2UU9M

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2uu9M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2uu9M02
4LF9M 1L1ZA 3GPYA 3JAMS 2F5NA 1HNWM 2OQ4A 1L2DA 1I94M 5ITXE 4LF5M 5ITTA 1Q3BA 4ITQA 4NRWA 2F5PA 3SASA 1R2YA 3T1HM 2UUBM 4LF6M 4GKKM 2OPFA 1R2ZA 2E5LM 5ITYA 4DR7M 4JI6M 4G4QA 4DR2M 4DR1M 3C58A 1XMQM 4LFCM 1L2BA 4GKJM 1Q39A 4NXMM 4DV1M 5IWAM 4CISA 4OX9M 1N34M 4KHPM 3A42A 4JI8M 3J7AS 3SARA 1N33M 1IBMM 2ZM6M 4NRVA 2EA0A 2UUAM 3GQ3A 4MB7A 3U6SA 2UXBM 3GPXA 4JI2M 2F5OA 1XNRM 3GO8A 1KFVA 1N32M 3TWMA 2UUCM 4PCZA 4PD2A 5FLXS 3J80S 3U6QA 1TDZA 4JI4M 3GPUA 1K82A 1NNJA 2F4VM 3W0FA 4YHHM 1XMOM 3DOAA 3TWKA 4YY3M 3OTOM 1MX0A 1MU5A 3TWLA 1TDHA 1Z5CA 2HHHM 4DV3M 4JV5M 1PJIA 4X65M 4DV5M 2ZBKB 3GQ5A 1FJGM 4AQYM 3U6MA 4JI0M 1K3WA 2HKJA 3VK7A 1J5EM 4DR4M 1L1TA 4B3MM 3U6OA 3SAWA 3A45A 1EE8A 5ITXA 3U6PA 3GPPA 4DUYM 4JYAM 2UXCM 1IBKM 4DR5M 3T1YM 4LF4M 4LF8M 4B3SM 2F5QA 1Z5BA 3SAVA 4X66M 5ITQA 5LMUM 4DUZM 4NXNM 4G4OA 1XC8A 1L2CA 3U6DA 1Z5AA 5IT9S 1HR0M 4LFBM 4K0KM 4X62M 4JI1M 1PM5A 2UU9M 3A46A 2VQFM 3SAUA 3U6CA 1Z59A 5ITRA 1Q3CA 1N36M 3GP1A 3U6EA 3J81S 4DV4M 4G4RA 4DV2M 1XNQM 5A2QS 1HNXM 1HNZM 4B3RM 3U6LA 4DV6M 4LFAM 4PDGA 3SATA 4PDIA 5LMNM 4B3TM 2F5SA 4JI7M 2VQEM 1IBLM 4DR3M 1K3XA 4DV7M 3JR5A 4G4NA 3SBJA 3GQ4A 4JI5M 2Q2EB 3VK8A 3JR4A 2UXDM 4JI3M 4DR6M 2XZFA 5ITUA 4X64M 5BR8M 4LF7M 2XZUA 1PJJA 4DV0M
chains in the Genus database with same CATH superfamily
2NQ8C 2X4AA 4RNAA 1L8QA 3GLFB 1TH3A 3IG8A 1IM2A 3JAMS 1TF0B 3ZC7B 2OQ4A 2LXEA 4HLQA 3SYLA 4F2LA 2VDBB 3DFZA 3ZQJA 2K9DA 2CFOA 2OPFA 1OIPA 2ZTCA 5ITYA 4DR2M 3C58A 2DAIA 3GRVA 4NXMM 1XWIA 3FUUA 4Q7JA 3FUXA 3FTFA 4OX9M 4CISA 4CHTB 1NY5A 1R6BX 4LJAA 2JY8A 3A42A 3FE3A 1DGGA 1N33M 1DGBA 4M9ZA 1G4AE 2EKKA 2J7NA 5FTLA 2DHRA 3IG5A 1VQ1A 2WSCF 5E6JA 1ZQ9A 3GLIE 1QQWA 5EXXA 1D0LA 4LZJA 5DYIA 2R44A 3FTEA 2VF8A 2CP8A 2QNJA 5DYGA 3W0LB 1TDZA 4KT0F 2DXIA 4FWDA 1NO1A 4GIPA 3T15A 1G8PA 1OKSA 3UGJA 1T3TA 1GJSA 3AOEA 1XMOM 1SXJD 1PJSA 2DZNB 3DA1A 3TWKA 3TWLA 1VEJA 2HHHM 3KP0E 1XXHA 2K0BX 4DV5M 5KPTA 4ZPXA 2KZUA 4WP2A 3HX3A 4NL4H 2QZ4A 1L1TA 1XB2B 3SAWA 1SXJE 2YR0A 4IBBA 3LQQA 3U6PA 2Y0TA 3LCUA 4LJ7A 2KW0A 4Z8XA 2CV2A 4DR5M 2LTUA 1GJTA 4LF8M 2JUJA 2O01F 4M9SA 4AG5A 1MN3A 2DENA 4MGIE 4DUZM 3SAVA 1R7RA 1W5SA 5IT9S 1E32A 5FTMA 2DZOB 3SMPA 2QQ8A 4II7A 2BJVA 4MGHA 3UMMA 3DZDA 5EP4A 4GH9A 5EXPA 1Z59A 1N36M 1CUKA 3GP1A 3MHVC 1DO2A 1GKIA 4DV4M 1TGUA 1Z6TA 3U61A 2KDLA 1HNXM 2BJWA 4B3RM 1UFZA 3SATA 3L25A 2ZAOA 3KDSE 1GLNA 2QENA 2F5SA 4HEOA 1DGFA 2G8LA 3LQRA 3R8FA 3ILKA 3QWLA 2JY6B 3VLFB 2OOBA 1VG5A 2BNKA 2JY5A 2KXEA 3FTCA 3JR5A 2W82A 1T6OA 3HU3A 1G41A 3GQ4A 2LHGA 1ZAEA 1GL7A 2Q2EB 3HU2A 4FWGA 3THGA 1ZMWA 4LRSA 2L4EA 3JR4A 2UXDM 4MH0E 4PT5A 3B7ZA 4KO8A 3SHGB 1QUTA 1NJGA 4IBGA 3V76A 3SHFA 3HU1A 3C9PA 2ERCA 2Y21A 2CUZA 1HQYE 3W67A 2JXNA 1PJJA 1XXHE 1QANA 2LNHC 4B7GA 4LF9M 3GRRA 1L1ZA 3GLIA 4AG6A 2LH0A 3GPYA 1TR8A 1Q02A 1HNWM 2Z3XA 1L2DA 4AKHA 5ITTA 4NRWA 2Z4SA 4LF6M 3T1HM 5BPVA 4Y28F 3K8ZA 1R2ZA 1VEKA 2E5LM 3LVWA 1J09A 4LJ6A 3E21A 1WGNA 3GRUA 4JI6M 2DAMA 4DR7M 4DR1M 2I7PA 2R46A 3U5ZB 3MK6A 1QZEA 2CE7A 4Z6YA 1XMQM 1L2BA 4GKJM 1IFYA 1X37A 7CATA 3HJSA 3HJQA 3A98B 4QNMA 4IJFA 4DV1M 4QHTA 2C5RA 4KHPM 2QP9X 3HJ8A 3TQSA 3SARA 4FCVA 2QBYB 1JR3A 3HZJA 5C1BA 4MB7A 2D7HA 1WXQA 3BBZA 3AOEC 3I4VA 3FKEA 1OFHA 4R3DA 5FTNA 3GO8A 2F5OA 2QSFX 1XNRM 1N32M 3B7QA 2UUCM 4PCZA 3U6QA 2DVWB 3U60A 3J2PB 4RF1A 5IZ7D 3K9PA 5EQTA 4JN6A 2Z7JA 1IN7A 1NNJA 1I4WA 1N78A 4QNRA 3DOAA 1W5TA 4AZFA 1MX0A 1DGHA 4LRTA 3T38A 1QDRA 4R7GA 1OAOC 3AKZA 1Z5CA 2CEAA 4I8OA 4DV3M 3R9XB 4JV5M 3GLHA 3PFIA 4AI6A 2D7GA 2GNOA 5DNYA 2XFTA 5JI2E 4AQYM 1K3WA 3VK7A 1J5EM 4DR4M 3GRYA 3QYEA 2KNZA 4WURA 3U6OA 2Z4RA 3PXGA 3LCVB 5ITXA 2V1CA 3GPPA 1QYRA 2UXCM 2EKFA 4OVZA 4L78A 2XEPA 1IBKM 3KP1E 3GLGA 3HGIA 4GC9A 3I04M 3KVWA 1JB0F 1Z5BA 1L2CA 4G4OA 3CTWB 2R4EA 1HR0M 4LFBM 1NY6A 1PM5A 5EXSA 