EKRA 5KXYA 1NHGC 257LA 4YENA 1D3MA 4JI6M 216LA 1BB4A 3A91A 5LZMA 1OQYA 2WSEF 3ZVQB 3U6DA 3UZUA 1OUGA 3EO5A 1PJIA 3TXHA 1LMTA 4BADA 1IFYA 4B1AA 3T36A 1GFEA 2BLYA 1YAOA 3C58A 225LA 3LZTA 1QQWA 2EKKA 1SXJB 162LA 4HEOA 5LIOA 4M4OA 3SC3A 5A3ZA 1GB6A 4H9IA 1UM8A 2OO9A 2EO2A 1BVXA 1WVUA 4GCBA 1DGHA 4F1IA 5I54A 1RCMA 3ZC7B 1WQQA 1TCYA 2Z37A 1LHHA 2XFSA 1LHMA 4W53A 241LA 3M3UA 4NGLA 4ARQB 3GRRA 4REZA 3J7AS 3TMVA 1LCNA 167LA 3G3WA 1IR7A 1L42A 3AOEC 2KNZA 1DV0A 4GLVA 3ZQJA 233LA 198LA 166LA 3W0LB 3ODUA 1GBZA 3GLFE 2M60A 1G59A 1L15A 2CHQA 4GKKM 3CQLA 4OO9A 4II7A 1IWWA 4I7JA 221LA 4B7HA 4JI4M 4I7SA 4GC9A 4DR6M 172LA 1N36M 3H4JA 5F9XA 1IBMM 3DMVA 3SB5A 1L80A 4LT0A 4NSHA 1HQYE 3T1YM 3GPUA 1Q3BA 251LA 1SQ2L 1LHLA 4LJ6A 4RLMA 2DNAA 4DYGA 2F32A 3GLHA 2BAAA 4EOFA 4B3SM 4MGYE 1QT7A 3PNVA 5HLLA 258LA 3UK6A 4KT0F 2HWJA 4GEWA 1J1XY 1LJFA 1LSCA 1NMMA 3A67Y 1GFJA 4FJRA 1OFIA 3K92A 120LA 148LE 2CE7A 3CT1A 5EP1A 2UUCM 128LA 4CIZA 1L36A 2L6OA 1LZAA 3RE8A 3VKGA 1XGPC 215LA 3J80S 1EL1A 1NV8A 1GBOA 5A2QS 3WXUA 1L00A 1LHJA 1DPXA 3M7GA 1JPOA 5B07A 2C9CA 4M9XA 2C8OA 3GLIA 4RF1A 250LA 1QUTA 1IIZA 253LA 1BB3A 4XBOA 3OE8A 1GAZA 182LA 1SSYA 2KEBA 4W59A 1XJTA 1SXJD 2NQ8C 4AXTA 3HZJA 4FVMA 1C6CA 126LA 1C62A 1P2RA 3AGHA 4I81A 4D80A 1IORA 3SYKA 1TEWA 4HPEA 2CFOA 1B7OA 3B7QA 4ZEEA 4GHLA 3W6FA 1WQMA 1FBIX 2UUBM 2LCBA 3HU1A 2K9DA 3MK6A 4XJBA 3UJNA 1GFTA 1Z5AA 5DYGA 229LA 1GEVA 1L38A 3SAWA 2VF8A 3KSJA 4WLTA 2IGCA 3WUMA 1QTDA 3TXGA 4BS7A 5FTLA 3GLGA 2XBSA 1YQVY 1QDRA 3D3DA 5EXXA 3GPPA 1WVVA 1C63A 2RBNA 4YEMA 1FNNA 1HQCA 4IBEA 3JR5A 1L34A 1HNXM 3UONA 2P5TA 1L06A 4XENA 1L65A 1DYFA 5ILFA 3D8LA 3DNAA 3AFHA 1IWUA 2WARA 1DO0A 4NSGA 1LI3A 4KO8A 3M6AA 1C6KA 5GKNA 1P3QQ 1GL6A 4Y28F 3FRIA 1JWRA 1L10A 3K3TA 1DGHB 4LY6A 4MGIE 3HBDA 4LYBA 4OWAA 3WULA 1PJSA 3SARA 3U5ZA 1BVSA 1HT1E 2RGOA 2JZ1A 5KKJA 3WU8A 5KXXA 4QNMA 1XEPA 4ARJA 1DO2A 2MEBA 5EXSA 4ZPUA 1PZYA 3NBXX 4I7KA 3CSZA 3JR4A 3LVWA 1DYAA 3U61A 4HV1A 187LA 1ZMVA 1NBZC 1L82A 3THGA 2BQEA 4LJ8A 5LYMA 1GDXA 4GCEA 4NRVA 2AHMA 2W1MA 4G3OA 1W6ZA 2HEDA 1ZURA 1I20A 5ITUA 5I4YA 4I4LA 2F5OA 145LA 3HU8A 4NGZA 3FI7A 1CU6A 131LA 2B74A 4GCDA 3P66A 1KY0A 1REXA 6LYZA 3U6QA 3LMMA 3AKZA 3GLHB 1HNLA 3AZ4A 4II8A 3HDFA 115LA 1XJUA 4DD3A 4LYMA 2MEEA 1FKQA 1JTNA 4D82A 1B5UA 4J1BA 2ZBKB 4NGYA 1LGWA 200LA 261LA 2F47A 2QB0B 5D5FA 3U60A 4H8ZA 4LYOA 1GJTA 4OWEA 138LA 1IXSA 4JI0M 3A6CY 1G1VA 1Z6TA 2LXEA 3P64A 3FADA 1KFVA 2MROB 2BQOA 2QENA 1OP9B 1L39A 1L91A 2ZM6M 1CJ6A 3DFZA 1GBYA 1VDTA 3GLIB 2DWMA 4CGYB 1OVKA 1XEKA 3I51A 1PQKA 3J81S 1L1ZA 2DKVA 1A4VA 3QYBA 3K9PA 2DWLA 2G4PA 1VEJA 1L01A 3SN6R 4W5WA 2K0BX 141LA 1PS5A 3LQRA 1C7YA 1LOZA 4HTNA 1OVHA 1QT6A 2VQEM 4JI1M 1L72A 1MX0A 1YKYX 3WPKA 3IECA 1C6EA 1GWDA 3AV0A 1DKKA 2BQDA 1L44A 1LI6A 1L17A 1GF6A 1DZBX 1A5TA 4FDYA 3J2PB 4OW1A 1C6FA 4AKGA 3WHLA 3GLGB 1HMLA 4IBDA 3GQ5A 1CJ8A 3GUNA 2H5XA 1CUPA 3RZEA 1C6TA 1PM5A 4M0DA 1EQ4A 1V7SA 3VDPA 1L79A 1QT8A 3H4MA 1XXHA 1LJHA 4OWBA 3OJPA 3L25A 2CRUA 226LA 2LNHC 1L2BA 1PQDA 1VAUA 5IREB 3VW7A 1L48A 4PCZA 1DI4A 1FLWA 2DXIA 207LA 4MSTA 2KDLA 4LYZA 1K3WA 3FI5A 2UUAM 133LA 1HSXA 4IASA 2DQDY 4WLYA 1DYGA 5EBHA 2B6YA 1LSGA 3EIEA 1GFAA 3W6DA 3NY8A 3KS4A 3W0FA 1LSPA 3PDSA 180LA 1VDPA 1NY5A 3TWLA 9LYZA 3GULA 5KXTA 1NO1A 1T3TA 147LA 2O01F 3BXWA 1N77A 2FNAA 1QTBA 3A92A 3ZH9B 3DN1A 1YL0X 1QSBA 1P37A 4HSFA 3U61B 1LMOA 2EPEA 5DM9A 5C6LA 2BQGA 2I26L 2KHHA 1BWJA 1L09A 1LZSA 3TXFA 5DNYA 1GE3A 4P2EA 1HR0M 1BB5A 4Z8XA 4EKPA 4DKLA 1QT4A 1LJNA 1TGUA 4NXNM 4BAFA 4EPFA 1YAPA 5FTMA 4NG1A 1GABA 1QTKA 1LZ4A 2C5RA 1GFUA 239LA 1D6PA 1L85A 1LV7A 2F5NA 1KS3A 1QSWA 1KIRC 1L67A 1L18A 2Q0MX 1L8QA 4Z41A 3U60B 4ML7A 1L20A 1XEJA 1GE1A 1IXSB 1L37A 1L46A 4JYAM 1EQEA 3AOEA 3TMWA 1QYRA 2WSCF 4GCCA 2Z6BA 4FCWA 2D7HA 4NSJA 1IP6A 1IC4Y 3KP0E 4GH9A 1LZ6A 2XQOA 4YXAC 4NXMM 5L3IA 1L14A 4X64M 3LN2A 4G4QA 1UUZC 4JI8M 1H6MA 1G7HC 4PRQA 206LA 2XSZA 1L11A 3KSXA 4KHPM 1JTOL 3KOYE 1QUGA 5LMUM 1T3PA 2B70A 3SMSA 1NNJA 5EP2A 4PRUA 3D9AC 4WM3A 4CHXA 3DN6A 1CU3A 1DYEA 4B4EA 1WQPA 3TXIA 4ZIXA 2Z39A 2HEAA 1NJFA 1KIPC 1I6SA 4G4CA 1CKDA 213LA 3N9AA 2F2QA 3HKPA 4NOOB 1GE0A 3T6UA 1IN8A 1JB0F 4DDBA 5LYZA 4G49A 247LA 1Z55A 1GKIA 3LVVA 4DUZM 3K1JA 5AMYA 3BKHA 1KYIA 3SYLA 1V7TA 5I53A 4DDCA 2JY7A 2DAGA 192LA 1LYZA 3R8FA 3KVWA 1CUQA 2MEIA 2DQAA 1XXHB 3FUTA 1W5SA 2R62A 1JKAA 3J6KA 1NDGC 4JI7M 1L68A 1HERA 3U6LA 2ZIKA 1L49A 4TTDA 4IAPA 2L09A 4NHIA 5LVIA 222LA 178LA 4LJ9A 4LJ5A 5F9UA 3ILKA 1R4GA 4OW0A 2B75A 1QVRA 1HFZA 4NEBA 2OE7X 1QTZA 1ZVYB 1TH2A 4IBFA 1DGGA 3AW7A 5APDA 4BBAA 1L71A 2YQZA 4ARLA 4IBKA 3WXTA 4EIWA 2ZYCA 164LA 1L83A 5JI3E 3AB6A 4XYYA 1B5XA 1L73A 1QS5A 3C83A 1G07A 1HFYA 3J7BA 154LA 1C08C 4RNAA 2K6BA 5E26A 3T38A 3W67A 1REZA 4L15A 2ZNXY 3WVXA 1XHBA 1PQMA 5LMNM 5I14A 8LYZA 193LA 2J7OA 260LA 1VEGA 2Z18A 1AZFA 3P68A 1IR9A 1OUHA 1LZTA 4K0KM 2D4KA 2JZ0A 4HTKA 4FD2A 4JV5M 2F5QA 1V92A 4HJVA 3HDEA 4X65M 1D9UA 1SX7A 3WU9A 255LA 1LZEA 3MJ5A 2RBSA 4WOAA 1GXV2 5K7OA 1IC5Y 1OKSA 2BLXA 2B5ZA 2LZMA 4I7LA 1L05A 1LSBA 3C7ZA 1GF8A 3V76A 1L66A 2HUBA 2CGIA 1LYHA 3I4VA 4NGIA 3SAUA 1D9WA 2LC9A 5LA5A 3J27B 4ZFPA 4F2LA 4TUWA 1EE8A 3FUXA 1LKSA 2YBJA 3FTCA 3CDOA 3MGWA 1QT3A 3HGIA 3AGIA 1L54A 4NL4H 4KLNA 2N35A 5FSWA 4ETCA 3TWKA 2V6ZM 4B3TM 2LWXA 1CJ9A 2D4IA 181LA 4X66M 2LYOA 3LZ2A 2L4FA 1XMQM 2FS1A 2H1RA 4AQYM 1L62A 2C96A 174LA 1L59A 1NNUC 1NHEA 3HU3A 1N4FA 5DN4A 1K82A 2F4VM 1GJSA 1B5ZA 1D3FA 3HBHA 4ET9A 2DZLA 4NGVA 1LSYA 1L61A 2X4AA 2MEHA 1VQ1A 3AJNA 2O5RA 3P4ZA 4H92A 4QNRA 1OWZA 5EP4A 1K3XA 1G4AE 195LA 1JR3D 3NYAA 2EA0A 1YUBA 2VF7A 4EKSA 1C68A 1LZRA 5F16A 4LG2A 4L16A 1HF4A 1HHLA 4LRTA 1RI8B 4NY5A 4NSIA 4ET8A 2BJWA 4JI3M 4X3BA 1D2WA 1CTWA 2X0AA 2ERCA 4HTQA 4LFBM 2DHRA 1B7NA 1REYA 3FKEA 1GF9A 1OUJA 1UBZA 1WTHA 4LFCM 1L24A 5FHWA 3WL2A 3U6PA 4YHHM 3C7YA 1CJ7A 1ZMYL 4OU7A 1C6DA 5C1BA 2G3QA 1LJGA 1UIDA 1LPIA 1T8GA 4LYCA 1HENA 4DQ7A 3GRUA 248LA 4LF6M 3FA0A 3AL0C 2J5YA 1LPYA 1GFGA 2BJVA 1IXRC 5HNCA 2UXBM 2D7GA 1FLQA 2YBHA 4L8RC 1G0PA 3CDTA 2JWSA 4LF5M 110LA 1L58A 4RKUF 168LA 4HP0A 1NKHA 1XGUC 1L21A 3GQ3A 2BQAA 2XSZD 1QUHA 1UIAA 4YX7C 1GB3A 4RW2A 1OUEA 2ANXA 3I04M 2G5GX 1KY1A 1IY4A 1F6SA 1ZMUA 1IEEA 4NGOA 1LYFA 235LA 2DQIY 1TBYA 3HWLA 191LA 3A90A 1L2DA 1CVKA 1OV5A 2Y0TA 4DV1M 1RJCB 4WL6A 3SFZA 2PC2A 5EP3A 4H8YA 4I0CA 4YY3M 3F6ZA 4PGJB 3DN2A 5KXZA 1MLCE 3U6SA 4LDEA 2HEFA 1GPQC 1L25A 1N32M 4QDNA 2HUMA 1EPYA 1HEQA 1L12A 4MB7A 1CX7A 1OV7A 4HJZA 5HMJA 3QAUA 1B5VA 113LA 157LA 3GQ4A 209LA 1LGUA 1TH4A 1DQJC 4B3MM 214LA 4DD9A 132LA 2XGNA 5KY1A 2N5ZA 1NDMC 3DN3A 4WM2A 1GLNA 2KZSA 3AOGA 3A6BY 2ZANA 1IN4A 4AZFA 1L28A 3W6EA 1L76A 3SMPA 3VK8A 4Z3MA 4ETAA 2V1UA 1OTRA 5LVJA 1L40A 4J1AA 171LA 1BWHA 4HV2A 1R6BX 3B9PA 1NF5A 3W3EA 3GRYA 4I5SA 176LA 2Q9DA 3RGSA 1C1KA 2CDSA 1VDSA 1P7SA 1C67A 1HEWA 4C5FA 4NWEA 4NC6A 1C64A 4FWDA 3A93A 1GL7A 5M1YA 1L2CA 2BPUA 2JXNA 1B7LA 219LA 2BQMA 5D5CA 1UCOA 1GXXA 130LA 1C6JA 4A7DA 4R3DA 2MEAA 3WVYA 4DJHA 1LSDA 1IBKM 4PJ2C 1WTNA 223LA 4MGHA 2QP9X 2O79A 2H9KA 2W1YA 2Y21A 5LXWA 1GB7A 217LA 1AM7A 3A95A 1L95A 1JSEA 4WW0A 1I56A 4GITA 1ZAEA 2Z7JA 2XLJA 190LA 1SLYA 4M6DA 1LTMA 4OVZA 3GP1A 1YANA 4H94A 3HJ8A 1D2YA 2KNVA 262LA 3C9PA 4LF7M 142LA 1YKXX 2Y20A 5FLXS 1JR3E 3GPYA 135LA 2D7EA 3HUQA 3AZ6A 3FE0A 4DC4A 1L1TA 3FTEA 2XTHA 2M5ZA 4WLXA 2ZIJA 1OYUA 4WURA 3F92A 1OUAA 1L43A 5HNLA 4GN3A 2Z4RA 1G0JA 3G3XA 5EQTA 1TDYA 1C69A 3KXEC 4NHSA 2LVQD 4QOZC 3SAVA 1ORYB 4DR4M 1FLUA 3K9OA 4HPIA 1E94E 3PVSA 134LA 1REMA 208LA 244LA 4HLQA 3HTDA 5ILCA 5ITQA 3HUAA 118LA 3IJVA 4KT3A 1V33A 4Z46A 4AW4A 1FJGM 1KXWA 4PK0A 1FDLY 4IJEA 1LSZA 1N78A 1YIKA 1LSNA 3EMLA 3OE9A 5T3FA 1C6GA 4BAPA 1L57A 4AKIA 1B7MA 2EUCA 3E9SA 4N8ZA 3VKHA 2YNMD 4E3UA 2K47A 1L45A 1KXYA 3JAMS 3GLFA 224LA 3TXBA 6LYTA 4DUYM 1L75A 231LA 4I7RA 1G8PA 4GLAA 2FBBA 1LSEA 1XGQC 2LHMA 1P46A 1GVNA 104LA 1J09A 5J7CA 3L28A 3CT0A 1CX6A 1IY0A 2YBLA 1V34A 3C8QA 2F4GA 5JENB 1IN5A 3SBBC 2L7HA 3L27A 2F4AA 4C3WA 1UIHA 1Q3CA 3FYCA 3U6MA 2BQLA 3C80A 3A34A 3GUKA 3A3QA 3IG5A 3HH5A 1OFHA 2ZILA 4XJFA 103LA 1XWIA 3FRHA 4OWHA 140LA 3PXGA 1FKVA 2QZ4A 1LHKA 1B2KA 1IOTA 1VDQA 1JKBA 1QAMA 3N9EA 1IXZA 160LA 2B3TA 4B7FA 2BQBA 3L26A 3NWLA 4DV5M 3B0IA 1G7JC 2CP8A 3WPLA 4AKHA 4B7GA 4EMNA 4DV7M 2BQJA 4XJDA 4QHTA 5KJ9A 2B6ZA 5KPZA 1OUCA 1YAQA 1L51A 1KIQC 2R6FA 4PDGA 259LA 1SXJE 2NTGA 4WM5A 4LF9M 2DQJY 1E9RA 1DI3A 1LZCA 2BQFA 1DPWA 3C7WA 4DDAA 4LRSA 2CJLA 5ITXA 1OIZA 1A2YC 2BQIA 4IJ4A 3LYOA 4OVZB 2C98A 3E4RA 1LJJA 1JJ1A 2RBPA 252LA 4ZPXA 1QZEA 1L08A 1D0LA 1W08A 153LA 3A8ZA 4CHTB 3N9CA 5KXWA 5FCPA 1EQ5A 1HNZM 1JEFA 4TUNA 2BQKA 2DKLA 230LA 218LA 5LINA 3A98B 5KXKA 2OE4X 1L77A 1LYGA 4GIPA 112LA 3TPZA 2MEFA 3EMSA 1TLAA 3E21A 4LJ7A 4I7TA 3HTGA 2HHHM 1F0WA 1GB8A 4H9CA 3RGPA 3PNYA 3HH4A 189LA 4OWCA 3VK7A 1R2ZA 4EJ4A 1LJ3A 6LZMA 4BB9A 151LA 1IWTA 1C45A 4XADA 2EKFA 2RBOA 3CDRA 2HCBA 3SB6A 1LJEA 3AZ5A 1N75A 5JI2E 1GDWA 4DV6M 3V2WA 3SHGB 1QSAA 4LFXA 1WGLA 1IY3A 2L7IA 4DR5M 1JJ3A 4WO9A 1LAAA 5BR8M 4ETDA 1TDZA 1OWYA 1P56A 3BBZA 3RU5A 227LA 2O7AA 4HJYA 1DYCA 2HUKA 