1D0MA

The escherichia coli lytic transglycosylase slt35 in complex with bulgecin a and (glcnac)2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
publication title Crystallographic studies of the interactions of Escherichia coli lytic transglycosylase Slt35 with peptidoglycan.
pubmed doi rcsb
source organism Escherichia coli
total genus 110
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1d0mA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1d0mA02
4HJVA 3W6DA 1GB7A 4LYZA 4IASA 1GB9A 1T6VL 1HNLA 1B7OA 2ZQ4A 4NGYA 3TXGA 2BQEA 1REMA 4NY5A 1GFUA 1JKBA 5B07A 3A92A 3AW6A 4XJGA 1LHLA 1XEKA 2YBLA 3W3EA 1GB0A 1B5XA 4GN3A 1D0KA 1LYYA 4LT1A 4LT2A 3W6CA 1DI4A 1LZTA 4N8ZA 2DQDY 4NIJA 4H8YA 4DD2A 4NFVA 4NHQA 4ML7A 4H9IA 1CNSA 1GXV2 3LYTA 1IORA 4G49A 3TXIA 3CT1A 1LAAA 3GXKA 1UIEA 4RDSA 4N1EI 1IWTA 1LMTA 5L3HA 3ZVQA 2N5ZA 1JEFA 1GBWA 3A8ZA 3N9EA 1LSMA 2ZIKA 4RLNA 3RW8A 1YKYX 1GBXA 2FBBA 1IP6A 5F81A 4DDAA 1AT6A 1LSCA 1F6SA 2LYOA 4LYOA 4WMGA 4NGWA 4XYYA 3WPJA 5LVKA 2YDGA 5A3EA 4G4CA 4GCBA 3WL2A 4WLDA 2MECA 3B0KA 1IY3A 1F6RA 1LSNA 5LYTA 1ALCA 134LA 4Z98A 6LYZA 5LVHA 2Z18A 1HELA 5HMJA 3TXKA 4NHPA 5HNCA 153LA 4G4HA 2HEFA 1LZRA 3IJUA 3QY4A 3WW5A 1Z55A 1BB6A 4NGVA 4DT3A 1FLUA 2YBHA 2ZNXY 2BQMA 2I26L 4KPMA 3EO5A 1GWDA 1LZBA 3WMKA 2HEBA 3EMSA 5APFA 2CDSA 1GFVA 1JISA 1XFPL 2HUBA 1IP4A 1OQMA 3WU8A 5L9JA 3J4GA 1IO5A 1GDWA 1HF4A 4PGJB 2DQCY 2BQLA 2BQOA 5FCPA 1LYZA 4OOOA 1WVVA 3AZ5A 5I53A 2D91A 4YENA 3P68A 1BVKC 3K3TA 4WM6A 5LVIA 4KXIA 1GEVA 2DKVA 1GB6A 1ZVYB 2DQEY 1IY4A 1LYSA 1CJ7A 3TXEA 4H9EA 1GF7A 4B1AA 2AUBA 7LYZA 1JITA 5B1GA 1RI8B 1DPWA 1LJNA 4YEOA 1V7SA 1CKDA 1YKZX 1B7NA 2BQAA 4CHXA 5B1FA 3LZTA 3VWOA 2Z12A 3CSZA 1TBYA 1LTMA 5T3FA 1VDPA 4OOTA 3GXRA 1YAOA 2Z19A 4R6CA 1LSEA 3WYHA 4W94A 2XBRA 2G4QA 4I0CA 1GXXA 1OUEA 4W96A 3RZ4A 1LZ5A 1G7MC 2EPEA 1B7LA 3HFMY 3TXDA 3TXJA 1QDRA 1GE0A 1NBYC 4J1BA 4WL6A 3E3DA 1LZNA 5I5QA 4PJ2C 1IVMA 4H93A 1UICA 1GBZA 2H5ZA 3RT5X 1BGIA 4H8ZA 4TX7A 1HSWA 1B7SA 5E9RA 3B0OA 1ZV5L 2F30A 1BQLY 1OUIA 5APDA 3WULA 4LT0A 4CGEA 5HLLA 1IR9A 1IWUA 1F0WA 1TAYA 5KXNA 1SQ2L 4M4OA 5FDJA 4UWVA 5KXXA 2FYCA 4WM5A 1JKDA 1IOQA 3A96A 1N4FA 5DN4A 4HTQA 2BQJA 1GF5A 1YKXX 1B5YA 1BB4A 4PPOA 1B7MA 1DKKA 2G4PA 3FI7A 1UIFA 1C45A 4X3BA 1KXXA 1LZGA 1LZSA 1REYA 1GF0A 1IWZA 3W6AA 1AM7A 4OWBA 4N9RA 1B9OA 2HECA 1GFHA 4XJHA 3WPLA 3TXBA 5FEKA 3P64A 1UIDA 1IOSA 2BLYA 1XGPC 1LMAA 3AZ6A 1QSWA 1GDXA 4RW1A 2GV0A 4PRQA 1G7LC 3TMWA 4DWXA 5A3ZA 5KXRA 3WU9A 4XN6A 1LHIA 2HEAA 2D4IA 1IP1A 1LMOA 1VATA 2HTXA 5I4WA 1OP9B 3A94A 3AGGG 1LJ3A 1WQMA 4UWUA 1F10A 4WLTA 1QDTA 4LFXA 4H9HA 4CJ2A 5I4YA 1IP2A 4ETEA 2Z38A 3LN2A 3WVXA 5KXTA 4WM1A 5KY1A 3CQLA 3TMUA 1YILA 2F4GA 1WQQA 3ATOA 1KXYA 4YF2A 1MLCE 1NDMC 2Z2FA 2MEEA 1JKAA 4DDBA 2BQGA 4YEMA 1FBIX 3CB7A 4RW2A 2Z37A 1CJ9A 1LSBA 2A7FA 2CGIA 2LZ2A 1HEQA 1LKRA 3A90A 4NHTA 1GF3A 1YAMA 4XJFA 1IP5A 1LJGA 4DDCA 1LZ4A 4B49A 1CKFA 1G7IC 4IATA 3W6EA 1NDGC 4GCFA 3RNXA 4TSBA 2W1MA 4NSJA 5APEA 3A6CY 4J7VA 1B7RA 4R0FA 3WUAA 4HV1A 4LZTA 3A6BY 3TXHA 1JJ3A 2MEGA 4WG1A 2Y8PA 3EBAB 5L3IA 3ZVQB 4I8SA 4ET8A 4H9FA 5KXPA 5M1YA 1JUGA 2BQFA 1LYOA 3WVYA 1B5ZA 1RFPA 1UIHA 4QGZA 1KIPC 2YBJA 4OWHA 3LYZA 3T6UA 1AKIA 1D0LA 1W08A 1OUGA 2HEDA 3CT5A 5C6JA 5KXOA 4ETAA 4O34A 1D9UA 207LA 4NHIA 3WXUA 5F9XA 1LHKA 1UC0A 2IHLA 1GD6A 5KXLA 2BLXA 5I4XA 4NSHA 1YL0X 4NGLA 1LMCA 4GCDA 1JTPL 5LVGA 1WTMA 2XBSA 1BHZA 1IOTA 2YVBA 5J7CA 5D5FA 3B0IA 1BVXA 4PHIA 4E3UA 1XGTC 4J1AA 1NMMA 2DQHY 1LHMA 1JIYA 4XJBA 3WU7A 4KL7A 4XJDA 1J1XY 1E8LA 3P66A 4WO9A 2BQHA 2BQNA 1C46A 2BPUA 1LZAA 1LJEA 1OUCA 3BKVA 1NQIA 2W1XA 4DD1A 4HTNA 1G7HC 1JTOL 2Q0MX 3WH1A 4N5RA 5DM9A 3D3DA 1EL1A 1LZYA 3LYOA 2EIZC 3B72A 4DD0A 1IX0A 3A3RX 4PRUA 4C3WA 1LJFA 3QNGA 1HEPA 4P2EA 2ZYCA 2D6BA 1GHLA 3P65A 1KIRC 1W6ZA 3OJPA 3ATNA 1PZYA 4YOPA 1QIOA 4WM4A 5D5CA 4H1PA 4J0LA 4NHSA 2MEDA 3TMVA 2F2NA 5B06A 1V7TA 4WLXA 3A67Y 4ETBA 3AZ7A 1YROA 1C43A 1LSDA 4NSGA 5HMVA 5F9UA 1YQVY 1GFJA 4H92A 2H9KA 5KKIA 1C08C 9LYZA 2I25L 1VAUA 1FLWA 4TSCA 2WARA 1GE2A 3WXTA 1LJIA 208LA 1LSYA 1LZ9A 3SP3A 4WM2A 1YL1X 1GF4A 2HU3A 1AT5A 1I56A 1QQYA 1QTEA 1UBZA 3AB6A 4GCEA 1LMNA 1B0DA 1LOZA 1HSXA 2DQIY 4Z41A 1HHLA 1B7QA 1JHLA 1YIKA 3AGIA 1XSFA 2BQBA 4B0DA 1OUAA 4MSTA 2ZYPA 2MEAA 3AYQA 4Z3MA 5DN5A 4AXTA 1O23A 1IC5Y 4N1CC 1A2YC 1GFGA 132LA 1EQEA 1JTTL 4HSFA 3HBEX 1LJKA 3OK0A 1D6QA 3M3UA 1LSPA 1UIAA 3A93A 2CJLA 1QUTA 1GPQC 5DLAA 1XEJA 1XGRC 1CKHA 4BAFA 1LZ6A 1OUJA 1BB5A 2MEHA 5LVJA 4NWEA 4U3XB 4LT3A 3ULRA 4B4EA 194LA 4H9CA 1LPIA 5C6LA 1LMQA 3RU5A 3A91A 4KT3A 1J1OY 1OUDA 4MCKA 4ET9A 4NGKA 1I1ZA 2LYMA 4ETDA 2X0AA 4NGZA 2W1YA 1YANA 1HERA 2G4NA 4GLAA 4GLVA 1B7PA 1HFZA 5ILCA 5II3A 1H6MA 2ZIJA 1B2KA 1DPXA 1QTKA 2H9JA 3IJVA 1GFAA 4C5FA 1LCNA 2BAAA 4DD3A 3CT0A 2C8PA 4GCCA 4LYCA 1LMPA 1IOCA 1KIQC 2IFFY 2Z39A 5KXMA 3N9CA 1LJ4A 5LAGA 2D4KA 5IELA 1H87A 2VB1A 4A7DA 2BQKA 1FKVA 1LHJA 3IWRA 2D4JA 1NBZC 1RJCB 3N9AA 4UWNA 4DC4A 1RCMA 4G4BA 3CSRA 2XTHA 1GAZA 4NGOA 1GBSA 4GN4A 1OUFA 1IWWA 1DZBX 1HEOA 2A7DA 1XEIA 5K7OA 1HC0A 1VFBC 2EQLA 5FSTA 1NHEA 2CWIA 5KJ9A 1HFXA 1IWXA 1UACY 5LIOA 1WQPA 2LHMA 4ZIXA 5LYMA 1D0MA 3TXFA 2DQFC 3AW7A 1JSEA 4EOFA 1IIZA 1GB8A 3WUMA 5EBHA 5LINA 4Z46A 2RSCA 154LA 1B5UA 5HNLA 1IC4Y 1LHHA 1LZ8A 2EKSC 2LYZA 1NWGA 4NG1A 3D9AC 3F6ZA 2PC2A 3HBDA 5KXYA 1QUSA 1I20A 2DQAA 2DQJY 4LYBA 5HQ1A 4CFOA 1GBYA 4H8XA 5LA8A 4XADA 1LSAA 4TUNA 1DXJA 4WOAA 3WUNA 1LZCA 2MEFA 2C8OA 8LYZA 4H9BA 1GFKA 3AZ4A 1UUZC 2ZWBA 133LA 2DQGY 1DQJC 1PS5A 3A34A 4H90A 4XENA 4II8A 1DKJA 2YSSC 1UIBA 1FDLY 1OUBA 1EQ4A 1P2CC 4B4JA 1LSZA 1LKSA 2YBNA 5F16A 4LGKA 3T36A 2FBDA 1UCOA 1YAQA 4OWAA 1QSAA 1GBOA 1LSGA 3HBHA 5JENB 2YBMA 4NWHA 1JSFA 1BB7A 1C7PA 4NSIA 1IR7A 1GB2A 4M6DA 4NEBA 1T3PA 1B5WA 4D9ZA 1VDSA 2Z2EA 1HMLA 1ZMYL 1FKQA 1IEEA 3A95A 1MELL 4HV2A 4ETCA 1HEMA 4MR1A 4BAPA 1REZA 3BKHA 193LA 1CJ6A 1JJ1A 1JPOA 1VDQA 3ZEKA 4CFPA 3AGHA 1GB5A 2YBIA 5KXSA 5KXZA 1EQ5A 1GFRA 1HENA 3J6KA 1ZVHL 1IC7Y 4NGIA 1WQNA 3LYMA 1AZFA 4BS7A 5APCA 1HEWA 4YM8A 1BWHA 1BWJA 4HP0A 2XJWA 4HTKA 5LAFA 5LYZA 4QDNA 1NF5A 3WW6A 5DL9A 1INUA 1WQRA 1SLYA 1D6PA 2I6ZA 3A3QA 6LYTA 5KKJA 4HPEA 4L41A 3EXDA 1LJJA 4HJYA 1GE3A 3M18B 2FYDA 2ZQ3A 5F14A 3B6LA 1GE4A 1GFEA 1IR8A 1DI3A 1GFTA 1BB3A 1HMKA 1UA6Y 3TMXA 4WLYA 4EMNA 5KXWA 5LXWA 2F4AA 1GAYA 4ZEEA 2ZNWY 1IP3A 135LA 2HU1A 1CKGA 1UIGA 1WTNA 5AMYA 3W6FA 1RE2A 4FDYA 2MEBA 4TWSA 1G7JC 5IHGA 4IJ4A 2B5ZA 4LYMA 2W1LA 1C10A 4DD7A 1GE1A 3W6BA 4GN5C 1LSFA 1IWVA 4G9SA 3G3AB 1GEZA 1GB3A 2HEEA 5FELA 1LZEA 4H9AA 1FLQA 4NG8A 5KXKA 4LYTA 1JKCA 2NWDX 4OW1A 4RLMA 2MEIA 5B59A 1B5VA 1JJ0A 3CSQA 1YAPA 3LZ2A 3QE8A 4H91A 5IDDA 5ILFA 4WO6A 4AGAA 4ANRA 5C6IA 4HJZA 1CJ8A 4OWCA 4DYGA 1A4VA 3WPKA 1FN5A 4DD9A 1J1PY 5FHWA 4NGJA 1IP7A 1HFYA 1LJHA 1GF9A 3MGWA 4OWEA 4QEQA 4FJRA 3AJNA 1CKCA 1XGQC 3G3BB 1NKHA 1REXA 3LHMA 1KXWA 4N0JA 1GF6A 5I54A 5E4PA 1TEWA 1DI5A 1TCYA 2BQIA 2BQDA 4HPIA 1LZDA 1OUHA 4H94A 4QY9A 5B05A 1JWRA 1WQOA 4TTDA 4XJIA 4ZFPA 5LA5A 4WL7A 1GF8A 2LZTA 2DBTA 4WM3A 3P4ZA 1XGUC 1FLYA 1VEDA 2ZILA 4LFPA 3FE0A 4B4IA 4BADA 1LZ1A 4WG7A 1IWYA 1BWIA 1VDTA 1TDYA 1WVUA 2BQCA 3KAMA
chains in the Genus database with same CATH superfamily
1HNLA 2HWJA 211LA 1IN7A 4NGYA 1EIJA 164LA 3A92A 4YHHM 4KT0F 1GB0A 118LA 1W5TA 3FUXA 3FTEA 1L23A 1LYIA 1C66A 3M7GA 2XSZD 113LA 4H8YA 2R62A 1KW7A 4ML7A 1L82A 4BLCA 1CNSA 2Q2EB 3UZUA 5L3HA 1GBWA 3A8ZA 1L17A 5ITXA 2ZIKA 4RLNA 4PD2A 1KS3A 4DDAA 1AT6A 1L61A 2CE7A 3UK6A 4LYOA 4WMGA 3WHLA 3WPJA 1B6IA 5A3EA 4W52A 1L24A 162LA 4IBJA 1F6RA 1LSNA 3DMVA 190LA 3TWMA 1OVHA 5LYTA 1N78A 2Z18A 4NHPA 3V2WA 2DNAA 4R7GA 1Z55A 1BB6A 4NGVA 4WURA 1AIPC 2LHGA 3KP0E 2RBSA 226LA 4QNMA 3FUTA 2B6WA 2HUBA 5L9JA 1JISA 1SG9A 2BQOA 5I53A 1WGNA 1X37A 3PVSA 3AZ5A 3P68A 1BVKC 1G3IA 3C82A 126LA 1L01A 3G3XA 4KXIA 4MGYE 5DFLA 1GEVA 4LDLA 1R2ZA 1IY4A 3TXEA 4H9EA 218LA 4AG5A 4LDEA 3G3WA 252LA 1TTEA 1QVRA 5ITQA 4DV7M 1CU5A 1DPWA 1RI8B 1C69A 3UONA 3U61A 1B7NA 4CHXA 2WSFF 1TBYA 1LTMA 5T3FA 5H37D 1ZYTA 1IBKM 2LVQD 1GXXA 4I0CA 2F5PA 4EXMA 3RZ4A 220LA 1G0GA 3E21A 2DXIA 4J1BA 2XGNA 5I5QA 2L2DA 4IJFA 2ZBKB 4JI5M 1QTZA 1IY0A 250LA 4IBCA 3GUOA 4H8ZA 2LVPC 3B0OA 2X8AA 1OIZA 5KPZA 5APDA 5JI2E 1IR9A 4JI4M 4LZZA 1C6DA 3HY5A 213LA 3W0LB 4WM5A 1XJUA 5DN4A 3OTOM 1L57A 2KNZA 1J7KA 4I7SA 3E46A 2LVAA 1LZGA 1L19A 5C18A 1AM7A 4OWBA 4N9RA 1B9OA 4XJHA 4PDIA 151LA 5FEKA 3P64A 3AZ6A 4RW1A 1GDXA 3HJ8A 4PRQA 5I4WA 2O79A 1MU5A 167LA 4GKJM 4UWUA 2KDLA 4WLTA 4H9HA 1C6BA 4WM1A 3KOZE 3TMUA 1L77A 4G4RA 3VKHA 2LBCA 2RKOA 4IBIA 2BQGA 4M0WA 2LVOC 4HLQA 5IZ7D 4LJ8A 2CGIA 4NHTA 2F5OA 1VEJA 1LJGA 1SWYA 1L45A 1L56A 4B49A 1G7IC 3MMPA 1NDGC 2BJWA 4GCFA 3RNXA 1XMOM 1P3QQ 1B7RA 4R0FA 2UUAM 4DUYM 1G0PA 4PCZA 3SASA 4I8SA 1IXZA 1LGUA 2BWEA 2Q9EA 4H9FA 4ARJA 235LA 4A3VB 1LYOA 2BQFA 3Q8GA 1B5ZA 1UIHA 1Q3CA 2R44A 1KIPC 3GLGE 1HQCA 3CT5A 161LA 5C6JA 1C6GA 223LA 5F9XA 1LHKA 1QS5A 2IHLA 2Z8YM 5IREB 1KSFX 4CGYB 4NSHA 1YL0X 4NGLA 1N32M 1LMCA 4GCDA 5LVGA 1ORYB 1BHZA 2YVBA 3E4RA 2Z7JA 1D9WA 2ZM6M 3HHWA 3WU7A 1L03A 4W5WA 2RAZX 1E8LA 3FRIA 1W5SA 4D82A 3JAMS 1XNQM 2BQHA 2BQNA 2BPUA 1LZAA 1NQIA 2JZ1A 1CUKA 5A2QS 2W1XA 1G7HC 2Q0MX 5GKNA 1EL1A 4HL4A 3T6PA 3LYOA 1IX0A 209LA 3A3RX 4PRUA 3HU1A 2OEAX 2D7GA 3QNGA 4FCVA 1CV5A 4ZPUA 3GLGA 3P65A 3A46A 248LA 4WM4A 1L2BA 4FCTA 1ZMUA 3A67Y 3AZ7A 1LSDA 128LA 4KLNA 1YQVY 262LA 9LYZA 3J7BA 1L29A 3HDFA 2MGWA 2BJVA 208LA 4WM2A 1YL1X 1QTEA 3JR4A 5FTKA 3GLIB 1L63A 3FRHA 2DQIY 1HHLA 2DWMA 1JHLA 1YIKA 1XSFA 4B0DA 2KZUA 257LA 1O23A 1GFGA 132LA 1JTTL 3HBEX 1D6QA 1L69A 3V76A 3DN3A 3CDTA 2CJLA 1GPQC 4BAFA 4LFBM 2MEHA 4LT3A 194LA 4H9CA 1L97A 1LPIA 4K0KM 3J27B 4KT3A 3C8RA 5LZMA 1JQJC 1C64A 1SXJD 1L04A 2G4NA 1B7PA 1HFZA 1B2KA 2H9JA 4B3TM 3IJVA 1L92A 1LCNA 3U6CA 1SXJC 1FNNA 3C81A 2D4KA 1LHJA 3FYDA 3GULA 5C1BA 2Y21A 4DV2M 4MGKE 3JR5A 1CU0A 5DYGA 1GAZA 1CU3A 1IWWA 1DZBX 2A5YB 3L26A 1NHEA 2Z6BA 1XHBA 2CWIA 3SB6A 5LIOA 1NNJA 3HTDA 1C6NA 3GRYA 4AW4A 1D0MA 3TXFA 2FE8A 4NC6A 3WUMA 4LRSA 4EKQA 4Z46A 1PJTA 3DA1A 1LHHA 2MR9A 3PNYA 1I20A 2DQAA 2NTHA 4CIZA 5LA8A 4XADA 1LSAA 1TH2A 4TUNA 4WOAA 1L83A 4LJ6A 1LWGA 1TF0B 2DQGY 4H90A 2DI0A 239LA 2O25A 4II8A 1UIBA 1OUBA 1EQ4A 1P2CC 3VKGA 1LKSA 2QB0B 3HTFA 1P7SA 4IBKA 3GPXA 2YBMA 4NWHA 2R6FA 1BB7A 1CV0A 206LA 4DR5M 4NEBA 1T3PA 1B5WA 2Z2EA 2XZFA 1ZMYL 4HV2A 1HEMA 1LI2A 3BKHA 155LA 4E97A 3H4JA 4LJ5A 3AGHA 5KXSA 5KXZA 2CRUA 2VQEM 3L2AA 2OO9A 3J6KA 2QSFX 1L59A 1WQNA 4BS7A 5APCA 1HEWA 1BWHA 5EQTA 4HP0A 2OE4X 2KRKA 5EJCA 4BBAA 1INUA 1WQRA 1OVJA 2I6ZA 196LA 1V92A 2QBYB 1G4AE 1VEKA 3EXDA 1GE3A 2V6ZM 1DYBA 2FYDA 1GFEA 3VK7A 1UA6Y 1HMKA 1BB3A 4WLYA 1DGHA 4ZEEA 5LMUM 1IP3A 2JY5A 4FWGA 1L67A 4DV4M 4TWSA 238LA 3CDVA 4LYMA 1C10A 1L1TA 4LZMA 4I4LA 2RBPA 3KVWA 1JR3E 