1D0MA

The escherichia coli lytic transglycosylase slt35 in complex with bulgecin a and (glcnac)2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
322
structure length
312
Chain Sequence
b'MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
publication title Crystallographic studies of the interactions of Escherichia coli lytic transglycosylase Slt35 with peptidoglycan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 110
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1d0mA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1d0mA02
1JHLA 2ZIKA 3W6FA 3IJVA 2FBBA 4HV1A 2RSCA 4NHIA 1HFZA 1DZBX 4Z98A 5LYTA 1VAUA 4TX7A 2I6ZA 1LSYA 1UIEA 1W08A 4LT3A 1IP2A 4KPMA 2MEIA 4ET8A 1B7MA 2YBLA 5B07A 5KXTA 1I1ZA 1LYSA 1GBZA 4NG8A 4DDAA 1GE1A 1IP3A 1C7PA 5I5QA 1JWRA 1ZVYB 2BQBA 208LA 4WG7A 3QNGA 1LJEA 2ZIJA 1LZDA 1WVUA 5C6IA 1OP9B 1YAMA 4C3WA 5LAFA 1NBZC 5F81A 4W96A 1CKFA 1OUJA 1H87A 1CKHA 1XGRC 1LZ5A 1YKZX 4MSTA 4NSHA 4TSCA 4WOAA 1HMLA 4DT3A 3HFMY 1VFBC 1UIFA 4ANRA 1GF0A 1NWGA 1JUGA 4QEQA 4WMGA 2D6BA 4OWHA 5LVIA 3TMUA 5KXMA 3D3DA 1BB6A 5APEA 1GBSA 1GB3A 3CB7A 4GLVA 1INUA 4H9IA 5DN5A 1RJCB 3WPJA 1IWZA 3P4ZA 1MLCE 1BVXA 4Z46A 3A93A 1HEOA 2A7DA 1IOCA 2DQGY 1TDYA 4LYCA 4N0JA 1IC4Y 4OOTA 4WLTA 4RLNA 1AKIA 1EQEA 1IY4A 4EMNA 1IWXA 1GFTA 1CJ9A 1LZYA 1YL0X 3AJNA 4XYYA 4WL7A 5I4YA 1LKSA 1IOTA 5LXWA 133LA 1B9OA 2DBTA 1AZFA 1GFHA 2F4GA 3RU5A 1B5VA 4ZIXA 3LYTA 4ETAA 2Z12A 1JKCA 1UUZC 4J1BA 4PJ2C 4B1AA 4GCFA 1HFYA 4DWXA 1NBYC 4A7DA 2ZILA 4HTNA 1AT6A 4GCEA 1GF5A 5DL9A 5KXPA 1GFEA 4TWSA 2BLXA 3TXDA 2CJLA 3EMSA 193LA 1QTEA 1BQLY 2MEEA 3AB6A 6LYTA 1LMTA 4XJFA 2LYMA 1WQPA 1G7IC 1LZ9A 1OUHA 3K3TA 4LT0A 4CGEA 1HELA 1IR8A 1DPWA 3BKHA 4NSJA 7LYZA 1GFJA 4YEOA 4NWEA 1VATA 1LSCA 2G4NA 1DXJA 5AMYA 1JTOL 1WQRA 1D0KA 3B0KA 3G3AB 1FKQA 1LZNA 1CKGA 2HEAA 2MEHA 4GLAA 4H93A 5LIOA 3W3EA 1GFAA 5LAGA 2C8PA 4LYOA 5KKIA 2G4QA 3MGWA 1IC7Y 5A3ZA 1LMNA 2HECA 2MEGA 3WULA 3J6KA 4H8YA 5HNCA 5LA8A 1VDQA 2Z2EA 1EL1A 1G7MC 2Z18A 4IASA 1WQQA 4XJDA 1BB4A 2ZWBA 3ZVQA 1JTTL 3WU8A 1HEWA 2F2NA 1IORA 5KXOA 2ZQ4A 4M4OA 5HMVA 2LYOA 1LJ3A 1EQ5A 2XBRA 1IY3A 1LZ4A 3TXIA 4I8SA 1LHHA 1ZV5L 2FYDA 3TXEA 5I4WA 5L3HA 1GB6A 5FSTA 1CKCA 1REMA 5M1YA 2IFFY 1YKYX 4PRUA 1IP5A 5LYZA 4C5FA 1Z55A 3QE8A 4J7VA 4WO9A 4HTKA 1F0WA 4Z41A 3WW5A 2F4AA 4LFXA 1FLYA 1IP6A 1IVMA 5KXLA 5KXZA 1GFGA 5F16A 1QTKA 1YKXX 4BAFA 1BHZA 3KAMA 1TEWA 2BQJA 1B7OA 2W1XA 3AW6A 3HBHA 5B59A 3A96A 5IDDA 3AYQA 4L41A 1LHKA 1B7QA 4RW1A 2HU1A 1JJ1A 3G3BB 1LMPA 4R6CA 2ZNWY 1HSWA 5KXNA 4DYGA 4OW1A 2YBHA 5A3EA 3TMVA 1LSAA 4WL6A 3GXKA 1LJIA 5C6LA 1DI4A 3B0OA 1XGQC 3N9EA 4XJHA 1F6RA 3A8ZA 1UIHA 3IJUA 4ETEA 1LJ4A 4WM4A 5D5CA 1IO5A 1AT5A 1IX0A 1BB7A 3FI7A 3WU9A 2BQMA 1GHLA 4NHQA 3B6LA 5HMJA 4X3BA 2W1LA 4LFPA 2HEDA 4NGOA 1OUIA 3EXDA 5FELA 1GAZA 1CJ6A 5IHGA 1IIZA 1KIPC 1LHIA 4XN6A 5IELA 4B0DA 1I56A 4GCDA 4NWHA 2BQLA 4XJIA 5EBHA 1GD6A 3AZ6A 1NKHA 2DQAA 2YBNA 2DQCY 4LYBA 2DKVA 1DKKA 2MECA 4NHTA 1JKBA 2BQDA 2BQOA 3IWRA 1JPOA 1NMMA 134LA 1GBWA 5KXYA 1GEZA 3SP3A 1JIYA 4LYTA 5D5FA 2DQIY 3WVXA 1GB9A 1BGIA 1GB0A 3P68A 194LA 1FLQA 4PRQA 9LYZA 2GV0A 3CSQA 4N5RA 4DDBA 4WM6A 1GXV2 4KT3A 1LTMA 3BKVA 1QIOA 4NGLA 1UIBA 5II3A 1D9UA 1LHJA 3AW7A 4H8ZA 3WYHA 2ZYPA 3HBEX 4GCBA 1REXA 4HV2A 1HHLA 1JSFA 1LZ6A 2NWDX 2FBDA 2W1MA 1QQYA 1B7LA 1GF9A 1LSDA 3E3DA 3LHMA 1B5XA 4LYZA 4ZFPA 1HSXA 1NDGC 4R0FA 1IOQA 4YM8A 1QSWA 1TBYA 1UBZA 2CWIA 2HEEA 2VB1A 4H9BA 1BWHA 4I0CA 3W6EA 4CHXA 1CNSA 1HC0A 3TXGA 2YSSC 4H9AA 3WVYA 4DD7A 4ETCA 1N4FA 1OQMA 4HPEA 3WU7A 1JEFA 5I4XA 1WQMA 1SQ2L 1GDXA 5I54A 4NIJA 1IWYA 1CJ8A 1KIRC 1EQ4A 3P66A 1D6QA 1G7LC 2BQKA 2MEFA 3AGHA 1YQVY 4XJGA 3W6CA 1FBIX 1LMOA 1IWVA 1JJ3A 1LJGA 3AZ5A 1XGUC 4WM3A 2BAAA 4QDNA 1JSEA 1UC0A 3M18B 4DD2A 3A3RX 2ZYCA 1RCMA 1F10A 1YAPA 3LYZA 3N9CA 1CKDA 1DI5A 4WO6A 1LKRA 3RNXA 1LJKA 1G7HC 3WL2A 1QUTA 1C46A 1NDMC 2Z38A 3CSRA 3M3UA 5F9UA 2HEFA 4II8A 1LSNA 3AGIA 1YILA 1OUEA 3B72A 1UCOA 1XFPL 3OK0A 3RZ4A 1GF7A 2YBMA 4IATA 2BQFA 1D0LA 4WM5A 4DD3A 1LSMA 4GN5C 1D6PA 3A90A 2EPEA 4NHSA 3A91A 1LZEA 2B5ZA 3WUAA 1GWDA 2LYZA 2MEAA 1C10A 5E4PA 4LGKA 2BQAA 1LJJA 2D91A 3ATNA 3WH1A 5HNLA 1LZGA 1YROA 1ZMYL 2EIZC 4GCCA 1LMCA 5FHWA 4NGWA 1HFXA 2HEBA 1GBOA 1LZ8A 1MELL 4DD9A 4G4CA 5LVJA 1GF6A 1XGPC 2C8OA 1QDRA 1G7JC 5B1FA 4AGAA 4XADA 1JKAA 1REYA 1J1OY 4NGZA 1PS5A 2IHLA 1P2CC 1LZ1A 1KXXA 1KXYA 1T6VL 1XEJA 5F14A 1GXXA 1LYZA 1UA6Y 2I25L 4G4HA 5LINA 1VEDA 1LMAA 5DLAA 1WTMA 3HBDA 1LZBA 1XEKA 4MCKA 4N9RA 5KJ9A 2BQNA 1IWWA 1RI8B 5DM9A 1GE4A 2YVBA 4ETDA 3VWOA 2DQFC 1HEQA 4O34A 4RW2A 1UACY 5HLLA 1NHEA 4D9ZA 1BB3A 3CT1A 1LZRA 1FN5A 2Z39A 4WLDA 3GXRA 1LAAA 1HEMA 4PHIA 4LZTA 3LZ2A 3WUMA 3F6ZA 4LYMA 5F9XA 1LJNA 4CFPA 1IR9A 2LZ2A 3WPLA 4B49A 2YDGA 4NFVA 3TXJA 1OUGA 3ZVQB 1BWIA 1DKJA 4CJ2A 3CSZA 2YBIA 4NY5A 1B7SA 1B0DA 1IC5Y 1WQOA 4G4BA 4N1EI 4W94A 4YEMA 1LSFA 1YAQA 3CT5A 2BQHA 2D4JA 1GE0A 1HENA 3A6CY 1HEPA 4H9HA 3WMKA 2F30A 1FKVA 3FE0A 5JENB 1KXWA 3AGGG 1GE2A 2YBJA 1IP4A 1TCYA 1JKDA 1LZSA 3A67Y 1GF8A 1LSBA 2HU3A 2ZQ3A 4GN3A 5KXKA 2BQCA 154LA 1FDLY 3TMXA 1LJFA 2FYCA 3CQLA 1OUCA 1LOZA 3QY4A 3TXFA 5KKJA 5KXWA 3A6BY 4MR1A 3P65A 1VDSA 4H8XA 1GB8A 1LZTA 4HTQA 1LCNA 1YL1X 1LMQA 5FCPA 1HMKA 1B7PA 4NGJA 1B5WA 5KXRA 1UICA 4DD0A 2MEDA 4UWNA 6LYZA 5J7CA 2AUBA 1V7TA 3LZTA 3CT0A 2MEBA 1OUAA 3A34A 2H9JA 1B7RA 2H9KA 4E3UA 5LA5A 2XTHA 1ZVHL 2DQEY 2LHMA 3D9AC 2EQLA 4HJZA 1GFUA 4Z3MA 1C45A 2D4IA 1HERA 4YENA 1GDWA 4H90A 1GAYA 5KY1A 1WTNA 4TTDA 1SLYA 1LHLA 4HJYA 2A7FA 4HP0A 4OWCA 1LSEA 4LT1A 3TXHA 4H9EA 3W6DA 5LYMA 4RDSA 1GFRA 1QUSA 1HF4A 4OOOA 4WLXA 3WUNA 2Q0MX 4HPIA 1REZA 4NEBA 1A4VA 2BQIA 1DPXA 4WM2A 4TUNA 4UWUA 4OWEA 5C6JA 5B1GA 4WLYA 2ZNXY 1QDTA 1IEEA 3J4GA 4BS7A 2BLYA 1CJ7A 4J0LA 4CFOA 2DQHY 4N8ZA 2LZTA 5APCA 4B4JA 4ML7A 1D0MA 3N9AA 4NSIA 3RW8A 4PGJB 2Z2FA 153LA 1GF4A 4OWAA 1VDTA 1GB5A 1RFPA 1GBYA 4IJ4A 2D4KA 2Z19A 4H9CA 1OUDA 4XENA 3TXBA 3ULRA 2G4PA 3P64A 2DQJY 2I26L 1A2YC 4NGKA 1BVKC 4NSGA 1IP1A 4DC4A 5LVHA 1B2KA 3AZ4A 1YAOA 2CGIA 1V7SA 2HUBA 1LHMA 2Z37A 1I20A 3A3QA 4WM1A 4BADA 3WW6A 1XSFA 5B06A 1C08C 207LA 3LYMA 4NGYA 5HQ1A 4H1PA 3TXKA 1BWJA 1J1PY 5ILCA 3EO5A 1FLWA 4AXTA 1AM7A 1UIGA 3OJPA 1NQIA 1VDPA 4U3XB 3T6UA 2Y8PA 4XJBA 2BPUA 3WXUA 2W1YA 1KIQC 1NF5A 1LPIA 4RLMA 1JTPL 1BB5A 5L3IA 3AZ7A 5K7OA 1YIKA 1LYYA 1GFKA 1LSPA 2BQGA 5APFA 1H6MA 4NGIA 2BQEA 3RT5X 5B05A 1O23A 5E9RA 1LYOA 3LYOA 1F6SA 4FJRA 1TAYA 2HTXA 2X0AA 135LA 5I53A 4H92A 2N5ZA 5LVKA 4ETBA 5APDA 1WQNA 4PPOA 5KXXA 3ATOA 1HNLA 1GB2A 4KL7A 5LVGA 1GBXA 4YF2A 4N1CC 1XEIA 1JISA 1IR7A 1FLUA 4J1AA 1LJHA 1OUFA 4QGZA 4TSBA 1IOSA 1E8LA 3W6AA 5L9JA 1GEVA 3EBAB 1B5YA 1YANA 3ZEKA 4EOFA 1IWUA 3A92A 4YOPA 8LYZA 2DQDY 5KXSA 4M6DA 1IWTA 1DI3A 132LA 3LN2A 5DN4A 1UIAA 1T3PA 4ET9A 1PZYA 1JITA 1W6ZA 4NHPA 4NGVA 1GFVA 1RE2A 1OUBA 3B0IA 4H9FA 1GF3A 4OWBA 4KXIA 4WG1A 4B4EA 1ALCA 1LZAA 1GB7A 1B5ZA 1B7NA 4BAPA 4DD1A 4QY9A 1JJ0A 4DDCA 1IP7A 1LZCA 4H94A 1C43A 5FEKA 4GN4A 1J1XY 4HJVA 4NG1A 3WPKA 1B5UA 3A95A 4ZEEA 3A94A 4HSFA 4LT2A 4B4IA 2PC2A 4G9SA 2CDSA 1DQJC 1QSAA 2WARA 5T3FA 4UWVA 1UIDA 4FDYA 4P2EA 2XBSA 5FDJA 3WXTA 1GE3A 1XGTC 3TMWA 4G49A 1GPQC 4H91A 1LSGA 3W6BA 5ILFA 3T36A 1WVVA 2H5ZA 2EKSC 2XJWA 1LSZA
chains in the Genus database with same CATH superfamily
1KW5A 1JHLA 3W6FA 2DAEA 3UONA 2FBBA 1OTRA 4HV1A 4Z98A 1JR3A 1VAUA 1L59A 1PRBA 2MEIA 141LA 2ZAMA 1KYIA 3GPXA 1LYSA 3SYLA 4NG8A 1OFHA 3H4MA 2O01F 3KOYE 1KFVA 1ZVYB 4WG7A 208LA 3R9XB 2NTGA 1LZDA 1WVUA 4C3WA 1NBZC 3U61A 1YKZX 1OUJA 4NSHA 1PQOA 1LLHA 1VFBC 228LA 1GF0A 4QEQA 3TMUA 3F92A 5IWAM 2D6BA 4OWHA 2UXDM 1BB6A 5APEA 3L26A 1GBSA 1L09A 2J7NA 1IWZA 2K0BX 2VF7A 3DMVA 4I7OA 2DQGY 4WLTA 2H5XA 4YHHM 1PQKA 4LYCA 1HNZM 1GO5A 4R3DA 1LZYA 1GFTA 1N33M 1YL0X 1C63A 3FI5A 2VDBB 4R71A 1EFUB 3J2PB 1PJJA 2FE8A 2QNJA 2DBTA 4DQ5A 1B5VA 3SASA 3UK6A 1P64A 230LA 1OAOC 2Z12A 1JKCA 1HNXM 2HHHM 4HLQA 1QZEA 1WJ7A 3LW5F 4ARJA 4IBEA 169LA 4HTNA 1AT6A 5DL9A 2CHGA 1GFEA 5LZMA 4LJ6A 3AFHA 4L78A 5KPTA 1L10A 2LYMA 3GUKA 1WQPA 1L40A 4YY3M 2B74A 1IR8A 7LYZA 2Q2EB 1L92A 1VATA 2G4NA 1D0KA 1L53A 4H93A 3W3EA 4X62M 5ITTA 2VQEM 214LA 5LAGA 176LA 3F9LA 1DYAA 3J6KA 2Z2EA 4W56A 1G7MC 2Z18A 1V34A 2ZANA 4IASA 1P3QQ 1QYRA 2Z4RA 2DWNA 1WQQA 2QQ8A 1BB4A 3ZVQA 3R8FA 1JTTL 3GUPA 1T8FA 2VIIA 3TWMA 2UXCM 2LHCA 1IORA 2ZQ4A 4M4OA 3KS8A 1SXJC 1EQ5A 219LA 1IY3A 1LZ4A 3TXIA 4I8SA 1ZV5L 122LA 1GB6A 3J81S 5FSTA 2A5YB 4R7GA 1F4IA 3GQ3A 1Z55A 2Z3XA 2JY6B 3FRHA 1T6HA 137LA 4W59A 1IVMA 5C18A 1V33A 4QHSA 5ITQA 1GFGA 1L86A 1QTKA 2WSEF 2XQOA 3C8SA 2BQJA 3AW6A 1P37A 1NHBA 5B59A 3PNYA 3AYQA 5EXSA 174LA 3G3VA 1LMPA 4W53A 4R6CA 2ZNWY 1L2CA 4DYGA 2YBHA 1LSAA 4WL6A 4DR7M 5KQDA 3U6OA 1WHCA 3W0LB 4XJHA 1XC8A 3A8ZA 3IJUA 4M9SA 3KS4A 1L36A 3K2LA 5ITXA 3SMPA 1BB7A 1L27A 1C64A 3B6LA 5HMJA 1NO1A 109LA 4X3BA 1I4WA 3GLIE 4LFPA 1ZV1A 1OUIA 3EXDA 3V76A 1L02A 3ODUA 5IHGA 1C7YA 1KIPC 1LHIA 2DVWB 3I51A 1CV5A 1SG9A 4JI3M 1L15A 4NHTA 3HHXA 184LA 4LG2A 4EPFA 1NNUC 1L73A 1L28A 134LA 1GBWA 1NMMA 3HH6A 1W5SA 2F5QA 1XMOM 2Y20A 1CX7A 1G71A 3T1HM 2ERCA 1EE8A 4JI4M 194LA 1L69A 4DDBA 1J09A 3K92A 1L2BA 1LHJA 3WYHA 2ZYPA 167LA 2NWDX 4PDGA 1QQYA 2JP7A 1LSDA 4G4RA 2OE7X 227LA 1HQYE 2K9DA 3HTFA 4R0FA 1TBYA 4I0CA 3SAWA 4CHXA 3W67A 1HC0A 4FWHA 3U61B 1N4FA 4HPEA 2HULA 5I4XA 3FTEA 4JI5M 4LDLA 8CATA 1C1KA 4NIJA 4S0WA 3P66A 1EQ4A 1G0KA 1L00A 4XJGA 4EJ4A 3HU2A 4AQYM 1L48A 1LMOA 2WSCF 212LA 4L6V6 225LA 2BAAA 2RBSA 1JSEA 4DD2A 2R0IA 5KPZA 4ETEA 1DI5A 2B75A 3WL2A 1L22A 151LA 2Z38A 3HT9A 4IBFA 2Z6BA 3U6LA 3OK0A 1Q02A 166LA 3RZ4A 1GF7A 2BQFA 1L89A 1D0LA 4DD3A 3TL4X 1L91A 3A90A 1L79A 4NHSA 3A91A 2B5ZA 1HT2E 1L56A 2HCBA 2LYZA 2MEAA 4AKHA 1C10A 3DN6A 5E4PA 2BQAA 3HUKA 1L13A 3EMLA 3ATNA 3FTFA 1LZGA 5FHWA 4IBBA 1PJQA 5FTLA 1C6LA 2C99A 4DAJA 4MGYE 2KNVA 1DYGA 4AGAA 5KPRA 1GVNA 4W54A 4NGZA 2WSFF 1PS5A 1P2CC 4IBKA 1SXJE 4G4HA 1IN5A 1LMAA 1L32A 5DLAA 3DN8A 4N9RA 2BQNA 4ETDA 4GKJM 1L99A 2DQFC 253LA 3FE3A 4WLDA 1CU5A 1IN7A 3IG8A 1HEMA 1QTHA 1NJFA 3F6ZA 4FCTA 1IR9A 2LZ2A 3KOWE 1OUGA 2KRKA 3GUJA 3U60B 1L39A 3ZVQB 1DKJA 2XZUA 2BWBA 2YBIA 4NY5A 4W51A 4W94A 140LA 180LA 3CT5A 1IN6A 2YR0A 1L63A 3A6CY 1B6IA 3VKHA 1HEPA 4H9HA 3WMKA 1NHGC 5JENB 3AGGG 221LA 2HU3A 154LA 1FDLY 3TMXA 1LJFA 2FYCA 1LOZA 3GLGE 2DZNB 189LA 3NYAA 4LDOA 5KXWA 2RB2X 1LZTA 201LA 1LCNA 5FCPA 1L84A 2RBPA 1YLAA 1UICA 4DD0A 4UWNA 186LA 2LVNC 3LZMA 1WIVA 4NSOB 2H9KA 4NRWA 3CDTA 3UGJA 2LHMA 159LA 2EQLA 4HJZA 1XNQM 4HL4A 103LA 2D4IA 3FRIA 2OU8A 127LA 1GDWA 211LA 4DR1M 4H90A 4YENA 1SLYA 1QT5A 2A7FA 4CGYB 1L55A 3TXHA 1T97A 5E26A 3ZH9B 4RDSA 4GMQA 4OOOA 2KNZA 3GLFE 2Q0MX 1C6MA 2BQIA 4LDEA 4WM2A 1TF0B 161LA 1L75A 4OWEA 5B1GA 4WLYA 2ZAOA 4LF5M 1TH2A 1QDTA 1IEEA 1CJ7A 4J0LA 4CFOA 2DQHY 2R46A 185LA 