2LHCA 5ITYA 4DQ5A 2I25L 1WGNA 2MEGA 2UXCM 1ALCA 5KXNA 4DD2A 4O34A 2DBTA 3GLFB 1CKFA 1T97A 2FOIC 3WMKA 1IWVA 3QY4A 1I4WA 2LTUA 237LA 1ZQ9A 2R18A 3CDQA 1LYIA 1GD6A 129LA 4H93A 5C18A 1OUBA 2ZYPA 1FLYA 4G9SA 1G3IA 1CU5A 7LZMA 2R44A 1UICA 2KW0A 1G41A 1IY1A 1EIJA 4QGZA 3HY5A 1L23A 4RLNA 2DI0A 4NFVA 2MR9A 1B7RA 1L04A 1WTMA 3HJSA 5KXRA 155LA 3HT8A 2XJWA 1L03A 1UFZA 1B7SA 1VDDA 4DR3M 3FTFA 2H9JA 2CHVA 1L53A 2YSSC 4IBBA 2KRKA 1W5TA 5DFLA 4A3VB 1J7KA 1L56A 5HMVA 1JQJC 2XZFA 3TXKA 1L94A 3DN4A 1GFKA 1Z5BA 2I7PA 4M9SA 2LYMA 1AIPC 3NY9A 4B49A 2A5YB 4DR7M 4XK8F 4W55A 3IWRA 1C66A 4DQJA 2BQHA 2VDBB 3KOWE 2CV2A 4DD7A 1QZMA 1XGRC 4B4IA 212LA 1C7PA 3LYTA 1UIBA 243LA 2WZJA 3U6EA 2R0IA 2XEPA 2A7FA 3AYQA 4DD0A 1AT6A 4RF0A 3CT5A 2W1LA 2YBMA 1GB5A 5F81A 3AZ7A 4AQNA 4QY9A 2FBDA 3WH1A 4FCVA 2RBQA 1C6MA 1CU0A 4PD2A 1YROA 3HT6A 3QE8A 211LA 1IP1A 4D81A 4GRIA 3TWMA 2HEBA 4RDSA 5FTNA 3HHXA 1LYSA 4LDLA 4IATA 1WQNA 4LFAM 3TMUA 2BQCA 1RE2A 3K2LA 4NGWA 1L29A 1QSQA 3HH3A 3KAMA 5KXSA 3IJUA 5IHGA 1L84A 2FH0A 1XNQM 1JIYA 1LYDA 1CV1A 2QSFX 1VATA 1F4IA 3GLHE 4ETEA 2C99A 1Z59A 3QWLA 188LA 4DR1M 3R9XB 1QUOA 5KPRA 4NGJA 1IY2A 3V2YA 2LZTA 1QTVA 2CUUA 2D91A 3Q8XA 4WM6A 161LA 7CATA 199LA 4N9RA 2IFFY 1D6QA 2DVWB 1HEPA 7LYZA 5F3WA 3TQSA 1G7IC 4LFPA 1IN6A 4PT5A 4H90A 2CV1A 1C10A 4EKQA 5FEKA 4WG1A 2CUZA 5L9JA 1J5EM 5ITRA 3EBAB 3HTFA 1L69A 234LA 3GLIE 1HMKA 3C8SA 3B0KA 2VB1A 3B6LA 4H9AA 4M0WA 1B5YA 1C43A 1YLAA 2J7NA 159LA 3C3DA 137LA 122LA 1PGYA 1LSFA 4LF4M 1QIOA 1UIGA 1QUSA 2OTZX 1L63A 4YXCA 2ZAMA 4E97A 2GQFA 1TH3A 4G4NA 5E9RA
chains in the Genus database with same CATH topology
2AUBA 1L30A 4GBRB 4NHPA 1C6HA 4LGKA 1L13A 4RW1A 1GB9A 2OTYX 4MR1A 3ATNA 2NTHA 1PQIA 102LA 1GBWA 1IO5A 1CV6A 194LA 3WPJA 3GUJA 123LA 3RT5X 2RB0X 4PPOA 2W1XA 3AGGG 3GXRA 5FSTA 3HTBA 4I7QA 1LZ8A 158LA 1L92A 5KXLA 3G3AB 1LMNA 1LMAA 163LA 4K5YA 2A4TA 2Z12A 4UWNA 1HEMA 5I4WA 3TMXA 4WMGA 1GF5A 1GB0A 1L74A 4N0JA 3HBEX 173LA 2RAYX 1L89A 3J4GA 1OUIA 3DKEX 1BVKC 3CB7A 4LDOA 196LA 1C6BA 1B7QA 4N5RA 1LJIA 1UA6Y 3HH6A 1GF7A 1GE4A 1G0QA 4D9ZA 2Z2FA 2RAZX 2C8PA 4W57A 4WG7A 4NG8A 1IC7Y 1CV3A 1AT5A 1L87A 1L47A 169LA 242LA 1LZDA 1L86A 1JUGA 3HU9A 2FYCA 1T8AA 3B0OA 1L64A 1AKIA 2B6TA 1XEIA 3E3DA 1C46A 1WQOA 4DAJA 2Z38A 5LVGA 1L41A 4I8SA 5IDDA 1LMCA 2RSCA 4NHQA 4NIJA 5FDJA 1LYEA 177LA 1L52A 1L55A 2YBNA 3W6CA 1LGXA 1TAYA 4XN6A 2G4QA 1F10A 3GUMA 1IP2A 1NWGA 205LA 256LA 5LVHA 2OU8A 4J0LA 5I5QA 1LW9A 4I7OA 4XJGA 183LA 1L81A 1G7MC 5B05A 2HTXA 1GHLA 5B06A 2HU1A 4R0FA 3C81A 4W94A 1IWYA 1KXXA 1L27A 4KPMA 1IOCA 201LA 1BWIA 4UWUA 4R6CA 2RB2X 4DWXA 228LA 2IHLA 2D6BA 5II3A 2LYZA 1L50A 3A94A 1QDTA 4B0DA 1LYJA 4DD1A 1P3NA 2DQCY 5KXOA 1MELL 1P2CC 4CFOA 4GN4A 3W6BA 4AGAA 4YOPA 4WM4A 1L07A 4WLDA 1GFHA 3RZ4A 1J1OY 2OU0X 3C8RA 1LI2A 2BQNA 4W58A 2YVBA 3F9LA 4H9HA 165LA 1GE2A 4W54A 1P6YA 1L26A 4TSCA 4I7MA 3JR6A 1B0DA 4ANRA 4WM1A 1B5WA 5B59A 2OE9X 4H91A 5F14A 4N1CC 2DQEY 1GFRA 1IP5A 4MCKA 1BGIA 3A3RX 3HFMY 1L99A 3ZEKA 1L70A 4EXMA 2B7XA 1IP3A 2CWIA 1B6IA 3TXDA 1DXJA 5DLAA 5B1FA 1HFXA 4YM8A 5L3HA 2EQLA 3ATOA 1L16A 1D0KA 4LYTA 1LZYA 210LA 2HULA 1WQRA 1LLHA 1C6QA 5C6IA 1P64A 1LMPA 3M18B 1L02A 4H9EA 1VFBC 139LA 5DL9A 4QEQA 4UWVA 2EIZC 1XGTC 4CJ2A 3ULRA 4NHTA 2F30A 1HSWA 1BB7A 3DN0A 1T6VL 1SSWA 2MECA 1K28A 3B72A 4CFPA 4J7VA 1GAYA 1P2LA 3OK0A 1NBYC 2ZWBA 4GRVA 3OE0A 1ZYTA 1JSFA 1OUFA 1IOQA 1UIFA 4OOOA 119LA 1H87A 2DQGY 1I1ZA 4Z98A 3G3VA 2ZNWY 3GUPA 1BB6A 4YF2A 4CGEA 3WUAA 1G0GA 2I6ZA 2D4JA 3WYHA 1JITA 3LYMA 4I7PA 3OE6A 3F8VA 220LA 2HEEA 1T6HA 1FN5A 3D4SA 1SX2A 5KXMA 3LZMA 3PBLA 1OVJA 232LA 246LA 3HUKA 1GB2A 2YDGA 1G0KA 1LSMA 1VEDA 238LA 1L0JA 1C61A 4ETBA 3CDVA 152LA 2RH1A 254LA 1HELA 5KKIA 1PQOA 1B7PA 3LHMA 1G7LC 4TSBA 1PQJA 5LA8A 149LA 1YILA 1L60A 125LA 1LYOA 1L19A 1LSAA 4ARMA 3C82A 2DQHY 3SBAA 4YEOA 1IX0A 1CV5A 1O23A 3L2XA 3L64A 5DN5A 1UC0A 1JTMA 4H8XA 1JKDA 111LA 197LA 1YAMA 170LA 1LMQA 4ARPA 3GUOA 3W6AA 1LKRA 3SB7A 1CKHA 1GF4A 3AW6A 2ZQ4A 249LA 1LZ1A 1C6PA 1UIEA 2FYDA 127LA 1L32A 1G0MA 4OOTA 3K2RA 5A3EA 1P36A 1J1PY 1LZGA 4H9BA 4TWSA 4GCFA 1OQMA 3BKVA 3HT9A 1CKGA 3WU7A 3GXKA 143LA 1L97A 1GBSA 1UACY 1YL1X 4KXIA 4U3XB 1GFVA 3SB9A 2RBRA 1P5CA 1QTEA 5LAFA 1QQYA 4W52A 1JTPL 3QNGA 1DKJA 1C6LA 5LYTA 1CU2A 1L22A 2Q9EA 1L98A 175LA 1C6AA 1JTTL 1CNSA 3QAKA 4W51A 4WL7A 1NHBA 4LT2A 3CSRA 1LHIA 1L33A 1E8LA 1LZNA 2OEAX 1ZVHL 2L78A 5E4PA 4EPIA 2HU3A 5APFA 1D0MA 4XJHA 1B9OA 3SB8A 185LA 108LA 1C6NA 1YKZX 1G0LA 3VWOA 107LA 4TX7A 1LYYA 186LA 1QTCA 1DI5A 1KW5A 1JHLA 114LA 4L41A 1T8FA 1LJ4A 1ZV5L 1BQLY 1LZBA 1GEZA 1GF3A 1LJKA 1ZWNA 2G4NA 3EXDA 5IELA 4LZMA 2HECA 4G4HA 5LVKA 1LWKA 5LAGA 2B73A 1HC0A 3CSQA 3DMXA 1JKCA 1L88A 3ZVQA 2ZQ3A 1SWZA 1IOSA 1L96A 2DQFC 1G1WA 2OU9A 3A96A 4S0WA 4H1PA 3TXEA 5APEA 4ARMB 1D3NA 2B72A 3P65A 4G4BA 5C6JA 1XSFA 1QS9A 1F6RA 5KXPA 1LZ5A 3SP3A 1CKCA 1L35A 3GUIA 1LZ9A 1D3JA 4ARQA 1QT5A 1OUDA 4XJIA 245LA 3HT7A 2RB1X 1CV0A 4LT3A 1IP7A 2GV0A 2QARC 2EKSC 1IP4A 3DMZA 240LA 1C60A 4NGKA 1LWGA 1IR8A 4GN5C 3WW6A 4W56A 2H5ZA 2Y8PA 1DYDA 1BHZA 4H9FA 1XFPL 4KL7A 2NWDX 4B4JA 4W96A 1HEOA 1GBXA 146LA 150LA 3RNXA 2B6XA 2Z19A 3TXJA 1L93A 4N1EI 4LT1A 1C65A 1JJ0A 1L90A 3LYZA 4DT3A 2O4WA 3G3BB 236LA 1G06A 1IVMA 1L31A 3RUNA 1SWYA 4I7NA 5HQ1A 2XBRA 4WO6A 184LA 1IWXA 1DYBA 5I4XA 2YBIA 1IWZA 1JISA 1C6IA 1GF0A 3WW5A 2ANVA 5B1GA 2B6WA 4PHIA 5FELA 1RFPA 109LA 2MEDA 1QTHA 4LZTA 3WUNA 1CV4A 1JQUA 1QUDA 5APCA 3RW8A 2F2NA 1NQIA 1KNIA 1L0KA 2A7DA 1KW7A 4NWHA 3DN8A 144LA 1INUA 2LZ2A 156LA 2Z2EA 4PJZA 4EKRA 5KXYA 257LA 4YENA 1D3MA 216LA 1BB4A 3A91A 5LZMA 3ZVQB 1OUGA 3EO5A 3TXHA 1LMTA 4BADA 4B1AA 3T36A 1GFEA 2BLYA 1YAOA 225LA 3LZTA 162LA 5LIOA 4M4OA 5A3ZA 1GB6A 4H9IA 1BVXA 1WVUA 4GCBA 5I54A 1RCMA 1WQQA 1TCYA 2Z37A 1LHHA 1LHMA 4W53A 241LA 3M3UA 4NGLA 4ARQB 3TMVA 1LCNA 167LA 3G3WA 1IR7A 1L42A 4GLVA 233LA 198LA 166LA 3ODUA 1GBZA 1L15A 3CQLA 4OO9A 1IWWA 4I7JA 221LA 4I7SA 172LA 5F9XA 3DMVA 3SB5A 1L80A 4LT0A 4NSHA 251LA 1SQ2L 1LHLA 4RLMA 4DYGA 2F32A 2BAAA 4EOFA 1QT7A 5HLLA 258LA 1LJFA 1J1XY 3A67Y 1LSCA 1NMMA 1GFJA 4FJRA 120LA 148LE 3CT1A 128LA 1L36A 1LZAA 1XGPC 215LA 1EL1A 1GBOA 3WXUA 1L00A 1LHJA 1DPXA 1JPOA 5B07A 2C8OA 250LA 1QUTA 1IIZA 253LA 1BB3A 3OE8A 1GAZA 182LA 1SSYA 4W59A 1XJTA 4AXTA 1C6CA 126LA 1C62A 1P2RA 3AGHA 1IORA 1TEWA 4HPEA 1B7OA 4ZEEA 3W6FA 1WQMA 1FBIX 2LCBA 4XJBA 1GFTA 229LA 1GEVA 1L38A 4WLTA 2IGCA 3WUMA 1QTDA 3TXGA 4BS7A 2XBSA 1YQVY 1QDRA 3D3DA 1WVVA 1C63A 2RBNA 4YEMA 1L34A 3UONA 1L06A 4XENA 1L65A 1DYFA 5ILFA 3DNAA 1IWUA 2WARA 4NSGA 1LI3A 1C6KA 1JWRA 4LYBA 1L10A 4NFVA 3K3TA 4OWAA 3WULA 3HBDA 5KKJA 3WU8A 5KXXA 1XEPA 4ARJA 2MEBA 4ZPUA 1PZYA 4I7KA 3CSZA 1DYAA 4HV1A 187LA 1NBZC 1L82A 2BQEA 5LYMA 1GDXA 4GCEA 2W1MA 1W6ZA 2HEDA 1ZURA 1I20A 5I4YA 145LA 3HU8A 4NGZA 3FI7A 1CU6A 131LA 2B74A 4GCDA 3P66A 1KY0A 1REXA 6LYZA 1HNLA 3AZ4A 4II8A 3HDFA 115LA 1XJUA 4DD3A 4LYMA 2MEEA 1FKQA 1JTNA 1B5UA 4J1BA 4NGYA 1LGWA 200LA 261LA 2F47A 2QB0B 5D5FA 4H8ZA 4LYOA 4OWEA 138LA 3A6CY 1G1VA 3P64A 3FADA 2BQOA 1OP9B 1L39A 1L91A 1CJ6A 1GBYA 1VDTA 1OVKA 1XEKA 1PQKA 2DKVA 1A4VA 2G4PA 1L01A 3SN6R 141LA 1PS5A 1LOZA 4HTNA 1OVHA 1QT6A 1L72A 1YKYX 3WPKA 1C6EA 1GWDA 1DKKA 2BQDA 1L44A 1LI6A 1L17A 1GF6A 1DZBX 4FDYA 4OW1A 1C6FA 1HMLA 1CJ8A 3GUNA 1CUPA 3RZEA 1C6TA 1EQ4A 1V7SA 1L79A 1QT8A 1LJHA 4OWBA 3OJPA 226LA 1PQDA 1VAUA 3VW7A 1L48A 1FLWA 1DI4A 207LA 4MSTA 4LYZA 3FI5A 133LA 1HSXA 4IASA 2DQDY 4WLYA 1DYGA 5EBHA 2B6YA 1LSGA 1GFAA 3W6DA 3NY8A 1LSPA 3PDSA 180LA 1VDPA 9LYZA 3GULA 5KXTA 147LA 1QTBA 3A92A 3DN1A 1YL0X 1QSBA 1P37A 4HSFA 1LMOA 2EPEA 5DM9A 5C6LA 2BQGA 2I26L 1BWJA 1L09A 1LZSA 3TXFA 1GE3A 4P2EA 1BB5A 4EKPA 4DKLA 1QT4A 1LJNA 4BAFA 4EPFA 1YAPA 4NG1A 1QTKA 1LZ4A 1GFUA 239LA 1D6PA 1L85A 1KS3A 1QSWA 1KIRC 1L67A 1L18A 2Q0MX 4Z41A 4ML7A 1L20A 1XEJA 1GE1A 1L46A 1L37A 1EQEA 3TMWA 4GCCA 2Z6BA 4NSJA 1IP6A 1IC4Y 1LZ6A 2XQOA 4YXAC 5L3IA 1L14A 3LN2A 1UUZC 1H6MA 1G7HC 4PRQA 206LA 1L11A 1JTOL 1T3PA 1QUGA 2B70A 4PRUA 3D9AC 4WM3A 4CHXA 3DN6A 1CU3A 1DYEA 4B4EA 1WQPA 3TXIA 4ZIXA 2Z39A 2HEAA 1KIPC 1I6SA 4G4CA 1CKDA 213LA 3N9AA 2F2QA 1GE0A 3T6UA 4DDBA 5LYZA 4G49A 247LA 1Z55A 5AMYA 3BKHA 1V7TA 5I53A 4DDCA 192LA 1LYZA 2MEIA 1CUQA 2DQAA 1JKAA 3J6KA 1NDGC 1L68A 1HERA 2ZIKA 1L49A 4TTDA 4IAPA 4NHIA 5LVIA 222LA 178LA 5F9UA 2B75A 1HFZA 4NEBA 2OE7X 1QTZA 1ZVYB 3AW7A 5APDA 1L71A 4ARLA 3WXTA 2ZYCA 164LA 1L83A 3AB6A 4XYYA 1B5XA 1L73A 1QS5A 3C83A 1G07A 1HFYA 154LA 1C08C 1REZA 2ZNXY 3WVXA 1PQMA 5I14A 8LYZA 193LA 260LA 2Z18A 1AZFA 3P68A 1IR9A 1OUHA 1LZTA 2D4KA 4HTKA 4HJVA 3HDEA 1D9UA 1SX7A 3WU9A 255LA 1LZEA 2RBSA 4WOAA 1GXV2 5K7OA 1IC5Y 2BLXA 2B5ZA 2LZMA 4I7LA 1L05A 1LSBA 3C7ZA 1GF8A 1L66A 2HUBA 2CGIA 1LYHA 4NGIA 1D9WA 2LC9A 5LA5A 4ZFPA 1LKSA 2YBJA 3CDOA 3MGWA 1QT3A 3AGIA 1L54A 4ETCA 1CJ9A 2D4IA 181LA 2LYOA 3LZ2A 1L62A 174LA 1L59A 1NHEA 1N4FA 5DN4A 3HBHA 1B5ZA 1D3FA 4ET9A 4NGVA 1LSYA 1L61A 2MEHA 3AJNA 3P4ZA 4H92A 1OWZA 195LA 3NYAA 4EKSA 1C68A 1LZRA 5F16A 1HF4A 1HHLA 1RI8B 4NY5A 4NSIA 4ET8A 4X3BA 1D2WA 1CTWA 2X0AA 4HTQA 1B7NA 