1SXJB 1Y8GA 1PJTA 2XGNA 2VQFM 3U6CA 5ITRA 2GQFA 2VIIA 3UZUA 4IBIA 4BB9A 4RKUF 3J81S 1IN6A 2CHVA 2CWBA 3RFWA 4G4RA 2DI0A 2KHHA 1QVRA 3K92A 1XNQM 3LW5F 2CHGA 5A2QS 4JXJA 2R6FA 1HNZM 3U6LA 4DV6M 2R18A 4LJ9A 2B3TA 5EP3A 2L4FA 1JR3E 3K2LA 2APLA 4PDIA 3VDUA 2EUCA 3HWSA 1QAMA 4OW0A 4JI7M 2VQEM 1VEGA 4XGIA 1IBLM 3H4JA 4QOSA 1K3XA 1UM8A 3NBXX 4JI5M 2HAKA 2AHMA 4GMQA 1LTMA 2VF7A 4MM3B 4IIWA 1N77A 2BWBA 2MGWA 2MROB 4L15A 3VDPA 3J7BA 4WW0A 4JI3M 4CIZA 4NOOB 2V1UA 2V6ZM 2XZFA 1XHBA 1IXSB 4X64M 1S3SA 2H5XA 1FNNA 1V34A 3GLHE 2RGOA 4XBOA 2DKLA 3I4YA 3T6PA 1SG9A 2O5RA 5E26A 1GABA 1HT1E 2F5NA 2K6BA 2DWNA 1R4GA 2KNVA 4IBDA 2YQZA 1QZMA 5ITXE 4LG2A 4QOZC 3I01M 4LY6A 1F4IA 2QPAA 2ZTDA 1R2YA 2F5PA 2L09A 3CGWA 3RGSA 2UUBM 3SASA 4TUWA 3AOGA 3GLGE 1G59A 1OFIA 1G3IA 2JNHA 4RF0A 2CV0A 1XXHB 2DAKA 4B7FA 2R0IA 2LVOC 4LFCM 1WGLA 1ZV1A 3W68A 4G6ZA 4GRIA 1Q39A 5FTKA 3SMSA 4LJ8A 4GHAA 3M0EA 5EXTA 3H4MA 1IY2A 4L16A 5IREB 1HT2E 1QAOA 3U5ZA 2C98A 3FUWA 1N34M 4JI8M 3J7AS 1J7KA 3CF0A 4AW4A 2MH8A 2MR9A 2KZSA 3HHZA 2QHOB 1IBMM 1HQCA 4NRVA 3E46A 3ZH9B 1T43A 3U6SA 2Y20A 3AJIB 2HCBA 2XSZA 3C3DA 3L29A 4LZZA 1V33A 4M0WA 2QBYA 3FRIA 4UN2B 3B74A 3MJ5A 3GLFA 5FLXS 3J80S 1C1KA 1D0KA 3C3EA 3GPUA 2X49A 2QCUA 3L27A 1NHGC 3Q8GA 1K82A 4ANRA 4P16A 3E9SA 5KPRA 2LHCA 3W0FA 4YHHM 2F4VM 3CF2A 1AIPC 1G71A 3OTOM 3FRHA 1QUSA 1NV9A 3ZCBB 3AL0C 1TDHA 1IN5A 3U61B 5EJCA 3VKHA 3IHPA 4X65M 1IY0A 2G3QA 3KXEC 4D81A 2ZBKB 2WZJA 3GQ5A 1PGYA 2KRUA 4BBAA 1KYIA 2Y0QA 4FWHA 1IN8A 2JP7A 3RGPA 2A5YB 2R4JA 2JA2A 1KSFX 1E9RA 2JZ0A 4FD2A 4DUYM 4JYAM 5FTJA 1NVMA 1OAIA 3Q8XA 4L6V6 2DWMA 4MGYE 3T1YM 2FS1A 3K1JA 4D80A 4B3SM 2F5QA 1NNUC 3SC3A 3HHXA 1PJQA 5LMUM 5ITQA 1ZMVA 4QHSA 1GL6A 4NXNM 1Z5AA 3D8BA 4X62M 4JI1M 1MJGM 2JWSA 1ORYB 3PVSA 1Q3CA 2DAGA 3NWLA 2KA6B 2KRKA 2RKOA 3GLIB 2XSZD 4B7HA 2N35A 4L4UA 2FNAA 2CRUA 2WSEF 4M9XA 4I81A 3HHWA 4B08A 4AKGA 1WJ7A 3KS4A 3PNVA 1VDLA 2XFSA 3I51A 2LBCA 1E9SA 4IBFA 2ZANA 4LFAM 4PDGA 2FOIC 1VDDA 3B9PA 4S12A 5KQ8A 5LMNM 2EO2A 3KSXA 1H6UA 2C96A 2HWJA 4DR3M 1OQYA 4GITA 3B89A 4IBKA 3GLFE 2J5YA 3BOSA 3SBJA 2H1RA 3VK8A 1YE9A 4IBCA 1IXZA 3HY5A 5FSWA 4DV7M 4NSOB 3SFZA 2RGHA 1C7YA 1JR3D 1YSYA 5L8RF 4NSRA 5KO3A 1DO0A 3QAUA 5F3WA 2X8AA 5BR8M 2O25A 1TH2A 3KOWE 3AFHA 2FH0A 1YLAA 1D2NA 3FYCA 3SYKA 4G3OA 4DV0M 3UJNA 3EIEA 1GVNA 3IECA 5JI3E 1IXSA 3KFUG 1OIZA 4A3VB 3U60B 4P17A 8CATA 1TH4A 2OOAA 2DAEA 3FTDA 3KW6A 1EFUB 4GEWA 1IQPA 3QYBA 1NV8A 1I94M 4LF5M 2DZLA 1Q3BA 4ITQA 1YUBA 5H37D 4GKKM 1JQJC 1DGHB 4LJ4A 1WHCA 1LV7A 3M7GA 5KQDA 3FD9A 3MMPA 2OO9A 3GLHB 4G4QA 4LCBA 1WIVA 1WR1B 5GKNA 1ZMUA 3L2AA 1EIJA 1P3QQ 4FCTA 5IWAM 2L2DA 2M60A 4XK8F 2R45A 2I7NA 2P5TA 3KSJA 4OVZB 2ZM6M 3TPZA 1IN4A 2K47A 3GLGB 2EA0A 2UUAM 3GQ3A 2YNMD 4NC6A 3TL4X 4IBJA 2UXBM 3VFDA 3GPXA 1N75A 4JI2M 2LVQD 4M0DA 1KFVA 2J7OA 3LMMA 4F1IA 3TWMA 2LVNC 4PD2A 1V92A 4JI4M 3B7NA 2R65A 2EJSA 3FYDA 3PNYA 4OU7A 2DNAA 3AV0A 1OJLA 1OTRA 4R71A 4YY3M 2CHQA 2LVAA 3D8LA 4FCWA 1MU5A 1IY1A 3KOXE 4HL4A 1E94E 4GC5A 4MGZE 1RU3A 2XF3A 1NSFA 1PJIA 2R62A 3L26A 4IJEA 1D0MA 1FJGM 3U6MA 4KODA 4JI0M 1R5LA 2HKJA 2KEBA 4FW9A 4B3MM 4LJ5A 4GHLA 2C9OA 1EE8A 3A45A 5C18A 3EIHA 1GO5A 2FFJA 1IXRC 4EIWA 3F92A 3L28A 1A5TA 4CJ6A 4DBGB 2JZ1A 2MJ5B 2C9CA 3CF6E 3HHYA 4LF4M 2XH9A 3BXWA 2LVPC 4AKIA 2KNAA 5DFLA 1HJPA 4X66M 1XC8A 2DWLA 3TE6A 1SXJC 3U6DA 4K0KM 2M5ZA 2L7HA 3UK6A 2UU9M 3A46A 2BWEA 5KPZA 3WHKA 4I4LA 2L7IA 3KOYE 3E4RA 2Z8YM 4I5SA 3SAUA 3VKGA 1TTEA 1DV0A 3U6EA 2DWZB 2L6OA 4W5WA 5EP1A 2XLJA 2CV1A 4LGMA 3FUTA 1PRBA 5EP2A 4D82A 4DV2M 4IBEA 3KS8A 2ZAMA 4REZA 4L8RC 2JY7A 1AUAA 4B3TM 3K9OA 3J27B 2D7EA 4MGKE 3KOZE 3LVVA 2YFQA 4FVMA 2RRUA 4LGYA 3WHLA 4CGYB 2WSFF 1NJFA 4BLCA 4G4NA 3RE8A 2DHYA 3NBIA 2FE8A 1NHWC 2G5GX 4KLNA 2HL7A 1QAQA 4DR6M 5ITUA 1SXJA 4LF7M 1BVSA 2C99A 2XZUA 3FUVA 1QDTA 3M6AA 3HKPA 2LWXA
chains in the Genus database with same CATH topology