4B4JA 5EP1A 4ML7A 3RW8A 4CISA 1C6NA 3A98B 4OWAA 4LZJA 4MB7A 1VDTA 1QUGA 4XENA 170LA 3TXBA 4QOZC 5EJCA 2DQJY 1JQUA 2M60A 3K9OA 4LJ5A 4JN6A 2F5OA 1C61A 4W57A 4QHTA 5LVHA 2XSZD 3QAUA 2HUBA 3CF2A 232LA 3A3QA 4WM1A 1C08C 2L2DA 207LA 239LA 2QENA 5HQ1A 1G0JA 1L64A 2CUZA 4AXTA 3A46A 1AM7A 1UIGA 3OJPA 2JNHA 4U3XB 5FLXS 2DHRA 4PD2A 3E9SA 2B7XA 139LA 1LWGA 3K2RA 5L3IA 2QCUA 188LA 5E6JA 4JI7M 115LA 1L45A 4ARLA 2BQGA 2RBRA 2BQEA 5B05A 1SSWA 3C3DA 3IHPA 3LYOA 1CV1A 5I53A 135LA 4H92A 2N5ZA 3SB8A 4ETBA 5APDA 1GL7A 1SXJA 4NRVA 1LGWA 1L87A 5KXXA 1CU3A 2C9OA 1GB2A 3GQ5A 4N1CC 1JISA 128LA 1FLUA 4QGZA 1LI3A 3GUIA 4DV0M 1ZQ9A 2MGWA 4D81A 1KY1A 1GEVA 2B72A 1QAQA 3A92A 2QSFX 4I7TA 5KXSA 1T3TA 1QAMA 2LXEA 132LA 1IWTA 4AKGA 2V1UA 1PZYA 4NHPA 1GFVA 4B4EA 4KXIA 1GB7A 259LA 4PCZA 3OE8A 3FA0A 190LA 1JJ0A 3HU8A 2J7OA 1BVSA 1E94E 3SARA 1G06A 3IG5A 1DQJC 1LYEA 4UWVA 1L50A 4FDYA 1Z5CA 2CV0A 4P2EA 2XBSA 4B3MM 1GE3A 4G49A 1GKIA 1L05A 4B3SM 1L80A 4LT3A 3AOGA 2ZIKA 2CP8A 3IJVA 2RSCA 4NHIA 5LYTA 4TX7A 2I6ZA 4KPMA 1V92A 1I1ZA 4DDAA 4I7QA 4LGMA 1L98A 2BQBA 3QNGA 3HHWA 4YXCA 2KDLA 2O79A 1Q3BA 4WOAA 1LZ5A 4QOSA 1R6BX 1HMLA 3HFMY 210LA 1OFIA 1IY2A 3EIHA 4P17A 2F5SA 145LA 5EQTA 3D3DA 4JI8M 1GB3A 175LA 1INUA 3U6EA 1RJCB 3SAVA 3EIEA 1L33A 1BVXA 4N0JA 4OOTA 2ZTCA 4RLNA 1EQEA 3J80S 1L70A 4WW0A 1NV8A 3QWLA 1KSFX 4WL7A 1LKSA 1IOTA 5EXXA 4I5SA 1D9WA 3HTBA 2F4GA 2B6XA 4ARMB 3LYTA 5KQ8A 3Q8GA 2L6OA 1L25A 4PJ2C 4B1AA 4DWXA 2ZILA 4GC5A 1GF5A 2BLXA 3GLHA 3C8QA 3EMSA 1BQLY 3AB6A 1VG5A 4XJFA 3VK8A 1L20A 1LZ9A 242LA 4CGEA 4ZPXA 1GFJA 1JTOL 3W68A 1WQRA 5KKIA 5LIOA 2D7HA 1G0LA 1CKGA 2MEHA 2KA6B 4GH9A 2R6FA 1TLAA 3M7GA 1GFAA 3DN1A 2JY5A 1IY0A 3HJ8A 3MGWA 5A3ZA 2F5PA 1P36A 2HECA 1DV0A 4JI2M 1EL1A 2CE7A 4AI6A 4XJDA 4OW0A 3WU8A 1HEWA 5HMVA 1LJ3A 1L06A 1C6IA 4DV1M 3TXEA 3CDOA 3SYKA 3DNAA 5L3HA 2JA2A 1DGBA 4B3RM 3AOEA 1CKCA 2IFFY 149LA 1D2WA 4OVZA 1CU0A 150LA 3HU3A 2CHVA 3C8RA 1JQJC 4LFXA 5KXZA 5F16A 1BHZA 3KAMA 2MROB 104LA 3AV0A 2L4FA 3SB7A 2XLJA 4KODA 1B7QA 2HU1A 1JJ1A 3PXGA 3VLFB 4AKIA 5KXNA 4OW1A 3U6QA 3TMVA 3GXKA 3FADA 1XGQC 4KHPM 3CDRA 2DAMA 4WM4A 1DYCA 2R45A 3GRRA 3FI7A 3WU9A 4ARQB 1GHLA 1CTWA 4QNMA 1NJGA 163LA 1VEGA 2HEDA 155LA 4I7LA 4NGOA 5FELA 1TDZA 3BBZA 3HUAA 4B0DA 4GCDA 4NWHA 4MGKE 1FJGM 1GJTA 3LQRA 2DQAA 2DKVA 4NC6A 2BQDA 2R18A 1G41A 4LYTA 3HWLA 2RB0X 3WVXA 1GB9A 1T43A 1L8QA 3NBIA 1XHBA 2GV0A 2FFJA 3CSQA 1L18A 4XK8F 216LA 4GKKM 2DAKA 1PQMA 1QIOA 1UIBA 1D9UA 3AW7A 3E4RA 1REXA 4HV2A 3G3XA 1C6HA 3LHMA 1DGHA 1IN4A 4LY6A 3L28A 2XFTA 1IOQA 4YM8A 2VB1A 2HUKA 2B6WA 1CNSA 3Q8XA 4II7A 4I7JA 3TQSA 4ETCA 1P5CA 1R2YA 1OQMA 3KVWA 1SQ2L 4OU7A 1CJ8A 1L1ZA 2ZBKB 2YQZA 1D6QA 3SMSA 2BQKA 1YQVY 3SHFA 3RFWA 1XXHE 129LA 1FBIX 1IWVA 1JJ3A 1QQWA 1LJGA 3AZ5A 4QDNA 4AG5A 1UC0A 3KDSE 147LA 3A3RX 251LA 1RCMA 1F10A 1L95A 3HUQA 3LYZA 1CKDA 4WO6A 4QNRA 220LA 1D3NA 3CSRA 3M3UA 2VF8A 5F9UA 4G4OA 1YILA 1OUEA 4AG6A 3M6AA 1D2YA 5IREB 148LE 3U5ZA 1R4GA 3SB6A 2B6ZA 1OYUA 2DWZB 1LZEA 3WUAA 2OO9A 1L41A 4LGKA 206LA 2EUCA 1JR3D 1LV7A 2D7GA 2QZ4A 1L81A 2D91A 5HNLA 1XB2B 2EIZC 1LMCA 1PJTA 4NGWA 1Z5BA 3AL0C 1MELL 1G0GA 1P46A 1TGUA 1L88A 3GLHB 2XF3A 249LA 1XGPC 2C8OA 2HAKA 1G7JC 4L16A 1LZ1A 1T6VL 1KXYA 1XEJA 2CHQA 1GXXA 1UA6Y 2QBYA 1C60A 1ZMWA 1WTMA 1LZBA 1XEKA 1C65A 1C6DA 3GRVA 2B6YA 2YVBA 1HEQA 4O34A 2LWXA 1UACY 3F8VA 5HLLA 3MHVC 4D9ZA 3RGPA 1LZRA 2Z39A 1CVKA 102LA 1LAAA 4LZTA 3WUMA 4LYMA 4OX9M 5F9XA 1LJNA 1L62A 196LA 1IM2A 1LWKA 4IBJA 3CSZA 1VEKA 1WQOA 4G4BA 1P7SA 4L4UA 1LSFA 1YAQA 1HENA 3NY8A 1GJSA 4LF8M 3FE0A 4CJ6A 2K6BA 4K5YA 1L82A 4I7MA 3UJNA 2XFSA 1IP4A 5FTNA 1JKDA 1LSBA 3QY4A 2Q9EA 2HWJA 3P65A 1VDSA 1GB8A 4K0KM 1QTDA 2DZOB 142LA 2G8LA 1HMKA 4NGJA 2Z7JA 1PQIA 213LA 3SC3A 6LYZA 7LZMA 2AUBA 1V7TA 3A34A 2H9JA 1ZVHL 2DQEY 2KZUA 4F2LA 1GFUA 4Z3MA 1C45A 4LRTA 3I4YA 1OVKA 1NVMA 1HERA 1QTZA 2MJ5B 1GAYA 1OWYA 1WTNA 205LA 3HZJA 4DR6M 3L2AA 1L71A 1LSEA 5LYMA 2XZFA 1L0JA 3HWSA 231LA 3DOAA 2W82A 2B3TA 5LMNM 4NEBA 3GPUA 1L07A 2VQFM 3J4GA 4KLNA 1L23A 1T8GA 1L57A 3HT7A 4I7SA 3LVWA 2UU9M 2LZTA 3B74A 158LA 192LA 240LA 1D0MA 3N9AA 2V1CA 5DFLA 4NSIA 2Z2FA 4PGJB 153LA 1C69A 197LA 2Z19A 1ZYTA 2UXBM 168LA 5A2QS 4B7FA 3U6DA 3QYBA 2I26L 3OE9A 1IP1A 4NGKA 3GULA 5DNYA 1YAOA 1V7SA 215LA 1RU3A 2G3QA 1I20A 1C67A 3T38A 1ZAEA 1C62A 4IBDA 5B06A 4IJEA 1DGHB 108LA 226LA 5ILCA 2CRUA 1OJLA 1G3IA 1FLWA 1L26A 1N78A 2O25A 4GC9A 2BPUA 2W1YA 3PNVA 2O5RA 1L58A 2KHHA 247LA 5K7OA 1S3SA 1P6YA 1GFKA 1YIKA 1JTNA 1N34M 1H6MA 4NGIA 3RT5X 1HT1E 1O23A 1QAOA 1LYOA 1DO2A 144LA 4G4QA 2Y21A 2HTXA 3CF0A 1WQNA 4LF6M 3TWLA 3C83A 1GBXA 7CATA 1NV9A 1L0KA 1L08A 1CU2A 1IR7A 4TSBA 3T6PA 222LA 1L51A 1E8LA 4DR4M 1QVRA 4LRSA 5L9JA 5BPVA 1YANA 4EOFA 1IWUA 2DHYA 3W0FA 171LA 1L35A 2DQDY 4M6DA 8LYZA 1LYJA 1QTVA 2OU0X 152LA 4ET9A 3PDSA 1JITA 4NGVA 3I01M 1RE2A 1D3MA 3B0IA 3GUMA 1P2RA 4WG1A 3DN4A 1B5ZA 5GKNA 3HT6A 3VFDA 1IP7A 1KNIA 2K47A 4H94A 1C43A 4GN4A 1J1XY 4NG1A 3A95A 3A94A 4LT2A 3GLIA 257LA 2WARA 183LA 5T3FA 3H4JA 2XSZA 4LFCM 3WXTA 237LA 3TMWA 1L49A 1Q39A 3RE8A 4H91A 3D8LA 1PGYA 4NSGA 1LSZA 2F5NA 1W5TA 1XWIA 3CDQA 1TTEA 2XEPA 4D82A 4B08A 4GHAA 5DYGA 3SBJA 1SX7A 1L34A 1HFZA 1DZBX 1DGFA 4LFBM 4LJ8A 2YBLA 5LMUM 5KXTA 1L60A 3QAKA 3K1JA 1Z6TA 2KW0A 1XNRM 1C7PA 5I5QA 2GQFA 1G0QA 1CX6A 2Y0TA 4AZFA 2ZIJA 1YAMA 5LAFA 5F81A 1XGRC 3C80A 3I04M 200LA 4TSCA 4ANRA 3GRYA 1NWGA 1JUGA 1QT3A 2G5GX 2C98A 4WMGA 5LVIA 4DR5M 5KXMA 3ZC7B 1C6BA 1L83A 4IAPA 3C7YA 120LA 2RGOA 4Z6YA 3DKEX 2F4VM 2BJVA 4DUYM 4H9IA 3WPJA 3P4ZA 1E9RA 1L65A 1MLCE 3A93A 2A7DA 1N32M 1IOCA 1Z59A 2DKLA 4LGYA 3LVVA 3MMPA 1AKIA 1IY4A 3ZQJA 3C7ZA 1DGGA 4LF4M 1CJ9A 1OV7A 2HUMA 2F32A 3WHKA 4DUZM 5LXWA 3LQQA 133LA 3M0EA 130LA 4ZIXA 2UUBM 4ETAA 1OAIA 2LHGA 4AQNA 2FH0A 1UUZC 3DMZA 4J1BA 4PT5A 1NBYC 157LA 2APLA 4GCEA 2LVQD 4TWSA 3TXDA 3NY9A 2CJLA 3KP1E 193LA 2DAIA 2MEEA 5H37D 6LYTA 1LMTA 4EKRA 1G7IC 1OUHA 3JR4A 3UMMA 244LA 3OTOM 1HR0M 4LT0A 1DPWA 3MK6A 4W58A 2Y0QA 4G6ZA 4NSJA 4YEOA 162LA 1L14A 5AMYA 2B73A 4BLCA 3GPPA 1FKQA 4FCWA 5EXPA 2QPAA 3FUTA 2C8PA 2O7AA 2G4QA 2EKFA 1IC7Y 1L90A 3HDFA 1K82A 2MEGA 5HNCA 2OTZX 2ANXA 4X64M 2ZWBA 5EP2A 1IXSA 224LA 2YFQA 4D80A 4CIZA 3LMMA 4FWDA 5KXOA 233LA 2LYOA 2RAYX 1K3XA 3CDVA 5I4WA 1LHHA 3JR6A 2FYDA 1REMA 1C6FA 4EIWA 1YKYX 1IP5A 1KS3A 2DAGA 3HJQA 4J7VA 1HNWM 3THGA 4WO9A 4HTKA 3HHZA 4Z41A 1OV5A 2F4AA 4S12A 1DYFA 4EKQA 5KXLA 3B9PA 2OOAA 4FW9A 1L46A 4BAFA 1GLNA 1TEWA 2W1XA 260LA 3RGSA 3HBHA 3A96A 5IDDA 1LYGA 1LHKA 5JI2E 4RW1A 2RBNA 3G3BB 1DYEA 1L44A 3T1YM 1K28A 1C6GA 3GLGA 1ZURA 1QZMA 3A42A 3JR5A 1G59A 1DI4A 1LJIA 5C6LA 4UN2B 3C82A 1LI6A 182LA 1XJTA 4AW4A 5D5CA 1IX0A 4YX7C 4NHQA 195LA 3HTDA 3HU1A 1CJ6A 3HHYA 4XN6A 2R4EA 1I56A 1ZWNA 2BQLA 5EBHA 1GD6A 3AZ6A 1DO0A 1P2LA 2OPFA 1N75A 5FSWA 2MECA 1L38A 3GLIB 1JKBA 2BQOA 1JR3E 4ARPA 3GLFA 1IFYA 1JPOA 5C1BA 5KXYA 3SP3A 1JIYA 2DQIY 1BGIA 3P68A 1QT7A 4PRQA 9LYZA 3C81A 4N5RA 1GXV2 4LFAM 1LTMA 4KT3A 1LYIA 110LA 1IBMM 1HHLA 1LZ6A 2FBDA 2W1MA 3E3DA 1B7LA 1GF9A 1R2ZA 2C5RA 2JWSA 1B5XA 4LYZA 1TH4A 1HSXA 1NDGC 1QSWA 1UBZA 2CWIA 3OE0A 1LYFA 3W6EA 3TXGA 2YSSC 1XEPA 4H9AA 3WVYA 5ITYA 2JZ0A 4DD7A 3PVSA 229LA 2C96A 1GDXA 5I54A 4RF1A 2DZLA 3VDPA 1KIRC 4RF0A 3D4SA 1G7LC 1CUQA 3CGWA 2MEFA 1WXQA 3HT8A 3DA1A 3RZEA 1L93A 1L97A 4JI1M 5L8RF 2FNAA 3L25A 4WM3A 2EKKA 6LZMA 4GITA 2OE4X 4NXMM 2ZYCA 2CEAA 4WURA 3N9CA 3U6CA 1LKRA 3RNXA 1LJKA 1G7HC 1L37A 1QUTA 1LSNA 1IXZA 3B72A 1UCOA 4Q7JA 4WM5A 3DMXA 1LSMA 4GN5C 4IJFA 4B7HA 4HEOA 4PK0A 3B89A 4REZA 1GWDA 2LCBA 1C6CA 4IBCA 1R5LA 3GUOA 3IECA 1QUHA 3WH1A 1T6OA 1YROA 3I4VA 4GCCA 2OEAX 1GBOA 2R44A 3SFZA 5F3WA 1LZ8A 261LA 5LVJA 1PM5A 1CUPA 4JI0M 2CV2A 3RUNA 1REYA 5F14A 4FCVA 4W5WA 2I25L 4MCKA 5KJ9A 2KXEA 3E21A 4IIWA 4I81A 256LA 5DM9A 2QB0B 4RW2A 2MH8A 1NHEA 126LA 3K9PA 2RB1X 1SXJB 3LZ2A 4CFPA 4NSRA 3UZUA 3VK7A 3TXJA 3OE6A 138LA 1IXSB 1L68A 4E97A 1L30A 4DV3M 3KOZE 1B0DA 1IC5Y 1I94M 4JI6M 1LI2A 4YEMA 2BQHA 3CF6E 2D4JA 1GE0A 4GIPA 1Y8GA 1P56A 1JTMA 4M9ZA 2F30A 1OVJA 1KXWA 1GE2A 4GHLA 2YBJA 4G3OA 1TCYA 3A67Y 5KXKA 2ZQ3A 4GN3A 2BQCA 3HU9A 1L43A 2X49A 3CQLA 3TXFA 2OOBA 5KKJA 236LA 4MR1A 4H8XA 4ZPUA 4X65M 2HKJA 1X37A 2MEDA 5BR8M 1DYBA 1L74A 2MEBA 1OUAA 1B7RA 1C6QA 3D9AC 3GLGB 3AJIB 1DYDA 252LA 4JXJA 3V2WA 4JYAM 1IY1A 1LHLA 4HP0A 3W6DA 1G8PA 1L85A 1HF4A 1QSBA 2N35A 4WLXA 125LA 1REZA 1A4VA 1MN3A 4EKSA 4XGIA 4TUNA 4UWUA 5C6JA 3HH4A 5FTKA 4BS7A 1CV4A 2BLYA 2KEBA 2OQ4A 1J7KA 1YSYA 1XJUA 4N8ZA 4A3VB 3GLFB 2Z8YM 4NL4H 1L12A 3FUVA 4LZZA 1GB5A 1RFPA 4L15A 5EP4A 160LA 1L03A 1OUDA 4H9CA 1OWZA 1L19A 3ULRA 3P64A 2ANVA 4DC4A 3AZ4A 2EJSA 209LA 2Z37A 1XMQM 1C66A 1QT8A 1XSFA 1L04A 1TR8A 1OIPA 258LA 5EXTA 3LYMA 4I7PA 4NGYA 2OE9X 4H1PA 3TXKA 1L54A 1QUOA 1L42A 1L31A 255LA 3T6UA 1VEJA 1JB0F 4XJBA 4TUWA 2YNMD 2Z4SA 1C6EA 1KIQC 1NF5A 1LPIA 1TH3A 1SWYA 4RLMA 2C9CA 1BB5A 3SBAA 3CTWB 1LSPA 5APFA 5E9RA 2CV1A 1H6UA 4YXAC 5I14A 1NSFA 2X0AA 254LA 1OIZA 2H1RA 3GUNA 1G0PA 1WTHA 1VDLA 3ATOA 2ZM6M 4KL7A 1WGLA 1L61A 4YF2A 3U60A 3KOXE 2LNHC 4J1AA 1LJHA 1OUFA 1PJIA 4RKUF 2I7NA 1IBLM 1SX2A 4LJAA 123LA 3W6AA 3EBAB 3NBXX 3ZEKA 178LA 235LA 1IN8A 3SB5A 1DI3A 2KRUA 1T3PA 4H9FA 4OWBA 1ALCA 1LZAA 1ZMUA 4GRVA 4BAPA 3B7QA 3HKPA 3TPZA 1LZCA 5FEKA 199LA 1G1VA 1B5UA 4OVZB 1LW9A 4HSFA 131LA 1TDHA 1UFZA 1UIDA 1G4AE 2L78A 5FDJA 2X8AA 4BBAA 1L67A 1GPQC 1LSGA 3W6BA 3HJSA 2V6ZM 1WVVA 2H5ZA 2RH1A 234LA 2EKSC 2WZJA 3J7AS 4LF7M 3ILKA 2RAZX 3DN2A 1KW7A 3KSJA 1LSYA 1UIEA 1W08A 5IT9S 1IP2A 4ET8A 4KT0F 1B7MA 4DV7M 5B07A 3C3EA 1GBZA 2QARC 1GE1A 1IP3A 1JWRA 2IGCA 2R4JA 1LJEA 5C6IA 1OP9B 4W96A 1WR1B 1CKFA 1H87A 1CKHA 4W55A 4MSTA 2DWLA 1C6TA 4DT3A 4MM3B 4I7NA 3HDEA 4DBGB 4F1IA 3U6PA 1UIFA 3L27A 4WP2A 2E5LM 1CV0A 2OTYX 4GLVA 3CB7A 2JXNA 2M5ZA 4DR3M 5KO3A 218LA 5DN5A 4Z46A 1HEOA 4DJHA 1TDYA 2O4WA 3TWKA 1IC4Y 1LPYA 4M0DA 1KY0A 4EMNA 2RKOA 1IWXA 3AJNA 4XYYA 5I4YA 2CUUA 4IBIA 1XXHA 4DV6M 1N77A 1B9OA 3FUXA 3QYEA 1AZFA 1GFHA 3RU5A 2I7PA 165LA 1NY5A 3SB9A 3WHLA 1HFYA 4M0WA 4GCFA 4A7DA 3DFZA 5KXPA 1CU6A 2LZMA 3FKEA 198LA 1QTEA 1L2DA 3B7NA 4GRIA 1G07A 1MX0A 4I4LA 3K3TA 4FWGA 1HELA 3BKHA 2J5YA 2F2QA 1QTBA 4NWEA 1LSCA 1DXJA 4CJ2A 3B0KA 3G3AB 4IATA 1LZNA 1L16A 2HEAA 4GLAA 2RGHA 4LYOA 4EKPA 2R62A 1SSYA 1LMNA 3A45A 3WULA 2LVPC 4H8YA 5LA8A 1VDQA 2GNOA 2KNAA 5ITUA 1QS5A 1EPYA 1PJSA 1CV3A 4MGIE 2F2NA 4I7KA 3U5ZB 1C6JA 2L7IA 2XBRA 2BWEA 1OVHA 1L21A 4EXMA 2P5TA 238LA 5M1YA 1HJPA 3BXWA 4PRUA 4C5FA 5LYZA 2FS1A 3QE8A 1NNJA 241LA 1F0WA 3WW5A 2CFOA 3AOEC 1FLYA 1IP6A 3VW7A 2ZTDA 1L76A 1YKXX 4MGHA 1I6SA 1YE9A 1B7OA 4L8RC 2QBYB 1PQDA 3GQ4A 4L41A 1C6PA 1AUAA 1QT6A 3G3WA 1HSWA 2EO2A 5A3EA 1NHWC 2QHOB 1L77A 3JAMS 2KZSA 3SATA 3B0OA 3N9EA 1F6RA 1UIHA 3PFIA 118LA 1LJ4A 1IO5A 1AT5A 246LA 2BQMA 4FD2A 2RBOA 