1REYA 1GF9A 1OUJA 1UBZA 1WTHA 1L24A 5FHWA 3WL2A 3C7YA 1CJ7A 1ZMYL 1C6DA 1UIDA 1LJGA 1LPIA 1T8GA 4LYCA 1HENA 4DQ7A 3FA0A 248LA 1LPYA 1GFGA 5HNCA 1FLQA 2YBHA 1G0PA 3CDTA 110LA 1L58A 168LA 4HP0A 1NKHA 1XGUC 1L21A 2BQAA 1QUHA 1UIAA 4YX7C 1GB3A 4RW2A 1OUEA 2ANXA 1KY1A 1IY4A 1F6SA 1IEEA 4NGOA 1LYFA 235LA 2DQIY 1TBYA 3HWLA 191LA 3A90A 1CVKA 1OV5A 1RJCB 4WL6A 2PC2A 4H8YA 4I0CA 3F6ZA 4PGJB 3DN2A 5KXZA 1MLCE 4LDEA 2HEFA 1GPQC 1L25A 4QDNA 2HUMA 1EPYA 1HEQA 1L12A 1CX7A 1OV7A 4HJZA 5HMJA 1B5VA 113LA 157LA 209LA 1LGUA 1DQJC 214LA 4DD9A 132LA 5KY1A 2N5ZA 1NDMC 3DN3A 4WM2A 3A6BY 1L28A 3W6EA 1L76A 4Z3MA 4ETAA 5LVJA 1L40A 4J1AA 171LA 1BWHA 4HV2A 1NF5A 3W3EA 176LA 2Q9DA 2CDSA 1VDSA 1P7SA 1C67A 1HEWA 4C5FA 4NWEA 1C64A 3A93A 5M1YA 2BPUA 1B7LA 219LA 2BQMA 5D5CA 1UCOA 1GXXA 130LA 1C6JA 4A7DA 2MEAA 3WVYA 4DJHA 1LSDA 4PJ2C 1WTNA 223LA 2O79A 2H9KA 2W1YA 5LXWA 1GB7A 217LA 1AM7A 3A95A 1L95A 1JSEA 1I56A 190LA 1SLYA 4M6DA 1LTMA 1YANA 4H94A 1D2YA 262LA 142LA 1YKXX 135LA 3HUQA 3AZ6A 3FE0A 4DC4A 2XTHA 4WLXA 2ZIJA 1OYUA 1OUAA 1L43A 5HNLA 4GN3A 1G0JA 3G3XA 1TDYA 1C69A 4NHSA 1FLUA 4HPIA 134LA 1REMA 208LA 244LA 5ILCA 3HTDA 3HUAA 4KT3A 118LA 3IJVA 4Z46A 1KXWA 4PK0A 1FDLY 1LSZA 1YIKA 1LSNA 3EMLA 3OE9A 5T3FA 1C6GA 4BAPA 1L57A 1B7MA 4N8ZA 4E3UA 1L45A 1KXYA 224LA 3TXBA 6LYTA 1L75A 231LA 4I7RA 4GLAA 2FBBA 1LSEA 1XGQC 2LHMA 1P46A 104LA 5J7CA 3CT0A 1CX6A 2YBLA 3C8QA 2F4GA 5JENB 3SBBC 2F4AA 4C3WA 1UIHA 2BQLA 3C80A 3A34A 3GUKA 3A3QA 3HH5A 2ZILA 4XJFA 103LA 4OWHA 140LA 1FKVA 1LHKA 1B2KA 1IOTA 1VDQA 1JKBA 3N9EA 160LA 2BQBA 3B0IA 1G7JC 3WPLA 4EMNA 2BQJA 4XJDA 5KJ9A 2B6ZA 1OUCA 1YAQA 1L51A 1KIQC 259LA 2NTGA 4WM5A 2DQJY 1DI3A 1LZCA 2BQFA 1DPWA 3C7WA 4DDAA 2CJLA 1A2YC 2BQIA 4IJ4A 3LYOA 1LJJA 1JJ1A 2RBPA 252LA 1L08A 1D0LA 1W08A 153LA 3A8ZA 3N9CA 5KXWA 5FCPA 1EQ5A 1JEFA 4TUNA 2BQKA 218LA 230LA 5LINA 5KXKA 2OE4X 1L77A 1LYGA 112LA 2MEFA 3EMSA 1TLAA 4I7TA 3HTGA 1F0WA 1GB8A 4H9CA 3HH4A 189LA 4OWCA 4EJ4A 1LJ3A 6LZMA 151LA 1IWTA 1C45A 4XADA 2RBOA 3CDRA 3SB6A 1LJEA 3AZ5A 1GDWA 3V2WA 1QSAA 4LFXA 1IY3A 1JJ3A 4WO9A 1LAAA 4ETDA 1OWYA 1P56A 3RU5A 227LA 2O7AA 4HJYA 1DYCA 2HUKA 4DQ5A 2I25L 2MEGA 5KXNA 1ALCA 4DD2A 4O34A 2DBTA 1CKFA 1T97A 3WMKA 1IWVA 3QY4A 237LA 3CDQA 1LYIA 1GD6A 129LA 4H93A 1OUBA 2ZYPA 1FLYA 4G9SA 1CU5A 7LZMA 1UICA 4QGZA 1L23A 4RLNA 1B7RA 1L04A 1WTMA 5KXRA 155LA 3HT8A 2XJWA 1L03A 1B7SA 2H9JA 1L53A 2YSSC 1L56A 5HMVA 3TXKA 1L94A 3DN4A 1GFKA 2LYMA 3NY9A 4B49A 4W55A 3IWRA 1C66A 4DQJA 2BQHA 4DD7A 1XGRC 4B4IA 212LA 1C7PA 3LYTA 1UIBA 243LA 2A7FA 3AYQA 4DD0A 1AT6A 3CT5A 2W1LA 2YBMA 1GB5A 5F81A 3AZ7A 4AQNA 4QY9A 2FBDA 3WH1A 2RBQA 1C6MA 1CU0A 1YROA 3HT6A 3QE8A 211LA 1IP1A 2HEBA 4RDSA 1LYSA 4LDLA 4IATA 1WQNA 3TMUA 2BQCA 1RE2A 4NGWA 1L29A 1QSQA 3HH3A 3KAMA 5KXSA 3IJUA 5IHGA 1L84A 1JIYA 1LYDA 1CV1A 1VATA 4ETEA 188LA 1QUOA 4NGJA 3V2YA 2LZTA 1QTVA 2CUUA 2D91A 4WM6A 161LA 199LA 4N9RA 2IFFY 1D6QA 7LYZA 1HEPA 1G7IC 4LFPA 4H90A 1C10A 4EKQA 5FEKA 4WG1A 5L9JA 3EBAB 3HTFA 1L69A 234LA 1HMKA 3C8SA 3B0KA 2VB1A 3B6LA 4H9AA 1B5YA 1C43A 159LA 137LA 122LA 1LSFA 1QIOA 1UIGA 1QUSA 2OTZX 1L63A 4YXCA 4E97A 5E9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUB A;  1CJ6 A;  1GBY A;  1VDT A;  4DD9 A;  4NHP A;  132L A;  1JTT L;  1XEK A;  5KY1 A;  4LGK A;  1CNS A;  2N5Z A;  1NDM C;  1A4V A;  2DKV A;  1GB9 A;  4RW1 A;  4WM2 A;  4MR1 A;  4WL7 A;  3ATN A;  4LT2 A;  3A6B Y;  2G4P A;  1GBW A;  3CSR A;  1LHI A;  3W6E A;  1IO5 A;  1E8L A;  1LZN A;  1PS5 A;  1ZVH L;  194L A;  3WPJ A;  4Z3M A;  5E4P A;  1LOZ A;  2HU3 A;  5APF A;  1D0M A;  4ETA A;  4HTN A;  4XJH A;  1B9O A;  5LVJ A;  4J1A A;  1BWH A;  3RT5 X;  4HV2 A;  4PPO A;  1YKY X;  2W1X A;  1YKZ X;  1NF5 A;  3W3E A;  3AGG G;  3VWO A;  3WPK A;  1GWD A;  4TX7 A;  2CDS A;  1LYY A;  1DKK A;  1VDS A;  1HEW A;  2BQD A;  3GXR A;  5FST A;  4C5F A;  4NWE A;  1GF6 A;  1DI5 A;  1DZB X;  1LZ8 A;  3A93 A;  4FDY A;  4OW1 A;  5M1Y A;  1JHL A;  2BPU A;  1B7L A;  1HML A;  4L41 A;  5KXL A;  3G3A B;  1LJ4 A;  1CJ8 A;  1LMN A;  1LMA A;  1UCO A;  1GXX A;  1ZV5 L;  2BQM A;  5D5C A;  1BQL Y;  1LZB A;  4A7D A;  2MEA A;  3WVY A;  1GEZ A;  1EQ4 A;  1LSD A;  1V7S A;  1GF3 A;  1LJK A;  2G4N A;  2Z12 A;  3EXD A;  5IEL A;  4PJ2 C;  1WTN A;  4UWN A;  2HEC A;  4G4H A;  1LJH A;  4OWB A;  5LVK A;  2H9K A;  1HEM A;  2W1Y A;  3OJP A;  5LAG A;  1GB7 A;  5LXW A;  1HC0 A;  5I4W A;  3TMX A;  1VAU A;  1AM7 A;  3CSQ A;  3A95 A;  1JSE A;  1I56 A;  4WMG A;  1JKC A;  1GF5 A;  1GB0 A;  3ZVQ A;  1FLW A;  1DI4 A;  1SLY A;  4N0J A;  3HBE X;  2ZQ3 A;  1LTM A;  1YAN A;  4M6D A;  1IOS A;  207L A;  4H94 A;  4MST A;  2DQF C;  4LYZ A;  1YKX X;  3A96 A;  3TXE A;  4H1P A;  133L A;  5APE A;  1HSX A;  3J4G A;  4IAS A;  2DQD Y;  4WLY A;  5EBH A;  1LSG A;  3P65 A;  135L A;  4G4B A;  1GFA A;  1OUI A;  3AZ6 A;  1BVK C;  1XSF A;  3CB7 A;  3W6D A;  5C6J A;  3FE0 A;  1LSP A;  4DC4 A;  1F6R A;  5KXP A;  1VDP A;  2XTH A;  4WLX A;  1LZ5 A;  2ZIJ A;  3SP3 A;  1B7Q A;  4N5R A;  1CKC A;  9LYZ A;  5KXT A;  1OUA A;  5HNL A;  1LJI A;  1UA6 Y;  1LZ9 A;  4GN3 A;  1GF7 A;  3A92 A;  1GE4 A;  1YL0 X;  1TDY A;  4D9Z A;  1OUD A;  4HSF A;  4XJI A;  1LMO A;  2EPE A;  5DM9 A;  5C6L A;  2Z2F A;  2C8P A;  2BQG A;  4NHS A;  2I26 L;  4NG8 A;  1IC7 Y;  4WG7 A;  4LT3 A;  1BWJ A;  1LZS A;  1IP7 A;  1FLU A;  3TXF A;  1AT5 A;  2GV0 A;  1GE3 A;  2EKS C;  4HPI A;  4P2E A;  134L A;  1IP4 A;  1LZD A;  1BB5 A;  1REM A;  5K7O A;  4NGK A;  208L A;  1IR8 A;  4GN5 C;  1JUG A;  3WW6 A;  5ILC A;  2FYC A;  1LJN A;  2H5Z A;  3IJV A;  4KT3 A;  4BAF A;  3B0O A;  2Y8P A;  1YAP A;  4Z46 A;  1AKI A;  4NG1 A;  1BHZ A;  1QTK A;  4H9F A;  1LZ4 A;  1KXW A;  1XEI A;  3E3D A;  1FDL Y;  1XFP L;  1C46 A;  4KL7 A;  1GFU A;  5FEL A;  1LSZ A;  1WQO A;  1YIK A;  1LSN A;  1D6P A;  2NWD X;  4W96 A;  5T3F A;  4B4J A;  1HEO A;  4BAP A;  1GBX A;  1B7M A;  2Z38 A;  5LVG A;  4N8Z A;  4I8S A;  1QSW A;  3RNX A;  4E3U A;  5IDD A;  1KIR C;  1LMC A;  1KXY A;  2RSC A;  2Q0M X;  4NHQ A;  2Z19 A;  4NIJ A;  5FDJ A;  4Z41 A;  3TXB A;  6LYT A;  4ML7 A;  3TXJ A;  4GLA A;  1XEJ A;  4N1E I;  1GE1 A;  1EQE A;  2FBB A;  2YBN A;  4LT1 A;  3TMW A;  3W6C A;  1JJ0 A;  1TAY A;  3LYZ A;  1LSE A;  4GCC A;  4XN6 A;  4DT3 A;  1XGQ C;  2LHM A;  3G3B B;  5J7C A;  3CT0 A;  4NSJ A;  1IP6 A;  1IC4 Y;  2G4Q A;  1F10 A;  2YBL A;  1IP2 A;  1IVM A;  1NWG A;  1LZ6 A;  5L3I A;  2F4G A;  5JEN B;  5HQ1 A;  5LVH A;  3LN2 A;  4J0L A;  2XBR A;  2F4A A;  5I5Q A;  4WO6 A;  1IWX A;  1UUZ C;  1UIH A;  4C3W A;  4XJG A;  5I4X A;  1H6M A;  2YBI A;  1IWZ A;  1JIS A;  1G7H C;  2BQL A;  4TWS A;  3A34 A;  1G7M C;  4PRQ A;  3A3Q A;  5B05 A;  1GF0 A;  2HTX A;  3WW5 A;  1GHL A;  2ZIL A;  4XJF A;  1JTO L;  5B06 A;  1T3P A;  5B1G A;  2HU1 A;  4OWH A;  4PHI A;  4R0F A;  1RFP A;  1FKV A;  2MED A;  4PRU A;  4LZT A;  1LHK A;  1B2K A;  1IOT A;  1VDQ A;  3D9A C;  4W94 A;  1JKB A;  3WUN A;  4WM3 A;  3N9E A;  4CHX A;  1IWY A;  4B4E A;  1KXX A;  1WQP A;  3TXI A;  2BQB A;  4ZIX A;  4KPM A;  2Z39 A;  1IOC A;  2HEA A;  1KIP C;  5APC A;  3RW8 A;  3B0I A;  1G7J C;  4G4C A;  3WPL A;  1CKD A;  2F2N A;  4EMN A;  2BQJ A;  1NQI A;  1BWI A;  4XJD A;  4UWU A;  4R6C A;  3N9A A;  5KJ9 A;  2A7D A;  1GE0 A;  1OUC A;  1YAQ A;  3T6U A;  1KIQ C;  4DWX A;  2IHL A;  4DDB A;  4NWH A;  5LYZ A;  4G49 A;  2D6B A;  1Z55 A;  5II3 A;  2LYZ A;  3A94 A;  1QDT A;  4B0D A;  5AMY A;  1INU A;  2LZ2 A;  4DD1 A;  2DQC Y;  5KXO A;  3BKH A;  1V7T A;  5I53 A;  4DDC A;  4WM5 A;  1MEL L;  2DQJ Y;  2Z2E A;  1LYZ A;  2MEI A;  5KXY A;  1P2C C;  4CFO A;  1DI3 A;  1LZC A;  2DQA A;  2BQF A;  1DPW A;  4GN4 A;  4YEN A;  4DDA A;  2CJL A;  1BB4 A;  3A91 A;  3W6B A;  1JKA A;  3J6K A;  4AGA A;  1NDG C;  1HER A;  2ZIK A;  4WM4 A;  4YOP A;  3ZVQ B;  1A2Y C;  2BQI A;  4IJ4 A;  3LYO A;  1OUG A;  4NHI A;  1GFH A;  3EO5 A;  4TTD A;  4WLD A;  5LVI A;  3TXH A;  1LJJ A;  3RZ4 A;  1JJ1 A;  1LMT A;  4BAD A;  4B1A A;  3T36 A;  1J1O Y;  5F9U A;  1GFE A;  2BLY A;  2BQN A;  1YAO A;  1D0L A;  1W08 A;  153L A;  2YVB A;  3A8Z A;  3LZT A;  4H9H A;  1HFZ A;  3N9C A;  4NEB A;  1ZVY B;  1GE2 A;  5LIO A;  4M4O A;  4TSC A;  5KXW A;  5A3Z A;  1GB6 A;  5FCP A;  4H9I A;  1EQ5 A;  1JEF A;  3AW7 A;  1B0D A;  1BVX A;  4TUN A;  2BQK A;  5APD A;  1WVU A;  4GCB A;  5I54 A;  1RCM A;  4ANR A;  1WQQ A;  3WXT A;  2ZYC A;  1TCY A;  2Z37 A;  1LHH A;  4WM1 A;  5LIN A;  1B5W A;  1LHM A;  5KXK A;  5B59 A;  3AB6 A;  3M3U A;  4H91 A;  4NGL A;  4XYY A;  1B5X A;  3TMV A;  5F14 A;  4N1C C;  1LCN A;  1IR7 A;  1HFY A;  2MEF A;  2DQE Y;  3EMS A;  1GFR A;  1F0W A;  1IP5 A;  1GB8 A;  1BGI A;  1C08 C;  3A3R X;  3HFM Y;  4GLV A;  4H9C A;  4MCK A;  3ZEK A;  154L A;  4OWC A;  1IP3 A;  2CWI A;  1LJ3 A;  1REZ A;  2ZNX Y;  1IWT A;  3TXD A;  3WVX A;  1C45 A;  1GBZ A;  4XAD A;  1DXJ A;  5DLA A;  3CQL A;  8LYZ A;  5B1F A;  1HFX A;  4YM8 A;  5L3H A;  1LJE A;  2EQL A;  1IWW A;  193L A;  3AZ5 A;  3ATO A;  1GDW A;  2Z18 A;  1AZF A;  3P68 A;  1D0K A;  4LYT A;  