2NQ8C 2X4AA 4RNAA 1L8QA 3GLFB 1TH3A 3IG8A 1IM2A 3JAMS 3ZC7B 2OQ4A 2LXEA 4HLQA 3SYLA 3DFZA 2CFOA 2OPFA 5ITYA 4DR2M 3C58A 3GRVA 4NXMM 1XWIA 3FUUA 3FTFA 3FUXA 4OX9M 4CISA 4CHTB 1NY5A 1R6BX 4LJAA 3A42A 1DGGA 1N33M 1DGBA 4M9ZA 1G4AE 2J7NA 5FTLA 2DHRA 3IG5A 5E6JA 1ZQ9A 1QQWA 5EXXA 5DYIA 4LZJA 3FTEA 5DYGA 3W0LB 1TDZA 2DXIA 4FWDA 3T15A 4GIPA 1G8PA 3UGJA 1T3TA 3AOEA 1XMOM 1SXJD 2DZNB 3DA1A 3TWKA 3TWLA 2HHHM 3KP0E 1XXHA 4DV5M 5KPTA 4ZPXA 2KZUA 4NL4H 2QZ4A 1L1TA 3SAWA 1SXJE 2YR0A 4IBBA 3LQQA 3U6PA 2Y0TA 4LJ7A 2KW0A 4Z8XA 2CV2A 4DR5M 4LF8M 4M9SA 4AG5A 3SAVA 4MGIE 4DUZM 1R7RA 1W5SA 5IT9S 1E32A 5FTMA 2DZOB 3SMPA 4II7A 2BJVA 4MGHA 3UMMA 3DZDA 5EP4A 4GH9A 5EXPA 1Z59A 1N36M 3GP1A 3MHVC 1DO2A 1GKIA 4DV4M 1TGUA 1Z6TA 3U61A 1HNXM 2BJWA 4B3RM 3SATA 3L25A 2ZAOA 3KDSE 1GLNA 2QENA 2F5SA 1DGFA 2G8LA 3LQRA 3R8FA 3ILKA 3QWLA 3VLFB 4DV7M 3FTCA 2BNKA 2KXEA 3JR5A 2W82A 3HU3A 1G41A 3GQ4A 1ZAEA 1GL7A 2Q2EB 3HU2A 4FWGA 3THGA 4LRSA 3JR4A 2UXDM 4MH0E 4PT5A 4KO8A 3SHGB 1NJGA 4IBGA 3SHFA 3HU1A 2ERCA 2Y21A 2CUZA 1HQYE 1PJJA 1QANA 2LNHC 4B7GA 4LF9M 3GRRA 1L1ZA 3GLIA 4AG6A 2LH0A 3GPYA 1HNWM 2Z3XA 1L2DA 4AKHA 5ITTA 4NRWA 2Z4SA 4LF6M 3T1HM 5BPVA 3K8ZA 1R2ZA 2E5LM 3LVWA 1J09A 4LJ6A 4DR7M 3GRUA 4JI6M 4DR1M 2I7PA 2R46A 3U5ZB 3MK6A 2CE7A 4Z6YA 1XMQM 1L2BA 4GKJM 1X37A 7CATA 3HJSA 3HJQA 3A98B 4QNMA 4IJFA 4DV1M 4QHTA 2C5RA 4KHPM 2QP9X 3HJ8A 3TQSA 3SARA 4FCVA 2QBYB 1JR3A 5C1BA 4MB7A 2D7HA 1WXQA 3AOEC 3I4VA 3FKEA 1OFHA 4R3DA 5FTNA 3GO8A 2F5OA 1XNRM 1N32M 2UUCM 4PCZA 3U6QA 2DVWB 3U60A 3J2PB 4RF1A 5IZ7D 5EQTA 4JN6A 2Z7JA 1IN7A 1NNJA 1I4WA 1N78A 4QNRA 3DOAA 1W5TA 4AZFA 1MX0A 1DGHA 4LRTA 3T38A 4R7GA 3AKZA 1Z5CA 2CEAA 4I8OA 4DV3M 3R9XB 4JV5M 3GLHA 3PFIA 4AI6A 2D7GA 5DNYA 2XFTA 5JI2E 4AQYM 1K3WA 3VK7A 1J5EM 4DR4M 3GRYA 3U6OA 4WURA 2Z4RA 3PXGA 5ITXA 2V1CA 3GPPA 1QYRA 2UXCM 4OVZA 4L78A 2XEPA 1IBKM 3KP1E 3GLGA 3HGIA 4GC9A 3KVWA 1Z5BA 1L2CA 4G4OA 3CTWB 2R4EA 1HR0M 4LFBM 1NY6A 1PM5A 5EXSA 1SXJB 2XGNA 2VQFM 3U6CA 5ITRA 2VIIA 3UZUA 4IBIA 4BB9A 3J81S 1IN6A 2CHVA 3RFWA 4G4RA 3K92A 1QVRA 1XNQM 2CHGA 5A2QS 4JXJA 1HNZM 3U6LA 4DV6M 2R18A 4LJ9A 5EP3A 3K2LA 4PDIA 3VDUA 2EUCA 3HWSA 1QAMA 4OW0A 4JI7M 2VQEM 1IBLM 4XGIA 4QOSA 1K3XA 1UM8A 4JI5M 2AHMA 4GMQA 4MM3B 4IIWA 1N77A 3VDPA 4L15A 2V1UA 3J7BA 4WW0A 4JI3M 4NOOB 2V6ZM 2XZFA 1XHBA 1IXSB 4X64M 1S3SA 1FNNA 2RGOA 4XBOA 3I4YA 2O5RA 5E26A 1HT1E 2F5NA 2DWNA 4IBDA 2YQZA 1QZMA 5ITXE 4LG2A 4QOZC 4LY6A 2QPAA 2F5PA 1R2YA 2UUBM 2L09A 3RGSA 3SASA 4TUWA 3AOGA 1G59A 1OFIA 1G3IA 4RF0A 2CV0A 1XXHB 4B7FA 4LFCM 4G6ZA 4GRIA 1Q39A 5FTKA 3SMSA 4LJ8A 4GHAA 3M0EA 5EXTA 3H4MA 1IY2A 4L16A 5IREB 1HT2E 1QAOA 3U5ZA 2C98A 3FUWA 1N34M 4JI8M 3J7AS 1J7KA 3CF0A 4AW4A 1IBMM 2KZSA 3HHZA 1HQCA 4NRVA 3ZH9B 3U6SA 2Y20A 3AJIB 2HCBA 2XSZA 3L29A 4LZZA 4M0WA 2QBYA 3MJ5A 3GLFA 5FLXS 3J80S 1C1KA 3GPUA 2X49A 2QCUA 3L27A 1NHGC 1K82A 4P16A 3E9SA 5KPRA 3W0FA 4YHHM 2F4VM 3CF2A 3OTOM 3ZCBB 3AL0C 1TDHA 1IN5A 3U61B 5EJCA 3VKHA 4X65M 1IY0A 3KXEC 4D81A 2ZBKB 3GQ5A 2KRUA 4BBAA 1KYIA 2Y0QA 4FWHA 1IN8A 3RGPA 2A5YB 2R4JA 2JA2A 1KSFX 1E9RA 4FD2A 4DUYM 4JYAM 5FTJA 1NVMA 3Q8XA 2DWMA 4MGYE 3T1YM 3K1JA 4D80A 4B3SM 2F5QA 1NNUC 3SC3A 3HHXA 5LMUM 5ITQA 4QHSA 1GL6A 4NXNM 1Z5AA 3D8BA 4X62M 4JI1M 1ORYB 3PVSA 1Q3CA 3NWLA 2KA6B 2KRKA 2RKOA 3GLIB 2XSZD 4B7HA 4L4UA 2FNAA 4M9XA 4B08A 4AKGA 4I81A 3HHWA 3PNVA 3KS4A 2XFSA 3I51A 1E9SA 4IBFA 2ZANA 4LFAM 4PDGA 2FOIC 1VDDA 3B9PA 4S12A 5KQ8A 5LMNM 2EO2A 3KSXA 1H6UA 2C96A 4DR3M 4GITA 4IBKA 3BOSA 3SBJA 2H1RA 3VK8A 1YE9A 4IBCA 1IXZA 5FSWA 4NSOB 3SFZA 2RGHA 1JR3D 1YSYA 5F3WA 4NSRA 5KO3A 1DO0A 3QAUA 2X8AA 5BR8M 3KOWE 1TH2A 3AFHA 3SYKA 1D2NA 3FYCA 4DV0M 3UJNA 3EIEA 1GVNA 5JI3E 3KFUG 4A3VB 3U60B 8CATA 1TH4A 3FTDA 3KW6A 1IQPA 1I94M 4LF5M 4ITQA 1Q3BA 1YUBA 5H37D 4GKKM 1JQJC 1DGHB 4LJ4A 1LV7A 3M7GA 5KQDA 3FD9A 3GLHB 4G4QA 4LCBA 5GKNA 3L2AA 4FCTA 5IWAM 2M60A 2R45A 2I7NA 2P5TA 3KSJA 4OVZB 2ZM6M 3TPZA 1IN4A 2K47A 3GLGB 2EA0A 2UUAM 3GQ3A 