1D0MA

The escherichia coli lytic transglycosylase slt35 in complex with bulgecin a and (glcnac)2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the interactions of Escherichia coli lytic transglycosylase Slt35 with peptidoglycan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE
total genus 110
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1d0mA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1d0mA02
5E9RA 5LXWA 1FLQA 9LYZA 1JEFA 4I8SA 1GF8A 4I0CA 4WOAA 4NIJA 4PJ2C 5FCPA 1HSXA 1B5YA 1VDTA 4B49A 1YAMA 4NGIA 2XBRA 5ILFA 3WPKA 5LVKA 5HLLA 4XYYA 1GF6A 2EQLA 5LYZA 4LT0A 1UIDA 3WYHA 4WM2A 5D5CA 5KY1A 2C8OA 1DZBX 1WQPA 1GE1A 4HJZA 4ETBA 1IWTA 1UACY 1NDMC 2LYMA 1B2KA 5KXNA 1IOQA 4YEOA 4NGWA 1LZ1A 5F9UA 3TXKA 1GB8A 1GFHA 1QQYA 5KXSA 3WU7A 3E3DA 4R0FA 4DT3A 1JIYA 3K3TA 1N4FA 1JKBA 4HP0A 3TXDA 1LZRA 2LZTA 1JHLA 3ULRA 3P66A 4AGAA 3EMSA 1QSWA 5KKJA 1HF4A 1NKHA 1XGUC 4QGZA 4WO6A 5IDDA 5KXXA 1HC0A 4H8YA 5F81A 3HBEX 4B4EA 2BQFA 2MEGA 1GE4A 3W6CA 1LSDA 1LZ4A 3AJNA 3LZTA 4HTNA 1REXA 1AZFA 5KXOA 3AW6A 1UUZC 1B5XA 1LZAA 5L9JA 1H6MA 4YF2A 3VWOA 2F2NA 4XENA 1FBIX 3WULA 1Z55A 1ZMYL 4HTQA 3A6BY 4IJ4A 4NGYA 2BQNA 4OW1A 3WVYA 4CHXA 2VB1A 1JSFA 1SQ2L 3AZ6A 3HFMY 4UWVA 5C6LA 3B6LA 5DM9A 3W3EA 1LZYA 4WLXA 1F6RA 1GFKA 1GAZA 3W6BA 1LZTA 1V7TA 5B59A 1LYZA 3LYMA 5T3FA 1GB3A 1GB7A 3OK0A 3IJVA 4J1BA 4TUNA 1GF7A 2ZQ3A 1DI5A 2YVBA 1UC0A 1QIOA 4XADA 2F4GA 1MLCE 3TXBA 2DQJY 4U3XB 3WVXA 8LYZA 1GB9A 1IP3A 2ZQ4A 2ZYPA 1IP7A 1LMCA 3A3RX 1IY4A 4RW2A 3B72A 3WUAA 4DD2A 2BLYA 5FELA 4DDCA 4Z41A 2HU3A 4G9SA 5KJ9A 2HECA 2W1XA 3SP3A 132LA 1REZA 5APDA 4HPEA 3LYOA 3AZ5A 4GCFA 4II8A 2BQHA 1EQ5A 1GE2A 4NSJA 1DI3A 1LYYA 3A94A 4RLNA 2PC2A 4XJBA 2D4KA 3A90A 1I20A 3AW7A 2BQJA 4PPOA 1C7PA 4G4BA 2FYCA 4OWCA 1GDWA 1KIQC 4LZTA 135LA 1FLWA 1LJFA 2HU1A 4NHTA 1GBOA 3T36A 3FI7A 3QE8A 1JTOL 1IWVA 1XEKA 3AZ7A 3B0OA 3RZ4A 5KXMA 4YOPA 4TX7A 1B7RA 4N1CC 2ZIJA 4HTKA 4OWAA 4TSCA 4W94A 4QY9A 3N9CA 4J1AA 4N5RA 1BHZA 4DD7A 4GLVA 1LZSA 5E4PA 1GFTA 1IR9A 4HJYA 4ZFPA 1LZGA 3AYQA 4ZIXA 3A34A 1GF4A 4G4CA 2D4IA 1NBYC 2BPUA 1LZ9A 3KAMA 1LOZA 1TEWA 2MEHA 4MR1A 3TXIA 4E3UA 2G4QA 1UCOA 3P64A 4MSTA 3CT1A 3GXRA 2ZNWY 1LSYA 1LHIA 1VDQA 1HEOA 2ZILA 4OWHA 4WL7A 4LYTA 1ZVHL 1D0MA 3AGIA 6LYTA 1PZYA 1IWUA 4WG1A 1LZDA 1LSEA 4NGVA 2G4NA 1GBZA 3P4ZA 2D91A 1P2CC 1LJJA 2BQCA 5LINA 4LFXA 1B9OA 3BKHA 2NWDX 1GFAA 4H9HA 5DN5A 1GXV2 1BB7A 1CJ9A 2DQHY 2BQGA 4LT2A 5HMVA 2CJLA 1AT6A 1JJ0A 3IJUA 1KXYA 1OUBA 4L41A 1JUGA 2BQDA 1PS5A 4FJRA 4J7VA 1B7OA 1TDYA 4H9BA 5DN4A 4CGEA 1JISA 1T6VL 1IIZA 5B07A 3TXFA 4AXTA 1G7LC 1RI8B 5KXZA 5DLAA 3A3QA 1IORA 4H93A 1GAYA 3BKVA 1G7HC 1GFRA 4DD3A 3CSZA 1LSBA 1C10A 1LJHA 1VATA 1JWRA 4HSFA 4MCKA 5FSTA 193LA 1WQOA 5HNLA 4TWSA 4PGJB 1IEEA 1GB2A 2HEEA 3LYTA 4XN6A 4A7DA 1IC7Y 1T3PA 3A95A 5C6JA 3ZVQA 3WUMA 1IR7A 3LZ2A 1CKFA 2N5ZA 4WM4A 194LA 4B4JA 1HERA 1BWHA 2BQBA 1EQ4A 1FLYA 3AB6A 1VDPA 4QDNA 1BGIA 4NGOA 1CKGA 1LJEA 1REMA 1BVKC 4ETEA 1HEPA 5ILCA 1H87A 208LA 1UBZA 4LYMA 5LYTA 1LSAA 1EQEA 1CJ6A 4IATA 5A3ZA 1WTMA 1C08C 1NWGA 1VEDA 2I25L 1IWXA 4OWBA 5K7OA 3RU5A 1UICA 3EXDA 4NGZA 3OJPA 5LAFA 4Z46A 5I4XA 5LVGA 5I5QA 2Z18A 1LZNA 1OQMA 5F14A 1GB0A 1LPIA 1IP1A 4GN5C 1IY3A 3IWRA 1JKAA 2D6BA 4B1AA 1D0LA 5LVJA 2Q0MX 3AGHA 4PRUA 4C3WA 3CT0A 1JTPL 1XEIA 2A7FA 4UWUA 4YM8A 3M3UA 2Z19A 4GCBA 2Z2EA 3WW5A 1SLYA 1WVVA 1YIKA 2ZIKA 1YKXX 4NWEA 4OOOA 2XJWA 4G49A 1IVMA 1INUA 2Z2FA 3WPJA 2FYDA 1GE3A 1F10A 3WUNA 4CJ2A 2HEFA 4WM5A 1AKIA 4DDBA 3A93A 4LYBA 1DQJC 2DQEY 1NBZC 1RCMA 5L3IA 4NWHA 1YKZX 4WM6A 2A7DA 1LHKA 1QUTA 1BB4A 2XTHA 4N8ZA 2AUBA 1LJKA 2I6ZA 4LYCA 5I4YA 2B5ZA 2DQCY 1YQVY 1BQLY 4HPIA 5KXYA 6LYZA 2DQIY 4GN3A 2DQDY 4GN4A 4QEQA 1IC5Y 1LZEA 4BAFA 1IWWA 1XGQC 2MECA 2YBJA 2ZYCA 5AMYA 1LKSA 4OWEA 1FLUA 5JENB 4WLYA 1OP9B 1QDRA 3TXEA 4HJVA 2H5ZA 1IP5A 1CNSA 1NDGC 1KXWA 3EO5A 1GBYA 1LJ3A 5L3HA 4DWXA 5EBHA 133LA 5C6IA 1YAOA 3AZ4A 1JITA 3CT5A 1LTMA 5HMJA 2H9KA 3T6UA 4RW1A 3A6CY 1LSFA 2HUBA 3WXTA 5A3EA 2BQMA 3TMXA 1LSZA 1CJ8A 1C45A 2WARA 3WU9A 1I56A 2MEEA 2W1MA 4GCEA 4H92A 1J1PY 1UIAA 1W6ZA 5HQ1A 1JJ1A 2YBHA 1JPOA 1HMLA 2HTXA 3QY4A 2H9JA 4YEMA 1KXXA 1LHMA 1LHHA 4H9AA 4KXIA 3RNXA 4LT3A 4DD9A 1IO5A 5I54A 4ANRA 1HMKA 2HEBA 2LHMA 3TMUA 207LA 5KXRA 4C5FA 4EMNA 1IP4A 3P65A 1LSNA 2Z39A 4LT1A 1XEJA 1OUEA 1HFYA 1CKDA 2DQAA 3TMVA 1C43A 3WL2A 2C8PA 4NGJA 1UIBA 1LCNA 1JKCA 2YBNA 1TCYA 1B7LA 3WXUA 5M1YA 4H8XA 1AM7A 4FDYA 4XJIA 3TXJA 2YDGA 1F6SA 4ML7A 1AT5A 1IOTA 3A8ZA 1YAQA 1HEWA 1LZ5A 4GCDA 1NMMA 5KXKA 3B0KA 1WQQA 4NHIA 1GFJA 4NSGA 4ET8A 5LIOA 4IASA 2YBLA 4H91A 2F4AA 4N0JA 1GFGA 2Z38A 3RT5X 2GV0A 1CJ7A 2LYZA 2Z37A 3W6AA 1RJCB 5B06A 4G4HA 3W6EA 4W96A 1OUCA 1WVUA 3G3BB 4GLAA 4XJDA 4XJFA 5F9XA 4WMGA 1LSMA 1LSPA 2BQAA 4YENA 2W1YA 3A91A 1FKQA 1LMOA 4NY5A 2BQIA 1ZV5L 4EOFA 4KT3A 4LGKA 5I4WA 1J1XY 1A2YC 1OUAA 2BAAA 2ZNXY 1WQRA 1QTEA 1XFPL 5APCA 2IFFY 2MEBA 4WLTA 4M4OA 1G7MC 2I26L 1UA6Y 1YKYX 2FBDA 4NG1A 1IOCA 1B7SA 2BQOA 1OUDA 2Z12A 5FDJA 4H9CA 1D6QA 1IP2A 1LJ4A 1GEZA 4NFVA 1GHLA 1HFXA 2YBIA 1CKHA 3LYZA 4WG7A 4ETDA 1VFBC 4TSBA 1CKCA 1LMAA 1LZ8A 1J1OY 3AGGG 4TTDA 4H94A 1NHEA 2HEAA 4UWNA 1XGTC 1OUJA 1YROA 1UIGA 3HBDA 1WTNA 4O34A 3WU8A 1OUGA 1BB3A 1YANA 4X3BA 5APEA 4DD1A 5B1FA 1LHLA 2Y8PA 1B7MA 1XGRC 1UIHA 1YAPA 3CSQA 3MGWA 1VDSA 3CQLA 1FKVA 2DQFC 4NG8A 4ET9A 5J7CA 3WW6A 3W6FA 7LYZA 5DL9A 4LYZA 3EBAB 1REYA 153LA 1GDXA 2W1LA 1XGPC 1IP6A 4NHPA 1LMQA 1D0KA 1B7NA 1B5WA 4NEBA 5FEKA 3ATOA 1W08A 1XSFA 4WM3A 3HBHA 1GBWA 3W6DA 4RLMA 3N9AA 1BVXA 1B7QA 1GE0A 1IC4Y 4DDAA 4Z3MA 2CWIA 1HFZA 2DBTA 4WL6A 2BQKA 1GB5A 1VAUA 1OUFA 1DI4A 1GFUA 3QNGA 2YBMA 1EL1A 3LN2A 1LHJA 4BS7A 2MEDA 3B0IA 1DKJA 4OOTA 4NGLA 4H8ZA 4ETAA 4B4IA 3CB7A 3WH1A 1JTTL 1QSAA 4WLDA 3G3AB 1WQNA 4RDSA 1MELL 1LYSA 4LYOA 2IHLA 1UIFA 1ZVYB 3WPLA 4H90A 1LZCA 2MEAA 3RW8A 1GBSA 2ZWBA 1WQMA 3LHMA 154LA 4NGKA 1LJGA 1D6PA 1O23A 4CFOA 3F6ZA 4H1PA 1HSWA 4H9FA 5I53A 3TXHA 5IHGA 1BWJA 3TMWA 2LYOA 4BAPA 3FE0A 2RSCA 5LVIA 5HNCA 4NHSA 1FN5A 3D3DA 5KKIA 3A67Y 1HEMA 3J4GA 5B1GA 1GF0A 2X0AA 2CDSA 5B05A 1LSCA 1OUIA 4DD0A 1LKRA 1QUSA 2FBBA 1NF5A 1DPWA 5LA8A 1LJNA 1G7IC 2XBSA 4P2EA 4CFPA 4NHQA 1TAYA 4H9IA 1QDTA 1IWZA 2EPEA 3P68A 1FDLY 1G7JC 1V7SA 4NSIA 1GD6A 1GWDA 3ZVQB 4LFPA 2DKVA 5FHWA 1IR8A 1LYOA 2D4JA 3D9AC 4J0LA 4HV1A 1GEVA 1B7PA 1GB6A 1HEQA 1KIPC 1GXXA 2EKSC 4GCCA 1LAAA 4H9EA 4DC4A 5KXTA 4N9RA 1DPXA 1LJIA 3N9EA 1E8LA 1HELA 1JSEA 1GF5A 1LMPA 4ETCA 4HV2A 3TXGA 1BWIA 4R6CA 2MEFA 2EIZC 4NSHA 3J6KA 1HENA 5KXLA 3A96A 3ATNA 5LVHA 1UIEA 2BQEA 1GFVA 4M6DA 1LSGA 2G4PA 1GPQC 5KXWA 2YSSC 1KIRC 5II3A 1BB5A 1JJ3A 4D9ZA 5F16A 4DYGA 2LZ2A 1IWYA 2BQLA 1A4VA 1NQIA 4N1EI 1JKDA 1HNLA 4ZEEA 4B0DA 1D9UA 1GFEA 1LMTA 5LAGA 1RE2A 1GBXA 2HEDA 2F30A 3GXKA 134LA 1ALCA 2DQGY 4XJHA 1B5UA 4PHIA 1IOSA 1YL1X 1GF3A 1TBYA 1I1ZA 1B5ZA 1LZ6A 1C46A 4Z98A 3M18B 5D5FA 3WMKA 5IELA 1BB6A 1IX0A 1LZBA 4XJGA 3ZEKA 5LA5A 1RFPA 4WM1A 2MEIA 1YL0X 3CSRA 1GF9A 1B0DA 1DKKA 1LMNA 5KXPA 4BADA 1OUHA 4KPMA 4PRQA 1HHLA 1F0WA 1B5VA 5LYMA 4KL7A 5APFA 1DXJA 1YILA 2BLXA 3A92A 2CGIA 4WO9A 1QTKA
chains in the Genus database with same CATH superfamily
9LYZA 3U60B 4B49A 1YAMA 3KOZE 3W67A 2KRUA 5LVKA 1L77A 5LYZA 3EIHA 4LT0A 1UIDA 4WM2A 1GE1A 151LA 1LYGA 5KXNA 1LZ1A 218LA 1IBKM 3TXKA 1Q02A 3FTCA 3K92A 1JKBA 4HP0A 3Q8XA 3TXDA 1JHLA 4AGAA 3EMSA 1B6IA 4OO9A 1NKHA 1TLAA 4QGZA 4DQ5A 1Z5AA 198LA 4B4EA 1HT2E 4JI5M 2BQFA 2RBQA 1LSDA 4HTNA 3FUXA 5E26A 1C6JA 3AW6A 2R4EA 3VK8A 1UUZC 1B5XA 2OE4X 1LZAA 2O5RA 3MK6A 1L16A 3DFZA 3VWOA 4G4RA 3WULA 4MB7A 4HTQA 4II7A 3VDUA 4R3DA 4IJ4A 3WVYA 4CHXA 3KVWA 3PNVA 3U6LA 1E9SA 1LZYA 4L16A 5ITTA 1GFKA 1GAZA 2L7HA 1L05A 223LA 5B59A 1GB3A 3OK0A 4CJ6A 1QT4A 2ZQ3A 1C6IA 4LDOA 1QIOA 4XADA 1NY6A 1MLCE 4W57A 3WVXA 8LYZA 3GPUA 3GLGB 3GULA 3GLGE 3A3RX 3OE6A 113LA 3HUKA 2O25A 4G9SA 2XLJA 3H4JA 1L14A 1C66A 5APDA 126LA 1E32A 3JR5A 2DZOB 1L63A 4ARMB 1DI3A 2DVWB 2B6ZA 2D4KA 2NTHA 3LMMA 5GKNA 1C6PA 4PPOA 1QZMA 2WSFF 3KS4A 135LA 5F3WA 1WGNA 5ITYA 3FI7A 2CV2A 4JN6A 1XEKA 3AZ7A 3B0OA 1L27A 2DHYA 5KPTA 4YOPA 4TX7A 1L43A 4QY9A 2QNJA 4W94A 1ORYB 4KO8A 4G4OA 1HQYE 1LZSA 5E4PA 1GFTA 237LA 3DOAA 1LZGA 1L0KA 3K9OA 3LQRA 4G4CA 4W54A 4DV5M 253LA 3U60A 1IXSA 4E3UA 220LA 2LVPC 1HNZM 3DN6A 2ZNWY 1CU3A 1L41A 1LHIA 1VDQA 1HEOA 2ZILA 3GUMA 4WG1A 3SAVA 249LA 1TH4A 3SYKA 2JP7A 1P2CC 2BQCA 3BKHA 2NWDX 5DN5A 2DQHY 1C6BA 4L41A 1GO5A 1PS5A 3AOEA 3GQ5A 4AKHA 1G7LC 4EXMA 4M9SA 1W5SA 3A3QA 3I01M 1PJTA 4H93A 130LA 4DD3A 3HKPA 190LA 1LJHA 1VATA 4S0WA 5LMUM 120LA 4TWSA 3B89A 3L25A 3NWLA 3SAUA 2HEEA 3LYTA 3LCUA 1IC7Y 119LA 3HUAA 1IR7A 1L56A 3GUIA 1CKFA 4B4JA 2XF3A 2BQBA 1FLYA 4QDNA 4NGOA 1CKGA 4F1IA 244LA 1TDZA 2XSZD 4ETEA 1HEPA 5ILCA 1UBZA 5EP2A 3UONA 5LYTA 1EQEA 4GKKM 108LA 1CJ6A 1L70A 4IATA 3HHWA 5A3ZA 1VEDA 1IXZA 1G8PA 2I25L 5K7OA 3IG8A 3CDTA 4DUZM 1L98A 4I81A 3GQ3A 1QS9A 2ZANA 1JKAA 5LVJA 2Q0MX 3AGHA 4PRUA 1JTPL 1XEIA 4YM8A 1I94M 214LA 3KOYE 3WW5A 2Z2EA 3PXGA 162LA 2BJWA 4X64M 1QTHA 3IECA 1YKXX 4AQNA 4LZMA 2ZTDA 3HHZA 168LA 123LA 4EJ4A 4FVMA 3WPJA 3SC3A 2HEFA 240LA 4Y28F 1Q3BA 1L30A 2J7OA 4LF9M 1NBZC 1GL6A 3B7NA 2RBPA 4WM6A 1BB4A 4N8ZA 4GBRB 4LYCA 2K9DA 4GN3A 4BAFA 1IWWA 1LWGA 2R45A 1KSFX 3KP0E 1R2YA 2B6TA 1FLUA 170LA 2X8AA 165LA 4QHTA 4HJVA 3PVSA 3GLHB 1KXWA 2B74A 4PCZA 5EBHA 4GIPA 3AL0C 4Q7JA 1JITA 1L80A 3DKEX 2XZFA 3T6UA 5ITXA 3A6CY 2KA6B 3GLHE 1R6BX 1IN4A 2WARA 3DN8A 2MEEA 1L94A 3KP1E 2HUMA 4H92A 1L12A 1UIAA 3TWMA 1KXXA 1J5EM 1LHMA 4H9AA 155LA 4KXIA 7LZMA 2MROB 3LVVA 2QENA 1IP4A 1P3NA 3P65A 2BJVA 3NYAA 2JY6B 1DGBA 1LLHA 2B70A 2CP8A 2LVQD 2MJ5B 4FDYA 4LFBM 1PQJA 3T6PA 2XSZA 1L18A 4QOZC 3HDFA 4NHIA 1L03A 2UXCM 1TR8A 3SASA 5LIOA 2G3QA 3C8SA 4IASA 4JI0M 2Q2EB 3NBXX 1CU5A 4GMQA 2CHGA 4NL4H 2DHRA 3RT5X 3W6AA 5B06A 4G4HA 2XEPA 2JA2A 1L23A 2FH0A 3QYEA 3DMXA 1OAIA 4MGKE 2YNMD 2BQAA 5EQTA 1SXJE 4YXAC 2J7NA 2ZNXY 1WQRA 4KT0F 1XFPL 5APCA 1G7MC 1PJSA 1L22A 1IOCA 2BQOA 1D2WA 1DGHB 1IFYA 1LJ4A 4CIZA 1Z5CA 2F47A 1GHLA 3ZCBB 4ETDA 1VFBC 1JTNA 4TSBA 3A98B 233LA 1J1OY 3AGGG 1NHEA 2MR9A 3C8RA 4O34A 3PDSA 1L52A 3C9PA 4DV3M 1I6SA 2ZM6M 1LHLA 1B7MA 4LJ9A 1C64A 1C62A 5EP1A 1P64A 2F5PA 161LA 1VDSA 3HJ8A 1MU5A 3WW6A 5DL9A 1REYA 2R62A 4IBKA 4B3RM 1GDXA 1PM5A 3U6OA 1XGPC 3UGJA 3DNAA 1QYRA 2Q9DA 1D0KA 1B5WA 1C61A 4WM3A 1XSFA 1GBWA 1DYEA 1J7KA 1QQWA 2HHHM 2CWIA 4ITQA 4FWDA 2R4JA 1CV0A 1GB5A 3GLHA 4I7LA 3QNGA 2YBMA 1L81A 1P5CA 225LA 1GL7A 4NGLA 1GABA 1QSAA 122LA 1WQNA 1LYSA 2F5SA 1P2LA 3U6CA 2NTGA 1ZVYB 3WPLA 4B08A 4LGYA 4DUYM 2KNVA 1TTEA 3LHMA 3K1JA 1LJGA 1G0MA 3TXHA 195LA 5FSWA 3TMWA 2LCBA 142LA 3FE0A 4R7GA 2OU8A 2RSCA 5LVIA 3SHFA 4NHSA 3C82A 5KKIA 3J4GA 5B1GA 4DJHA 1QUSA 3I51A 2FBBA 2XBSA 1IXSB 2IGCA 2UXBM 4MM3B 1G3IA 1L42A 