1IR9 A;  1QSA A;  4LFX A;  1IY3 A;  1JJ3 A;  1OUH A;  4WO9 A;  1LZT A;  1LAA A;  1LZY A;  5F9X A;  2D4K A;  4HTK A;  4ETD A;  4LT0 A;  1WQR A;  4NSH A;  4HJV A;  3RU5 A;  5C6I A;  1D9U A;  3WU9 A;  1LMP A;  3M18 B;  4HJY A;  1LZE A;  2I25 L;  1SQ2 L;  4H9E A;  1GXV 2;  2MEG A;  1ALC A;  1IC5 Y;  1LHL A;  4WOA A;  5KXN A;  1VFB C;  2BLX A;  2DBT A;  4O34 A;  4RLM A;  2B5Z A;  4DYG A;  1CKF A;  1LSB A;  5DL9 A;  4QEQ A;  2BAA A;  1GF8 A;  1IWV A;  2EIZ C;  4UWV A;  3WMK A;  3QY4 A;  4EOF A;  1XGT C;  2HUB A;  2CGI A;  5HLL A;  4CJ2 A;  3ULR A;  4NGI A;  4NHT A;  1LJF A;  1J1X Y;  2F30 A;  1HSW A;  1LSC A;  1NMM A;  3A67 Y;  5LA5 A;  1GFJ A;  4FJR A;  4ZFP A;  1GD6 A;  1BB7 A;  1T6V L;  4H93 A;  1LKS A;  1OUB A;  2ZYP A;  3CT1 A;  2MEC A;  1FLY A;  2YBJ A;  4G9S A;  1LZA A;  1UIC A;  1XGP C;  3B72 A;  3MGW A;  4CFP A;  4J7V A;  1EL1 A;  1GAY A;  1GBO A;  3OK0 A;  3AGI A;  1NBY C;  4QGZ A;  2ZWB A;  4RLN A;  3WXU A;  1LHJ A;  4ETC A;  1DPX A;  1JPO A;  5B07 A;  1JSF A;  2C8O A;  1OUF A;  1CJ9 A;  1B7R A;  1IOQ A;  2D4I A;  1UIF A;  1QUT A;  1IIZ A;  2LYO A;  1WTM A;  5KXR A;  1BB3 A;  3LZ2 A;  2XJW A;  4OOO A;  1GAZ A;  1B7S A;  1H87 A;  2DQG Y;  1I1Z A;  2H9J A;  4Z98 A;  4AXT A;  1NHE A;  2ZNW Y;  1N4F A;  1BB6 A;  2YSS C;  3AGH A;  4YF2 A;  4CGE A;  5DN4 A;  1IOR A;  3WUA A;  3HBH A;  1B5Z A;  2I6Z A;  2D4J A;  1TEW A;  3WYH A;  4ET9 A;  1JIT A;  4HPE A;  1LSY A;  4NGV A;  1B7O A;  3LYM A;  5HMV A;  4ZEE A;  2MEH A;  3TXK A;  3AJN A;  3W6F A;  1WQM A;  1FBI X;  3P4Z A;  1GFK A;  4H92 A;  4XJB A;  2HEE A;  1FN5 A;  1GFT A;  2LYM A;  5KXM A;  4B49 A;  1GEV A;  1LZR A;  1GB2 A;  2YDG A;  4WLT A;  3IWR A;  5F16 A;  3WUM A;  2BQH A;  3TXG A;  4DD2 A;  4BS7 A;  1LSM A;  1VED A;  2XBS A;  4DD7 A;  1YQV Y;  1XGR C;  1HF4 A;  4B4I A;  1HHL A;  1QDR A;  1C7P A;  3LYT A;  1UIB A;  3D3D A;  1RI8 B;  4NY5 A;  4ETB A;  4NSI A;  2A7F A;  3AYQ A;  1WVV A;  4ET8 A;  4X3B A;  4YEM A;  4DD0 A;  1AT6 A;  3CT5 A;  2W1L A;  2X0A A;  1HEL A;  1GB5 A;  2YBM A;  4HTQ A;  5F81 A;  3AZ7 A;  5KKI A;  1B7P A;  4XEN A;  3LHM A;  1G7L C;  4QY9 A;  5ILF A;  2FBD A;  1B7N A;  1REY A;  3WH1 A;  1GF9 A;  1OUJ A;  4TSB A;  1IWU A;  1UBZ A;  2WAR A;  5LA8 A;  1YIL A;  4NSG A;  5FHW A;  3WL2 A;  1LYO A;  1YRO A;  3QE8 A;  1CJ7 A;  1JWR A;  4LYB A;  1LSA A;  1ZMY L;  3K3T A;  1IP1 A;  4NFV A;  4OWA A;  2HEB A;  3HBD A;  3WUL A;  4RDS A;  2DQH Y;  1UID A;  1LJG A;  1LYS A;  1IX0 A;  1O23 A;  4YEO A;  1LPI A;  5DN5 A;  3WU8 A;  1UC0 A;  4LYC A;  5KKJ A;  5KXX A;  1HEN A;  4IAT A;  4H8X A;  1WQN A;  3TMU A;  1JKD A;  2BQC A;  2MEB A;  1RE2 A;  1YAM A;  4NGW A;  1LMQ A;  3KAM A;  5KXS A;  5IHG A;  3IJU A;  3W6A A;  1GFG A;  1LKR A;  5HNC A;  1CKH A;  1FLQ A;  2YBH A;  1JIY A;  1PZY A;  1GF4 A;  3AW6 A;  2ZQ4 A;  3CSZ A;  1LZ1 A;  1VAT A;  4ETE A;  4HV1 A;  4HP0 A;  1NKH A;  1XGU C;  4NGJ A;  1NBZ C;  1UIE A;  2LZT A;  2FYD A;  2BQE A;  2BQA A;  5LYM A;  1UIA A;  1GDX A;  4GCE A;  2D91 A;  4WM6 A;  2W1M A;  4OOT A;  1W6Z A;  2HED A;  1GB3 A;  4RW2 A;  1OUE A;  1I20 A;  4N9R A;  5A3E A;  5I4Y A;  2IFF Y;  1IY4 A;  1J1P Y;  1D6Q A;  1LZG A;  1F6S A;  1IEE A;  4H9B A;  4NGO A;  1HEP A;  7LYZ A;  2DQI Y;  1G7I C;  4GCF A;  3FI7 A;  1TBY A;  1OQM A;  4LFP A;  3A90 A;  4NGZ A;  4H90 A;  3BKV A;  1C10 A;  5FEK A;  4WG1 A;  3WU7 A;  1CKG A;  4GCD A;  3P66 A;  5L9J A;  3GXK A;  1RJC B;  1REX A;  4WL6 A;  6LYZ A;  2PC2 A;  4H8Y A;  4I0C A;  1HNL A;  3AZ4 A;  3EBA B;  4II8 A;  4DD3 A;  1HMK A;  1GBS A;  1UAC Y;  1YL1 X;  2MEE A;  1FKQ A;  3F6Z A;  4LYM A;  4PGJ B;  3B0K A;  4KXI A;  2VB1 A;  1B5U A;  3B6L A;  4H9A A;  1B5Y A;  1C43 A;  1GFV A;  4J1B A;  4U3X B;  5KXZ A;  4NGY A;  1MLC E;  2HEF A;  1GPQ C;  5D5F A;  4QDN A;  4H8Z A;  1QTE A;  1LSF A;  4LYO A;  5LAF A;  1QIO A;  1QQY A;  1UIG A;  1HEQ A;  4OWE A;  1QUS A;  1JTP L;  3QNG A;  3A6C Y;  4HJZ A;  5HMJ A;  1DKJ A;  1B5V A;  5LYT A;  3P64 A;  2BQO A;  5E9R A;  1OP9 B;  1DQJ C; 
#chains in the Genus database with same CATH topology
 2AUB A;  2DWZ B;  1L30 A;  4Q7J A;  4GBR B;  4NHP A;  1C6H A;  2LHG A;  4LGK A;  4R71 A;  1L13 A;  4RW1 A;  1GB9 A;  2OTY X;  4MR1 A;  4MH0 E;  1D2N A;  2NTH A;  3ATN A;  1PQI A;  102L A;  4I8O A;  3GLG E;  1GBW A;  2Z3X A;  1IO5 A;  1CV6 A;  3IG8 A;  194L A;  3WPJ A;  4MM3 B;  3GUJ A;  4GKJ M;  4R7G A;  3PFI A;  123L A;  3RT5 X;  2RB0 X;  5KQD A;  4PPO A;  2Z4S A;  3CTW B;  2W1X A;  2XZU A;  3AGG G;  2GNO A;  1IQP A;  2DEN A;  1Q02 A;  3GXR A;  5FST A;  3HTB A;  4I7Q A;  1IM2 A;  1LZ8 A;  158L A;  1HNW M;  1L92 A;  3RFW A;  4P16 A;  5KXL A;  2QNJ A;  3G3A B;  1LMN A;  1LMA A;  163L A;  4IBJ A;  1H6U A;  4K5Y A;  2KA6 B;  2A4T A;  2Z12 A;  4AG6 A;  4UWN A;  4LJA A;  1R7R A;  4FW9 A;  1HEM A;  5I4W A;  3TMX A;  4LZJ A;  4B08 A;  1S3S A;  4WMG A;  1GF5 A;  1GB0 A;  1L74 A;  4N0J A;  4LGM A;  173L A;  3HBE X;  2RAY X;  3GO8 A;  4DBG B;  2F5S A;  3HX3 A;  1L89 A;  2DZN B;  3J4G A;  2KRU A;  1I94 M;  3LW5 F;  3LQQ A;  1OUI A;  3DKE X;  1BVK C;  3CB7 A;  1HT2 E;  4LDO A;  2FFJ A;  3M0E A;  196L A;  3MHV C;  2G8L A;  1C6B A;  1B7Q A;  2W82 A;  4P17 A;  4N5R A;  3SAT A;  1LJI A;  1UA6 Y;  3HH6 A;  3L2A A;  1GF7 A;  1GE4 A;  1G0Q A;  4D9Z A;  1N34 M;  1PJT A;  5IWA M;  2ZAO A;  2Z2F A;  2RAZ X;  2C8P A;  1IBL M;  4W57 A;  3A45 A;  4NG8 A;  4NSR A;  1IC7 Y;  4WG7 A;  2OOB A;  1CV3 A;  1AT5 A;  1TF0 B;  1L87 A;  1L47 A;  3ZCB B;  3K8Z A;  169L A;  242L A;  1LZD A;  4GHA A;  1NSF A;  3AJI B;  1JUG A;  1L86 A;  3HU9 A;  2DAM A;  2FYC A;  1T8A A;  4FWG A;  3B0O A;  1L64 A;  2Y0Q A;  1AKI A;  2YR0 A;  2B6T A;  1XEI A;  3E3D A;  1C46 A;  1WQO A;  2LVN C;  4DAJ A;  2Z38 A;  1N33 M;  5LVG A;  1L41 A;  3CF0 A;  2MGW A;  4I8S A;  5IDD A;  1LMC A;  2RSC A;  4NHQ A;  3FUU A;  4NIJ A;  5FDJ A;  4L6V 6;  1LYE A;  177L A;  1L52 A;  1L55 A;  4HL4 A;  2DWN A;  2YBN A;  3W6C A;  1LGX A;  1TAY A;  4XN6 A;  3U6O A;  3KFU G;  1R5L A;  2G4Q A;  4JI5 M;  1F10 A;  1IP2 A;  3GUM A;  1NWG A;  4AI6 A;  205L A;  4DV2 M;  256L A;  2QCU A;  1MN3 A;  5LVH A;  2OU8 A;  4J0L A;  3B7N A;  5I5Q A;  3HHY A;  4DV3 M;  1LW9 A;  4I7O A;  4XJG A;  2OQ4 A;  183L A;  4CIS A;  1L81 A;  2R4E A;  1G7M C;  3HHW A;  1ZV1 A;  5B05 A;  4OX9 M;  2QBY A;  2HTX A;  1GHL A;  5B06 A;  2LVA A;  2HU1 A;  4R0F A;  3C81 A;  4W94 A;  1T6O A;  1NV9 A;  1XXH E;  3E46 A;  1SG9 A;  1IWY A;  1KXX A;  3UMM A;  1L27 A;  4KPM A;  1IOC A;  1SXJ C;  1WHC A;  5ITX E;  2OPF A;  201L A;  1BWI A;  4UWU A;  4R6C A;  1NY6 A;  5EXP A;  2RB2 X;  2F5P A;  4DWX A;  2XF3 A;  228L A;  2IHL A;  2D6B A;  5II3 A;  2LYZ A;  1L50 A;  3A94 A;  1QDT A;  4B0D A;  1LYJ A;  4DD1 A;  1P3N A;  2DQC Y;  5KXO A;  1YE9 A;  1XNR M;  1MEL L;  1TDH A;  2JY5 A;  1DGB A;  1P2C C;  4CFO A;  1X37 A;  3KW6 A;  3FTD A;  4GN4 A;  4IJF A;  4LGY A;  3W6B A;  4AGA A;  5EXT A;  4YOP A;  5FTK A;  4WM4 A;  1L07 A;  4WLD A;  1VDL A;  1GFH A;  3RZ4 A;  2VII A;  1J1O Y;  2OU0 X;  3C8R A;  1LI2 A;  2BQN A;  4W58 A;  2LVO C;  3DZD A;  2YVB A;  3F9L A;  4H9H A;  1KSF X;  165L A;  1GE2 A;  4W54 A;  1P6Y A;  1L26 A;  4TSC A;  4I7M A;  3JR6 A;  1B0D A;  1HJP A;  3VLF B;  1R2Y A;  3A46 A;  1WIV A;  4ANR A;  2BWE A;  3HU2 A;  3SBJ A;  4WM1 A;  1B5W A;  5B59 A;  1TTE A;  2R65 A;  2OE9 X;  4H91 A;  3VFD A;  5F14 A;  4N1C C;  2DQE Y;  1GFR A;  4LF8 M;  1IP5 A;  4MCK A;  1BGI A;  3A3R X;  3LCV B;  2RGH A;  3HFM Y;  1L99 A;  3ZEK A;  1L70 A;  2HAK A;  4EXM A;  2B7X A;  1IP3 A;  2CWI A;  1B6I A;  3TXD A;  1DXJ A;  5DLA A;  2CEA A;  5B1F A;  1HFX A;  4YM8 A;  5L3H A;  3CGW A;  2EQL A;  3ATO A;  1L16 A;  2X49 A;  4G6Z A;  3L29 A;  1VEK A;  1D0K A;  3WHK A;  1XC8 A;  4LYT A;  1AUA A;  1LZY A;  1RU3 A;  3SHF A;  210L A;  1QAQ A;  3HWS A;  2HUL A;  1WQR A;  4UN2 B;  1OAO C;  1LLH A;  2BNK A;  1C6Q A;  5C6I A;  1P64 A;  1LMP A;  3M18 B;  1L02 A;  2VQF M;  4H9E A;  1OIP A;  1VFB C;  139L A;  3B7Z A;  5DL9 A;  4QEQ A;  4UWV A;  2EIZ C;  1GO5 A;  1XGT C;  5KPT A;  1VG5 A;  4CJ2 A;  3ULR A;  2LH0 A;  4NHT A;  2F30 A;  1HSW A;  3KOZ E;  1BB7 A;  3DN0 A;  1T6V L;  1SSW A;  2LVP C;  2DHY A;  2MEC A;  5FTJ A;  5EJC A;  2JA2 A;  1K28 A;  1G71 A;  3A42 A;  3B72 A;  4CFP A;  4J7V A;  1GAY A;  1P2L A;  1IN7 A;  3OK0 A;  1NBY C;  2ZWB A;  4GRV A;  4S12 A;  3OE0 A;  4PDI A;  1ZYT A;  1OJL A;  2QBY B;  1JSF A;  1OUF A;  1IOQ A;  1UIF A;  4OOO A;  2APL A;  119L A;  1H87 A;  3U6C A;  2KXE A;  2DQG Y;  2UXD M;  1I1Z A;  4Z98 A;  3G3V A;  2ZNW Y;  3GUP A;  2BWB A;  1BB6 A;  4YF2 A;  4CGE A;  3WUA A;  2UU9 M;  1G0G A;  2I6Z A;  2D4J A;  3WYH A;  2WSF F;  2RRU A;  1JIT A;  3LYM A;  4I7P A;  3OE6 A;  5KQ8 A;  3F8V A;  220L A;  2HKJ A;  2HEE A;  3HHZ A;  1FN5 A;  1T6H A;  1SX2 A;  3D4S A;  5KXM A;  3LZM A;  3PBL A;  1OVJ A;  2LBC A;  232L A;  246L A;  3HUK A;  1GB2 A;  2YDG A;  4WP2 A;  1G0K A;  4X62 M;  4L78 A;  1LSM A;  1VED A;  4DR2 M;  