3SB9A 4GHLA 1L73A 1FLQA 166LA 2OTYX 3IG8A 3QE8A 3CSQA 1YAPA 1L68A 5ILFA 221LA 1ZWNA 2QCUA 4OWCA 1A4VA 1QTBA 4ITQA 2WSCF 4B7HA 3KSJA 2N35A 1QAOA 4OWEA 3THGA 1XGQC 2R46A 210LA 1GF6A 1GKIA 2VQFM 3HT9A 5I54A 2BQDA 4QY9A 3B7ZA 4XJIA 4TTDA 2DBTA 1TH3A 1L93A 5IWAM 1VEDA 1K82A 4WG7A 4LJAA 1KFVA 2KZSA 3GQ4A 1G0MA 4QHTA 3KAMA 4IASA 2R45A 3KXEC 173LA 3TXGA 2BQEA 3HT8A 4XJGA 3GUNA 1EFUB 1LHLA 1XEKA 4R3DA 172LA 4P17A 2FH0A 3K1JA 1TGUA 1B5XA 2RBNA 4RNAA 2YNMD 1D0KA 4XBOA 3W6CA 3T15A 3J80S 1LZTA 2HAKA 1P5CA 1T8FA 4DD2A 1UFZA 3C8SA 1ZMVA 4NFVA 4H9IA 3L25A 1GXV2 200LA 3HHXA 3AFHA 1D3NA 3LYTA 3TXIA 1LAAA 1N75A 4UN2B 3GXKA 137LA 2DHYA 3VDUA 1IWTA 1CX6A 1C6MA 1JEFA 4EKSA 2RBRA 3H4MA 3SBBC 3VDPA 1YKYX 4I7PA 2NQ8C 4B08A 1LSCA 140LA 1F6SA 4NRVA 3CDRA 4I8OA 1L0JA 5LVKA 147LA 2YDGA 4GCBA 3WL2A 4YY3M 4B7FA 2QQ8A 1XMQM 2UU9M 1ALCA 1WXQA 2B7XA 4Z98A 6LYZA 1HELA 3TXKA 3SHFA 5HNCA 3QWLA 3SHGB 4G4HA 3QY4A 2KA6B 3AOEA 4LRTA 4DT3A 2CHQA 1HR0M 1I94M 2I26L 1L22A 1L00A 3EMSA 2CDSA 3WU8A 1OIPA 5KQDA 1IP4A 1OQMA 3J4GA 1HF4A 4GH9A 240LA 3UJNA 2Y0TA 1G59A 1LYZA 1IXSA 4OOOA 2D91A 4OU7A 1G41A 1HNZM 1SWZA 2DKVA 3HJQA 3U60B 1ZVYB 2DQEY 1CJ7A 2QZ4A 4IIWA 1L42A 3J81S 3A98B 4LF8M 4DR1M 1QS9A 1L28A 1YKZX 4K5YA 2HULA 5I14A 3U5ZB 4I7OA 2Z19A 1LSEA 199LA 1L26A 2XBRA 4W94A 1OUEA 4W96A 1G7MC 2EPEA 1VQ1A 1OQYA 1L32A 3HFMY 3TXDA 1GE0A 1NBYC 2KEBA 3SBJA 3E3DA 1QAQA 159LA 3SB7A 4DV3M 4DKLA 3RT5X 4TX7A 1L8QA 2MH8A 3L29A 1ZV5L 4DV0M 1IN6A 1L72A 2OE7X 4LT0A 4CGEA 5HLLA 1C65A 5KXNA 1RU3A 4M4OA 2FYCA 2RBQA 216LA 1QT4A 1JKDA 1IOQA 3A96A 1N4FA 1L2DA 2BQJA 4JYAM 1REYA 1IWZA 244LA 120LA 4EIWA 3R9XB 1T8AA 3WPLA 1ZURA 1IY1A 3KOYE 1IM2A 1LMAA 5DYIA 5A3ZA 1NY6A 3KS4A 4W56A 4XN6A 3LCVB 1LHIA 2C9CA 4LY6A 4Y28F 1OP9B 3AGGG 1LJ3A 3PDSA 253LA 2KXEA 1WQMA 1F10A 2LCBA 4CISA 1JB0F 2Z38A 3WVXA 5KY1A 3M6AA 1YILA 2F4GA 2M60A 1L05A 4YF2A 1NDMC 1R2YA 2MEEA 1L75A 175LA 4YEMA 3CB7A 5EP4A 3RFWA 1CUQA 2A7FA 2LZ2A 1LKRA 4XJFA 3HWLA 201LA 1CKFA 1L58A 4EPIA 3W0FA 4LF4M 1G06A 1KY1A 4NSJA 3A6CY 3AJIB 3A6BY 1JJ3A 2Y8PA 5EXXA 1JQUA 5L3IA 3L27A 4LF5M 5KXPA 5M1YA 3WVYA 229LA 3KFUG 4QGZA 3KW6A 4F2LA 5KXOA 4ETAA 4O34A 3F92A 1WIVA 1D9UA 1XC8A 3ZC7B 1L99A 5KXLA 3KOXE 4FVMA 1C6AA 2DZNB 2XBSA 5J7CA 3B0IA 4GIPA 2C96A 1H6UA 5F3WA 2FOIC 3MJ5A 1L15A 4LZJA 1JIYA 1LHMA 4KL7A 4XJDA 4GKKM 1C46A 4X65M 5ITRA 2QP9X 3WH1A 1QZEA 4N5RA 3GUPA 141LA 1CV1A 1L10A 1LZYA 2DAEA 1LJFA 1D2YA 2ZYCA 2LH0A 1GHLA 3B9PA 1QSQA 1HQYE 3FTCA 3FUVA 4H1PA 4J0LA 2F2NA 4XGIA 4OW0A 4LCBA 1V7TA 188LA 4NSGA 1L06A 3U61B 5F9UA 4I7TA 2H9KA 4EPFA 5KKIA 2I25L 1OWYA 2B70A 4P16A 3WXTA 3BBZA 1LSYA 1D3JA 1GF4A 4JXJA 1QQYA 176LA 1LGWA 241LA 3HJSA 4GCEA 1LOZA 3GLHE 1HSXA 1LI3A 1B7QA 3AGIA 2BQBA 1OUAA 4OX9M 2MEAA 3FE3A 3FYCA 2B6XA 5DN5A 2VDBB 1EQEA 2XFSA 2OU8A 1UIAA 3A93A 1QUTA 1XEJA 1DYGA 258LA 1LZ6A 5LVJA 5EP3A 1L60A 4NWEA 3SC3A 3WHKA 4U3XB 4L15A 4FCWA 3KOWE 4I81A 1L54A 3A91A 1J1OY 3SBAA 2X0AA 1HERA 4GLAA 4GLVA 1L18A 4FW9A 1H6MA 1DPXA 1L96A 1QTKA 4C5FA 2BAAA 3CT0A 4GCCA 1WHCA 4AKIA 4LYCA 245LA 2Z39A 2DENA 3GPPA 5FTMA 1LJ4A 1OV5A 5LAGA 4A7DA 3GLHA 2BQKA 4II7A 3IWRA 1XWIA 5ITYA 1RJCB 1RCMA 1C6LA 217LA 2XLJA 4JI6M 1MN3A 4GN4A 1L09A 1L52A 1HEOA 3C7YA 1L95A 1FJGM 2DVWB 143LA 2DKLA 231LA 1XEIA 4I7RA 1SX2A 3OE9A 5FSTA 1Y8GA 2JA2A 4AZFA 1IWXA 5EXSA 1PJJA 2LVNC 4G6ZA 5LYMA 4ARMA 4ZIXA 1CV4A 3DN6A 3AW7A 1JSEA 2Z3XA 233LA 1YLAA 2RSCA 154LA 3KSXA 2NTGA 5HNLA 1LZ8A 1QUOA 237LA 3F6ZA 5E26A 4JV5M 4DAJA 1LYEA 1VG5A 4LYBA 3KS8A 4H8XA 4LFAM 2O5RA 1LZCA 1OJLA 2OTZX 2C8OA 2C99A 197LA 2Y0QA 3U6PA 1UUZC 2UXDM 2ZWBA 4M9SA 1QT8A 1DQJC 2QPAA 2YSSC 1OAIA 4FD2A 2EKKA 130LA 3T36A 1C60A 4OWAA 1R4GA 8CATA 107LA 1L37A 1Z5BA 1GVNA 4OVZA 5BPVA 1VDSA 3GP1A 109LA 1SSWA 1MELL 1QANA 4ETCA 4BAPA 4MR1A 1REZA 193LA 1CJ6A 1VDQA 1GL6A 1LV7A 4CFPA 1C7YA 3QAKA 1EQ5A 1GFRA 1QTCA 4DQ5A 1L81A 4CHTB 3LYMA 2YQZA 3GPYA 5L8RF 2DAGA 1WGLA 5KO3A 3GLGB 2JXNA 5LAFA 5LYZA 1WJ7A 3QYEA 1YUBA 1IFYA 5IT9S 4HEOA 5DL9A 1L20A 1JR3D 5FLXS 1D6PA 3ILKA 180LA 4MGIE 183LA 3DOAA 3HTBA 1T6OA 4HJYA 259LA 1GE4A 3TMXA 1DI3A 2XSZA 2RAYX 2R4EA 243LA 2HU1A 3RGPA 1CKGA 1UIGA 5AMYA 1D2NA 1XXHE 1TLAA 165LA 2B5ZA 3C7ZA 2APLA 3W6BA 4G9SA 1GEZA 1GB3A 1L07A 2UUBM 1PJIA 4G3OA 1JKCA 2RB1X 3LVWA 4RLMA 2MEIA 3CDOA 2FS1A 1J5EM 1L14A 5C6IA 4HJZA 1CJ8A 2DHRA 3MK6A 3GPUA 234LA 1FN5A 1DGFA 1J1PY 157LA 1L94A 1L51A 3MGWA 1GF9A 4DR6M 3AJNA 3LHMA 4N0JA 1NKHA 1KXWA 215LA 3SB5A 2L6OA 5B05A 1LZDA 1OUHA 4GITA 4H94A 1L11A 3B7NA 2LZTA 2ANXA 4CJ6A 1PQMA 2X49A 4NXNM 1F4IA 3NY9A 2K6BA 1XXHA 4KHPM 1FLYA 4YXCA 1DGBA 3C7WA 4BADA 4WW0A 1LZ1A 1L38A 2P5TA 4NSOB 1C6HA 2Q9DA 3RZEA 4EKRA 3HT7A 2BQCA 3W6DA 4LYZA 1B7OA 1REMA 4NY5A 3HX3A 1GFUA 5B07A 5KQ8A 3AW6A 2YBLA 3W3EA 4ARPA 4KO8A 4GN3A 2Y20A 1LYYA 4LT1A 3DZDA 4LT2A 3NYAA 3SAUA 1DI4A 4N8ZA 4NIJA 4NHQA 191LA 3HU3A 1DV0A 2EJSA 4ZPXA 4RDSA 1E32A 1LMTA 3NBIA 4N1EI 3ZVQA 4DJHA 2N5ZA 3DFZA 4FWDA 2G5GX 4MB7A 1L98A 1L53A 1LSMA 3RW8A 4M9ZA 1GBXA 1IP6A 2HUKA 1LGXA 2LYOA 4NGWA 1ZQ9A 187LA 2R18A 1NV8A 3G3VA 4G4CA 1QT7A 3AKZA 1R5LA 1IY3A 2CEAA 134LA 3K2LA 247LA 5HMJA 3DMZA 1NHWC 3KDSE 153LA 1LZRA 4EJ4A 3C3DA 2ZNXY 1L12A 2CHGA 2K9DA 1LZBA 3WMKA 3SATA 3TWKA 3U6OA 2HEBA 4B7GA 2QARC 5APFA 1D2WA 2DZOB 2DQCY 152LA 2QENA 4YENA 2UUCM 3FTDA 3K3TA 2GNOA 1G07A 1GJTA 3HUQA 5KPTA 1IY2A 2YFQA 1YSYA 145LA 1LYSA 1IXRC 3HT6A 7LYZA 1JITA 256LA 236LA 3AL0C 3LVVA 4D80A 1CKDA 3LZTA 2Z12A 1G0KA 3CSZA 2RH1A 4R6CA 138LA 5FTLA 1YAOA 3WYHA 1DGHB 4IBEA 4GBRB 2X4AA 1LZ5A 1B7LA 1QDRA 2B6ZA 3U6SA 3K2RA 1UICA 1GBZA 1GL7A 2ZAMA 3I4VA 184LA 4ARLA 1HSWA 4REZA 1Q39A 3WULA 1PQOA 4GHAA 1L65A 1IWUA 1TAYA 2KHHA 4QOSA 1SQ2L 4L4UA 5KXXA 1XB2B 2R4JA 2O01F 110LA 4Z6YA 260LA 2Z4RA 1DO0A 4GRVA 4HTQA 4AQYM 3TQSA 1YKXX 4PJZA 1B5YA 1C6PA 2G4PA 2RGHA 3FI7A 1C45A 1KXXA 3PNVA 1LZSA 1GF0A 4DR4M 3W6AA 144LA 2HECA 1GFHA 3F9LA 1UIDA 2BLYA 3B7QA 1QUGA 1QSWA 5KXRA 1KYIA 2GV0A 3TMWA 3C8QA 4I7NA 4EKPA 3AOGA 2D4IA 3R8FA 3I51A 1VATA 1MJGM 1L84A 3A94A 2RB0X 3AV0A 3OE6A 3U6QA 1PM5A 4WP2A 4LFXA 5I4YA 3T1YM 1IP2A 4ETEA 2JP7A 4I7LA 1WQQA 1L64A 171LA 1L36A 3SARA 1MLCE 1C6KA 3GQ3A 1NJGA 4IBGA 1SXJE 1VDDA 3FUUA 1VDLA 1LSBA 1S3SA 3A90A 1GF3A 4DDCA 3HUAA 2B73A 4GMQA 4IBFA 1LZ4A 2JY8A 4IATA 1L34A 4ARQA 3W6EA 182LA 123LA 4TSBA 2W1MA 4W59A 4J7VA 5LXWA 2F4VM 2MEGA 6LZMA 3GLFE 2LXEA 129LA 1V34A 1TR8A 1L70A 4ET8A 3HUKA 2IGCA 1N33M 3PXGA 1RFPA 1NVMA 4F1IA 1W08A 1D0LA 219LA 2HEDA 1DYAA 4LF9M 3ODUA 4NHIA 4LG2A 1UC0A 3K8ZA 4NOOB 1GD6A 2BLXA 2VF7A 2C9OA 4LJ7A 4IJEA 1JTPL 1WTMA 160LA 4I7QA 4RF0A 1CTWA 1BVXA 4PHIA 4LGMA 1G0LA 3FA0A 4E3UA 4J1AA 2DQHY 1SXJA 4W55A 1XNRM 4AQNA 3U6LA 4RKUF 4DUZM 4XJBA 3IECA 2L7HA 3B89A 1E9SA 2HL7A 1J1XY 3P66A 4WO9A 2FNAA 1OFHA 1OUCA 3BKVA 4M0DA 4HTNA 1DGGA 1JTOL 3HZJA 5DM9A 102LA 1L33A 1TDZA 1IXSB 2OU9A 108LA 3GLFA 1L39A 2HUMA 4OO9A 1L90A 3B72A 4JI8M 158LA 3W67A 4P2EA 1L40A 2D6BA 2MROB 3GLFB 1KIRC 3OJPA 1KNIA 3ATNA 1PZYA 4YOPA 1QIOA 2CWBA 4NHSA 4ETBA 3ZCBB 4WLXA 1L50A 3HHYA 3OE8A 1C08C 3CF0A 1VAUA 4TSCA 1GE2A 2D7EA 1LJIA 3SP3A 1AT5A 2L4EA 1I56A 1UBZA 3SMPA 3DMXA 4DQ7A 4Z41A 2V1UA 3GUJA 2ZYPA 3AYQA 4Z3MA 4JI7M 1NV9A 1IC5Y 4N1CC 4I7KA 4HSFA 3OK0A 1G1VA 4S12A 3VFDA 5DLAA 1OV7A 1CKHA 1XGRC 3EIEA 2K0BX 1P3NA 1OUJA 2EUCA 1BB5A 1ZAEA 1P6YA 3ULRA 4B4EA 1LMQA 1IN5A 2EKFA 1PQDA 2ZTDA 2F5QA 1Q3BA 2F47A 4MCKA 3FKEA 4ET9A 4NGKA 1I1ZA 1NHGC 2LYMA 4ETDA 4DR2M 2W1YA 3HKPA 1YANA 2XFTA 1QAMA 4JI2M 1G0JA 1L66A 4L16A 1L49A 2JWSA 3I01M 114LA 2ZANA 4DD3A 2C8PA 3KP1E 1L41A 4DR7M 1LMPA 1IOCA 174LA 5LMNM 3N9CA 139LA 1D3FA 1QUDA 1FKVA 2DAMA 2D4JA 3N9AA 1DO2A 4UWNA 1KY0A 4DC4A 1XJTA 4G4BA 2B3TA 3CSRA 1PRBA 2RB2X 2XTHA 1MX0A 3HH6A 3W68A 1GBSA 1OYUA 2BWBA 2J7OA 1C6FA 3GUMA 4KODA 1L62A 2EQLA 4LF7M 3ZQJA 1L46A 131LA 5KJ9A 3CTWB 1OFIA 4DR3M 1L2CA 3SMSA 4EOFA 1IIZA 1GB8A 2O7AA 4W51A 4JI1M 4JI0M 4Q7JA 1IC4Y 2EKSC 5KXYA 2LYZA 3D9AC 1QUSA 5HQ1A 4CFOA 2EO2A 5EP2A 1N36M 3WUNA 115LA 2MEFA 4H9BA 195LA 2CP8A 3AZ4A 133LA 1T43A 2B72A 3A34A 2GQFA 1FDLY 4B4JA 2KNAA 1LSZA 2YBNA 1QTDA 1CU2A 2LNHC 4LGKA 2ZAOA 1L71A 1UCOA 2FBDA 1C68A 5JENB 4X62M 1PQKA 4G4OA 2ZTCA 4W58A 4Z8XA 1C7PA 4NSIA 1GB2A 2M5ZA 4M6DA 4W54A 4D9ZA 156LA 4DV5M 1FKQA 3C80A 3A95A 142LA 4G4QA 1JPOA 2VIIA 2OOAA 227LA 2H5XA 4QHSA 181LA 4R71A 1L76A 2B6YA 3Q8XA 2CUZA 2JUJA 4YM8A 2KNVA 1HJPA 1EE8A 1GABA 1CX7A 1ZMWA 2V1CA 3QAUA 1L27A 2HCBA 1T3TA 6LYTA 3SN6R 1LJJA 3M18B 3B6LA 1IR8A 3DN0A 4EMNA 2XQOA 2F4AA 1GAYA 2ZNWY 3FADA 5EXTA 135LA 2RBOA 4IAPA 1WTNA 3W6FA 2I7PA 5IHGA 3HDEA 1LYDA 3L28A 2W1LA 4DD7A 1IBMM 1QT5A 4GN5C 4X64M 1LSFA 1Z5CA 1NSFA 2OU0X 2L7IA 5FELA 5KXKA 1CVKA 3DN8A 4PT5A 4LYTA 2MJ5B 2NWDX 2L09A 5B59A 149LA 4ANRA 4DYGA 1L21A 3WPKA 4DD9A 3LCUA 3U6DA 4NGJA 4QEQA 146LA 1N34M 4FJRA 3G3BB 3CF6E 5E4PA 5FTNA 1JWRA 1WQOA 1LPYA 1C6QA 1GF8A 3CGWA 1N77A 1IBLM 4WM3A 4LJ4A 3GLHB 3J2PB 1CV6A 3HH5A 1G71A 1IWYA 1KW5A 3HHZA 2L78A 1WVUA 4HJVA 1GB7A 1GB9A 1T6VL 2ZQ4A 2CV1A 2KRUA 2K47A 4DV6M 1JKBA 3RE8A 2C98A 1C62A 1L16A 1L25A 3K9PA 3RGSA 2XEPA 3HH4A 2L4FA 4ARMB 3HU9A 2DQDY 249LA 3IHPA 1IN8A 1L30A 1CU6A 3DKEX 4TUWA 3F8VA 3PFIA 1IORA 4G49A 3CT1A 2R65A 1UIEA 3LQQA 2DWLA 1L1ZA 3D8BA 5DNYA 1C63A 1L74A 1P56A 1P2LA 3N9EA 1C6JA 3C83A 2HHHM 2FBBA 5F81A 1DYEA 4MM3B 3MHVC 4JI3M 163LA 4XYYA 170LA 3LQRA 1YE9A 4GEWA 4RF1A 2XZUA 4LFCM 3VLFB 1AUAA 4WLDA 2MECA 3B0KA 3CF2A 127LA 5LVHA 3UMMA 3GLIE 2HEFA 4OVZB 103LA 3IJUA 3WW5A 1P37A 1FLUA 3K9OA 2YBHA 2BQMA 5KPRA 4KPMA 3EO5A 1GWDA 1T8GA 1GFVA 1L02A 1XFPL 3I04M 1IO5A 1GDWA 4PGJB 1G8PA 1WR1B 2BQLA 5FCPA 3FD9A 1WVVA 5FTJA 1C6IA 4L8RC 4WM6A 5LVIA 104LA 1L13A 2ERCA 1GB6A 1GF7A 2VF8A 4B1AA 2AUBA 4D81A 1C1KA 212LA 4W53A 5B1GA 2I7NA 1T6HA 177LA 1LJNA 4YEOA 3BOSA 1V7SA 1XEPA 2BQAA 3C3EA 5B1FA 1L89A 3VWOA 1PJQA 192LA 4I7MA 1VDPA 4GC5A 3GXRA 4OOTA 3TPZA 251LA 2G4QA 3C58A 2J7NA 2CUUA 3TXJA 1G0QA 1L79A 3GLIA 3SYKA 4W57A 4WL6A 1QSBA 1LZNA 5FSWA 4PJ2C 2F32A 1IVMA 4H93A 4GRIA 2H5ZA 1BGIA 1B7SA 1L44A 1LYHA 5E9RA 2F30A 1K3WA 1BQLY 1OUIA 3L2XA 3CDQA 1F0WA 148LE 1L87A 3QYBA 1NHBA 4UWVA 5FDJA 1QQWA 1A5TA 4YXAC 3DNAA 1GF5A 1JTNA 3GRUA 1BB4A 4PPOA 1B7MA 1DKKA 3IG5A 4IBDA 1UIFA 4X3BA 4MGZE 3ZH9B 185LA 3TXBA 2CV0A 1IOSA 3NWLA 1I6SA 1C6EA 1XGPC 4AKHA 1G7LC 186LA 3RUNA 4DWXA 2DAKA 1Q02A 3AOEC 1LYFA 3WU9A 2HEAA 1XXHB 1IP1A 1LMOA 2HTXA 4QOZC 1IN4A 4L78A 3SB8A 3D8LA 3VK8A 1QDTA 4CJ2A 189LA 2LWXA 1L91A 3LN2A 5KXTA 3CQLA 1NNUC 2J5YA 3ATOA 222LA 1GO5A 1L85A 1KXYA 3GUKA 2Z2FA 1JKAA 4DDBA 1L86A 242LA 1OVKA 4IBBA 1Z5AA 1FBIX 4NRWA 4RW2A 2Z37A 1CJ9A 1DYFA 4NL4H 1ZV1A 4AKGA 1HEQA 2LHCA 3JR6A 3OE0A 1YAMA 1IP5A 1R6BX 5APEA 2R0IA 3WUAA 1PJSA 4HV1A 4LZTA 2XH9A 1L80A 225LA 4WG1A 3TXHA 3EBAB 4BB9A 3ZVQB 4DBGB 1JUGA 2C5RA 1C67A 4PDGA 1LLHA 1WTHA 