2YNMD 3TL4X 4IBJA 2UXBM 3VFDA 3GPXA 1N75A 4JI2M 4M0DA 1KFVA 2J7OA 3LMMA 3TWMA 4PD2A 4JI4M 2R65A 3FYDA 3PNYA 4OU7A 3AV0A 1OJLA 4YY3M 2CHQA 3D8LA 4FCWA 1MU5A 1IY1A 3KOXE 4HL4A 1E94E 4GC5A 4MGZE 2XF3A 1NSFA 1PJIA 2R62A 3L26A 4IJEA 1FJGM 3U6MA 4KODA 4JI0M 2HKJA 4FW9A 2KEBA 4B3MM 4LJ5A 4GHLA 2C9OA 1EE8A 3A45A 5C18A 3EIHA 2FFJA 1IXRC 4EIWA 3L28A 2C9CA 3CF6E 3HHYA 4LF4M 2XH9A 4AKIA 4X66M 1XC8A 2DWLA 3TE6A 1SXJC 3U6DA 4K0KM 2M5ZA 2L7HA 3UK6A 2UU9M 3A46A 5KPZA 3WHKA 4I4LA 2L7IA 3KOYE 3E4RA 3SAUA 4I5SA 3VKGA 3U6EA 2DWZB 2L6OA 4W5WA 5EP1A 2XLJA 2CV1A 4LGMA 3FUTA 5EP2A 4D82A 4DV2M 3KS8A 4IBEA 2ZAMA 4REZA 4L8RC 4B3TM 3J27B 2D7EA 4MGKE 3KOZE 3LVVA 2YFQA 4FVMA 4LGYA 3WHLA 4CGYB 4G4NA 1NJFA 4BLCA 3RE8A 3NBIA 2FE8A 1NHWC 2G5GX 4KLNA 2HL7A 1QAQA 4DR6M 5ITUA 1SXJA 4LF7M 2C99A 2XZUA 3FUVA 3M6AA 3HKPA 2LWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 M;  1L1Z A;  3GPY A;  3JAM S;  2F5N A;  1HNW M;  2OQ4 A;  1L2D A;  1I94 M;  5ITX E;  4LF5 M;  5ITT A;  1Q3B A;  4ITQ A;  4NRW A;  2F5P A;  3SAS A;  1R2Y A;  3T1H M;  2UUB M;  4LF6 M;  4GKK M;  2OPF A;  1R2Z A;  2E5L M;  5ITY A;  4DR7 M;  4JI6 M;  4G4Q A;  4DR2 M;  4DR1 M;  3C58 A;  1XMQ M;  4LFC M;  1L2B A;  4GKJ M;  1Q39 A;  4NXM M;  4DV1 M;  5IWA M;  4CIS A;  4OX9 M;  1N34 M;  4KHP M;  3A42 A;  4JI8 M;  3J7A S;  3SAR A;  1N33 M;  1IBM M;  2ZM6 M;  4NRV A;  2EA0 A;  2UUA M;  3GQ3 A;  4MB7 A;  3U6S A;  2UXB M;  3GPX A;  4JI2 M;  2F5O A;  1XNR M;  3GO8 A;  1KFV A;  1N32 M;  3TWM A;  2UUC M;  4PCZ A;  4PD2 A;  5FLX S;  3J80 S;  3U6Q A;  1TDZ A;  4JI4 M;  3GPU A;  1K82 A;  1NNJ A;  2F4V M;  3W0F A;  4YHH M;  1XMO M;  3DOA A;  3TWK A;  4YY3 M;  3OTO M;  1MX0 A;  1MU5 A;  3TWL A;  1TDH A;  1Z5C A;  2HHH M;  4DV3 M;  4JV5 M;  1PJI A;  4X65 M;  4DV5 M;  2ZBK B;  3GQ5 A;  1FJG M;  4AQY M;  3U6M A;  4JI0 M;  1K3W A;  2HKJ A;  3VK7 A;  1J5E M;  4DR4 M;  1L1T A;  4B3M M;  3U6O A;  3SAW A;  3A45 A;  1EE8 A;  5ITX A;  3U6P A;  3GPP A;  4DUY M;  4JYA M;  2UXC M;  1IBK M;  4DR5 M;  3T1Y M;  4LF4 M;  4LF8 M;  4B3S M;  2F5Q A;  1Z5B A;  3SAV A;  4X66 M;  5ITQ A;  5LMU M;  4DUZ M;  4NXN M;  4G4O A;  1XC8 A;  1L2C A;  3U6D A;  1Z5A A;  5IT9 S;  1HR0 M;  4LFB M;  4K0K M;  4X62 M;  4JI1 M;  1PM5 A;  2UU9 M;  3A46 A;  2VQF M;  3SAU A;  3U6C A;  1Z59 A;  5ITR A;  1Q3C A;  1N36 M;  3GP1 A;  3U6E A;  3J81 S;  4DV4 M;  4G4R A;  4DV2 M;  1XNQ M;  5A2Q S;  1HNX M;  1HNZ M;  4B3R M;  3U6L A;  4DV6 M;  4LFA M;  4PDG A;  3SAT A;  4PDI A;  5LMN M;  4B3T M;  2F5S A;  4JI7 M;  2VQE M;  1IBL M;  4DR3 M;  1K3X A;  4DV7 M;  3JR5 A;  4G4N A;  3SBJ A;  3GQ4 A;  4JI5 M;  2Q2E B;  3VK8 A;  3JR4 A;  2UXD M;  4JI3 M;  4DR6 M;  2XZF A;  5ITU A;  4X64 M;  5BR8 M;  4LF7 M;  2XZU A;  1PJJ A;  4DV0 M; 
#chains in the Genus database with same CATH topology
 2NQ8 C;  2X4A A;  4RNA A;  1L8Q A;  3GLF B;  1TH3 A;  3IG8 A;  1IM2 A;  3JAM S;  1TF0 B;  3ZC7 B;  2OQ4 A;  2LXE A;  4HLQ A;  3SYL A;  4F2L A;  2VDB B;  3DFZ A;  3ZQJ A;  2K9D A;  2CFO A;  2OPF A;  1OIP A;  2ZTC A;  5ITY A;  4DR2 M;  3C58 A;  2DAI A;  3GRV A;  4NXM M;  1XWI A;  3FUU A;  4Q7J A;  3FUX A;  3FTF A;  4OX9 M;  4CIS A;  4CHT B;  1NY5 A;  1R6B X;  4LJA A;  2JY8 A;  3A42 A;  3FE3 A;  1DGG A;  1N33 M;  1DGB A;  4M9Z A;  1G4A E;  2EKK A;  2J7N A;  5FTL A;  2DHR A;  3IG5 A;  1VQ1 A;  2WSC F;  5E6J A;  1ZQ9 A;  3GLI E;  1QQW A;  5EXX A;  1D0L A;  4LZJ A;  5DYI A;  2R44 A;  3FTE A;  2VF8 A;  2CP8 A;  2QNJ A;  5DYG A;  3W0L B;  1TDZ A;  4KT0 F;  2DXI A;  4FWD A;  1NO1 A;  4GIP A;  3T15 A;  1G8P A;  1OKS A;  3UGJ A;  1T3T A;  1GJS A;  3AOE A;  1XMO M;  1SXJ D;  1PJS A;  2DZN B;  3DA1 A;  3TWK A;  3TWL A;  1VEJ A;  2HHH M;  3KP0 E;  1XXH A;  2K0B X;  4DV5 M;  5KPT A;  4ZPX A;  2KZU A;  4WP2 A;  3HX3 A;  4NL4 H;  2QZ4 A;  1L1T A;  1XB2 B;  3SAW A;  1SXJ E;  2YR0 A;  4IBB A;  3LQQ A;  3U6P A;  2Y0T A;  