4H9IA 2K6BA 1IWZA 1G7JC 1PQIA 1L34A 3RGSA 1GD6A 1C67A 1NSFA 102LA 4LFPA 1LYOA 2D4JA 4J0LA 3D9AC 1L37A 1B7PA 4W55A 2EKSC 4GCCA 4RF0A 5KXTA 181LA 192LA 1DPXA 1L71A 4P16A 1IN5A 3SB5A 4ETCA 3K2LA 4R6CA 4AKIA 2CRUA 3RFWA 5KXLA 191LA 3HHYA 241LA 3ATNA 1XNRM 5LVHA 2LVAA 4EIWA 1KIRC 4PK0A 2O4WA 5L8RF 1QTZA 2V1UA 3V2YA 4ZEEA 4B0DA 3M6AA 1QSBA 3RUNA 134LA 4LF4M 1IOSA 1TBYA 4B7GA 4I7QA 3SFZA 4Z98A 3GLIE 1SX2A 4XJGA 4I7NA 1LI6A 2DI0A 4JV5M 144LA 4JYAM 1G0QA 260LA 4WM1A 5A2QS 3CSRA 1GF9A 1B0DA 1QSQA 2DAIA 1DKKA 5KXPA 4JI4M 3ILKA 1PQKA 2QSFX 3F92A 4L6V6 1I4WA 2B7XA 5APFA 1YILA 5LYMA 2CGIA 4IBDA 1PJIA 5LXWA 1GF8A 4WOAA 4PJ2C 3L64A 2HL7A 4G6ZA 1B5YA 1HSXA 129LA 5ILFA 3BBZA 4IBIA 5HLLA 114LA 4XYYA 1V33A 2RBRA 2GQFA 3WYHA 2C8OA 1SXJC 4HJZA 1UACY 1B2KA 3KW6A 1QANA 4NGWA 5F9UA 1GFHA 230LA 2VDBB 4DT3A 3WU7A 1N4FA 3HTGA 2LZTA 2F5QA 1QSWA 3FE3A 5IDDA 1HC0A 4H8YA 5F81A 3W6CA 3C80A 2RBSA 1REXA 1WHCA 1T6OA 1XMOM 1TH3A 2E5LM 4LJ7A 3LCVB 2Q9EA 1HNWM 1H6MA 3CF2A 2F2NA 2XFTA 1L19A 4NGYA 3C7WA 2VB1A 1JSFA 1SQ2L 3HFMY 4LJ4A 1WJ7A 3L27A 4IJFA 1C6EA 3TQSA 4JXJA 3FA0A 3W6BA 1SSYA 1LZTA 4LJAA 4GHAA 1LYZA 5T3FA 1ZV1A 245LA 1GF7A 1V92A 1QUHA 2YVBA 4DR5M 4ZPXA 159LA 219LA 2DQJY 3CDOA 1GB9A 1IP3A 1C6AA 2ZYPA 1IP7A 1LMCA 139LA 3QYBA 4RW2A 3B72A 1BVSA 2BLYA 2JXNA 7CATA 2HU3A 4ARPA 5I14A 5KJ9A 1NJGA 4L8RC 1L24A 3I4YA 1CTWA 4HPEA 3SN6R 4II8A 4I7PA 1EQ5A 3J80S 5C18A 4NSJA 1LYYA 2CE7A 2PC2A 1FJGM 1L20A 177LA 3A90A 3HT7A 2OTZX 1L31A 2OO9A 4G4BA 2FYCA 3U6PA 4OWCA 5KQ8A 4W51A 4GHLA 1DO0A 3KOWE 1LJFA 243LA 1R2ZA 1JB0F 3Q8GA 242LA 4G3OA 147LA 2EKFA 3HJSA 3VDPA 4NSOB 1JQUA 1B7RA 2QHOB 5DYGA 2ZIJA 4GITA 2A4TA 4N5RA 4JI7M 3HY5A 1R5LA 2EUCA 1IR9A 4HJYA 3AYQA 1C6MA 1NBYC 1LOZA 1TEWA 2MEHA 4MR1A 5IT9S 1QT7A 2G4QA 3GUKA 1UCOA 4MSTA 2B6WA 1SX7A 2EKKA 4WL7A 4LYTA 6LYTA 1IWUA 3KFUG 1SWZA 210LA 4DR6M 1LZDA 1QUOA 4NGVA 1GBZA 111LA 1CJ9A 2BQGA 4FWGA 1Z59A 221LA 4LT2A 1JJ0A 3SP3A 3NY9A 3FKEA 1JUGA 4FJRA 1TDYA 3TXFA 3DA1A 167LA 2F32A 3GLIB 1HQCA 1LGWA 3GQ4A 4QOSA 1IORA 1G7HC 4HSFA 2VF7A 1JWRA 5FSTA 2KEBA 1KS3A 4IBJA 5IWAM 1IEEA 3HT6A 4LDEA 4A7DA 1L89A 2HWJA 3J81S 3A95A 2B3TA 2JUJA 5C6JA 3HH3A 3WUMA 3LZ2A 222LA 2L78A 2N5ZA 4WM4A 194LA 1HERA 3CDVA 2CV0A 1BWHA 148LE 3UK6A 3AB6A 4I8OA 2YQZA 1LJEA 1L85A 2RGHA 4D81A 160LA 4A3VB 201LA 107LA 1WTMA 3KSXA 5FTNA 4IBEA 1UICA 4Z46A 1YSYA 3C7YA 1CV3A 1GB0A 5JI3E 4GN5C 3IWRA 2D6BA 4OX9M 1VDDA 4UWUA 3OE9A 2Z19A 4LY6A 1L47A 4JI2M 1SLYA 215LA 1L39A 212LA 1JR3D 180LA 3HT8A 4X65M 4G49A 3FD9A 232LA 2Z2FA 3E21A 1IQPA 1F10A 1GE3A 4CJ2A 1L55A 2B6XA 4WM5A 2XGNA 1AKIA 4DDBA 2V6ZM 4BBAA 3A93A 2DQEY 2WSCF 1RCMA 4NWHA 1YKZX 3U61A 2KRKA 1LHKA 1QUTA 2AUBA 5I4YA 2DQCY 4HPIA 1BQLY 6LYZA 5DFLA 4I7OA 3BOSA 4L15A 1LZEA 4NOOB 2L09A 1P36A 1XGQC 2MECA 1LKSA 3GLFA 4NXMM 2H5ZA 2OOAA 1NDGC 1L90A 3F8VA 3OE0A 255LA 3HU3A 1PQMA 4S12A 5C6IA 3AZ4A 4L78A 2C99A 3CGWA 4LGMA 1LTMA 5ITUA 3GRYA 1KY0A 1QS5A 2N35A 1LSFA 2HUBA 3TMXA 1CJ8A 251LA 2K47A 8CATA 5H37D 1JJ1A 1JPOA 3FRHA 4YEMA 3GRRA 262LA 2UXDM 1IO5A 4ANRA 1HMKA 2HEBA 2LHMA 1P37A 5KXRA 4C5FA 4EMNA 1LSNA 197LA 1P46A 2Z39A 4LT1A 1UFZA 3FUUA 1N77A 1CKDA 2DQAA 1C43A 4DR1M 3U5ZA 2C8PA 1UIBA 4LJ6A 1TCYA 3C8QA 1H6UA 4XJIA 252LA 3TXJA 3ODUA 4ML7A 3A8ZA 205LA 1HEWA 1LZ5A 4GCDA 5ITXE 1GFJA 3GPYA 1C6HA 2YBLA 1CU2A 2Z38A 1CJ7A 4CGYB 2Z37A 3U6MA 1YLAA 1KFVA 1WVUA 4XJDA 4I7RA 1L08A 4K5YA 1L96A 2W1YA 2OEAX 1L64A 1LMOA 4NY5A 4YX7C 5FTJA 4Z6YA 1ZV5L 4EOFA 4LG2A 1C65A 1LGUA 2HULA 2Z12A 2KNZA 1OUDA 1PRBA 4W58A 2ERCA 1IP2A 4HL4A 2CHVA 3HX3A 2D7EA 1GEZA 3KSJA 1CKHA 1CKCA 1LMAA 1LZ8A 4H94A 1L65A 4QHSA 2XH9A 1XGTC 3SMPA 1UIGA 3HBDA 3DN2A 1OUGA 1BB3A 1YANA 4DD1A 2LZMA 2Y8PA 3RZEA 1UIHA 1YAPA 3C58A 4HEOA 4LJ5A 4AG6A 3W6FA 7LYZA 1L50A 3EBAB 1N32M 1LMQA 4ARJA 5EXXA 2ZBKB 1W08A 4LRTA 2JWSA 1BVXA 3ZQJA 1GE0A 1IC4Y 2QARC 3K2RA 1T6HA 1QAOA 2DBTA 2BQKA 3EIEA 1OUFA 1DI4A 2QZ4A 1D3NA 3GPPA 2RB1X 4H8ZA 157LA 4ETAA 4B4IA 3J7BA 2F5OA 1GVNA 1C63A 1VEKA 2IHLA 1JQJC 1UIFA 4HLQA 1K3WA 4H90A 2MEAA 3AFHA 4NXNM 1WQMA 1K3XA 3SATA 1L32A 1WTHA 227LA 5FTKA 3F6ZA 1HSWA 4B3SM 4MGHA 1L53A 1ZYTA 2Z7JA 3DN4A 2Y0QA 1OFHA 1FN5A 3D3DA 3A67Y 1HEMA 1GF0A 5B05A 1OUIA 3R8FA 3IG5A 3HT9A 4E97A 5LA8A 1NF5A 1LJNA 4P2EA 3K8ZA 1TAYA 4DBGB 1QDTA 5C1BA 1OWZA 4NSIA 1L82A 5FHWA 4HV1A 4PD2A 1SXJA 1G0PA 1KIPC 3L28A 3GUPA 1LAAA 4H9EA 4DC4A 1L66A 3FYDA 1JSEA 185LA 1LYHA 1GF5A 1LMPA 1EE8A 1LWKA 4EKPA 3V76A 3SB8A 1MJGM 1XB2B 3A96A 143LA 1UIEA 4GEWA 3CDRA 1GPQC 1KYIA 2YSSC 5II3A 3A45A 1JJ3A 4DYGA 3GRVA 1L93A 3SAWA 2LZ2A 127LA 1L2BA 1JTMA 1NQIA 4GH9A 2KZSA 1PJJA 1XWIA 1LMTA 5LAGA 1DYAA 1L75A 1RE2A 3T1HM 1G1VA 4XJHA 1YL1X 4BB9A 1P3QQ 1C60A 2JY5A 4W56A 1C46A 5D5FA 3WMKA 2L4FA 1C7YA 1BB6A 1IX0A 1LZBA 2ZAMA 1RFPA 2DAEA 2MEIA 1XMQM 3VLFB 2OTYX 1WIVA 2XQOA 1OQYA 1F0WA 2HAKA 1DXJA 2BLXA 3A92A 3AZ5A 3M3UA 5E9RA 1JEFA 1XEPA 4NIJA 1VDTA 2XBRA 2GNOA 2RKOA 2W82A 248LA 1XXHE 2EQLA 2KHHA 3FTDA 1QZEA 3SBJA 5D5CA 5KY1A 3H4MA 1DZBX 4ETBA 1Z5BA 2Z8YM 1ZMWA 1IOQA 4YEOA 1J09A 1GB8A 5KXSA 3E3DA 4R0FA 3MHVC 3K3TA 3L29A 1OVHA 1LZRA 3P66A 4YXCA 1HF4A 5KO3A 1QT6A 1XGUC 5KXXA 3HBEX 2MEGA 3HGIA 1LZ4A 3AJNA 175LA 3PNYA 4B7HA 1AZFA 2OQ4A 4IBBA 258LA 4GC9A 5L9JA 2QQ8A 2RB2X 4XENA 1CU0A 4CHTB 1FBIX 2Y0TA 1VQ1A 1OYUA 2BQNA 1Q39A 4OW1A 2JZ0A 4DV1M 1TDHA 3AZ6A 1L69A 1IY2A 5DM9A 2R44A 3LQQA 1MN3A 4LF7M 3W3EA 4WLXA 1F6RA 213LA 1GB7A 2F2QA 3IJVA 4J1BA 1XXHA 2CUZA 2F4GA 2Z6BA 3TXBA 1L73A 209LA 1GLNA 236LA 4DD2A 5FELA 3E9SA 4OW0A 4OU7A 1ZMUA 3LVWA 2W1XA 3B74A 1REZA 2CUUA 2OPFA 3LYOA 1L62A 4GCFA 1L59A 4MGYE 3A94A 1L36A 1T8FA 1L1TA 1C6DA 1IN6A 4JI6M 1C7PA 3E46A 1L79A 1KIQC 2HU1A 4NHTA 1GBOA 3T36A 4DR7M 4XBOA 1L8QA 3QE8A 1JTOL 1IWVA 3RZ4A 1JR3E 1LW9A 4OWAA 4TSCA 3GO8A 3N9CA 1C6LA 4GLVA 2EO2A 224LA 3VW7A 4ZIXA 3A34A 1LZ9A 1IM2A 2P5TA 3CF6E 3TXIA 3SYLA 2RH1A 5KPZA 2K0BX 4FCVA 164LA 138LA 4OWHA 1V34A 1ZVHL 1L86A 1PZYA 3D8LA 2G4NA 3P4ZA 2D91A 2CWBA 3HU9A 4LFXA 1B9OA 2UUAM 2O7AA 4H9HA 1OFIA 1GFAA 1GXV2 1BB7A 4PDGA 2Y21A 2CJLA 1KXYA 2LBCA 4LCBA 4J7VA 4ARMA 4H9BA 2DXIA 1JR3A 5DN4A 4CGEA 2L6OA 4G4QA 1RI8B 2L7IA 4ZPUA 1XNQM 3CSZA 1P6YA 4I4LA 1LSBA 4IAPA 193LA 5HNLA 3QAKA 1L02A 1L97A 1NJFA 1T3PA 1CV4A 3L2XA 3HHXA 1OV7A 5EXTA 4DV4M 2CEAA 1G07A 3TPZA 1OVKA 1EQ4A 5EXPA 3W68A 1VDPA 1IXRC 3U61B 1L45A 1BVKC 1PQOA 1H87A 208LA 4WURA 4LYMA 1L68A 1LSAA 1QTVA 2R18A 4OWBA 3RU5A 3EXDA 4NGZA 3OJPA 5LAFA 1LYJA 2RBNA 5I5QA 2Z18A 5F14A 1CU6A 4GKJM 1IP1A 1C1KA 1IY3A 3J7AS 4B1AA 1D0LA 1A5TA 199LA 1L61A 257LA 4C3WA 1VG5A 4DR3M 1GJTA 4GCBA 1NVMA 173LA 1WVVA 2DZNB 1LYIA 1L04A 4OOOA 2XJWA 1C6KA 4KLNA 2MH8A 4LF5M 1DGHA 1INUA 1QUDA 1L57A 4WW0A 2DWMA 4LYBA 4JI1M 3KS8A 3JR4A 3C81A 1DQJC 4GRIA 1NV9A 2KZUA 1L48A 3UJNA 1C6CA 2XFSA 228LA 4D80A 2A7DA 4I5SA 1LJKA 3BXWA 2JZ1A 3GLFB 2B5ZA 1YQVY 5KXYA 2YFQA 3M7GA 4FCTA 2BWBA 2Z4SA 2WSEF 2DQDY 2LNHC 2BNKA 4R71A 1IC5Y 2D7HA 3KDSE 1L11A 2YBJA 2ZYCA 2C96A 4WLYA 125LA 183LA 1SG9A 1Y8GA 1NY5A 3HZJA 4IBCA 103LA 1GBYA 1LJ3A 1ZQ9A 4DWXA 2DWZB 2D7GA 4X66M 3D4SA 3CT5A 4RW1A 3HU8A 5A3EA 2BQMA 1C45A 1CUKA 2LHGA 4NRVA 1I56A 2W1MA 4GCEA 5IREB 2VIIA 5HQ1A 2YBHA 1HMLA 3FYCA 3QY4A 4W53A 1FNNA 3VFDA 4QNMA 3RNXA 4LT3A 5I54A 3TMUA 2X4AA 1IY1A 2OE9X 3HDEA 4M0WA 1N33M 1OUEA 189LA 4NGJA 2B6YA 1ZWNA 1CUPA 5M1YA 118LA 3THGA 1AM7A 5IZ7D 1QAQA 2VQFM 3UZUA 2DNAA 174LA 1NMMA 4NSRA 196LA 4H91A 2F4AA 4N0JA 1YUBA 3RGPA 4B3TM 4EPIA 184LA 1KW7A 4WMGA 2KDLA 4YENA 3A91A 1FKQA 1T8GA 145LA 3F9LA 1J1XY 4MGZE 1L92A 2LVNC 2LVOC 1R7RA 1OKSA 3EMLA 2C98A 3WHLA 4TUWA 163LA 2IFFY 3FRIA 4M4OA 2I26L 1UA6Y 2F4VM 2FBDA 1XHBA 1B7SA 3SB7A 4H9CA 1D6QA 1LYEA 1L2CA 4EKSA 2YBIA 3LYZA 1HT1E 2M5ZA 1Q3CA 1G71A 4TTDA 1TF0B 1CV6A 2HEAA 1OUJA 1YROA 2B73A 1WTNA 4K0KM 3U6SA 1YE9A 3WU8A 4X3BA 5B1FA 2ANXA 1XGRC 1KW5A 3CSQA 2DAGA 3CQLA 6LZMA 1FKVA 2APLA 4NG8A 4ET9A 5J7CA 5ITRA 1L01A 153LA 2KNAA 2W1LA 1IP6A 1L88A 2LH0A 4LFCM 1L91A 4NEBA 5FEKA 4UN2B 3HBHA 3W6DA 4RLMA 2UUCM 3FUTA 4KODA 1VAUA 187LA 1OAOC 1OV5A 3HWSA 1NHBA 4BS7A 2MEDA 3B0IA 1DKJA 2I7PA 3CB7A 1L1ZA 1JTTL 3WH1A 2QPAA 2H5XA 3G3AB 4RDSA 1MELL 1LZCA 3RW8A 1EFUB 2NQ8C 2QB0B 4NGKA 4CFOA 4H1PA 1OIZA 4ARQA 1BWJA 1QT8A 4FCWA 3G3XA 4BAPA 2JNHA 4AG5A 1L29A 1P56A 5BPVA 4DV2M 3V2WA 4YHHM 5ITQA 3HTBA 2J5YA 2FFJA 3K9PA 150LA 3AJIB 2H1RA 1DPWA 156LA 1GKIA 171LA 2B75A 1D3JA 3U6EA 2O79A 110LA 2EPEA 3P68A 3C3DA 3DZDA 1L84A 1IR8A 1G0LA 1AIPC 1HEQA 1GXXA 4EKQA 1LJIA 3GRUA 5DNYA 4QNRA 3E4RA 3TWKA 1L21A 4DQJA 1D9WA 2MEFA 1OWYA 3J6KA 3I4VA 149LA 1C6TA 1L2DA 4M6DA 2G4PA 1P7SA 2F5NA 4ARLA 3WHKA 1DYGA 1DYDA 4OVZA 250LA 5F16A 2OOBA 1IWYA 5FTMA 1A4VA 1JKDA 3R9XB 1HNLA 4AW4A 3UMMA 4RF1A 1GBXA 4G4NA 2HEDA 1L09A 3GXKA 3JAMS 137LA 2DQGY 1B5UA 1DYCA 256LA 4PHIA 2HKJA 3TE6A 2DAKA 254LA 1L35A 2JY8A 1L00A 3SARA 4MH0E 1L46A 1CX6A 3CDQA 1WGLA 3AV0A 1OIPA 1L26A 1DO2A 1D2YA 4KPMA 4PRQA 5EP3A 1N75A 4KL7A 1L25A 2DWLA 3DN0A 200LA 1LYFA 1FLQA 4I8SA 4I0CA 3T38A 5FCPA 1DGGA 3PBLA 4NGIA 4XGIA 3WPKA 3GUOA 1GF6A 1D2NA 2HCBA 1XXHB 2ZTCA 1L33A 1WQPA 1IWTA 4PT5A 1NDMC 2LYMA 4DQ7A 3A42A 1N78A 235LA 1QQYA 4M9XA 1JIYA 1L28A 3ULRA 4RKUF 1IN8A 5KKJA 4WO6A 4PDIA 1GE4A 3LZTA 5KXOA 1L17A 3GP1A 2QBYA 4KHPM 4YF2A 4F2LA 1G41A 3B7ZA 1OVJA 1Z55A 1ZMYL 4DR2M 3U6DA 3A6BY 2VF8A 2V1CA 1SXJD 5C6LA 4UWVA 4I7KA 3B6LA 1QVRA 3C7ZA 1UM8A 1V7TA 3LYMA 1N36M 2R0IA 4TUNA 1DI5A 1UC0A 1TGUA 3VK7A 4U3XB 2ZQ4A 1IY4A 1G4AE 4Z8XA 1IBLM 3WUAA 3RE8A 4DDCA 4Z41A 2HECA 3LZMA 132LA 3DMZA 2BQHA 4AI6A 1C6FA 1GE2A 4RLNA 3MMPA 4XJBA 3GLIA 3HH5A 1I20A 1L38A 4IBFA 3AW7A 2BQJA 3VKGA 2DZLA 2R46A 1LI2A 3T15A 2BWEA 3HU1A 1GDWA 4LZTA 1NHGC 1FLWA 1NV8A 4DR4M 5KQDA 3G3VA 2O01F 2Z3XA 3KXEC 146LA 4IIWA 1L13A 5KXMA 1AUAA 2CV1A 4HTKA 4N1CC 5FTLA 3J27B 4J1AA 1BHZA 4DD7A 4REZA 2LC9A 1D3FA 3FUWA 3B9PA 2L2DA 4ZFPA 4W5WA 1G0KA 1GF4A 2D4IA 3KAMA 2BPUA 1L74A 1L15A 4AKGA 231LA 4P17A 2C9OA 3P64A 3CT1A 3GXRA 1HR0M 1LSYA 1T3TA 4B7FA 1D0MA 3AGIA 4I7SA 1L10A 226LA 1QT3A 1DGFA 1LSEA 3DN1A 1LJJA 4PJZA 3C3EA 1TH2A 3KOXE 5LINA 5HMVA 4X62M 169LA 4IJEA 1AT6A 3IJUA 1LPYA 1OUBA 2BQDA 1L06A 1B7OA 4DV7M 2B72A 3B7QA 3I04M 1NNUC 1JISA 2RBOA 1T6VL 178LA 1IIZA 5B07A 4AXTA 128LA 3OTOM 238LA 5KXZA 5DLAA 1GAYA 3BKVA 1GFRA 2UU9M 1T43A 1C10A 4MCKA 2M60A 1R4GA 1WQOA 3FUVA 3SMSA 1C69A 4PGJB 3L26A 1T8AA 1GB2A 2CHQA 4M0DA 4XN6A 3ZVQA 3SB9A 229LA 3VKHA 261LA 1L99A 1DYBA 1LYDA 1LV7A 4LF6M 1BGIA 3SHGB 2OE7X 1REMA 166LA 1LGXA 2A5YB 4IBGA 2OU9A 1L60A 4LFAM 104LA 1KNIA 1C6GA 1C6QA 1XJUA 2KW0A 1C08C 1NWGA 1IN7A 1CV1A 1IWXA 2R6FA 5I4XA 5LVGA 3L2AA 1LZNA 1OQMA 4I7JA 1LPIA 3SBBC 2CFOA 1C68A 3SBAA 2RB0X 3CT0A 1HNXM 2A7FA 1ZMVA 1YIKA 182LA 2ZIKA 1OJLA 4EPFA 4D82A 3HU2A 2C5RA 4NWEA 1CVKA 1IVMA 2LXEA 1L40A 3WUNA 1CUQA 2FYDA 4I7TA 4FD2A 