2YBJA 169LA 112LA 3LYZA 4OWHA 2WSEF 1AKIA 1BVSA 3T6UA 1OUGA 1K3XA 1NY5A 3TL4X 1PQIA 3WXUA 207LA 3UGJA 3DN4A 5I4XA 2QNJA 2ANVA 3HWSA 1IOTA 5D5FA 1NJFA 4XK8F 214LA 4PK0A 2OQ4A 3J7AS 1XGTC 1NMMA 1LW9A 3T1HM 1SSYA 2DWZB 122LA 3GUIA 1DYDA 4QNRA 2Z4SA 2A4TA 1LJEA 4YX7C 1HT1E 1PGYA 4DD1A 3D3DA 3EMLA 1E94E 198LA 2LZMA 3BXWA 2EIZC 4LDOA 1C6TA 4DD0A 4C3WA 4M9XA 2LC9A 1HEPA 3HTGA 5BR8M 2AHMA 1W6ZA 2EA0A 1QTHA 5D5CA 2XF3A 3TMVA 3DN2A 2MEDA 1GLNA 2HKJA 3FUWA 5B06A 1YROA 1C43A 1NO1A 5HMVA 4GC9A 1GFJA 4H92A 2QBYA 1FLWA 2RGOA 1C6CA 1T97A 2WARA 1LZ9A 1C61A 230LA 1IQPA 3GQ5A 2HU3A 2B74A 224LA 3HU8A 2DZLA 4MGHA 3AB6A 1LMNA 1B0DA 3NY8A 1HT2E 4S0WA 5E6JA 4MSTA 3NBXX 1G1WA 1VEGA 1P46A 1GJSA 2CFOA 4AXTA 1A2YC 205LA 1LJKA 1UM8A 3M3UA 2JNHA 1LSPA 4JN6A 1LI6A 2YR0A 4FWHA 1LWKA 4B3MM 4DV1M 1EPYA 1I4WA 4B3SM 5C6LA 3RU5A 1HNXM 1OUDA 3FI5A 1OKSA 1OTRA 4LJ9A 4NGZA 1R7RA 3I4YA 246LA 2F5NA 2F2QA 1L08A 2O4WA 1TH4A 5ILCA 5II3A 2ZIJA 1L0KA 2JZ0A 1QT6A 2UXBM 1J09A 1GFAA 1L48A 2E5LM 2B6TA 178LA 1KIQC 2IFFY 5KXMA 2JY6B 3HH3A 5IELA 1H87A 2VB1A 4NXMM 1CV3A 2D7HA 5ITTA 1NBZC 4AG6A 1L55A 2DAIA 2B75A 1QZMA 3SAVA 4NGOA 5EP1A 1OUFA 2DWNA 2OPFA 2A7DA 1PQJA 1JR3A 5K7OA 1HC0A 1JTMA 1VFBC 1L47A 3TE6A 4LGYA 1P64A 1HFXA 3LW5F 1UACY 3T38A 1WQPA 2LHMA 3E9SA 4ARQB 3SYLA 1L43A 2DQFC 1QYRA 3U6MA 4G4NA 2G8LA 1QTVA 5EBHA 168LA 5LINA 2BNKA 1B5UA 1NWGA 4NG1A 3HBDA 2PC2A 2JY7A 3U6EA 1D3MA 3D4SA 3A42A 1LYJA 4L6V6 4NSRA 2CHVA 1GBYA 1DXJA 8LYZA 1P36A 1GFKA 254LA 1PS5A 4I5SA 2CV2A 4XENA 4LF6M 1DKJA 1Z59A 2OE9X 5F16A 1YAQA 1QSAA 1SXJB 1GBOA 1LSGA 7CATA 228LA 3HBHA 1LYGA 232LA 1JSFA 1IR7A 3V2YA 4I7JA 1Z6TA 3GO8A 255LA 3GRVA 3K92A 1HMLA 1IEEA 1DYCA 2OOBA 1JJ1A 3ZEKA 3EIHA 1SX7A 2RRUA 1GB5A 2YBIA 1HENA 4NGIA 1ZVHL 1IC7Y 1AZFA 1OAOC 1HNWM 2F5SA 1TDHA 1BWJA 2QHOB 2XJWA 4HTKA 3U60A 3SFZA 4QDNA 1NF5A 3WW6A 1P2RA 1SLYA 3A45A 3A3QA 2UXCM 5KKJA 4HPEA 3GRRA 4L41A 3L64A 3U5ZA 3LMMA 2ZQ3A 261LA 5F14A 1GFTA 3C9PA 5KXWA 3PBLA 4DQJA 1V33A 3DN1A 4X66M 2G3QA 1E9RA 1RE2A 3SAWA 2MEBA 4FDYA 3VW7A 1G7JC 4IJ4A 1GE1A 1OWZA 1CUPA 1IWVA 3G3AB 2HEEA 2WZJA 1LZEA 4H9AA 4NG8A 4B3RM 5ITUA 3HGIA 3HU2A 3LZMA 2KW0A 4OW1A 1B5VA 1JJ0A 3LZ2A 4H91A 5IDDA 111LA 2W82A 4WO6A 4AGAA 1QT3A 125LA 3FTFA 1K28A 5FHWA 1IP7A 1HFYA 1LJHA 2LTUA 2H1RA 1CKCA 5JI3E 1REXA 3B74A 1L35A 1TEWA 1DI5A 1TCYA 2BQIA 4HPIA 5EXPA 1L88A 4AI6A 4ZFPA 5LA5A 4WL7A 4MH0E 150LA 5ITXE 3P4ZA 2FFJA 119LA 1XGUC 2ZILA 4LFPA 3FE0A 4B4IA 1QUHA 3TWLA 1BWIA 1VDTA 3M0EA 7LZMA 1TDYA 2DQJY 1L31A
chains in the Genus database with same CATH topology
1HNLA 211LA 4NGYA 164LA 3A92A 1GB0A 118LA 1L23A 1LYIA 1C66A 4H8YA 113LA 1KW7A 4ML7A 1L82A 1CNSA 5L3HA 1GBWA 3A8ZA 1L17A 2ZIKA 4RLNA 1KS3A 4DDAA 1AT6A 1L61A 4LYOA 4WMGA 3WPJA 1B6IA 5A3EA 4W52A 1L24A 162LA 1F6RA 1LSNA 3DMVA 190LA 1OVHA 5LYTA 2Z18A 4NHPA 3V2WA 1Z55A 1BB6A 4NGVA 2RBSA 226LA 2B6WA 2HUBA 5L9JA 1JISA 2BQOA 5I53A 3AZ5A 3P68A 1BVKC 3C82A 126LA 1L01A 3G3XA 4KXIA 1GEVA 4LDLA 1IY4A 3TXEA 4H9EA 218LA 4LDEA 3G3WA 252LA 1CU5A 1DPWA 1RI8B 3UONA 1C69A 1B7NA 4CHXA 1TBYA 1LTMA 5T3FA 1ZYTA 4I0CA 1GXXA 4EXMA 3RZ4A 220LA 1G0GA 4J1BA 5I5QA 1QTZA 250LA 3GUOA 4H8ZA 3B0OA 5APDA 1IR9A 1C6DA 213LA 4WM5A 1XJUA 5DN4A 1L57A 4I7SA 1LZGA 1L19A 1AM7A 4OWBA 4N9RA 1B9OA 4XJHA 151LA 5FEKA 3P64A 3AZ6A 4RW1A 1GDXA 4PRQA 5I4WA 2O79A 167LA 4UWUA 4WLTA 4H9HA 1C6BA 4WM1A 3TMUA 1L77A 2BQGA 2CGIA 4NHTA 1LJGA 1SWYA 1L45A 1L56A 4B49A 1G7IC 1NDGC 4GCFA 3RNXA 1B7RA 4R0FA 1G0PA 4I8SA 1LGUA 4H9FA 2Q9EA 4ARJA 235LA 2BQFA 1LYOA 1B5ZA 1UIHA 1KIPC 3CT5A 161LA 5C6JA 1C6GA 223LA 5F9XA 1LHKA 1QS5A 2IHLA 4NSHA 1YL0X 4NGLA 1LMCA 4GCDA 5LVGA 1BHZA 2YVBA 1D9WA 3WU7A 1L03A 2RAZX 1E8LA 2BQHA 2BQNA 2BPUA 1LZAA 1NQIA 2W1XA 1G7HC 2Q0MX 1EL1A 3LYOA 1IX0A 209LA 3A3RX 4PRUA 2OEAX 3QNGA 1CV5A 4ZPUA 3P65A 248LA 4WM4A 3A67Y 3AZ7A 1LSDA 128LA 1YQVY 262LA 9LYZA 1L29A 3HDFA 208LA 4WM2A 1YL1X 1QTEA 1L63A 2DQIY 1HHLA 1JHLA 1YIKA 1XSFA 4B0DA 257LA 1O23A 1GFGA 132LA 1JTTL 3HBEX 1D6QA 1L69A 3DN3A 3CDTA 2CJLA 1GPQC 4BAFA 2MEHA 4LT3A 194LA 4H9CA 1L97A 1LPIA 4KT3A 3C8RA 5LZMA 1C64A 1L04A 2G4NA 1B7PA 1HFZA 1B2KA 2H9JA 3IJVA 1L92A 1LCNA 3C81A 2D4KA 1LHJA 3GULA 1CU0A 1GAZA 1CU3A 1IWWA 1DZBX 1NHEA 2Z6BA 3SB6A 2CWIA 5LIOA 3HTDA 1C6NA 1D0MA 3TXFA 3WUMA 4EKQA 4Z46A 1LHHA 1I20A 2DQAA 2NTHA 5LA8A 4XADA 1LSAA 4TUNA 4WOAA 1L83A 1LWGA 2DQGY 4H90A 239LA 4II8A 1UIBA 1OUBA 1EQ4A 1P2CC 1LKSA 2QB0B 3HTFA 1P7SA 2YBMA 4NWHA 1BB7A 1CV0A 206LA 4NEBA 1T3PA 1B5WA 2Z2EA 1ZMYL 4HV2A 1HEMA 1LI2A 3BKHA 155LA 4E97A 3AGHA 5KXSA 5KXZA 3J6KA 1L59A 1WQNA 4BS7A 5APCA 1HEWA 1BWHA 4HP0A 2OE4X 1INUA 1WQRA 1OVJA 2I6ZA 196LA 3EXDA 1GE3A 1DYBA 2FYDA 1GFEA 1UA6Y 1HMKA 1BB3A 4WLYA 4ZEEA 1IP3A 1L67A 4TWSA 238LA 3CDVA 4LYMA 1C10A 4LZMA 2RBPA 3SB9A 1L73A 1FLQA 166LA 2OTYX 3QE8A 3CSQA 1YAPA 1L68A 5ILFA 221LA 1ZWNA 4OWCA 1A4VA 1QTBA 4OWEA 1XGQC 210LA 1GF6A 3HT9A 5I54A 2BQDA 4QY9A 4XJIA 4TTDA 2DBTA 1L93A 1VEDA 4WG7A 1G0MA 3KAMA 4IASA 173LA 3TXGA 2BQEA 3HT8A 4XJGA 3GUNA 1LHLA 1XEKA 172LA 1B5XA 2RBNA 1D0KA 3W6CA 1LZTA 1P5CA 1T8FA 4DD2A 3C8SA 4NFVA 4H9IA 1GXV2 200LA 1D3NA 3LYTA 3TXIA 1LAAA 3GXKA 137LA 1IWTA 1CX6A 1C6MA 1JEFA 4EKSA 2RBRA 3SBBC 1YKYX 4I7PA 1LSCA 140LA 1F6SA 3CDRA 1L0JA 5LVKA 147LA 2YDGA 4GCBA 3WL2A 1ALCA 4Z98A 2B7XA 6LYZA 1HELA 3TXKA 5HNCA 4G4HA 3QY4A 4DT3A 2I26L 1L22A 1L00A 3EMSA 2CDSA 3WU8A 1IP4A 1OQMA 3J4GA 1HF4A 240LA 1LYZA 4OOOA 2D91A 1SWZA 2DKVA 1ZVYB 2DQEY 1CJ7A 1L42A 1QS9A 1L28A 1YKZX 4K5YA 2HULA 5I14A 4I7OA 2Z19A 1LSEA 199LA 1L26A 2XBRA 4W94A 1OUEA 4W96A 1G7MC 2EPEA 3HFMY 1L32A 3TXDA 1GE0A 1NBYC 3E3DA 159LA 3SB7A 4DKLA 3RT5X 4TX7A 1ZV5L 1L72A 2OE7X 4LT0A 4CGEA 5HLLA 1C65A 5KXNA 4M4OA 2FYCA 2RBQA 216LA 1QT4A 1JKDA 1IOQA 3A96A 1N4FA 2BQJA 1REYA 1IWZA 244LA 120LA 1T8AA 3WPLA 1ZURA 1LMAA 5A3ZA 4W56A 4XN6A 1LHIA 1OP9B 3AGGG 1LJ3A 3PDSA 253LA 1WQMA 1F10A 2LCBA 2Z38A 3WVXA 5KY1A 1YILA 2F4GA 1L05A 4YF2A 1NDMC 2MEEA 1L75A 175LA 4YEMA 3CB7A 2A7FA 1CUQA 2LZ2A 1LKRA 4XJFA 3HWLA 201LA 1CKFA 1L58A 4EPIA 1G06A 1KY1A 4NSJA 3A6CY 3A6BY 1JJ3A 2Y8PA 1JQUA 5L3IA 5KXPA 5M1YA 3WVYA 229LA 4QGZA 5KXOA 4ETAA 4O34A 1D9UA 1L99A 5KXLA 1C6AA 2XBSA 5J7CA 3B0IA 1LHMA 1L15A 1JIYA 4KL7A 4XJDA 1C46A 3WH1A 4N5RA 3GUPA 141LA 1CV1A 1L10A 1LZYA 1LJFA 1D2YA 2ZYCA 1GHLA 1QSQA 4H1PA 4J0LA 2F2NA 1V7TA 188LA 4NSGA 1L06A 5F9UA 4I7TA 2H9KA 4EPFA 5KKIA 2I25L 1OWYA 2B70A 3WXTA 1LSYA 1D3JA 1GF4A 1QQYA 176LA 1LGWA 241LA 4GCEA 1LOZA 1HSXA 1LI3A 1B7QA 3AGIA 2BQBA 1OUAA 2MEAA 2B6XA 5DN5A 1EQEA 2OU8A 1UIAA 3A93A 1QUTA 1XEJA 1DYGA 258LA 1LZ6A 5LVJA 1L60A 4NWEA 4U3XB 1L54A 3A91A 1J1OY 3SBAA 2X0AA 1HERA 4GLAA 4GLVA 1L18A 1H6MA 1DPXA 1L96A 1QTKA 4C5FA 2BAAA 3CT0A 4GCCA 4LYCA 245LA 2Z39A 1LJ4A 5LAGA 1OV5A 4A7DA 2BQKA 3IWRA 1RJCB 1RCMA 1C6LA 217LA 4GN4A 1L09A 1L52A 1HEOA 3C7YA 1L95A 143LA 231LA 1XEIA 4I7RA 1SX2A 3OE9A 5FSTA 1IWXA 5LYMA 4ARMA 4ZIXA 1CV4A 3DN6A 3AW7A 1JSEA 233LA 2RSCA 154LA 2NTGA 5HNLA 1LZ8A 1QUOA 237LA 3F6ZA 4DAJA 1LYEA 4LYBA 4H8XA 1LZCA 2OTZX 2C8OA 197LA 1UUZC 2ZWBA 1QT8A 1DQJC 2YSSC 130LA 3T36A 1C60A 4OWAA 107LA 1L37A 1VDSA 109LA 1SSWA 1MELL 4ETCA 4BAPA 4MR1A 1REZA 193LA 1CJ6A 1VDQA 4CFPA 3QAKA 1EQ5A 1GFRA 1QTCA 4DQ5A 1L81A 3LYMA 5LAFA 5LYZA 5DL9A 1L20A 1D6PA 180LA 183LA 3HTBA 4HJYA 259LA 1GE4A 3TMXA 1DI3A 2RAYX 243LA 2HU1A 1CKGA 1UIGA 5AMYA 1TLAA 165LA 2B5ZA 3C7ZA 3W6BA 4G9SA 1GEZA 1GB3A 1L07A 1JKCA 2RB1X 4RLMA 2MEIA 3CDOA 1L14A 5C6IA 4HJZA 1CJ8A 234LA 1FN5A 1J1PY 157LA 1L94A 1L51A 3MGWA 1GF9A 3AJNA 3LHMA 4N0JA 1NKHA 1KXWA 215LA 3SB5A 5B05A 1LZDA 1OUHA 4H94A 1L11A 2LZTA 2ANXA 1PQMA 3NY9A 1FLYA 4YXCA 3C7WA 4BADA 1LZ1A 1L38A 1C6HA 2Q9DA 3RZEA 4EKRA 3HT7A 2BQCA 3W6DA 4LYZA 1B7OA 1REMA 4NY5A 1GFUA 5B07A 3AW6A 2YBLA 3W3EA 4ARPA 4GN3A 1LYYA 4LT1A 4LT2A 3NYAA 1DI4A 4N8ZA 4NIJA 4NHQA 191LA 4RDSA 4N1EI 1LMTA 3ZVQA 4DJHA 2N5ZA 1L98A 1L53A 1LSMA 3RW8A 1GBXA 1IP6A 2HUKA 1LGXA 2LYOA 4NGWA 187LA 3G3VA 4G4CA 1QT7A 1IY3A 134LA 247LA 5HMJA 3DMZA 153LA 1LZRA 4EJ4A 2ZNXY 1L12A 1LZBA 3WMKA 2QARC 2HEBA 5APFA 1D2WA 2DQCY 152LA 4YENA 3K3TA 1G07A 3HUQA 1LYSA 145LA 3HT6A 7LYZA 1JITA 256LA 236LA 1CKDA 3LZTA 2Z12A 1G0KA 3CSZA 2RH1A 4R6CA 138LA 1YAOA 3WYHA 4GBRB 1LZ5A 1B7LA 1QDRA 2B6ZA 3K2RA 1UICA 1GBZA 184LA 4ARLA 1HSWA 3WULA 1PQOA 1L65A 1IWUA 1TAYA 1SQ2L 5KXXA 110LA 260LA 4GRVA 4HTQA 1YKXX 4PJZA 1B5YA 1C6PA 2G4PA 3FI7A 1C45A 1KXXA 1LZSA 1GF0A 3W6AA 144LA 2HECA 1GFHA 3F9LA 1UIDA 2BLYA 1QUGA 1QSWA 5KXRA 2GV0A 3TMWA 3C8QA 4I7NA 4EKPA 2D4IA 1VATA 1L84A 3A94A 2RB0X 3OE6A 5I4YA 4LFXA 1IP2A 4ETEA 4I7LA 1WQQA 1L64A 171LA 1L36A 1MLCE 1C6KA 1LSBA 3A90A 1GF3A 4DDCA 3HUAA 2B73A 1LZ4A 4IATA 1L34A 4ARQA 3W6EA 182LA 123LA 4TSBA 2W1MA 4W59A 4J7VA 5LXWA 2MEGA 6LZMA 129LA 1L70A 4ET8A 3HUKA 2IGCA 1RFPA 1W08A 1D0LA 219LA 2HEDA 1DYAA 3ODUA 4NHIA 1UC0A 1GD6A 2BLXA 1JTPL 1WTMA 160LA 4I7QA 1CTWA 1BVXA 4PHIA 1G0LA 3FA0A 4E3UA 4J1AA 2DQHY 4W55A 4AQNA 4XJBA 1J1XY 3P66A 4WO9A 1OUCA 3BKVA 4HTNA 1JTOL 5DM9A 102LA 1L33A 2OU9A 108LA 1L39A 2HUMA 4OO9A 1L90A 3B72A 158LA 4P2EA 1L40A 2D6BA 1KIRC 3OJPA 1KNIA 3ATNA 1PZYA 4YOPA 1QIOA 4NHSA 4ETBA 4WLXA 1L50A 3OE8A 1C08C 1VAUA 4TSCA 1GE2A 1LJIA 3SP3A 1AT5A 1I56A 1UBZA 3DMXA 4DQ7A 4Z41A 3GUJA 2ZYPA 3AYQA 4Z3MA 1IC5Y 4N1CC 4I7KA 4HSFA 3OK0A 1G1VA 5DLAA 1OV7A 1CKHA 1XGRC 1P3NA 1OUJA 1BB5A 1P6YA 3ULRA 4B4EA 1LMQA 1PQDA 2F47A 4MCKA 4ET9A 4NGKA 1I1ZA 2LYMA 4ETDA 2W1YA 1YANA 1L66A 1G0JA 1L49A 114LA 4DD3A 2C8PA 1L41A 1LMPA 1IOCA 174LA 3N9CA 139LA 1D3FA 1QUDA 1FKVA 2D4JA 3N9AA 4UWNA 1KY0A 4DC4A 1XJTA 4G4BA 3CSRA 2RB2X 2XTHA 3HH6A 1GBSA 1OYUA 1C6FA 3GUMA 1L62A 2EQLA 1L46A 131LA 5KJ9A 4EOFA 1IIZA 1GB8A 2O7AA 4W51A 1IC4Y 2EKSC 5KXYA 2LYZA 3D9AC 1QUSA 5HQ1A 4CFOA 3WUNA 115LA 2MEFA 4H9BA 195LA 3AZ4A 133LA 2B72A 3A34A 1FDLY 4B4JA 1LSZA 2YBNA 1QTDA 1CU2A 4LGKA 1L71A 1UCOA 2FBDA 1C68A 5JENB 4W58A 1PQKA 1C7PA 4NSIA 1GB2A 4M6DA 4W54A 4D9ZA 156LA 3C80A 1FKQA 3A95A 142LA 1JPOA 227LA 181LA 1L76A 2B6YA 4YM8A 1CX7A 1L27A 6LYTA 3SN6R 1LJJA 3M18B 3B6LA 1IR8A 3DN0A 4EMNA 2XQOA 2F4AA 1GAYA 2ZNWY 3FADA 135LA 2RBOA 4IAPA 1WTNA 3W6FA 5IHGA 3HDEA 1LYDA 2W1LA 4DD7A 1QT5A 4GN5C 1LSFA 2OU0X 5FELA 5KXKA 1CVKA 3DN8A 4LYTA 2NWDX 5B59A 149LA 4ANRA 4DYGA 1L21A 3WPKA 4DD9A 4NGJA 4QEQA 146LA 4FJRA 3G3BB 5E4PA 1JWRA 1WQOA 1LPYA 1C6QA 1GF8A 4WM3A 1CV6A 3HH5A 1IWYA 1KW5A 2L78A 1WVUA 4HJVA 1GB7A 1GB9A 1T6VL 2ZQ4A 1JKBA 1C62A 1L16A 1L25A 3HH4A 4ARMB 3HU9A 2DQDY 249LA 1L30A 1CU6A 3DKEX 3F8VA 1IORA 4G49A 3CT1A 1UIEA 1C63A 1L74A 1P56A 1P2LA 3N9EA 1C6JA 3C83A 2FBBA 5F81A 1DYEA 163LA 4XYYA 170LA 4WLDA 2MECA 3B0KA 127LA 5LVHA 2HEFA 3IJUA 103LA 3WW5A 1P37A 1FLUA 2YBHA 2BQMA 4KPMA 3EO5A 1GWDA 1T8GA 1GFVA 1L02A 1XFPL 1IO5A 1GDWA 4PGJB 2BQLA 5FCPA 1WVVA 1C6IA 