3LCU A;  4LJ7 A;  2KW0 A;  4Z8X A;  2CV2 A;  4DR5 M;  2LTU A;  1GJT A;  4LF8 M;  2JUJ A;  2O01 F;  4M9S A;  4AG5 A;  1MN3 A;  2DEN A;  4MGI E;  4DUZ M;  3SAV A;  1R7R A;  1W5S A;  5IT9 S;  1E32 A;  5FTM A;  2DZO B;  3SMP A;  2QQ8 A;  4II7 A;  2BJV A;  4MGH A;  3UMM A;  3DZD A;  5EP4 A;  4GH9 A;  5EXP A;  1Z59 A;  1N36 M;  1CUK A;  3GP1 A;  3MHV C;  1DO2 A;  1GKI A;  4DV4 M;  1TGU A;  1Z6T A;  3U61 A;  2KDL A;  1HNX M;  2BJW A;  4B3R M;  1UFZ A;  3SAT A;  3L25 A;  2ZAO A;  3KDS E;  1GLN A;  2QEN A;  2F5S A;  4HEO A;  1DGF A;  2G8L A;  3LQR A;  3R8F A;  3ILK A;  3QWL A;  2JY6 B;  3VLF B;  2OOB A;  1VG5 A;  2BNK A;  2JY5 A;  2KXE A;  3FTC A;  3JR5 A;  2W82 A;  1T6O A;  3HU3 A;  1G41 A;  3GQ4 A;  2LHG A;  1ZAE A;  1GL7 A;  2Q2E B;  3HU2 A;  4FWG A;  3THG A;  1ZMW A;  4LRS A;  2L4E A;  3JR4 A;  2UXD M;  4MH0 E;  4PT5 A;  3B7Z A;  4KO8 A;  3SHG B;  1QUT A;  1NJG A;  4IBG A;  3V76 A;  3SHF A;  3HU1 A;  3C9P A;  2ERC A;  2Y21 A;  2CUZ A;  1HQY E;  3W67 A;  2JXN A;  1PJJ A;  1XXH E;  1QAN A;  2LNH C;  4B7G A;  4LF9 M;  3GRR A;  1L1Z A;  3GLI A;  4AG6 A;  2LH0 A;  3GPY A;  1TR8 A;  1Q02 A;  1HNW M;  2Z3X A;  1L2D A;  4AKH A;  5ITT A;  4NRW A;  2Z4S A;  4LF6 M;  3T1H M;  5BPV A;  4Y28 F;  3K8Z A;  1R2Z A;  1VEK A;  2E5L M;  3LVW A;  1J09 A;  4LJ6 A;  3E21 A;  1WGN A;  3GRU A;  4JI6 M;  2DAM A;  4DR7 M;  4DR1 M;  2I7P A;  2R46 A;  3U5Z B;  3MK6 A;  1QZE A;  2CE7 A;  4Z6Y A;  1XMQ M;  1L2B A;  4GKJ M;  1IFY A;  1X37 A;  7CAT A;  3HJS A;  3HJQ A;  3A98 B;  4QNM A;  4IJF A;  4DV1 M;  4QHT A;  2C5R A;  4KHP M;  2QP9 X;  3HJ8 A;  3TQS A;  3SAR A;  4FCV A;  2QBY B;  1JR3 A;  3HZJ A;  5C1B A;  4MB7 A;  2D7H A;  1WXQ A;  3BBZ A;  3AOE C;  3I4V A;  3FKE A;  1OFH A;  4R3D A;  5FTN A;  3GO8 A;  2F5O A;  2QSF X;  1XNR M;  1N32 M;  3B7Q A;  2UUC M;  4PCZ A;  3U6Q A;  2DVW B;  3U60 A;  3J2P B;  4RF1 A;  5IZ7 D;  3K9P A;  5EQT A;  4JN6 A;  2Z7J A;  1IN7 A;  1NNJ A;  1I4W A;  1N78 A;  4QNR A;  3DOA A;  1W5T A;  4AZF A;  1MX0 A;  1DGH A;  4LRT A;  3T38 A;  1QDR A;  4R7G A;  1OAO C;  3AKZ A;  1Z5C A;  2CEA A;  4I8O A;  4DV3 M;  3R9X B;  4JV5 M;  3GLH A;  3PFI A;  4AI6 A;  2D7G A;  2GNO A;  5DNY A;  2XFT A;  5JI2 E;  4AQY M;  1K3W A;  3VK7 A;  1J5E M;  4DR4 M;  3GRY A;  3QYE A;  2KNZ A;  4WUR A;  3U6O A;  2Z4R A;  3PXG A;  3LCV B;  5ITX A;  2V1C A;  3GPP A;  1QYR A;  2UXC M;  2EKF A;  4OVZ A;  4L78 A;  2XEP A;  1IBK M;  3KP1 E;  3GLG A;  3HGI A;  4GC9 A;  3I04 M;  3KVW A;  1JB0 F;  1Z5B A;  1L2C A;  4G4O A;  3CTW B;  2R4E A;  1HR0 M;  4LFB M;  1NY6 A;  1PM5 A;  5EXS A;  1SXJ B;  1Y8G A;  1PJT A;  2XGN A;  2VQF M;  3U6C A;  5ITR A;  2GQF A;  2VII A;  3UZU A;  4IBI A;  4BB9 A;  4RKU F;  3J81 S;  1IN6 A;  2CHV A;  2CWB A;  3RFW A;  4G4R A;  2DI0 A;  2KHH A;  1QVR A;  3K92 A;  1XNQ M;  3LW5 F;  2CHG A;  5A2Q S;  4JXJ A;  2R6F A;  1HNZ M;  3U6L A;  4DV6 M;  2R18 A;  4LJ9 A;  2B3T A;  5EP3 A;  2L4F A;  1JR3 E;  3K2L A;  2APL A;  4PDI A;  3VDU A;  2EUC A;  3HWS A;  1QAM A;  4OW0 A;  4JI7 M;  2VQE M;  1VEG A;  4XGI A;  1IBL M;  3H4J A;  4QOS A;  1K3X A;  1UM8 A;  3NBX X;  4JI5 M;  2HAK A;  2AHM A;  4GMQ A;  1LTM A;  2VF7 A;  4MM3 B;  4IIW A;  1N77 A;  2BWB A;  2MGW A;  2MRO B;  4L15 A;  3VDP A;  3J7B A;  4WW0 A;  4JI3 M;  4CIZ A;  4NOO B;  2V1U A;  2V6Z M;  2XZF A;  1XHB A;  1IXS B;  4X64 M;  1S3S A;  2H5X A;  1FNN A;  1V34 A;  3GLH E;  2RGO A;  4XBO A;  2DKL A;  3I4Y A;  3T6P A;  1SG9 A;  2O5R A;  5E26 A;  1GAB A;  1HT1 E;  2F5N A;  2K6B A;  2DWN A;  1R4G A;  2KNV A;  4IBD A;  2YQZ A;  1QZM A;  5ITX E;  4LG2 A;  4QOZ C;  3I01 M;  4LY6 A;  1F4I A;  2QPA A;  2ZTD A;  1R2Y A;  2F5P A;  2L09 A;  3CGW A;  3RGS A;  2UUB M;  3SAS A;  4TUW A;  3AOG A;  3GLG E;  1G59 A;  1OFI A;  1G3I A;  2JNH A;  4RF0 A;  2CV0 A;  1XXH B;  2DAK A;  4B7F A;  2R0I A;  2LVO C;  4LFC M;  1WGL A;  1ZV1 A;  