238L A;  1L0J A;  1C61 A;  4ETB A;  3CDV A;  1NHW C;  2Q2E B;  4JN6 A;  3IHP A;  3VDU A;  152L A;  2RH1 A;  4LJ4 A;  254L A;  4FCT A;  3T6P A;  1HEL A;  5KKI A;  1PQO A;  1B7P A;  3LHM A;  1G7L C;  2JY8 A;  4TSB A;  1PQJ A;  5LA8 A;  3NBI A;  149L A;  1YIL A;  1L60 A;  125L A;  1LYO A;  5L8R F;  3T15 A;  4AG5 A;  1L19 A;  1LSA A;  1Q39 A;  4ARM A;  3C82 A;  2DQH Y;  3SBA A;  2KNA A;  4YEO A;  1IX0 A;  2DAE A;  1CV5 A;  1O23 A;  3L2X A;  2CHG A;  2R46 A;  3L64 A;  5DN5 A;  1UC0 A;  1JTM A;  3U5Z B;  2CV0 A;  4H8X A;  2DZO B;  3KS8 A;  2YFQ A;  2HL7 A;  3LCU A;  4IBC A;  1JKD A;  111L A;  3FE3 A;  1YAM A;  197L A;  170L A;  1LMQ A;  4ARP A;  3GUO A;  3W6A A;  1LKR A;  5ITT A;  3UGJ A;  1CKH A;  3SB7 A;  2QQ8 A;  1GF4 A;  3AW6 A;  2V1C A;  2ZQ4 A;  249L A;  1LZ1 A;  3BOS A;  2MJ5 B;  3FUW A;  1C6P A;  2MH8 A;  1UIE A;  1PJQ A;  5BPV A;  2FYD A;  4CJ6 A;  127L A;  1L32 A;  4DV0 M;  2E5L M;  2L2D A;  1JR3 A;  1YSY A;  1G0M A;  4OOT A;  3K2R A;  5A3E A;  1P36 A;  1J1P Y;  1LZG A;  4H9B A;  4TWS A;  4GCF A;  2Z8Y M;  1OQM A;  3B89 A;  3BKV A;  2FE8 A;  3HT9 A;  1CKG A;  3WU7 A;  3GXK A;  3QYE A;  143L A;  4MGZ E;  2OOA A;  4IBG A;  1L97 A;  1GBS A;  1UAC Y;  2EJS A;  1YL1 X;  2QHO B;  5KO3 A;  4KXI A;  4U3X B;  1GFV A;  1ZMW A;  3SB9 A;  4B3R M;  2RBR A;  1P5C A;  1QTE A;  5LAF A;  1QQY A;  4JXJ A;  4W52 A;  1JTP L;  5DYI A;  3QNG A;  1QAN A;  1DKJ A;  1C6L A;  5LYT A;  1CU2 A;  1L22 A;  2Q9E A;  1L98 A;  4QHS A;  175L A;  4DV4 M;  1C6A A;  3Q8G A;  1JTT L;  1CNS A;  3QAK A;  2XH9 A;  4W51 A;  1NJG A;  4WL7 A;  1NHB A;  5IT9 S;  4LT2 A;  1WXQ A;  3KDS E;  3CSR A;  1LHI A;  1L33 A;  1PJJ A;  1LZN A;  2OEA X;  1E8L A;  1ZVH L;  2L78 A;  5E4P A;  4EPI A;  2HU3 A;  5APF A;  1D0M A;  1E9S A;  4XJH A;  1B9O A;  3SB8 A;  4G4O A;  4GMQ A;  185L A;  3I01 M;  108L A;  3CF2 A;  3GPX A;  1C6N A;  1YKZ X;  1G0L A;  3VWO A;  5IZ7 D;  107L A;  4TX7 A;  1E32 A;  3T1H M;  1LYY A;  186L A;  3FD9 A;  1QTC A;  8CAT A;  1DI5 A;  1KW5 A;  2R4J A;  2RKO A;  1JHL A;  4BLC A;  114L A;  1Z5C A;  4L41 A;  1T43 A;  1LJ4 A;  1T8F A;  1ZV5 L;  4MGK E;  1BQL Y;  1LZB A;  1NVM A;  1OAI A;  1GEZ A;  4FWH A;  1GF3 A;  1LJK A;  2JP7 A;  1ZWN A;  2G4N A;  3EXD A;  5IEL A;  4LZM A;  2X8A A;  4L4U A;  2C9O A;  2HEC A;  4G4H A;  3C3E A;  5LVK A;  1LWK A;  5LAG A;  2B73 A;  1HC0 A;  3CSQ A;  3DMX A;  1JKC A;  2QPA A;  1L88 A;  3ZVQ A;  5E6J A;  2ZQ3 A;  1XB2 B;  1SWZ A;  2JY6 B;  1IOS A;  1L96 A;  4Z6Y A;  4ITQ A;  2DQF C;  4NRW A;  1G1W A;  2OU9 A;  3A96 A;  4S0W A;  4H1P A;  3TXE A;  5APE A;  4ARM B;  1EFU B;  1D3N A;  2B72 A;  3P65 A;  4G4B A;  1SXJ A;  3D8B A;  5C6J A;  1XSF A;  3TL4 X;  3DA1 A;  1QS9 A;  4IBI A;  1F6R A;  5KXP A;  1LZ5 A;  3SP3 A;  1CKC A;  4G4R A;  1L35 A;  3GUI A;  1LZ9 A;  1D3J A;  4IIW A;  4ARQ A;  1QT5 A;  1OUD A;  4XJI A;  245L A;  3HT7 A;  2RB1 X;  1WJ7 A;  1CV0 A;  5H37 D;  4LT3 A;  3CF6 E;  1IP7 A;  3EIH A;  1MU5 A;  3FUV A;  1XMO M;  2EKS C;  2GV0 A;  2QAR C;  1IP4 A;  3DMZ A;  240L A;  1C60 A;  4NGK A;  1LWG A;  1IR8 A;  4GN5 C;  4LCB A;  3WW6 A;  4W56 A;  2H5Z A;  2Y8P A;  4QOS A;  1DYD A;  1BHZ A;  4H9F A;  4LZZ A;  2JNH A;  1XFP L;  4KL7 A;  2NWD X;  4B4J A;  4NSO B;  4W96 A;  1HEO A;  1GBX A;  146L A;  1QAO A;  150L A;  3RNX A;  2B6X A;  3W68 A;  2Z19 A;  2XFT A;  3TXJ A;  3B74 A;  1L93 A;  4N1E I;  2DAI A;  4GC5 A;  4LT1 A;  1C65 A;  3MMP A;  1JJ0 A;  1L90 A;  3LYZ A;  4DT3 A;  2O4W A;  3G3B B;  3I4Y A;  2L4E A;  236L A;  1G06 A;  1IVM A;  1L31 A;  1WR1 B;  3HJQ A;  3RUN A;  1SWY A;  3GRV A;  4I7N A;  5HQ1 A;  2XBR A;  4WO6 A;  184L A;  1IWX A;  3OTO M;  1DGF A;  1DYB A;  4JI2 M;  5I4X A;  2YBI A;  1IWZ A;  1JIS A;  1CUK A;  1C6I A;  1GF0 A;  3WW5 A;  2ANV A;  3FYD A;  5B1G A;  1TR8 A;  1Y8G A;  2JUJ A;  2B6W A;  4PHI A;  5FEL A;  1RFP A;  109L A;  2MED A;  1QTH A;  4LZT A;  3WUN A;  4KOD A;  1CV4 A;  1JQU A;  1QUD A;  5APC A;  3RW8 A;  2F2N A;  1NQI A;  2R45 A;  1KNI A;  1PRB A;  2CWB A;  2O25 A;  1L0K A;  2A7D A;  1MJG M;  4XGI A;  1KW7 A;  4M9Z A;  4NWH A;  2DAK A;  3TE6 A;  3DN8 A;  144L A;  1INU A;  2LZ2 A;  2KZU A;  3KOX E;  3SAS A;  3DOA A;  3KP1 E;  2I7N A;  156L A;  2ZTD A;  2ZTC A;  2Z2E A;  4PJZ A;  4EKR A;  5KXY A;  1NHG C;  257L A;  4YEN A;  1D3M A;  4JI6 M;  216L A;  1BB4 A;  3A91 A;  5LZM A;  1OQY A;  2WSE F;  3ZVQ B;  3U6D A;  3UZU A;  1OUG A;  3EO5 A;  1PJI A;  3TXH A;  1LMT A;  4BAD A;  1IFY A;  4B1A A;  3T36 A;  1GFE A;  2BLY A;  1YAO A;  3C58 A;  225L A;  3LZT A;  1QQW A;  2EKK A;  1SXJ B;  162L A;  4HEO A;  5LIO A;  4M4O A;  3SC3 A;  5A3Z A;  1GB6 A;  4H9I A;  1UM8 A;  2OO9 A;  2EO2 A;  1BVX A;  1WVU A;  4GCB A;  1DGH A;  4F1I A;  5I54 A;  1RCM A;  3ZC7 B;  1WQQ A;  1TCY A;  2Z37 A;  1LHH A;  2XFS A;  1LHM A;  4W53 A;  241L A;  3M3U A;  4NGL A;  4ARQ B;  3GRR A;  4REZ A;  3J7A S;  3TMV A;  1LCN A;  167L A;  3G3W A;  1IR7 A;  1L42 A;  3AOE C;  2KNZ A;  1DV0 A;  4GLV A;  3ZQJ A;  233L A;  198L A;  166L A;  3W0L B;  3ODU A;  1GBZ A;  3GLF E;  2M60 A;  1G59 A;  1L15 A;  2CHQ A;  4GKK M;  3CQL A;  4OO9 A;  4II7 A;  1IWW A;  4I7J A;  221L A;  4B7H A;  4JI4 M;  4I7S A;  4GC9 A;  4DR6 M;  172L A;  1N36 M;  3H4J A;  5F9X A;  1IBM M;  3DMV A;  3SB5 A;  1L80 A;  4LT0 A;  4NSH A;  1HQY E;  3T1Y M;  3GPU A;  1Q3B A;  251L A;  1SQ2 L;  1LHL A;  4LJ6 A;  4RLM A;  2DNA A;  4DYG A;  2F32 A;  3GLH A;  2BAA A;  4EOF A;  4B3S M;  4MGY E;  1QT7 A;  3PNV A;  5HLL A;  258L A;  3UK6 A;  4KT0 F;  2HWJ A;  4GEW A;  1J1X Y;  1LJF A;  1LSC A;  1NMM A;  3A67 Y;  1GFJ A;  4FJR A;  1OFI A;  3K92 A;  120L A;  148L E;  2CE7 A;  3CT1 A;  5EP1 A;  2UUC M;  128L A;  4CIZ A;  1L36 A;  2L6O A;  1LZA A;  3RE8 A;  3VKG A;  1XGP C;  215L A;  3J80 S;  1EL1 A;  1NV8 A;  1GBO A;  5A2Q S;  3WXU A;  1L00 A;  1LHJ A;  1DPX A;  3M7G A;  1JPO A;  5B07 A;  2C9C A;  4M9X A;  2C8O A;  3GLI A;  4RF1 A;  250L A;  1QUT A;  1IIZ A;  253L A;  1BB3 A;  4XBO A;  3OE8 A;  1GAZ A;  182L A;  1SSY A;  2KEB A;  4W59 A;  1XJT A;  1SXJ D;  2NQ8 C;  4AXT A;  3HZJ A;  4FVM A;  1C6C A;  126L A;  1C62 A;  1P2R A;  3AGH A;  4I81 A;  4D80 A;  1IOR A;  3SYK A;  1TEW A;  4HPE A;  2CFO A;  1B7O A;  3B7Q A;  4ZEE A;  4GHL A;  3W6F A;  1WQM A;  1FBI X;  2UUB M;  2LCB A;  3HU1 A;  2K9D A;  3MK6 A;  4XJB A;  3UJN A;  1GFT A;  1Z5A A;  5DYG A;  229L A;  1GEV A;  1L38 A;  3SAW A;  2VF8 A;  3KSJ A;  4WLT A;  2IGC A;  3WUM A;  1QTD A;  3TXG A;  4BS7 A;  5FTL A;  3GLG A;  2XBS A;  1YQV Y;  1QDR A;  3D3D A;  5EXX A;  3GPP A;  1WVV A;  1C63 A;  2RBN A;  4YEM A;  1FNN A;  1HQC A;  4IBE A;  3JR5 A;  1L34 A;  1HNX M;  3UON A;  2P5T A;  1L06 A;  4XEN A;  1L65 A;  1DYF A;  5ILF A;  3D8L A;  3DNA A;  3AFH A;  1IWU A;  2WAR A;  1DO0 A;  4NSG A;  1LI3 A;  4KO8 A;  3M6A A;  1C6K A;  5GKN A;  1P3Q Q;  1GL6 A;  4Y28 F;  3FRI A;  1JWR A;  1L10 A;  3K3T A;  1DGH B;  4LY6 A;  4MGI E;  3HBD A;  4LYB A;  4OWA A;  3WUL A;  1PJS A;  3SAR A;  3U5Z A;  1BVS A;  1HT1 E;  2RGO A;  2JZ1 A;  5KKJ A;  3WU8 A;  5KXX A;  4QNM A;  1XEP A;  4ARJ A;  1DO2 A;  2MEB A;  5EXS A;  4ZPU A;  1PZY A;  3NBX X;  4I7K A;  3CSZ A;  3JR4 A;  3LVW A;  1DYA A;  3U61 A;  4HV1 A;  187L A;  1ZMV A;  1NBZ C;  1L82 A;  3THG A;  2BQE A;  4LJ8 A;  5LYM A;  1GDX A;  4GCE A;  4NRV A;  2AHM A;  2W1M A;  4G3O A;  1W6Z A;  2HED A;  1ZUR A;  1I20 A;  5ITU A;  5I4Y A;  4I4L A;  2F5O A;  145L A;  3HU8 A;  4NGZ A;  3FI7 A;  1CU6 A;  131L A;  2B74 A;  4GCD A;  3P66 A;  1KY0 A;  1REX A;  6LYZ A;  3U6Q A;  3LMM A;  3AKZ A;  3GLH B;  1HNL A;  3AZ4 A;  4II8 A;  3HDF A;  115L A;  1XJU A;  4DD3 A;  4LYM A;  2MEE A;  1FKQ A;  1JTN A;  4D82 A;  1B5U A;  4J1B A;  2ZBK B;  4NGY A;  1LGW A;  200L A;  261L A;  2F47 A;  2QB0 B;  5D5F A;  3U60 A;  4H8Z A;  4LYO A;  1GJT A;  4OWE A;  138L A;  1IXS A;  4JI0 M;  3A6C Y;  1G1V A;  1Z6T A;  2LXE A;  3P64 A;  3FAD A;  1KFV A;  2MRO B;  2BQO A;  2QEN A;  1OP9 B;  1L39 A;  1L91 A;  2ZM6 M;  1CJ6 A;  3DFZ A;  1GBY A;  1VDT A;  3GLI B;  2DWM A;  4CGY B;  1OVK A;  1XEK A;  3I51 A;  1PQK A;  3J81 S;  1L1Z A;  2DKV A;  1A4V A;  3QYB A;  3K9P A;  2DWL A;  2G4P A;  1VEJ A;  1L01 A;  3SN6 R;  4W5W A;  2K0B X;  141L A;  1PS5 A;  3LQR A;  1C7Y A;  1LOZ A;  4HTN A;  1OVH A;  1QT6 A;  2VQE M;  4JI1 M;  1L72 A;  1MX0 A;  1YKY X;  3WPK A;  3IEC A;  1C6E A;  1GWD A;  3AV0 A;  1DKK A;  2BQD A;  1L44 A;  1LI6 A;  1L17 A;  1GF6 A;  1DZB X;  1A5T A;  4FDY A;  3J2P B;  4OW1 A;  1C6F A;  4AKG A;  3WHL A;  3GLG B;  1HML A;  4IBD A;  3GQ5 A;  1CJ8 A;  3GUN A;  2H5X A;  1CUP A;  3RZE A;  1C6T A;  1PM5 A;  4M0D A;  1EQ4 A;  1V7S A;  3VDP A;  1L79 A;  1QT8 A;  3H4M A;  1XXH A;  1LJH A;  4OWB A;  3OJP A;  3L25 A;  2CRU A;  226L A;  2LNH C;  1L2B A;  1PQD A;  1VAU A;  5IRE B;  3VW7 A;  1L48 A;  4PCZ A;  1DI4 A;  1FLW A;  2DXI A;  207L A;  4MST A;  2KDL A;  4LYZ A;  1K3W A;  3FI5 A;  2UUA M;  133L A;  1HSX A;  4IAS A;  2DQD Y;  4WLY A;  1DYG