4WM6A 5LVIA 104LA 1L13A 1GB6A 1GF7A 4B1AA 2AUBA 212LA 177LA 4W53A 5B1GA 1T6HA 1LJNA 4YEOA 1V7SA 1XEPA 2BQAA 5B1FA 1L89A 3VWOA 192LA 4I7MA 1VDPA 4OOTA 3GXRA 251LA 2G4QA 2CUUA 3TXJA 1G0QA 1L79A 4W57A 4WL6A 1QSBA 1LZNA 4PJ2C 2F32A 1IVMA 4H93A 2H5ZA 1BGIA 1B7SA 1L44A 1LYHA 5E9RA 2F30A 1BQLY 1OUIA 3L2XA 3CDQA 1F0WA 148LE 1L87A 5FDJA 1NHBA 4UWVA 4YXAC 3DNAA 1GF5A 1JTNA 1BB4A 4PPOA 1B7MA 1DKKA 1UIFA 4X3BA 185LA 3TXBA 1IOSA 1I6SA 1C6EA 1XGPC 1G7LC 186LA 3RUNA 4DWXA 1LYFA 3WU9A 2HEAA 1IP1A 1LMOA 2HTXA 3SB8A 1QDTA 4CJ2A 189LA 3LN2A 1L91A 5KXTA 3CQLA 3ATOA 222LA 1L85A 1KXYA 3GUKA 2Z2FA 1JKAA 4DDBA 1L86A 242LA 1OVKA 1FBIX 4RW2A 2Z37A 1CJ9A 1DYFA 1HEQA 3JR6A 3OE0A 1YAMA 1IP5A 5APEA 3WUAA 4HV1A 4LZTA 3TXHA 1L80A 225LA 4WG1A 3EBAB 3ZVQB 1JUGA 1C67A 1LLHA 1WTHA 2YBJA 169LA 112LA 3LYZA 4OWHA 3T6UA 1AKIA 1OUGA 1PQIA 3WXUA 207LA 3DN4A 5I4XA 2ANVA 1IOTA 5D5FA 214LA 4PK0A 1XGTC 1NMMA 1LW9A 1SSYA 122LA 3GUIA 1DYDA 2A4TA 1LJEA 4YX7C 4DD1A 3D3DA 3EMLA 198LA 2LZMA 2EIZC 4LDOA 1C6TA 4DD0A 4C3WA 2LC9A 1HEPA 3HTGA 1W6ZA 1QTHA 5D5CA 3TMVA 3DN2A 2MEDA 5B06A 1YROA 1C43A 5HMVA 1GFJA 4H92A 1FLWA 1C6CA 1T97A 2WARA 1LZ9A 1C61A 230LA 2HU3A 2B74A 224LA 3HU8A 3AB6A 1LMNA 1B0DA 3NY8A 4S0WA 4MSTA 1G1WA 1P46A 4AXTA 1A2YC 205LA 1LJKA 3M3UA 1LSPA 1LI6A 1LWKA 1EPYA 5C6LA 3RU5A 1OUDA 3FI5A 4NGZA 246LA 2F2QA 1L08A 2O4WA 5ILCA 5II3A 2ZIJA 1L0KA 1QT6A 1GFAA 1L48A 2B6TA 178LA 1KIQC 2IFFY 5KXMA 5IELA 3HH3A 1H87A 2VB1A 1CV3A 1NBZC 1L55A 2B75A 4NGOA 1OUFA 2A7DA 1PQJA 1HC0A 5K7OA 1JTMA 1VFBC 1L47A 1P64A 1HFXA 1UACY 1WQPA 2LHMA 4ARQB 1L43A 2DQFC 1QTVA 5EBHA 168LA 5LINA 1B5UA 1NWGA 4NG1A 3HBDA 2PC2A 1D3MA 3D4SA 1LYJA 1GBYA 1DXJA 8LYZA 1P36A 1GFKA 254LA 1PS5A 4XENA 1DKJA 2OE9X 5F16A 1YAQA 1QSAA 1GBOA 1LSGA 228LA 3HBHA 1LYGA 232LA 1JSFA 1IR7A 3V2YA 4I7JA 255LA 1HMLA 1IEEA 1DYCA 1JJ1A 3ZEKA 1SX7A 1GB5A 2YBIA 1HENA 4NGIA 1ZVHL 1IC7Y 1AZFA 1BWJA 2XJWA 4HTKA 4QDNA 1NF5A 3WW6A 1P2RA 1SLYA 3A3QA 5KKJA 4HPEA 4L41A 3L64A 2ZQ3A 261LA 5F14A 1GFTA 5KXWA 3PBLA 4DQJA 3DN1A 1RE2A 4FDYA 2MEBA 3VW7A 1G7JC 4IJ4A 1GE1A 1OWZA 1CUPA 1IWVA 3G3AB 2HEEA 1LZEA 4H9AA 4NG8A 3LZMA 4OW1A 1B5VA 1JJ0A 3LZ2A 4H91A 5IDDA 111LA 4WO6A 4AGAA 1QT3A 125LA 1K28A 5FHWA 1IP7A 1HFYA 1LJHA 1CKCA 1REXA 1L35A 1TEWA 1DI5A 1TCYA 2BQIA 4HPIA 1L88A 4ZFPA 5LA5A 4WL7A 150LA 3P4ZA 119LA 1XGUC 2ZILA 4LFPA 3FE0A 4B4IA 1QUHA 1BWIA 1VDTA 7LZMA 1TDYA 2DQJY 1L31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJV A;  3W6D A;  1GB7 A;  4LYZ A;  4IAS A;  1GB9 A;  1T6V L;  1HNL A;  1B7O A;  2ZQ4 A;  4NGY A;  3TXG A;  2BQE A;  1REM A;  4NY5 A;  1GFU A;  1JKB A;  5B07 A;  3A92 A;  3AW6 A;  4XJG A;  1LHL A;  1XEK A;  2YBL A;  3W3E A;  1GB0 A;  1B5X A;  4GN3 A;  1D0K A;  1LYY A;  4LT1 A;  4LT2 A;  3W6C A;  1DI4 A;  1LZT A;  4N8Z A;  2DQD Y;  4NIJ A;  4H8Y A;  4DD2 A;  4NFV A;  4NHQ A;  4ML7 A;  4H9I A;  1CNS A;  1GXV 2;  3LYT A;  1IOR A;  4G49 A;  3TXI A;  3CT1 A;  1LAA A;  3GXK A;  1UIE A;  4RDS A;  4N1E I;  1IWT A;  1LMT A;  5L3H A;  3ZVQ A;  2N5Z A;  1JEF A;  1GBW A;  3A8Z A;  3N9E A;  1LSM A;  2ZIK A;  4RLN A;  3RW8 A;  1YKY X;  1GBX A;  2FBB A;  1IP6 A;  5F81 A;  4DDA A;  1AT6 A;  1LSC A;  1F6S A;  2LYO A;  4LYO A;  4WMG A;  4NGW A;  4XYY A;  3WPJ A;  5LVK A;  2YDG A;  5A3E A;  4G4C A;  4GCB A;  3WL2 A;  4WLD A;  2MEC A;  3B0K A;  1IY3 A;  1F6R A;  1LSN A;  5LYT A;  1ALC A;  134L A;  4Z98 A;  6LYZ A;  5LVH A;  2Z18 A;  1HEL A;  5HMJ A;  3TXK A;  4NHP A;  5HNC A;  153L A;  4G4H A;  2HEF A;  1LZR A;  3IJU A;  3QY4 A;  3WW5 A;  1Z55 A;  1BB6 A;  4NGV A;  4DT3 A;  1FLU A;  2YBH A;  2ZNX Y;  2BQM A;  2I26 L;  4KPM A;  3EO5 A;  1GWD A;  1LZB A;  3WMK A;  2HEB A;  3EMS A;  5APF A;  2CDS A;  1GFV A;  1JIS A;  1XFP L;  2HUB A;  1IP4 A;  1OQM A;  3WU8 A;  5L9J A;  3J4G A;  1IO5 A;  1GDW A;  1HF4 A;  4PGJ B;  2DQC Y;  2BQL A;  2BQO A;  5FCP A;  1LYZ A;  4OOO A;  1WVV A;  3AZ5 A;  5I53 A;  2D91 A;  4YEN A;  3P68 A;  1BVK C;  3K3T A;  4WM6 A;  5LVI A;  4KXI A;  1GEV A;  2DKV A;  1GB6 A;  1ZVY B;  2DQE Y;  1IY4 A;  1LYS A;  1CJ7 A;  3TXE A;  4H9E A;  1GF7 A;  4B1A A;  2AUB A;  7LYZ A;  1JIT A;  5B1G A;  1RI8 B;  1DPW A;  1LJN A;  4YEO A;  1V7S A;  1CKD A;  1YKZ X;  1B7N A;  2BQA A;  4CHX A;  5B1F A;  3LZT A;  3VWO A;  2Z12 A;  3CSZ A;  1TBY A;  1LTM A;  5T3F A;  1VDP A;  4OOT A;  3GXR A;  1YAO A;  2Z19 A;  4R6C A;  1LSE A;  3WYH A;  4W94 A;  2XBR A;  2G4Q A;  4I0C A;  1GXX A;  1OUE A;  4W96 A;  3RZ4 A;  1LZ5 A;  1G7M C;  2EPE A;  1B7L A;  3HFM Y;  3TXD A;  3TXJ A;  1QDR A;  1GE0 A;  1NBY C;  4J1B A;  4WL6 A;  3E3D A;  1LZN A;  5I5Q A;  4PJ2 C;  1IVM A;  4H93 A;  1UIC A;  1GBZ A;  2H5Z A;  3RT5 X;  1BGI A;  4H8Z A;  4TX7 A;  1HSW A;  1B7S A;  5E9R A;  3B0O A;  1ZV5 L;  2F30 A;  1BQL Y;  1OUI A;  5APD A;  3WUL A;  4LT0 A;  4CGE A;  5HLL A;  1IR9 A;  1IWU A;  1F0W A;  1TAY A;  5KXN A;  1SQ2 L;  4M4O A;  5FDJ A;  4UWV A;  5KXX A;  2FYC A;  4WM5 A;  1JKD A;  1IOQ A;  3A96 A;  1N4F A;  5DN4 A;  4HTQ A;  2BQJ A;  1GF5 A;  1YKX X;  1B5Y A;  1BB4 A;  4PPO A;  1B7M A;  1DKK A;  2G4P A;  3FI7 A;  1UIF A;  1C45 A;  4X3B A;  1KXX A;  1LZG A;  1LZS A;  1REY A;  1GF0 A;  1IWZ A;  3W6A A;  1AM7 A;  4OWB A;  4N9R A;  1B9O A;  2HEC A;  1GFH A;  4XJH A;  3WPL A;  3TXB A;  5FEK A;  3P64 A;  1UID A;  1IOS A;  2BLY A;  1XGP C;  1LMA A;  3AZ6 A;  1QSW A;  1GDX A;  4RW1 A;  2GV0 A;  4PRQ A;  1G7L C;  3TMW A;  4DWX A;  5A3Z A;  5KXR A;  3WU9 A;  4XN6 A;  1LHI A;  2HEA A;  2D4I A;  1IP1 A;  1LMO A;  1VAT A;  2HTX A;  5I4W A;  1OP9 B;  3A94 A;  3AGG G;  1LJ3 A;  1WQM A;  4UWU A;  1F10 A;  4WLT A;  1QDT A;  4LFX A;  4H9H A;  4CJ2 A;  5I4Y A;  1IP2 A;  4ETE A;  2Z38 A;  3LN2 A;  3WVX A;  5KXT A;  4WM1 A;  5KY1 A;  3CQL A;  3TMU A;  1YIL A;  2F4G A;  1WQQ A;  3ATO A;  1KXY A;  4YF2 A;  1MLC E;  1NDM C;  2Z2F A;  2MEE A;  1JKA A;  4DDB A;  2BQG A;  4YEM A;  1FBI X;  3CB7 A;  4RW2 A;  2Z37 A;  1CJ9 A;  1LSB A;  2A7F A;  2CGI A;  2LZ2 A;  1HEQ A;  1LKR A;  3A90 A;  4NHT A;  1GF3 A;  1YAM A;  4XJF A;  1IP5 A;  1LJG A;  4DDC A;  1LZ4 A;  4B49 A;  1CKF A;  1G7I C;  4IAT A;  3W6E A;  1NDG C;  4GCF A;  3RNX A;  4TSB A;  2W1M A;  4NSJ A;  5APE A;  3A6C Y;  4J7V A;  1B7R A;  4R0F A;  3WUA A;  4HV1 A;  4LZT A;  3A6B Y;  3TXH A;  1JJ3 A;  2MEG A;  4WG1 A;  2Y8P A;  3EBA B;  5L3I A;  3ZVQ B;  4I8S A;  4ET8 A;  4H9F A;  5KXP A;  5M1Y A;  1JUG A;  2BQF A;  1LYO A;  3WVY A;  1B5Z A;  1RFP A;  1UIH A;  4QGZ A;  1KIP C;  2YBJ A;  4OWH A;  3LYZ A;  3T6U A;  1AKI A;  1D0L A;  1W08 A;  1OUG A;  2HED A;  3CT5 A;  5C6J A;  5KXO A;  4ETA A;  4O34 A;  1D9U A;  207L A;  4NHI A;  3WXU A;  5F9X A;  1LHK A;  1UC0 A;  2IHL A;  1GD6 A;  5KXL A;  2BLX A;  5I4X A;  4NSH A;  1YL0 X;  4NGL A;  1LMC A;  4GCD A;  1JTP L;  5LVG A;  1WTM A;  2XBS A;  1BHZ A;  1IOT A;  2YVB A;  5J7C A;  5D5F A;  3B0I A;  1BVX A;  4PHI A;  4E3U A;  1XGT C;  4J1A A;  1NMM A;  2DQH Y;  1LHM A;  1JIY A;  4XJB A;  3WU7 A;  4KL7 A;  4XJD A;  1J1X Y;  1E8L A;  3P66 A;  4WO9 A;  2BQH A;  2BQN A;  1C46 A;  2BPU A;  1LZA A;  1LJE A;  1OUC A;  3BKV A;  1NQI A;  2W1X A;  4DD1 A;  4HTN A;  1G7H C;  1JTO L;  2Q0M X;  3WH1 A;  4N5R A;  5DM9 A;  3D3D A;  1EL1 A;  1LZY A;  3LYO A;  2EIZ C;  3B72 A;  4DD0 A;  1IX0 A;  3A3R X;  4PRU A;  4C3W A;  1LJF A;  3QNG A;  1HEP A;  4P2E A;  2ZYC A;  2D6B A;  1GHL A;  3P65 A;  1KIR C;  1W6Z A;  3OJP A;  3ATN A;  1PZY A;  4YOP A;  1QIO A;  4WM4 A;  5D5C A;  4H1P A;  4J0L A;  4NHS A;  2MED A;  3TMV A;  2F2N A;  5B06 A;  1V7T A;  4WLX A;  3A67 Y;  4ETB A;  3AZ7 A;  1YRO A;  1C43 A;  1LSD A;  4NSG A;  5HMV A;  5F9U A;  1YQV Y;  1GFJ A;  4H92 A;  2H9K A;  5KKI A;  1C08 C;  9LYZ A;  2I25 L;  1VAU A;  1FLW A;  4TSC A;  2WAR A;  1GE2 A;  3WXT A;  1LJI A;  208L A;  1LSY A;  1LZ9 A;  3SP3 A;  4WM2 A;  1YL1 X;  1GF4 A;  2HU3 A;  1AT5 A;  1I56 A;  1QQY A;  1QTE A;  1UBZ A;  3AB6 A;  4GCE A;  1LMN A;  1B0D A;  1LOZ A;  1HSX A;  2DQI Y;  4Z41 A;  1HHL A;  1B7Q A;  1JHL A;  1YIK A;  3AGI A;  1XSF A;  2BQB A;  4B0D A;  1OUA A;  4MST A;  2ZYP A;  2MEA A;  3AYQ A;  4Z3M A;  5DN5 A;  4AXT A;  1O23 A;  1IC5 Y;  4N1C C;  1A2Y C;  1GFG A;  132L A;  1EQE A;  1JTT L;  4HSF A;  3HBE X;  1LJK A;  3OK0 A;  1D6Q A;  3M3U A;  1LSP A;  1UIA A;  3A93 A;  2CJL A;  1QUT A;  1GPQ C;  5DLA A;  1XEJ A;  1XGR C;  1CKH A;  4BAF A;  1LZ6 A;  1OUJ A;  1BB5 A;  2MEH A;  5LVJ A;  4NWE A;  4U3X B;  4LT3 A;  3ULR A;  4B4E A;  194L A;  4H9C A;  1LPI A;  5C6L A;  1LMQ A;  3RU5 A;  3A91 A;  4KT3 A;  1J1O Y;  1OUD A;  4MCK A;  4ET9 A;  4NGK A;  1I1Z A;  2LYM A;  4ETD A;  2X0A A;  4NGZ A;  2W1Y A;  1YAN A;  1HER A;  2G4N A;  4GLA A;  4GLV A;  1B7P A;  1HFZ A;  5ILC A;  5II3 A;  1H6M A;  2ZIJ A;  1B2K A;  1DPX A;  1QTK A;  2H9J A;  3IJV A;  1GFA A;  4C5F A;  1LCN A;  2BAA A;  4DD3 A;  3CT0 A;  2C8P A;  4GCC A;  4LYC A;  1LMP A;  1IOC A;  1KIQ C;  2IFF Y;  2Z39 A;  5KXM A;  3N9C A;  1LJ4 A;  5LAG A;  2D4K A;  5IEL A;  1H87 A;  2VB1 A;  4A7D A;  2BQK A;  1FKV A;  1LHJ A;  3IWR A;  2D4J A;  1NBZ C;  1RJC B;  3N9A A;  4UWN A;  4DC4 A;  1RCM A;  4G4B A;  3CSR A;  2XTH A;  1GAZ A;  4NGO A;  1GBS A;  4GN4 A;  1OUF A;  1IWW A;  1DZB X;  1HEO A;  2A7D A;  1XEI A;  5K7O A;  1HC0 A;  1VFB C;  2EQL A;  5FST A;  1NHE A;  2CWI A;  5KJ9 A;  1HFX A;  1IWX A;  1UAC Y;  5LIO A;  1WQP A;  2LHM A;  4ZIX A;  5LYM A;  1D0M A;  3TXF A;  2DQF C;  3AW7 A;  1JSE A;  4EOF A;  1IIZ A;  1GB8 A;  3WUM A;  5EBH A;  5LIN A;  4Z46 A;  2RSC A;  154L A;  1B5U A;  5HNL A;  1IC4 Y;  1LHH A;  1LZ8 A;  2EKS C;  2LYZ A;  1NWG A;  4NG1 A;  3D9A C;  3F6Z A;  2PC2 A;  3HBD A;  5KXY A;  1QUS A;  1I20 A;  2DQA A;  2DQJ Y;  4LYB A;  5HQ1 A;  4CFO A;  1GBY A;  4H8X A;  5LA8 A;  4XAD A;  1LSA A;  4TUN A;  1DXJ A;  4WOA A;  3WUN A;  1LZC A;  2MEF A;  2C8O A;  8LYZ A;  4H9B A;  1GFK A;  3AZ4 A;  1UUZ C;  2ZWB A;  133L A;  2DQG Y;  1DQJ C;  1PS5 A;  3A34 A;  4H90 A;  4XEN A;  4II8 A;  1DKJ A;  2YSS C;  1UIB A;  1FDL Y;  1OUB A;  1EQ4 A;  1P2C C;  4B4J A;  1LSZ A;  1LKS A;  2YBN A;  5F16 A;  4LGK A;  3T36 A;  2FBD A;  1UCO A;  1YAQ A;  4OWA A;  1QSA A;  1GBO A;  1LSG A;  3HBH A;  5JEN B;  2YBM A;  4NWH A;  1JSF A;  1BB7 A;  1C7P A;  4NSI A;  1IR7 A;  1GB2 A;  4M6D A;  4NEB A;  1T3P A;  1B5W A;  4D9Z A;  1VDS A;  2Z2E A;  1HML A;  1ZMY L;  1FKQ A;  1IEE A;  3A95 A;  1MEL L;  4HV2 A;  4ETC A;  1HEM A;  4MR1 A;  4BAP A;  1REZ A;  3BKH A;  193L A;  1CJ6 A;  1JJ1 A;  1JPO A;  1VDQ A;  3ZEK A;  4CFP A;  3AGH A;  1GB5 A;  2YBI A;  5KXS A;  5KXZ A;  1EQ5 A;  1GFR A;  1HEN A;  3J6K A;  1ZVH L;  1IC7 Y;  4NGI A;  1WQN A;  3LYM A;  1AZF A;  4BS7 A;  5APC