1OFHA

Asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
309
structure length
309
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAGGAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
publication title Structure and Reactivity of an Asymmetric Complex between Hslv and I-Domain Deleted Hslu, a Prokaryotic Homolog of the Eukaryotic Proteasome
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 102
structure length 309
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ofhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ofhA01
3EIHA 3SI7A 3VR3A 3D31A 4ZIRB 1X3SA 4MA4A 5FOSA 2ZJ8A 2C98A 5BYJA 1Z07A 3QPVA 4QHTA 3K53A 5BXQC 1OXTA 3EIQA 2CVFA 4LC0A 5G41A 2C9CA 1TQDA 2X77A 2ORIA 3QE0A 1AN0A 1TTTA 3AVXA 2H8KA 2ONKA 4RFVA 3Q7PA 3O8RA 3WHLA 1EFUA 1Q3TA 4D80A 1KYIA 4GZLA 5K8TA 2ZRLA 3DDCA 2G6BA 2J9RA 4BFTA 3X2SA 4OL0A 3RS4A 4NCKA 1QHNA 5GJVC 1WE2A 3HYTA 4Q4HB 4D0GA 3I61A 4TLBA 1UBEA 5J47A 3U60B 1NBME 2DWPA 3NH9A 1YZTA 3TW8B 3PEWA 2F1JA 4UKDA 1N6IA 5AJYA 2WJGA 2A7QA 4M1YA 4DZZA 3E2IA 1M7GA 4L9SA 3V4RA 3CRQA 4G5QA 1ZM7A 3F3YA 4C0AC 1AK2A 1U9IA 2OCAA 1MO4A 4P4SB 1P60A 4DEXA 1ZU5A 4EPRA 1UBFA 1G19A 4FWHA 1IONA 1NLFA 4DUGD 3A6PC 1D6JA 2VQSA 3SZRA 2VH5R 3SHFA 2ZROA 3PUYA 4D4MA 5DYIA 1GRNA 3SFVA 3T12A 4D0NA 3R9IA 2PX3A 4DDTA 1GAJA 4ZIRA 2ZAMA 3K0FB 2RGXA 2PT5A 2OCBA 3BORA 3EZ6A 3T5GA 1XTJA 2ZRKA 4RKEA 4U7DA 4EDHA 2C99A 4CEJB 1NN5A 3R20A 1XMVA 3NIBA 2R62A 1JR3E 1Z5ZA 3AQ4A 2WIAA 3SJBA 5IK2D 3ZVLA 1AGPA 3ZIAD 5FTLA 2CCKA 2IYLD 2IEYA 3WHKA 4B73A 4DIEA 4A3VB 3UANA 2QMHA 4TL7A 1QBKC 1BYUA 1E79A 2OBMA 4Q4HA 3NEJA 1BOFA 1TEVA 4TL6A 2KBFA 1WRBA 1UAAA 4Q1CA 1XEXB 1HV8A 3L0SA 4FWTA 4UNRA 4I1OA 4JLJA 5FOWA 4C0HA 3B1VA 1LF5A 1X86B 3EX7C 4OI0A 3B8HA 1M7HA 3QKTA 4P4SA 1N6KA 2GTPA 2ZRHA 1ODFA 1ZIPA 3P20A 2WVJA 2QORA 3FTQA 2IBMA 3K8YA 3TQFA 4XVRA 