2W1LA 1IBKM 1R7RA 3MJ5A 3HGIA 217LA 3J27B 1GAZA 245LA 1IIZA 3AKZA 5IELA 4XJIA 4Z8XA 1VQ1A 112LA 4DKLA 1NKHA 2YBNA 1ORYB 2DQCY 4LYBA 3DN3A 1DKKA 1D2NA 1QANA 3IWRA 3VKGA 1T8AA 1GEZA 107LA 5D5FA 156LA 3GRUA 4BB9A 1L11A 1GB0A 1FLQA 119LA 4WM6A 1L1TA 113LA 3BKVA 4ARMA 1EIJA 3HH5A 4NGLA 5II3A 4H8ZA 3KXEC 3HBEX 4GCBA 1JSFA 2UUCM 4ZFPA 2BNKA 2LH0A 1K3WA 2HEEA 4H9BA 1BWHA 2NQ8C 164LA 3PBLA 2A4TA 1LYHA 1CV6A 2L7HA 3SHGB 4LJ7A 3WU7A 1JEFA 1WQMA 2OU9A 1IWYA 1L52A 3AGHA 4FVMA 177LA 5DYIA 4XBOA 4KO8A 3W6CA 3U6MA 2RBQA 3TE6A 1LGUA 1XGUC 223LA 4IBGA 4CHTB 3M18B 1YAPA 3L64A 146LA 1LYDA 3GP1A 1CUKA 1C46A 1NDMC 2XGNA 4OO9A 4P16A 2HEFA 4II8A 3AGIA 4Y28F 2R65A 172LA 1XFPL 5IZ7D 2YBMA 3K8ZA 1XXHB 3GLHE 4NXNM 3C58A 1D6PA 4GBRB 3LCUA 2EPEA 4DR2M 4LZMA 3L29A 250LA 4JV5M 1LJJA 2DENA 1PQJA 2Q9DA 1SWZA 1ZMYL 181LA 1UM8A 2NTHA 1HFXA 2HEBA 5FTMA 4DD9A 4G4CA 1OKSA 5EP3A 3KW6A 1GF6A 1D3JA 1QDRA 5B1FA 4EPIA 3HTGA 1YUBA 4XADA 1JKAA 3U6SA 1J1OY 2IHLA 1KXXA 1MU5A 114LA 5LINA 1LYZA 1VEDA 4I8OA 3HBDA 1NY6A 4PDIA 5JI3E 3FTCA 1IWWA 1RI8B 1GE4A 3VWOA 4DV2M 3SN6R 4W52A 1BB3A 4B3TM 3NWLA 1FN5A 3CT1A 1QT4A 3GXRA 1MJGM 3HX3A 4DV5M 2DWMA 4PHIA 2FOIC 3DZDA 2L09A 3WPLA 4B49A 4ARQA 2YDGA 2JY7A 4NFVA 1BWIA 3SAUA 1B7SA 4N1EI 3C9PA 2DXIA 2QP9X 187LA 1FKVA 3FUUA 1Z5AA 3GO8A 1L47A 1LZSA 1GF8A 1OUCA 2B6TA 4NOOB 3A6BY 4HTQA 4ITQA 1YL1X 1LMQA 4MGZE 1L66A 1B7PA 1P3NA 1B5WA 5KXRA 1L96A 5J7CA 1IXRC 3LZTA 3CT0A 1G0MA 4E3UA 5LA5A 3E46A 2XTHA 2BJWA 3HH3A 4LCBA 4DV4M 1C68A 1L01A 1FNNA 1SXJD 2AHMA 5KY1A 1QUDA 4TTDA 4HJYA 3T15A 4OWCA 1E32A 4LT1A 4H9EA 1GFRA 1QUSA 3WUNA 173LA 2F47A 4LJ4A 4M9XA 4HPIA 1C6AA 4G4NA 3FTDA 1GABA 1DPXA 1L72A 2XH9A 2ZNXY 5FTJA 4LF9M 3B7ZA 1ZMVA 1D3FA 2CWBA 1HQCA 5APCA 1L24A 2JUJA 1A5TA 3FYDA 1GF4A 1GBYA 4IJ4A 1L94A 2D4KA 2G4PA 1A2YC 1BVKC 3FUWA 4X66M 1B2KA 2CGIA 5ITRA 1LHMA 2DI0A 3VDUA 2X4AA 3LCVB 2RRUA 3WW6A 4BADA 2L4EA 2JZ1A 3FYCA 1BWJA 1J1PY 4MH0E 1GL6A 3EO5A 248LA 4LJ9A 1NQIA 1VDPA 4RNAA 2Y8PA 3KP0E 3WXUA 2DNAA 191LA 1LGXA 3GPYA 1J5EM 4PJZA 3KSXA 1JTPL 3AZ7A 1IQPA 3J7BA 1LYYA 1VDDA 3D8BA 1QS9A 2LC9A 2MR9A 2LBCA 4FJRA 1F6SA 3SBBC 1QTCA 1WGNA 1TAYA 5LVKA 4PPOA 1HNLA 4DQ7A 5LVGA 2JY8A 2EA0A 2B70A 2HL7A 1XEIA 1IOSA 4B7GA 1E9SA 4I7RA 2LVAA 1C6KA 1B5YA 1L17A 4YOPA 3KFUG 3DN0A 3LN2A 5DN4A 3L2XA 1UIAA 3FD9A 1G1WA 111LA 1W6ZA 1OUBA 1OQYA 1L29A 1GF3A 2D7EA 4DQJA 1B7NA 4DD1A 4QY9A 4DDCA 143LA 3BOSA 2UUAM 1QSQA 4HJVA 3WPKA 4ZEEA 4B4IA 3ZCBB 2PC2A 1N36M 4G9SA 2LTUA 2CDSA 1QSAA 243LA 3HY5A 1AIPC 4GEWA 1XGTC 2LVOC 262LA 5ILFA 3T36A 3C7WA 3V2YA 2XJWA 5ITXE 1Q3CA
chains in the Genus database with same CATH topology
1KW5A 1JHLA 3W6FA 3UONA 2FBBA 4HV1A 4Z98A 1VAUA 1L59A 2MEIA 141LA 1LYSA 4NG8A 1ZVYB 4WG7A 208LA 2NTGA 1LZDA 1WVUA 4C3WA 1NBZC 1YKZX 1OUJA 4NSHA 1PQOA 1LLHA 1VFBC 228LA 1GF0A 4QEQA 3TMUA 2D6BA 4OWHA 1BB6A 5APEA 1GBSA 1L09A 1IWZA 3DMVA 4I7OA 2DQGY 4WLTA 1PQKA 4LYCA 1LZYA 1GFTA 1YL0X 1C63A 3FI5A 2DBTA 4DQ5A 1B5VA 1P64A 230LA 2Z12A 1JKCA 4ARJA 169LA 4HTNA 1AT6A 5DL9A 1GFEA 5LZMA 1L10A 2LYMA 3GUKA 1WQPA 1L40A 2B74A 1IR8A 7LYZA 1L92A 1VATA 2G4NA 1D0KA 1L53A 4H93A 3W3EA 214LA 5LAGA 176LA 3F9LA 1DYAA 3J6KA 2Z2EA 4W56A 1G7MC 2Z18A 4IASA 1WQQA 1BB4A 3ZVQA 1JTTL 3GUPA 1T8FA 1IORA 2ZQ4A 4M4OA 1EQ5A 219LA 1IY3A 1LZ4A 3TXIA 4I8SA 1ZV5L 122LA 1GB6A 5FSTA 1Z55A 1T6HA 137LA 4W59A 1IVMA 1GFGA 1L86A 1QTKA 2XQOA 3C8SA 2BQJA 3AW6A 1P37A 1NHBA 5B59A 3AYQA 174LA 3G3VA 1LMPA 4W53A 4R6CA 2ZNWY 4DYGA 2YBHA 1LSAA 4WL6A 4XJHA 3A8ZA 3IJUA 1L36A 1BB7A 1L27A 1C64A 3B6LA 5HMJA 4X3BA 109LA 4LFPA 1OUIA 3EXDA 1L02A 3ODUA 5IHGA 1KIPC 1LHIA 1CV5A 1L15A 4NHTA 4EPFA 184LA 1L73A 1L28A 134LA 1GBWA 1NMMA 3HH6A 1CX7A 194LA 1L69A 4DDBA 1LHJA 3WYHA 2ZYPA 167LA 2NWDX 1QQYA 1LSDA 2OE7X 227LA 3HTFA 4R0FA 1TBYA 4I0CA 4CHXA 1HC0A 1N4FA 4HPEA 2HULA 5I4XA 4LDLA 4NIJA 4S0WA 3P66A 1EQ4A 1G0KA 1L00A 4XJGA 4EJ4A 1L48A 1LMOA 212LA 225LA 2BAAA 2RBSA 1JSEA 4DD2A 4ETEA 1DI5A 2B75A 3WL2A 1L22A 151LA 2Z38A 3HT9A 2Z6BA 3OK0A 166LA 3RZ4A 1GF7A 2BQFA 1L89A 1D0LA 4DD3A 1L91A 3A90A 1L79A 4NHSA 3A91A 2B5ZA 1L56A 2LYZA 2MEAA 1C10A 3DN6A 5E4PA 2BQAA 3HUKA 1L13A 3EMLA 3ATNA 1LZGA 5FHWA 1C6LA 4DAJA 1DYGA 4AGAA 4W54A 4NGZA 1PS5A 1P2CC 4G4HA 1LMAA 1L32A 5DLAA 3DN8A 4N9RA 2BQNA 4ETDA 1L99A 2DQFC 253LA 4WLDA 1CU5A 1HEMA 1QTHA 3F6ZA 1IR9A 2LZ2A 1OUGA 3GUJA 3ZVQB 1L39A 1DKJA 4NY5A 2YBIA 4W51A 4W94A 140LA 180LA 3CT5A 1L63A 3A6CY 1B6IA 1HEPA 4H9HA 3WMKA 5JENB 3AGGG 221LA 2HU3A 154LA 1FDLY 3TMXA 1LJFA 2FYCA 1LOZA 189LA 5KXWA 3NYAA 4LDOA 2RB2X 1LZTA 201LA 1LCNA 5FCPA 1L84A 2RBPA 1UICA 4DD0A 4UWNA 186LA 3LZMA 2H9KA 3CDTA 2LHMA 159LA 2EQLA 4HJZA 2D4IA 103LA 2OU8A 127LA 1GDWA 211LA 4H90A 4YENA 1SLYA 1QT5A 2A7FA 1L55A 3TXHA 1T97A 4RDSA 4OOOA 2Q0MX 1C6MA 2BQIA 4LDEA 4WM2A 161LA 4OWEA 1L75A 5B1GA 4WLYA 1QDTA 1IEEA 1CJ7A 4J0LA 4CFOA 2DQHY 185LA 4B4JA 4ML7A 3RW8A 1C6NA 4OWAA 1VDTA 1QUGA 4XENA 170LA 3TXBA 2DQJY 1JQUA 1C61A 4W57A 5LVHA 2HUBA 232LA 3A3QA 4WM1A 1C08C 207LA 239LA 5HQ1A 1G0JA 1L64A 4AXTA 1AM7A 1UIGA 3OJPA 4U3XB 2B7XA 139LA 1LWGA 3K2RA 5L3IA 188LA 115LA 1L45A 4ARLA 2BQGA 2RBRA 2BQEA 5B05A 1SSWA 3LYOA 1CV1A 5I53A 135LA 4H92A 2N5ZA 3SB8A 4ETBA 5APDA 1LGWA 1L87A 5KXXA 1CU3A 1GB2A 4N1CC 1JISA 128LA 1FLUA 4QGZA 1LI3A 3GUIA 1KY1A 1GEVA 2B72A 3A92A 4I7TA 5KXSA 1IWTA 132LA 1PZYA 4NHPA 1GFVA 4B4EA 4KXIA 1GB7A 259LA 3OE8A 3FA0A 190LA 1JJ0A 3HU8A 1G06A 1DQJC 1LYEA 4UWVA 1L50A 4FDYA 4P2EA 2XBSA 1GE3A 4G49A 1L05A 1L80A 4LT3A 2ZIKA 3IJVA 2RSCA 4NHIA 5LYTA 4TX7A 2I6ZA 4KPMA 1I1ZA 4DDAA 4I7QA 1L98A 2BQBA 3QNGA 4YXCA 2O79A 4WOAA 1LZ5A 1HMLA 3HFMY 210LA 145LA 3D3DA 1GB3A 175LA 1INUA 1RJCB 1L33A 1BVXA 4N0JA 4OOTA 4RLNA 1EQEA 1L70A 4WL7A 1LKSA 1IOTA 1D9WA 3HTBA 2F4GA 4ARMB 3LYTA 1L25A 4PJ2C 4B1AA 4DWXA 2ZILA 1GF5A 2BLXA 3C8QA 3EMSA 1BQLY 3AB6A 4XJFA 1L20A 1LZ9A 242LA 4CGEA 1GFJA 1JTOL 1WQRA 5KKIA 5LIOA 2MEHA 1G0LA 1CKGA 1TLAA 1GFAA 3DN1A 3MGWA 5A3ZA 1P36A 2HECA 1EL1A 4XJDA 3WU8A 1HEWA 5HMVA 1LJ3A 1L06A 1C6IA 3TXEA 3CDOA 3DNAA 5L3HA 1CKCA 2IFFY 149LA 1D2WA 1CU0A 150LA 3C8RA 4LFXA 5KXZA 5F16A 1BHZA 3KAMA 104LA 3SB7A 1B7QA 2HU1A 1JJ1A 5KXNA 4OW1A 3TMVA 3GXKA 3FADA 1XGQC 3CDRA 4WM4A 1DYCA 3FI7A 3WU9A 4ARQB 1GHLA 1CTWA 163LA 2HEDA 155LA 4I7LA 4NGOA 5FELA 3HUAA 4B0DA 4GCDA 4NWHA 2DQAA 2DKVA 2BQDA 4LYTA 3HWLA 2RB0X 3WVXA 1GB9A 2GV0A 3CSQA 1L18A 216LA 1PQMA 1QIOA 1UIBA 1D9UA 3AW7A 1REXA 4HV2A 3G3XA 1C6HA 3LHMA 1IOQA 4YM8A 2VB1A 2HUKA 2B6WA 1CNSA 4I7JA 4ETCA 1P5CA 1OQMA 1SQ2L 1CJ8A 1D6QA 2BQKA 1YQVY 1FBIX 129LA 1IWVA 1JJ3A 1LJGA 3AZ5A 4QDNA 1UC0A 147LA 3A3RX 251LA 1RCMA 1F10A 3LYZA 1L95A 3HUQA 1CKDA 4WO6A 220LA 1D3NA 3CSRA 3M3UA 5F9UA 1YILA 1OUEA 1D2YA 148LE 3SB6A 2B6ZA 1OYUA 1LZEA 3WUAA 1L41A 4LGKA 206LA 1L81A 2D91A 5HNLA 2EIZC 1LMCA 4NGWA 1MELL 1G0GA 1P46A 1L88A 249LA 1XGPC 2C8OA 1G7JC 1LZ1A 1T6VL 1KXYA 1XEJA 1GXXA 1UA6Y 1C60A 1WTMA 1LZBA 1XEKA 1C65A 1C6DA 2YVBA 2B6YA 1HEQA 4O34A 1UACY 3F8VA 5HLLA 4D9ZA 1LZRA 2Z39A 1CVKA 102LA 1LAAA 4LZTA 3WUMA 4LYMA 5F9XA 1LJNA 1L62A 196LA 1LWKA 3CSZA 4G4BA 1WQOA 1P7SA 1LSFA 1YAQA 1HENA 3NY8A 3FE0A 4K5YA 1L82A 4I7MA 1IP4A 1JKDA 1LSBA 3QY4A 2Q9EA 3P65A 1VDSA 1GB8A 1QTDA 142LA 1HMKA 4NGJA 7LZMA 1PQIA 213LA 6LYZA 2AUBA 1V7TA 3A34A 2H9JA 1ZVHL 2DQEY 1GFUA 4Z3MA 1C45A 1OVKA 1QTZA 1HERA 1GAYA 1OWYA 1WTNA 205LA 1L71A 1LSEA 5LYMA 1L0JA 231LA 4NEBA 1L07A 3J4GA 1L23A 1T8GA 1L57A 3HT7A 4I7SA 2LZTA 158LA 192LA 240LA 1D0MA 3N9AA 4NSIA 153LA 4PGJB 2Z2FA 1C69A 197LA 2Z19A 1ZYTA 168LA 2I26L 3OE9A 4NGKA 1IP1A 3GULA 1YAOA 1V7SA 215LA 1I20A 1C67A 1C62A 5B06A 108LA 226LA 5ILCA 1FLWA 1L26A 2BPUA 2W1YA 1L58A 247LA 5K7OA 1P6YA 1YIKA 1GFKA 1JTNA 1H6MA 4NGIA 3RT5X 1O23A 1LYOA 144LA 2HTXA 1WQNA 3C83A 1GBXA 1L0KA 1L08A 1CU2A 1IR7A 4TSBA 222LA 1L51A 1E8LA 5L9JA 1YANA 4EOFA 1IWUA 171LA 1L35A 2DQDY 4M6DA 8LYZA 1LYJA 1QTVA 2OU0X 152LA 4ET9A 3PDSA 1JITA 4NGVA 1RE2A 1D3MA 3B0IA 3GUMA 1P2RA 4WG1A 3DN4A 1B5ZA 3HT6A 1IP7A 1KNIA 4H94A 1C43A 4GN4A 1J1XY 4NG1A 3A95A 3A94A 4LT2A 257LA 2WARA 183LA 5T3FA 3WXTA 237LA 3TMWA 1L49A 4H91A 4NSGA 1LSZA 3CDQA 1SX7A 1L34A 1HFZA 1DZBX 2YBLA 5KXTA 1L60A 3QAKA 1C7PA 5I5QA 1G0QA 1CX6A 2ZIJA 1YAMA 5LAFA 5F81A 1XGRC 3C80A 200LA 4TSCA 4ANRA 1QT3A 1NWGA 1JUGA 5LVIA 4WMGA 5KXMA 1C6BA 1L83A 4IAPA 3C7YA 120LA 3DKEX 4H9IA 3WPJA 3P4ZA 1L65A 1MLCE 3A93A 2A7DA 1IOCA 1AKIA 1IY4A 3C7ZA 1CJ9A 1OV7A 2HUMA 2F32A 5LXWA 133LA 130LA 4ZIXA 4ETAA 4AQNA 1UUZC 3DMZA 4J1BA 1NBYC 157LA 4GCEA 4TWSA 3TXDA 3NY9A 2CJLA 193LA 2MEEA 6LYTA 1LMTA 4EKRA 1G7IC 1OUHA 244LA 4LT0A 1DPWA 4W58A 4NSJA 4YEOA 162LA 1L14A 5AMYA 2B73A 1FKQA 2C8PA 2O7AA 2G4QA 1L90A 1IC7Y 3HDFA 2MEGA 5HNCA 2OTZX 2ANXA 2ZWBA 224LA 5KXOA 233LA 2LYOA 2RAYX 3CDVA 5I4WA 1LHHA 3JR6A 2FYDA 1REMA 1C6FA 1YKYX 1IP5A 1KS3A 4J7VA 4WO9A 4HTKA 4Z41A 1OV5A 2F4AA 1DYFA 4EKQA 5KXLA 1L46A 4BAFA 1TEWA 2W1XA 260LA 3HBHA 3A96A 5IDDA 1LYGA 1LHKA 4RW1A 2RBNA 3G3BB 1DYEA 1L44A 1K28A 1C6GA 1ZURA 1LJIA 5C6LA 1DI4A 3C82A 1LI6A 182LA 1XJTA 5D5CA 1IX0A 4YX7C 4NHQA 195LA 3HTDA 1CJ6A 4XN6A 1I56A 1ZWNA 2BQLA 5EBHA 1GD6A 3AZ6A 1P2LA 2MECA 1L38A 1JKBA 2BQOA 4ARPA 1JPOA 5KXYA 3SP3A 1JIYA 2DQIY 1BGIA 3P68A 1QT7A 4PRQA 9LYZA 3C81A 4N5RA 1GXV2 4KT3A 1LTMA 1LYIA 110LA 1HHLA 1LZ6A 2FBDA 2W1MA 3E3DA 1B7LA 1GF9A 1B5XA 4LYZA 1HSXA 1NDGC 1QSWA 1UBZA 2CWIA 3OE0A 1LYFA 3W6EA 3TXGA 2YSSC 1XEPA 4H9AA 3WVYA 4DD7A 229LA 1GDXA 5I54A 1KIRC 3D4SA 1G7LC 1CUQA 2MEFA 3HT8A 3RZEA 1L93A 1L97A 4WM3A 6LZMA 2OE4X 2ZYCA 3N9CA 1LKRA 3RNXA 1LJKA 1G7HC 1L37A 1QUTA 1LSNA 3B72A 1UCOA 4WM5A 3DMXA 1LSMA 4GN5C 4PK0A 2LCBA 1GWDA 1C6CA 3GUOA 1QUHA 3WH1A 1YROA 4GCCA 2OEAX 1GBOA 1LZ8A 261LA 5LVJA 1CUPA 3RUNA 1REYA 5F14A 2I25L 4MCKA 5KJ9A 256LA 5DM9A 2QB0B 4RW2A 1NHEA 126LA 2RB1X 3LZ2A 4CFPA 3TXJA 3OE6A 138LA 1L68A 4E97A 1L30A 1B0DA 1IC5Y 1LI2A 4YEMA 2BQHA 2D4JA 1GE0A 1P56A 1JTMA 2F30A 1OVJA 1KXWA 1GE2A 2YBJA 1TCYA 3A67Y 5KXKA 2ZQ3A 4GN3A 2BQCA 3HU9A 1L43A 3CQLA 3TXFA 5KKJA 236LA 4MR1A 4H8XA 4ZPUA 2MEDA 1DYBA 1L74A 2MEBA 1OUAA 1B7RA 1C6QA 3D9AC 1DYDA 252LA 3V2WA 1LHLA 4HP0A 3W6DA 1L85A 1HF4A 1QSBA 4WLXA 125LA 1REZA 1A4VA 4EKSA 4TUNA 4UWUA 5C6JA 3HH4A 4BS7A 1CV4A 2BLYA 1XJUA 4N8ZA 1L12A 1GB5A 1RFPA 160LA 1L03A 1OUDA 4H9CA 1OWZA 1L19A 3ULRA 3P64A 2ANVA 4DC4A 3AZ4A 209LA 2Z37A 1C66A 1QT8A 1XSFA 1L04A 4I7PA 258LA 3LYMA 4NGYA 2OE9X 4H1PA 3TXKA 1L54A 1QUOA 1L42A 1L31A 255LA 3T6UA 4XJBA 1C6EA 1KIQC 1NF5A 1LPIA 1SWYA 4RLMA 1BB5A 3SBAA 1LSPA 5APFA 5E9RA 5I14A 4YXAC 2X0AA 254LA 3GUNA 1G0PA 1WTHA 3ATOA 4KL7A 1L61A 4YF2A 4J1AA 1LJHA 1OUFA 1SX2A 3W6AA 123LA 3EBAB 3ZEKA 178LA 235LA 3SB5A 1DI3A 1T3PA 4H9FA 4OWBA 1ALCA 1LZAA 4GRVA 4BAPA 1LZCA 5FEKA 199LA 1G1VA 1B5UA 4HSFA 1LW9A 131LA 1UIDA 2L78A 5FDJA 1L67A 1GPQC 1LSGA 3W6BA 1WVVA 