A;  1HEW A;  4YM8 A;  1BWH A;  1BWJ A;  4HP0 A;  2XJW A;  4HTK A;  5LAF A;  5LYZ A;  4QDN A;  1NF5 A;  3WW6 A;  5DL9 A;  1INU A;  1WQR A;  1SLY A;  1D6P A;  2I6Z A;  3A3Q A;  6LYT A;  5KKJ A;  4HPE A;  4L41 A;  3EXD A;  1LJJ A;  4HJY A;  1GE3 A;  3M18 B;  2FYD A;  2ZQ3 A;  5F14 A;  3B6L A;  1GE4 A;  1GFE A;  1IR8 A;  1DI3 A;  1GFT A;  1BB3 A;  1HMK A;  1UA6 Y;  3TMX A;  4WLY A;  4EMN A;  5KXW A;  5LXW A;  2F4A A;  1GAY A;  4ZEE A;  2ZNW Y;  1IP3 A;  135L A;  2HU1 A;  1CKG A;  1UIG A;  1WTN A;  5AMY A;  3W6F A;  1RE2 A;  4FDY A;  2MEB A;  4TWS A;  1G7J C;  5IHG A;  4IJ4 A;  2B5Z A;  4LYM A;  2W1L A;  1C10 A;  4DD7 A;  1GE1 A;  3W6B A;  4GN5 C;  1LSF A;  1IWV A;  4G9S A;  3G3A B;  1GEZ A;  1GB3 A;  2HEE A;  5FEL A;  1LZE A;  4H9A A;  1FLQ A;  4NG8 A;  5KXK A;  4LYT A;  1JKC A;  2NWD X;  4OW1 A;  4RLM A;  2MEI A;  5B59 A;  1B5V A;  1JJ0 A;  3CSQ A;  1YAP A;  3LZ2 A;  3QE8 A;  4H91 A;  5IDD A;  5ILF A;  4WO6 A;  4AGA A;  4ANR A;  5C6I A;  4HJZ A;  1CJ8 A;  4OWC A;  4DYG A;  1A4V A;  3WPK A;  1FN5 A;  4DD9 A;  1J1P Y;  5FHW A;  4NGJ A;  1IP7 A;  1HFY A;  1LJH A;  1GF9 A;  3MGW A;  4OWE A;  4QEQ A;  4FJR A;  3AJN A;  1CKC A;  1XGQ C;  3G3B B;  1NKH A;  1REX A;  3LHM A;  1KXW A;  4N0J A;  1GF6 A;  5I54 A;  5E4P A;  1TEW A;  1DI5 A;  1TCY A;  2BQI A;  2BQD A;  4HPI A;  1LZD A;  1OUH A;  4H94 A;  4QY9 A;  5B05 A;  1JWR A;  1WQO A;  4TTD A;  4XJI A;  4ZFP A;  5LA5 A;  4WL7 A;  1GF8 A;  2LZT A;  2DBT A;  4WM3 A;  3P4Z A;  1XGU C;  1FLY A;  1VED A;  2ZIL A;  4LFP A;  3FE0 A;  4B4I A;  4BAD A;  1LZ1 A;  4WG7 A;  1IWY A;  1BWI A;  1VDT A;  1TDY A;  1WVU A;  2BQC A;  3KAM A; 
#chains in the Genus database with same CATH topology
 1HNL A;  2HWJ A;  211L A;  1IN7 A;  4NGY A;  1EIJ A;  164L A;  3A92 A;  4YHH M;  4KT0 F;  1GB0 A;  118L A;  1W5T A;  3FUX A;  3FTE A;  1L23 A;  1LYI A;  1C66 A;  3M7G A;  2XSZ D;  113L A;  4H8Y A;  2R62 A;  1KW7 A;  4ML7 A;  1L82 A;  4BLC A;  1CNS A;  2Q2E B;  3UZU A;  5L3H A;  1GBW A;  3A8Z A;  1L17 A;  5ITX A;  2ZIK A;  4RLN A;  4PD2 A;  1KS3 A;  4DDA A;  1AT6 A;  1L61 A;  2CE7 A;  3UK6 A;  4LYO A;  4WMG A;  3WHL A;  3WPJ A;  1B6I A;  5A3E A;  4W52 A;  1L24 A;  162L A;  4IBJ A;  1F6R A;  1LSN A;  3DMV A;  190L A;  3TWM A;  1OVH A;  5LYT A;  1N78 A;  2Z18 A;  4NHP A;  3V2W A;  2DNA A;  4R7G A;  1Z55 A;  1BB6 A;  4NGV A;  4WUR A;  1AIP C;  2LHG A;  3KP0 E;  2RBS A;  226L A;  4QNM A;  3FUT A;  2B6W A;  2HUB A;  5L9J A;  1JIS A;  1SG9 A;  2BQO A;  5I53 A;  1WGN A;  1X37 A;  3PVS A;  3AZ5 A;  3P68 A;  1BVK C;  1G3I A;  3C82 A;  126L A;  1L01 A;  3G3X A;  4KXI A;  4MGY E;  5DFL A;  1GEV A;  4LDL A;  1R2Z A;  1IY4 A;  3TXE A;  4H9E A;  218L A;  4AG5 A;  4LDE A;  3G3W A;  252L A;  1TTE A;  1QVR A;  5ITQ A;  4DV7 M;  1CU5 A;  1DPW A;  1RI8 B;  1C69 A;  3UON A;  3U61 A;  1B7N A;  4CHX A;  2WSF F;  1TBY A;  1LTM A;  5T3F A;  5H37 D;  1ZYT A;  1IBK M;  2LVQ D;  1GXX A;  4I0C A;  2F5P A;  4EXM A;  3RZ4 A;  220L A;  1G0G A;  3E21 A;  2DXI A;  4J1B A;  2XGN A;  5I5Q A;  2L2D A;  4IJF A;  2ZBK B;  4JI5 M;  1QTZ A;  1IY0 A;  250L A;  4IBC A;  3GUO A;  4H8Z A;  2LVP C;  3B0O A;  2X8A A;  1OIZ A;  5KPZ A;  5APD A;  5JI2 E;  1IR9 A;  4JI4 M;  4LZZ A;  1C6D A;  3HY5 A;  213L A;  3W0L B;  4WM5 A;  1XJU A;  5DN4 A;  3OTO M;  1L57 A;  2KNZ A;  1J7K A;  4I7S A;  3E46 A;  2LVA A;  1LZG A;  1L19 A;  5C18 A;  1AM7 A;  4OWB A;  4N9R A;  1B9O A;  4XJH A;  4PDI A;  151L A;  5FEK A;  3P64 A;  3AZ6 A;  4RW1 A;  1GDX A;  3HJ8 A;  4PRQ A;  5I4W A;  2O79 A;  1MU5 A;  167L A;  4GKJ M;  4UWU A;  2KDL A;  4WLT A;  4H9H A;  1C6B A;  4WM1 A;  3KOZ E;  3TMU A;  1L77 A;  4G4R A;  3VKH A;  2LBC A;  2RKO A;  4IBI A;  2BQG A;  4M0W A;  2LVO C;  4HLQ A;  5IZ7 D;  4LJ8 A;  2CGI A;  4NHT A;  2F5O A;  1VEJ A;  1LJG A;  1SWY A;  1L45 A;  1L56 A;  4B49 A;  1G7I C;  3MMP A;  1NDG C;  2BJW A;  4GCF A;  3RNX A;  1XMO M;  1P3Q Q;  1B7R A;  4R0F A;  2UUA M;  4DUY M;  1G0P A;  4PCZ A;  3SAS A;  4I8S A;  1IXZ A;  1LGU A;  2BWE A;  2Q9E A;  4H9F A;  4ARJ A;  235L A;  4A3V B;  1LYO A;  2BQF A;  3Q8G A;  1B5Z A;  1UIH A;  1Q3C A;  2R44 A;  1KIP C;  3GLG E;  1HQC A;  3CT5 A;  161L A;  5C6J A;  1C6G A;  223L A;  5F9X A;  1LHK A;  1QS5 A;  2IHL A;  2Z8Y M;  5IRE B;  1KSF X;  4CGY B;  4NSH A;  1YL0 X;  4NGL A;  1N32 M;  1LMC A;  4GCD A;  5LVG A;  1ORY B;  1BHZ A;  2YVB A;  3E4R A;  2Z7J A;  1D9W A;  2ZM6 M;  3HHW A;  3WU7 A;  1L03 A;  4W5W A;  2RAZ X;  1E8L A;  3FRI A;  1W5S A;  4D82 A;  3JAM S;  1XNQ M;  2BQH A;  2BQN A;  2BPU A;  1LZA A;  1NQI A;  2JZ1 A;  1CUK A;  5A2Q S;  2W1X A;  1G7H C;  2Q0M X;  5GKN A;  1EL1 A;  4HL4 A;  3T6P A;  3LYO A;  1IX0 A;  209L A;  3A3R X;  4PRU A;  3HU1 A;  2OEA X;  2D7G A;  3QNG A;  4FCV A;  1CV5 A;  4ZPU A;  3GLG A;  3P65 A;  3A46 A;  248L A;  4WM4 A;  1L2B A;  4FCT A;  1ZMU A;  3A67 Y;  3AZ7 A;  1LSD A;  128L A;  4KLN A;  1YQV Y;  262L A;  9LYZ A;  3J7B A;  1L29 A;  3HDF A;  2MGW A;  2BJV A;  208L A;  4WM2 A;  1YL1 X;  1QTE A;  3JR4 A;  5FTK A;  3GLI B;  1L63 A;  3FRH A;  2DQI Y;  1HHL A;  2DWM A;  1JHL A;  1YIK A;  1XSF A;  4B0D A;  2KZU A;  257L A;  1O23 A;  1GFG A;  132L A;  1JTT L;  3HBE X;  1D6Q A;  1L69 A;  3V76 A;  3DN3 A;  3CDT A;  2CJL A;  1GPQ C;  4BAF A;  4LFB M;  2MEH A;  4LT3 A;  194L A;  4H9C A;  1L97 A;  1LPI A;  4K0K M;  3J27 B;  4KT3 A;  3C8R A;  5LZM A;  1JQJ C;  1C64 A;  1SXJ D;  1L04 A;  2G4N A;  1B7P A;  1HFZ A;  1B2K A;  2H9J A;  4B3T M;  3IJV A;  1L92 A;  1LCN A;  3U6C A;  1SXJ C;  1FNN A;  3C81 A;  2D4K A;  1LHJ A;  3FYD A;  3GUL A;  5C1B A;  2Y21 A;  4DV2 M;  4MGK E;  3JR5 A;  1CU0 A;  5DYG A;  1GAZ A;  1CU3 A;  1IWW A;  1DZB X;  2A5Y B;  3L26 A;  1NHE A;  2Z6B A;  1XHB A;  2CWI A;  3SB6 A;  5LIO A;  1NNJ A;  3HTD A;  1C6N A;  3GRY A;  4AW4 A;  1D0M A;  3TXF A;  2FE8 A;  4NC6 A;  3WUM A;  4LRS A;  4EKQ A;  4Z46 A;  1PJT A;  3DA1 A;  1LHH A;  2MR9 A;  3PNY A;  1I20 A;  2DQA A;  2NTH A;  4CIZ A;  5LA8 A;  4XAD A;  1LSA A;  1TH2 A;  4TUN A;  4WOA A;  1L83 A;  4LJ6 A;  1LWG A;  1TF0 B;  2DQG Y;  4H90 A;  2DI0 A;  239L A;  2O25 A;  4II8 A;  1UIB A;  1OUB A;  1EQ4 A;  1P2C C;  3VKG A;  1LKS A;  2QB0 B;  3HTF A;  1P7S A;  4IBK A;  3GPX A;  2YBM A;  4NWH A;  2R6F A;  1BB7 A;  1CV0 A;  206L A;  4DR5 M;  4NEB A;  1T3P A;  1B5W A;  2Z2E A;  2XZF A;  1ZMY L;  4HV2 A;  1HEM A;  1LI2 A;  3BKH A;  155L A;  4E97 A;  3H4J A;  4LJ5 A;  3AGH A;  5KXS A;  5KXZ A;  2CRU A;  2VQE M;  3L2A A;  2OO9 A;  3J6K A;  2QSF X;  1L59 A;  1WQN A;  4BS7 A;  5APC A;  1HEW A;  1BWH A;  5EQT A;  4HP0 A;  2OE4 X;  2KRK A;  5EJC A;  4BBA A;  1INU A;  1WQR A;  1OVJ A;  2I6Z A;  196L A;  1V92 A;  2QBY B;  1G4A E;  1VEK A;  3EXD A;  1GE3 A;  2V6Z M;  1DYB A;  2FYD A;  1GFE A;  3VK7 A;  1UA6 Y;  1HMK A;  1BB3 A;  4WLY A;  1DGH A;  4ZEE A;  5LMU M;  1IP3 A;  2JY5 A;  4FWG A;  1L67 A;  4DV4 M;  4TWS A;  238L A;  3CDV A;  4LYM A;  1C10 A;  1L1T A;  4LZM A;  4I4L A;  2RBP A;  3KVW A;  1JR3 E;  3SB9 A;  4GHL A;  1L73 A;  1FLQ A;  166L A;  2OTY X;  3IG8 A;  3QE8 A;  3CSQ A;  1YAP A;  1L68 A;  5ILF A;  221L A;  1ZWN A;  2QCU A;  4OWC A;  1A4V A;  1QTB A;  4ITQ A;  2WSC F;  4B7H A;  3KSJ A;  2N35 A;  1QAO A;  4OWE A;  3THG A;  1XGQ C;  2R46 A;  210L A;  1GF6 A;  1GKI A;  2VQF M;  3HT9 A;  5I54 A;  2BQD A;  4QY9 A;  3B7Z A;  4XJI A;  4TTD A;  2DBT A;  1TH3 A;  1L93 A;  5IWA M;  1VED A;  1K82 A;  4WG7 A;  4LJA A;  1KFV A;  2KZS A;  3GQ4 A;  1G0M A;  4QHT A;  3KAM A;  4IAS A;  2R45 A;  3KXE C;  173L A;  3TXG A;  2BQE A;  3HT8 A;  4XJG A;  3GUN A;  1EFU B;  1LHL A;  1XEK A;  4R3D A;  172L A;  4P17 A;  2FH0 A;  3K1J A;  1TGU A;  1B5X A;  2RBN A;  4RNA A;  2YNM D;  1D0K A;  4XBO A;  3W6C A;  3T15 A;  3J80 S;  1LZT A;  2HAK A;  1P5C A;  1T8F A;  4DD2 A;  1UFZ A;  3C8S A;  1ZMV A;  4NFV A;  4H9I A;  3L25 A;  1GXV 2;  200L A;  3HHX A;  3AFH A;  1D3N A;  3LYT A;  3TXI A;  1LAA A;  1N75 A;  4UN2 B;  3GXK A;  137L A;  2DHY A;  3VDU A;  1IWT A;  1CX6 A;  1C6M A;  1JEF A;  4EKS A;  2RBR A;  3H4M A;  3SBB C;  3VDP A;  1YKY X;  4I7P A;  2NQ8 C;  4B08 A;  1LSC A;  140L A;  1F6S A;  4NRV A;  3CDR A;  4I8O A;  1L0J A;  5LVK A;  147L A;  2YDG A;  4GCB A;  3WL2 A;  4YY3 M;  4B7F A;  2QQ8 A;  1XMQ M;  2UU9 M;  1ALC A;  1WXQ A;  2B7X A;  4Z98 A;  6LYZ A;  1HEL A;  3TXK A;  3SHF A;  5HNC A;  3QWL A;  3SHG B;  4G4H A;  3QY4 A;  2KA6 B;  3AOE A;  4LRT A;  4DT3 A;  2CHQ A;  1HR0 M;  1I94 M;  2I26 L;  1L22 A;  1L00 A;  3EMS A;  2CDS A;  3WU8 A;  1OIP A;  5KQD A;  1IP4 A;  1OQM A;  3J4G A;  1HF4 A;  4GH9 A;  240L A;  3UJN A;  2Y0T A;  1G59 A;  1LYZ A;  1IXS A;  4OOO A;  2D91 A;  4OU7 A;  1G41 A;  1HNZ M;  1SWZ A;  2DKV A;  3HJQ A;  3U60 B;  1ZVY B;  2DQE Y;  1CJ7 A;  2QZ4 A;  4IIW A;  1L42 A;  3J81 S;  3A98 B;  4LF8 M;  4DR1 M;  1QS9 A;  1L28 A;  1YKZ X;  4K5Y A;  2HUL A;  5I14 A;  3U5Z B;  4I7O A;  2Z19 A;  1LSE A;  199L A;  1L26 A;  2XBR A;  4W94 A;  1OUE A;  4W96 A;  1G7M C;  2EPE A;  1VQ1 A;  1OQY A;  1L32 A;  3HFM Y;  3TXD A;  1GE0 A;  1NBY C;  2KEB A;  3SBJ A;  3E3D A;  1QAQ A;  159L A;  3SB7 A;  4DV3 M;  4DKL A;  3RT5 X;  4TX7 A;  1L8Q A;  2MH8 A;  3L29 A;  1ZV5 L;  4DV0 M;  1IN6 A;  1L72 A;  2OE7 X;  4LT0 A;  4CGE A;  5HLL A;  1C65 A;  5KXN A;  1RU3 A;  4M4O A;  2FYC A;  2RBQ A;  216L A;  1QT4 A;  1JKD A;  1IOQ A;  3A96 A;  1N4F A;  1L2D A;  2BQJ A;  4JYA M;  1REY A;  1IWZ A;  244L A;  120L A;  4EIW A;  3R9X B;  1T8A A;  3WPL A;  1ZUR A;  1IY1 A;  3KOY E;  1IM2 A;  1LMA A;  5DYI A;  5A3Z A;  1NY6 A;  3KS4 A;  4W56 A;  4XN6 A;  3LCV B;  1LHI A;  2C9C A;  4LY6 A;  4Y28 F;  1OP9 B;  3AGG G;  1LJ3 A;  3PDS A;  253L A;  2KXE A;  1WQM A;  1F10 A;  2LCB A;  4CIS A;  1JB0 F;  2Z38 A;  3WVX A;  5KY1 A;  3M6A A;  1YIL A;  2F4G A;  2M60 A;  1L05 A;  4YF2 A;  1NDM C;  1R2Y A;  2MEE A;  1L75 A;  175L A;  4YEM A;  3CB7 A;  5EP4 A;  3RFW A;  1CUQ A;  2A7F A;  2LZ2 A;  1LKR A;  4XJF A;  3HWL A;  201L A;  1CKF A;  1L58 A;  4EPI A;  3W0F A;  4LF4 M;  1G06 A;  1KY1 A;  4NSJ A;  3A6C Y;  3AJI B;  3A6B Y;  1JJ3 A;  2Y8P A;  5EXX A;  1JQU A;  5L3I A;  3L27 A;  4LF5 M;  5KXP A;  5M1Y A;  3WVY A;  229L A;  3KFU G;  4QGZ A;  3KW6 A;  4F2L A;  5KXO A;  4ETA A;  4O34 A;  3F92 A;  1WIV A;  1D9U A;  1XC8 A;  3ZC7 B;  1L99 A;  5KXL A;  3KOX E;  4FVM A;  1C6A A;  2DZN B;  2XBS A;  5J7C A;  3B0I A;  4GIP A;  2C96 A;  1H6U A;  5F3W A;  2FOI C;  3MJ5 A;  1L15 A;  4LZJ A;  1JIY A;  1LHM A;  4KL7 A;  4XJD A;  4GKK M;  1C46 A;  4X65 M;  5ITR A;  2QP9 X;  3WH1 A;  1QZE A;  4N5R A;  3GUP A;  141L A;  1CV1 A;  1L10 A;  1LZY A;  2DAE A;  1LJF A;  1D2Y A;  