3W68 A;  4G6Z A;  4GRI A;  1Q39 A;  5FTK A;  3SMS A;  4LJ8 A;  4GHA A;  3M0E A;  5EXT A;  3H4M A;  1IY2 A;  4L16 A;  5IRE B;  1HT2 E;  1QAO A;  3U5Z A;  2C98 A;  3FUW A;  1N34 M;  4JI8 M;  3J7A S;  1J7K A;  3CF0 A;  4AW4 A;  2MH8 A;  2MR9 A;  2KZS A;  3HHZ A;  2QHO B;  1IBM M;  1HQC A;  4NRV A;  3E46 A;  3ZH9 B;  1T43 A;  3U6S A;  2Y20 A;  3AJI B;  2HCB A;  2XSZ A;  3C3D A;  3L29 A;  4LZZ A;  1V33 A;  4M0W A;  2QBY A;  3FRI A;  4UN2 B;  3B74 A;  3MJ5 A;  3GLF A;  5FLX S;  3J80 S;  1C1K A;  1D0K A;  3C3E A;  3GPU A;  2X49 A;  2QCU A;  3L27 A;  1NHG C;  3Q8G A;  1K82 A;  4ANR A;  4P16 A;  3E9S A;  5KPR A;  2LHC A;  3W0F A;  4YHH M;  2F4V M;  3CF2 A;  1AIP C;  1G71 A;  3OTO M;  3FRH A;  1QUS A;  1NV9 A;  3ZCB B;  3AL0 C;  1TDH A;  1IN5 A;  3U61 B;  5EJC A;  3VKH A;  3IHP A;  4X65 M;  1IY0 A;  2G3Q A;  3KXE C;  4D81 A;  2ZBK B;  2WZJ A;  3GQ5 A;  1PGY A;  2KRU A;  4BBA A;  1KYI A;  2Y0Q A;  4FWH A;  1IN8 A;  2JP7 A;  3RGP A;  2A5Y B;  2R4J A;  2JA2 A;  1KSF X;  1E9R A;  2JZ0 A;  4FD2 A;  4DUY M;  4JYA M;  5FTJ A;  1NVM A;  1OAI A;  3Q8X A;  4L6V 6;  2DWM A;  4MGY E;  3T1Y M;  2FS1 A;  3K1J A;  4D80 A;  4B3S M;  2F5Q A;  1NNU C;  3SC3 A;  3HHX A;  1PJQ A;  5LMU M;  5ITQ A;  1ZMV A;  4QHS A;  1GL6 A;  4NXN M;  1Z5A A;  3D8B A;  4X62 M;  4JI1 M;  1MJG M;  2JWS A;  1ORY B;  3PVS A;  1Q3C A;  2DAG A;  3NWL A;  2KA6 B;  2KRK A;  2RKO A;  3GLI B;  2XSZ D;  4B7H A;  2N35 A;  4L4U A;  2FNA A;  2CRU A;  2WSE F;  4M9X A;  4I81 A;  3HHW A;  4B08 A;  4AKG A;  1WJ7 A;  3KS4 A;  3PNV A;  1VDL A;  2XFS A;  3I51 A;  2LBC A;  1E9S A;  4IBF A;  2ZAN A;  4LFA M;  4PDG A;  2FOI C;  1VDD A;  3B9P A;  4S12 A;  5KQ8 A;  5LMN M;  2EO2 A;  3KSX A;  1H6U A;  2C96 A;  2HWJ A;  4DR3 M;  1OQY A;  4GIT A;  3B89 A;  4IBK A;  3GLF E;  2J5Y A;  3BOS A;  3SBJ A;  2H1R A;  3VK8 A;  1YE9 A;  4IBC A;  1IXZ A;  3HY5 A;  5FSW A;  4DV7 M;  4NSO B;  3SFZ A;  2RGH A;  1C7Y A;  1JR3 D;  1YSY A;  5L8R F;  4NSR A;  5KO3 A;  1DO0 A;  3QAU A;  5F3W A;  2X8A A;  5BR8 M;  2O25 A;  1TH2 A;  3KOW E;  3AFH A;  2FH0 A;  1YLA A;  1D2N A;  3FYC A;  3SYK A;  4G3O A;  4DV0 M;  3UJN A;  3EIE A;  1GVN A;  3IEC A;  5JI3 E;  1IXS A;  3KFU G;  1OIZ A;  4A3V B;  3U60 B;  4P17 A;  8CAT A;  1TH4 A;  2OOA A;  2DAE A;  3FTD A;  3KW6 A;  1EFU B;  4GEW A;  1IQP A;  3QYB A;  1NV8 A;  1I94 M;  4LF5 M;  2DZL A;  1Q3B A;  4ITQ A;  1YUB A;  5H37 D;  4GKK M;  1JQJ C;  1DGH B;  4LJ4 A;  1WHC A;  1LV7 A;  3M7G A;  5KQD A;  3FD9 A;  3MMP A;  2OO9 A;  3GLH B;  4G4Q A;  4LCB A;  1WIV A;  1WR1 B;  5GKN A;  1ZMU A;  3L2A A;  1EIJ A;  1P3Q Q;  4FCT A;  5IWA M;  2L2D A;  2M60 A;  4XK8 F;  2R45 A;  2I7N A;  2P5T A;  3KSJ A;  4OVZ B;  2ZM6 M;  3TPZ A;  1IN4 A;  2K47 A;  3GLG B;  2EA0 A;  2UUA M;  3GQ3 A;  2YNM D;  4NC6 A;  3TL4 X;  4IBJ A;  2UXB M;  3VFD A;  3GPX A;  1N75 A;  4JI2 M;  2LVQ D;  4M0D A;  1KFV A;  2J7O A;  3LMM A;  4F1I A;  3TWM A;  2LVN C;  4PD2 A;  1V92 A;  4JI4 M;  3B7N A;  2R65 A;  2EJS A;  3FYD A;  3PNY A;  4OU7 A;  2DNA A;  3AV0 A;  1OJL A;  1OTR A;  4R71 A;  4YY3 M;  2CHQ A;  2LVA A;  3D8L A;  4FCW A;  1MU5 A;  1IY1 A;  3KOX E;  4HL4 A;  1E94 E;  4GC5 A;  4MGZ E;  1RU3 A;  2XF3 A;  1NSF A;  1PJI A;  2R62 A;  3L26 A;  4IJE A;  1D0M A;  1FJG M;  3U6M A;  4KOD A;  4JI0 M;  1R5L A;  2HKJ A;  2KEB A;  4FW9 A;  4B3M M;  4LJ5 A;  4GHL A;  2C9O A;  1EE8 A;  3A45 A;  5C18 A;  3EIH A;  1GO5 A;  2FFJ A;  1IXR C;  4EIW A;  3F92 A;  3L28 A;  1A5T A;  4CJ6 A;  4DBG B;  2JZ1 A;  2MJ5 B;  2C9C A;  3CF6 E;  3HHY A;  4LF4 M;  2XH9 A;  3BXW A;  2LVP C;  4AKI A;  2KNA A;  5DFL A;  1HJP A;  4X66 M;  1XC8 A;  2DWL A;  3TE6 A;  1SXJ C;  3U6D A;  4K0K M;  2M5Z A;  2L7H A;  3UK6 A;  2UU9 M;  3A46 A;  2BWE A;  5KPZ A;  3WHK A;  4I4L A;  2L7I A;  3KOY E;  3E4R A;  2Z8Y M;  4I5S A;  3SAU A;  3VKG A;  1TTE A;  1DV0 A;  3U6E A;  2DWZ B;  2L6O A;  4W5W A;  5EP1 A;  2XLJ A;  2CV1 A;  4LGM A;  3FUT A;  1PRB A;  5EP2 A;  4D82 A;  4DV2 M;  4IBE A;  3KS8 A;  2ZAM A;  4REZ A;  4L8R C;  2JY7 A;  1AUA A;  4B3T M;  3K9O A;  3J27 B;  2D7E A;  4MGK E;  3KOZ E;  3LVV A;  2YFQ A;  4FVM A;  2RRU A;  4LGY A;  3WHL A;  4CGY B;  2WSF F;  1NJF A;  4BLC A;  4G4N A;  3RE8 A;  2DHY A;  3NBI A;  2FE8 A;  1NHW C;  2G5G X;  4KLN A;  2HL7 A;  1QAQ A;  4DR6 M;  5ITU A;  1SXJ A;  4LF7 M;  1BVS A;  2C99 A;  2XZU A;  3FUV A;  1QDT A;  3M6A A;  3HKP A;  2LWX A; 