2H5ZA 2RH1A 234LA 2EKSC 2RAZX 3DN2A 1KW7A 1LSYA 1UIEA 1W08A 1IP2A 4ET8A 1B7MA 5B07A 1GBZA 2QARC 1GE1A 1IP3A 1JWRA 2IGCA 1LJEA 5C6IA 1OP9B 4W96A 1CKFA 1H87A 1CKHA 4W55A 4MSTA 1C6TA 4DT3A 4I7NA 3HDEA 1UIFA 1CV0A 2OTYX 4GLVA 3CB7A 218LA 5DN5A 4Z46A 1HEOA 4DJHA 1TDYA 2O4WA 1IC4Y 1LPYA 1KY0A 4EMNA 1IWXA 3AJNA 4XYYA 5I4YA 2CUUA 1B9OA 1AZFA 1GFHA 3RU5A 165LA 3SB9A 4GCFA 1HFYA 4A7DA 5KXPA 1CU6A 2LZMA 198LA 1QTEA 1G07A 3K3TA 1HELA 3BKHA 2F2QA 1QTBA 4NWEA 1LSCA 1DXJA 4CJ2A 3B0KA 3G3AB 4IATA 1LZNA 1L16A 2HEAA 4GLAA 4LYOA 4EKPA 1SSYA 1LMNA 3WULA 4H8YA 5LA8A 1VDQA 1QS5A 1EPYA 1CV3A 2F2NA 4I7KA 1C6JA 2XBRA 1OVHA 1L21A 4EXMA 238LA 5M1YA 4PRUA 4C5FA 5LYZA 3QE8A 241LA 1F0WA 3WW5A 1FLYA 1IP6A 3VW7A 1L76A 1YKXX 1I6SA 1B7OA 1PQDA 4L41A 1C6PA 1QT6A 3G3WA 1HSWA 5A3EA 1L77A 3B0OA 3N9EA 1F6RA 1UIHA 118LA 1LJ4A 1IO5A 1AT5A 246LA 2BQMA 2RBOA 2W1LA 217LA 1GAZA 245LA 1IIZA 5IELA 4XJIA 112LA 4DKLA 1NKHA 2YBNA 4LYBA 2DQCY 3DN3A 1DKKA 3IWRA 1T8AA 1GEZA 107LA 5D5FA 156LA 1L11A 1GB0A 1FLQA 119LA 4WM6A 113LA 3BKVA 4ARMA 3HH5A 4NGLA 5II3A 4H8ZA 3HBEX 4GCBA 1JSFA 4ZFPA 2HEEA 4H9BA 1BWHA 164LA 3PBLA 2A4TA 1LYHA 1CV6A 3WU7A 1JEFA 1WQMA 2OU9A 1IWYA 1L52A 3AGHA 177LA 3W6CA 2RBQA 1LGUA 1XGUC 223LA 3M18B 1YAPA 3L64A 146LA 1LYDA 1C46A 1NDMC 4OO9A 2HEFA 4II8A 3AGIA 172LA 1XFPL 2YBMA 1D6PA 4GBRB 2EPEA 4LZMA 250LA 1LJJA 1PQJA 2Q9DA 1SWZA 1ZMYL 181LA 2NTHA 1HFXA 2HEBA 4DD9A 4G4CA 1GF6A 1D3JA 1QDRA 5B1FA 4EPIA 3HTGA 4XADA 1JKAA 1J1OY 2IHLA 1KXXA 114LA 5LINA 1LYZA 1VEDA 3HBDA 1IWWA 1RI8B 1GE4A 3VWOA 3SN6R 4W52A 1BB3A 3CT1A 1FN5A 1QT4A 3GXRA 4PHIA 3WPLA 4B49A 4ARQA 2YDGA 4NFVA 1BWIA 1B7SA 4N1EI 1FKVA 187LA 1L47A 1LZSA 1GF8A 1OUCA 2B6TA 3A6BY 4HTQA 1YL1X 1LMQA 1L66A 1B7PA 1P3NA 1B5WA 5KXRA 1L96A 5J7CA 3LZTA 3CT0A 1G0MA 4E3UA 5LA5A 2XTHA 3HH3A 1C68A 1L01A 5KY1A 1QUDA 4TTDA 4HJYA 4OWCA 4LT1A 4H9EA 1GFRA 1QUSA 3WUNA 173LA 2F47A 4HPIA 1C6AA 1DPXA 1L72A 2ZNXY 1D3FA 5APCA 1L24A 1GF4A 1GBYA 4IJ4A 1L94A 2D4KA 2G4PA 1A2YC 1BVKC 1B2KA 2CGIA 1LHMA 4BADA 3WW6A 1BWJA 1J1PY 3EO5A 248LA 1NQIA 1VDPA 2Y8PA 3WXUA 191LA 1LGXA 4PJZA 1JTPL 3AZ7A 1LYYA 1QS9A 2LC9A 4FJRA 1F6SA 3SBBC 1QTCA 1TAYA 5LVKA 4PPOA 1HNLA 4DQ7A 5LVGA 2B70A 1XEIA 1IOSA 4I7RA 1C6KA 1B5YA 1L17A 4YOPA 3DN0A 3LN2A 5DN4A 3L2XA 1UIAA 1G1WA 111LA 1W6ZA 1OUBA 1L29A 1GF3A 4DQJA 1B7NA 4DD1A 4QY9A 4DDCA 143LA 4HJVA 1QSQA 3WPKA 4ZEEA 4B4IA 2PC2A 4G9SA 2CDSA 1QSAA 243LA 1XGTC 262LA 5ILFA 3T36A 3C7WA 3V2YA 2XJWA 2B6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JHL A;  2ZIK A;  3W6F A;  3IJV A;  2FBB A;  4HV1 A;  2RSC A;  4NHI A;  1HFZ A;  1DZB X;  4Z98 A;  5LYT A;  1VAU A;  4TX7 A;  2I6Z A;  1LSY A;  1UIE A;  1W08 A;  4LT3 A;  1IP2 A;  4KPM A;  2MEI A;  4ET8 A;  1B7M A;  2YBL A;  5B07 A;  5KXT A;  1I1Z A;  1LYS A;  1GBZ A;  4NG8 A;  4DDA A;  1GE1 A;  1IP3 A;  1C7P A;  5I5Q A;  1JWR A;  1ZVY B;  2BQB A;  208L A;  4WG7 A;  3QNG A;  1LJE A;  2ZIJ A;  1LZD A;  1WVU A;  5C6I A;  1OP9 B;  1YAM A;  4C3W A;  5LAF A;  1NBZ C;  5F81 A;  4W96 A;  1CKF A;  1OUJ A;  1H87 A;  1CKH A;  1XGR C;  1LZ5 A;  1YKZ X;  4MST A;  4NSH A;  4TSC A;  4WOA A;  1HML A;  4DT3 A;  3HFM Y;  1VFB C;  1UIF A;  4ANR A;  1GF0 A;  1NWG A;  1JUG A;  4QEQ A;  4WMG A;  2D6B A;  4OWH A;  5LVI A;  3TMU A;  5KXM A;  3D3D A;  1BB6 A;  5APE A;  1GBS A;  1GB3 A;  3CB7 A;  4GLV A;  1INU A;  4H9I A;  5DN5 A;  1RJC B;  3WPJ A;  1IWZ A;  3P4Z A;  1MLC E;  1BVX A;  4Z46 A;  3A93 A;  1HEO A;  2A7D A;  1IOC A;  2DQG Y;  1TDY A;  4LYC A;  4N0J A;  1IC4 Y;  4OOT A;  4WLT A;  4RLN A;  1AKI A;  1EQE A;  1IY4 A;  4EMN A;  1IWX A;  1GFT A;  1CJ9 A;  1LZY A;  1YL0 X;  3AJN A;  4XYY A;  4WL7 A;  5I4Y A;  1LKS A;  1IOT A;  5LXW A;  133L A;  1B9O A;  2DBT A;  1AZF A;  1GFH A;  2F4G A;  3RU5 A;  1B5V A;  4ZIX A;  3LYT A;  4ETA A;  2Z12 A;  1JKC A;  1UUZ C;  4J1B A;  4PJ2 C;  4B1A A;  4GCF A;  1HFY A;  4DWX A;  1NBY C;  4A7D A;  2ZIL A;  4HTN A;  1AT6 A;  4GCE A;  1GF5 A;  5DL9 A;  5KXP A;  1GFE A;  4TWS A;  2BLX A;  3TXD A;  2CJL A;  3EMS A;  193L A;  1QTE A;  1BQL Y;  2MEE A;  3AB6 A;  6LYT A;  1LMT A;  4XJF A;  2LYM A;  1WQP A;  1G7I C;  1LZ9 A;  1OUH A;  3K3T A;  4LT0 A;  4CGE A;  1HEL A;  1IR8 A;  1DPW A;  3BKH A;  4NSJ A;  7LYZ A;  1GFJ A;  4YEO A;  4NWE A;  1VAT A;  1LSC A;  2G4N A;  1DXJ A;  5AMY A;  1JTO L;  1WQR A;  1D0K A;  3B0K A;  3G3A B;  1FKQ A;  1LZN A;  1CKG A;  2HEA A;  2MEH A;  4GLA A;  4H93 A;  5LIO A;  3W3E A;  1GFA A;  5LAG A;  2C8P A;  4LYO A;  5KKI A;  2G4Q A;  3MGW A;  1IC7 Y;  5A3Z A;  1LMN A;  2HEC A;  2MEG A;  3WUL A;  3J6K A;  4H8Y A;  5HNC A;  5LA8 A;  1VDQ A;  2Z2E A;  1EL1 A;  1G7M C;  2Z18 A;  4IAS A;  1WQQ A;  4XJD A;  1BB4 A;  2ZWB A;  3ZVQ A;  1JTT L;  3WU8 A;  1HEW A;  2F2N A;  1IOR A;  5KXO A;  2ZQ4 A;  4M4O A;  5HMV A;  2LYO A;  1LJ3 A;  1EQ5 A;  2XBR A;  1IY3 A;  1LZ4 A;  3TXI A;  4I8S A;  1LHH A;  1ZV5 L;  2FYD A;  3TXE A;  5I4W A;  5L3H A;  1GB6 A;  5FST A;  1CKC A;  1REM A;  5M1Y A;  2IFF Y;  1YKY X;  4PRU A;  1IP5 A;  5LYZ A;  4C5F A;  1Z55 A;  3QE8 A;  4J7V A;  4WO9 A;  4HTK A;  1F0W A;  4Z41 A;  3WW5 A;  2F4A A;  4LFX A;  1FLY A;  1IP6 A;  1IVM A;  5KXL A;  5KXZ A;  1GFG A;  5F16 A;  1QTK A;  1YKX X;  4BAF A;  1BHZ A;  3KAM A;  1TEW A;  2BQJ A;  1B7O A;  2W1X A;  3AW6 A;  3HBH A;  5B59 A;  3A96 A;  5IDD A;  3AYQ A;  4L41 A;  1LHK A;  1B7Q A;  4RW1 A;  2HU1 A;  1JJ1 A;  3G3B B;  1LMP A;  4R6C A;  2ZNW Y;  1HSW A;  5KXN A;  4DYG A;  4OW1 A;  2YBH A;  5A3E A;  3TMV A;  1LSA A;  4WL6 A;  3GXK A;  1LJI A;  5C6L A;  1DI4 A;  3B0O A;  1XGQ C;  3N9E A;  4XJH A;  1F6R A;  3A8Z A;  1UIH A;  3IJU A;  4ETE A;  1LJ4 A;  4WM4 A;  5D5C A;  1IO5 A;  1AT5 A;  1IX0 A;  1BB7 A;  3FI7 A;  3WU9 A;  2BQM A;  1GHL A;  4NHQ A;  3B6L A;  5HMJ A;  4X3B A;  2W1L A;  4LFP A;  2HED A;  4NGO A;  1OUI A;  3EXD A;  5FEL A;  1GAZ A;  1CJ6 A;  5IHG A;  1IIZ A;  1KIP C;  1LHI A;  4XN6 A;  5IEL A;  4B0D A;  1I56 A;  4GCD A;  4NWH A;  2BQL A;  4XJI A;  5EBH A;  1GD6 A;  3AZ6 A;  1NKH A;  2DQA A;  2YBN A;  2DQC Y;  4LYB A;  2DKV A;  1DKK A;  2MEC A;  4NHT A;  1JKB A;  2BQD A;  2BQO A;  3IWR A;  1JPO A;  1NMM A;  134L A;  1GBW A;  5KXY A;  1GEZ A;  3SP3 A;  1JIY A;  4LYT A;  5D5F A;  2DQI Y;  3WVX A;  1GB9 A;  1BGI A;  1GB0 A;  3P68 A;  194L A;  1FLQ A;  4PRQ A;  9LYZ A;  2GV0 A;  3CSQ A;  4N5R A;  4DDB A;  4WM6 A;  1GXV 2;  4KT3 A;  1LTM A;  3BKV A;  1QIO A;  4NGL A;  1UIB A;  5II3 A;  1D9U A;  1LHJ A;  3AW7 A;  4H8Z A;  3WYH A;  2ZYP A;  3HBE X;  4GCB A;  1REX A;  4HV2 A;  1HHL A;  1JSF A;  1LZ6 A;  2NWD X;  2FBD A;  2W1M A;  1QQY A;  1B7L A;  1GF9 A;  1LSD A;  3E3D A;  3LHM A;  1B5X A;  4LYZ A;  4ZFP A;  1HSX A;  1NDG C;  4R0F A;  1IOQ A;  4YM8 A;  1QSW A;  1TBY A;  1UBZ A;  2CWI A;  2HEE A;  2VB1 A;  4H9B A;  1BWH A;  4I0C A;  3W6E A;  4CHX A;  1CNS A;  1HC0 A;  3TXG A;  2YSS C;  4H9A A;  3WVY A;  4DD7 A;  4ETC A;  1N4F A;  1OQM A;  4HPE A;  3WU7 A;  1JEF A;  5I4X A;  1WQM A;  1SQ2 L;  1GDX A;  5I54 A;  4NIJ A;  1IWY A;  1CJ8 A;  1KIR C;  1EQ4 A;  3P66 A;  1D6Q A;  1G7L C;  2BQK A;  2MEF A;  3AGH A;  1YQV Y;  4XJG A;  3W6C A;  1FBI X;  1LMO A;  1IWV A;  1JJ3 A;  1LJG A;  3AZ5 A;  1XGU C;  4WM3 A;  2BAA A;  4QDN A;  1JSE A;  1UC0 A;  3M18 B;  4DD2 A;  3A3R X;  2ZYC A;  1RCM A;  1F10 A;  1YAP A;  3LYZ A;  3N9C A;  1CKD A;  1DI5 A;  4WO6 A;  1LKR A;  3RNX A;  1LJK A;  1G7H C;  3WL2 A;  1QUT A;  1C46 A;  1NDM C;  2Z38 A;  3CSR A;  3M3U A;  5F9U A;  2HEF A;  4II8 A;  1LSN A;  3AGI A;  1YIL A;  1OUE A;  3B72 A;  1UCO A;  1XFP L;  3OK0 A;  3RZ4 A;  1GF7 A;  2YBM A;  4IAT A;  2BQF A;  1D0L A;  4WM5 A;  4DD3 A;  1LSM A;  4GN5 C;  1D6P A;  3A90 A;  2EPE A;  4NHS A;  3A91 A;  1LZE A;  2B5Z A;  3WUA A;  1GWD A;  2LYZ A;  2MEA A;  1C10 A;  5E4P A;  4LGK A;  2BQA A;  1LJJ A;  2D91 A;  3ATN A;  3WH1 A;  5HNL A;  1LZG A;  1YRO A;  1ZMY L;  2EIZ C;  4GCC A;  1LMC A;  5FHW A;  4NGW A;  1HFX A;  2HEB A;  1GBO A;  1LZ8 A;  1MEL L;  4DD9 A;  4G4C A;  5LVJ A;  1GF6 A;  1XGP C;  2C8O A;  1QDR A;  1G7J C;  5B1F A;  4AGA A;  4XAD A;  1JKA A;  1REY A;  1J1O Y;  4NGZ A;  1PS5 A;  2IHL A;  1P2C C;  1LZ1 A;  1KXX A;  1KXY A;  1T6V L;  1XEJ A;  5F14 A;  1GXX A;  1LYZ A;  1UA6 Y;  2I25 L;  4G4H A;  5LIN A;  1VED A;  1LMA A;  5DLA A;  1WTM A;  3HBD A;  1LZB A;  1XEK A;  4MCK A;  4N9R A;  5KJ9 A;  2BQN A;  1IWW A;  1RI8 B;  5DM9 A;  1GE4 A;  2YVB A;  4ETD A;  3VWO A;  2DQF C;  1HEQ A;  4O34 A;  4RW2 A;  1UAC Y;  5HLL A;  1NHE A;  4D9Z A;  1BB3 A;  3CT1 A;  1LZR A;  1FN5 A;  2Z39 A;  4WLD A;  3GXR A;  1LAA A;  1HEM A;  4PHI A;  4LZT A;  3LZ2 A;  3WUM A;  3F6Z A;  4LYM A;  5F9X A;  1LJN A;  4CFP A;  1IR9 A;  2LZ2 A;  3WPL A;  4B49 A;  2YDG A;  4NFV A;  3TXJ A;  1OUG A;  3ZVQ B;  1BWI A;  1DKJ A;  4CJ2 A;  3CSZ A;  2YBI A;  4NY5 A;  1B7S A;  1B0D A;  1IC5 Y;  1WQO A;  4G4B A;  4N1E I;  4W94 A;  4YEM A;  1LSF A;  1YAQ A;  3CT5 A;  2BQH A;  2D4J A;  1GE0 A;  1HEN A;  3A6C Y;  1HEP A;  4H9H A;  3WMK A;  2F30 A;  1FKV A;  3FE0 A;  5JEN B;  1KXW A;  3AGG G;  1GE2 A;  2YBJ A;  1IP4 A;  1TCY A;  1JKD A;  1LZS A;  3A67 Y;  1GF8 A;  1LSB A;  2HU3 A;  2ZQ3 A;  4GN3 A;  5KXK A;  2BQC A;  154L A;  1FDL Y;  3TMX A;  1LJF A;  2FYC A;  3CQL A;  1OUC A;  1LOZ A;  3QY4 A;  3TXF A;  5KKJ A;  5KXW A;  3A6B Y;  4MR1 A;  3P65 A;  1VDS A;  4H8X A;  1GB8 A;  1LZT A;  4HTQ A;  1LCN A;  1YL1 X;  1LMQ A;  5FCP A;  1HMK A;  1B7P A;  4NGJ A;  1B5W A;  5KXR A;  1UIC A;  4DD0 A;  2MED A;  4UWN A;  6LYZ A;  5J7C A;  2AUB A;  1V7T A;  3LZT A;  3CT0 A;  2MEB A;  1OUA A;  3A34 A;  2H9J A;  1B7R A;  2H9K A;  4E3U A;  5LA5 A;  2XTH A;  1ZVH L;  2DQE Y;  2LHM A;  3D9A C;  2EQL A;  4HJZ A;  1GFU A;  4Z3M A;  1C45 A;  2D4I A;  1HER A;  4YEN A;  1GDW A;  4H90 A;  1GAY A;  5KY1 A;  1WTN A;  4TTD A;  1SLY A;  1LHL A;  4HJY A;  2A7F A;  4HP0 A;  4OWC A;  1LSE A;  4LT1 A;  3TXH A;  4H9E A;  3W6D A;  5LYM A;  4RDS A;  1GFR A;  1QUS A;  1HF4 A;  4OOO A;  4WLX A;  3WUN A;  2Q0M X;  4HPI A;  1REZ A;  4NEB A;  1A4V A;  2BQI A;  1DPX A;  4WM2 A;  4TUN A;  4UWU A;  4OWE A;  5C6J A;  5B1G A;  4WLY A;  2ZNX Y;  1QDT A;  1IEE A;  3J4G A;  4BS7 A;  2BLY A;  1CJ7 A;  4J0L A;  4CFO A;  2DQH Y;  4N8Z A;  2LZT A;  5APC A;  4B4J A;  4ML7 A;  1D0M A;  3N9A A;  4NSI A;  3RW8 A;  4PGJ B;  2Z2F A;  153L A;  1GF4 A;  4OWA A;  1VDT A;  1GB5 A;  1RFP A;  1GBY A;  4IJ4 A;  2D4K A;  2Z19 A;  4H9C A;  1OUD A;  4XEN A;  3TXB A;  3ULR A;  2G4P A;  3P64 A;  2DQJ Y;  2I26 L;  1A2Y C;  4NGK A;  1BVK C;  4NSG A;  1IP1 A;  4DC4 A;  5LVH A;  1B2K A;  3AZ4 A;  1YAO A;  2CGI A;  1V7S A;  2HUB A;  1LHM A;  2Z37 A;  1I20 A;  3A3Q A;  4WM1 