2ZYC A;  2LH0 A;  1GHL A;  3B9P A;  1QSQ A;  1HQY E;  3FTC A;  3FUV A;  4H1P A;  4J0L A;  2F2N A;  4XGI A;  4OW0 A;  4LCB A;  1V7T A;  188L A;  4NSG A;  1L06 A;  3U61 B;  5F9U A;  4I7T A;  2H9K A;  4EPF A;  5KKI A;  2I25 L;  1OWY A;  2B70 A;  4P16 A;  3WXT A;  3BBZ A;  1LSY A;  1D3J A;  1GF4 A;  4JXJ A;  1QQY A;  176L A;  1LGW A;  241L A;  3HJS A;  4GCE A;  1LOZ A;  3GLH E;  1HSX A;  1LI3 A;  1B7Q A;  3AGI A;  2BQB A;  1OUA A;  4OX9 M;  2MEA A;  3FE3 A;  3FYC A;  2B6X A;  5DN5 A;  2VDB B;  1EQE A;  2XFS A;  2OU8 A;  1UIA A;  3A93 A;  1QUT A;  1XEJ A;  1DYG A;  258L A;  1LZ6 A;  5LVJ A;  5EP3 A;  1L60 A;  4NWE A;  3SC3 A;  3WHK A;  4U3X B;  4L15 A;  4FCW A;  3KOW E;  4I81 A;  1L54 A;  3A91 A;  1J1O Y;  3SBA A;  2X0A A;  1HER A;  4GLA A;  4GLV A;  1L18 A;  4FW9 A;  1H6M A;  1DPX A;  1L96 A;  1QTK A;  4C5F A;  2BAA A;  3CT0 A;  4GCC A;  1WHC A;  4AKI A;  4LYC A;  245L A;  2Z39 A;  2DEN A;  3GPP A;  5FTM A;  1LJ4 A;  1OV5 A;  5LAG A;  4A7D A;  3GLH A;  2BQK A;  4II7 A;  3IWR A;  1XWI A;  5ITY A;  1RJC B;  1RCM A;  1C6L A;  217L A;  2XLJ A;  4JI6 M;  1MN3 A;  4GN4 A;  1L09 A;  1L52 A;  1HEO A;  3C7Y A;  1L95 A;  1FJG M;  2DVW B;  143L A;  2DKL A;  231L A;  1XEI A;  4I7R A;  1SX2 A;  3OE9 A;  5FST A;  1Y8G A;  2JA2 A;  4AZF A;  1IWX A;  5EXS A;  1PJJ A;  2LVN C;  4G6Z A;  5LYM A;  4ARM A;  4ZIX A;  1CV4 A;  3DN6 A;  3AW7 A;  1JSE A;  2Z3X A;  233L A;  1YLA A;  2RSC A;  154L A;  3KSX A;  2NTG A;  5HNL A;  1LZ8 A;  1QUO A;  237L A;  3F6Z A;  5E26 A;  4JV5 M;  4DAJ A;  1LYE A;  1VG5 A;  4LYB A;  3KS8 A;  4H8X A;  4LFA M;  2O5R A;  1LZC A;  1OJL A;  2OTZ X;  2C8O A;  2C99 A;  197L A;  2Y0Q A;  3U6P A;  1UUZ C;  2UXD M;  2ZWB A;  4M9S A;  1QT8 A;  1DQJ C;  2QPA A;  2YSS C;  1OAI A;  4FD2 A;  2EKK A;  130L A;  3T36 A;  1C60 A;  4OWA A;  1R4G A;  8CAT A;  107L A;  1L37 A;  1Z5B A;  1GVN A;  4OVZ A;  5BPV A;  1VDS A;  3GP1 A;  109L A;  1SSW A;  1MEL L;  1QAN A;  4ETC A;  4BAP A;  4MR1 A;  1REZ A;  193L A;  1CJ6 A;  1VDQ A;  1GL6 A;  1LV7 A;  4CFP A;  1C7Y A;  3QAK A;  1EQ5 A;  1GFR A;  1QTC A;  4DQ5 A;  1L81 A;  4CHT B;  3LYM A;  2YQZ A;  3GPY A;  5L8R F;  2DAG A;  1WGL A;  5KO3 A;  3GLG B;  2JXN A;  5LAF A;  5LYZ A;  1WJ7 A;  3QYE A;  1YUB A;  1IFY A;  5IT9 S;  4HEO A;  5DL9 A;  1L20 A;  1JR3 D;  5FLX S;  1D6P A;  3ILK A;  180L A;  4MGI E;  183L A;  3DOA A;  3HTB A;  1T6O A;  4HJY A;  259L A;  1GE4 A;  3TMX A;  1DI3 A;  2XSZ A;  2RAY X;  2R4E A;  243L A;  2HU1 A;  3RGP A;  1CKG A;  1UIG A;  5AMY A;  1D2N A;  1XXH E;  1TLA A;  165L A;  2B5Z A;  3C7Z A;  2APL A;  3W6B A;  4G9S A;  1GEZ A;  1GB3 A;  1L07 A;  2UUB M;  1PJI A;  4G3O A;  1JKC A;  2RB1 X;  3LVW A;  4RLM A;  2MEI A;  3CDO A;  2FS1 A;  1J5E M;  1L14 A;  5C6I A;  4HJZ A;  1CJ8 A;  2DHR A;  3MK6 A;  3GPU A;  234L A;  1FN5 A;  1DGF A;  1J1P Y;  157L A;  1L94 A;  1L51 A;  3MGW A;  1GF9 A;  4DR6 M;  3AJN A;  3LHM A;  4N0J A;  1NKH A;  1KXW A;  215L A;  3SB5 A;  2L6O A;  5B05 A;  1LZD A;  1OUH A;  4GIT A;  4H94 A;  1L11 A;  3B7N A;  2LZT A;  2ANX A;  4CJ6 A;  1PQM A;  2X49 A;  4NXN M;  1F4I A;  3NY9 A;  2K6B A;  1XXH A;  4KHP M;  1FLY A;  4YXC A;  1DGB A;  3C7W A;  4BAD A;  4WW0 A;  1LZ1 A;  1L38 A;  2P5T A;  4NSO B;  1C6H A;  2Q9D A;  3RZE A;  4EKR A;  3HT7 A;  2BQC A;  3W6D A;  4LYZ A;  1B7O A;  1REM A;  4NY5 A;  3HX3 A;  1GFU A;  5B07 A;  5KQ8 A;  3AW6 A;  2YBL A;  3W3E A;  4ARP A;  4KO8 A;  4GN3 A;  2Y20 A;  1LYY A;  4LT1 A;  3DZD A;  4LT2 A;  3NYA A;  3SAU A;  1DI4 A;  4N8Z A;  4NIJ A;  4NHQ A;  191L A;  3HU3 A;  1DV0 A;  2EJS A;  4ZPX A;  4RDS A;  1E32 A;  1LMT A;  3NBI A;  4N1E I;  3ZVQ A;  4DJH A;  2N5Z A;  3DFZ A;  4FWD A;  2G5G X;  4MB7 A;  1L98 A;  1L53 A;  1LSM A;  3RW8 A;  4M9Z A;  1GBX A;  1IP6 A;  2HUK A;  1LGX A;  2LYO A;  4NGW A;  1ZQ9 A;  187L A;  2R18 A;  1NV8 A;  3G3V A;  4G4C A;  1QT7 A;  3AKZ A;  1R5L A;  1IY3 A;  2CEA A;  134L A;  3K2L A;  247L A;  5HMJ A;  3DMZ A;  1NHW C;  3KDS E;  153L A;  1LZR A;  4EJ4 A;  3C3D A;  2ZNX Y;  1L12 A;  2CHG A;  2K9D A;  1LZB A;  3WMK A;  3SAT A;  3TWK A;  3U6O A;  2HEB A;  4B7G A;  2QAR C;  5APF A;  1D2W A;  2DZO B;  2DQC Y;  152L A;  2QEN A;  4YEN A;  2UUC M;  3FTD A;  3K3T A;  2GNO A;  1G07 A;  1GJT A;  3HUQ A;  5KPT A;  1IY2 A;  2YFQ A;  1YSY A;  145L A;  1LYS A;  1IXR C;  3HT6 A;  7LYZ A;  1JIT A;  256L A;  236L A;  3AL0 C;  3LVV A;  4D80 A;  1CKD A;  3LZT A;  2Z12 A;  1G0K A;  3CSZ A;  2RH1 A;  4R6C A;  138L A;  5FTL A;  1YAO A;  3WYH A;  1DGH B;  4IBE A;  4GBR B;  2X4A A;  1LZ5 A;  1B7L A;  1QDR A;  2B6Z A;  3U6S A;  3K2R A;  1UIC A;  1GBZ A;  1GL7 A;  2ZAM A;  3I4V A;  184L A;  4ARL A;  1HSW A;  4REZ A;  1Q39 A;  3WUL A;  1PQO A;  4GHA A;  1L65 A;  1IWU A;  1TAY A;  2KHH A;  4QOS A;  1SQ2 L;  4L4U A;  5KXX A;  1XB2 B;  2R4J A;  2O01 F;  110L A;  4Z6Y A;  260L A;  2Z4R A;  1DO0 A;  4GRV A;  4HTQ A;  4AQY M;  3TQS A;  1YKX X;  4PJZ A;  1B5Y A;  1C6P A;  2G4P A;  2RGH A;  3FI7 A;  1C45 A;  1KXX A;  3PNV A;  1LZS A;  1GF0 A;  4DR4 M;  3W6A A;  144L A;  2HEC A;  1GFH A;  3F9L A;  1UID A;  2BLY A;  3B7Q A;  1QUG A;  1QSW A;  5KXR A;  1KYI A;  2GV0 A;  3TMW A;  3C8Q A;  4I7N A;  4EKP A;  3AOG A;  2D4I A;  3R8F A;  3I51 A;  1VAT A;  1MJG M;  1L84 A;  3A94 A;  2RB0 X;  3AV0 A;  3OE6 A;  3U6Q A;  1PM5 A;  4WP2 A;  4LFX A;  5I4Y A;  3T1Y M;  1IP2 A;  4ETE A;  2JP7 A;  4I7L A;  1WQQ A;  1L64 A;  171L A;  1L36 A;  3SAR A;  1MLC E;  1C6K A;  3GQ3 A;  1NJG A;  4IBG A;  1SXJ E;  1VDD A;  3FUU A;  1VDL A;  1LSB A;  1S3S A;  3A90 A;  1GF3 A;  4DDC A;  3HUA A;  2B73 A;  4GMQ A;  4IBF A;  1LZ4 A;  2JY8 A;  4IAT A;  1L34 A;  4ARQ A;  3W6E A;  182L A;  123L A;  4TSB A;  2W1M A;  4W59 A;  4J7V A;  5LXW A;  2F4V M;  2MEG A;  6LZM A;  3GLF E;  2LXE A;  129L A;  1V34 A;  1TR8 A;  1L70 A;  4ET8 A;  3HUK A;  2IGC A;  1N33 M;  3PXG A;  1RFP A;  1NVM A;  4F1I A;  1W08 A;  1D0L A;  219L A;  2HED A;  1DYA A;  4LF9 M;  3ODU A;  4NHI A;  4LG2 A;  1UC0 A;  3K8Z A;  4NOO B;  1GD6 A;  2BLX A;  2VF7 A;  2C9O A;  4LJ7 A;  4IJE A;  1JTP L;  1WTM A;  160L A;  4I7Q A;  4RF0 A;  1CTW A;  1BVX A;  4PHI A;  4LGM A;  1G0L A;  3FA0 A;  4E3U A;  4J1A A;  2DQH Y;  1SXJ A;  4W55 A;  1XNR M;  4AQN A;  3U6L A;  4RKU F;  4DUZ M;  4XJB A;  3IEC A;  2L7H A;  3B89 A;  1E9S A;  2HL7 A;  1J1X Y;  3P66 A;  4WO9 A;  2FNA A;  1OFH A;  1OUC A;  3BKV A;  4M0D A;  4HTN A;  1DGG A;  1JTO L;  3HZJ A;  5DM9 A;  102L A;  1L33 A;  1TDZ A;  1IXS B;  2OU9 A;  108L A;  3GLF A;  1L39 A;  2HUM A;  4OO9 A;  1L90 A;  3B72 A;  4JI8 M;  158L A;  3W67 A;  4P2E A;  1L40 A;  2D6B A;  2MRO B;  3GLF B;  1KIR C;  3OJP A;  1KNI A;  3ATN A;  1PZY A;  4YOP A;  1QIO A;  2CWB A;  4NHS A;  4ETB A;  3ZCB B;  4WLX A;  1L50 A;  3HHY A;  3OE8 A;  1C08 C;  3CF0 A;  1VAU A;  4TSC A;  1GE2 A;  2D7E A;  1LJI A;  3SP3 A;  1AT5 A;  2L4E A;  1I56 A;  1UBZ A;  3SMP A;  3DMX A;  4DQ7 A;  4Z41 A;  2V1U A;  3GUJ A;  2ZYP A;  3AYQ A;  4Z3M A;  4JI7 M;  1NV9 A;  1IC5 Y;  4N1C C;  4I7K A;  4HSF A;  3OK0 A;  1G1V A;  4S12 A;  3VFD A;  5DLA A;  1OV7 A;  1CKH A;  1XGR C;  3EIE A;  2K0B X;  1P3N A;  1OUJ A;  2EUC A;  1BB5 A;  1ZAE A;  1P6Y A;  3ULR A;  4B4E A;  1LMQ A;  1IN5 A;  2EKF A;  1PQD A;  2ZTD A;  2F5Q A;  1Q3B A;  2F47 A;  4MCK A;  3FKE A;  4ET9 A;  4NGK A;  1I1Z A;  1NHG C;  2LYM A;  4ETD A;  4DR2 M;  2W1Y A;  3HKP A;  1YAN A;  2XFT A;  1QAM A;  4JI2 M;  1G0J A;  1L66 A;  4L16 A;  1L49 A;  2JWS A;  3I01 M;  114L A;  2ZAN A;  4DD3 A;  2C8P A;  3KP1 E;  1L41 A;  4DR7 M;  1LMP A;  1IOC A;  174L A;  5LMN M;  3N9C A;  139L A;  1D3F A;  1QUD A;  1FKV A;  2DAM A;  2D4J A;  3N9A A;  1DO2 A;  4UWN A;  1KY0 A;  4DC4 A;  1XJT A;  4G4B A;  2B3T A;  3CSR A;  1PRB A;  2RB2 X;  2XTH A;  1MX0 A;  3HH6 A;  3W68 A;  1GBS A;  1OYU A;  2BWB A;  2J7O A;  1C6F A;  3GUM A;  4KOD A;  1L62 A;  2EQL A;  4LF7 M;  3ZQJ A;  1L46 A;  131L A;  5KJ9 A;  3CTW B;  1OFI A;  4DR3 M;  1L2C A;  3SMS A;  4EOF A;  1IIZ A;  1GB8 A;  2O7A A;  4W51 A;  4JI1 M;  4JI0 M;  4Q7J A;  1IC4 Y;  2EKS C;  5KXY A;  2LYZ A;  3D9A C;  1QUS A;  5HQ1 A;  4CFO A;  2EO2 A;  5EP2 A;  1N36 M;  3WUN A;  115L A;  2MEF A;  4H9B A;  195L A;  2CP8 A;  3AZ4 A;  133L A;  1T43 A;  2B72 A;  3A34 A;  2GQF A;  1FDL Y;  4B4J A;  2KNA A;  1LSZ A;  2YBN A;  1QTD A;  1CU2 A;  2LNH C;  4LGK A;  2ZAO A;  1L71 A;  1UCO A;  2FBD A;  1C68 A;  5JEN B;  4X62 M;  1PQK A;  4G4O A;  2ZTC A;  4W58 A;  4Z8X A;  1C7P A;  4NSI A;  1GB2 A;  2M5Z A;  4M6D A;  4W54 A;  4D9Z A;  156L A;  4DV5 M;  1FKQ A;  3C80 A;  3A95 A;  142L A;  4G4Q A;  1JPO A;  2VII A;  2OOA A;  227L A;  2H5X A;  4QHS A;  181L A;  4R71 A;  1L76 A;  2B6Y A;  3Q8X A;  2CUZ A;  2JUJ A;  4YM8 A;  2KNV A;  1HJP A;  1EE8 A;  1GAB A;  1CX7 A;  1ZMW A;  2V1C A;  3QAU A;  1L27 A;  2HCB A;  1T3T A;  6LYT A;  3SN6 R;  1LJJ A;  3M18 B;  3B6L A;  1IR8 A;  3DN0 A;  4EMN A;  2XQO A;  2F4A A;  1GAY A;  2ZNW Y;  3FAD A;  5EXT A;  135L A;  2RBO A;  4IAP A;  1WTN A;  3W6F A;  2I7P A;  5IHG A;  3HDE A;  1LYD A;  3L28 A;  2W1L A;  4DD7 A;  1IBM M;  1QT5 A;  4GN5 C;  4X64 M;  1LSF A;  1Z5C A;  1NSF A;  2OU0 X;  2L7I A;  5FEL A;  5KXK A;  1CVK A;  3DN8 A;  4PT5 A;  4LYT A;  2MJ5 B;  2NWD X;  2L09 A;  5B59 A;  149L A;  4ANR A;  4DYG A;  1L21 A;  3WPK A;  4DD9 A;  3LCU A;  3U6D A;  4NGJ A;  4QEQ A;  146L A;  1N34 M;  4FJR A;  3G3B B;  3CF6 E;  5E4P A;  5FTN A;  1JWR A;  1WQO A;  1LPY A;  1C6Q A;  1GF8 A;  3CGW A;  1N77 A;  1IBL M;  4WM3 A;  4LJ4 A;  3GLH B;  3J2P B;  1CV6 A;  3HH5 A;  1G71 A;  1IWY A;  1KW5 A;  3HHZ A;  2L78 A;  1WVU A;  4HJV A;  1GB7 A;  1GB9 A;  1T6V L;  2ZQ4 A;  2CV1 A;  2KRU A;  2K47 A;  4DV6 M;  1JKB A;  3RE8 A;  2C98 A;  1C62 A;  1L16 A;  1L25 A;  3K9P A;  3RGS A;  2XEP A;  3HH4 A;  2L4F A;  4ARM B;  3HU9 A;  2DQD Y;  249L A;  3IHP A;  1IN8 A;  1L30 A;  1CU6 A;  3DKE X;  4TUW A;  3F8V A;  3PFI A;  1IOR A;  4G49 A;  3CT1 A;  2R65 A;  1UIE A;  3LQQ A;  2DWL A;  1L1Z A;  3D8B A;  5DNY A;  1C63 A;  1L74 A;  1P56 A;  1P2L A;  3N9E A;  1C6J A;  3C83 A;  2HHH M;  2FBB A;  5F81 A;  1DYE A;  4MM3 B;  3MHV C;  4JI3 M;  163L A;  4XYY A;  170L A;  3LQR A;  1YE9 A;  4GEW A;  4RF1 A;  2XZU A;  4LFC M;  3VLF B;  1AUA A;  4WLD A;  2MEC A;  3B0K A;  3CF2 A;  127L A;  5LVH A;  3UMM A;  3GLI E;  2HEF A;  4OVZ B;  103L A;  3IJU A;  3WW5 A;  1P37 A;  1FLU A;  3K9O A;  2YBH A;  2BQM A;  5KPR A;  4KPM A;  3EO5 A;  1GWD A;  1T8G A;  1GFV A;  1L02 A;  1XFP L;  3I04 M;  1IO5 A;  1GDW A;  4PGJ B;  1G8P A;  1WR1 B;  2BQL A;  5FCP A;  3FD9 A;  1WVV A;  5FTJ A;  1C6I A;  4L8R C;  4WM6 A;  5LVI A;  104L