2ZAOA 1C6NA 5EP4A 4OVZB 206LA 5L3IA 1IY0A 3AOEC 115LA 2XTHA 2I6ZA 4RNAA 1QTCA 3NY8A 1VEJA 1PJQA 1G0JA 1VDLA 4W52A 5EXSA 3GPXA 2DQIY 4GN4A 1E9RA 4QEQA 1L87A 3HH4A 2DWNA 5AMYA 4WP2A 2EA0A 4OWEA 5JENB 1OP9B 1QDRA 3TXEA 2R65A 3SB6A 2QCUA 1IP5A 1CNSA 1L58A 1ZURA 3EO5A 1MX0A 2LWXA 4DV6M 5L3HA 1Z6TA 211LA 133LA 1YAOA 1L76A 5HMJA 2H9KA 5E6JA 152LA 2C9CA 2WZJA 3AKZA 1D3MA 4M9ZA 1T97A 3WXTA 1LSZA 4EKRA 2JY7A 5EJCA 1K82A 172LA 3WU9A 3IHPA 5FLXS 1J1PY 1W6ZA 3QAUA 1L67A 2ANVA 2HTXA 1DV0A 2H9JA 2HUKA 112LA 1LHHA 1OTRA 4DD9A 2FNAA 141LA 3ZH9B 3U6QA 1NNJA 3D8BA 207LA 3NBIA 2OU0X 1L72A 239LA 5LZMA 1XEJA 1HFYA 3TMVA 1G59A 4XK8F 3WL2A 1LCNA 4LJ8A 1JKCA 2YBNA 1LI3A 4CISA 1B7LA 3WXUA 188LA 4H8XA 1L07A 2FOIC 2LHCA 1CX7A 2YDGA 1F6SA 3A46A 2DKLA 1AT5A 2UUBM 1IOTA 1YAQA 5KXKA 3B0KA 1WQQA 4NSGA 4ET8A 2EJSA 1K28A 1GFGA 1SXJB 3TWLA 2GV0A 2LYZA 1RJCB 3HTFA 3W6EA 4W96A 1OUCA 3G3BB 4GLAA 1XC8A 4XJFA 1L49A 5F9XA 1LSMA 1LSPA 4B3MM 2AHMA 3GUNA 1WR1B 4LF8M 2BQIA 3TL4X 4KT3A 2RGOA 4LGKA 5I4WA 1A2YC 1OUAA 2BAAA 3PFIA 1QTDA 1VEGA 4NRWA 109LA 1QTEA 2MEBA 3OE8A 4WLTA 1YKYX 4NG1A 2FE8A 5FDJA 2QBYB 1L83A 3FI5A 3CF0A 4AQYM 3J2PB 4GC5A 4NFVA 1HFXA 4WG7A 1EIJA 4YY3M 3JR6A 5BR8M 2G8LA 4NC6A 3T1YM 4UWNA 3CTWB 5APEA 2LTUA 2I7NA 4ARQB 131LA 4LZZA 2VQEM 3U5ZB 1CV5A 5DYIA 4DAJA 3MGWA 2DQFC 1KY1A 4LYZA 3W0LB 1PQDA 1L44A 3FTEA 140LA 2RRUA 1N34M 158LA 4NHPA 3DN3A 1B7NA 3ATOA 186LA 3N9AA 1B7QA 2MGWA 1XJTA 4DDAA 4Z3MA 217LA 1L51A 1IBMM 1HFZA 4WL6A 1GFUA 2DAMA 3DMVA 1EL1A 4FW9A 3LN2A 2QP9X 3FTFA 1LHJA 4OOTA 3M0EA 2RAYX 5LMNM 4MGIE 216LA 4WLDA 4JI8M 3HH6A 4LYOA 1QT5A 1GBSA 2ZWBA 1ZAEA 3GUJA 246LA 3GLFE 2XZUA 3LW5F 154LA 1D6PA 1QAMA 1O23A 5IHGA 4H9FA 5I53A 1X37A 2LYOA 5HNCA 176LA 4L4UA 1G06A 1QTBA 2Y20A 3HJQA 2X0AA 2CDSA 1LSCA 4DD0A 1LKRA 2FS1A 3MJ5A 1G7IC 1SSWA 4CFPA 4NHQA 1P2RA 1G1WA 1FDLY 1V7SA 1GWDA 3ZVQB 4LZJA 3AOGA 2DKVA 4BLCA 1GEVA 259LA 1GB6A 3FADA 4N9RA 3GLGA 4GRVA 3N9EA 1E8LA 1HELA 2Z4RA 4HV2A 3TXGA 1BWIA 5KPRA 2EIZC 4DKLA 2YR0A 4NSHA 1HENA 1NHWC 4LRSA 1L0JA 3ZC7B 2G5GX 3C83A 3QWLA 2X49A 1F4IA 2BQEA 1GFVA 1LSGA 5KXWA 2L4EA 1DYFA 1L54A 3HUQA 1BB5A 4DV0M 3W0FA 4D9ZA 2DENA 1NO1A 1PGYA 2BQLA 1G0GA 1HJPA 4JI3M 4N1EI 1E94E 1RU3A 3G3WA 1D9UA 1GFEA 4I7MA 2RAZX 1S3SA 4W59A 4FWHA 234LA 3HTDA 2F30A 1ALCA 1QUGA 4LDLA 1L95A 247LA 1WXQA 1GF3A 1I1ZA 1B5ZA 1LZ6A 3M18B 5IELA 1GJSA 1W5TA 3ZEKA 5LA5A 1SWYA 1EPYA 5JI2E 1YL0X 2KXEA 1LMNA 4BADA 1OUHA 3HWLA 1HHLA 1B5VA 4AZFA 4WO9A 1QTKA
chains in the Genus database with same CATH topology
9LYZA 4B49A 1YAMA 5LVKA 1L77A 5LYZA 4LT0A 1UIDA 4WM2A 1GE1A 151LA 1LYGA 5KXNA 1LZ1A 218LA 3TXKA 1JKBA 4HP0A 3TXDA 1JHLA 4AGAA 3EMSA 1B6IA 4OO9A 1NKHA 1TLAA 4QGZA 4DQ5A 198LA 4B4EA 2BQFA 2RBQA 1LSDA 4HTNA 1C6JA 3AW6A 1UUZC 1B5XA 2OE4X 1LZAA 1L16A 3VWOA 3WULA 4HTQA 4IJ4A 3WVYA 4CHXA 1LZYA 1GFKA 1GAZA 223LA 1L05A 5B59A 1GB3A 3OK0A 1QT4A 2ZQ3A 1C6IA 4LDOA 1QIOA 4XADA 1MLCE 4W57A 3WVXA 8LYZA 3GULA 3A3RX 3OE6A 113LA 3HUKA 4G9SA 1L14A 1C66A 5APDA 126LA 1L63A 4ARMB 1DI3A 2B6ZA 2D4KA 2NTHA 4PPOA 1C6PA 135LA 3FI7A 1XEKA 3AZ7A 3B0OA 1L27A 4YOPA 4TX7A 1L43A 4QY9A 4W94A 1LZSA 5E4PA 1GFTA 237LA 1LZGA 1L0KA 4G4CA 4W54A 253LA 4E3UA 220LA 3DN6A 2ZNWY 1CU3A 1L41A 1LHIA 1VDQA 1HEOA 2ZILA 3GUMA 4WG1A 249LA 1P2CC 2BQCA 3BKHA 2NWDX 5DN5A 2DQHY 1C6BA 4L41A 1PS5A 1G7LC 4EXMA 3A3QA 4H93A 130LA 4DD3A 190LA 1LJHA 1VATA 4S0WA 120LA 4TWSA 2HEEA 3LYTA 1IC7Y 119LA 3HUAA 1IR7A 1L56A 3GUIA 1CKFA 4B4JA 2BQBA 1FLYA 4QDNA 4NGOA 1CKGA 244LA 4ETEA 1HEPA 5ILCA 1UBZA 3UONA 5LYTA 1EQEA 108LA 1L70A 1CJ6A 4IATA 5A3ZA 1VEDA 2I25L 5K7OA 3CDTA 1L98A 1QS9A 1JKAA 5LVJA 2Q0MX 3AGHA 4PRUA 1JTPL 1XEIA 4YM8A 214LA 3WW5A 2Z2EA 162LA 1QTHA 1YKXX 4AQNA 4LZMA 168LA 123LA 4EJ4A 3WPJA 2HEFA 240LA 1L30A 1NBZC 2RBPA 4WM6A 1BB4A 4N8ZA 4GBRB 4LYCA 4GN3A 4BAFA 1IWWA 1LWGA 2B6TA 1FLUA 170LA 165LA 4HJVA 1KXWA 2B74A 5EBHA 1JITA 1L80A 3DKEX 3T6UA 3A6CY 2WARA 3DN8A 2MEEA 1L94A 2HUMA 4H92A 1L12A 1UIAA 1KXXA 1LHMA 4H9AA 155LA 4KXIA 7LZMA 1IP4A 1P3NA 3P65A 3NYAA 1LLHA 2B70A 4FDYA 1PQJA 1L18A 3HDFA 4NHIA 1L03A 5LIOA 3C8SA 4IASA 1CU5A 3RT5X 3W6AA 5B06A 4G4HA 1L23A 3DMXA 2BQAA 4YXAC 2ZNXY 1WQRA 1XFPL 5APCA 1G7MC 1L22A 1IOCA 2BQOA 1D2WA 1LJ4A 2F47A 1GHLA 4ETDA 1VFBC 1JTNA 4TSBA 233LA 1J1OY 3AGGG 1NHEA 3C8RA 4O34A 3PDSA 1L52A 1I6SA 1LHLA 1B7MA 1C64A 1C62A 1P64A 161LA 1VDSA 3WW6A 5DL9A 1REYA 1GDXA 1XGPC 3DNAA 2Q9DA 1D0KA 1C61A 1B5WA 4WM3A 1XSFA 1GBWA 1DYEA 2CWIA 1CV0A 1GB5A 4I7LA 3QNGA 2YBMA 1L81A 1P5CA 225LA 4NGLA 1QSAA 122LA 1WQNA 1LYSA 1P2LA 2NTGA 1ZVYB 3WPLA 3LHMA 1LJGA 1G0MA 3TXHA 195LA 3TMWA 2LCBA 142LA 3FE0A 2RSCA 2OU8A 5LVIA 4NHSA 3C82A 5KKIA 3J4GA 5B1GA 4DJHA 1QUSA 2FBBA 2XBSA 2IGCA 1L42A 4H9IA 1IWZA 1G7JC 1PQIA 1L34A 1GD6A 1C67A 102LA 4LFPA 1LYOA 2D4JA 4J0LA 3D9AC 1L37A 1B7PA 4W55A 2EKSC 4GCCA 5KXTA 181LA 192LA 1DPXA 1L71A 3SB5A 4ETCA 4R6CA 5KXLA 191LA 241LA 3ATNA 5LVHA 1KIRC 4PK0A 2O4WA 1QTZA 3V2YA 4ZEEA 4B0DA 1QSBA 3RUNA 134LA 1IOSA 1TBYA 4I7QA 4Z98A 1SX2A 4XJGA 4I7NA 1LI6A 144LA 1G0QA 4WM1A 260LA 3CSRA 1GF9A 1B0DA 1QSQA 1DKKA 5KXPA 1PQKA 2B7XA 5LYMA 5APFA 1YILA 2CGIA 5LXWA 1GF8A 4WOAA 4PJ2C 3L64A 1HSXA 1B5YA 129LA 5ILFA 5HLLA 114LA 4XYYA 2RBRA 3WYHA 2C8OA 4HJZA 1UACY 1B2KA 4NGWA 5F9UA 1GFHA 230LA 4DT3A 3WU7A 1N4FA 3HTGA 2LZTA 1QSWA 5IDDA 1HC0A 4H8YA 5F81A 3W6CA 3C80A 2RBSA 1REXA 2Q9EA 1H6MA 2F2NA 1L19A 4NGYA 3C7WA 2VB1A 1JSFA 1SQ2L 3HFMY 1C6EA 3FA0A 3W6BA 1SSYA 1LZTA 1LYZA 5T3FA 245LA 1GF7A 1QUHA 2YVBA 159LA 219LA 2DQJY 3CDOA 1GB9A 1IP3A 1C6AA 2ZYPA 1IP7A 1LMCA 139LA 4RW2A 3B72A 2BLYA 2HU3A 4ARPA 5I14A 5KJ9A 1L24A 1CTWA 4HPEA 3SN6R 4II8A 4I7PA 1EQ5A 4NSJA 1LYYA 2PC2A 1L20A 177LA 3A90A 3HT7A 2OTZX 1L31A 4G4BA 2FYCA 4OWCA 4W51A 1LJFA 243LA 242LA 147LA 1JQUA 1B7RA 2ZIJA 2A4TA 4N5RA 1IR9A 4HJYA 3AYQA 1C6MA 1NBYC 1LOZA 1TEWA 2MEHA 4MR1A 1QT7A 2G4QA 3GUKA 1UCOA 4MSTA 2B6WA 1SX7A 4WL7A 4LYTA 6LYTA 1IWUA 1SWZA 210LA 1LZDA 1QUOA 4NGVA 1GBZA 111LA 1CJ9A 2BQGA 221LA 4LT2A 1JJ0A 3SP3A 3NY9A 1JUGA 4FJRA 1TDYA 3TXFA 167LA 2F32A 1LGWA 1IORA 1G7HC 4HSFA 1JWRA 5FSTA 1KS3A 1IEEA 3HT6A 4LDEA 4A7DA 1L89A 3A95A 5C6JA 3HH3A 3WUMA 3LZ2A 222LA 2L78A 2N5ZA 4WM4A 194LA 1HERA 3CDVA 1BWHA 148LE 3AB6A 1LJEA 1L85A 160LA 201LA 107LA 1WTMA 1UICA 4Z46A 3C7YA 1CV3A 1GB0A 4GN5C 3IWRA 2D6BA 4UWUA 3OE9A 2Z19A 1L47A 1SLYA 215LA 1L39A 212LA 180LA 3HT8A 4G49A 232LA 2Z2FA 1GE3A 1F10A 4CJ2A 1L55A 2B6XA 4WM5A 1AKIA 4DDBA 3A93A 2DQEY 1RCMA 4NWHA 1YKZX 1LHKA 1QUTA 2AUBA 5I4YA 2DQCY 4HPIA 1BQLY 6LYZA 4I7OA 1LZEA 1XGQC 1P36A 2MECA 1LKSA 2H5ZA 1NDGC 1L90A 3F8VA 3OE0A 255LA 1PQMA 5C6IA 3AZ4A 1LTMA 1KY0A 1QS5A 1LSFA 2HUBA 3TMXA 1CJ8A 251LA 1JJ1A 1JPOA 4YEMA 262LA 1IO5A 4ANRA 1HMKA 2HEBA 2LHMA 1P37A 5KXRA 4C5FA 4EMNA 1LSNA 197LA 1P46A 2Z39A 4LT1A 1CKDA 2DQAA 1C43A 2C8PA 1UIBA 1TCYA 3C8QA 4XJIA 252LA 3TXJA 3ODUA 4ML7A 3A8ZA 205LA 1HEWA 1LZ5A 4GCDA 1GFJA 1C6HA 2YBLA 1CU2A 2Z38A 1CJ7A 2Z37A 1WVUA 4XJDA 4I7RA 1L08A 4K5YA 1L96A 2W1YA 2OEAX 1L64A 1LMOA 4NY5A 4YX7C 1ZV5L 4EOFA 1C65A 1LGUA 2HULA 2Z12A 1OUDA 4W58A 1IP2A 1GEZA 1CKHA 1CKCA 1LMAA 1LZ8A 4H94A 1L65A 1XGTC 1UIGA 3HBDA 3DN2A 1OUGA 1BB3A 1YANA 4DD1A 2LZMA 2Y8PA 3RZEA 1UIHA 1YAPA 3W6FA 7LYZA 1L50A 3EBAB 1LMQA 4ARJA 1W08A 1BVXA 1GE0A 2QARC 1IC4Y 3K2RA 1T6HA 2DBTA 2BQKA 1OUFA 1DI4A 1D3NA 2RB1X 4H8ZA 157LA 4ETAA 4B4IA 1C63A 2IHLA 1UIFA 4H90A 2MEAA 1WQMA 1L32A 1WTHA 227LA 3F6ZA 1HSWA 1L53A 1ZYTA 3DN4A 1FN5A 3D3DA 3A67Y 1HEMA 1GF0A 5B05A 1OUIA 3HT9A 4E97A 5LA8A 1NF5A 1LJNA 4P2EA 1TAYA 1QDTA 1OWZA 4NSIA 1L82A 5FHWA 4HV1A 1G0PA 1KIPC 3GUPA 1LAAA 4H9EA 4DC4A 1L66A 1JSEA 185LA 1LYHA 1GF5A 1LMPA 1LWKA 4EKPA 3SB8A 3A96A 143LA 1UIEA 3CDRA 1GPQC 2YSSC 5II3A 1JJ3A 4DYGA 1L93A 2LZ2A 127LA 1NQIA 1JTMA 1LMTA 5LAGA 1DYAA 1L75A 1RE2A 1G1VA 4XJHA 1YL1X 1C60A 4W56A 1C46A 5D5FA 3WMKA 1BB6A 1IX0A 1LZBA 1RFPA 2MEIA 2OTYX 2XQOA 1F0WA 1DXJA 2BLXA 3M3UA 3AZ5A 3A92A 5E9RA 1JEFA 1XEPA 4NIJA 1VDTA 2XBRA 248LA 2EQLA 5D5CA 5KY1A 1DZBX 4ETBA 1IOQA 4YEOA 1GB8A 5KXSA 3E3DA 4R0FA 3K3TA 1OVHA 1LZRA 3P66A 4YXCA 1HF4A 1QT6A 1XGUC 5KXXA 3HBEX 2MEGA 1LZ4A 3AJNA 175LA 1AZFA 258LA 5L9JA 2RB2X 4XENA 1CU0A 1FBIX 1OYUA 2BQNA 4OW1A 3AZ6A 1L69A 5DM9A 3W3EA 4WLXA 1F6RA 213LA 1GB7A 2F2QA 3IJVA 4J1BA 2F4GA 2Z6BA 3TXBA 1L73A 209LA 236LA 4DD2A 5FELA 2W1XA 1REZA 2CUUA 3LYOA 1L62A 4GCFA 1L59A 3A94A 1L36A 1T8FA 1C6DA 1C7PA 1L79A 1KIQC 2HU1A 4NHTA 1GBOA 3T36A 3QE8A 1JTOL 1IWVA 3RZ4A 1LW9A 4OWAA 4TSCA 3N9CA 1C6LA 4GLVA 224LA 3VW7A 4ZIXA 3A34A 1LZ9A 3TXIA 2RH1A 164LA 138LA 4OWHA 1ZVHL 1L86A 1PZYA 2G4NA 3P4ZA 2D91A 3HU9A 4LFXA 1B9OA 2O7AA 4H9HA 1GFAA 1GXV2 1BB7A 2CJLA 1KXYA 4J7VA 4ARMA 4H9BA 5DN4A 4CGEA 1RI8B 4ZPUA 3CSZA 1P6YA 1LSBA 4IAPA 193LA 5HNLA 3QAKA 1L02A 1L97A 1T3PA 1CV4A 3L2XA 1OV7A 1G07A 1OVKA 1EQ4A 1VDPA 1L45A 1BVKC 1PQOA 1H87A 208LA 4LYMA 1L68A 1LSAA 1QTVA 4OWBA 3RU5A 3EXDA 4NGZA 3OJPA 5LAFA 1LYJA 2RBNA 5I5QA 2Z18A 5F14A 1CU6A 1IP1A 1IY3A 4B1AA 1D0LA 199LA 257LA 1L61A 4C3WA 4GCBA 173LA 1WVVA 1LYIA 4OOOA 1L04A 2XJWA 1C6KA 1INUA 1QUDA 1L57A 4LYBA 3C81A 1DQJC 1L48A 228LA 1C6CA 2A7DA 1LJKA 2B5ZA 1YQVY 5KXYA 2DQDY 1IC5Y 1L11A 2YBJA 2ZYCA 4WLYA 125LA 183LA 103LA 1GBYA 1LJ3A 4DWXA 3D4SA 3CT5A 4RW1A 3HU8A 5A3EA 2BQMA 1C45A 1I56A 2W1MA 4GCEA 5HQ1A 2YBHA 4W53A 1HMLA 3QY4A 3RNXA 4LT3A 5I54A 3TMUA 2OE9X 3HDEA 1OUEA 189LA 4NGJA 2B6YA 1ZWNA 1CUPA 5M1YA 118LA 1AM7A 174LA 1NMMA 196LA 4H91A 2F4AA 4N0JA 4EPIA 184LA 1KW7A 4WMGA 4YENA 3A91A 1FKQA 1T8GA 145LA 3F9LA 1J1XY 1L92A 3EMLA 163LA 2IFFY 4M4OA 2I26L 1UA6Y 2FBDA 1B7SA 3SB7A 4H9CA 1D6QA 1LYEA 4EKSA 2YBIA 3LYZA 4TTDA 1CV6A 2HEAA 1OUJA 1YROA 2B73A 1WTNA 3WU8A 4X3BA 5B1FA 2ANXA 1XGRC 1KW5A 3CSQA 3CQLA 6LZMA 1FKVA 4NG8A 4ET9A 5J7CA 1L01A 153LA 2W1LA 1IP6A 1L88A 1L91A 4NEBA 5FEKA 3HBHA 3W6DA 4RLMA 1VAUA 187LA 1OV5A 1NHBA 4BS7A 2MEDA 3B0IA 1DKJA 3CB7A 3WH1A 1JTTL 3G3AB 4RDSA 1MELL 1LZCA 3RW8A 2QB0B 4NGKA 4CFOA 4H1PA 4ARQA 1BWJA 1QT8A 4BAPA 3G3XA 1L29A 1P56A 3V2WA 3HTBA 150LA 1DPWA 156LA 171LA 2B75A 1D3JA 2O79A 110LA 2EPEA 3P68A 1L84A 1IR8A 1G0LA 1HEQA 1GXXA 4EKQA 1LJIA 1L21A 4DQJA 1D9WA 2MEFA 1OWYA 3J6KA 149LA 1C6TA 4M6DA 2G4PA 1P7SA 4ARLA 1DYGA 1DYDA 250LA 5F16A 1IWYA 1A4VA 1JKDA 1HNLA 1GBXA 2HEDA 1L09A 3GXKA 137LA 2DQGY 1B5UA 1DYCA 256LA 4PHIA 254LA 1L35A 1L00A 1L46A 1CX6A 3CDQA 1L26A 1D2YA 4PRQA 4KPMA 4KL7A 1L25A 3DN0A 200LA 1LYFA 1FLQA 4I8SA 4I0CA 5FCPA 3PBLA 4NGIA 3WPKA 3GUOA 1GF6A 1L33A 1WQPA 1IWTA 2LYMA 1NDMC 4DQ7A 235LA 1QQYA 1L28A 1JIYA 3ULRA 5KKJA 4WO6A 1GE4A 3LZTA 5KXOA 1L17A 4YF2A 1OVJA 1Z55A 1ZMYL 3A6BY 5C6LA 4UWVA 4I7KA 3B6LA 3C7ZA 1V7TA 3LYMA 4TUNA 1DI5A 1UC0A 4U3XB 2ZQ4A 1IY4A 3WUAA 4DDCA 4Z41A 2HECA 3LZMA 132LA 3DMZA 2BQHA 1C6FA 1GE2A 4RLNA 4XJBA 3HH5A 