#chains in the Genus database with same CATH homology
 2NQ8 C;  2X4A A;  4RNA A;  1L8Q A;  3GLF B;  1TH3 A;  3IG8 A;  1IM2 A;  3JAM S;  3ZC7 B;  2OQ4 A;  2LXE A;  4HLQ A;  3SYL A;  3DFZ A;  2CFO A;  2OPF A;  5ITY A;  4DR2 M;  3C58 A;  3GRV A;  4NXM M;  1XWI A;  3FUU A;  3FTF A;  3FUX A;  4OX9 M;  4CIS A;  4CHT B;  1NY5 A;  1R6B X;  4LJA A;  3A42 A;  1DGG A;  1N33 M;  1DGB A;  4M9Z A;  1G4A E;  2J7N A;  5FTL A;  2DHR A;  3IG5 A;  5E6J A;  1ZQ9 A;  1QQW A;  5EXX A;  5DYI A;  4LZJ A;  3FTE A;  5DYG A;  3W0L B;  1TDZ A;  2DXI A;  4FWD A;  3T15 A;  4GIP A;  1G8P A;  3UGJ A;  1T3T A;  3AOE A;  1XMO M;  1SXJ D;  2DZN B;  3DA1 A;  3TWK A;  3TWL A;  2HHH M;  3KP0 E;  1XXH A;  4DV5 M;  5KPT A;  4ZPX A;  2KZU A;  4NL4 H;  2QZ4 A;  1L1T A;  3SAW A;  1SXJ E;  2YR0 A;  4IBB A;  3LQQ A;  3U6P A;  2Y0T A;  4LJ7 A;  2KW0 A;  4Z8X A;  2CV2 A;  4DR5 M;  4LF8 M;  4M9S A;  4AG5 A;  3SAV A;  4MGI E;  4DUZ M;  1R7R A;  1W5S A;  5IT9 S;  1E32 A;  5FTM A;  2DZO B;  3SMP A;  4II7 A;  2BJV A;  4MGH A;  3UMM A;  3DZD A;  5EP4 A;  4GH9 A;  5EXP A;  1Z59 A;  1N36 M;  3GP1 A;  3MHV C;  1DO2 A;  1GKI A;  4DV4 M;  1TGU A;  1Z6T A;  3U61 A;  1HNX M;  2BJW A;  4B3R M;  3SAT A;  3L25 A;  2ZAO A;  3KDS E;  1GLN A;  2QEN A;  2F5S A;  1DGF A;  2G8L A;  3LQR A;  3R8F A;  3ILK A;  3QWL A;  3VLF B;  4DV7 M;  3FTC A;  2BNK A;  2KXE A;  3JR5 A;  2W82 A;  3HU3 A;  1G41 A;  3GQ4 A;  1ZAE A;  1GL7 A;  2Q2E B;  3HU2 A;  4FWG A;  3THG A;  4LRS A;  3JR4 A;  2UXD M;  4MH0 E;  4PT5 A;  4KO8 A;  3SHG B;  1NJG A;  4IBG A;  3SHF A;  3HU1 A;  2ERC A;  2Y21 A;  2CUZ A;  1HQY E;  1PJJ A;  1QAN A;  2LNH C;  4B7G A;  4LF9 M;  3GRR A;  1L1Z A;  3GLI A;  4AG6 A;  2LH0 A;  3GPY A;  1HNW M;  2Z3X A;  1L2D A;  4AKH A;  5ITT A;  4NRW A;  2Z4S A;  4LF6 M;  3T1H M;  5BPV A;  3K8Z A;  1R2Z A;  2E5L M;  3LVW A;  1J09 A;  4LJ6 A;  4DR7 M;  3GRU A;  4JI6 M;  4DR1 M;  2I7P A;  2R46 A;  3U5Z B;  3MK6 A;  2CE7 A;  4Z6Y A;  1XMQ M;  1L2B A;  4GKJ M;  1X37 A;  7CAT A;  3HJS A;  3HJQ A;  3A98 B;  4QNM A;  4IJF A;  4DV1 M;  4QHT A;  2C5R A;  4KHP M;  2QP9 X;  3HJ8 A;  3TQS A;  3SAR A;  4FCV A;  2QBY B;  1JR3 A;  5C1B A;  4MB7 A;  2D7H A;  1WXQ A;  3AOE C;  3I4V A;  3FKE A;  1OFH A;  4R3D A;  5FTN A;  3GO8 A;  2F5O A;  1XNR M;  1N32 M;  2UUC M;  4PCZ A;  3U6Q A;  2DVW B;  3U60 A;  3J2P B;  4RF1 A;  5IZ7 D;  5EQT A;  4JN6 A;  2Z7J A;  1IN7 A;  1NNJ A;  1I4W A;  1N78 A;  4QNR A;  3DOA A;  1W5T A;  4AZF A;  1MX0 A;  1DGH A;  4LRT A;  3T38 A;  4R7G A;  3AKZ A;  1Z5C A;  2CEA A;  4I8O A;  4DV3 M;  3R9X B;  4JV5 M;  3GLH A;  3PFI A;  4AI6 A;  2D7G A;  5DNY A;  2XFT A;  5JI2 E;  4AQY M;  1K3W A;  3VK7 A;  1J5E M;  4DR4 M;  3GRY A;  3U6O A;  4WUR A;  2Z4R A;  3PXG A;  5ITX A;  2V1C A;  3GPP A;  1QYR A;  2UXC M;  4OVZ A;  4L78 A;  2XEP A;  1IBK M;  3KP1 E;  3GLG A;  3HGI A;  4GC9 A;  3KVW A;  1Z5B A;  1L2C A;  4G4O A;  3CTW B;  2R4E A;  1HR0 M;  4LFB M;  1NY6 A;  1PM5 A;  5EXS A;  1SXJ B;  2XGN A;  2VQF M;  3U6C A;  5ITR A;  2VII A;  3UZU A;  4IBI A;  4BB9 A;  3J81 S;  1IN6 A;  2CHV A;  3RFW A;  4G4R A;  3K92 A;  1QVR A;  1XNQ M;  2CHG A;  5A2Q S;  4JXJ A;  1HNZ M;  3U6L A;  4DV6 M;  2R18 A;  4LJ9 A;  5EP3 A;  3K2L A;  4PDI A;  3VDU A;  2EUC A;  3HWS A;  1QAM A;  4OW0 A;  4JI7 M;  2VQE M;  1IBL M;  4XGI A;  4QOS A;  1K3X A;  1UM8 