A;  1L13 A;  2ERC A;  1GB6 A;  1GF7 A;  2VF8 A;  4B1A A;  2AUB A;  4D81 A;  1C1K A;  212L A;  4W53 A;  5B1G A;  2I7N A;  1T6H A;  177L A;  1LJN A;  4YEO A;  3BOS A;  1V7S A;  1XEP A;  2BQA A;  3C3E A;  5B1F A;  1L89 A;  3VWO A;  1PJQ A;  192L A;  4I7M A;  1VDP A;  4GC5 A;  3GXR A;  4OOT A;  3TPZ A;  251L A;  2G4Q A;  3C58 A;  2J7N A;  2CUU A;  3TXJ A;  1G0Q A;  1L79 A;  3GLI A;  3SYK A;  4W57 A;  4WL6 A;  1QSB A;  1LZN A;  5FSW A;  4PJ2 C;  2F32 A;  1IVM A;  4H93 A;  4GRI A;  2H5Z A;  1BGI A;  1B7S A;  1L44 A;  1LYH A;  5E9R A;  2F30 A;  1K3W A;  1BQL Y;  1OUI A;  3L2X A;  3CDQ A;  1F0W A;  148L E;  1L87 A;  3QYB A;  1NHB A;  4UWV A;  5FDJ A;  1QQW A;  1A5T A;  4YXA C;  3DNA A;  1GF5 A;  1JTN A;  3GRU A;  1BB4 A;  4PPO A;  1B7M A;  1DKK A;  3IG5 A;  4IBD A;  1UIF A;  4X3B A;  4MGZ E;  3ZH9 B;  185L A;  3TXB A;  2CV0 A;  1IOS A;  3NWL A;  1I6S A;  1C6E A;  1XGP C;  4AKH A;  1G7L C;  186L A;  3RUN A;  4DWX A;  2DAK A;  1Q02 A;  3AOE C;  1LYF A;  3WU9 A;  2HEA A;  1XXH B;  1IP1 A;  1LMO A;  2HTX A;  4QOZ C;  1IN4 A;  4L78 A;  3SB8 A;  3D8L A;  3VK8 A;  1QDT A;  4CJ2 A;  189L A;  2LWX A;  1L91 A;  3LN2 A;  5KXT A;  3CQL A;  1NNU C;  2J5Y A;  3ATO A;  222L A;  1GO5 A;  1L85 A;  1KXY A;  3GUK A;  2Z2F A;  1JKA A;  4DDB A;  1L86 A;  242L A;  1OVK A;  4IBB A;  1Z5A A;  1FBI X;  4NRW A;  4RW2 A;  2Z37 A;  1CJ9 A;  1DYF A;  4NL4 H;  1ZV1 A;  4AKG A;  1HEQ A;  2LHC A;  3JR6 A;  3OE0 A;  1YAM A;  1IP5 A;  1R6B X;  5APE A;  2R0I A;  3WUA A;  1PJS A;  4HV1 A;  4LZT A;  2XH9 A;  1L80 A;  225L A;  4WG1 A;  3TXH A;  3EBA B;  4BB9 A;  3ZVQ B;  4DBG B;  1JUG A;  2C5R A;  1C67 A;  4PDG A;  1LLH A;  1WTH A;  2YBJ A;  169L A;  112L A;  3LYZ A;  4OWH A;  2WSE F;  1AKI A;  1BVS A;  3T6U A;  1OUG A;  1K3X A;  1NY5 A;  3TL4 X;  1PQI A;  3WXU A;  207L A;  3UGJ A;  3DN4 A;  5I4X A;  2QNJ A;  2ANV A;  3HWS A;  1IOT A;  5D5F A;  1NJF A;  4XK8 F;  214L A;  4PK0 A;  2OQ4 A;  3J7A S;  1XGT C;  1NMM A;  1LW9 A;  3T1H M;  1SSY A;  2DWZ B;  122L A;  3GUI A;  1DYD A;  4QNR A;  2Z4S A;  2A4T A;  1LJE A;  4YX7 C;  1HT1 E;  1PGY A;  4DD1 A;  3D3D A;  3EML A;  1E94 E;  198L A;  2LZM A;  3BXW A;  2EIZ C;  4LDO A;  1C6T A;  4DD0 A;  4C3W A;  4M9X A;  2LC9 A;  1HEP A;  3HTG A;  5BR8 M;  2AHM A;  1W6Z A;  2EA0 A;  1QTH A;  5D5C A;  2XF3 A;  3TMV A;  3DN2 A;  2MED A;  1GLN A;  2HKJ A;  3FUW A;  5B06 A;  1YRO A;  1C43 A;  1NO1 A;  5HMV A;  4GC9 A;  1GFJ A;  4H92 A;  2QBY A;  1FLW A;  2RGO A;  1C6C A;  1T97 A;  2WAR A;  1LZ9 A;  1C61 A;  230L A;  1IQP A;  3GQ5 A;  2HU3 A;  2B74 A;  224L A;  3HU8 A;  2DZL A;  4MGH A;  3AB6 A;  1LMN A;  1B0D A;  3NY8 A;  1HT2 E;  4S0W A;  5E6J A;  4MST A;  3NBX X;  1G1W A;  1VEG A;  1P46 A;  1GJS A;  2CFO A;  4AXT A;  1A2Y C;  205L A;  1LJK A;  1UM8 A;  3M3U A;  2JNH A;  1LSP A;  4JN6 A;  1LI6 A;  2YR0 A;  4FWH A;  1LWK A;  4B3M M;  4DV1 M;  1EPY A;  1I4W A;  4B3S M;  5C6L A;  3RU5 A;  1HNX M;  1OUD A;  3FI5 A;  1OKS A;  1OTR A;  4LJ9 A;  4NGZ A;  1R7R A;  3I4Y A;  246L A;  2F5N A;  2F2Q A;  1L08 A;  2O4W A;  1TH4 A;  5ILC A;  5II3 A;  2ZIJ A;  1L0K A;  2JZ0 A;  1QT6 A;  2UXB M;  1J09 A;  1GFA A;  1L48 A;  2E5L M;  2B6T A;  178L A;  1KIQ C;  2IFF Y;  5KXM A;  2JY6 B;  3HH3 A;  5IEL A;  1H87 A;  2VB1 A;  4NXM M;  1CV3 A;  2D7H A;  5ITT A;  1NBZ C;  4AG6 A;  1L55 A;  2DAI A;  2B75 A;  1QZM A;  3SAV A;  4NGO A;  5EP1 A;  1OUF A;  2DWN A;  2OPF A;  2A7D A;  1PQJ A;  1JR3 A;  5K7O A;  1HC0 A;  1JTM A;  1VFB C;  1L47 A;  3TE6 A;  4LGY A;  1P64 A;  1HFX A;  3LW5 F;  1UAC Y;  3T38 A;  1WQP A;  2LHM A;  3E9S A;  4ARQ B;  3SYL A;  1L43 A;  2DQF C;  1QYR A;  3U6M A;  4G4N A;  2G8L A;  1QTV A;  5EBH A;  168L A;  5LIN A;  2BNK A;  1B5U A;  1NWG A;  4NG1 A;  3HBD A;  2PC2 A;  2JY7 A;  3U6E A;  1D3M A;  3D4S A;  3A42 A;  1LYJ A;  4L6V 6;  4NSR A;  2CHV A;  1GBY A;  1DXJ A;  8LYZ A;  1P36 A;  1GFK A;  254L A;  1PS5 A;  4I5S A;  2CV2 A;  4XEN A;  4LF6 M;  1DKJ A;  1Z59 A;  2OE9 X;  5F16 A;  1YAQ A;  1QSA A;  1SXJ B;  1GBO A;  1LSG A;  7CAT A;  228L A;  3HBH A;  1LYG A;  232L A;  1JSF A;  1IR7 A;  3V2Y A;  4I7J A;  1Z6T A;  3GO8 A;  255L A;  3GRV A;  3K92 A;  1HML A;  1IEE A;  1DYC A;  2OOB A;  1JJ1 A;  3ZEK A;  3EIH A;  1SX7 A;  2RRU A;  1GB5 A;  2YBI A;  1HEN A;  4NGI A;  1ZVH L;  1IC7 Y;  1AZF A;  1OAO C;  1HNW M;  2F5S A;  1TDH A;  1BWJ A;  2QHO B;  2XJW A;  4HTK A;  3U60 A;  3SFZ A;  4QDN A;  1NF5 A;  3WW6 A;  1P2R A;  1SLY A;  3A45 A;  3A3Q A;  2UXC M;  5KKJ A;  4HPE A;  3GRR A;  4L41 A;  3L64 A;  3U5Z A;  3LMM A;  2ZQ3 A;  261L A;  5F14 A;  1GFT A;  3C9P A;  5KXW A;  3PBL A;  4DQJ A;  1V33 A;  3DN1 A;  4X66 M;  2G3Q A;  1E9R A;  1RE2 A;  3SAW A;  2MEB A;  4FDY A;  3VW7 A;  1G7J C;  4IJ4 A;  1GE1 A;  1OWZ A;  1CUP A;  1IWV A;  3G3A B;  2HEE A;  2WZJ A;  1LZE A;  4H9A A;  4NG8 A;  4B3R M;  5ITU A;  3HGI A;  3HU2 A;  3LZM A;  2KW0 A;  4OW1 A;  1B5V A;  1JJ0 A;  3LZ2 A;  4H91 A;  5IDD A;  111L A;  2W82 A;  4WO6 A;  4AGA A;  1QT3 A;  125L A;  3FTF A;  1K28 A;  5FHW A;  1IP7 A;  1HFY A;  1LJH A;  2LTU A;  2H1R A;  1CKC A;  5JI3 E;  1REX A;  3B74 A;  1L35 A;  1TEW A;  1DI5 A;  1TCY A;  2BQI A;  4HPI A;  5EXP A;  1L88 A;  4AI6 A;  4ZFP A;  5LA5 A;  4WL7 A;  4MH0 E;  150L A;  5ITX E;  3P4Z A;  2FFJ A;  119L A;  1XGU C;  2ZIL A;  4LFP A;  3FE0 A;  4B4I A;  1QUH A;  3TWL A;  1BWI A;  1VDT A;  3M0E A;  7LZM A;  1TDY A;  2DQJ Y;  1L31 A; 
#chains in the Genus database with same CATH homology
 1HNL A;  211L A;  4NGY A;  164L A;  3A92 A;  1GB0 A;  118L A;  1L23 A;  1LYI A;  1C66 A;  4H8Y A;  113L A;  1KW7 A;  4ML7 A;  1L82 A;  1CNS A;  5L3H A;  1GBW A;  3A8Z A;  1L17 A;  2ZIK A;  4RLN A;  1KS3 A;  4DDA A;  1AT6 A;  1L61 A;  4LYO A;  4WMG A;  3WPJ A;  1B6I A;  5A3E A;  4W52 A;  1L24 A;  162L A;  1F6R A;  1LSN A;  3DMV A;  190L A;  1OVH A;  5LYT A;  2Z18 A;  4NHP A;  3V2W A;  1Z55 A;  1BB6 A;  4NGV A;  2RBS A;  226L A;  2B6W A;  2HUB A;  5L9J A;  1JIS A;  2BQO A;  5I53 A;  3AZ5 A;  3P68 A;  1BVK C;  3C82 A;  126L A;  1L01 A;  3G3X A;  4KXI A;  1GEV A;  4LDL A;  1IY4 A;  3TXE A;  4H9E A;  218L A;  4LDE A;  3G3W A;  252L A;  1CU5 A;  1DPW A;  1RI8 B;  3UON A;  1C69 A;  1B7N A;  4CHX A;  1TBY A;  1LTM A;  5T3F A;  1ZYT A;  4I0C A;  1GXX A;  4EXM A;  3RZ4 A;  220L A;  1G0G A;  4J1B A;  5I5Q A;  1QTZ A;  250L A;  3GUO A;  4H8Z A;  3B0O A;  5APD A;  1IR9 A;  1C6D A;  213L A;  4WM5 A;  1XJU A;  5DN4 A;  1L57 A;  4I7S A;  1LZG A;  1L19 A;  1AM7 A;  4OWB A;  4N9R A;  1B9O A;  4XJH A;  151L A;  5FEK A;  3P64 A;  3AZ6 A;  4RW1 A;  1GDX A;  4PRQ A;  5I4W A;  2O79 A;  167L A;  4UWU A;  4WLT A;  4H9H A;  1C6B A;  4WM1 A;  3TMU A;  1L77 A;  2BQG A;  2CGI A;  4NHT A;  1LJG A;  1SWY A;  1L45 A;  1L56 A;  4B49 A;  1G7I C;  1NDG C;  4GCF A;  3RNX A;  1B7R A;  4R0F A;  1G0P A;  4I8S A;  1LGU A;  4H9F A;  2Q9E A;  4ARJ A;  235L A;  2BQF A;  1LYO A;  1B5Z A;  1UIH A;  1KIP C;  3CT5 A;  161L A;  5C6J A;  1C6G A;  223L A;  5F9X A;  1LHK A;  1QS5 A;  2IHL A;  4NSH A;  1YL0 X;  4NGL A;  1LMC A;  4GCD A;  5LVG A;  1BHZ A;  2YVB A;  1D9W A;  3WU7 A;  1L03 A;  2RAZ X;  1E8L A;  2BQH A;  2BQN A;  2BPU A;  1LZA A;  1NQI A;  2W1X A;  1G7H C;  2Q0M X;  1EL1 A;  3LYO A;  1IX0 A;  209L A;  3A3R X;  4PRU A;  2OEA X;  3QNG A;  1CV5 A;  4ZPU A;  3P65 A;  248L A;  4WM4 A;  3A67 Y;  3AZ7 A;  1LSD A;  128L A;  1YQV Y;  262L A;  9LYZ A;  1L29 A;  3HDF A;  208L A;  4WM2 A;  1YL1 X;  1QTE A;  1L63 A;  2DQI Y;  1HHL A;  1JHL A;  1YIK A;  1XSF A;  4B0D A;  257L A;  1O23 A;  1GFG A;  132L A;  1JTT L;  3HBE X;  1D6Q A;  1L69 A;  3DN3 A;  3CDT A;  2CJL A;  1GPQ C;  4BAF A;  2MEH A;  4LT3 A;  194L A;  4H9C A;  1L97 A;  1LPI A;  4KT3 A;  3C8R A;  5LZM A;  1C64 A;  1L04 A;  2G4N A;  1B7P A;  1HFZ A;  1B2K A;  2H9J A;  3IJV A;  1L92 A;  1LCN A;  3C81 A;  2D4K A;  1LHJ A;  3GUL A;  1CU0 A;  1GAZ A;  1CU3 A;  1IWW A;  1DZB X;  1NHE A;  2Z6B A;  3SB6 A;  2CWI A;  5LIO A;  3HTD A;  1C6N A;  1D0M A;  3TXF A;  3WUM A;  4EKQ A;  4Z46 A;  1LHH A;  1I20 A;  2DQA A;  2NTH A;  5LA8 A;  4XAD A;  1LSA A;  4TUN A;  4WOA A;  1L83 A;  1LWG A;  2DQG Y;  4H90 A;  239L A;  4II8 A;  1UIB A;  1OUB A;  1EQ4 A;  1P2C C;  1LKS A;  2QB0 B;  3HTF A;  1P7S A;  2YBM A;  4NWH A;  1BB7 A;  1CV0 A;  206L A;  4NEB A;  1T3P A;  1B5W A;  2Z2E A;  1ZMY L;  4HV2 A;  1HEM A;  1LI2 A;  3BKH A;  155L A;  4E97 A;  3AGH A;  5KXS A;  5KXZ A;  3J6K A;  1L59 A;  1WQN A;  4BS7 A;  5APC A;  1HEW A;  1BWH A;  4HP0 A;  2OE4 X;  1INU A;  1WQR A;  1OVJ A;  2I6Z A;  196L A;  3EXD A;  1GE3 A;  1DYB A;  2FYD A;  1GFE A;  1UA6 Y;  1HMK A;  1BB3 A;  4WLY A;  4ZEE A;  1IP3 A;  1L67 A;  4TWS A;  238L A;  3CDV A;  4LYM A;  1C10 A;  4LZM A;  2RBP A;  3SB9 A;  1L73 A;  1FLQ A;  166L A;  2OTY X;  3QE8 A;  3CSQ A;  1YAP A;  1L68 A;  5ILF A;  221L A;  1ZWN A;  4OWC A;  1A4V A;  1QTB A;  4OWE A;  1XGQ C;  210L A;  1GF6 A;  3HT9 A;  5I54 A;  2BQD A;  4QY9 A;  4XJI A;  4TTD A;  2DBT A;  1L93 A;  1VED A;  4WG7 A;  1G0M A;  3KAM A;  4IAS A;  173L A;  3TXG A;  2BQE A;  3HT8 A;  4XJG A;  3GUN A;  1LHL A;  1XEK A;  172L A;  1B5X A;  2RBN A;  1D0K A;  3W6C A;  1LZT A;  1P5C A;  1T8F A;  4DD2 A;  3C8S A;  4NFV A;  4H9I A;  1GXV 2;  200L A;  1D3N A;  3LYT A;  3TXI A;  1LAA A;  3GXK A;  137L A;  1IWT A;  1CX6 A;  1C6M A;  1JEF A;  4EKS A;  2RBR A;  3SBB C;  1YKY X;  4I7P A;  1LSC A;  140L A;  1F6S A;  3CDR A;  1L0J A;  5LVK A;  147L A;  2YDG A;  4GCB A;  3WL2 A;  1ALC A;  4Z98 A;  2B7X A;  6LYZ A;  1HEL A;  3TXK A;  5HNC A;  4G4H A;  3QY4 A;  4DT3 A;  2I26 L;  1L22 A;  1L00 A;  3EMS A;  2CDS A;  3WU8 A;  1IP4 A;  1OQM A;  3J4G A;  1HF4 A;  240L A;  1LYZ A;  4OOO A;  2D91 A;  1SWZ A;  2DKV A;  1ZVY B;  2DQE Y;  1CJ7 A;  1L42 A;  1QS9 A;  1L28 A;  1YKZ X;  4K5Y A;  2HUL A;  5I14 A;  4I7O A;  2Z19 A;  1LSE A;  199L A;  1L26 A;  2XBR A;  4W94 A;  1OUE A;  4W96 A;  1G7M C;  2EPE A;  3HFM Y;  1L32 A;  3TXD A;  1GE0 A;  1NBY C;  3E3D A;  159L A;  3SB7 A;  4DKL A;  3RT5 X;  4TX7 A;  1ZV5 L;  1L72 A;  2OE7 X;  4LT0 A;  4CGE A;  5HLL A;  1C65 A;  5KXN A;  4M4O A;  2FYC A;  2RBQ A;  216L A;  1QT4 A;  1JKD A;  1IOQ A;  3A96 A;  1N4F A;  2BQJ A;  1REY A;  1IWZ A;  244L A;  120L A;  1T8A A;  3WPL A;  1ZUR A;  1LMA A;  5A3Z A;  4W56 A;  4XN6 A;  1LHI A;  1OP9 B;  3AGG G;  1LJ3 A;  3PDS A;  253L A;  1WQM A;  1F10 A;  2LCB A;  2Z38 A;  3WVX A;  5KY1 A;  1YIL A;  2F4G A;  1L05 A;  4YF2 A;  1NDM C;  2MEE A;  1L75 A;  175L A;  4YEM A;  3CB7 A;  2A7F A;  1CUQ A;  2LZ2 A;  1LKR A;  4XJF A;  3HWL A;  201L A;  1CKF A;  1L58 A;  4EPI A;  1G06 A;  