A;  5EBH A;  2B6Y A;  1LSG A;  3EIE A;  1GFA A;  3W6D A;  3NY8 A;  3KS4 A;  3W0F A;  1LSP A;  3PDS A;  180L A;  1VDP A;  1NY5 A;  3TWL A;  9LYZ A;  3GUL A;  5KXT A;  1NO1 A;  1T3T A;  147L A;  2O01 F;  3BXW A;  1N77 A;  2FNA A;  1QTB A;  3A92 A;  3ZH9 B;  3DN1 A;  1YL0 X;  1QSB A;  1P37 A;  4HSF A;  3U61 B;  1LMO A;  2EPE A;  5DM9 A;  5C6L A;  2BQG A;  2I26 L;  2KHH A;  1BWJ A;  1L09 A;  1LZS A;  3TXF A;  5DNY A;  1GE3 A;  4P2E A;  1HR0 M;  1BB5 A;  4Z8X A;  4EKP A;  4DKL A;  1QT4 A;  1LJN A;  1TGU A;  4NXN M;  4BAF A;  4EPF A;  1YAP A;  5FTM A;  4NG1 A;  1GAB A;  1QTK A;  1LZ4 A;  2C5R A;  1GFU A;  239L A;  1D6P A;  1L85 A;  1LV7 A;  2F5N A;  1KS3 A;  1QSW A;  1KIR C;  1L67 A;  1L18 A;  2Q0M X;  1L8Q A;  4Z41 A;  3U60 B;  4ML7 A;  1L20 A;  1XEJ A;  1GE1 A;  1IXS B;  1L37 A;  1L46 A;  4JYA M;  1EQE A;  3AOE A;  3TMW A;  1QYR A;  2WSC F;  4GCC A;  2Z6B A;  4FCW A;  2D7H A;  4NSJ A;  1IP6 A;  1IC4 Y;  3KP0 E;  4GH9 A;  1LZ6 A;  2XQO A;  4YXA C;  4NXM M;  5L3I A;  1L14 A;  4X64 M;  3LN2 A;  4G4Q A;  1UUZ C;  4JI8 M;  1H6M A;  1G7H C;  4PRQ A;  206L A;  2XSZ A;  1L11 A;  3KSX A;  4KHP M;  1JTO L;  3KOY E;  1QUG A;  5LMU M;  1T3P A;  2B70 A;  3SMS A;  1NNJ A;  5EP2 A;  4PRU A;  3D9A C;  4WM3 A;  4CHX A;  3DN6 A;  1CU3 A;  1DYE A;  4B4E A;  1WQP A;  3TXI A;  4ZIX A;  2Z39 A;  2HEA A;  1NJF A;  1KIP C;  1I6S A;  4G4C A;  1CKD A;  213L A;  3N9A A;  2F2Q A;  3HKP A;  4NOO B;  1GE0 A;  3T6U A;  1IN8 A;  1JB0 F;  4DDB A;  5LYZ A;  4G49 A;  247L A;  1Z55 A;  1GKI A;  3LVV A;  4DUZ M;  3K1J A;  5AMY A;  3BKH A;  1KYI A;  3SYL A;  1V7T A;  5I53 A;  4DDC A;  2JY7 A;  2DAG A;  192L A;  1LYZ A;  3R8F A;  3KVW A;  1CUQ A;  2MEI A;  2DQA A;  1XXH B;  3FUT A;  1W5S A;  2R62 A;  1JKA A;  3J6K A;  1NDG C;  4JI7 M;  1L68 A;  1HER A;  3U6L A;  2ZIK A;  1L49 A;  4TTD A;  4IAP A;  2L09 A;  4NHI A;  5LVI A;  222L A;  178L A;  4LJ9 A;  4LJ5 A;  5F9U A;  3ILK A;  1R4G A;  4OW0 A;  2B75 A;  1QVR A;  1HFZ A;  4NEB A;  2OE7 X;  1QTZ A;  1ZVY B;  1TH2 A;  4IBF A;  1DGG A;  3AW7 A;  5APD A;  4BBA A;  1L71 A;  2YQZ A;  4ARL A;  4IBK A;  3WXT A;  4EIW A;  2ZYC A;  164L A;  1L83 A;  5JI3 E;  3AB6 A;  4XYY A;  1B5X A;  1L73 A;  1QS5 A;  3C83 A;  1G07 A;  1HFY A;  3J7B A;  154L A;  1C08 C;  4RNA A;  2K6B A;  5E26 A;  3T38 A;  3W67 A;  1REZ A;  4L15 A;  2ZNX Y;  3WVX A;  1XHB A;  1PQM A;  5LMN M;  5I14 A;  8LYZ A;  193L A;  2J7O A;  260L A;  1VEG A;  2Z18 A;  1AZF A;  3P68 A;  1IR9 A;  1OUH A;  1LZT A;  4K0K M;  2D4K A;  2JZ0 A;  4HTK A;  4FD2 A;  4JV5 M;  2F5Q A;  1V92 A;  4HJV A;  3HDE A;  4X65 M;  1D9U A;  1SX7 A;  3WU9 A;  255L A;  1LZE A;  3MJ5 A;  2RBS A;  4WOA A;  1GXV 2;  5K7O A;  1IC5 Y;  1OKS A;  2BLX A;  2B5Z A;  2LZM A;  4I7L A;  1L05 A;  1LSB A;  3C7Z A;  1GF8 A;  3V76 A;  1L66 A;  2HUB A;  2CGI A;  1LYH A;  3I4V A;  4NGI A;  3SAU A;  1D9W A;  2LC9 A;  5LA5 A;  3J27 B;  4ZFP A;  4F2L A;  4TUW A;  1EE8 A;  3FUX A;  1LKS A;  2YBJ A;  3FTC A;  3CDO A;  3MGW A;  1QT3 A;  3HGI A;  3AGI A;  1L54 A;  4NL4 H;  4KLN A;  2N35 A;  5FSW A;  4ETC A;  3TWK A;  2V6Z M;  4B3T M;  2LWX A;  1CJ9 A;  2D4I A;  181L A;  4X66 M;  2LYO A;  3LZ2 A;  2L4F A;  1XMQ M;  2FS1 A;  2H1R A;  4AQY M;  1L62 A;  2C96 A;  174L A;  1L59 A;  1NNU C;  1NHE A;  3HU3 A;  1N4F A;  5DN4 A;  1K82 A;  2F4V M;  1GJS A;  1B5Z A;  1D3F A;  3HBH A;  4ET9 A;  2DZL A;  4NGV A;  1LSY A;  1L61 A;  2X4A A;  2MEH A;  1VQ1 A;  3AJN A;  2O5R A;  3P4Z A;  4H92 A;  4QNR A;  1OWZ A;  5EP4 A;  1K3X A;  1G4A E;  195L A;  1JR3 D;  3NYA A;  2EA0 A;  1YUB A;  2VF7 A;  4EKS A;  1C68 A;  1LZR A;  5F16 A;  4LG2 A;  4L16 A;  1HF4 A;  1HHL A;  4LRT A;  1RI8 B;  4NY5 A;  4NSI A;  4ET8 A;  2BJW A;  4JI3 M;  4X3B A;  1D2W A;  1CTW A;  2X0A A;  2ERC A;  4HTQ A;  4LFB M;  2DHR A;  1B7N A;  1REY A;  3FKE A;  1GF9 A;  1OUJ A;  1UBZ A;  1WTH A;  4LFC M;  1L24 A;  5FHW A;  3WL2 A;  3U6P A;  4YHH M;  3C7Y A;  1CJ7 A;  1ZMY L;  4OU7 A;  1C6D A;  5C1B A;  2G3Q A;  1LJG A;  1UID A;  1LPI A;  1T8G A;  4LYC A;  1HEN A;  4DQ7 A;  3GRU A;  248L A;  4LF6 M;  3FA0 A;  3AL0 C;  2J5Y A;  1LPY A;  1GFG A;  2BJV A;  1IXR C;  5HNC A;  2UXB M;  2D7G A;  1FLQ A;  2YBH A;  4L8R C;  1G0P A;  3CDT A;  2JWS A;  4LF5 M;  110L A;  1L58 A;  4RKU F;  168L A;  4HP0 A;  1NKH A;  1XGU C;  1L21 A;  3GQ3 A;  2BQA A;  2XSZ D;  1QUH A;  1UIA A;  4YX7 C;  1GB3 A;  4RW2 A;  1OUE A;  2ANX A;  3I04 M;  2G5G X;  1KY1 A;  1IY4 A;  1F6S A;  1ZMU A;  1IEE A;  4NGO A;  1LYF A;  235L A;  2DQI Y;  1TBY A;  3HWL A;  191L A;  3A90 A;  1L2D A;  1CVK A;  1OV5 A;  2Y0T A;  4DV1 M;  1RJC B;  4WL6 A;  3SFZ A;  2PC2 A;  5EP3 A;  4H8Y A;  4I0C A;  4YY3 M;  3F6Z A;  4PGJ B;  3DN2 A;  5KXZ A;  1MLC E;  3U6S A;  4LDE A;  2HEF A;  1GPQ C;  1L25 A;  1N32 M;  4QDN A;  2HUM A;  1EPY A;  1HEQ A;  1L12 A;  4MB7 A;  1CX7 A;  1OV7 A;  4HJZ A;  5HMJ A;  3QAU A;  1B5V A;  113L A;  157L A;  3GQ4 A;  209L A;  1LGU A;  1TH4 A;  1DQJ C;  4B3M M;  214L A;  4DD9 A;  132L A;  2XGN A;  5KY1 A;  2N5Z A;  1NDM C;  3DN3 A;  4WM2 A;  1GLN A;  2KZS A;  3AOG A;  3A6B Y;  2ZAN A;  1IN4 A;  4AZF A;  1L28 A;  3W6E A;  1L76 A;  3SMP A;  3VK8 A;  4Z3M A;  4ETA A;  2V1U A;  1OTR A;  5LVJ A;  1L40 A;  4J1A A;  171L A;  1BWH A;  4HV2 A;  1R6B X;  3B9P A;  1NF5 A;  3W3E A;  3GRY A;  4I5S A;  176L A;  2Q9D A;  3RGS A;  1C1K A;  2CDS A;  1VDS A;  1P7S A;  1C67 A;  1HEW A;  4C5F A;  4NWE A;  4NC6 A;  1C64 A;  4FWD A;  3A93 A;  1GL7 A;  5M1Y A;  1L2C A;  2BPU A;  2JXN A;  1B7L A;  219L A;  2BQM A;  5D5C A;  1UCO A;  1GXX A;  130L A;  1C6J A;  4A7D A;  4R3D A;  2MEA A;  3WVY A;  4DJH A;  1LSD A;  1IBK M;  4PJ2 C;  1WTN A;  223L A;  4MGH A;  2QP9 X;  2O79 A;  2H9K A;  2W1Y A;  2Y21 A;  5LXW A;  1GB7 A;  217L A;  1AM7 A;  3A95 A;  1L95 A;  1JSE A;  4WW0 A;  1I56 A;  4GIT A;  1ZAE A;  2Z7J A;  2XLJ A;  190L A;  1SLY A;  4M6D A;  1LTM A;  4OVZ A;  3GP1 A;  1YAN A;  4H94 A;  3HJ8 A;  1D2Y A;  2KNV A;  262L A;  3C9P A;  4LF7 M;  142L A;  1YKX X;  2Y20 A;  5FLX S;  1JR3 E;  3GPY A;  135L A;  2D7E A;  3HUQ A;  3AZ6 A;  3FE0 A;  4DC4 A;  1L1T A;  3FTE A;  2XTH A;  2M5Z A;  4WLX A;  2ZIJ A;  1OYU A;  4WUR A;  3F92 A;  1OUA A;  1L43 A;  5HNL A;  4GN3 A;  2Z4R A;  1G0J A;  3G3X A;  5EQT A;  1TDY A;  1C69 A;  3KXE C;  4NHS A;  2LVQ D;  4QOZ C;  3SAV A;  1ORY B;  4DR4 M;  1FLU A;  3K9O A;  4HPI A;  1E94 E;  3PVS A;  134L A;  1REM A;  208L A;  244L A;  4HLQ A;  3HTD A;  5ILC A;  5ITQ A;  3HUA A;  118L A;  3IJV A;  4KT3 A;  1V33 A;  4Z46 A;  4AW4 A;  1FJG M;  1KXW A;  4PK0 A;  1FDL Y;  4IJE A;  1LSZ A;  1N78 A;  1YIK A;  1LSN A;  3EML A;  3OE9 A;  5T3F A;  1C6G A;  4BAP A;  1L57 A;  4AKI A;  1B7M A;  2EUC A;  3E9S A;  4N8Z A;  3VKH A;  2YNM D;  4E3U A;  2K47 A;  1L45 A;  1KXY A;  3JAM S;  3GLF A;  224L A;  3TXB A;  6LYT A;  4DUY M;  1L75 A;  231L A;  4I7R A;  1G8P A;  4GLA A;  2FBB A;  1LSE A;  1XGQ C;  2LHM A;  1P46 A;  1GVN A;  104L A;  1J09 A;  5J7C A;  3L28 A;  3CT0 A;  1CX6 A;  1IY0 A;  2YBL A;  1V34 A;  3C8Q A;  2F4G A;  5JEN B;  1IN5 A;  3SBB C;  2L7H A;  3L27 A;  2F4A A;  4C3W A;  1UIH A;  1Q3C A;  3FYC A;  3U6M A;  2BQL A;  3C80 A;  3A34 A;  3GUK A;  3A3Q A;  3IG5 A;  3HH5 A;  1OFH A;  2ZIL A;  4XJF A;  103L A;  1XWI A;  3FRH A;  4OWH A;  140L A;  3PXG A;  1FKV A;  2QZ4 A;  1LHK A;  1B2K A;  1IOT A;  1VDQ A;  1JKB A;  1QAM A;  3N9E A;  1IXZ A;  160L A;  2B3T A;  4B7F A;  2BQB A;  3L26 A;  3NWL A;  4DV5 M;  3B0I A;  1G7J C;  2CP8 A;  3WPL A;  4AKH A;  4B7G A;  4EMN A;  4DV7 M;  2BQJ A;  4XJD A;  4QHT A;  5KJ9 A;  2B6Z A;  5KPZ A;  1OUC A;  1YAQ A;  1L51 A;  1KIQ C;  2R6F A;  4PDG A;  259L A;  1SXJ E;  2NTG A;  4WM5 A;  4LF9 M;  2DQJ Y;  1E9R A;  1DI3 A;  1LZC A;  2BQF A;  1DPW A;  3C7W A;  4DDA A;  4LRS A;  2CJL A;  5ITX A;  1OIZ A;  1A2Y C;  2BQI A;  4IJ4 A;  3LYO A;  4OVZ B;  2C98 A;  3E4R A;  1LJJ A;  1JJ1 A;  2RBP A;  252L A;  4ZPX A;  1QZE A;  1L08 A;  1D0L A;  1W08 A;  153L A;  3A8Z A;  4CHT B;  3N9C A;  5KXW A;  5FCP A;  1EQ5 A;  1HNZ M;  1JEF A;  4TUN A;  2BQK A;  2DKL A;  230L A;  218L A;  5LIN A;  3A98 B;  5KXK A;  2OE4 X;  1L77 A;  1LYG A;  4GIP A;  112L A;  3TPZ A;  2MEF A;  3EMS A;  1TLA A;  3E21 A;  4LJ7 A;  4I7T A;  3HTG A;  2HHH M;  1F0W A;  1GB8 A;  4H9C A;  3RGP A;  3PNY A;  3HH4 A;  189L A;  4OWC A;  3VK7 A;  1R2Z A;  4EJ4 A;  1LJ3 A;  6LZM A;  4BB9 A;  151L A;  1IWT A;  1C45 A;  4XAD A;  2EKF A;  2RBO A;  3CDR A;  2HCB A;  3SB6 A;  1LJE A;  3AZ5 A;  1N75 A;  5JI2 E;  1GDW A;  4DV6 M;  3V2W A;  3SHG B;  1QSA A;  4LFX A;  1WGL A;  1IY3 A;  2L7I A;  4DR5 M;  1JJ3 A;  4WO9 A;  1LAA A;  5BR8 M;  4ETD A;  1TDZ A;  1OWY A;  1P56 A;  3BBZ A;  3RU5 A;  227L A;  2O7A A;  4HJY A;  1DYC A;  2HUK A;  2LHC A;  5ITY A;  4DQ5 A;  2I25 L;  1WGN A;  2MEG A;  2UXC M;  1ALC A;  5KXN A;  4DD2 A;  4O34 A;  2DBT A;  3GLF B;  1CKF A;  1T97 A;  2FOI C;  3WMK A;  1IWV A;  3QY4 A;  1I4W A;  2LTU A;  237L A;  1ZQ9 A;  