A;  4BAD A;  3WW6 A;  1XSF A;  5B06 A;  1C08 C;  207L A;  3LYM A;  4NGY A;  5HQ1 A;  4H1P A;  3TXK A;  1BWJ A;  1J1P Y;  5ILC A;  3EO5 A;  1FLW A;  4AXT A;  1AM7 A;  1UIG A;  3OJP A;  1NQI A;  1VDP A;  4U3X B;  3T6U A;  2Y8P A;  4XJB A;  2BPU A;  3WXU A;  2W1Y A;  1KIQ C;  1NF5 A;  1LPI A;  4RLM A;  1JTP L;  1BB5 A;  5L3I A;  3AZ7 A;  5K7O A;  1YIK A;  1LYY A;  1GFK A;  1LSP A;  2BQG A;  5APF A;  1H6M A;  4NGI A;  2BQE A;  3RT5 X;  5B05 A;  1O23 A;  5E9R A;  1LYO A;  3LYO A;  1F6S A;  4FJR A;  1TAY A;  2HTX A;  2X0A A;  135L A;  5I53 A;  4H92 A;  2N5Z A;  5LVK A;  4ETB A;  5APD A;  1WQN A;  4PPO A;  5KXX A;  3ATO A;  1HNL A;  1GB2 A;  4KL7 A;  5LVG A;  1GBX A;  4YF2 A;  4N1C C;  1XEI A;  1JIS A;  1IR7 A;  1FLU A;  4J1A A;  1LJH A;  1OUF A;  4QGZ A;  4TSB A;  1IOS A;  1E8L A;  3W6A A;  5L9J A;  1GEV A;  3EBA B;  1B5Y A;  1YAN A;  3ZEK A;  4EOF A;  1IWU A;  3A92 A;  4YOP A;  8LYZ A;  2DQD Y;  5KXS A;  4M6D A;  1IWT A;  1DI3 A;  132L A;  3LN2 A;  5DN4 A;  1UIA A;  1T3P A;  4ET9 A;  1PZY A;  1JIT A;  1W6Z A;  4NHP A;  4NGV A;  1GFV A;  1RE2 A;  1OUB A;  3B0I A;  4H9F A;  1GF3 A;  4OWB A;  4KXI A;  4WG1 A;  4B4E A;  1ALC A;  1LZA A;  1GB7 A;  1B5Z A;  1B7N A;  4BAP A;  4DD1 A;  4QY9 A;  1JJ0 A;  4DDC A;  1IP7 A;  1LZC A;  4H94 A;  1C43 A;  5FEK A;  4GN4 A;  1J1X Y;  4HJV A;  4NG1 A;  3WPK A;  1B5U A;  3A95 A;  4ZEE A;  3A94 A;  4HSF A;  4LT2 A;  4B4I A;  2PC2 A;  4G9S A;  2CDS A;  1DQJ C;  1QSA A;  2WAR A;  5T3F A;  4UWV A;  1UID A;  4FDY A;  4P2E A;  2XBS A;  5FDJ A;  3WXT A;  1GE3 A;  1XGT C;  3TMW A;  4G49 A;  1GPQ C;  4H91 A;  1LSG A;  3W6B A;  5ILF A;  3T36 A;  1WVV A;  2H5Z A;  2EKS C;  2XJW A;  1LSZ A; 
#chains in the Genus database with same CATH topology
 1KW5 A;  1JHL A;  3W6F A;  2DAE A;  3UON A;  2FBB A;  1OTR A;  4HV1 A;  4Z98 A;  1JR3 A;  1VAU A;  1L59 A;  1PRB A;  2MEI A;  141L A;  2ZAM A;  1KYI A;  3GPX A;  1LYS A;  3SYL A;  4NG8 A;  1OFH A;  3H4M A;  2O01 F;  3KOY E;  1KFV A;  1ZVY B;  4WG7 A;  208L A;  3R9X B;  2NTG A;  1LZD A;  1WVU A;  4C3W A;  1NBZ C;  3U61 A;  1YKZ X;  1OUJ A;  4NSH A;  1PQO A;  1LLH A;  1VFB C;  228L A;  1GF0 A;  4QEQ A;  3TMU A;  3F92 A;  5IWA M;  2D6B A;  4OWH A;  2UXD M;  1BB6 A;  5APE A;  3L26 A;  1GBS A;  1L09 A;  2J7N A;  1IWZ A;  2K0B X;  2VF7 A;  3DMV A;  4I7O A;  2DQG Y;  4WLT A;  2H5X A;  4YHH M;  1PQK A;  4LYC A;  1HNZ M;  1GO5 A;  4R3D A;  1LZY A;  1GFT A;  1N33 M;  1YL0 X;  1C63 A;  3FI5 A;  2VDB B;  4R71 A;  1EFU B;  3J2P B;  1PJJ A;  2FE8 A;  2QNJ A;  2DBT A;  4DQ5 A;  1B5V A;  3SAS A;  3UK6 A;  1P64 A;  230L A;  1OAO C;  2Z12 A;  1JKC A;  1HNX M;  2HHH M;  4HLQ A;  1QZE A;  1WJ7 A;  3LW5 F;  4ARJ A;  4IBE A;  169L A;  4HTN A;  1AT6 A;  5DL9 A;  2CHG A;  1GFE A;  5LZM A;  4LJ6 A;  3AFH A;  4L78 A;  5KPT A;  1L10 A;  2LYM A;  3GUK A;  1WQP A;  1L40 A;  4YY3 M;  2B74 A;  1IR8 A;  7LYZ A;  2Q2E B;  1L92 A;  1VAT A;  2G4N A;  1D0K A;  1L53 A;  4H93 A;  3W3E A;  4X62 M;  5ITT A;  2VQE M;  214L A;  5LAG A;  176L A;  3F9L A;  1DYA A;  3J6K A;  2Z2E A;  4W56 A;  1G7M C;  2Z18 A;  1V34 A;  2ZAN A;  4IAS A;  1P3Q Q;  1QYR A;  2Z4R A;  2DWN A;  1WQQ A;  2QQ8 A;  1BB4 A;  3ZVQ A;  3R8F A;  1JTT L;  3GUP A;  1T8F A;  2VII A;  3TWM A;  2UXC M;  2LHC A;  1IOR A;  2ZQ4 A;  4M4O A;  3KS8 A;  1SXJ C;  1EQ5 A;  219L A;  1IY3 A;  1LZ4 A;  3TXI A;  4I8S A;  1ZV5 L;  122L A;  1GB6 A;  3J81 S;  5FST A;  2A5Y B;  4R7G A;  1F4I A;  3GQ3 A;  1Z55 A;  2Z3X A;  2JY6 B;  3FRH A;  1T6H A;  137L A;  4W59 A;  1IVM A;  5C18 A;  1V33 A;  4QHS A;  5ITQ A;  1GFG A;  1L86 A;  1QTK A;  2WSE F;  2XQO A;  3C8S A;  2BQJ A;  3AW6 A;  1P37 A;  1NHB A;  5B59 A;  3PNY A;  3AYQ A;  5EXS A;  174L A;  3G3V A;  1LMP A;  4W53 A;  4R6C A;  2ZNW Y;  1L2C A;  4DYG A;  2YBH A;  1LSA A;  4WL6 A;  4DR7 M;  5KQD A;  3U6O A;  1WHC A;  3W0L B;  4XJH A;  1XC8 A;  3A8Z A;  3IJU A;  4M9S A;  3KS4 A;  1L36 A;  3K2L A;  5ITX A;  3SMP A;  1BB7 A;  1L27 A;  1C64 A;  3B6L A;  5HMJ A;  1NO1 A;  109L A;  4X3B A;  1I4W A;  3GLI E;  4LFP A;  1ZV1 A;  1OUI A;  3EXD A;  3V76 A;  1L02 A;  3ODU A;  5IHG A;  1C7Y A;  1KIP C;  1LHI A;  2DVW B;  3I51 A;  1CV5 A;  1SG9 A;  4JI3 M;  1L15 A;  4NHT A;  3HHX A;  184L A;  4LG2 A;  4EPF A;  1NNU C;  1L73 A;  1L28 A;  134L A;  1GBW A;  1NMM A;  3HH6 A;  1W5S A;  2F5Q A;  1XMO M;  2Y20 A;  1CX7 A;  1G71 A;  3T1H M;  2ERC A;  1EE8 A;  4JI4 M;  194L A;  1L69 A;  4DDB A;  1J09 A;  3K92 A;  1L2B A;  1LHJ A;  3WYH A;  2ZYP A;  167L A;  2NWD X;  4PDG A;  1QQY A;  2JP7 A;  1LSD A;  4G4R A;  2OE7 X;  227L A;  1HQY E;  2K9D A;  3HTF A;  4R0F A;  1TBY A;  4I0C A;  3SAW A;  4CHX A;  3W67 A;  1HC0 A;  4FWH A;  3U61 B;  1N4F A;  4HPE A;  2HUL A;  5I4X A;  3FTE A;  4JI5 M;  4LDL A;  8CAT A;  1C1K A;  4NIJ A;  4S0W A;  3P66 A;  1EQ4 A;  1G0K A;  1L00 A;  4XJG A;  4EJ4 A;  3HU2 A;  4AQY M;  1L48 A;  1LMO A;  2WSC F;  212L A;  4L6V 6;  225L A;  2BAA A;  2RBS A;  1JSE A;  4DD2 A;  2R0I A;  5KPZ A;  4ETE A;  1DI5 A;  2B75 A;  3WL2 A;  1L22 A;  151L A;  2Z38 A;  3HT9 A;  4IBF A;  2Z6B A;  3U6L A;  3OK0 A;  1Q02 A;  166L A;  3RZ4 A;  1GF7 A;  2BQF A;  1L89 A;  1D0L A;  4DD3 A;  3TL4 X;  1L91 A;  3A90 A;  1L79 A;  4NHS A;  3A91 A;  2B5Z A;  1HT2 E;  1L56 A;  2HCB A;  2LYZ A;  2MEA A;  4AKH A;  1C10 A;  3DN6 A;  5E4P A;  2BQA A;  3HUK A;  1L13 A;  3EML A;  3ATN A;  3FTF A;  1LZG A;  5FHW A;  4IBB A;  1PJQ A;  5FTL A;  1C6L A;  2C99 A;  4DAJ A;  4MGY E;  2KNV A;  1DYG A;  4AGA A;  5KPR A;  1GVN A;  4W54 A;  4NGZ A;  2WSF F;  1PS5 A;  1P2C C;  4IBK A;  1SXJ E;  4G4H A;  1IN5 A;  1LMA A;  1L32 A;  5DLA A;  3DN8 A;  4N9R A;  2BQN A;  4ETD A;  4GKJ M;  1L99 A;  2DQF C;  253L A;  3FE3 A;  4WLD A;  1CU5 A;  1IN7 A;  3IG8 A;  1HEM A;  1QTH A;  1NJF A;  3F6Z A;  4FCT A;  1IR9 A;  2LZ2 A;  3KOW E;  1OUG A;  2KRK A;  3GUJ A;  3U60 B;  1L39 A;  3ZVQ B;  1DKJ A;  2XZU A;  2BWB A;  2YBI A;  4NY5 A;  4W51 A;  4W94 A;  140L A;  180L A;  3CT5 A;  1IN6 A;  2YR0 A;  1L63 A;  3A6C Y;  1B6I A;  3VKH A;  1HEP A;  4H9H A;  3WMK A;  1NHG C;  5JEN B;  3AGG G;  221L A;  2HU3 A;  154L A;  1FDL Y;  3TMX A;  1LJF A;  2FYC A;  1LOZ A;  3GLG E;  2DZN B;  189L A;  3NYA A;  4LDO A;  5KXW A;  2RB2 X;  1LZT A;  201L A;  1LCN A;  5FCP A;  1L84 A;  2RBP A;  1YLA A;  1UIC A;  4DD0 A;  4UWN A;  186L A;  2LVN C;  3LZM A;  1WIV A;  4NSO B;  2H9K A;  4NRW A;  3CDT A;  3UGJ A;  2LHM A;  159L A;  2EQL A;  4HJZ A;  1XNQ M;  4HL4 A;  103L A;  2D4I A;  3FRI A;  2OU8 A;  127L A;  1GDW A;  211L A;  4DR1 M;  4H90 A;  4YEN A;  1SLY A;  1QT5 A;  2A7F A;  4CGY B;  1L55 A;  3TXH A;  1T97 A;  5E26 A;  3ZH9 B;  4RDS A;  4GMQ A;  4OOO A;  2KNZ A;  3GLF E;  2Q0M X;  1C6M A;  2BQI A;  4LDE A;  4WM2 A;  1TF0 B;  161L A;  1L75 A;  4OWE A;  5B1G A;  4WLY A;  2ZAO A;  4LF5 M;  1TH2 A;  1QDT A;  1IEE A;  1CJ7 A;  4J0L A;  4CFO A;  2DQH Y;  2R46 A;  185L A;  4B4J A;  5EP1 A;  4ML7 A;  3RW8 A;  4CIS A;  1C6N A;  3A98 B;  4OWA A;  4LZJ A;  4MB7 A;  1VDT A;  1QUG A;  4XEN A;  170L A;  3TXB A;  4QOZ C;  5EJC A;  2DQJ Y;  1JQU A;  2M60 A;  3K9O A;  4LJ5 A;  4JN6 A;  2F5O A;  1C61 A;  4W57 A;  4QHT A;  5LVH A;  2XSZ D;  3QAU A;  2HUB A;  3CF2 A;  232L A;  3A3Q A;  4WM1 A;  1C08 C;  2L2D A;  207L A;  239L A;  2QEN A;  5HQ1 A;  1G0J A;  1L64 A;  2CUZ A;  4AXT A;  3A46 A;  1AM7 A;  1UIG A;  3OJP A;  2JNH A;  4U3X B;  5FLX S;  2DHR A;  4PD2 A;  3E9S A;  2B7X A;  139L A;  1LWG A;  3K2R A;  5L3I A;  2QCU A;  188L A;  5E6J A;  4JI7 M;  115L A;  1L45 A;  4ARL A;  2BQG A;  2RBR A;  2BQE A;  5B05 A;  1SSW A;  3C3D A;  3IHP A;  3LYO A;  1CV1 A;  5I53 A;  135L A;  4H92 A;  2N5Z A;  3SB8 A;  4ETB A;  5APD A;  1GL7 A;  1SXJ A;  4NRV A;  1LGW A;  1L87 A;  5KXX A;  1CU3 A;  2C9O A;  1GB2 A;  3GQ5 A;  4N1C C;  1JIS A;  128L A;  1FLU A;  4QGZ A;  1LI3 A;  3GUI A;  4DV0 M;  1ZQ9 A;  2MGW A;  4D81 A;  1KY1 A;  1GEV A;  2B72 A;  1QAQ A;  3A92 A;  2QSF X;  4I7T A;  5KXS A;  1T3T A;  1QAM A;  2LXE A;  132L A;  1IWT A;  4AKG A;  2V1U A;  1PZY A;  4NHP A;  1GFV A;  4B4E A;  4KXI A;  1GB7 A;  259L A;  4PCZ A;  3OE8 A;  3FA0 A;  190L A;  1JJ0 A;  3HU8 A;  2J7O A;  1BVS A;  1E94 E;  3SAR A;  1G06 A;  3IG5 A;  1DQJ C;  1LYE A;  4UWV A;  1L50 A;  4FDY A;  1Z5C A;  2CV0 A;  4P2E A;  2XBS A;  4B3M M;  1GE3 A;  4G49 A;  1GKI A;  1L05 A;  4B3S M;  1L80 A;  4LT3 A;  3AOG A;  2ZIK A;  2CP8 A;  3IJV A;  2RSC A;  4NHI A;  5LYT A;  4TX7 A;  2I6Z A;  4KPM A;  1V92 A;  1I1Z A;  4DDA A;  4I7Q A;  4LGM A;  1L98 A;  2BQB A;  3QNG A;  3HHW A;  4YXC A;  2KDL A;  2O79 A;  1Q3B A;  4WOA A;  1LZ5 A;  4QOS A;  1R6B X;  1HML A;  3HFM Y;  210L A;  1OFI A;  1IY2 A;  3EIH A;  4P17 A;  2F5S A;  145L A;  5EQT A;  3D3D A;  4JI8 M;  1GB3 A;  175L A;  1INU A;  3U6E A;  1RJC B;  3SAV A;  3EIE A;  1L33 A;  1BVX A;  4N0J A;  4OOT A;  2ZTC A;  4RLN A;  1EQE A;  3J80 S;  1L70 A;  4WW0 A;  1NV8 A;  3QWL A;  1KSF X;  4WL7 A;  1LKS A;  1IOT A;  5EXX A;  4I5S A;  1D9W A;  3HTB A;  2F4G A;  2B6X A;  4ARM B;  3LYT A;  5KQ8 A;  3Q8G A;  2L6O A;  1L25 A;  4PJ2 C;  4B1A A;  4DWX A;  2ZIL A;  4GC5 A;  1GF5 A;  2BLX A;  3GLH A;  3C8Q A;  3EMS A;  1BQL Y;  3AB6 A;  1VG5 A;  4XJF A;  3VK8 A;  1L20 A;  1LZ9 A;  242L A;  4CGE A;  4ZPX A;  1GFJ A;  1JTO L;  3W68 A;  1WQR A;  5KKI A;  5LIO A;  2D7H A;  1G0L A;  1CKG A;  2MEH A;  2KA6 B;  4GH9 A;  2R6F A;  1TLA A;  3M7G A;  1GFA A;  3DN1 A;  2JY5 A;  1IY0 A;  3HJ8 A;  3MGW A;  5A3Z A;  2F5P A;  1P36 A;  2HEC A;  1DV0 A;  4JI2 M;  1EL1 A;  2CE7 A;  4AI6 A;  4XJD A;  4OW0 A;  3WU8 A;  1HEW A;  5HMV A;  1LJ3 A;  1L06 A;  1C6I A;  4DV1 M;  3TXE A;  3CDO A;  3SYK A;  3DNA A;  5L3H A;  2JA2 A;  1DGB A;  4B3R M;  3AOE A;  1CKC A;  2IFF Y;  149L A;  1D2W A;  4OVZ A;  1CU0 A;  150L A;  3HU3 A;  2CHV A;  3C8R A;  1JQJ C;  4LFX A;  5KXZ A;  5F16 A;  1BHZ A;  3KAM A;  2MRO B;  104L A;  3AV0 A;  2L4F A;  3SB7 A;  2XLJ A;  4KOD A;  1B7Q A;  2HU1 A;  1JJ1 A;  3PXG A;  3VLF B;  4AKI A;  5KXN A;  4OW1 A;  3U6Q A;  3TMV A;  3GXK A;  3FAD A;  1XGQ C;  4KHP M;  3CDR A;  2DAM A;  4WM4 A;  1DYC A;  2R45 A;  3GRR A;  3FI7 A;  3WU9 A;  4ARQ B;  1GHL A;  1CTW A;  4QNM A;  1NJG A;  163L A;  1VEG A;  2HED A;  155L A;  4I7L A;  4NGO A;  5FEL A;  1TDZ A;  3BBZ A;  3HUA A;  4B0D A;  4GCD A;  4NWH A;  4MGK E;  1FJG M;  1GJT A;  3LQR A;  2DQA A;  2DKV A;  4NC6 A;  2BQD A;  2R18 A;  1G41 A;  4LYT A;  3HWL A;  2RB0 X;  3WVX A;  1GB9 A;  1T43 A;  1L8Q A;  3NBI A;  1XHB A;  2GV0 A;  2FFJ A;  3CSQ A;  1L18 A;  4XK8 F;  216L A;  4GKK M;  2DAK A;  1PQM A;  1QIO A;  1UIB A;  1D9U A;  3AW7 A;  3E4R A;  1REX A;  4HV2 