1KY1 A;  4NSJ A;  3A6C Y;  3A6B Y;  1JJ3 A;  2Y8P A;  1JQU A;  5L3I A;  5KXP A;  5M1Y A;  3WVY A;  229L A;  4QGZ A;  5KXO A;  4ETA A;  4O34 A;  1D9U A;  1L99 A;  5KXL A;  1C6A A;  2XBS A;  5J7C A;  3B0I A;  1LHM A;  1L15 A;  1JIY A;  4KL7 A;  4XJD A;  1C46 A;  3WH1 A;  4N5R A;  3GUP A;  141L A;  1CV1 A;  1L10 A;  1LZY A;  1LJF A;  1D2Y A;  2ZYC A;  1GHL A;  1QSQ A;  4H1P A;  4J0L A;  2F2N A;  1V7T A;  188L A;  4NSG A;  1L06 A;  5F9U A;  4I7T A;  2H9K A;  4EPF A;  5KKI A;  2I25 L;  1OWY A;  2B70 A;  3WXT A;  1LSY A;  1D3J A;  1GF4 A;  1QQY A;  176L A;  1LGW A;  241L A;  4GCE A;  1LOZ A;  1HSX A;  1LI3 A;  1B7Q A;  3AGI A;  2BQB A;  1OUA A;  2MEA A;  2B6X A;  5DN5 A;  1EQE A;  2OU8 A;  1UIA A;  3A93 A;  1QUT A;  1XEJ A;  1DYG A;  258L A;  1LZ6 A;  5LVJ A;  1L60 A;  4NWE A;  4U3X B;  1L54 A;  3A91 A;  1J1O Y;  3SBA A;  2X0A A;  1HER A;  4GLA A;  4GLV A;  1L18 A;  1H6M A;  1DPX A;  1L96 A;  1QTK A;  4C5F A;  2BAA A;  3CT0 A;  4GCC A;  4LYC A;  245L A;  2Z39 A;  1LJ4 A;  5LAG A;  1OV5 A;  4A7D A;  2BQK A;  3IWR A;  1RJC B;  1RCM A;  1C6L A;  217L A;  4GN4 A;  1L09 A;  1L52 A;  1HEO A;  3C7Y A;  1L95 A;  143L A;  231L A;  1XEI A;  4I7R A;  1SX2 A;  3OE9 A;  5FST A;  1IWX A;  5LYM A;  4ARM A;  4ZIX A;  1CV4 A;  3DN6 A;  3AW7 A;  1JSE A;  233L A;  2RSC A;  154L A;  2NTG A;  5HNL A;  1LZ8 A;  1QUO A;  237L A;  3F6Z A;  4DAJ A;  1LYE A;  4LYB A;  4H8X A;  1LZC A;  2OTZ X;  2C8O A;  197L A;  1UUZ C;  2ZWB A;  1QT8 A;  1DQJ C;  2YSS C;  130L A;  3T36 A;  1C60 A;  4OWA A;  107L A;  1L37 A;  1VDS A;  109L A;  1SSW A;  1MEL L;  4ETC A;  4BAP A;  4MR1 A;  1REZ A;  193L A;  1CJ6 A;  1VDQ A;  4CFP A;  3QAK A;  1EQ5 A;  1GFR A;  1QTC A;  4DQ5 A;  1L81 A;  3LYM A;  5LAF A;  5LYZ A;  5DL9 A;  1L20 A;  1D6P A;  180L A;  183L A;  3HTB A;  4HJY A;  259L A;  1GE4 A;  3TMX A;  1DI3 A;  2RAY X;  243L A;  2HU1 A;  1CKG A;  1UIG A;  5AMY A;  1TLA A;  165L A;  2B5Z A;  3C7Z A;  3W6B A;  4G9S A;  1GEZ A;  1GB3 A;  1L07 A;  1JKC A;  2RB1 X;  4RLM A;  2MEI A;  3CDO A;  1L14 A;  5C6I A;  4HJZ A;  1CJ8 A;  234L A;  1FN5 A;  1J1P Y;  157L A;  1L94 A;  1L51 A;  3MGW A;  1GF9 A;  3AJN A;  3LHM A;  4N0J A;  1NKH A;  1KXW A;  215L A;  3SB5 A;  5B05 A;  1LZD A;  1OUH A;  4H94 A;  1L11 A;  2LZT A;  2ANX A;  1PQM A;  3NY9 A;  1FLY A;  4YXC A;  3C7W A;  4BAD A;  1LZ1 A;  1L38 A;  1C6H A;  2Q9D A;  3RZE A;  4EKR A;  3HT7 A;  2BQC A;  3W6D A;  4LYZ A;  1B7O A;  1REM A;  4NY5 A;  1GFU A;  5B07 A;  3AW6 A;  2YBL A;  3W3E A;  4ARP A;  4GN3 A;  1LYY A;  4LT1 A;  4LT2 A;  3NYA A;  1DI4 A;  4N8Z A;  4NIJ A;  4NHQ A;  191L A;  4RDS A;  4N1E I;  1LMT A;  3ZVQ A;  4DJH A;  2N5Z A;  1L98 A;  1L53 A;  1LSM A;  3RW8 A;  1GBX A;  1IP6 A;  2HUK A;  1LGX A;  2LYO A;  4NGW A;  187L A;  3G3V A;  4G4C A;  1QT7 A;  1IY3 A;  134L A;  247L A;  5HMJ A;  3DMZ A;  153L A;  1LZR A;  4EJ4 A;  2ZNX Y;  1L12 A;  1LZB A;  3WMK A;  2QAR C;  2HEB A;  5APF A;  1D2W A;  2DQC Y;  152L A;  4YEN A;  3K3T A;  1G07 A;  3HUQ A;  1LYS A;  145L A;  3HT6 A;  7LYZ A;  1JIT A;  256L A;  236L A;  1CKD A;  3LZT A;  2Z12 A;  1G0K A;  3CSZ A;  2RH1 A;  4R6C A;  138L A;  1YAO A;  3WYH A;  4GBR B;  1LZ5 A;  1B7L A;  1QDR A;  2B6Z A;  3K2R A;  1UIC A;  1GBZ A;  184L A;  4ARL A;  1HSW A;  3WUL A;  1PQO A;  1L65 A;  1IWU A;  1TAY A;  1SQ2 L;  5KXX A;  110L A;  260L A;  4GRV A;  4HTQ A;  1YKX X;  4PJZ A;  1B5Y A;  1C6P A;  2G4P A;  3FI7 A;  1C45 A;  1KXX A;  1LZS A;  1GF0 A;  3W6A A;  144L A;  2HEC A;  1GFH A;  3F9L A;  1UID A;  2BLY A;  1QUG A;  1QSW A;  5KXR A;  2GV0 A;  3TMW A;  3C8Q A;  4I7N A;  4EKP A;  2D4I A;  1VAT A;  1L84 A;  3A94 A;  2RB0 X;  3OE6 A;  5I4Y A;  4LFX A;  1IP2 A;  4ETE A;  4I7L A;  1WQQ A;  1L64 A;  171L A;  1L36 A;  1MLC E;  1C6K A;  1LSB A;  3A90 A;  1GF3 A;  4DDC A;  3HUA A;  2B73 A;  1LZ4 A;  4IAT A;  1L34 A;  4ARQ A;  3W6E A;  182L A;  123L A;  4TSB A;  2W1M A;  4W59 A;  4J7V A;  5LXW A;  2MEG A;  6LZM A;  129L A;  1L70 A;  4ET8 A;  3HUK A;  2IGC A;  1RFP A;  1W08 A;  1D0L A;  219L A;  2HED A;  1DYA A;  3ODU A;  4NHI A;  1UC0 A;  1GD6 A;  2BLX A;  1JTP L;  1WTM A;  160L A;  4I7Q A;  1CTW A;  1BVX A;  4PHI A;  1G0L A;  3FA0 A;  4E3U A;  4J1A A;  2DQH Y;  4W55 A;  4AQN A;  4XJB A;  1J1X Y;  3P66 A;  4WO9 A;  1OUC A;  3BKV A;  4HTN A;  1JTO L;  5DM9 A;  102L A;  1L33 A;  2OU9 A;  108L A;  1L39 A;  2HUM A;  4OO9 A;  1L90 A;  3B72 A;  158L A;  4P2E A;  1L40 A;  2D6B A;  1KIR C;  3OJP A;  1KNI A;  3ATN A;  1PZY A;  4YOP A;  1QIO A;  4NHS A;  4ETB A;  4WLX A;  1L50 A;  3OE8 A;  1C08 C;  1VAU A;  4TSC A;  1GE2 A;  1LJI A;  3SP3 A;  1AT5 A;  1I56 A;  1UBZ A;  3DMX A;  4DQ7 A;  4Z41 A;  3GUJ A;  2ZYP A;  3AYQ A;  4Z3M A;  1IC5 Y;  4N1C C;  4I7K A;  4HSF A;  3OK0 A;  1G1V A;  5DLA A;  1OV7 A;  1CKH A;  1XGR C;  1P3N A;  1OUJ A;  1BB5 A;  1P6Y A;  3ULR A;  4B4E A;  1LMQ A;  1PQD A;  2F47 A;  4MCK A;  4ET9 A;  4NGK A;  1I1Z A;  2LYM A;  4ETD A;  2W1Y A;  1YAN A;  1L66 A;  1G0J A;  1L49 A;  114L A;  4DD3 A;  2C8P A;  1L41 A;  1LMP A;  1IOC A;  174L A;  3N9C A;  139L A;  1D3F A;  1QUD A;  1FKV A;  2D4J A;  3N9A A;  4UWN A;  1KY0 A;  4DC4 A;  1XJT A;  4G4B A;  3CSR A;  2RB2 X;  2XTH A;  3HH6 A;  1GBS A;  1OYU A;  1C6F A;  3GUM A;  1L62 A;  2EQL A;  1L46 A;  131L A;  5KJ9 A;  4EOF A;  1IIZ A;  1GB8 A;  2O7A A;  4W51 A;  1IC4 Y;  2EKS C;  5KXY A;  2LYZ A;  3D9A C;  1QUS A;  5HQ1 A;  4CFO A;  3WUN A;  115L A;  2MEF A;  4H9B A;  195L A;  3AZ4 A;  133L A;  2B72 A;  3A34 A;  1FDL Y;  4B4J A;  1LSZ A;  2YBN A;  1QTD A;  1CU2 A;  4LGK A;  1L71 A;  1UCO A;  2FBD A;  1C68 A;  5JEN B;  4W58 A;  1PQK A;  1C7P A;  4NSI A;  1GB2 A;  4M6D A;  4W54 A;  4D9Z A;  156L A;  3C80 A;  1FKQ A;  3A95 A;  142L A;  1JPO A;  227L A;  181L A;  1L76 A;  2B6Y A;  4YM8 A;  1CX7 A;  1L27 A;  6LYT A;  3SN6 R;  1LJJ A;  3M18 B;  3B6L A;  1IR8 A;  3DN0 A;  4EMN A;  2XQO A;  2F4A A;  1GAY A;  2ZNW Y;  3FAD A;  135L A;  2RBO A;  4IAP A;  1WTN A;  3W6F A;  5IHG A;  3HDE A;  1LYD A;  2W1L A;  4DD7 A;  1QT5 A;  4GN5 C;  1LSF A;  2OU0 X;  5FEL A;  5KXK A;  1CVK A;  3DN8 A;  4LYT A;  2NWD X;  5B59 A;  149L A;  4ANR A;  4DYG A;  1L21 A;  3WPK A;  4DD9 A;  4NGJ A;  4QEQ A;  146L A;  4FJR A;  3G3B B;  5E4P A;  1JWR A;  1WQO A;  1LPY A;  1C6Q A;  1GF8 A;  4WM3 A;  1CV6 A;  3HH5 A;  1IWY A;  1KW5 A;  2L78 A;  1WVU A;  4HJV A;  1GB7 A;  1GB9 A;  1T6V L;  2ZQ4 A;  1JKB A;  1C62 A;  1L16 A;  1L25 A;  3HH4 A;  4ARM B;  3HU9 A;  2DQD Y;  249L A;  1L30 A;  1CU6 A;  3DKE X;  3F8V A;  1IOR A;  4G49 A;  3CT1 A;  1UIE A;  1C63 A;  1L74 A;  1P56 A;  1P2L A;  3N9E A;  1C6J A;  3C83 A;  2FBB A;  5F81 A;  1DYE A;  163L A;  4XYY A;  170L A;  4WLD A;  2MEC A;  3B0K A;  127L A;  5LVH A;  2HEF A;  3IJU A;  103L A;  3WW5 A;  1P37 A;  1FLU A;  2YBH A;  2BQM A;  4KPM A;  3EO5 A;  1GWD A;  1T8G A;  1GFV A;  1L02 A;  1XFP L;  1IO5 A;  1GDW A;  4PGJ B;  2BQL A;  5FCP A;  1WVV A;  1C6I A;  4WM6 A;  5LVI A;  104L A;  1L13 A;  1GB6 A;  1GF7 A;  4B1A A;  2AUB A;  212L A;  177L A;  4W53 A;  5B1G A;  1T6H A;  1LJN A;  4YEO A;  1V7S A;  1XEP A;  2BQA A;  5B1F A;  1L89 A;  3VWO A;  192L A;  4I7M A;  1VDP A;  4OOT A;  3GXR A;  251L A;  2G4Q A;  2CUU A;  3TXJ A;  1G0Q A;  1L79 A;  4W57 A;  4WL6 A;  1QSB A;  1LZN A;  4PJ2 C;  2F32 A;  1IVM A;  4H93 A;  2H5Z A;  1BGI A;  1B7S A;  1L44 A;  1LYH A;  5E9R A;  2F30 A;  1BQL Y;  1OUI A;  3L2X A;  3CDQ A;  1F0W A;  148L E;  1L87 A;  5FDJ A;  1NHB A;  4UWV A;  4YXA C;  3DNA A;  1GF5 A;  1JTN A;  1BB4 A;  4PPO A;  1B7M A;  1DKK A;  1UIF A;  4X3B A;  185L A;  3TXB A;  1IOS A;  1I6S A;  1C6E A;  1XGP C;  1G7L C;  186L A;  3RUN A;  4DWX A;  1LYF A;  3WU9 A;  2HEA A;  1IP1 A;  1LMO A;  2HTX A;  3SB8 A;  1QDT A;  4CJ2 A;  189L A;  3LN2 A;  1L91 A;  5KXT A;  3CQL A;  3ATO A;  222L A;  1L85 A;  1KXY A;  3GUK A;  2Z2F A;  1JKA A;  4DDB A;  1L86 A;  242L A;  1OVK A;  1FBI X;  4RW2 A;  2Z37 A;  1CJ9 A;  1DYF A;  1HEQ A;  3JR6 A;  3OE0 A;  1YAM A;  1IP5 A;  5APE A;  3WUA A;  4HV1 A;  4LZT A;  3TXH A;  1L80 A;  225L A;  4WG1 A;  3EBA B;  3ZVQ B;  1JUG A;  1C67 A;  1LLH A;  1WTH A;  2YBJ A;  169L A;  112L A;  3LYZ A;  4OWH A;  3T6U A;  1AKI A;  1OUG A;  1PQI A;  3WXU A;  207L A;  3DN4 A;  5I4X A;  2ANV A;  1IOT A;  5D5F A;  214L A;  4PK0 A;  1XGT C;  1NMM A;  1LW9 A;  1SSY A;  122L A;  3GUI A;  1DYD A;  2A4T A;  1LJE A;  4YX7 C;  4DD1 A;  3D3D A;  3EML A;  198L A;  2LZM A;  2EIZ C;  4LDO A;  1C6T A;  4DD0 A;  4C3W A;  2LC9 A;  1HEP A;  3HTG A;  1W6Z A;  1QTH A;  5D5C A;  3TMV A;  3DN2 A;  2MED A;  5B06 A;  1YRO A;  1C43 A;  5HMV A;  1GFJ A;  4H92 A;  1FLW A;  1C6C A;  1T97 A;  2WAR A;  1LZ9 A;  1C61 A;  230L A;  2HU3 A;  2B74 A;  224L A;  3HU8 A;  3AB6 A;  1LMN A;  1B0D A;  3NY8 A;  4S0W A;  4MST A;  1G1W A;  1P46 A;  4AXT A;  1A2Y C;  205L A;  1LJK A;  3M3U A;  1LSP A;  1LI6 A;  1LWK A;  1EPY A;  5C6L A;  3RU5 A;  1OUD A;  3FI5 A;  4NGZ A;  246L A;  2F2Q A;  1L08 A;  2O4W A;  5ILC A;  5II3 A;  2ZIJ A;  1L0K A;  1QT6 A;  1GFA A;  1L48 A;  2B6T A;  178L A;  1KIQ C;  2IFF Y;  5KXM A;  5IEL A;  3HH3 A;  1H87 A;  2VB1 A;  1CV3 A;  1NBZ C;  1L55 A;  2B75 A;  4NGO A;  1OUF A;  2A7D A;  1PQJ A;  1HC0 A;  5K7O A;  1JTM A;  1VFB C;  1L47 A;  1P64 A;  1HFX A;  1UAC Y;  1WQP A;  2LHM A;  4ARQ B;  1L43 A;  2DQF C;  1QTV A;  5EBH A;  168L A;  5LIN A;  1B5U A;  1NWG A;  4NG1 A;  3HBD A;  2PC2 A;  1D3M A;  3D4S A;  1LYJ A;  1GBY A;  1DXJ A;  8LYZ A;  1P36 A;  1GFK A;  254L A;  1PS5 A;  4XEN A;  1DKJ A;  2OE9 X;  5F16 A;  1YAQ A;  1QSA A;  1GBO A;  1LSG A;  228L A;  3HBH A;  1LYG A;  232L A;  1JSF A;  1IR7 A;  3V2Y A;  4I7J A;  255L A;  1HML A;  1IEE A;  1DYC A;  1JJ1 A;  3ZEK A;  1SX7 A;  1GB5 A;  2YBI A;  1HEN A;  4NGI A;  1ZVH L;  1IC7 Y;  1AZF A;  1BWJ A;  2XJW A;  4HTK A;  4QDN A;  1NF5 A;  3WW6 A;  1P2R A;  1SLY A;  3A3Q A;  5KKJ A;  4HPE A;  4L41 A;  3L64 A;  2ZQ3 A;  261L A;  5F14 A;  1GFT A;  5KXW A;  3PBL A;  4DQJ A;  3DN1 A;  1RE2 A;  4FDY A;  2MEB A;  3VW7 A;  1G7J C;  4IJ4 A;  1GE1 A;  1OWZ A;  1CUP A;  1IWV A;  3G3A B;  2HEE A;  1LZE A;  4H9A A;  4NG8 A;  3LZM A;  4OW1 A;  1B5V A;  1JJ0 A;  3LZ2 A;  4H91 A;  5IDD A;  111L A;  4WO6 A;  4AGA A;  1QT3 A;  125L A;  1K28 A;  5FHW A;  1IP7 A;  1HFY A;  1LJH A;  1CKC A;  1REX A;  1L35 A;  1TEW A;  1DI5 A;  1TCY A;  2BQI A;  4HPI A;  1L88 A;  4ZFP A;  5LA5 A;  4WL7 A;  150L A;  3P4Z A;  119L A;  1XGU C;  2ZIL A;  4LFP A;  3FE0 A;  4B4I A;  1QUH A;  1BWI A;  1VDT A;  7LZM A;  1TDY A;  2DQJ Y;  1L31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...