2R18 A;  3CDQ A;  1LYI A;  1GD6 A;  129L A;  4H93 A;  5C18 A;  1OUB A;  2ZYP A;  1FLY A;  4G9S A;  1G3I A;  1CU5 A;  7LZM A;  2R44 A;  1UIC A;  2KW0 A;  1G41 A;  1IY1 A;  1EIJ A;  4QGZ A;  3HY5 A;  1L23 A;  4RLN A;  2DI0 A;  4NFV A;  2MR9 A;  1B7R A;  1L04 A;  1WTM A;  3HJS A;  5KXR A;  155L A;  3HT8 A;  2XJW A;  1L03 A;  1UFZ A;  1B7S A;  1VDD A;  4DR3 M;  3FTF A;  2H9J A;  2CHV A;  1L53 A;  2YSS C;  4IBB A;  2KRK A;  1W5T A;  5DFL A;  4A3V B;  1J7K A;  1L56 A;  5HMV A;  1JQJ C;  2XZF A;  3TXK A;  1L94 A;  3DN4 A;  1GFK A;  1Z5B A;  2I7P A;  4M9S A;  2LYM A;  1AIP C;  3NY9 A;  4B49 A;  2A5Y B;  4DR7 M;  4XK8 F;  4W55 A;  3IWR A;  1C66 A;  4DQJ A;  2BQH A;  2VDB B;  3KOW E;  2CV2 A;  4DD7 A;  1QZM A;  1XGR C;  4B4I A;  212L A;  1C7P A;  3LYT A;  1UIB A;  243L A;  2WZJ A;  3U6E A;  2R0I A;  2XEP A;  2A7F A;  3AYQ A;  4DD0 A;  1AT6 A;  4RF0 A;  3CT5 A;  2W1L A;  2YBM A;  1GB5 A;  5F81 A;  3AZ7 A;  4AQN A;  4QY9 A;  2FBD A;  3WH1 A;  4FCV A;  2RBQ A;  1C6M A;  1CU0 A;  4PD2 A;  1YRO A;  3HT6 A;  3QE8 A;  211L A;  1IP1 A;  4D81 A;  4GRI A;  3TWM A;  2HEB A;  4RDS A;  5FTN A;  3HHX A;  1LYS A;  4LDL A;  4IAT A;  1WQN A;  4LFA M;  3TMU A;  2BQC A;  1RE2 A;  3K2L A;  4NGW A;  1L29 A;  1QSQ A;  3HH3 A;  3KAM A;  5KXS A;  3IJU A;  5IHG A;  1L84 A;  2FH0 A;  1XNQ M;  1JIY A;  1LYD A;  1CV1 A;  2QSF X;  1VAT A;  1F4I A;  3GLH E;  4ETE A;  2C99 A;  1Z59 A;  3QWL A;  188L A;  4DR1 M;  3R9X B;  1QUO A;  5KPR A;  4NGJ A;  1IY2 A;  3V2Y A;  2LZT A;  1QTV A;  2CUU A;  2D91 A;  3Q8X A;  4WM6 A;  161L A;  7CAT A;  199L A;  4N9R A;  2IFF Y;  1D6Q A;  2DVW B;  1HEP A;  7LYZ A;  5F3W A;  3TQS A;  1G7I C;  4LFP A;  1IN6 A;  4PT5 A;  4H90 A;  2CV1 A;  1C10 A;  4EKQ A;  5FEK A;  4WG1 A;  2CUZ A;  5L9J A;  1J5E M;  5ITR A;  3EBA B;  3HTF A;  1L69 A;  234L A;  3GLI E;  1HMK A;  3C8S A;  3B0K A;  2VB1 A;  3B6L A;  4H9A A;  4M0W A;  1B5Y A;  1C43 A;  1YLA A;  2J7N A;  159L A;  3C3D A;  137L A;  122L A;  1PGY A;  1LSF A;  4LF4 M;  1QIO A;  1UIG A;  1QUS A;  2OTZ X;  1L63 A;  4YXC A;  2ZAM A;  4E97 A;  2GQF A;  1TH3 A;  4G4N A;  5E9R A; 
#chains in the Genus database with same CATH homology
 2AUB A;  1L30 A;  4GBR B;  4NHP A;  1C6H A;  4LGK A;  1L13 A;  4RW1 A;  1GB9 A;  2OTY X;  4MR1 A;  3ATN A;  2NTH A;  1PQI A;  102L A;  1GBW A;  1IO5 A;  1CV6 A;  194L A;  3WPJ A;  3GUJ A;  123L A;  3RT5 X;  2RB0 X;  4PPO A;  2W1X A;  3AGG G;  3GXR A;  5FST A;  3HTB A;  4I7Q A;  1LZ8 A;  158L A;  1L92 A;  5KXL A;  3G3A B;  1LMN A;  1LMA A;  163L A;  4K5Y A;  2A4T A;  2Z12 A;  4UWN A;  1HEM A;  5I4W A;  3TMX A;  4WMG A;  1GF5 A;  1GB0 A;  1L74 A;  4N0J A;  3HBE X;  173L A;  2RAY X;  1L89 A;  3J4G A;  1OUI A;  3DKE X;  1BVK C;  3CB7 A;  4LDO A;  196L A;  1C6B A;  1B7Q A;  4N5R A;  1LJI A;  1UA6 Y;  3HH6 A;  1GF7 A;  1GE4 A;  1G0Q A;  4D9Z A;  2Z2F A;  2RAZ X;  2C8P A;  4W57 A;  4WG7 A;  4NG8 A;  1IC7 Y;  1CV3 A;  1AT5 A;  1L87 A;  1L47 A;  169L A;  242L A;  1LZD A;  1L86 A;  1JUG A;  3HU9 A;  2FYC A;  1T8A A;  3B0O A;  1L64 A;  1AKI A;  2B6T A;  1XEI A;  3E3D A;  1C46 A;  1WQO A;  4DAJ A;  2Z38 A;  5LVG A;  1L41 A;  4I8S A;  5IDD A;  1LMC A;  2RSC A;  4NHQ A;  4NIJ A;  5FDJ A;  1LYE A;  177L A;  1L52 A;  1L55 A;  2YBN A;  3W6C A;  1LGX A;  1TAY A;  4XN6 A;  2G4Q A;  1F10 A;  3GUM A;  1IP2 A;  1NWG A;  205L A;  256L A;  5LVH A;  2OU8 A;  4J0L A;  5I5Q A;  1LW9 A;  4I7O A;  4XJG A;  183L A;  1L81 A;  1G7M C;  5B05 A;  2HTX A;  1GHL A;  5B06 A;  2HU1 A;  4R0F A;  3C81 A;  4W94 A;  1IWY A;  1KXX A;  1L27 A;  4KPM A;  1IOC A;  201L A;  1BWI A;  4UWU A;  4R6C A;  2RB2 X;  4DWX A;  228L A;  2IHL A;  2D6B A;  5II3 A;  2LYZ A;  1L50 A;  3A94 A;  1QDT A;  4B0D A;  1LYJ A;  4DD1 A;  1P3N A;  2DQC Y;  5KXO A;  1MEL L;  1P2C C;  4CFO A;  4GN4 A;  3W6B A;  4AGA A;  4YOP A;  4WM4 A;  1L07 A;  4WLD A;  1GFH A;  3RZ4 A;  1J1O Y;  2OU0 X;  3C8R A;  1LI2 A;  2BQN A;  4W58 A;  2YVB A;  3F9L A;  4H9H A;  165L A;  1GE2 A;  4W54 A;  1P6Y A;  1L26 A;  4TSC A;  4I7M A;  3JR6 A;  1B0D A;  4ANR A;  4WM1 A;  1B5W A;  5B59 A;  2OE9 X;  4H91 A;  5F14 A;  4N1C C;  2DQE Y;  1GFR A;  1IP5 A;  4MCK A;  1BGI A;  3A3R X;  3HFM Y;  1L99 A;  3ZEK A;  1L70 A;  4EXM A;  2B7X A;  1IP3 A;  2CWI A;  1B6I A;  3TXD A;  1DXJ A;  5DLA A;  5B1F A;  1HFX A;  4YM8 A;  5L3H A;  2EQL A;  3ATO A;  1L16 A;  1D0K A;  4LYT A;  1LZY A;  210L A;  2HUL A;  1WQR A;  1LLH A;  1C6Q A;  5C6I A;  1P64 A;  1LMP A;  3M18 B;  1L02 A;  4H9E A;  1VFB C;  139L A;  5DL9 A;  4QEQ A;  4UWV A;  2EIZ C;  1XGT C;  4CJ2 A;  3ULR A;  4NHT A;  2F30 A;  1HSW A;  1BB7 A;  3DN0 A;  1T6V L;  1SSW A;  2MEC A;  1K28 A;  3B72 A;  4CFP A;  4J7V A;  1GAY A;  1P2L A;  3OK0 A;  1NBY C;  2ZWB A;  4GRV A;  3OE0 A;  1ZYT A;  1JSF A;  1OUF A;  1IOQ A;  1UIF A;  4OOO A;  119L A;  1H87 A;  2DQG Y;  1I1Z A;  4Z98 A;  3G3V A;  2ZNW Y;  3GUP A;  1BB6 A;  4YF2 A;  4CGE A;  3WUA A;  1G0G A;  2I6Z A;  2D4J A;  3WYH A;  1JIT A;  3LYM A;  4I7P A;  3OE6 A;  3F8V A;  220L A;  2HEE A;  1T6H A;  1FN5 A;  3D4S A;  1SX2 A;  5KXM A;  3LZM A;  3PBL A;  1OVJ A;  232L A;  246L A;  3HUK A;  1GB2 A;  2YDG A;  1G0K A;  1LSM A;  1VED A;  238L A;  1L0J A;  1C61 A;  4ETB A;  3CDV A;  152L A;  2RH1 A;  254L A;  1HEL A;  5KKI A;  1PQO A;  1B7P A;  3LHM A;  1G7L C;  4TSB A;  1PQJ A;  5LA8 A;  149L A;  1YIL A;  1L60 A;  125L A;  1LYO A;  1L19 A;  1LSA A;  4ARM A;  3C82 A;  2DQH Y;  3SBA A;  4YEO A;  1IX0 A;  1CV5 A;  1O23 A;  3L2X A;  3L64 A;  5DN5 A;  1UC0 A;  1JTM A;  4H8X A;  1JKD A;  111L A;  197L A;  1YAM A;  170L A;  1LMQ A;  4ARP A;  3GUO A;  3W6A A;  1LKR A;  3SB7 A;  1CKH A;  1GF4 A;  3AW6 A;  2ZQ4 A;  249L A;  1LZ1 A;  1C6P A;  1UIE A;  2FYD A;  127L A;  1L32 A;  1G0M A;  4OOT A;  3K2R A;  5A3E A;  1P36 A;  1J1P Y;  1LZG A;  4H9B A;  4TWS A;  4GCF A;  1OQM A;  3BKV A;  3HT9 A;  1CKG A;  3WU7 A;  3GXK A;  143L A;  1L97 A;  1GBS A;  1UAC Y;  1YL1 X;  4KXI A;  4U3X B;  1GFV A;  3SB9 A;  2RBR A;  1P5C A;  1QTE A;  5LAF A;  1QQY A;  4W52 A;  1JTP L;  3QNG A;  1DKJ A;  1C6L A;  5LYT A;  1CU2 A;  1L22 A;  2Q9E A;  1L98 A;  175L A;  1C6A A;  1JTT L;  1CNS A;  3QAK A;  4W51 A;  4WL7 A;  1NHB A;  4LT2 A;  3CSR A;  1LHI A;  1L33 A;  1E8L A;  1LZN A;  2OEA X;  1ZVH L;  2L78 A;  5E4P A;  4EPI A;  2HU3 A;  5APF A;  1D0M A;  4XJH A;  1B9O A;  3SB8 A;  185L A;  108L A;  1C6N A;  1YKZ X;  1G0L A;  3VWO A;  107L A;  4TX7 A;  1LYY A;  186L A;  1QTC A;  1DI5 A;  1KW5 A;  1JHL A;  114L A;  4L41 A;  1T8F A;  1LJ4 A;  1ZV5 L;  1BQL Y;  1LZB A;  1GEZ A;  1GF3 A;  1LJK A;  1ZWN A;  2G4N A;  3EXD A;  5IEL A;  4LZM A;  2HEC A;  4G4H A;  5LVK A;  1LWK A;  5LAG A;  2B73 A;  1HC0 A;  3CSQ A;  3DMX A;  1JKC A;  1L88 A;  3ZVQ A;  2ZQ3 A;  1SWZ A;  1IOS A;  1L96 A;  2DQF C;  1G1W A;  2OU9 A;  3A96 A;  4S0W A;  4H1P A;  3TXE A;  5APE A;  4ARM B;  1D3N A;  2B72 A;  3P65 A;  4G4B A;  5C6J A;  1XSF A;  1QS9 A;  1F6R A;  5KXP A;  1LZ5 A;  3SP3 A;  1CKC A;  1L35 A;  3GUI A;  1LZ9 A;  1D3J A;  4ARQ A;  1QT5 A;  1OUD A;  4XJI A;  245L A;  3HT7 A;  2RB1 X;  1CV0 A;  4LT3 A;  1IP7 A;  2GV0 A;  2QAR C;  2EKS C;  1IP4 A;  3DMZ A;  240L A;  1C60 A;  4NGK A;  1LWG A;  1IR8 A;  4GN5 C;  3WW6 A;  4W56 A;  2H5Z A;  2Y8P A;  1DYD A;  1BHZ A;  4H9F A;  1XFP L;  4KL7 A;  2NWD X;  4B4J A;  4W96 A;  1HEO A;  1GBX A;  146L A;  150L A;  3RNX A;  2B6X A;  2Z19 A;  3TXJ A;  1L93 A;  4N1E I;  4LT1 A;  1C65 A;  1JJ0 A;  1L90 A;  3LYZ A;  4DT3 A;  2O4W A;  3G3B B;  236L A;  1G06 A;  1IVM A;  1L31 A;  3RUN A;  1SWY A;  4I7N A;  5HQ1 A;  2XBR A;  4WO6 A;  184L A;  1IWX A;  1DYB A;  5I4X A;  2YBI A;  1IWZ A;  1JIS A;  1C6I A;  1GF0 A;  3WW5 A;  2ANV A;  5B1G A;  2B6W A;  4PHI A;  5FEL A;  1RFP A;  109L A;  2MED A;  1QTH A;  4LZT A;  3WUN A;  1CV4 A;  1JQU A;  1QUD A;  5APC A;  3RW8 A;  2F2N A;  1NQI A;  1KNI A;  1L0K A;  2A7D A;  1KW7 A;  4NWH A;  3DN8 A;  144L A;  1INU A;  2LZ2 A;  156L A;  2Z2E A;  4PJZ A;  4EKR A;  5KXY A;  257L A;  4YEN A;  1D3M A;  216L A;  1BB4 A;  3A91 A;  5LZM A;  3ZVQ B;  1OUG A;  3EO5 A;  3TXH A;  1LMT A;  4BAD A;  4B1A A;  3T36 A;  1GFE A;  2BLY A;  1YAO A;  225L A;  3LZT A;  162L A;  5LIO A;  4M4O A;  5A3Z A;  1GB6 A;  4H9I A;  1BVX A;  1WVU A;  4GCB A;  5I54 A;  1RCM A;  1WQQ A;  1TCY A;  2Z37 A;  1LHH A;  1LHM A;  4W53 A;  241L A;  3M3U A;  4NGL A;  4ARQ B;  3TMV A;  1LCN A;  167L A;  3G3W A;  1IR7 A;  1L42 A;  4GLV A;  233L A;  198L A;  166L A;  3ODU A;  1GBZ A;  1L15 A;  3CQL A;  4OO9 A;  1IWW A;  4I7J A;  221L A;  4I7S A;  172L A;  5F9X A;  3DMV A;  3SB5 A;  1L80 A;  4LT0 A;  4NSH A;  251L A;  1SQ2 L;  1LHL A;  4RLM A;  4DYG A;  2F32 A;  2BAA A;  4EOF A;  1QT7 A;  5HLL A;  258L A;  1LJF A;  1J1X Y;  3A67 Y;  1LSC A;  1NMM A;  1GFJ A;  4FJR A;  120L A;  148L E;  3CT1 A;  128L A;  1L36 A;  1LZA A;  1XGP C;  215L A;  1EL1 A;  1GBO A;  3WXU A;  1L00 A;  1LHJ A;  1DPX A;  1JPO A;  5B07 A;  2C8O A;  