A;  4JI5 M;  2AHM A;  4GMQ A;  4MM3 B;  4IIW A;  1N77 A;  3VDP A;  4L15 A;  2V1U A;  3J7B A;  4WW0 A;  4JI3 M;  4NOO B;  2V6Z M;  2XZF A;  1XHB A;  1IXS B;  4X64 M;  1S3S A;  1FNN A;  2RGO A;  4XBO A;  3I4Y A;  2O5R A;  5E26 A;  1HT1 E;  2F5N A;  2DWN A;  4IBD A;  2YQZ A;  1QZM A;  5ITX E;  4LG2 A;  4QOZ C;  4LY6 A;  2QPA A;  2F5P A;  1R2Y A;  2UUB M;  2L09 A;  3RGS A;  3SAS A;  4TUW A;  3AOG A;  1G59 A;  1OFI A;  1G3I A;  4RF0 A;  2CV0 A;  1XXH B;  4B7F A;  4LFC M;  4G6Z A;  4GRI A;  1Q39 A;  5FTK A;  3SMS A;  4LJ8 A;  4GHA A;  3M0E A;  5EXT A;  3H4M A;  1IY2 A;  4L16 A;  5IRE B;  1HT2 E;  1QAO A;  3U5Z A;  2C98 A;  3FUW A;  1N34 M;  4JI8 M;  3J7A S;  1J7K A;  3CF0 A;  4AW4 A;  1IBM M;  2KZS A;  3HHZ A;  1HQC A;  4NRV A;  3ZH9 B;  3U6S A;  2Y20 A;  3AJI B;  2HCB A;  2XSZ A;  3L29 A;  4LZZ A;  4M0W A;  2QBY A;  3MJ5 A;  3GLF A;  5FLX S;  3J80 S;  1C1K A;  3GPU A;  2X49 A;  2QCU A;  3L27 A;  1NHG C;  1K82 A;  4P16 A;  3E9S A;  5KPR A;  3W0F A;  4YHH M;  2F4V M;  3CF2 A;  3OTO M;  3ZCB B;  3AL0 C;  1TDH A;  1IN5 A;  3U61 B;  5EJC A;  3VKH A;  4X65 M;  1IY0 A;  3KXE C;  4D81 A;  2ZBK B;  3GQ5 A;  2KRU A;  4BBA A;  1KYI A;  2Y0Q A;  4FWH A;  1IN8 A;  3RGP A;  2A5Y B;  2R4J A;  2JA2 A;  1KSF X;  1E9R A;  4FD2 A;  4DUY M;  4JYA M;  5FTJ A;  1NVM A;  3Q8X A;  2DWM A;  4MGY E;  3T1Y M;  3K1J A;  4D80 A;  4B3S M;  2F5Q A;  1NNU C;  3SC3 A;  3HHX A;  5LMU M;  5ITQ A;  4QHS A;  1GL6 A;  4NXN M;  1Z5A A;  3D8B A;  4X62 M;  4JI1 M;  1ORY B;  3PVS A;  1Q3C A;  3NWL A;  2KA6 B;  2KRK A;  2RKO A;  3GLI B;  2XSZ D;  4B7H A;  4L4U A;  2FNA A;  4M9X A;  4B08 A;  4AKG A;  4I81 A;  3HHW A;  3PNV A;  3KS4 A;  2XFS A;  3I51 A;  1E9S A;  4IBF A;  2ZAN A;  4LFA M;  4PDG A;  2FOI C;  1VDD A;  3B9P A;  4S12 A;  5KQ8 A;  5LMN M;  2EO2 A;  3KSX A;  1H6U A;  2C96 A;  4DR3 M;  4GIT A;  4IBK A;  3BOS A;  3SBJ A;  2H1R A;  3VK8 A;  1YE9 A;  4IBC A;  1IXZ A;  5FSW A;  4NSO B;  3SFZ A;  2RGH A;  1JR3 D;  1YSY A;  5F3W A;  4NSR A;  5KO3 A;  1DO0 A;  3QAU A;  2X8A A;  5BR8 M;  3KOW E;  1TH2 A;  3AFH A;  3SYK A;  1D2N A;  3FYC A;  4DV0 M;  3UJN A;  3EIE A;  1GVN A;  5JI3 E;  3KFU G;  4A3V B;  3U60 B;  8CAT A;  1TH4 A;  3FTD A;  3KW6 A;  1IQP A;  1I94 M;  4LF5 M;  4ITQ A;  1Q3B A;  1YUB A;  5H37 D;  4GKK M;  1JQJ C;  1DGH B;  4LJ4 A;  1LV7 A;  3M7G A;  5KQD A;  3FD9 A;  3GLH B;  4G4Q A;  4LCB A;  5GKN A;  3L2A A;  4FCT A;  5IWA M;  2M60 A;  2R45 A;  2I7N A;  2P5T A;  3KSJ A;  4OVZ B;  2ZM6 M;  3TPZ A;  1IN4 A;  2K47 A;  3GLG B;  2EA0 A;  2UUA M;  3GQ3 A;  2YNM D;  3TL4 X;  4IBJ A;  2UXB M;  3VFD A;  3GPX A;  1N75 A;  4JI2 M;  4M0D A;  1KFV A;  2J7O A;  3LMM A;  3TWM A;  4PD2 A;  4JI4 M;  2R65 A;  3FYD A;  3PNY A;  4OU7 A;  3AV0 A;  1OJL A;  4YY3 M;  2CHQ A;  3D8L A;  4FCW A;  1MU5 A;  1IY1 A;  3KOX E;  4HL4 A;  1E94 E;  4GC5 A;  4MGZ E;  2XF3 A;  1NSF A;  1PJI A;  2R62 A;  3L26 A;  4IJE A;  1FJG M;  3U6M A;  4KOD A;  4JI0 M;  2HKJ A;  4FW9 A;  2KEB A;  4B3M M;  4LJ5 A;  4GHL A;  2C9O A;  1EE8 A;  3A45 A;  5C18 A;  3EIH A;  2FFJ A;  1IXR C;  4EIW A;  3L28 A;  2C9C A;  3CF6 E;  3HHY A;  4LF4 M;  2XH9 A;  4AKI A;  4X66 M;  1XC8 A;  2DWL A;  3TE6 A;  1SXJ C;  3U6D A;  4K0K M;  2M5Z A;  2L7H A;  3UK6 A;  2UU9 M;  3A46 A;  5KPZ A;  3WHK A;  4I4L A;  2L7I A;  3KOY E;  3E4R A;  3SAU A;  4I5S A;  3VKG A;  3U6E A;  2DWZ B;  2L6O A;  4W5W A;  5EP1 A;  2XLJ A;  2CV1 A;  4LGM A;  3FUT A;  5EP2 A;  4D82 A;  4DV2 M;  3KS8 A;  4IBE A;  2ZAM A;  4REZ A;  4L8R C;  4B3T M;  3J27 B;  2D7E A;  4MGK E;  3KOZ E;  3LVV A;  2YFQ A;  4FVM A;  4LGY A;  3WHL A;  4CGY B;  4G4N A;  1NJF A;  4BLC A;  3RE8 A;  3NBI A;  2FE8 A;  1NHW C;  2G5G X;  4KLN A;  2HL7 A;  1QAQ A;  4DR6 M;  5ITU A;  1SXJ A;  4LF7 M;  2C99 A;  2XZU A;  3FUV A;  3M6A A;  3HKP A;  2LWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...