1I20A 1L38A 3AW7A 2BQJA 1LI2A 1GDWA 4LZTA 1FLWA 3G3VA 146LA 1L13A 5KXMA 4N1CC 4HTKA 4J1AA 1BHZA 4DD7A 2LC9A 1D3FA 4ZFPA 1GF4A 1G0KA 2D4IA 3KAMA 2BPUA 1L74A 1L15A 231LA 3P64A 3CT1A 3GXRA 1LSYA 1D0MA 3AGIA 4I7SA 1L10A 226LA 3DN1A 1LSEA 1QT3A 1LJJA 4PJZA 5LINA 5HMVA 169LA 3IJUA 1AT6A 1LPYA 1OUBA 2BQDA 1L06A 1B7OA 2B72A 1JISA 2RBOA 1T6VL 178LA 1IIZA 5B07A 4AXTA 128LA 238LA 5KXZA 5DLAA 1GAYA 3BKVA 1GFRA 1C10A 4MCKA 1WQOA 1C69A 4PGJB 1T8AA 1GB2A 4XN6A 3ZVQA 3SB9A 229LA 261LA 1L99A 1DYBA 1LYDA 1BGIA 2OE7X 1REMA 166LA 1LGXA 2OU9A 1L60A 104LA 1KNIA 1C6GA 1C6QA 1XJUA 1C08C 1NWGA 1CV1A 1IWXA 5I4XA 5LVGA 1LZNA 1OQMA 4I7JA 1LPIA 3SBBC 1C68A 3SBAA 2RB0X 3CT0A 2A7FA 1YIKA 182LA 2ZIKA 4EPFA 4NWEA 1CVKA 1IVMA 1L40A 3WUNA 1CUQA 2FYDA 4I7TA 1C6NA 206LA 5L3IA 115LA 2XTHA 2I6ZA 3NY8A 1QTCA 1G0JA 4W52A 2DQIY 4GN4A 4QEQA 1L87A 3HH4A 5AMYA 4OWEA 5JENB 1OP9B 1QDRA 3TXEA 3SB6A 1IP5A 1CNSA 1L58A 1ZURA 3EO5A 5L3HA 211LA 133LA 1YAOA 1L76A 5HMJA 2H9KA 152LA 1T97A 1D3MA 3WXTA 1LSZA 4EKRA 172LA 3WU9A 1J1PY 1W6ZA 1L67A 2ANVA 2HTXA 2H9JA 2HUKA 112LA 1LHHA 4DD9A 141LA 207LA 2OU0X 1L72A 239LA 5LZMA 1XEJA 1HFYA 3TMVA 3WL2A 1LCNA 1JKCA 2YBNA 1LI3A 1B7LA 3WXUA 188LA 4H8XA 1L07A 1CX7A 2YDGA 1F6SA 1AT5A 1IOTA 1YAQA 5KXKA 3B0KA 1WQQA 4NSGA 4ET8A 1K28A 1GFGA 2GV0A 2LYZA 1RJCB 3HTFA 3W6EA 4W96A 1OUCA 3G3BB 4GLAA 4XJFA 1L49A 5F9XA 1LSMA 1LSPA 3GUNA 2BQIA 4KT3A 4LGKA 5I4WA 1A2YC 1OUAA 2BAAA 1QTDA 109LA 1QTEA 2MEBA 3OE8A 4WLTA 1YKYX 4NG1A 5FDJA 3FI5A 1L83A 4NFVA 1HFXA 4WG7A 3JR6A 4UWNA 5APEA 4ARQB 131LA 1CV5A 4DAJA 3MGWA 2DQFC 1KY1A 4LYZA 1PQDA 1L44A 140LA 4NHPA 158LA 3DN3A 1B7NA 3ATOA 186LA 3N9AA 1B7QA 4DDAA 1XJTA 4Z3MA 217LA 1L51A 1HFZA 4WL6A 1GFUA 3DMVA 1EL1A 3LN2A 1LHJA 4OOTA 2RAYX 216LA 4WLDA 3HH6A 4LYOA 1QT5A 1GBSA 2ZWBA 3GUJA 246LA 154LA 1D6PA 1O23A 5IHGA 4H9FA 5I53A 2LYOA 5HNCA 176LA 1G06A 1QTBA 2X0AA 2CDSA 1LSCA 4DD0A 1LKRA 1G7IC 1SSWA 4CFPA 4NHQA 1P2RA 1G1WA 1FDLY 1V7SA 1GWDA 3ZVQB 2DKVA 1GEVA 259LA 1GB6A 3FADA 4N9RA 4GRVA 3N9EA 1E8LA 1HELA 4HV2A 3TXGA 1BWIA 2EIZC 4DKLA 4NSHA 1HENA 1L0JA 3C83A 2BQEA 1GFVA 1LSGA 5KXWA 1DYFA 1L54A 3HUQA 1BB5A 4D9ZA 2BQLA 1G0GA 4N1EI 3G3WA 1D9UA 1GFEA 4I7MA 2RAZX 4W59A 234LA 3HTDA 2F30A 1ALCA 1QUGA 4LDLA 1L95A 247LA 1GF3A 1I1ZA 1B5ZA 1LZ6A 3M18B 5IELA 3ZEKA 5LA5A 1SWYA 1EPYA 1YL0X 1LMNA 4BADA 1OUHA 3HWLA 1HHLA 1B5VA 4WO9A 1QTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E9R A;  5LXW A;  1FLQ A;  9LYZ A;  1JEF A;  4I8S A;  1GF8 A;  4I0C A;  4WOA A;  4NIJ A;  4PJ2 C;  5FCP A;  1HSX A;  1B5Y A;  1VDT A;  4B49 A;  1YAM A;  4NGI A;  2XBR A;  5ILF A;  3WPK A;  5LVK A;  5HLL A;  4XYY A;  1GF6 A;  2EQL A;  5LYZ A;  4LT0 A;  1UID A;  3WYH A;  4WM2 A;  5D5C A;  5KY1 A;  2C8O A;  1DZB X;  1WQP A;  1GE1 A;  4HJZ A;  4ETB A;  1IWT A;  1UAC Y;  1NDM C;  2LYM A;  1B2K A;  5KXN A;  1IOQ A;  4YEO A;  4NGW A;  1LZ1 A;  5F9U A;  3TXK A;  1GB8 A;  1GFH A;  1QQY A;  5KXS A;  3WU7 A;  3E3D A;  4R0F A;  4DT3 A;  1JIY A;  3K3T A;  1N4F A;  1JKB A;  4HP0 A;  3TXD A;  1LZR A;  2LZT A;  1JHL A;  3ULR A;  3P66 A;  4AGA A;  3EMS A;  1QSW A;  5KKJ A;  1HF4 A;  1NKH A;  1XGU C;  4QGZ A;  4WO6 A;  5IDD A;  5KXX A;  1HC0 A;  4H8Y A;  5F81 A;  3HBE X;  4B4E A;  2BQF A;  2MEG A;  1GE4 A;  3W6C A;  1LSD A;  1LZ4 A;  3AJN A;  3LZT A;  4HTN A;  1REX A;  1AZF A;  5KXO A;  3AW6 A;  1UUZ C;  1B5X A;  1LZA A;  5L9J A;  1H6M A;  4YF2 A;  3VWO A;  2F2N A;  4XEN A;  1FBI X;  3WUL A;  1Z55 A;  1ZMY L;  4HTQ A;  3A6B Y;  4IJ4 A;  4NGY A;  2BQN A;  4OW1 A;  3WVY A;  4CHX A;  2VB1 A;  1JSF A;  1SQ2 L;  3AZ6 A;  3HFM Y;  4UWV A;  5C6L A;  3B6L A;  5DM9 A;  3W3E A;  1LZY A;  4WLX A;  1F6R A;  1GFK A;  1GAZ A;  3W6B A;  1LZT A;  1V7T A;  5B59 A;  1LYZ A;  3LYM A;  5T3F A;  1GB3 A;  1GB7 A;  3OK0 A;  3IJV A;  4J1B A;  4TUN A;  1GF7 A;  2ZQ3 A;  1DI5 A;  2YVB A;  1UC0 A;  1QIO A;  4XAD A;  2F4G A;  1MLC E;  3TXB A;  2DQJ Y;  4U3X B;  3WVX A;  8LYZ A;  1GB9 A;  1IP3 A;  2ZQ4 A;  2ZYP A;  1IP7 A;  1LMC A;  3A3R X;  1IY4 A;  4RW2 A;  3B72 A;  3WUA A;  4DD2 A;  2BLY A;  5FEL A;  4DDC A;  4Z41 A;  2HU3 A;  4G9S A;  5KJ9 A;  2HEC A;  2W1X A;  3SP3 A;  132L A;  1REZ A;  5APD A;  4HPE A;  3LYO A;  3AZ5 A;  4GCF A;  4II8 A;  2BQH A;  1EQ5 A;  1GE2 A;  4NSJ A;  1DI3 A;  1LYY A;  3A94 A;  4RLN A;  2PC2 A;  4XJB A;  2D4K A;  3A90 A;  1I20 A;  3AW7 A;  2BQJ A;  4PPO A;  1C7P A;  4G4B A;  2FYC A;  4OWC A;  1GDW A;  1KIQ C;  4LZT A;  135L A;  1FLW A;  1LJF A;  2HU1 A;  4NHT A;  1GBO A;  3T36 A;  3FI7 A;  3QE8 A;  1JTO L;  1IWV A;  1XEK A;  3AZ7 A;  3B0O A;  3RZ4 A;  5KXM A;  4YOP A;  4TX7 A;  1B7R A;  4N1C C;  2ZIJ A;  4HTK A;  4OWA A;  4TSC A;  4W94 A;  4QY9 A;  3N9C A;  4J1A A;  4N5R A;  1BHZ A;  4DD7 A;  4GLV A;  1LZS A;  5E4P A;  1GFT A;  1IR9 A;  4HJY A;  4ZFP A;  1LZG A;  3AYQ A;  4ZIX A;  3A34 A;  1GF4 A;  4G4C A;  2D4I A;  1NBY C;  2BPU A;  1LZ9 A;  3KAM A;  1LOZ A;  1TEW A;  2MEH A;  4MR1 A;  3TXI A;  4E3U A;  2G4Q A;  1UCO A;  3P64 A;  4MST A;  3CT1 A;  3GXR A;  2ZNW Y;  1LSY A;  1LHI A;  1VDQ A;  1HEO A;  2ZIL A;  4OWH A;  4WL7 A;  4LYT A;  1ZVH L;  1D0M A;  3AGI A;  6LYT A;  1PZY A;  1IWU A;  4WG1 A;  1LZD A;  1LSE A;  4NGV A;  2G4N A;  1GBZ A;  3P4Z A;  2D91 A;  1P2C C;  1LJJ A;  2BQC A;  5LIN A;  4LFX A;  1B9O A;  3BKH A;  2NWD X;  1GFA A;  4H9H A;  5DN5 A;  1GXV 2;  1BB7 A;  1CJ9 A;  2DQH Y;  2BQG A;  4LT2 A;  5HMV A;  2CJL A;  1AT6 A;  1JJ0 A;  3IJU A;  1KXY A;  1OUB A;  4L41 A;  1JUG A;  2BQD A;  1PS5 A;  4FJR A;  4J7V A;  1B7O A;  1TDY A;  4H9B A;  5DN4 A;  4CGE A;  1JIS A;  1T6V L;  1IIZ A;  5B07 A;  3TXF A;  4AXT A;  1G7L C;  1RI8 B;  5KXZ A;  5DLA A;  3A3Q A;  1IOR A;  4H93 A;  1GAY A;  3BKV A;  1G7H C;  1GFR A;  4DD3 A;  3CSZ A;  1LSB A;  1C10 A;  1LJH A;  1VAT A;  1JWR A;  4HSF A;  4MCK A;  5FST A;  193L A;  1WQO A;  5HNL A;  4TWS A;  4PGJ B;  1IEE A;  1GB2 A;  2HEE A;  3LYT A;  4XN6 A;  4A7D A;  1IC7 Y;  1T3P A;  3A95 A;  5C6J A;  3ZVQ A;  3WUM A;  1IR7 A;  3LZ2 A;  1CKF A;  2N5Z A;  4WM4 A;  194L A;  4B4J A;  1HER A;  1BWH A;  2BQB A;  1EQ4 A;  1FLY A;  3AB6 A;  1VDP A;  4QDN A;  1BGI A;  4NGO A;  1CKG A;  1LJE A;  1REM A;  1BVK C;  4ETE A;  1HEP A;  5ILC A;  1H87 A;  208L A;  1UBZ A;  4LYM A;  5LYT A;  1LSA A;  1EQE A;  1CJ6 A;  4IAT A;  5A3Z A;  1WTM A;  1C08 C;  1NWG A;  1VED A;  2I25 L;  1IWX A;  4OWB A;  5K7O A;  3RU5 A;  1UIC A;  3EXD A;  4NGZ A;  3OJP A;  5LAF A;  4Z46 A;  5I4X A;  5LVG A;  5I5Q A;  2Z18 A;  1LZN A;  1OQM A;  5F14 A;  1GB0 A;  1LPI A;  1IP1 A;  4GN5 C;  1IY3 A;  3IWR A;  1JKA A;  2D6B A;  4B1A A;  1D0L A;  5LVJ A;  2Q0M X;  3AGH A;  4PRU A;  4C3W A;  3CT0 A;  1JTP L;  1XEI A;  2A7F A;  4UWU A;  4YM8 A;  3M3U A;  2Z19 A;  4GCB A;  2Z2E A;  3WW5 A;  1SLY A;  1WVV A;  1YIK A;  2ZIK A;  1YKX X;  4NWE A;  4OOO A;  2XJW A;  4G49 A;  1IVM A;  1INU A;  2Z2F A;  3WPJ A;  2FYD A;  1GE3 A;  1F10 A;  3WUN A;  4CJ2 A;  2HEF A;  4WM5 A;  1AKI A;  4DDB A;  3A93 A;  4LYB A;  1DQJ C;  2DQE Y;  1NBZ C;  1RCM A;  5L3I A;  4NWH A;  1YKZ X;  4WM6 A;  2A7D A;  1LHK A;  1QUT A;  1BB4 A;  2XTH A;  4N8Z A;  2AUB A;  1LJK A;  2I6Z A;  4LYC A;  5I4Y A;  2B5Z A;  2DQC Y;  1YQV Y;  1BQL Y;  4HPI A;  5KXY A;  6LYZ A;  2DQI Y;  4GN3 A;  2DQD Y;  4GN4 A;  4QEQ A;  1IC5 Y;  1LZE A;  4BAF A;  1IWW A;  1XGQ C;  2MEC A;  2YBJ A;  2ZYC A;  5AMY A;  1LKS A;  4OWE A;  1FLU A;  5JEN B;  4WLY A;  1OP9 B;  1QDR A;  3TXE A;  4HJV A;  2H5Z A;  1IP5 A;  1CNS A;  1NDG C;  1KXW A;  3EO5 A;  1GBY A;  1LJ3 A;  5L3H A;  4DWX A;  5EBH A;  133L A;  5C6I A;  1YAO A;  3AZ4 A;  1JIT A;  3CT5 A;  1LTM A;  5HMJ A;  2H9K A;  3T6U A;  4RW1 A;  3A6C Y;  1LSF A;  2HUB A;  3WXT A;  5A3E A;  2BQM A;  3TMX A;  1LSZ A;  1CJ8 A;  1C45 A;  2WAR A;  3WU9 A;  1I56 A;  2MEE A;  2W1M A;  4GCE A;  4H92 A;  1J1P Y;  1UIA A;  1W6Z A;  5HQ1 A;  1JJ1 A;  2YBH A;  1JPO A;  1HML A;  2HTX A;  3QY4 A;  2H9J A;  4YEM A;  1KXX A;  1LHM A;  1LHH A;  4H9A A;  4KXI A;  3RNX A;  4LT3 A;  4DD9 A;  1IO5 A;  5I54 A;  4ANR A;  1HMK A;  2HEB A;  2LHM A;  3TMU A;  207L A;  5KXR A;  4C5F A;  4EMN A;  1IP4 A;  3P65 A;  1LSN A;  2Z39 A;  4LT1 A;  1XEJ A;  1OUE A;  1HFY A;  1CKD A;  2DQA A;  3TMV A;  1C43 A;  3WL2 A;  2C8P A;  4NGJ A;  1UIB A;  1LCN A;  1JKC A;  2YBN A;  1TCY A;  1B7L A;  3WXU A;  5M1Y A;  4H8X A;  1AM7 A;  4FDY A;  4XJI A;  3TXJ A;  2YDG A;  1F6S A;  4ML7 A;  1AT5 A;  1IOT A;  3A8Z A;  1YAQ A;  1HEW A;  1LZ5 A;  4GCD A;  1NMM A;  5KXK A;  3B0K A;  1WQQ A;  4NHI A;  1GFJ A;  4NSG A;  4ET8 A;  5LIO A;  4IAS A;  2YBL A;  4H91 A;  2F4A A;  4N0J A;  1GFG A;  2Z38 A;  3RT5 X;  2GV0 A;  1CJ7 A;  2LYZ A;  2Z37 A;  3W6A A;  1RJC B;  5B06 A;  4G4H A;  3W6E A;  4W96 A;  1OUC A;  1WVU A;  3G3B B;  4GLA A;  4XJD A;  4XJF A;  5F9X A;  4WMG A;  1LSM A;  1LSP A;  2BQA A;  4YEN A;  2W1Y A;  3A91 A;  1FKQ A;  1LMO A;  4NY5 A;  2BQI A;  1ZV5 L;  4EOF A;  4KT3 A;  4LGK A;  5I4W A;  1J1X Y;  1A2Y C;  1OUA A;  2BAA A;  2ZNX Y;  1WQR A;  1QTE A;  1XFP L;  5APC A;  2IFF Y;  2MEB A;  4WLT A;  4M4O A;  1G7M C;  2I26 L;  1UA6 Y;  1YKY X;  2FBD A;  4NG1 A;  1IOC A;  1B7S A;  2BQO A;  1OUD A;  2Z12 A;  5FDJ A;  4H9C A;  1D6Q A;  1IP2 A;  1LJ4 A;  1GEZ A;  4NFV A;  1GHL A;  1HFX A;  2YBI A;  1CKH A;  3LYZ A;  4WG7 A;  4ETD A;  1VFB C;  4TSB A;  1CKC A;  1LMA A;  1LZ8 A;  1J1O Y;  3AGG G;  4TTD A;  4H94 A;  1NHE A;  2HEA A;  4UWN A;  1XGT C;  1OUJ A;  1YRO A;  1UIG A;  3HBD A;  1WTN A;  4O34 A;  3WU8 A;  1OUG A;  1BB3 A;  1YAN A;  4X3B A;  5APE A;  4DD1 A;  5B1F A;  1LHL A;  2Y8P A;  1B7M A;  1XGR C;  1UIH A;  1YAP A;  3CSQ A;  3MGW A;  1VDS A;  3CQL A;  1FKV A;  2DQF C;  4NG8 A;  4ET9 A;  5J7C A;  3WW6 A;  3W6F A;  7LYZ A;  5DL9 A;  4LYZ A;  3EBA B;  1REY A;  153L A;  1GDX A;  2W1L A;  1XGP C;  1IP6 A;  4NHP A;  1LMQ A;  1D0K A;  1B7N A;  1B5W A;  4NEB A;  5FEK A;  3ATO A;  1W08 A;  1XSF A;  4WM3 A;  3HBH A;  1GBW A;  3W6D A;  4RLM A;  3N9A A;  1BVX A;  1B7Q A;  1GE0 A;  1IC4 Y;  4DDA A;  4Z3M A;  2CWI A;  1HFZ A;  2DBT A;  4WL6 A;  2BQK A;  1GB5 A;  1VAU A;  1OUF A;  1DI4 A;  1GFU A;  3QNG A;  2YBM A;  1EL1 A;  3LN2 A;  1LHJ A;  4BS7 A;  2MED A;  3B0I A;  1DKJ A;  4OOT A;  4NGL A;  4H8Z A;  4ETA A;  4B4I A;  3CB7 A;  3WH1 A;  1JTT L;  1QSA A;  4WLD A;  3G3A B;  1WQN A;  4RDS A;  1MEL L;  1LYS A;  4LYO A;  2IHL A;  1UIF A;  1ZVY B;  3WPL A;  4H90 A;  1LZC A;  2MEA A;  3RW8 A;  1GBS A;  2ZWB A;  1WQM A;  3LHM A;  154L A;  4NGK A;  1LJG A;  1D6P A;  1O23 A;  4CFO A;  3F6Z A;  4H1P A;  1HSW A;  4H9F A;  5I53 A;  3TXH A;  5IHG A;  1BWJ A;  3TMW A;  2LYO A;  4BAP A;  3FE0 A;  