250L A;  1QUT A;  1IIZ A;  253L A;  1BB3 A;  3OE8 A;  1GAZ A;  182L A;  1SSY A;  4W59 A;  1XJT A;  4AXT A;  1C6C A;  126L A;  1C62 A;  1P2R A;  3AGH A;  1IOR A;  1TEW A;  4HPE A;  1B7O A;  4ZEE A;  3W6F A;  1WQM A;  1FBI X;  2LCB A;  4XJB A;  1GFT A;  229L A;  1GEV A;  1L38 A;  4WLT A;  2IGC A;  3WUM A;  1QTD A;  3TXG A;  4BS7 A;  2XBS A;  1YQV Y;  1QDR A;  3D3D A;  1WVV A;  1C63 A;  2RBN A;  4YEM A;  1L34 A;  3UON A;  1L06 A;  4XEN A;  1L65 A;  1DYF A;  5ILF A;  3DNA A;  1IWU A;  2WAR A;  4NSG A;  1LI3 A;  1C6K A;  1JWR A;  4LYB A;  1L10 A;  4NFV A;  3K3T A;  4OWA A;  3WUL A;  3HBD A;  5KKJ A;  3WU8 A;  5KXX A;  1XEP A;  4ARJ A;  2MEB A;  4ZPU A;  1PZY A;  4I7K A;  3CSZ A;  1DYA A;  4HV1 A;  187L A;  1NBZ C;  1L82 A;  2BQE A;  5LYM A;  1GDX A;  4GCE A;  2W1M A;  1W6Z A;  2HED A;  1ZUR A;  1I20 A;  5I4Y A;  145L A;  3HU8 A;  4NGZ A;  3FI7 A;  1CU6 A;  131L A;  2B74 A;  4GCD A;  3P66 A;  1KY0 A;  1REX A;  6LYZ A;  1HNL A;  3AZ4 A;  4II8 A;  3HDF A;  115L A;  1XJU A;  4DD3 A;  4LYM A;  2MEE A;  1FKQ A;  1JTN A;  1B5U A;  4J1B A;  4NGY A;  1LGW A;  200L A;  261L A;  2F47 A;  2QB0 B;  5D5F A;  4H8Z A;  4LYO A;  4OWE A;  138L A;  3A6C Y;  1G1V A;  3P64 A;  3FAD A;  2BQO A;  1OP9 B;  1L39 A;  1L91 A;  1CJ6 A;  1GBY A;  1VDT A;  1OVK A;  1XEK A;  1PQK A;  2DKV A;  1A4V A;  2G4P A;  1L01 A;  3SN6 R;  141L A;  1PS5 A;  1LOZ A;  4HTN A;  1OVH A;  1QT6 A;  1L72 A;  1YKY X;  3WPK A;  1C6E A;  1GWD A;  1DKK A;  2BQD A;  1L44 A;  1LI6 A;  1L17 A;  1GF6 A;  1DZB X;  4FDY A;  4OW1 A;  1C6F A;  1HML A;  1CJ8 A;  3GUN A;  1CUP A;  3RZE A;  1C6T A;  1EQ4 A;  1V7S A;  1L79 A;  1QT8 A;  1LJH A;  4OWB A;  3OJP A;  226L A;  1PQD A;  1VAU A;  3VW7 A;  1L48 A;  1FLW A;  1DI4 A;  207L A;  4MST A;  4LYZ A;  3FI5 A;  133L A;  1HSX A;  4IAS A;  2DQD Y;  4WLY A;  1DYG A;  5EBH A;  2B6Y A;  1LSG A;  1GFA A;  3W6D A;  3NY8 A;  1LSP A;  3PDS A;  180L A;  1VDP A;  9LYZ A;  3GUL A;  5KXT A;  147L A;  1QTB A;  3A92 A;  3DN1 A;  1YL0 X;  1QSB A;  1P37 A;  4HSF A;  1LMO A;  2EPE A;  5DM9 A;  5C6L A;  2BQG A;  2I26 L;  1BWJ A;  1L09 A;  1LZS A;  3TXF A;  1GE3 A;  4P2E A;  1BB5 A;  4EKP A;  4DKL A;  1QT4 A;  1LJN A;  4BAF A;  4EPF A;  1YAP A;  4NG1 A;  1QTK A;  1LZ4 A;  1GFU A;  239L A;  1D6P A;  1L85 A;  1KS3 A;  1QSW A;  1KIR C;  1L67 A;  1L18 A;  2Q0M X;  4Z41 A;  4ML7 A;  1L20 A;  1XEJ A;  1GE1 A;  1L46 A;  1L37 A;  1EQE A;  3TMW A;  4GCC A;  2Z6B A;  4NSJ A;  1IP6 A;  1IC4 Y;  1LZ6 A;  2XQO A;  4YXA C;  5L3I A;  1L14 A;  3LN2 A;  1UUZ C;  1H6M A;  1G7H C;  4PRQ A;  206L A;  1L11 A;  1JTO L;  1T3P A;  1QUG A;  2B70 A;  4PRU A;  3D9A C;  4WM3 A;  4CHX A;  3DN6 A;  1CU3 A;  1DYE A;  4B4E A;  1WQP A;  3TXI A;  4ZIX A;  2Z39 A;  2HEA A;  1KIP C;  1I6S A;  4G4C A;  1CKD A;  213L A;  3N9A A;  2F2Q A;  1GE0 A;  3T6U A;  4DDB A;  5LYZ A;  4G49 A;  247L A;  1Z55 A;  5AMY A;  3BKH A;  1V7T A;  5I53 A;  4DDC A;  192L A;  1LYZ A;  2MEI A;  1CUQ A;  2DQA A;  1JKA A;  3J6K A;  1NDG C;  1L68 A;  1HER A;  2ZIK A;  1L49 A;  4TTD A;  4IAP A;  4NHI A;  5LVI A;  222L A;  178L A;  5F9U A;  2B75 A;  1HFZ A;  4NEB A;  2OE7 X;  1QTZ A;  1ZVY B;  3AW7 A;  5APD A;  1L71 A;  4ARL A;  3WXT A;  2ZYC A;  164L A;  1L83 A;  3AB6 A;  4XYY A;  1B5X A;  1L73 A;  1QS5 A;  3C83 A;  1G07 A;  1HFY A;  154L A;  1C08 C;  1REZ A;  2ZNX Y;  3WVX A;  1PQM A;  5I14 A;  8LYZ A;  193L A;  260L A;  2Z18 A;  1AZF A;  3P68 A;  1IR9 A;  1OUH A;  1LZT A;  2D4K A;  4HTK A;  4HJV A;  3HDE A;  1D9U A;  1SX7 A;  3WU9 A;  255L A;  1LZE A;  2RBS A;  4WOA A;  1GXV 2;  5K7O A;  1IC5 Y;  2BLX A;  2B5Z A;  2LZM A;  4I7L A;  1L05 A;  1LSB A;  3C7Z A;  1GF8 A;  1L66 A;  2HUB A;  2CGI A;  1LYH A;  4NGI A;  1D9W A;  2LC9 A;  5LA5 A;  4ZFP A;  1LKS A;  2YBJ A;  3CDO A;  3MGW A;  1QT3 A;  3AGI A;  1L54 A;  4ETC A;  1CJ9 A;  2D4I A;  181L A;  2LYO A;  3LZ2 A;  1L62 A;  174L A;  1L59 A;  1NHE A;  1N4F A;  5DN4 A;  3HBH A;  1B5Z A;  1D3F A;  4ET9 A;  4NGV A;  1LSY A;  1L61 A;  2MEH A;  3AJN A;  3P4Z A;  4H92 A;  1OWZ A;  195L A;  3NYA A;  4EKS A;  1C68 A;  1LZR A;  5F16 A;  1HF4 A;  1HHL A;  1RI8 B;  4NY5 A;  4NSI A;  4ET8 A;  4X3B A;  1D2W A;  1CTW A;  2X0A A;  4HTQ A;  1B7N A;  1REY A;  1GF9 A;  1OUJ A;  1UBZ A;  1WTH A;  1L24 A;  5FHW A;  3WL2 A;  3C7Y A;  1CJ7 A;  1ZMY L;  1C6D A;  1UID A;  1LJG A;  1LPI A;  1T8G A;  4LYC A;  1HEN A;  4DQ7 A;  3FA0 A;  248L A;  1LPY A;  1GFG A;  5HNC A;  1FLQ A;  2YBH A;  1G0P A;  3CDT A;  110L A;  1L58 A;  168L A;  4HP0 A;  1NKH A;  1XGU C;  1L21 A;  2BQA A;  1QUH A;  1UIA A;  4YX7 C;  1GB3 A;  4RW2 A;  1OUE A;  2ANX A;  1KY1 A;  1IY4 A;  1F6S A;  1IEE A;  4NGO A;  1LYF A;  235L A;  2DQI Y;  1TBY A;  3HWL A;  191L A;  3A90 A;  1CVK A;  1OV5 A;  1RJC B;  4WL6 A;  2PC2 A;  4H8Y A;  4I0C A;  3F6Z A;  4PGJ B;  3DN2 A;  5KXZ A;  1MLC E;  4LDE A;  2HEF A;  1GPQ C;  1L25 A;  4QDN A;  2HUM A;  1EPY A;  1HEQ A;  1L12 A;  1CX7 A;  1OV7 A;  4HJZ A;  5HMJ A;  1B5V A;  113L A;  157L A;  209L A;  1LGU A;  1DQJ C;  214L A;  4DD9 A;  132L A;  5KY1 A;  2N5Z A;  1NDM C;  3DN3 A;  4WM2 A;  3A6B Y;  1L28 A;  3W6E A;  1L76 A;  4Z3M A;  4ETA A;  5LVJ A;  1L40 A;  4J1A A;  171L A;  1BWH A;  4HV2 A;  1NF5 A;  3W3E A;  176L A;  2Q9D A;  2CDS A;  1VDS A;  1P7S A;  1C67 A;  1HEW A;  4C5F A;  4NWE A;  1C64 A;  3A93 A;  5M1Y A;  2BPU A;  1B7L A;  219L A;  2BQM A;  5D5C A;  1UCO A;  1GXX A;  130L A;  1C6J A;  4A7D A;  2MEA A;  3WVY A;  4DJH A;  1LSD A;  4PJ2 C;  1WTN A;  223L A;  2O79 A;  2H9K A;  2W1Y A;  5LXW A;  1GB7 A;  217L A;  1AM7 A;  3A95 A;  1L95 A;  1JSE A;  1I56 A;  190L A;  1SLY A;  4M6D A;  1LTM A;  1YAN A;  4H94 A;  1D2Y A;  262L A;  142L A;  1YKX X;  135L A;  3HUQ A;  3AZ6 A;  3FE0 A;  4DC4 A;  2XTH A;  4WLX A;  2ZIJ A;  1OYU A;  1OUA A;  1L43 A;  5HNL A;  4GN3 A;  1G0J A;  3G3X A;  1TDY A;  1C69 A;  4NHS A;  1FLU A;  4HPI A;  134L A;  1REM A;  208L A;  244L A;  5ILC A;  3HTD A;  3HUA A;  4KT3 A;  118L A;  3IJV A;  4Z46 A;  1KXW A;  4PK0 A;  1FDL Y;  1LSZ A;  1YIK A;  1LSN A;  3EML A;  3OE9 A;  5T3F A;  1C6G A;  4BAP A;  1L57 A;  1B7M A;  4N8Z A;  4E3U A;  1L45 A;  1KXY A;  224L A;  3TXB A;  6LYT A;  1L75 A;  231L A;  4I7R A;  4GLA A;  2FBB A;  1LSE A;  1XGQ C;  2LHM A;  1P46 A;  104L A;  5J7C A;  3CT0 A;  1CX6 A;  2YBL A;  3C8Q A;  2F4G A;  5JEN B;  3SBB C;  2F4A A;  4C3W A;  1UIH A;  2BQL A;  3C80 A;  3A34 A;  3GUK A;  3A3Q A;  3HH5 A;  2ZIL A;  4XJF A;  103L A;  4OWH A;  140L A;  1FKV A;  1LHK A;  1B2K A;  1IOT A;  1VDQ A;  1JKB A;  3N9E A;  160L A;  2BQB A;  3B0I A;  1G7J C;  3WPL A;  4EMN A;  2BQJ A;  4XJD A;  5KJ9 A;  2B6Z A;  1OUC A;  1YAQ A;  1L51 A;  1KIQ C;  259L A;  2NTG A;  4WM5 A;  2DQJ Y;  1DI3 A;  1LZC A;  2BQF A;  1DPW A;  3C7W A;  4DDA A;  2CJL A;  1A2Y C;  2BQI A;  4IJ4 A;  3LYO A;  1LJJ A;  1JJ1 A;  2RBP A;  252L A;  1L08 A;  1D0L A;  1W08 A;  153L A;  3A8Z A;  3N9C A;  5KXW A;  5FCP A;  1EQ5 A;  1JEF A;  4TUN A;  2BQK A;  218L A;  230L A;  5LIN A;  5KXK A;  2OE4 X;  1L77 A;  1LYG A;  112L A;  2MEF A;  3EMS A;  1TLA A;  4I7T A;  3HTG A;  1F0W A;  1GB8 A;  4H9C A;  3HH4 A;  189L A;  4OWC A;  4EJ4 A;  1LJ3 A;  6LZM A;  151L A;  1IWT A;  1C45 A;  4XAD A;  2RBO A;  3CDR A;  3SB6 A;  1LJE A;  3AZ5 A;  1GDW A;  3V2W A;  1QSA A;  4LFX A;  1IY3 A;  1JJ3 A;  4WO9 A;  1LAA A;  4ETD A;  1OWY A;  1P56 A;  3RU5 A;  227L A;  2O7A A;  4HJY A;  1DYC A;  2HUK A;  4DQ5 A;  2I25 L;  2MEG A;  5KXN A;  1ALC A;  4DD2 A;  4O34 A;  2DBT A;  1CKF A;  1T97 A;  3WMK A;  1IWV A;  3QY4 A;  237L A;  3CDQ A;  1LYI A;  1GD6 A;  129L A;  4H93 A;  1OUB A;  2ZYP A;  1FLY A;  4G9S A;  1CU5 A;  7LZM A;  1UIC A;  4QGZ A;  1L23 A;  4RLN A;  1B7R A;  1L04 A;  1WTM A;  5KXR A;  155L A;  3HT8 A;  2XJW A;  1L03 A;  1B7S A;  2H9J A;  1L53 A;  2YSS C;  1L56 A;  5HMV A;  3TXK A;  1L94 A;  3DN4 A;  1GFK A;  2LYM A;  3NY9 A;  4B49 A;  4W55 A;  3IWR A;  1C66 A;  4DQJ A;  2BQH A;  4DD7 A;  1XGR C;  4B4I A;  212L A;  1C7P A;  3LYT A;  1UIB A;  243L A;  2A7F A;  3AYQ A;  4DD0 A;  1AT6 A;  3CT5 A;  2W1L A;  2YBM A;  1GB5 A;  5F81 A;  3AZ7 A;  4AQN A;  4QY9 A;  2FBD A;  3WH1 A;  2RBQ A;  1C6M A;  1CU0 A;  1YRO A;  3HT6 A;  3QE8 A;  211L A;  1IP1 A;  2HEB A;  4RDS A;  1LYS A;  4LDL A;  4IAT A;  1WQN A;  3TMU A;  2BQC A;  1RE2 A;  4NGW A;  1L29 A;  1QSQ A;  3HH3 A;  3KAM A;  5KXS A;  3IJU A;  5IHG A;  1L84 A;  1JIY A;  1LYD A;  1CV1 A;  1VAT A;  4ETE A;  188L A;  1QUO A;  4NGJ A;  3V2Y A;  2LZT A;  1QTV A;  2CUU A;  2D91 A;  4WM6 A;  161L A;  199L A;  4N9R A;  2IFF Y;  1D6Q A;  7LYZ A;  1HEP A;  1G7I C;  4LFP A;  4H90 A;  1C10 A;  4EKQ A;  5FEK A;  4WG1 A;  5L9J A;  3EBA B;  3HTF A;  1L69 A;  234L A;  1HMK A;  3C8S A;  3B0K A;  2VB1 A;  3B6L A;  4H9A A;  1B5Y A;  1C43 A;  159L A;  137L A;  122L A;  1LSF A;  1QIO A;  1UIG A;  1QUS A;  2OTZ X;  1L63 A;  4YXC A;  4E97 A;  5E9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...