3FHCB 1QG2A 4TMVA 4V0NA 3K0FA 4HLQB 1GUAA 2D74A 2I1VB 1RW4A 4KVGA 2P0EA 1Z2CA 1KZGB 4IHQA 4AYXA 2BJWA 4CZ2A 1NL3A 2WAYA 4B3XA 3K1JA 1IXRC 4CEJA 3ZS9A 3K0EA 1KI7A 2OFOA 1FTSA 2RMKA 3IIJA 4BFZA 2ZM5A 4ZI3A 2YV5A 2IF2A 5J4YA 3AF3A 3BE4A 4US1R 2FSIA 2ZQ5A 4JL8A 3MMPA 4Q4AB 5FOXA 2R8RA 3VR5A 3D6TB 1J99A 3IILA 3BWDD 4MYCA 4DB4A 2GXQA 2IL1A 2ZJBA 1Z6XA 5E3HA 2CE2X 2WJVA 3MG9A 2BEJA 4KFRA 4AK9A 1G5RA 4OQXA 1XF9A 4C9BA 4JLMA 1XEXA 2F55A 2WWIA 3AGQA 2QA5A 1XPOA 5CM8B 1ZIOA 2AL7A 5KPDA 1JXMA 3EPHA 2QP9X 1GSIA 4JIMA 3LQQA 4LWZA 4RSGA 1KGDA 3NDBB 4HB3A 3QXXA 2QQ0A 2FV8A 4FMDB 1BO6A 2ORWA 4NYJQ 4D2IA 1XTKA 2LCFA 3C41J 1P2VA 2VHQA 4RZXA 4QM7A 5KNDA 2ODWA 1KY3A 4FWGA 2IXEA 2NIPA 3P4XA 1L2TA 4B44A 1II8B 2FF7A 1D2NA 3AUYA 4OQNA 2ZSEA 4L15A 3C16C 3LAWA 3OAAD 4IVQA 1T5LA 4QKQA 1NG1A 2GCOB 4Q4AA 2A5DA 3RRZA 3X1ZA 3CW2A 1XPRA 1VMAA 2WWWA 1X6VA 3R8CA 1OIWA 3PEVA 3RS5A 1N5JA 3H2YA 4HB2A 4IVPA 2ZRPA 1E9FA 4LHWA 4NPHA 3RYTC 3FVQA 1XTIA 3QXHA 1KTVA 4AC9A 4LJ7A 1JNYA 1NKSA 2CVHA 3IBYA 2I3BA 3B9PA 2FG5A 4GNKA 3H4MA 4J0QA 4TLDA 3RLFA 3TE6A 4IFBA 4YLGA 721PA 4KJZA 1S3GA 2VP9A 1Z0IA 4Q9JA 2RGCA 1KK2A 4F4IA 1W2HA 3AP3A 1DPFA 3EPJA 1JJ7A 1QRAA 4LDJA 4CVNA 4PC2A 3MD0A 2Q9CA 2V7QD 4AYTA 4C7OB 4MGYR 1G3UA 1QHGA 3BK7A 4A9AA 3A4NA 4MKFA 3N2EA 2OT3B 4PZZA 3GJ6A 1TADA 4Q4LA 4DLYA 3GLGB 1IOZA 1XB2A 3HP1A 1II8A 2QAGA 2ZRBA 3BFXA 1X8JA 2QTVB 3A4MA 4OQFA 3NTUA 1RRCA 3AM1A 4XWAA 2QBYB 1RIFA 4M21A 5J4HA 2OSBA 2GCOA 2V55B 3UMSA 3VHXA 2XXAB 2WJIA 2ZRAA 2C2HA 1CR4A 2JEOA 1ETUA 2CL7X 2G77B 4NCIA 2VP6A 2GZAA 4RZ2A 2J0UB 3IHLA 1W1WA 1G6OA 2Z83A 3BC1A 1Z47A 3TUJC 4HAZA 2ZUDA 1C9KA 4JT2A 1VCIA 4Y0AA 2F9LA 5CIWA 1YZNA 2IS1A 1W46A 4IJMA 1U98A 1UKYA 5CK4A 3FKSA 1CJKC 1N6PA 2B6HA 1KO5A 2EFHB 1P2UA 3T35A 4DCNA 1XNJA 4YMUA 4C7OA 4D81A 1T8TA 4QHYA 3ND8A 2YC4C 4QNMA 2ZI7A 1FMLA 2WWFA 1Z6TA 