2RSC A;  5LVI A;  5HNC A;  4NHS A;  1FN5 A;  3D3D A;  5KKI A;  3A67 Y;  1HEM A;  3J4G A;  5B1G A;  1GF0 A;  2X0A A;  2CDS A;  5B05 A;  1LSC A;  1OUI A;  4DD0 A;  1LKR A;  1QUS A;  2FBB A;  1NF5 A;  1DPW A;  5LA8 A;  1LJN A;  1G7I C;  2XBS A;  4P2E A;  4CFP A;  4NHQ A;  1TAY A;  4H9I A;  1QDT A;  1IWZ A;  2EPE A;  3P68 A;  1FDL Y;  1G7J C;  1V7S A;  4NSI A;  1GD6 A;  1GWD A;  3ZVQ B;  4LFP A;  2DKV A;  5FHW A;  1IR8 A;  1LYO A;  2D4J A;  3D9A C;  4J0L A;  4HV1 A;  1GEV A;  1B7P A;  1GB6 A;  1HEQ A;  1KIP C;  1GXX A;  2EKS C;  4GCC A;  1LAA A;  4H9E A;  4DC4 A;  5KXT A;  4N9R A;  1DPX A;  1LJI A;  3N9E A;  1E8L A;  1HEL A;  1JSE A;  1GF5 A;  1LMP A;  4ETC A;  4HV2 A;  3TXG A;  1BWI A;  4R6C A;  2MEF A;  2EIZ C;  4NSH A;  3J6K A;  1HEN A;  5KXL A;  3A96 A;  3ATN A;  5LVH A;  1UIE A;  2BQE A;  1GFV A;  4M6D A;  1LSG A;  2G4P A;  1GPQ C;  5KXW A;  2YSS C;  1KIR C;  5II3 A;  1BB5 A;  1JJ3 A;  4D9Z A;  5F16 A;  4DYG A;  2LZ2 A;  1IWY A;  2BQL A;  1A4V A;  1NQI A;  4N1E I;  1JKD A;  1HNL A;  4ZEE A;  4B0D A;  1D9U A;  1GFE A;  1LMT A;  5LAG A;  1RE2 A;  1GBX A;  2HED A;  2F30 A;  3GXK A;  134L A;  1ALC A;  2DQG Y;  4XJH A;  1B5U A;  4PHI A;  1IOS A;  1YL1 X;  1GF3 A;  1TBY A;  1I1Z A;  1B5Z A;  1LZ6 A;  1C46 A;  4Z98 A;  3M18 B;  5D5F A;  3WMK A;  5IEL A;  1BB6 A;  1IX0 A;  1LZB A;  4XJG A;  3ZEK A;  5LA5 A;  1RFP A;  4WM1 A;  2MEI A;  1YL0 X;  3CSR A;  1GF9 A;  1B0D A;  1DKK A;  1LMN A;  5KXP A;  4BAD A;  1OUH A;  4KPM A;  4PRQ A;  1HHL A;  1F0W A;  1B5V A;  5LYM A;  4KL7 A;  5APF A;  1DXJ A;  1YIL A;  2BLX A;  3A92 A;  2CGI A;  4WO9 A;  1QTK A; 
#chains in the Genus database with same CATH topology
 9LYZ A;  3U60 B;  4B49 A;  1YAM A;  3KOZ E;  3W67 A;  2KRU A;  5LVK A;  1L77 A;  5LYZ A;  3EIH A;  4LT0 A;  1UID A;  4WM2 A;  1GE1 A;  151L A;  1LYG A;  5KXN A;  1LZ1 A;  218L A;  1IBK M;  3TXK A;  1Q02 A;  3FTC A;  3K92 A;  1JKB A;  4HP0 A;  3Q8X A;  3TXD A;  1JHL A;  4AGA A;  3EMS A;  1B6I A;  4OO9 A;  1NKH A;  1TLA A;  4QGZ A;  4DQ5 A;  1Z5A A;  198L A;  4B4E A;  1HT2 E;  4JI5 M;  2BQF A;  2RBQ A;  1LSD A;  4HTN A;  3FUX A;  5E26 A;  1C6J A;  3AW6 A;  2R4E A;  3VK8 A;  1UUZ C;  1B5X A;  2OE4 X;  1LZA A;  2O5R A;  3MK6 A;  1L16 A;  3DFZ A;  3VWO A;  4G4R A;  3WUL A;  4MB7 A;  4HTQ A;  4II7 A;  3VDU A;  4R3D A;  4IJ4 A;  3WVY A;  4CHX A;  3KVW A;  3PNV A;  3U6L A;  1E9S A;  1LZY A;  4L16 A;  5ITT A;  1GFK A;  1GAZ A;  2L7H A;  1L05 A;  223L A;  5B59 A;  1GB3 A;  3OK0 A;  4CJ6 A;  1QT4 A;  2ZQ3 A;  1C6I A;  4LDO A;  1QIO A;  4XAD A;  1NY6 A;  1MLC E;  4W57 A;  3WVX A;  8LYZ A;  3GPU A;  3GLG B;  3GUL A;  3GLG E;  3A3R X;  3OE6 A;  113L A;  3HUK A;  2O25 A;  4G9S A;  2XLJ A;  3H4J A;  1L14 A;  1C66 A;  5APD A;  126L A;  1E32 A;  3JR5 A;  2DZO B;  1L63 A;  4ARM B;  1DI3 A;  2DVW B;  2B6Z A;  2D4K A;  2NTH A;  3LMM A;  5GKN A;  1C6P A;  4PPO A;  1QZM A;  2WSF F;  3KS4 A;  135L A;  5F3W A;  1WGN A;  5ITY A;  3FI7 A;  2CV2 A;  4JN6 A;  1XEK A;  3AZ7 A;  3B0O A;  1L27 A;  2DHY A;  5KPT A;  4YOP A;  4TX7 A;  1L43 A;  4QY9 A;  2QNJ A;  4W94 A;  1ORY B;  4KO8 A;  4G4O A;  1HQY E;  1LZS A;  5E4P A;  1GFT A;  237L A;  3DOA A;  1LZG A;  1L0K A;  3K9O A;  3LQR A;  4G4C A;  4W54 A;  4DV5 M;  253L A;  3U60 A;  1IXS A;  4E3U A;  220L A;  2LVP C;  1HNZ M;  3DN6 A;  2ZNW Y;  1CU3 A;  1L41 A;  1LHI A;  1VDQ A;  1HEO A;  2ZIL A;  3GUM A;  4WG1 A;  3SAV A;  249L A;  1TH4 A;  3SYK A;  2JP7 A;  1P2C C;  2BQC A;  3BKH A;  2NWD X;  5DN5 A;  2DQH Y;  1C6B A;  4L41 A;  1GO5 A;  1PS5 A;  3AOE A;  3GQ5 A;  4AKH A;  1G7L C;  4EXM A;  4M9S A;  1W5S A;  3A3Q A;  3I01 M;  1PJT A;  4H93 A;  130L A;  4DD3 A;  3HKP A;  190L A;  1LJH A;  1VAT A;  4S0W A;  5LMU M;  120L A;  4TWS A;  3B89 A;  3L25 A;  3NWL A;  3SAU A;  2HEE A;  3LYT A;  3LCU A;  1IC7 Y;  119L A;  3HUA A;  1IR7 A;  1L56 A;  3GUI A;  1CKF A;  4B4J A;  2XF3 A;  2BQB A;  1FLY A;  4QDN A;  4NGO A;  1CKG A;  4F1I A;  244L A;  1TDZ A;  2XSZ D;  4ETE A;  1HEP A;  5ILC A;  1UBZ A;  5EP2 A;  3UON A;  5LYT A;  1EQE A;  4GKK M;  108L A;  1CJ6 A;  1L70 A;  4IAT A;  3HHW A;  5A3Z A;  1VED A;  1IXZ A;  1G8P A;  2I25 L;  5K7O A;  3IG8 A;  3CDT A;  4DUZ M;  1L98 A;  4I81 A;  3GQ3 A;  1QS9 A;  2ZAN A;  1JKA A;  5LVJ A;  2Q0M X;  3AGH A;  4PRU A;  1JTP L;  1XEI A;  4YM8 A;  1I94 M;  214L A;  3KOY E;  3WW5 A;  2Z2E A;  3PXG A;  162L A;  2BJW A;  4X64 M;  1QTH A;  3IEC A;  1YKX X;  4AQN A;  4LZM A;  2ZTD A;  3HHZ A;  168L A;  123L A;  4EJ4 A;  4FVM A;  3WPJ A;  3SC3 A;  2HEF A;  240L A;  4Y28 F;  1Q3B A;  1L30 A;  2J7O A;  4LF9 M;  1NBZ C;  1GL6 A;  3B7N A;  2RBP A;  4WM6 A;  1BB4 A;  4N8Z A;  4GBR B;  4LYC A;  2K9D A;  4GN3 A;  4BAF A;  1IWW A;  1LWG A;  2R45 A;  1KSF X;  3KP0 E;  1R2Y A;  2B6T A;  1FLU A;  170L A;  2X8A A;  165L A;  4QHT A;  4HJV A;  3PVS A;  3GLH B;  1KXW A;  2B74 A;  4PCZ A;  5EBH A;  4GIP A;  3AL0 C;  4Q7J A;  1JIT A;  1L80 A;  3DKE X;  2XZF A;  3T6U A;  5ITX A;  3A6C Y;  2KA6 B;  3GLH E;  1R6B X;  1IN4 A;  2WAR A;  3DN8 A;  2MEE A;  1L94 A;  3KP1 E;  2HUM A;  4H92 A;  1L12 A;  1UIA A;  3TWM A;  1KXX A;  1J5E M;  1LHM A;  4H9A A;  155L A;  4KXI A;  7LZM A;  2MRO B;  3LVV A;  2QEN A;  1IP4 A;  1P3N A;  3P65 A;  2BJV A;  3NYA A;  2JY6 B;  1DGB A;  1LLH A;  2B70 A;  2CP8 A;  2LVQ D;  2MJ5 B;  4FDY A;  4LFB M;  1PQJ A;  3T6P A;  2XSZ A;  1L18 A;  4QOZ C;  3HDF A;  4NHI A;  1L03 A;  2UXC M;  1TR8 A;  3SAS A;  5LIO A;  2G3Q A;  3C8S A;  4IAS A;  4JI0 M;  2Q2E B;  3NBX X;  1CU5 A;  4GMQ A;  2CHG A;  4NL4 H;  2DHR A;  3RT5 X;  3W6A A;  5B06 A;  4G4H A;  2XEP A;  2JA2 A;  1L23 A;  2FH0 A;  3QYE A;  3DMX A;  1OAI A;  4MGK E;  2YNM D;  2BQA A;  5EQT A;  1SXJ E;  4YXA C;  2J7N A;  2ZNX Y;  1WQR A;  4KT0 F;  1XFP L;  5APC A;  1G7M C;  1PJS A;  1L22 A;  1IOC A;  2BQO A;  1D2W A;  1DGH B;  1IFY A;  1LJ4 A;  4CIZ A;  1Z5C A;  2F47 A;  1GHL A;  3ZCB B;  4ETD A;  1VFB C;  1JTN A;  4TSB A;  3A98 B;  233L A;  1J1O Y;  3AGG G;  1NHE A;  2MR9 A;  3C8R A;  4O34 A;  3PDS A;  1L52 A;  3C9P A;  4DV3 M;  1I6S A;  2ZM6 M;  1LHL A;  1B7M A;  4LJ9 A;  1C64 A;  1C62 A;  5EP1 A;  1P64 A;  2F5P A;  161L A;  1VDS A;  3HJ8 A;  1MU5 A;  3WW6 A;  5DL9 A;  1REY A;  2R62 A;  4IBK A;  4B3R M;  1GDX A;  1PM5 A;  3U6O A;  1XGP C;  3UGJ A;  3DNA A;  1QYR A;  2Q9D A;  1D0K A;  1B5W A;  1C61 A;  4WM3 A;  1XSF A;  1GBW A;  1DYE A;  1J7K A;  1QQW A;  2HHH M;  2CWI A;  4ITQ A;  4FWD A;  2R4J A;  1CV0 A;  1GB5 A;  3GLH A;  4I7L A;  3QNG A;  2YBM A;  1L81 A;  1P5C A;  225L A;  1GL7 A;  4NGL A;  1GAB A;  1QSA A;  122L A;  1WQN A;  1LYS A;  2F5S A;  1P2L A;  3U6C A;  2NTG A;  1ZVY B;  3WPL A;  4B08 A;  4LGY A;  4DUY M;  2KNV A;  1TTE A;  3LHM A;  3K1J A;  1LJG A;  1G0M A;  3TXH A;  195L A;  5FSW A;  3TMW A;  2LCB A;  142L A;  3FE0 A;  4R7G A;  2OU8 A;  2RSC A;  5LVI A;  3SHF A;  4NHS A;  3C82 A;  5KKI A;  3J4G A;  5B1G A;  4DJH A;  1QUS A;  3I51 A;  2FBB A;  2XBS A;  1IXS B;  2IGC A;  2UXB M;  4MM3 B;  1G3I A;  1L42 A;  4H9I A;  2K6B A;  1IWZ A;  1G7J C;  1PQI A;  1L34 A;  3RGS A;  1GD6 A;  1C67 A;  1NSF A;  102L A;  4LFP A;  1LYO A;  2D4J A;  4J0L A;  3D9A C;  1L37 A;  1B7P A;  4W55 A;  2EKS C;  4GCC A;  4RF0 A;  5KXT A;  181L A;  192L A;  1DPX A;  1L71 A;  4P16 A;  1IN5 A;  3SB5 A;  4ETC A;  3K2L A;  4R6C A;  4AKI A;  2CRU A;  3RFW A;  5KXL A;  191L A;  3HHY A;  241L A;  3ATN A;  1XNR M;  5LVH A;  2LVA A;  4EIW A;  1KIR C;  4PK0 A;  2O4W A;  5L8R F;  1QTZ A;  2V1U A;  3V2Y A;  4ZEE A;  4B0D A;  3M6A A;  1QSB A;  3RUN A;  134L A;  4LF4 M;  1IOS A;  1TBY A;  4B7G A;  4I7Q A;  3SFZ A;  4Z98 A;  3GLI E;  1SX2 A;  4XJG A;  4I7N A;  1LI6 A;  2DI0 A;  4JV5 M;  144L A;  4JYA M;  1G0Q A;  260L A;  4WM1 A;  5A2Q S;  3CSR A;  1GF9 A;  1B0D A;  1QSQ A;  2DAI A;  1DKK A;  5KXP A;  4JI4 M;  3ILK A;  1PQK A;  2QSF X;  3F92 A;  4L6V 6;  1I4W A;  2B7X A;  5APF A;  1YIL A;  5LYM A;  2CGI A;  4IBD A;  1PJI A;  5LXW A;  1GF8 A;  4WOA A;  4PJ2 C;  3L64 A;  2HL7 A;  4G6Z A;  1B5Y A;  1HSX A;  129L A;  5ILF A;  3BBZ A;  4IBI A;  5HLL A;  114L A;  4XYY A;  1V33 A;  2RBR A;  2GQF A;  3WYH A;  2C8O A;  1SXJ C;  4HJZ A;  1UAC Y;  1B2K A;  3KW6 A;  1QAN A;  4NGW A;  5F9U A;  1GFH A;  230L A;  2VDB B;  4DT3 A;  3WU7 A;  1N4F A;  3HTG A;  2LZT A;  2F5Q A;  1QSW A;  3FE3 A;  5IDD A;  1HC0 A;  4H8Y A;  5F81 A;  3W6C A;  3C80 A;  2RBS A;  1REX A;  1WHC A;  1T6O A;  1XMO M;  1TH3 A;  2E5L M;  4LJ7 A;  3LCV B;  2Q9E A;  1HNW M;  1H6M A;  3CF2 A;  2F2N A;  2XFT A;  1L19 A;  4NGY A;  3C7W A;  2VB1 A;  1JSF A;  1SQ2 L;  3HFM Y;  4LJ4 A;  1WJ7 A;  3L27 A;  4IJF A;  1C6E A;  3TQS A;  4JXJ A;  3FA0 A;  3W6B A;  1SSY A;  1LZT A;  4LJA A;  4GHA A;  1LYZ A;  5T3F A;  1ZV1 A;  245L A;  1GF7 A;  1V92 A;  1QUH A;  2YVB A;  4DR5 M;  4ZPX A;  159L A;  219L A;  2DQJ Y;  3CDO A;  1GB9 A;  1IP3 A;  1C6A A;  2ZYP A;  1IP7 A;  1LMC A;  139L A;  3QYB A;  4RW2 A;  3B72 A;  1BVS A;  2BLY A;  2JXN A;  7CAT A;  2HU3 A;  4ARP A;  5I14 A;  5KJ9 A;  1NJG A;  4L8R C;  1L24 A;  3I4Y A;  1CTW A;  4HPE A;  3SN6 R;  4II8 A;  4I7P A;  1EQ5 A;  3J80 S;  5C18 A;  4NSJ A;  1LYY A;  2CE7 A;  2PC2 A;  1FJG M;  1L20 A;  177L A;  3A90 A;  3HT7 A;  2OTZ X;  1L31 A;  2OO9 A;  4G4B A;  2FYC A;  3U6P A;  4OWC A;  5KQ8 A;  4W51 A;  4GHL A;  1DO0 A;  3KOW E;  1LJF A;  243L A;  1R2Z A;  1JB0 F;  3Q8G A;  242L A;  4G3O A;  147L A;  2EKF A;  3HJS A;  3VDP A;  4NSO B;  1JQU A;  1B7R A;  2QHO B;  5DYG A;  2ZIJ A;  4GIT A;  2A4T A;  4N5R A;  4JI7 M;  3HY5 A;  1R5L A;  2EUC A;  1IR9 A;  4HJY A;  3AYQ A;  1C6M A;  1NBY C;  1LOZ A;  1TEW A;  2MEH A;  4MR1 A;  5IT9 S;  1QT7 A;  2G4Q A;  3GUK A;  1UCO A;  4MST A;  2B6W A;  1SX7 A;  2EKK A;  4WL7 A;  4LYT A;  6LYT A;  1IWU A;  3KFU G;  1SWZ A;  210L A;  4DR6 M;  1LZD A;  1QUO A;  4NGV A;  1GBZ A;  111L A;  1CJ9 A;  2BQG A;  4FWG A;  1Z59 A;  221L A;  4LT2 A;  1JJ0 A;  3SP3 A;  3NY9 A;  3FKE A;  1JUG A;  4FJR A;  1TDY A;  3TXF A;  3DA1 A;  167L A;  2F32 A;  3GLI B;  1HQC A;  1LGW A;  3GQ4 A;  4QOS A;  1IOR A;  1G7H C;  4HSF A;  2VF7 A;  1JWR A;  5FST A;  2KEB A;  1KS3 A;  4IBJ A;  5IWA M;  1IEE A;  3HT6 A;  4LDE A;  4A7D A;  1L89 A;  2HWJ A;  3J81 S;  3A95 A;  2B3T A;  2JUJ A;  5C6J A;  3HH3 A;  3WUM A;  3LZ2 A;  222L A;  2L78 A;  2N5Z A;  4WM4 A;  194L A;  1HER A;  3CDV A;  2CV0 A;  1BWH A;  148L E;  3UK6 A;  3AB6 A;  4I8O A;  2YQZ A;  1LJE A;  1L85 A;  2RGH A;  4D81 A;  160L A;  4A3V B;  201L A;  107L A;  1WTM A;  3KSX A;  5FTN A;  4IBE A;  1UIC A;  4Z46 A;  1YSY A;  3C7Y A;  1CV3 A;  1GB0 A;  5JI3 E;  4GN5 C;  3IWR