A;  3G3X A;  1C6H A;  3LHM A;  1DGH A;  1IN4 A;  4LY6 A;  3L28 A;  2XFT A;  1IOQ A;  4YM8 A;  2VB1 A;  2HUK A;  2B6W A;  1CNS A;  3Q8X A;  4II7 A;  4I7J A;  3TQS A;  4ETC A;  1P5C A;  1R2Y A;  1OQM A;  3KVW A;  1SQ2 L;  4OU7 A;  1CJ8 A;  1L1Z A;  2ZBK B;  2YQZ A;  1D6Q A;  3SMS A;  2BQK A;  1YQV Y;  3SHF A;  3RFW A;  1XXH E;  129L A;  1FBI X;  1IWV A;  1JJ3 A;  1QQW A;  1LJG A;  3AZ5 A;  4QDN A;  4AG5 A;  1UC0 A;  3KDS E;  147L A;  3A3R X;  251L A;  1RCM A;  1F10 A;  1L95 A;  3HUQ A;  3LYZ A;  1CKD A;  4WO6 A;  4QNR A;  220L A;  1D3N A;  3CSR A;  3M3U A;  2VF8 A;  5F9U A;  4G4O A;  1YIL A;  1OUE A;  4AG6 A;  3M6A A;  1D2Y A;  5IRE B;  148L E;  3U5Z A;  1R4G A;  3SB6 A;  2B6Z A;  1OYU A;  2DWZ B;  1LZE A;  3WUA A;  2OO9 A;  1L41 A;  4LGK A;  206L A;  2EUC A;  1JR3 D;  1LV7 A;  2D7G A;  2QZ4 A;  1L81 A;  2D91 A;  5HNL A;  1XB2 B;  2EIZ C;  1LMC A;  1PJT A;  4NGW A;  1Z5B A;  3AL0 C;  1MEL L;  1G0G A;  1P46 A;  1TGU A;  1L88 A;  3GLH B;  2XF3 A;  249L A;  1XGP C;  2C8O A;  2HAK A;  1G7J C;  4L16 A;  1LZ1 A;  1T6V L;  1KXY A;  1XEJ A;  2CHQ A;  1GXX A;  1UA6 Y;  2QBY A;  1C60 A;  1ZMW A;  1WTM A;  1LZB A;  1XEK A;  1C65 A;  1C6D A;  3GRV A;  2B6Y A;  2YVB A;  1HEQ A;  4O34 A;  2LWX A;  1UAC Y;  3F8V A;  5HLL A;  3MHV C;  4D9Z A;  3RGP A;  1LZR A;  2Z39 A;  1CVK A;  102L A;  1LAA A;  4LZT A;  3WUM A;  4LYM A;  4OX9 M;  5F9X A;  1LJN A;  1L62 A;  196L A;  1IM2 A;  1LWK A;  4IBJ A;  3CSZ A;  1VEK A;  1WQO A;  4G4B A;  1P7S A;  4L4U A;  1LSF A;  1YAQ A;  1HEN A;  3NY8 A;  1GJS A;  4LF8 M;  3FE0 A;  4CJ6 A;  2K6B A;  4K5Y A;  1L82 A;  4I7M A;  3UJN A;  2XFS A;  1IP4 A;  5FTN A;  1JKD A;  1LSB A;  3QY4 A;  2Q9E A;  2HWJ A;  3P65 A;  1VDS A;  1GB8 A;  4K0K M;  1QTD A;  2DZO B;  142L A;  2G8L A;  1HMK A;  4NGJ A;  2Z7J A;  1PQI A;  213L A;  3SC3 A;  6LYZ A;  7LZM A;  2AUB A;  1V7T A;  3A34 A;  2H9J A;  1ZVH L;  2DQE Y;  2KZU A;  4F2L A;  1GFU A;  4Z3M A;  1C45 A;  4LRT A;  3I4Y A;  1OVK A;  1NVM A;  1HER A;  1QTZ A;  2MJ5 B;  1GAY A;  1OWY A;  1WTN A;  205L A;  3HZJ A;  4DR6 M;  3L2A A;  1L71 A;  1LSE A;  5LYM A;  2XZF A;  1L0J A;  3HWS A;  231L A;  3DOA A;  2W82 A;  2B3T A;  5LMN M;  4NEB A;  3GPU A;  1L07 A;  2VQF M;  3J4G A;  4KLN A;  1L23 A;  1T8G A;  1L57 A;  3HT7 A;  4I7S A;  3LVW A;  2UU9 M;  2LZT A;  3B74 A;  158L A;  192L A;  240L A;  1D0M A;  3N9A A;  2V1C A;  5DFL A;  4NSI A;  2Z2F A;  4PGJ B;  153L A;  1C69 A;  197L A;  2Z19 A;  1ZYT A;  2UXB M;  168L A;  5A2Q S;  4B7F A;  3U6D A;  3QYB A;  2I26 L;  3OE9 A;  1IP1 A;  4NGK A;  3GUL A;  5DNY A;  1YAO A;  1V7S A;  215L A;  1RU3 A;  2G3Q A;  1I20 A;  1C67 A;  3T38 A;  1ZAE A;  1C62 A;  4IBD A;  5B06 A;  4IJE A;  1DGH B;  108L A;  226L A;  5ILC A;  2CRU A;  1OJL A;  1G3I A;  1FLW A;  1L26 A;  1N78 A;  2O25 A;  4GC9 A;  2BPU A;  2W1Y A;  3PNV A;  2O5R A;  1L58 A;  2KHH A;  247L A;  5K7O A;  1S3S A;  1P6Y A;  1GFK A;  1YIK A;  1JTN A;  1N34 M;  1H6M A;  4NGI A;  3RT5 X;  1HT1 E;  1O23 A;  1QAO A;  1LYO A;  1DO2 A;  144L A;  4G4Q A;  2Y21 A;  2HTX A;  3CF0 A;  1WQN A;  4LF6 M;  3TWL A;  3C83 A;  1GBX A;  7CAT A;  1NV9 A;  1L0K A;  1L08 A;  1CU2 A;  1IR7 A;  4TSB A;  3T6P A;  222L A;  1L51 A;  1E8L A;  4DR4 M;  1QVR A;  4LRS A;  5L9J A;  5BPV A;  1YAN A;  4EOF A;  1IWU A;  2DHY A;  3W0F A;  171L A;  1L35 A;  2DQD Y;  4M6D A;  8LYZ A;  1LYJ A;  1QTV A;  2OU0 X;  152L A;  4ET9 A;  3PDS A;  1JIT A;  4NGV A;  3I01 M;  1RE2 A;  1D3M A;  3B0I A;  3GUM A;  1P2R A;  4WG1 A;  3DN4 A;  1B5Z A;  5GKN A;  3HT6 A;  3VFD A;  1IP7 A;  1KNI A;  2K47 A;  4H94 A;  1C43 A;  4GN4 A;  1J1X Y;  4NG1 A;  3A95 A;  3A94 A;  4LT2 A;  3GLI A;  257L A;  2WAR A;  183L A;  5T3F A;  3H4J A;  2XSZ A;  4LFC M;  3WXT A;  237L A;  3TMW A;  1L49 A;  1Q39 A;  3RE8 A;  4H91 A;  3D8L A;  1PGY A;  4NSG A;  1LSZ A;  2F5N A;  1W5T A;  1XWI A;  3CDQ A;  1TTE A;  2XEP A;  4D82 A;  4B08 A;  4GHA A;  5DYG A;  3SBJ A;  1SX7 A;  1L34 A;  1HFZ A;  1DZB X;  1DGF A;  4LFB M;  4LJ8 A;  2YBL A;  5LMU M;  5KXT A;  1L60 A;  3QAK A;  3K1J A;  1Z6T A;  2KW0 A;  1XNR M;  1C7P A;  5I5Q A;  2GQF A;  1G0Q A;  1CX6 A;  2Y0T A;  4AZF A;  2ZIJ A;  1YAM A;  5LAF A;  5F81 A;  1XGR C;  3C80 A;  3I04 M;  200L A;  4TSC A;  4ANR A;  3GRY A;  1NWG A;  1JUG A;  1QT3 A;  2G5G X;  2C98 A;  4WMG A;  5LVI A;  4DR5 M;  5KXM A;  3ZC7 B;  1C6B A;  1L83 A;  4IAP A;  3C7Y A;  120L A;  2RGO A;  4Z6Y A;  3DKE X;  2F4V M;  2BJV A;  4DUY M;  4H9I A;  3WPJ A;  3P4Z A;  1E9R A;  1L65 A;  1MLC E;  3A93 A;  2A7D A;  1N32 M;  1IOC A;  1Z59 A;  2DKL A;  4LGY A;  3LVV A;  3MMP A;  1AKI A;  1IY4 A;  3ZQJ A;  3C7Z A;  1DGG A;  4LF4 M;  1CJ9 A;  1OV7 A;  2HUM A;  2F32 A;  3WHK A;  4DUZ M;  5LXW A;  3LQQ A;  133L A;  3M0E A;  130L A;  4ZIX A;  2UUB M;  4ETA A;  1OAI A;  2LHG A;  4AQN A;  2FH0 A;  1UUZ C;  3DMZ A;  4J1B A;  4PT5 A;  1NBY C;  157L A;  2APL A;  4GCE A;  2LVQ D;  4TWS A;  3TXD A;  3NY9 A;  2CJL A;  3KP1 E;  193L A;  2DAI A;  2MEE A;  5H37 D;  6LYT A;  1LMT A;  4EKR A;  1G7I C;  1OUH A;  3JR4 A;  3UMM A;  244L A;  3OTO M;  1HR0 M;  4LT0 A;  1DPW A;  3MK6 A;  4W58 A;  2Y0Q A;  4G6Z A;  4NSJ A;  4YEO A;  162L A;  1L14 A;  5AMY A;  2B73 A;  4BLC A;  3GPP A;  1FKQ A;  4FCW A;  5EXP A;  2QPA A;  3FUT A;  2C8P A;  2O7A A;  2G4Q A;  2EKF A;  1IC7 Y;  1L90 A;  3HDF A;  1K82 A;  2MEG A;  5HNC A;  2OTZ X;  2ANX A;  4X64 M;  2ZWB A;  5EP2 A;  1IXS A;  224L A;  2YFQ A;  4D80 A;  4CIZ A;  3LMM A;  4FWD A;  5KXO A;  233L A;  2LYO A;  2RAY X;  1K3X A;  3CDV A;  5I4W A;  1LHH A;  3JR6 A;  2FYD A;  1REM A;  1C6F A;  4EIW A;  1YKY X;  1IP5 A;  1KS3 A;  2DAG A;  3HJQ A;  4J7V A;  1HNW M;  3THG A;  4WO9 A;  4HTK A;  3HHZ A;  4Z41 A;  1OV5 A;  2F4A A;  4S12 A;  1DYF A;  4EKQ A;  5KXL A;  3B9P A;  2OOA A;  4FW9 A;  1L46 A;  4BAF A;  1GLN A;  1TEW A;  2W1X A;  260L A;  3RGS A;  3HBH A;  3A96 A;  5IDD A;  1LYG A;  1LHK A;  5JI2 E;  4RW1 A;  2RBN A;  3G3B B;  1DYE A;  1L44 A;  3T1Y M;  1K28 A;  1C6G A;  3GLG A;  1ZUR A;  1QZM A;  3A42 A;  3JR5 A;  1G59 A;  1DI4 A;  1LJI A;  5C6L A;  4UN2 B;  3C82 A;  1LI6 A;  182L A;  1XJT A;  4AW4 A;  5D5C A;  1IX0 A;  4YX7 C;  4NHQ A;  195L A;  3HTD A;  3HU1 A;  1CJ6 A;  3HHY A;  4XN6 A;  2R4E A;  1I56 A;  1ZWN A;  2BQL A;  5EBH A;  1GD6 A;  3AZ6 A;  1DO0 A;  1P2L A;  2OPF A;  1N75 A;  5FSW A;  2MEC A;  1L38 A;  3GLI B;  1JKB A;  2BQO A;  1JR3 E;  4ARP A;  3GLF A;  1IFY A;  1JPO A;  5C1B A;  5KXY A;  3SP3 A;  1JIY A;  2DQI Y;  1BGI A;  3P68 A;  1QT7 A;  4PRQ A;  9LYZ A;  3C81 A;  4N5R A;  1GXV 2;  4LFA M;  1LTM A;  4KT3 A;  1LYI A;  110L A;  1IBM M;  1HHL A;  1LZ6 A;  2FBD A;  2W1M A;  3E3D A;  1B7L A;  1GF9 A;  1R2Z A;  2C5R A;  2JWS A;  1B5X A;  4LYZ A;  1TH4 A;  1HSX A;  1NDG C;  1QSW A;  1UBZ A;  2CWI A;  3OE0 A;  1LYF A;  3W6E A;  3TXG A;  2YSS C;  1XEP A;  4H9A A;  3WVY A;  5ITY A;  2JZ0 A;  4DD7 A;  3PVS A;  229L A;  2C96 A;  1GDX A;  5I54 A;  4RF1 A;  2DZL A;  3VDP A;  1KIR C;  4RF0 A;  3D4S A;  1G7L C;  1CUQ A;  3CGW A;  2MEF A;  1WXQ A;  3HT8 A;  3DA1 A;  3RZE A;  1L93 A;  1L97 A;  4JI1 M;  5L8R F;  2FNA A;  3L25 A;  4WM3 A;  2EKK A;  6LZM A;  4GIT A;  2OE4 X;  4NXM M;  2ZYC A;  2CEA A;  4WUR A;  3N9C A;  3U6C A;  1LKR A;  3RNX A;  1LJK A;  1G7H C;  1L37 A;  1QUT A;  1LSN A;  1IXZ A;  3B72 A;  1UCO A;  4Q7J A;  4WM5 A;  3DMX A;  1LSM A;  4GN5 C;  4IJF A;  4B7H A;  4HEO A;  4PK0 A;  3B89 A;  4REZ A;  1GWD A;  2LCB A;  1C6C A;  4IBC A;  1R5L A;  3GUO A;  3IEC A;  1QUH A;  3WH1 A;  1T6O A;  1YRO A;  3I4V A;  4GCC A;  2OEA X;  1GBO A;  2R44 A;  3SFZ A;  5F3W A;  1LZ8 A;  261L A;  5LVJ A;  1PM5 A;  1CUP A;  4JI0 M;  2CV2 A;  3RUN A;  1REY A;  5F14 A;  4FCV A;  4W5W A;  2I25 L;  4MCK A;  5KJ9 A;  2KXE A;  3E21 A;  4IIW A;  4I81 A;  256L A;  5DM9 A;  2QB0 B;  4RW2 A;  2MH8 A;  1NHE A;  126L A;  3K9P A;  2RB1 X;  1SXJ B;  3LZ2 A;  4CFP A;  4NSR A;  3UZU A;  3VK7 A;  3TXJ A;  3OE6 A;  138L A;  1IXS B;  1L68 A;  4E97 A;  1L30 A;  4DV3 M;  3KOZ E;  1B0D A;  1IC5 Y;  1I94 M;  4JI6 M;  1LI2 A;  4YEM A;  2BQH A;  3CF6 E;  2D4J A;  1GE0 A;  4GIP A;  1Y8G A;  1P56 A;  1JTM A;  4M9Z A;  2F30 A;  1OVJ A;  1KXW A;  1GE2 A;  4GHL A;  2YBJ A;  4G3O A;  1TCY A;  3A67 Y;  5KXK A;  2ZQ3 A;  4GN3 A;  2BQC A;  3HU9 A;  1L43 A;  2X49 A;  3CQL A;  3TXF A;  2OOB A;  5KKJ A;  236L A;  4MR1 A;  4H8X A;  4ZPU A;  4X65 M;  2HKJ A;  1X37 A;  2MED A;  5BR8 M;  1DYB A;  1L74 A;  2MEB A;  1OUA A;  1B7R A;  1C6Q A;  3D9A C;  3GLG B;  3AJI B;  1DYD A;  252L A;  4JXJ A;  3V2W A;  4JYA M;  1IY1 A;  1LHL A;  4HP0 A;  3W6D A;  1G8P A;  1L85 A;  1HF4 A;  1QSB A;  2N35 A;  4WLX A;  125L A;  1REZ A;  1A4V A;  1MN3 A;  4EKS A;  4XGI A;  4TUN A;  4UWU A;  5C6J A;  3HH4 A;  5FTK A;  4BS7 A;  1CV4 A;  2BLY A;  2KEB A;  2OQ4 A;  1J7K A;  1YSY A;  1XJU A;  4N8Z A;  4A3V B;  3GLF B;  2Z8Y M;  4NL4 H;  1L12 A;  3FUV A;  4LZZ A;  1GB5 A;  1RFP A;  4L15 A;  5EP4 A;  160L A;  1L03 A;  1OUD A;  4H9C A;  1OWZ A;  1L19 A;  3ULR A;  3P64 A;  2ANV A;  4DC4 A;  3AZ4 A;  2EJS A;  209L A;  2Z37 A;  1XMQ M;  1C66 A;  1QT8 A;  1XSF A;  1L04 A;  1TR8 A;  1OIP A;  258L A;  5EXT A;  3LYM A;  4I7P A;  4NGY A;  2OE9 X;  4H1P A;  3TXK A;  1L54 A;  1QUO A;  1L42 A;  1L31 A;  255L A;  3T6U A;  1VEJ A;  1JB0 F;  4XJB A;  4TUW A;  2YNM D;  2Z4S A;  1C6E A;  1KIQ C;  1NF5 A;  1LPI A;  1TH3 A;  1SWY A;  4RLM A;  2C9C A;  1BB5 A;  3SBA A;  3CTW B;  1LSP A;  5APF A;  5E9R A;  2CV1 A;  1H6U A;  4YXA C;  5I14 A;  1NSF A;  2X0A A;  254L A;  1OIZ A;  2H1R A;  3GUN A;  1G0P A;  1WTH A;  1VDL A;  3ATO A;  2ZM6 M;  4KL7 A;  1WGL A;  1L61 A;  4YF2 A;  3U60 A;  3KOX E;  2LNH C;  4J1A A;  1LJH A;  1OUF A;  1PJI A;  4RKU F;  2I7N A;  1IBL M;  1SX2 A;  4LJA A;  123L A;  3W6A A;  3EBA B;  3NBX X;  3ZEK A;  178L A;  235L A;  1IN8 A;  3SB5 A;  1DI3 A;  2KRU A;  1T3P A;  4H9F A;  4OWB A;  1ALC A;  1LZA A;  1ZMU A;  4GRV A;  4BAP A;  3B7Q A;  3HKP A;  3TPZ A;  1LZC A;  5FEK A;  199L A;  1G1V A;  1B5U A;  4OVZ B;  1LW9 A;  4HSF A;  131L A;  1TDH A;  1UFZ A;  1UID A;  1G4A E;  2L78 A;  5FDJ A;  2X8A A;  4BBA A;  1L67 A;  1GPQ C;  1LSG A;  3W6B A;  3HJS A;  2V6Z M;  1WVV A;  2H5Z A;  2RH1 A;  234L A;  2EKS C;  2WZJ A;  3J7A S;  4LF7 M;  3ILK A;  2RAZ X;  3DN2 A;  1KW7 A;  3KSJ A;  1LSY A;  1UIE A;  1W08 A;  5IT9 S;  1IP2 A;  4ET8 A;  4KT0 F;  1B7M A;  4DV7 M;  5B07 A;  3C3E A;  1GBZ A;  2QAR C;  1GE1 A;  1IP3 A;  1JWR A;  2IGC A;  2R4J A;  1LJE A;  5C6I A;  1OP9 B;  4W96 A;  1WR1 B;  1CKF A;  1H87 A;  1CKH A;  4W55 A;  4MST A;  2DWL A;  1C6T A;  4DT3 A;  4MM3 B;  4I7N A;  3HDE A;  