A;  2D6B A;  4OX9 M;  1VDD A;  4UWU A;  3OE9 A;  2Z19 A;  4LY6 A;  1L47 A;  4JI2 M;  1SLY A;  215L A;  1L39 A;  212L A;  1JR3 D;  180L A;  3HT8 A;  4X65 M;  4G49 A;  3FD9 A;  232L A;  2Z2F A;  3E21 A;  1IQP A;  1F10 A;  1GE3 A;  4CJ2 A;  1L55 A;  2B6X A;  4WM5 A;  2XGN A;  1AKI A;  4DDB A;  2V6Z M;  4BBA A;  3A93 A;  2DQE Y;  2WSC F;  1RCM A;  4NWH A;  1YKZ X;  3U61 A;  2KRK A;  1LHK A;  1QUT A;  2AUB A;  5I4Y A;  2DQC Y;  4HPI A;  1BQL Y;  6LYZ A;  5DFL A;  4I7O A;  3BOS A;  4L15 A;  1LZE A;  4NOO B;  2L09 A;  1P36 A;  1XGQ C;  2MEC A;  1LKS A;  3GLF A;  4NXM M;  2H5Z A;  2OOA A;  1NDG C;  1L90 A;  3F8V A;  3OE0 A;  255L A;  3HU3 A;  1PQM A;  4S12 A;  5C6I A;  3AZ4 A;  4L78 A;  2C99 A;  3CGW A;  4LGM A;  1LTM A;  5ITU A;  3GRY A;  1KY0 A;  1QS5 A;  2N35 A;  1LSF A;  2HUB A;  3TMX A;  1CJ8 A;  251L A;  2K47 A;  8CAT A;  5H37 D;  1JJ1 A;  1JPO A;  3FRH A;  4YEM A;  3GRR A;  262L A;  2UXD M;  1IO5 A;  4ANR A;  1HMK A;  2HEB A;  2LHM A;  1P37 A;  5KXR A;  4C5F A;  4EMN A;  1LSN A;  197L A;  1P46 A;  2Z39 A;  4LT1 A;  1UFZ A;  3FUU A;  1N77 A;  1CKD A;  2DQA A;  1C43 A;  4DR1 M;  3U5Z A;  2C8P A;  1UIB A;  4LJ6 A;  1TCY A;  3C8Q A;  1H6U A;  4XJI A;  252L A;  3TXJ A;  3ODU A;  4ML7 A;  3A8Z A;  205L A;  1HEW A;  1LZ5 A;  4GCD A;  5ITX E;  1GFJ A;  3GPY A;  1C6H A;  2YBL A;  1CU2 A;  2Z38 A;  1CJ7 A;  4CGY B;  2Z37 A;  3U6M A;  1YLA A;  1KFV A;  1WVU A;  4XJD A;  4I7R A;  1L08 A;  4K5Y A;  1L96 A;  2W1Y A;  2OEA X;  1L64 A;  1LMO A;  4NY5 A;  4YX7 C;  5FTJ A;  4Z6Y A;  1ZV5 L;  4EOF A;  4LG2 A;  1C65 A;  1LGU A;  2HUL A;  2Z12 A;  2KNZ A;  1OUD A;  1PRB A;  4W58 A;  2ERC A;  1IP2 A;  4HL4 A;  2CHV A;  3HX3 A;  2D7E A;  1GEZ A;  3KSJ A;  1CKH A;  1CKC A;  1LMA A;  1LZ8 A;  4H94 A;  1L65 A;  4QHS A;  2XH9 A;  1XGT C;  3SMP A;  1UIG A;  3HBD A;  3DN2 A;  1OUG A;  1BB3 A;  1YAN A;  4DD1 A;  2LZM A;  2Y8P A;  3RZE A;  1UIH A;  1YAP A;  3C58 A;  4HEO A;  4LJ5 A;  4AG6 A;  3W6F A;  7LYZ A;  1L50 A;  3EBA B;  1N32 M;  1LMQ A;  4ARJ A;  5EXX A;  2ZBK B;  1W08 A;  4LRT A;  2JWS A;  1BVX A;  3ZQJ A;  1GE0 A;  1IC4 Y;  2QAR C;  3K2R A;  1T6H A;  1QAO A;  2DBT A;  2BQK A;  3EIE A;  1OUF A;  1DI4 A;  2QZ4 A;  1D3N A;  3GPP A;  2RB1 X;  4H8Z A;  157L A;  4ETA A;  4B4I A;  3J7B A;  2F5O A;  1GVN A;  1C63 A;  1VEK A;  2IHL A;  1JQJ C;  1UIF A;  4HLQ A;  1K3W A;  4H90 A;  2MEA A;  3AFH A;  4NXN M;  1WQM A;  1K3X A;  3SAT A;  1L32 A;  1WTH A;  227L A;  5FTK A;  3F6Z A;  1HSW A;  4B3S M;  4MGH A;  1L53 A;  1ZYT A;  2Z7J A;  3DN4 A;  2Y0Q A;  1OFH A;  1FN5 A;  3D3D A;  3A67 Y;  1HEM A;  1GF0 A;  5B05 A;  1OUI A;  3R8F A;  3IG5 A;  3HT9 A;  4E97 A;  5LA8 A;  1NF5 A;  1LJN A;  4P2E A;  3K8Z A;  1TAY A;  4DBG B;  1QDT A;  5C1B A;  1OWZ A;  4NSI A;  1L82 A;  5FHW A;  4HV1 A;  4PD2 A;  1SXJ A;  1G0P A;  1KIP C;  3L28 A;  3GUP A;  1LAA A;  4H9E A;  4DC4 A;  1L66 A;  3FYD A;  1JSE A;  185L A;  1LYH A;  1GF5 A;  1LMP A;  1EE8 A;  1LWK A;  4EKP A;  3V76 A;  3SB8 A;  1MJG M;  1XB2 B;  3A96 A;  143L A;  1UIE A;  4GEW A;  3CDR A;  1GPQ C;  1KYI A;  2YSS C;  5II3 A;  3A45 A;  1JJ3 A;  4DYG A;  3GRV A;  1L93 A;  3SAW A;  2LZ2 A;  127L A;  1L2B A;  1JTM A;  1NQI A;  4GH9 A;  2KZS A;  1PJJ A;  1XWI A;  1LMT A;  5LAG A;  1DYA A;  1L75 A;  1RE2 A;  3T1H M;  1G1V A;  4XJH A;  1YL1 X;  4BB9 A;  1P3Q Q;  1C60 A;  2JY5 A;  4W56 A;  1C46 A;  5D5F A;  3WMK A;  2L4F A;  1C7Y A;  1BB6 A;  1IX0 A;  1LZB A;  2ZAM A;  1RFP A;  2DAE A;  2MEI A;  1XMQ M;  3VLF B;  2OTY X;  1WIV A;  2XQO A;  1OQY A;  1F0W A;  2HAK A;  1DXJ A;  2BLX A;  3A92 A;  3AZ5 A;  3M3U A;  5E9R A;  1JEF A;  1XEP A;  4NIJ A;  1VDT A;  2XBR A;  2GNO A;  2RKO A;  2W82 A;  248L A;  1XXH E;  2EQL A;  2KHH A;  3FTD A;  1QZE A;  3SBJ A;  5D5C A;  5KY1 A;  3H4M A;  1DZB X;  4ETB A;  1Z5B A;  2Z8Y M;  1ZMW A;  1IOQ A;  4YEO A;  1J09 A;  1GB8 A;  5KXS A;  3E3D A;  4R0F A;  3MHV C;  3K3T A;  3L29 A;  1OVH A;  1LZR A;  3P66 A;  4YXC A;  1HF4 A;  5KO3 A;  1QT6 A;  1XGU C;  5KXX A;  3HBE X;  2MEG A;  3HGI A;  1LZ4 A;  3AJN A;  175L A;  3PNY A;  4B7H A;  1AZF A;  2OQ4 A;  4IBB A;  258L A;  4GC9 A;  5L9J A;  2QQ8 A;  2RB2 X;  4XEN A;  1CU0 A;  4CHT B;  1FBI X;  2Y0T A;  1VQ1 A;  1OYU A;  2BQN A;  1Q39 A;  4OW1 A;  2JZ0 A;  4DV1 M;  1TDH A;  3AZ6 A;  1L69 A;  1IY2 A;  5DM9 A;  2R44 A;  3LQQ A;  1MN3 A;  4LF7 M;  3W3E A;  4WLX A;  1F6R A;  213L A;  1GB7 A;  2F2Q A;  3IJV A;  4J1B A;  1XXH A;  2CUZ A;  2F4G A;  2Z6B A;  3TXB A;  1L73 A;  209L A;  1GLN A;  236L A;  4DD2 A;  5FEL A;  3E9S A;  4OW0 A;  4OU7 A;  1ZMU A;  3LVW A;  2W1X A;  3B74 A;  1REZ A;  2CUU A;  2OPF A;  3LYO A;  1L62 A;  4GCF A;  1L59 A;  4MGY E;  3A94 A;  1L36 A;  1T8F A;  1L1T A;  1C6D A;  1IN6 A;  4JI6 M;  1C7P A;  3E46 A;  1L79 A;  1KIQ C;  2HU1 A;  4NHT A;  1GBO A;  3T36 A;  4DR7 M;  4XBO A;  1L8Q A;  3QE8 A;  1JTO L;  1IWV A;  3RZ4 A;  1JR3 E;  1LW9 A;  4OWA A;  4TSC A;  3GO8 A;  3N9C A;  1C6L A;  4GLV A;  2EO2 A;  224L A;  3VW7 A;  4ZIX A;  3A34 A;  1LZ9 A;  1IM2 A;  2P5T A;  3CF6 E;  3TXI A;  3SYL A;  2RH1 A;  5KPZ A;  2K0B X;  4FCV A;  164L A;  138L A;  4OWH A;  1V34 A;  1ZVH L;  1L86 A;  1PZY A;  3D8L A;  2G4N A;  3P4Z A;  2D91 A;  2CWB A;  3HU9 A;  4LFX A;  1B9O A;  2UUA M;  2O7A A;  4H9H A;  1OFI A;  1GFA A;  1GXV 2;  1BB7 A;  4PDG A;  2Y21 A;  2CJL A;  1KXY A;  2LBC A;  4LCB A;  4J7V A;  4ARM A;  4H9B A;  2DXI A;  1JR3 A;  5DN4 A;  4CGE A;  2L6O A;  4G4Q A;  1RI8 B;  2L7I A;  4ZPU A;  1XNQ M;  3CSZ A;  1P6Y A;  4I4L A;  1LSB A;  4IAP A;  193L A;  5HNL A;  3QAK A;  1L02 A;  1L97 A;  1NJF A;  1T3P A;  1CV4 A;  3L2X A;  3HHX A;  1OV7 A;  5EXT A;  4DV4 M;  2CEA A;  1G07 A;  3TPZ A;  1OVK A;  1EQ4 A;  5EXP A;  3W68 A;  1VDP A;  1IXR C;  3U61 B;  1L45 A;  1BVK C;  1PQO A;  1H87 A;  208L A;  4WUR A;  4LYM A;  1L68 A;  1LSA A;  1QTV A;  2R18 A;  4OWB A;  3RU5 A;  3EXD A;  4NGZ A;  3OJP A;  5LAF A;  1LYJ A;  2RBN A;  5I5Q A;  2Z18 A;  5F14 A;  1CU6 A;  4GKJ M;  1IP1 A;  1C1K A;  1IY3 A;  3J7A S;  4B1A A;  1D0L A;  1A5T A;  199L A;  1L61 A;  257L A;  4C3W A;  1VG5 A;  4DR3 M;  1GJT A;  4GCB A;  1NVM A;  173L A;  1WVV A;  2DZN B;  1LYI A;  1L04 A;  4OOO A;  2XJW A;  1C6K A;  4KLN A;  2MH8 A;  4LF5 M;  1DGH A;  1INU A;  1QUD A;  1L57 A;  4WW0 A;  2DWM A;  4LYB A;  4JI1 M;  3KS8 A;  3JR4 A;  3C81 A;  1DQJ C;  4GRI A;  1NV9 A;  2KZU A;  1L48 A;  3UJN A;  1C6C A;  2XFS A;  228L A;  4D80 A;  2A7D A;  4I5S A;  1LJK A;  3BXW A;  2JZ1 A;  3GLF B;  2B5Z A;  1YQV Y;  5KXY A;  2YFQ A;  3M7G A;  4FCT A;  2BWB A;  2Z4S A;  2WSE F;  2DQD Y;  2LNH C;  2BNK A;  4R71 A;  1IC5 Y;  2D7H A;  3KDS E;  1L11 A;  2YBJ A;  2ZYC A;  2C96 A;  4WLY A;  125L A;  183L A;  1SG9 A;  1Y8G A;  1NY5 A;  3HZJ A;  4IBC A;  103L A;  1GBY A;  1LJ3 A;  1ZQ9 A;  4DWX A;  2DWZ B;  2D7G A;  4X66 M;  3D4S A;  3CT5 A;  4RW1 A;  3HU8 A;  5A3E A;  2BQM A;  1C45 A;  1CUK A;  2LHG A;  4NRV A;  1I56 A;  2W1M A;  4GCE A;  5IRE B;  2VII A;  5HQ1 A;  2YBH A;  1HML A;  3FYC A;  3QY4 A;  4W53 A;  1FNN A;  3VFD A;  4QNM A;  3RNX A;  4LT3 A;  5I54 A;  3TMU A;  2X4A A;  1IY1 A;  2OE9 X;  3HDE A;  4M0W A;  1N33 M;  1OUE A;  189L A;  4NGJ A;  2B6Y A;  1ZWN A;  1CUP A;  5M1Y A;  118L A;  3THG A;  1AM7 A;  5IZ7 D;  1QAQ A;  2VQF M;  3UZU A;  2DNA A;  174L A;  1NMM A;  4NSR A;  196L A;  4H91 A;  2F4A A;  4N0J A;  1YUB A;  3RGP A;  4B3T M;  4EPI A;  184L A;  1KW7 A;  4WMG A;  2KDL A;  4YEN A;  3A91 A;  1FKQ A;  1T8G A;  145L A;  3F9L A;  1J1X Y;  4MGZ E;  1L92 A;  2LVN C;  2LVO C;  1R7R A;  1OKS A;  3EML A;  2C98 A;  3WHL A;  4TUW A;  163L A;  2IFF Y;  3FRI A;  4M4O A;  2I26 L;  1UA6 Y;  2F4V M;  2FBD A;  1XHB A;  1B7S A;  3SB7 A;  4H9C A;  1D6Q A;  1LYE A;  1L2C A;  4EKS A;  2YBI A;  3LYZ A;  1HT1 E;  2M5Z A;  1Q3C A;  1G71 A;  4TTD A;  1TF0 B;  1CV6 A;  2HEA A;  1OUJ A;  1YRO A;  2B73 A;  1WTN A;  4K0K M;  3U6S A;  1YE9 A;  3WU8 A;  4X3B A;  5B1F A;  2ANX A;  1XGR C;  1KW5 A;  3CSQ A;  2DAG A;  3CQL A;  6LZM A;  1FKV A;  2APL A;  4NG8 A;  4ET9 A;  5J7C A;  5ITR A;  1L01 A;  153L A;  2KNA A;  2W1L A;  1IP6 A;  1L88 A;  2LH0 A;  4LFC M;  1L91 A;  4NEB A;  5FEK A;  4UN2 B;  3HBH A;  3W6D A;  4RLM A;  2UUC M;  3FUT A;  4KOD A;  1VAU A;  187L A;  1OAO C;  1OV5 A;  3HWS A;  1NHB A;  4BS7 A;  2MED A;  3B0I A;  1DKJ A;  2I7P A;  3CB7 A;  1L1Z A;  1JTT L;  3WH1 A;  2QPA A;  2H5X A;  3G3A B;  4RDS A;  1MEL L;  1LZC A;  3RW8 A;  1EFU B;  2NQ8 C;  2QB0 B;  4NGK A;  4CFO A;  4H1P A;  1OIZ A;  4ARQ A;  1BWJ A;  1QT8 A;  4FCW A;  3G3X A;  4BAP A;  2JNH A;  4AG5 A;  1L29 A;  1P56 A;  5BPV A;  4DV2 M;  3V2W A;  4YHH M;  5ITQ A;  3HTB A;  2J5Y A;  2FFJ A;  3K9P A;  150L A;  3AJI B;  2H1R A;  1DPW A;  156L A;  1GKI A;  171L A;  2B75 A;  1D3J A;  3U6E A;  2O79 A;  110L A;  2EPE A;  3P68 A;  3C3D A;  3DZD A;  1L84 A;  1IR8 A;  1G0L A;  1AIP C;  1HEQ A;  1GXX A;  4EKQ A;  1LJI A;  3GRU A;  5DNY A;  4QNR A;  3E4R A;  3TWK A;  1L21 A;  4DQJ A;  1D9W A;  2MEF A;  1OWY A;  3J6K A;  3I4V A;  149L A;  1C6T A;  1L2D A;  4M6D A;  2G4P A;  1P7S A;  2F5N A;  4ARL A;  3WHK A;  1DYG A;  1DYD A;  4OVZ A;  250L A;  5F16 A;  2OOB A;  1IWY A;  5FTM A;  1A4V A;  1JKD A;  3R9X B;  1HNL A;  4AW4 A;  3UMM A;  4RF1 A;  1GBX A;  4G4N A;  2HED A;  1L09 A;  3GXK A;  3JAM S;  137L A;  2DQG Y;  1B5U A;  1DYC A;  256L A;  4PHI A;  2HKJ A;  3TE6 A;  2DAK A;  254L A;  1L35 A;  2JY8 A;  1L00 A;  3SAR A;  4MH0 E;  1L46 A;  1CX6 A;  3CDQ A;  1WGL A;  3AV0 A;  1OIP A;  1L26 A;  1DO2 A;  1D2Y A;  4KPM A;  4PRQ A;  5EP3 A;  1N75 A;  4KL7 A;  1L25 A;  2DWL A;  3DN0 A;  200L A;  1LYF A;  1FLQ A;  4I8S A;  4I0C A;  3T38 A;  5FCP A;  1DGG A;  3PBL A;  4NGI A;  4XGI A;  3WPK A;  3GUO A;  1GF6 A;  1D2N A;  2HCB A;  1XXH B;  2ZTC A;  1L33 A;  1WQP A;  1IWT A;  4PT5 A;  1NDM C;  2LYM A;  4DQ7 A;  3A42 A;  1N78 A;  235L A;  1QQY A;  4M9X A;  1JIY A;  1L28 A;  3ULR A;  4RKU F;  1IN8 A;  5KKJ A;  4WO6 A;  4PDI A;  1GE4 A;  3LZT A;  5KXO A;  1L17 A;  3GP1 A;  2QBY A;  4KHP M;  4YF2 A;  4F2L A;  1G41 A;  3B7Z A;  1OVJ A;  1Z55 A;  1ZMY L;  4DR2 M;  3U6D A;  3A6B Y;  2VF8 A;  2V1C A;  1SXJ D;  5C6L A;  4UWV A;  4I7K A;  3B6L A;  1QVR A;  3C7Z A;  1UM8 A;  1V7T A;  3LYM A;  1N36 M;  2R0I A;  4TUN A;  1DI5 A;  1UC0 A;  1TGU A;  3VK7 A;  4U3X B;  2ZQ4 A;  1IY4 A;  1G4A E;  4Z8X A;  1IBL M;  3WUA A;  3RE8 A;  4DDC A;  4Z41 A;  2HEC A;  3LZM A;  132L A;  3DMZ A;  2BQH A;  4AI6 A;  1C6F A;  1GE2 A;  4RLN A;  3MMP A;  4XJB A;  3GLI A;  3HH5 A;  1I20 A;  1L38 A;  4IBF A;  3AW7 A;  2BQJ A;  3VKG A;  2DZL A;  2R46 A;  1LI2 A;  3T15 A;  2BWE A;  3HU1 A;  1GDW A;  4LZT A;  1NHG C;  1FLW A;  1NV8 A;  4DR4 M;  5KQD A;  3G3V A;  2O01 F;  2Z3X A;  3KXE C;  146L A;  4IIW A;  1L13 A;  5KXM A;  1AUA A;  2CV1 A;  4HTK A;  4N1C C;  5FTL A;  3J27 B;  4J1A A;  1BHZ A;  4DD7 A;  4REZ A;  2LC9 A;  1D3F A;  3FUW A;  3B9P A;  2L2D A;  4ZFP A;  4W5W A;  1G0K A;  1GF4 A;  2D4I A;  3KAM A;  2BPU A;  1L74 A;  1L15 A;  4AKG A;  231L A;  4P17 A;  2C9O A;  3P64 A;  3CT1 A;  3GXR A;  1HR0 M;  1LSY A;  1T3T A;  4B7F A;  1D0M A;  3AGI A;  4I7S A;  1L10 A;  226L A;  1QT3 A;  1DGF A;  1LSE A;  3DN1 A;  1LJJ A;  4PJZ A;  3C3E A;  1TH2 A;  3KOX E;  5LIN A;  5HMV A;  4X62 M;  169L A;  4IJE A;  1AT6 A;  3IJU A;  1LPY A;  1OUB A;  2BQD A;  1L06 A;  1B7O A;  4DV7 M;  2B72 A;  3B7Q A;  3I04 M;  1NNU C;  1JIS A;  2RBO A;  1T6V L;  178L A;  1IIZ A;  5B07 A;  4AXT A;  128L A;  3OTO M;  238L A;  5KXZ A;  5DLA A;  1GAY A;  3BKV A;  1GFR A;  2UU9 M;  1T43 A;  1C10 A;  4MCK A;  2M60 A;  1R4G A;  1WQO A;  3FUV A;  3SMS A;  1C69 A;  4PGJ B;  3L26 A;  1T8A A;  1GB2 A;  2CHQ A;  4M0D A;  4XN6 A;  3ZVQ A;  3SB9 A;  229L A;  3VKH A;  261L A;  1L99 A;  1DYB A;  1LYD A;  1LV7 A;  4LF6 M;  1BGI A;  3SHG B;  2OE7 X;  1REM A;  166L A;  1LGX A;  2A5Y B;  4IBG A;  2OU9 A;  1L60 A;  4LFA M;  104L A;  1KNI A;  1C6G A;  1C6Q A;  1XJU A;  2KW0 A;  1C08 C;  1NWG A;  1IN7 A;  1CV1 A;  1IWX A;  2R6F A;  5I4X A;  5LVG A;  3L2A A;  1LZN A;  1OQM A;  4I7J A;  1LPI A;  3SBB C;  2CFO A;  1C68 A;  3SBA A;  2RB0 X;  3CT0 A;  1HNX M;  2A7F A;  1ZMV A;  1YIK A;  182L A;  2ZIK A;  1OJL A;  4EPF A;  4D82 A;  3HU2 A;  2C5R A;  4NWE A;  1CVK A;  1IVM A;  2LXE A;  1L40 A;  3WUN A;  1CUQ A;  2FYD A;  4I7T A;  4FD2 A;  2ZAO A;  1C6N A;  5EP4 A;  4OVZ B;  206L A;  5L3I A;  1IY0 A;  3AOE C;  115L A;  2XTH A;  2I6Z A;  4RNA A;  1QTC A;  3NY8 A;  1VEJ A;  1PJQ A;  1G0J A;  1VDL A;  4W52 A;  5EXS A;  3GPX A;  2DQI Y;  4GN4 A;  1E9R A;  4QEQ A;  1L87 A;  3HH4 A;  2DWN A;  5AMY A;  4WP2 A;  2EA0 A;  4OWE A;  5JEN B;  1OP9 B;  1QDR A;  3TXE A;  2R65 A;  3SB6 A;  2QCU A;  1IP5 A;  1CNS A;  1L58 A;  1ZUR A;  3EO5 A;  1MX0 A;  2LWX A;  4DV6 M;  5L3H A;  1Z6T A;  211L A;  133L A;  1YAO A;  1L76 A;  5HMJ A;  2H9K A;  5E6J A;  152L A;  2C9C A;  2WZJ A;  3AKZ A;  1D3M A;  4M9Z A;  1T97 A;  3WXT A;  1LSZ A;  4EKR A;  2JY7 A;  5EJC A;  1K82 A;  172L A;  3WU9 A;  3IHP A;  5FLX S;  1J1P Y;  1W6Z A;  3QAU A;  1L67 A;  2ANV A;  2HTX A;  1DV0 A;  2H9J A;  2HUK A;  112L A;  1LHH A;  1OTR A;  4DD9 A;  2FNA A;  141L A;  3ZH9 B;  3U6Q A;  1NNJ A;  3D8B A;  207L A;  3NBI A;  2OU0 X;  1L72 A;  239L A;  5LZM A;  1XEJ A;  1HFY A;  3TMV A;  1G59 A;  4XK8 F;  3WL2 A;  1LCN A;  4LJ8 A;  1JKC A;  2YBN A;  1LI3 A;  4CIS A;  1B7L A;  3WXU A;  188L A;  4H8X A;  1L07 A;  2FOI C;  2LHC A;  1CX7 A;  2YDG A;  1F6S A;  3A46 A;  2DKL A;  1AT5 A;  2UUB M;  1IOT A;  1YAQ A;  5KXK A;  3B0K A;  1WQQ A;  4NSG A;  4ET8 A;  2EJS A;  1K28 A;  1GFG A;  1SXJ B;  3TWL A;  2GV0 A;  2LYZ A;  1RJC B;  3HTF A;  3W6E A;  4W96 A;  1OUC A;  3G3B B;  4GLA A;  1XC8 A;  4XJF A;  1L49 A;  5F9X A;  1LSM A;  1LSP A;  4B3M M;  2AHM A;  3GUN A;  1WR1 B;  4LF8 M;  2BQI A;  3TL4 X;  4KT3 A;  2RGO A;  4LGK A;  5I4W A;  1A2Y C;  1OUA A;  2BAA A;  3PFI A;  1QTD A;  1VEG A;  4NRW A;  109L A;  1QTE A;  2MEB A;  3OE8 A;  4WLT A;  1YKY X;  4NG1 A;  2FE8 A;  5FDJ A;  2QBY B;  1L83 A;  3FI5 A;  3CF0 A;  4AQY M;  3J2P B;  4GC5 A;  4NFV A;  1HFX A;  4WG7 A;  1EIJ A;  4YY3 M;  3JR6 A;  5BR8 M;  2G8L A;  4NC6 A;  3T1Y M;  4UWN A;  3CTW B;  5APE A;  2LTU A;  2I7N A;  4ARQ B;  131L A;  4LZZ A;  2VQE M;  3U5Z B;  1CV5 A;  5DYI A;  4DAJ A;  3MGW A;  2DQF C;  1KY1 A;  4LYZ A;  3W0L B;  1PQD A;  1L44 A;  3FTE A;  140L A;  2RRU A;  1N34 M;  158L A;  4NHP A;  3DN3 A;  1B7N A;  3ATO A;  186L A;  3N9A A;  1B7Q A;  2MGW A;  1XJT A;  4DDA A;  4Z3M A;  217L A;  1L51 A;  1IBM M;  1HFZ A;  4WL6 A;  1GFU A;  2DAM A;  3DMV A;  1EL1 A;  4FW9 A;  3LN2 A;  2QP9 X;  3FTF A;  1LHJ A;  4OOT A;  3M0E A;  2RAY X;  5LMN M;  4MGI E;  216L A;  4WLD A;  4JI8 M;  3HH6 A;  4LYO A;  1QT5 A;  1GBS A;  2ZWB A;  1ZAE A;  3GUJ A;  246L A;  3GLF E;  2XZU A;  3LW5 F;  154L A;  1D6P A;  1QAM A;  1O23 A;  5IHG A;  4H9F A;  5I53 A;  1X37 A;  2LYO A;  5HNC A;  176L A;  4L4U A;  1G06 A;  1QTB A;  2Y20 A;  3HJQ A;  2X0A A;  2CDS A;  1LSC A;  4DD0 A;  1LKR A;  2FS1 A;  3MJ5 A;  1G7I C;  1SSW A;  4CFP A;  4NHQ A;  1P2R A;  1G1W A;  1FDL Y;  1V7S A;  1GWD A;  3ZVQ B;  4LZJ A;  3AOG A;  2DKV A;  4BLC A;  1GEV A;  259L A;  1GB6 A;  3FAD A;  4N9R A;  3GLG A;  4GRV A;  3N9E A;  1E8L A;  1HEL A;  2Z4R A;  4HV2 A;  3TXG A;  1BWI A;  5KPR A;  2EIZ C;  4DKL A;  2YR0 A;  4NSH A;  1HEN A;  1NHW C;  4LRS A;  1L0J A;  3ZC7 B;  2G5G X;  3C83 A;  3QWL A;  2X49 A;  1F4I A;  2BQE A;  1GFV A;  1LSG A;  5KXW A;  2L4E A;  1DYF A;  1L54 A;  3HUQ A;  1BB5 A;  4DV0 M;  3W0F A;  4D9Z A;  2DEN A;  1NO1 A;  1PGY A;  2BQL A;  1G0G A;  1HJP A;  4JI3 M;  4N1E I;  1E94 E;  1RU3 A;  3G3W A;  1D9U A;  1GFE A;  4I7M A;  2RAZ X;  1S3S A;  4W59 A;  4FWH A;  234L A;  3HTD A;  2F30 A;  1ALC A;  1QUG A;  4LDL A;  1L95 A;  247L A;  1WXQ A;  1GF3 A;  1I1Z A;  1B5Z A;  1LZ6 A;  3M18 B;  5IEL A;  1GJS A;  1W5T A;  3ZEK A;  5LA5 A;  1SWY A;  1EPY A;  5JI2 E;  1YL0 X;  2KXE A;  1LMN A;  4BAD A;  1OUH A;  3HWL A;  1HHL A;  1B5V A;  4AZF A;  4WO9 A;  1QTK A; 
#chains in the Genus database with same CATH homology
 9LYZ A;  4B49 A;  1YAM A;  5LVK A;  1L77 A;  5LYZ A;  4LT0 A;  1UID A;  4WM2 A;  1GE1 A;  151L A;  1LYG A;  5KXN A;  1LZ1 A;  218L A;  3TXK A;  1JKB A;  4HP0 A;  3TXD A;  1JHL A;  4AGA A;  3EMS A;  1B6I A;  4OO9 A;  1NKH A;  1TLA A;  4QGZ A;  4DQ5 A;  198L A;  4B4E A;  2BQF A;  2RBQ A;  1LSD A;  4HTN A;  1C6J A;  3AW6 A;  1UUZ C;  1B5X A;  2OE4 X;  1LZA A;  1L16 A;  3VWO A;  3WUL A;  4HTQ A;  4IJ4 A;  3WVY A;  4CHX A;  1LZY A;  1GFK A;  1GAZ A;  223L A;  1L05 A;  5B59 A;  1GB3 A;  3OK0 A;  1QT4 A;  2ZQ3 A;  1C6I A;  4LDO A;  1QIO A;  4XAD A;  1MLC E;  4W57 A;  3WVX A;  8LYZ A;  3GUL A;  3A3R X;  3OE6 A;  113L A;  3HUK A;  4G9S A;  1L14 A;  1C66 A;  5APD A;  126L A;  1L63 A;  4ARM B;  1DI3 A;  2B6Z A;  2D4K A;  2NTH A;  4PPO A;  1C6P A;  135L A;  3FI7 A;  1XEK A;  3AZ7 A;  3B0O A;  1L27 A;  4YOP A;  4TX7 A;  1L43 A;  4QY9 A;  4W94 A;  1LZS A;  5E4P A;  1GFT A;  237L A;  1LZG A;  1L0K A;  4G4C A;  4W54 A;  253L A;  4E3U A;  220L A;  3DN6 A;  2ZNW Y;  1CU3 A;  1L41 A;  1LHI A;  1VDQ A;  1HEO A;  2ZIL A;  3GUM A;  4WG1 A;  249L A;  1P2C C;  2BQC A;  3BKH A;  2NWD X;  5DN5 A;  2DQH Y;  1C6B A;  4L41 A;  1PS5 A;  1G7L C;  4EXM A;  3A3Q A;  4H93 A;  130L A;  4DD3 A;  190L A;  1LJH A;  1VAT A;  4S0W A;  120L A;  4TWS A;  2HEE A;  3LYT A;  1IC7 Y;  119L A;  3HUA A;  1IR7 A;  1L56 A;  3GUI A;  1CKF A;  4B4J A;  2BQB A;  1FLY A;  4QDN A;  4NGO A;  1CKG A;  244L A;  4ETE A;  1HEP A;  5ILC A;  1UBZ A;  3UON A;  5LYT A;  1EQE A;  108L A;  1L70 A;  1CJ6 A;  4IAT A;  5A3Z A;  1VED A;  2I25 L;  5K7O A;  3CDT A;  1L98 A;  1QS9 A;  1JKA A;  5LVJ A;  2Q0M X;  3AGH A;  4PRU A;  1JTP L;  1XEI A;  4YM8 A;  214L A;  3WW5 A;  2Z2E A;  162L A;  1QTH A;  1YKX X;  4AQN A;  4LZM A;  168L A;  123L A;  4EJ4 A;  3WPJ A;  2HEF A;  240L A;  1L30 A;  1NBZ C;  2RBP A;  4WM6 A;  1BB4 A;  4N8Z A;  4GBR B;  4LYC A;  4GN3 A;  4BAF A;  1IWW A;  1LWG A;  2B6T A;  1FLU A;  170L A;  165L A;  4HJV A;  1KXW A;  2B74 A;  5EBH A;  1JIT A;  1L80 A;  3DKE X;  3T6U A;  3A6C Y;  2WAR A;  3DN8 A;  2MEE A;  1L94 A;  2HUM A;  4H92 A;  1L12 A;  1UIA A;  1KXX A;  1LHM A;  4H9A A;  155L A;  4KXI A;  7LZM A;  1IP4 A;  1P3N A;  3P65 A;  3NYA A;  1LLH A;  2B70 A;  4FDY A;  1PQJ A;  1L18 A;  3HDF A;  4NHI A;  1L03 A;  5LIO A;  3C8S A;  4IAS A;  1CU5 A;  3RT5 X;  3W6A A;  5B06 A;  4G4H A;  1L23 A;  3DMX A;  2BQA A;  4YXA C;  2ZNX Y;  1WQR A;  1XFP L;  5APC A;  1G7M C;  1L22 A;  1IOC A;  2BQO A;  1D2W A;  1LJ4 A;  2F47 A;  1GHL A;  4ETD A;  1VFB C;  1JTN A;  4TSB A;  233L A;  1J1O Y;  3AGG G;  1NHE A;  3C8R A;  4O34 A;  3PDS A;  1L52 A;  1I6S A;  1LHL A;  1B7M A;  1C64 A;  1C62 A;  1P64 A;  161L A;  1VDS A;  3WW6 A;  5DL9 A;  1REY A;  1GDX A;  1XGP C;  3DNA A;  2Q9D A;  1D0K A;  1C61 A;  1B5W A;  4WM3 A;  1XSF A;  1GBW A;  1DYE A;  2CWI A;  1CV0 A;  1GB5 A;  4I7L A;  3QNG A;  2YBM A;  1L81 A;  1P5C A;  225L A;  4NGL A;  1QSA A;  122L A;  1WQN A;  1LYS A;  1P2L A;  2NTG A;  1ZVY B;  3WPL A;  3LHM A;  1LJG A;  1G0M A;  3TXH A;  195L A;  3TMW A;  2LCB A;  142L A;  3FE0 A;  2RSC A;  2OU8 A;  5LVI A;  4NHS A;  3C82 A;  5KKI A;  3J4G A;  5B1G A;  4DJH A;  1QUS A;  2FBB A;  2XBS A;  2IGC A;  1L42 A;  4H9I A;  1IWZ A;  1G7J C;  1PQI A;  1L34 A;  1GD6 A;  1C67 A;  102L A;  4LFP A;  1LYO A;  2D4J A;  4J0L A;  3D9A C;  1L37 A;  1B7P A;  4W55 A;  2EKS C;  4GCC A;  5KXT A;  181L A;  192L A;  1DPX A;  1L71 A;  3SB5 A;  4ETC A;  4R6C A;  5KXL A;  191L A;  241L A;  3ATN A;  5LVH A;  1KIR C;  4PK0 A;  2O4W A;  1QTZ A;  3V2Y A;  4ZEE A;  4B0D A;  1QSB A;  3RUN A;  134L A;  1IOS A;  1TBY A;  4I7Q A;  4Z98 A;  1SX2 A;  4XJG A;  4I7N A;  1LI6 A;  144L A;  1G0Q A;  4WM1 A;  260L A;  3CSR A;  1GF9 A;  1B0D A;  1QSQ A;  1DKK A;  5KXP A;  1PQK A;  2B7X A;  5LYM A;  5APF A;  1YIL A;  2CGI A;  5LXW A;  1GF8 A;  4WOA A;  4PJ2 C;  3L64 A;  1HSX A;  1B5Y A;  129L A;  5ILF A;  5HLL A;  114L A;  4XYY A;  2RBR A;  3WYH A;  2C8O A;  4HJZ A;  1UAC Y;  1B2K A;  4NGW A;  5F9U A;  1GFH A;  230L A;  4DT3 A;  3WU7 A;  1N4F A;  3HTG A;  2LZT A;  1QSW A;  5IDD A;  1HC0 A;  4H8Y A;  5F81 A;  3W6C A;  3C80 A;  2RBS A;  1REX A;  2Q9E A;  1H6M A;  2F2N A;  1L19 A;  4NGY A;  3C7W A;  2VB1 A;  1JSF A;  1SQ2 L;  3HFM Y;  1C6E A;  3FA0 A;  3W6B A;  1SSY A;  1LZT A;  1LYZ A;  5T3F A;  245L A;  1GF7 A;  1QUH A;  2YVB A;  159L A;  219L A;  2DQJ Y;  3CDO A;  1GB9 A;  1IP3 A;  1C6A A;  2ZYP A;  1IP7 A;  1LMC A;  139L A;  4RW2 A;  3B72 A;  2BLY A;  2HU3 A;  4ARP A;  5I14 A;  5KJ9 A;  1L24 A;  1CTW A;  4HPE A;  3SN6 R;  4II8 A;  4I7P A;  1EQ5 A;  4NSJ A;  1LYY A;  2PC2 A;  1L20 A;  177L A;  3A90 A;  3HT7 A;  2OTZ X;  1L31 A;  4G4B A;  2FYC A;  4OWC A;  4W51 A;  1LJF A;  243L A;  242L A;  147L A;  1JQU A;  1B7R A;  2ZIJ A;  2A4T A;  4N5R A;  1IR9 A;  4HJY A;  3AYQ A;  1C6M A;  1NBY C;  1LOZ A;  1TEW A;  2MEH A;  4MR1 A;  1QT7 A;  2G4Q A;  3GUK A;  1UCO A;  4MST A;  2B6W A;  1SX7 A;  4WL7 A;  4LYT A;  6LYT A;  1IWU A;  1SWZ A;  210L A;  1LZD A;  1QUO A;  4NGV A;  1GBZ A;  111L A;  1CJ9 A;  2BQG A;  221L A;  4LT2 A;  1JJ0 A;  3SP3 A;  3NY9 A;  1JUG A;  4FJR A;  1TDY A;  3TXF A;  167L A;  2F32 A;  1LGW A;  1IOR A;  1G7H C;  4HSF A;  1JWR A;  5FST A;  1KS3 A;  1IEE A;  3HT6 A;  4LDE A;  4A7D A;  1L89 A;  3A95 A;  5C6J A;  3HH3 A;  3WUM A;  3LZ2 A;  222L A;  2L78 A;  2N5Z A;  4WM4 A;  194L A;  1HER A;  3CDV A;  1BWH A;  148L E;  3AB6 A;  1LJE A;  1L85 A;  160L A;  201L A;  107L A;  1WTM A;  1UIC A;  4Z46 A;  3C7Y A;  1CV3 A;  1GB0 A;  4GN5 C;  3IWR A;  2D6B A;  4UWU A;  3OE9 A;  2Z19 A;  1L47 A;  1SLY A;  215L A;  1L39 A;  212L A;  180L A;  3HT8 A;  4G49 A;  232L A;  2Z2F A;  1GE3 A;  1F10 A;  4CJ2 A;  1L55 A;  2B6X A;  4WM5 A;  1AKI A;  4DDB A;  3A93 A;  2DQE Y;  1RCM A;  4NWH A;  1YKZ X;  1LHK A;  1QUT A;  2AUB A;  5I4Y A;  2DQC Y;  4HPI A;  1BQL Y;  6LYZ A;  4I7O A;  1LZE A;  1XGQ C;  1P36 A;  2MEC A;  1LKS A;  2H5Z A;  1NDG C;  1L90 A;  3F8V A;  3OE0 A;  255L A;  1PQM A;  5C6I A;  3AZ4 A;  1LTM A;  1KY0 A;  1QS5 A;  1LSF A;  2HUB A;  3TMX A;  1CJ8 A;  251L A;  1JJ1 A;  1JPO A;  4YEM A;  262L A;  1IO5 A;  4ANR A;  1HMK A;  2HEB A;  2LHM A;  1P37 A;  5KXR A;  4C5F A;  4EMN A;  1LSN A;  197L A;  1P46 A;  2Z39 A;  4LT1 A;  1CKD A;  2DQA A;  1C43 A;  2C8P A;  1UIB A;  1TCY A;  3C8Q A;  4XJI A;  252L A;  3TXJ A;  3ODU A;  4ML7 A;  3A8Z A;  205L A;  1HEW A;  1LZ5 A;  4GCD A;  1GFJ A;  1C6H A;  2YBL A;  1CU2 A;  2Z38 A;  1CJ7 A;  2Z37 A;  1WVU A;  4XJD A;  4I7R A;  1L08 A;  4K5Y A;  1L96 A;  2W1Y A;  2OEA X;  1L64 A;  1LMO A;  4NY5 A;  4YX7 C;  1ZV5 L;  4EOF A;  1C65 A;  1LGU A;  2HUL A;  2Z12 A;  1OUD A;  4W58 A;  1IP2 A;  1GEZ A;  1CKH A;  1CKC A;  1LMA A;  1LZ8 A;  4H94 A;  1L65 A;  1XGT C;  1UIG A;  3HBD A;  3DN2 A;  1OUG A;  1BB3 A;  1YAN A;  4DD1 A;  2LZM A;  2Y8P A;  3RZE A;  1UIH A;  1YAP A;  3W6F A;  7LYZ A;  1L50 A;  3EBA B;  1LMQ A;  4ARJ A;  1W08 A;  1BVX A;  1GE0 A;  2QAR C;  1IC4 Y;  3K2R A;  1T6H A;  2DBT A;  2BQK A;  1OUF A;  1DI4 A;  1D3N A;  2RB1 X;  4H8Z A;  157L A;  4ETA A;  4B4I A;  1C63 A;  2IHL A;  1UIF A;  4H90 A;  2MEA A;  1WQM A;  1L32 A;  1WTH A;  227L A;  3F6Z A;  1HSW A;  1L53 A;  1ZYT A;  3DN4 A;  1FN5 A;  3D3D A;  3A67 Y;  1HEM A;  1GF0 A;  5B05 A;  1OUI A;  3HT9 A;  4E97 A;  5LA8 A;  1NF5 A;  1LJN A;  4P2E A;  1TAY A;  1QDT A;  1OWZ A;  4NSI A;  1L82 A;  5FHW A;  4HV1 A;  1G0P A;  1KIP C;  3GUP A;  1LAA A;  4H9E A;  4DC4 A;  1L66 A;  1JSE A;  185L A;  1LYH A;  1GF5 A;  1LMP A;  1LWK A;  4EKP A;  3SB8 A;  3A96 A;  143L A;  1UIE A;  3CDR A;  1GPQ C;  2YSS C;  5II3 A;  1JJ3 A;  4DYG A;  1L93 A;  2LZ2 A;  127L A;  1NQI A;  1JTM A;  1LMT A;  5LAG A;  1DYA A;  1L75 A;  1RE2 A;  1G1V A;  4XJH A;  1YL1 X;  1C60 A;  4W56 A;  1C46 A;  5D5F A;  3WMK A;  1BB6 A;  1IX0 A;  1LZB A;  1RFP A;  2MEI A;  2OTY X;  2XQO A;  1F0W A;  1DXJ A;  2BLX A;  3M3U A;  3AZ5 A;  3A92 A;  5E9R A;  1JEF A;  1XEP A;  4NIJ A;  1VDT A;  2XBR A;  248L A;  2EQL A;  5D5C A;  5KY1 A;  1DZB X;  4ETB A;  1IOQ A;  4YEO A;  1GB8 A;  5KXS A;  3E3D A;  4R0F A;  3K3T A;  1OVH A;  1LZR A;  3P66 A;  4YXC A;  1HF4 A;  1QT6 A;  1XGU C;  5KXX A;  3HBE X;  2MEG A;  1LZ4 A;  3AJN A;  175L A;  1AZF A;  258L A;  5L9J A;  2RB2 X;  4XEN A;  1CU0 A;  1FBI X;  1OYU A;  2BQN A;  4OW1 A;  3AZ6 A;  1L69 A;  5DM9 A;  3W3E A;  4WLX A;  1F6R A;  213L A;  1GB7 A;  2F2Q A;  3IJV A;  4J1B A;  2F4G A;  2Z6B A;  3TXB A;  1L73 A;  209L A;  236L A;  4DD2 A;  5FEL A;  2W1X A;  1REZ A;  2CUU A;  3LYO A;  1L62 A;  4GCF A;  1L59 A;  3A94 A;  1L36 A;  1T8F A;  1C6D A;  1C7P A;  1L79 A;  1KIQ C;  2HU1 A;  4NHT A;  1GBO A;  3T36 A;  3QE8 A;  1JTO L;  1IWV A;  3RZ4 A;  1LW9 A;  4OWA A;  4TSC A;  3N9C A;  1C6L A;  4GLV A;  224L A;  3VW7 A;  4ZIX A;  3A34 A;  1LZ9 A;  3TXI A;  2RH1 A;  164L A;  138L A;  4OWH A;  1ZVH L;  1L86 A;  1PZY A;  2G4N A;  3P4Z A;  2D91 A;  3HU9 A;  4LFX A;  1B9O A;  2O7A A;  4H9H A;  1GFA A;  1GXV 2;  1BB7 A;  2CJL A;  1KXY A;  4J7V A;  4ARM A;  4H9B A;  5DN4 A;  4CGE A;  1RI8 B;  4ZPU A;  3CSZ A;  1P6Y A;  1LSB A;  4IAP A;  193L A;  5HNL A;  3QAK A;  1L02 A;  1L97 A;  1T3P A;  1CV4 A;  3L2X A;  1OV7 A;  1G07 A;  1OVK A;  1EQ4 A;  1VDP A;  1L45 A;  1BVK C;  1PQO A;  1H87 A;  208L A;  4LYM A;  1L68 A;  1LSA A;  1QTV A;  4OWB A;  3RU5 A;  3EXD A;  4NGZ A;  3OJP A;  5LAF A;  1LYJ A;  2RBN A;  5I5Q A;  2Z18 A;  5F14 A;  1CU6 A;  1IP1 A;  1IY3 A;  4B1A A;  1D0L A;  199L A;  257L A;  1L61 A;  4C3W A;  4GCB A;  173L A;  1WVV A;  1LYI A;  4OOO A;  1L04 A;  2XJW A;  1C6K A;  1INU A;  1QUD A;  1L57 A;  4LYB A;  3C81 A;  1DQJ C;  1L48 A;  228L A;  1C6C A;  2A7D A;  1LJK A;  2B5Z A;  1YQV Y;  5KXY A;  2DQD Y;  1IC5 Y;  1L11 A;  2YBJ A;  2ZYC A;  4WLY A;  125L A;  183L A;  103L A;  1GBY A;  1LJ3 A;  4DWX A;  3D4S A;  3CT5 A;  4RW1 A;  3HU8 A;  5A3E A;  2BQM A;  1C45 A;  1I56 A;  2W1M A;  4GCE A;  5HQ1 A;  2YBH A;  4W53 A;  1HML A;  3QY4 A;  3RNX A;  4LT3 A;  5I54 A;  3TMU A;  2OE9 X;  3HDE A;  1OUE A;  189L A;  4NGJ A;  2B6Y A;  1ZWN A;  1CUP A;  5M1Y A;  118L A;  1AM7 A;  174L A;  1NMM A;  196L A;  4H91 A;  2F4A A;  4N0J A;  4EPI A;  184L A;  1KW7 A;  4WMG A;  4YEN A;  3A91 A;  1FKQ A;  1T8G A;  145L A;  3F9L A;  1J1X Y;  1L92 A;  3EML A;  163L A;  2IFF Y;  4M4O A;  2I26 L;  1UA6 Y;  2FBD A;  1B7S A;  3SB7 A;  4H9C A;  1D6Q A;  1LYE A;  4EKS A;  2YBI A;  3LYZ A;  4TTD A;  1CV6 A;  2HEA A;  1OUJ A;  1YRO A;  2B73 A;  1WTN A;  3WU8 A;  4X3B A;  5B1F A;  2ANX A;  1XGR C;  1KW5 A;  3CSQ A;  3CQL A;  6LZM A;  1FKV A;  4NG8 A;  4ET9 A;  5J7C A;  1L01 A;  153L A;  2W1L A;  1IP6 A;  1L88 A;  1L91 A;  4NEB A;  5FEK A;  3HBH A;  3W6D A;  4RLM A;  1VAU A;  187L A;  1OV5 A;  1NHB A;  4BS7 A;  2MED A;  3B0I A;  1DKJ A;  3CB7 A;  3WH1 A;  1JTT L;  3G3A B;  4RDS A;  1MEL L;  1LZC A;  3RW8 A;  2QB0 B;  4NGK A;  4CFO A;  4H1P A;  4ARQ A;  1BWJ A;  1QT8 A;  4BAP A;  3G3X A;  1L29 A;  1P56 A;  3V2W A;  3HTB A;  150L A;  1DPW A;  156L A;  171L A;  2B75 A;  1D3J A;  2O79 A;  110L A;  2EPE A;  3P68 A;  1L84 A;  1IR8 A;  1G0L A;  1HEQ A;  1GXX A;  4EKQ A;  1LJI A;  1L21 A;  4DQJ A;  1D9W A;  2MEF A;  1OWY A;  3J6K A;  149L A;  1C6T A;  4M6D A;  2G4P A;  1P7S A;  4ARL A;  1DYG A;  1DYD A;  250L A;  5F16 A;  1IWY A;  1A4V A;  1JKD A;  1HNL A;  1GBX A;  2HED A;  1L09 A;  3GXK A;  137L A;  2DQG Y;  1B5U A;  1DYC A;  256L A;  4PHI A;  254L A;  1L35 A;  1L00 A;  1L46 A;  1CX6 A;  3CDQ A;  1L26 A;  1D2Y A;  4PRQ A;  4KPM A;  4KL7 A;  1L25 A;  3DN0 A;  200L A;  1LYF A;  1FLQ A;  4I8S A;  4I0C A;  5FCP A;  3PBL A;  4NGI A;  3WPK A;  3GUO A;  1GF6 A;  1L33 A;  1WQP A;  1IWT A;  2LYM A;  1NDM C;  4DQ7 A;  235L A;  1QQY A;  1L28 A;  1JIY A;  3ULR A;  5KKJ A;  4WO6 A;  1GE4 A;  3LZT A;  5KXO A;  1L17 A;  4YF2 A;  1OVJ A;  1Z55 A;  1ZMY L;  3A6B Y;  5C6L A;  4UWV A;  4I7K A;  3B6L A;  3C7Z A;  1V7T A;  3LYM A;  4TUN A;  1DI5 A;  1UC0 A;  4U3X B;  2ZQ4 A;  1IY4 A;  3WUA A;  4DDC A;  4Z41 A;  2HEC A;  3LZM A;  132L A;  3DMZ A;  2BQH A;  1C6F A;  1GE2 A;  4RLN A;  4XJB A;  3HH5 A;  1I20 A;  1L38 A;  3AW7 A;  2BQJ A;  1LI2 A;  1GDW A;  4LZT A;  1FLW A;  3G3V A;  146L A;  1L13 A;  5KXM A;  4N1C C;  4HTK A;  4J1A A;  1BHZ A;  4DD7 A;  2LC9 A;  1D3F A;  4ZFP A;  1GF4 A;  1G0K A;  2D4I A;  3KAM A;  2BPU A;  1L74 A;  1L15 A;  231L A;  3P64 A;  3CT1 A;  3GXR A;  1LSY A;  1D0M A;  3AGI A;  4I7S A;  1L10 A;  226L A;  3DN1 A;  1LSE A;  1QT3 A;  1LJJ A;  4PJZ A;  5LIN A;  5HMV A;  169L A;  3IJU A;  1AT6 A;  1LPY A;  1OUB A;  2BQD A;  1L06 A;  1B7O A;  2B72 A;  1JIS A;  2RBO A;  1T6V L;  178L A;  1IIZ A;  5B07 A;  4AXT A;  128L A;  238L A;  5KXZ A;  5DLA A;  1GAY A;  3BKV A;  1GFR A;  1C10 A;  4MCK A;  1WQO A;  1C69 A;  4PGJ B;  1T8A A;  1GB2 A;  4XN6 A;  3ZVQ A;  3SB9 A;  229L A;  261L A;  1L99 A;  1DYB A;  1LYD A;  1BGI A;  2OE7 X;  1REM A;  166L A;  1LGX A;  2OU9 A;  1L60 A;  104L A;  1KNI A;  1C6G A;  1C6Q A;  1XJU A;  1C08 C;  1NWG A;  1CV1 A;  1IWX A;  5I4X A;  5LVG A;  1LZN A;  1OQM A;  4I7J A;  1LPI A;  3SBB C;  1C68 A;  3SBA A;  2RB0 X;  3CT0 A;  2A7F A;  1YIK A;  182L A;  2ZIK A;  4EPF A;  4NWE A;  1CVK A;  1IVM A;  1L40 A;  3WUN A;  1CUQ A;  2FYD A;  4I7T A;  1C6N A;  206L A;  5L3I A;  115L A;  2XTH A;  2I6Z A;  3NY8 A;  1QTC A;  1G0J A;  4W52 A;  2DQI Y;  4GN4 A;  4QEQ A;  1L87 A;  3HH4 A;  5AMY A;  4OWE A;  5JEN B;  1OP9 B;  1QDR A;  3TXE A;  3SB6 A;  1IP5 A;  1CNS A;  1L58 A;  1ZUR A;  3EO5 A;  5L3H A;  211L A;  133L A;  1YAO A;  1L76 A;  5HMJ A;  2H9K A;  152L A;  1T97 A;  1D3M A;  3WXT A;  1LSZ A;  4EKR A;  172L A;  3WU9 A;  1J1P Y;  1W6Z A;  1L67 A;  2ANV A;  2HTX A;  2H9J A;  2HUK A;  112L A;  1LHH A;  4DD9 A;  141L A;  207L A;  2OU0 X;  1L72 A;  239L A;  5LZM A;  1XEJ A;  1HFY A;  3TMV A;  3WL2 A;  1LCN A;  1JKC A;  2YBN A;  1LI3 A;  1B7L A;  3WXU A;  188L A;  4H8X A;  1L07 A;  1CX7 A;  2YDG A;  1F6S A;  1AT5 A;  1IOT A;  1YAQ A;  5KXK A;  3B0K A;  1WQQ A;  4NSG A;  4ET8 A;  1K28 A;  1GFG A;  2GV0 A;  2LYZ A;  1RJC B;  3HTF A;  3W6E A;  4W96 A;  1OUC A;  3G3B B;  4GLA A;  4XJF A;  1L49 A;  5F9X A;  1LSM A;  1LSP A;  3GUN A;  2BQI A;  4KT3 A;  4LGK A;  5I4W A;  1A2Y C;  1OUA A;  2BAA A;  1QTD A;  109L A;  1QTE A;  2MEB A;  3OE8 A;  4WLT A;  1YKY X;  4NG1 A;  5FDJ A;  3FI5 A;  1L83 A;  4NFV A;  1HFX A;  4WG7 A;  3JR6 A;  4UWN A;  5APE A;  4ARQ B;  131L A;  1CV5 A;  4DAJ A;  3MGW A;  2DQF C;  1KY1 A;  4LYZ A;  1PQD A;  1L44 A;  140L A;  4NHP A;  158L A;  3DN3 A;  1B7N A;  3ATO A;  186L A;  3N9A A;  1B7Q A;  4DDA A;  1XJT A;  4Z3M A;  217L A;  1L51 A;  1HFZ A;  4WL6 A;  1GFU A;  3DMV A;  1EL1 A;  3LN2 A;  1LHJ A;  4OOT A;  2RAY X;  216L A;  4WLD A;  3HH6 A;  4LYO A;  1QT5 A;  1GBS A;  2ZWB A;  3GUJ A;  246L A;  154L A;  1D6P A;  1O23 A;  5IHG A;  4H9F A;  5I53 A;  2LYO A;  5HNC A;  176L A;  1G06 A;  1QTB A;  2X0A A;  2CDS A;  1LSC A;  4DD0 A;  1LKR A;  1G7I C;  1SSW A;  4CFP A;  4NHQ A;  1P2R A;  1G1W A;  1FDL Y;  1V7S A;  1GWD A;  3ZVQ B;  2DKV A;  1GEV A;  259L A;  1GB6 A;  3FAD A;  4N9R A;  4GRV A;  3N9E A;  1E8L A;  1HEL A;  4HV2 A;  3TXG A;  1BWI A;  2EIZ C;  4DKL A;  4NSH A;  1HEN A;  1L0J A;  3C83 A;  2BQE A;  1GFV A;  1LSG A;  5KXW A;  1DYF A;  1L54 A;  3HUQ A;  1BB5 A;  4D9Z A;  2BQL A;  1G0G A;  4N1E I;  3G3W A;  1D9U A;  1GFE A;  4I7M A;  2RAZ X;  4W59 A;  234L A;  3HTD A;  2F30 A;  1ALC A;  1QUG A;  4LDL A;  1L95 A;  247L A;  1GF3 A;  1I1Z A;  1B5Z A;  1LZ6 A;  3M18 B;  5IEL A;  3ZEK A;  5LA5 A;  1SWY A;  1EPY A;  1YL0 X;  1LMN A;  4BAD A;  1OUH A;  3HWL A;  1HHL A;  1B5V A;  4WO9 A;  1QTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...