4DBG B;  4F1I A;  3U6P A;  1UIF A;  3L27 A;  4WP2 A;  2E5L M;  1CV0 A;  2OTY X;  4GLV A;  3CB7 A;  2JXN A;  2M5Z A;  4DR3 M;  5KO3 A;  218L A;  5DN5 A;  4Z46 A;  1HEO A;  4DJH A;  1TDY A;  2O4W A;  3TWK A;  1IC4 Y;  1LPY A;  4M0D A;  1KY0 A;  4EMN A;  2RKO A;  1IWX A;  3AJN A;  4XYY A;  5I4Y A;  2CUU A;  4IBI A;  1XXH A;  4DV6 M;  1N77 A;  1B9O A;  3FUX A;  3QYE A;  1AZF A;  1GFH A;  3RU5 A;  2I7P A;  165L A;  1NY5 A;  3SB9 A;  3WHL A;  1HFY A;  4M0W A;  4GCF A;  4A7D A;  3DFZ A;  5KXP A;  1CU6 A;  2LZM A;  3FKE A;  198L A;  1QTE A;  1L2D A;  3B7N A;  4GRI A;  1G07 A;  1MX0 A;  4I4L A;  3K3T A;  4FWG A;  1HEL A;  3BKH A;  2J5Y A;  2F2Q A;  1QTB A;  4NWE A;  1LSC A;  1DXJ A;  4CJ2 A;  3B0K A;  3G3A B;  4IAT A;  1LZN A;  1L16 A;  2HEA A;  4GLA A;  2RGH A;  4LYO A;  4EKP A;  2R62 A;  1SSY A;  1LMN A;  3A45 A;  3WUL A;  2LVP C;  4H8Y A;  5LA8 A;  1VDQ A;  2GNO A;  2KNA A;  5ITU A;  1QS5 A;  1EPY A;  1PJS A;  1CV3 A;  4MGI E;  2F2N A;  4I7K A;  3U5Z B;  1C6J A;  2L7I A;  2XBR A;  2BWE A;  1OVH A;  1L21 A;  4EXM A;  2P5T A;  238L A;  5M1Y A;  1HJP A;  3BXW A;  4PRU A;  4C5F A;  5LYZ A;  2FS1 A;  3QE8 A;  1NNJ A;  241L A;  1F0W A;  3WW5 A;  2CFO A;  3AOE C;  1FLY A;  1IP6 A;  3VW7 A;  2ZTD A;  1L76 A;  1YKX X;  4MGH A;  1I6S A;  1YE9 A;  1B7O A;  4L8R C;  2QBY B;  1PQD A;  3GQ4 A;  4L41 A;  1C6P A;  1AUA A;  1QT6 A;  3G3W A;  1HSW A;  2EO2 A;  5A3E A;  1NHW C;  2QHO B;  1L77 A;  3JAM S;  2KZS A;  3SAT A;  3B0O A;  3N9E A;  1F6R A;  1UIH A;  3PFI A;  118L A;  1LJ4 A;  1IO5 A;  1AT5 A;  246L A;  2BQM A;  4FD2 A;  2RBO A;  2W1L A;  1IBK M;  1R7R A;  3MJ5 A;  3HGI A;  217L A;  3J27 B;  1GAZ A;  245L A;  1IIZ A;  3AKZ A;  5IEL A;  4XJI A;  4Z8X A;  1VQ1 A;  112L A;  4DKL A;  1NKH A;  2YBN A;  1ORY B;  2DQC Y;  4LYB A;  3DN3 A;  1DKK A;  1D2N A;  1QAN A;  3IWR A;  3VKG A;  1T8A A;  1GEZ A;  107L A;  5D5F A;  156L A;  3GRU A;  4BB9 A;  1L11 A;  1GB0 A;  1FLQ A;  119L A;  4WM6 A;  1L1T A;  113L A;  3BKV A;  4ARM A;  1EIJ A;  3HH5 A;  4NGL A;  5II3 A;  4H8Z A;  3KXE C;  3HBE X;  4GCB A;  1JSF A;  2UUC M;  4ZFP A;  2BNK A;  2LH0 A;  1K3W A;  2HEE A;  4H9B A;  1BWH A;  2NQ8 C;  164L A;  3PBL A;  2A4T A;  1LYH A;  1CV6 A;  2L7H A;  3SHG B;  4LJ7 A;  3WU7 A;  1JEF A;  1WQM A;  2OU9 A;  1IWY A;  1L52 A;  3AGH A;  4FVM A;  177L A;  5DYI A;  4XBO A;  4KO8 A;  3W6C A;  3U6M A;  2RBQ A;  3TE6 A;  1LGU A;  1XGU C;  223L A;  4IBG A;  4CHT B;  3M18 B;  1YAP A;  3L64 A;  146L A;  1LYD A;  3GP1 A;  1CUK A;  1C46 A;  1NDM C;  2XGN A;  4OO9 A;  4P16 A;  2HEF A;  4II8 A;  3AGI A;  4Y28 F;  2R65 A;  172L A;  1XFP L;  5IZ7 D;  2YBM A;  3K8Z A;  1XXH B;  3GLH E;  4NXN M;  3C58 A;  1D6P A;  4GBR B;  3LCU A;  2EPE A;  4DR2 M;  4LZM A;  3L29 A;  250L A;  4JV5 M;  1LJJ A;  2DEN A;  1PQJ A;  2Q9D A;  1SWZ A;  1ZMY L;  181L A;  1UM8 A;  2NTH A;  1HFX A;  2HEB A;  5FTM A;  4DD9 A;  4G4C A;  1OKS A;  5EP3 A;  3KW6 A;  1GF6 A;  1D3J A;  1QDR A;  5B1F A;  4EPI A;  3HTG A;  1YUB A;  4XAD A;  1JKA A;  3U6S A;  1J1O Y;  2IHL A;  1KXX A;  1MU5 A;  114L A;  5LIN A;  1LYZ A;  1VED A;  4I8O A;  3HBD A;  1NY6 A;  4PDI A;  5JI3 E;  3FTC A;  1IWW A;  1RI8 B;  1GE4 A;  3VWO A;  4DV2 M;  3SN6 R;  4W52 A;  1BB3 A;  4B3T M;  3NWL A;  1FN5 A;  3CT1 A;  1QT4 A;  3GXR A;  1MJG M;  3HX3 A;  4DV5 M;  2DWM A;  4PHI A;  2FOI C;  3DZD A;  2L09 A;  3WPL A;  4B49 A;  4ARQ A;  2YDG A;  2JY7 A;  4NFV A;  1BWI A;  3SAU A;  1B7S A;  4N1E I;  3C9P A;  2DXI A;  2QP9 X;  187L A;  1FKV A;  3FUU A;  1Z5A A;  3GO8 A;  1L47 A;  1LZS A;  1GF8 A;  1OUC A;  2B6T A;  4NOO B;  3A6B Y;  4HTQ A;  4ITQ A;  1YL1 X;  1LMQ A;  4MGZ E;  1L66 A;  1B7P A;  1P3N A;  1B5W A;  5KXR A;  1L96 A;  5J7C A;  1IXR C;  3LZT A;  3CT0 A;  1G0M A;  4E3U A;  5LA5 A;  3E46 A;  2XTH A;  2BJW A;  3HH3 A;  4LCB A;  4DV4 M;  1C68 A;  1L01 A;  1FNN A;  1SXJ D;  2AHM A;  5KY1 A;  1QUD A;  4TTD A;  4HJY A;  3T15 A;  4OWC A;  1E32 A;  4LT1 A;  4H9E A;  1GFR A;  1QUS A;  3WUN A;  173L A;  2F47 A;  4LJ4 A;  4M9X A;  4HPI A;  1C6A A;  4G4N A;  3FTD A;  1GAB A;  1DPX A;  1L72 A;  2XH9 A;  2ZNX Y;  5FTJ A;  4LF9 M;  3B7Z A;  1ZMV A;  1D3F A;  2CWB A;  1HQC A;  5APC A;  1L24 A;  2JUJ A;  1A5T A;  3FYD A;  1GF4 A;  1GBY A;  4IJ4 A;  1L94 A;  2D4K A;  2G4P A;  1A2Y C;  1BVK C;  3FUW A;  4X66 M;  1B2K A;  2CGI A;  5ITR A;  1LHM A;  2DI0 A;  3VDU A;  2X4A A;  3LCV B;  2RRU A;  3WW6 A;  4BAD A;  2L4E A;  2JZ1 A;  3FYC A;  1BWJ A;  1J1P Y;  4MH0 E;  1GL6 A;  3EO5 A;  248L A;  4LJ9 A;  1NQI A;  1VDP A;  4RNA A;  2Y8P A;  3KP0 E;  3WXU A;  2DNA A;  191L A;  1LGX A;  3GPY A;  1J5E M;  4PJZ A;  3KSX A;  1JTP L;  3AZ7 A;  1IQP A;  3J7B A;  1LYY A;  1VDD A;  3D8B A;  1QS9 A;  2LC9 A;  2MR9 A;  2LBC A;  4FJR A;  1F6S A;  3SBB C;  1QTC A;  1WGN A;  1TAY A;  5LVK A;  4PPO A;  1HNL A;  4DQ7 A;  5LVG A;  2JY8 A;  2EA0 A;  2B70 A;  2HL7 A;  1XEI A;  1IOS A;  4B7G A;  1E9S A;  4I7R A;  2LVA A;  1C6K A;  1B5Y A;  1L17 A;  4YOP A;  3KFU G;  3DN0 A;  3LN2 A;  5DN4 A;  3L2X A;  1UIA A;  3FD9 A;  1G1W A;  111L A;  1W6Z A;  1OUB A;  1OQY A;  1L29 A;  1GF3 A;  2D7E A;  4DQJ A;  1B7N A;  4DD1 A;  4QY9 A;  4DDC A;  143L A;  3BOS A;  2UUA M;  1QSQ A;  4HJV A;  3WPK A;  4ZEE A;  4B4I A;  3ZCB B;  2PC2 A;  1N36 M;  4G9S A;  2LTU A;  2CDS A;  1QSA A;  243L A;  3HY5 A;  1AIP C;  4GEW A;  1XGT C;  2LVO C;  262L A;  5ILF A;  3T36 A;  3C7W A;  3V2Y A;  2XJW A;  5ITX E;  1Q3C A; 
#chains in the Genus database with same CATH homology
 1KW5 A;  1JHL A;  3W6F A;  3UON A;  2FBB A;  4HV1 A;  4Z98 A;  1VAU A;  1L59 A;  2MEI A;  141L A;  1LYS A;  4NG8 A;  1ZVY B;  4WG7 A;  208L A;  2NTG A;  1LZD A;  1WVU A;  4C3W A;  1NBZ C;  1YKZ X;  1OUJ A;  4NSH A;  1PQO A;  1LLH A;  1VFB C;  228L A;  1GF0 A;  4QEQ A;  3TMU A;  2D6B A;  4OWH A;  1BB6 A;  5APE A;  1GBS A;  1L09 A;  1IWZ A;  3DMV A;  4I7O A;  2DQG Y;  4WLT A;  1PQK A;  4LYC A;  1LZY A;  1GFT A;  1YL0 X;  1C63 A;  3FI5 A;  2DBT A;  4DQ5 A;  1B5V A;  1P64 A;  230L A;  2Z12 A;  1JKC A;  4ARJ A;  169L A;  4HTN A;  1AT6 A;  5DL9 A;  1GFE A;  5LZM A;  1L10 A;  2LYM A;  3GUK A;  1WQP A;  1L40 A;  2B74 A;  1IR8 A;  7LYZ A;  1L92 A;  1VAT A;  2G4N A;  1D0K A;  1L53 A;  4H93 A;  3W3E A;  214L A;  5LAG A;  176L A;  3F9L A;  1DYA A;  3J6K A;  2Z2E A;  4W56 A;  1G7M C;  2Z18 A;  4IAS A;  1WQQ A;  1BB4 A;  3ZVQ A;  1JTT L;  3GUP A;  1T8F A;  1IOR A;  2ZQ4 A;  4M4O A;  1EQ5 A;  219L A;  1IY3 A;  1LZ4 A;  3TXI A;  4I8S A;  1ZV5 L;  122L A;  1GB6 A;  5FST A;  1Z55 A;  1T6H A;  137L A;  4W59 A;  1IVM A;  1GFG A;  1L86 A;  1QTK A;  2XQO A;  3C8S A;  2BQJ A;  3AW6 A;  1P37 A;  1NHB A;  5B59 A;  3AYQ A;  174L A;  3G3V A;  1LMP A;  4W53 A;  4R6C A;  2ZNW Y;  4DYG A;  2YBH A;  1LSA A;  4WL6 A;  4XJH A;  3A8Z A;  3IJU A;  1L36 A;  1BB7 A;  1L27 A;  1C64 A;  3B6L A;  5HMJ A;  4X3B A;  109L A;  4LFP A;  1OUI A;  3EXD A;  1L02 A;  3ODU A;  5IHG A;  1KIP C;  1LHI A;  1CV5 A;  1L15 A;  4NHT A;  4EPF A;  184L A;  1L73 A;  1L28 A;  134L A;  1GBW A;  1NMM A;  3HH6 A;  1CX7 A;  194L A;  1L69 A;  4DDB A;  1LHJ A;  3WYH A;  2ZYP A;  167L A;  2NWD X;  1QQY A;  1LSD A;  2OE7 X;  227L A;  3HTF A;  4R0F A;  1TBY A;  4I0C A;  4CHX A;  1HC0 A;  1N4F A;  4HPE A;  2HUL A;  5I4X A;  4LDL A;  4NIJ A;  4S0W A;  3P66 A;  1EQ4 A;  1G0K A;  1L00 A;  4XJG A;  4EJ4 A;  1L48 A;  1LMO A;  212L A;  225L A;  2BAA A;  2RBS A;  1JSE A;  4DD2 A;  4ETE A;  1DI5 A;  2B75 A;  3WL2 A;  1L22 A;  151L A;  2Z38 A;  3HT9 A;  2Z6B A;  3OK0 A;  166L A;  3RZ4 A;  1GF7 A;  2BQF A;  1L89 A;  1D0L A;  4DD3 A;  1L91 A;  3A90 A;  1L79 A;  4NHS A;  3A91 A;  2B5Z A;  1L56 A;  2LYZ A;  2MEA A;  1C10 A;  3DN6 A;  5E4P A;  2BQA A;  3HUK A;  1L13 A;  3EML A;  3ATN A;  1LZG A;  5FHW A;  1C6L A;  4DAJ A;  1DYG A;  4AGA A;  4W54 A;  4NGZ A;  1PS5 A;  1P2C C;  4G4H A;  1LMA A;  1L32 A;  5DLA A;  3DN8 A;  4N9R A;  2BQN A;  4ETD A;  1L99 A;  2DQF C;  253L A;  4WLD A;  1CU5 A;  1HEM A;  1QTH A;  3F6Z A;  1IR9 A;  2LZ2 A;  1OUG A;  3GUJ A;  3ZVQ B;  1L39 A;  1DKJ A;  4NY5 A;  2YBI A;  4W51 A;  4W94 A;  140L A;  180L A;  3CT5 A;  1L63 A;  3A6C Y;  1B6I A;  1HEP A;  4H9H A;  3WMK A;  5JEN B;  3AGG G;  221L A;  2HU3 A;  154L A;  1FDL Y;  3TMX A;  1LJF A;  2FYC A;  1LOZ A;  189L A;  5KXW A;  3NYA A;  4LDO A;  2RB2 X;  1LZT A;  201L A;  1LCN A;  5FCP A;  1L84 A;  2RBP A;  1UIC A;  4DD0 A;  4UWN A;  186L A;  3LZM A;  2H9K A;  3CDT A;  2LHM A;  159L A;  2EQL A;  4HJZ A;  2D4I A;  103L A;  2OU8 A;  127L A;  1GDW A;  211L A;  4H90 A;  4YEN A;  1SLY A;  1QT5 A;  2A7F A;  1L55 A;  3TXH A;  1T97 A;  4RDS A;  4OOO A;  2Q0M X;  1C6M A;  2BQI A;  4LDE A;  4WM2 A;  161L A;  4OWE A;  1L75 A;  5B1G A;  4WLY A;  1QDT A;  1IEE A;  1CJ7 A;  4J0L A;  4CFO A;  2DQH Y;  185L A;  4B4J A;  4ML7 A;  3RW8 A;  1C6N A;  4OWA A;  1VDT A;  1QUG A;  4XEN A;  170L A;  3TXB A;  2DQJ Y;  1JQU A;  1C61 A;  4W57 A;  5LVH A;  2HUB A;  232L A;  3A3Q A;  4WM1 A;  1C08 C;  207L A;  239L A;  5HQ1 A;  1G0J A;  1L64 A;  4AXT A;  1AM7 A;  1UIG A;  3OJP A;  4U3X B;  2B7X A;  139L A;  1LWG A;  3K2R A;  5L3I A;  188L A;  115L A;  1L45 A;  4ARL A;  2BQG A;  2RBR A;  2BQE A;  5B05 A;  1SSW A;  3LYO A;  1CV1 A;  5I53 A;  135L A;  4H92 A;  2N5Z A;  3SB8 A;  4ETB A;  5APD A;  1LGW A;  1L87 A;  5KXX A;  1CU3 A;  1GB2 A;  4N1C C;  1JIS A;  128L A;  1FLU A;  4QGZ A;  1LI3 A;  3GUI A;  1KY1 A;  1GEV A;  2B72 A;  3A92 A;  4I7T A;  5KXS A;  1IWT A;  132L A;  1PZY A;  4NHP A;  1GFV A;  4B4E A;  4KXI A;  1GB7 A;  259L A;  3OE8 A;  3FA0 A;  190L A;  1JJ0 A;  3HU8 A;  1G06 A;  1DQJ C;  1LYE A;  4UWV A;  1L50 A;  4FDY A;  4P2E A;  2XBS A;  1GE3 A;  4G49 A;  1L05 A;  1L80 A;  4LT3 A;  2ZIK A;  3IJV A;  2RSC A;  4NHI A;  5LYT A;  4TX7 A;  2I6Z A;  4KPM A;  1I1Z A;  4DDA A;  4I7Q A;  1L98 A;  2BQB A;  3QNG A;  4YXC A;  2O79 A;  4WOA A;  1LZ5 A;  1HML A;  3HFM Y;  210L A;  145L A;  3D3D A;  1GB3 A;  175L A;  1INU A;  1RJC B;  1L33 A;  1BVX A;  4N0J A;  4OOT A;  4RLN A;  1EQE A;  1L70 A;  4WL7 A;  1LKS A;  1IOT A;  1D9W A;  3HTB A;  2F4G A;  4ARM B;  3LYT A;  1L25 A;  4PJ2 C;  4B1A A;  4DWX A;  2ZIL A;  1GF5 A;  2BLX A;  3C8Q A;  3EMS A;  1BQL Y;  3AB6 A;  4XJF A;  1L20 A;  1LZ9 A;  242L A;  4CGE A;  1GFJ A;  1JTO L;  1WQR A;  5KKI A;  5LIO A;  2MEH A;  1G0L A;  1CKG A;  1TLA A;  1GFA A;  3DN1 A;  3MGW A;  5A3Z A;  1P36 A;  2HEC A;  1EL1 A;  4XJD A;  3WU8 A;  1HEW A;  5HMV A;  1LJ3 A;  1L06 A;  1C6I A;  3TXE A;  3CDO A;  3DNA A;  5L3H A;  1CKC A;  2IFF Y;  149L A;  1D2W A;  1CU0 A;  150L A;  3C8R A;  4LFX A;  5KXZ A;  5F16 A;  1BHZ A;  3KAM A;  104L A;  3SB7 A;  1B7Q A;  2HU1 A;  1JJ1 A;  5KXN A;  4OW1 A;  3TMV A;  3GXK A;  3FAD A;  1XGQ C;  3CDR A;  4WM4 A;  1DYC A;  3FI7 A;  3WU9 A;  4ARQ B;  1GHL A;  1CTW A;  163L A;  2HED A;  155L A;  4I7L A;  4NGO A;  5FEL A;  3HUA A;  4B0D A;  4GCD A;  4NWH A;  2DQA A;  2DKV A;  2BQD A;  4LYT A;  3HWL A;  2RB0 X;  3WVX A;  1GB9 A;  2GV0 A;  3CSQ A;  1L18 A;  216L A;  1PQM A;  1QIO A;  1UIB A;  1D9U A;  3AW7 A;  1REX A;  4HV2 A;  3G3X A;  1C6H A;  3LHM A;  1IOQ A;  4YM8 A;  2VB1 A;  2HUK A;  2B6W A;  1CNS A;  4I7J A;  4ETC A;  1P5C A;  1OQM A;  1SQ2 L;  1CJ8 A;  1D6Q A;  2BQK A;  1YQV Y;  1FBI X;  129L A;  1IWV A;  1JJ3 A;  1LJG A;  3AZ5 A;  4QDN A;  1UC0 A;  147L A;  3A3R X;  251L A;  1RCM A;  1F10 A;  3LYZ A;  1L95 A;  3HUQ A;  1CKD A;  4WO6 A;  220L A;  1D3N A;  3CSR A;  3M3U A;  5F9U A;  1YIL A;  1OUE A;  1D2Y A;  148L E;  3SB6 A;  2B6Z A;  1OYU A;  1LZE A;  3WUA A;  1L41 A;  4LGK A;  206L A;  1L81 A;  2D91 A;  5HNL A;  2EIZ C;  1LMC A;  4NGW A;  1MEL L;  1G0G A;  1P46 A;  1L88 A;  249L A;  1XGP C;  2C8O A;  1G7J C;  1LZ1 A;  1T6V L;  1KXY A;  1XEJ A;  1GXX A;  1UA6 Y;  1C60 A;  1WTM A;  1LZB A;  1XEK A;  1C65 A;  1C6D A;  2YVB A;  2B6Y A;  1HEQ A;  4O34 A;  1UAC Y;  3F8V A;  5HLL A;  4D9Z A;  1LZR A;  2Z39 A;  1CVK A;  102L A;  1LAA A;  4LZT A;  3WUM A;  4LYM A;  5F9X A;  1LJN A;  1L62 A;  196L A;  1LWK A;  3CSZ A;  4G4B A;  1WQO A;  1P7S A;  1LSF A;  1YAQ A;  1HEN A;  3NY8 A;  3FE0 A;  4K5Y A;  1L82 A;  4I7M A;  1IP4 A;  1JKD A;  1LSB A;  3QY4 A;  2Q9E A;  3P65 A;  1VDS A;  1GB8 A;  1QTD A;  142L A;  1HMK A;  4NGJ A;  7LZM A;  1PQI A;  213L A;  6LYZ A;  2AUB A;  1V7T A;  3A34 A;  2H9J A;  1ZVH L;  2DQE Y;  1GFU A;  4Z3M A;  1C45 A;  1OVK A;  1QTZ A;  1HER A;  1GAY A;  1OWY A;  1WTN A;  205L A;  1L71 A;  1LSE A;  5LYM A;  1L0J A;  231L A;  4NEB A;  1L07 A;  3J4G A;  1L23 A;  1T8G A;  1L57 A;  3HT7 A;  4I7S A;  2LZT A;  158L A;  192L A;  240L A;  1D0M A;  3N9A A;  4NSI A;  153L A;  4PGJ B;  2Z2F A;  1C69 A;  197L A;  2Z19 A;  1ZYT A;  168L A;  2I26 L;  3OE9 A;  4NGK A;  1IP1 A;  3GUL A;  1YAO A;  1V7S A;  215L A;  1I20 A;  1C67 A;  1C62 A;  5B06 A;  108L A;  226L A;  5ILC A;  1FLW A;  1L26 A;  2BPU A;  2W1Y A;  1L58 A;  247L A;  5K7O A;  1P6Y A;  1YIK A;  1GFK A;  1JTN A;  1H6M A;  4NGI A;  3RT5 X;  1O23 A;  1LYO A;  144L A;  2HTX A;  1WQN A;  3C83 A;  1GBX A;  1L0K A;  1L08 A;  1CU2 A;  1IR7 A;  4TSB A;  222L A;  1L51 A;  1E8L A;  5L9J A;  1YAN A;  4EOF A;  1IWU A;  171L A;  1L35 A;  2DQD Y;  4M6D A;  8LYZ A;  1LYJ A;  1QTV A;  2OU0 X;  152L A;  4ET9 A;  3PDS A;  1JIT A;  4NGV A;  1RE2 A;  1D3M A;  3B0I A;  3GUM A;  1P2R A;  4WG1 A;  3DN4 A;  1B5Z A;  3HT6 A;  1IP7 A;  1KNI A;  4H94 A;  1C43 A;  4GN4 A;  1J1X Y;  4NG1 A;  3A95 A;  3A94 A;  4LT2 A;  257L A;  2WAR A;  183L A;  5T3F A;  3WXT A;  237L A;  3TMW A;  1L49 A;  4H91 A;  4NSG A;  1LSZ A;  3CDQ A;  1SX7 A;  1L34 A;  1HFZ A;  1DZB X;  2YBL A;  5KXT A;  1L60 A;  3QAK A;  1C7P A;  5I5Q A;  1G0Q A;  1CX6 A;  2ZIJ A;  1YAM A;  5LAF A;  5F81 A;  1XGR C;  3C80 A;  200L A;  4TSC A;  4ANR A;  1QT3 A;  1NWG A;  1JUG A;  5LVI A;  4WMG A;  5KXM A;  1C6B A;  1L83 A;  4IAP A;  3C7Y A;  120L A;  3DKE X;  4H9I A;  3WPJ A;  3P4Z A;  1L65 A;  1MLC E;  3A93 A;  2A7D A;  1IOC A;  1AKI A;  1IY4 A;  3C7Z A;  1CJ9 A;  1OV7 A;  2HUM A;  2F32 A;  5LXW A;  133L A;  130L A;  4ZIX A;  4ETA A;  4AQN A;  1UUZ C;  3DMZ A;  4J1B A;  1NBY C;  157L A;  4GCE A;  4TWS A;  3TXD A;  3NY9 A;  2CJL A;  193L A;  2MEE A;  6LYT A;  1LMT A;  4EKR A;  1G7I C;  1OUH A;  244L A;  4LT0 A;  1DPW A;  4W58 A;  4NSJ A;  4YEO A;  162L A;  1L14 A;  5AMY A;  2B73 A;  1FKQ A;  2C8P A;  2O7A A;  2G4Q A;  1L90 A;  1IC7 Y;  3HDF A;  2MEG A;  5HNC A;  2OTZ X;  2ANX A;  2ZWB A;  224L A;  5KXO A;  233L A;  2LYO A;  2RAY X;  3CDV A;  5I4W A;  1LHH A;  3JR6 A;  2FYD A;  1REM A;  1C6F A;  1YKY X;  1IP5 A;  1KS3 A;  4J7V A;  4WO9 A;  4HTK A;  4Z41 A;  1OV5 A;  2F4A A;  1DYF A;  4EKQ A;  5KXL A;  1L46 A;  4BAF A;  1TEW A;  2W1X A;  260L A;  3HBH A;  3A96 A;  5IDD A;  1LYG A;  1LHK A;  4RW1 A;  2RBN A;  3G3B B;  1DYE A;  1L44 A;  1K28 A;  1C6G A;  1ZUR A;  1LJI A;  5C6L A;  1DI4 A;  3C82 A;  1LI6 A;  182L A;  1XJT A;  5D5C A;  1IX0 A;  4YX7 C;  4NHQ A;  195L A;  3HTD A;  1CJ6 A;  4XN6 A;  1I56 A;  1ZWN A;  2BQL A;  5EBH A;  1GD6 A;  3AZ6 A;  1P2L A;  2MEC A;  1L38 A;  1JKB A;  2BQO A;  4ARP A;  1JPO A;  5KXY A;  3SP3 A;  1JIY A;  2DQI Y;  1BGI A;  3P68 A;  1QT7 A;  4PRQ A;  9LYZ A;  3C81 A;  4N5R A;  1GXV 2;  4KT3 A;  1LTM A;  1LYI A;  110L A;  1HHL A;  1LZ6 A;  2FBD A;  2W1M A;  3E3D A;  1B7L A;  1GF9 A;  1B5X A;  4LYZ A;  1HSX A;  1NDG C;  1QSW A;  1UBZ A;  2CWI A;  3OE0 A;  1LYF A;  3W6E A;  3TXG A;  2YSS C;  1XEP A;  4H9A A;  3WVY A;  4DD7 A;  229L A;  1GDX A;  5I54 A;  1KIR C;  3D4S A;  1G7L C;  1CUQ A;  2MEF A;  3HT8 A;  3RZE A;  1L93 A;  1L97 A;  4WM3 A;  6LZM A;  2OE4 X;  2ZYC A;  3N9C A;  1LKR A;  3RNX A;  1LJK A;  1G7H C;  1L37 A;  1QUT A;  1LSN A;  3B72 A;  1UCO A;  4WM5 A;  3DMX A;  1LSM A;  4GN5 C;  4PK0 A;  2LCB A;  1GWD A;  1C6C A;  3GUO A;  1QUH A;  3WH1 A;  1YRO A;  4GCC A;  2OEA X;  1GBO A;  1LZ8 A;  261L A;  5LVJ A;  1CUP A;  3RUN A;  1REY A;  5F14 A;  2I25 L;  4MCK A;  5KJ9 A;  256L A;  5DM9 A;  2QB0 B;  4RW2 A;  1NHE A;  126L A;  2RB1 X;  3LZ2 A;  4CFP A;  3TXJ A;  3OE6 A;  138L A;  1L68 A;  4E97 A;  1L30 A;  1B0D A;  1IC5 Y;  1LI2 A;  4YEM A;  2BQH A;  2D4J A;  1GE0 A;  1P56 A;  1JTM A;  2F30 A;  1OVJ A;  1KXW A;  1GE2 A;  2YBJ A;  1TCY A;  3A67 Y;  5KXK A;  2ZQ3 A;  4GN3 A;  2BQC A;  3HU9 A;  1L43 A;  3CQL A;  3TXF A;  5KKJ A;  236L A;  4MR1 A;  4H8X A;  4ZPU A;  2MED A;  1DYB A;  1L74 A;  2MEB A;  1OUA A;  1B7R A;  1C6Q A;  3D9A C;  1DYD A;  252L A;  3V2W A;  1LHL A;  4HP0 A;  3W6D A;  1L85 A;  1HF4 A;  1QSB A;  4WLX A;  125L A;  1REZ A;  1A4V A;  4EKS A;  4TUN A;  4UWU A;  5C6J A;  3HH4 A;  4BS7 A;  1CV4 A;  2BLY A;  1XJU A;  4N8Z A;  1L12 A;  1GB5 A;  1RFP A;  160L A;  1L03 A;  1OUD A;  4H9C A;  1OWZ A;  1L19 A;  3ULR A;  3P64 A;  2ANV A;  4DC4 A;  3AZ4 A;  209L A;  2Z37 A;  1C66 A;  1QT8 A;  1XSF A;  1L04 A;  4I7P A;  258L A;  3LYM A;  4NGY A;  2OE9 X;  4H1P A;  3TXK A;  1L54 A;  1QUO A;  1L42 A;  1L31 A;  255L A;  3T6U A;  4XJB A;  1C6E A;  1KIQ C;  1NF5 A;  1LPI A;  1SWY A;  4RLM A;  1BB5 A;  3SBA A;  1LSP A;  5APF A;  5E9R A;  5I14 A;  4YXA C;  2X0A A;  254L A;  3GUN A;  1G0P A;  1WTH A;  3ATO A;  4KL7 A;  1L61 A;  4YF2 A;  4J1A A;  1LJH A;  1OUF A;  1SX2 A;  3W6A A;  123L A;  3EBA B;  3ZEK A;  178L A;  235L A;  3SB5 A;  1DI3 A;  1T3P A;  4H9F A;  4OWB A;  1ALC A;  1LZA A;  4GRV A;  4BAP A;  1LZC A;  5FEK A;  199L A;  1G1V A;  1B5U A;  4HSF A;  1LW9 A;  131L A;  1UID A;  2L78 A;  5FDJ A;  1L67 A;  1GPQ C;  1LSG A;  3W6B A;  1WVV A;  2H5Z A;  2RH1 A;  234L A;  2EKS C;  2RAZ X;  3DN2 A;  1KW7 A;  1LSY A;  1UIE A;  1W08 A;  1IP2 A;  4ET8 A;  1B7M A;  5B07 A;  1GBZ A;  2QAR C;  1GE1 A;  1IP3 A;  1JWR A;  2IGC A;  1LJE A;  5C6I A;  1OP9 B;  4W96 A;  1CKF A;  1H87 A;  1CKH A;  4W55 A;  4MST A;  1C6T A;  4DT3 A;  4I7N A;  3HDE A;  1UIF A;  1CV0 A;  2OTY X;  4GLV A;  3CB7 A;  218L A;  5DN5 A;  4Z46 A;  1HEO A;  4DJH A;  1TDY A;  2O4W A;  1IC4 Y;  1LPY A;  1KY0 A;  4EMN A;  1IWX A;  3AJN A;  4XYY A;  5I4Y A;  2CUU A;  1B9O A;  1AZF A;  1GFH A;  3RU5 A;  165L A;  3SB9 A;  4GCF A;  1HFY A;  4A7D A;  5KXP A;  1CU6 A;  2LZM A;  198L A;  1QTE A;  1G07 A;  3K3T A;  1HEL A;  3BKH A;  2F2Q A;  1QTB A;  4NWE A;  1LSC A;  1DXJ A;  4CJ2 A;  3B0K A;  3G3A B;  4IAT A;  1LZN A;  1L16 A;  2HEA A;  4GLA A;  4LYO A;  4EKP A;  1SSY A;  1LMN A;  3WUL A;  4H8Y A;  5LA8 A;  1VDQ A;  1QS5 A;  1EPY A;  1CV3 A;  2F2N A;  4I7K A;  1C6J A;  2XBR A;  1OVH A;  1L21 A;  4EXM A;  238L A;  5M1Y A;  4PRU A;  4C5F A;  5LYZ A;  3QE8 A;  241L A;  1F0W A;  3WW5 A;  1FLY A;  1IP6 A;  3VW7 A;  1L76 A;  1YKX X;  1I6S A;  1B7O A;  1PQD A;  4L41 A;  1C6P A;  1QT6 A;  3G3W A;  1HSW A;  5A3E A;  1L77 A;  3B0O A;  3N9E A;  1F6R A;  1UIH A;  118L A;  1LJ4 A;  1IO5 A;  1AT5 A;  246L A;  2BQM A;  2RBO A;  2W1L A;  217L A;  1GAZ A;  245L A;  1IIZ A;  5IEL A;  4XJI A;  112L A;  4DKL A;  1NKH A;  2YBN A;  4LYB A;  2DQC Y;  3DN3 A;  1DKK A;  3IWR A;  1T8A A;  1GEZ A;  107L A;  5D5F A;  156L A;  1L11 A;  1GB0 A;  1FLQ A;  119L A;  4WM6 A;  113L A;  3BKV A;  4ARM A;  3HH5 A;  4NGL A;  5II3 A;  4H8Z A;  3HBE X;  4GCB A;  1JSF A;  4ZFP A;  2HEE A;  4H9B A;  1BWH A;  164L A;  3PBL A;  2A4T A;  1LYH A;  1CV6 A;  3WU7 A;  1JEF A;  1WQM A;  2OU9 A;  1IWY A;  1L52 A;  3AGH A;  177L A;  3W6C A;  2RBQ A;  1LGU A;  1XGU C;  223L A;  3M18 B;  1YAP A;  3L64 A;  146L A;  1LYD A;  1C46 A;  1NDM C;  4OO9 A;  2HEF A;  4II8 A;  3AGI A;  172L A;  1XFP L;  2YBM A;  1D6P A;  4GBR B;  2EPE A;  4LZM A;  250L A;  1LJJ A;  1PQJ A;  2Q9D A;  1SWZ A;  1ZMY L;  181L A;  2NTH A;  1HFX A;  2HEB A;  4DD9 A;  4G4C A;  1GF6 A;  1D3J A;  1QDR A;  5B1F A;  4EPI A;  3HTG A;  4XAD A;  1JKA A;  1J1O Y;  2IHL A;  1KXX A;  114L A;  5LIN A;  1LYZ A;  1VED A;  3HBD A;  1IWW A;  1RI8 B;  1GE4 A;  3VWO A;  3SN6 R;  4W52 A;  1BB3 A;  3CT1 A;  1FN5 A;  1QT4 A;  3GXR A;  4PHI A;  3WPL A;  4B49 A;  4ARQ A;  2YDG A;  4NFV A;  1BWI A;  1B7S A;  4N1E I;  1FKV A;  187L A;  1L47 A;  1LZS A;  1GF8 A;  1OUC A;  2B6T A;  3A6B Y;  4HTQ A;  1YL1 X;  1LMQ A;  1L66 A;  1B7P A;  1P3N A;  1B5W A;  5KXR A;  1L96 A;  5J7C A;  3LZT A;  3CT0 A;  1G0M A;  4E3U A;  5LA5 A;  2XTH A;  3HH3 A;  1C68 A;  1L01 A;  5KY1 A;  1QUD A;  4TTD A;  4HJY A;  4OWC A;  4LT1 A;  4H9E A;  1GFR A;  1QUS A;  3WUN A;  173L A;  2F47 A;  4HPI A;  1C6A A;  1DPX A;  1L72 A;  2ZNX Y;  1D3F A;  5APC A;  1L24 A;  1GF4 A;  1GBY A;  4IJ4 A;  1L94 A;  2D4K A;  2G4P A;  1A2Y C;  1BVK C;  1B2K A;  2CGI A;  1LHM A;  4BAD A;  3WW6 A;  1BWJ A;  1J1P Y;  3EO5 A;  248L A;  1NQI A;  1VDP A;  2Y8P A;  3WXU A;  191L A;  1LGX A;  4PJZ A;  1JTP L;  3AZ7 A;  1LYY A;  1QS9 A;  2LC9 A;  4FJR A;  1F6S A;  3SBB C;  1QTC A;  1TAY A;  5LVK A;  4PPO A;  1HNL A;  4DQ7 A;  5LVG A;  2B70 A;  1XEI A;  1IOS A;  4I7R A;  1C6K A;  1B5Y A;  1L17 A;  4YOP A;  3DN0 A;  3LN2 A;  5DN4 A;  3L2X A;  1UIA A;  1G1W A;  111L A;  1W6Z A;  1OUB A;  1L29 A;  1GF3 A;  4DQJ A;  1B7N A;  4DD1 A;  4QY9 A;  4DDC A;  143L A;  4HJV A;  1QSQ A;  3WPK A;  4ZEE A;  4B4I A;  2PC2 A;  4G9S A;  2CDS A;  1QSA A;  243L A;  1XGT C;  262L A;  5ILF A;  3T36 A;  3C7W A;  3V2Y A;  2XJW A;  2B6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...