1VDZA 2PBRA 3B60A 3CB4A 3NBFA 3V9PA 4QG7A 4PC6A 2RGGA 3FKSD 3GLGA 3F5FA 2ZJAA 2FZ4A 4LOAA 2GEVA 3JZAA 4IEIA 3VMFA 4EFLA 4Q21A 4G5SA 3RDPA 5DGXA 2QBYA 3DEFA 1GWNA 3AH8A 1U8ZA 4TYYA 3FFAA 2O8EB 2XXAA 4GITA 1JEDA 3M4YA 3NWJA 2QNRA 2GZHA 1YRBA 4NCJA 4DSTA 5JWRA 1TNDA 1ZP6A 1TUEA 2J0UA 2ZRNA 4BFWA 1B23P 1E0AA 1N6RA 4RD2A 4BZXA 1W4RA 521PA 2OO7A 4Y0VA 2NPIA 4JN6A 2NO1A 3CM0A 1HT2E 1IN7A 1Q3HA 1MOZA 1FX0B 1PV4A 2AFHE 4ABYA 1OFHA 2IXFA 1DAFA 2XNDA 3AF0A 2VF7A 1N0WA 4TTPA 3FB4A 3ADBA 3THOA 5SZIA 4LYJA 4MGIR 3B6EA 4TMTA 1I4DD 2QRNA 2FMXA 4LHZA 1M7BA 3BH0A 1ELOA 1COWA 3KKPA 3OIUA 3WBJA 1A5TA 5DLQC 4QM6A 3EARA 2GNOA 2GF0A 2XNDD 4B6EA 3I1FA 3CRW1 4ZDJA 1NSTA 1E99A 4PSKA 5L8VA 5FL7A 3SDZA 1AQUA 1NVVR 2K5UA 3EZ7A 3V4FA 3RS7A 2IC5A 5CB6A 3K0CA 4Q1BA 5L3QB 1XP8A 3SS8A 2O8EA 1COWD 1E6CA 5K8UA 4EPVA 4QGHA 4B71A 3VAAA 4UXHA 3OE7D 3TVTA 3A1UA 5JEDA 4I1SA 1G4AE 3M0EA 2G88A 5AR1A 3KXKA 3KKNA 2ZI6A 3PEUA 4NYMQ 4RY2A 2PZGA 2ZU6A 2CCGA 5FL7D 2V3CC 2XZLA 5F3WB 2ORVA 3VKWA 2CHVA 1F2TB 2EYUA 4M53A 4WIAA 4A0GA 3W8NA 1BMFD 1IJEA 1YZGA 4LSGA 3P26A 2R44A 1E9AA 3V00A 2R6CA 4ZPXA 1GG2A 3FDIA 4LX0A 3PEYA 1G3IA 1G7RA 3CONA 1FX0A 3LW8A 4QXAA 4ZI2A 1T3SA 3QKSB 5TV2A 2KI5A 1EG7A 5DE3A 1C1YA 3A8TA 3W6NA 3TVDA 5K8IA 4HB4A 3ZD7A 5BN3A 4ZV4A 3ADCA 1F48A 3O8CA 2NTYC 2L0XA 5CYPA 5FOVA 1YQTA 2J0VA 3GLGE 4MQBA 2DHRA 1Z0FA 3L8YA 4Q47A 5CJ2A 3AF2A 4RD6A 1A2KC 3IDQA 2LKCA 1DE0A 4IOLA 4PZLA 3GCGA 1QVAA 1CEEA 5L3QA 5TDHA 3QXSA 2OCPA 5AJZA 2VBCA 2C77A 1Z8FA 1Z06A 1DAMA 2D2EA 2JLRA 2GXUA 1GRRA 3KDSE 1WDTA 4S2EA 3W90A 1R10A 5JJLA 1F2TA 2GA8A 2V6IA 2ZVPX 4ARZB 5CK5A 5AUPB 1HYQA 2VIIA 2IEZA 5JRZA 4W7SA 2E9SA 1YRAA 1KNXA 3KW6A 3P1JA 1EX7A 3NBYC 1E32A 2QN6A 3PJRA 1IN8A 1L4UA 5DN6A 1Z29A 3Q72A 3QKSA 4MKHA 4B74A 1Z08A 4G0NA 4HDOB 2X8AA 4NKRA 1K8RA 1XX6A 4L5BA 1W36B 5K8LA 1FUUA 3KFVA 3OF5A 1OYWA 4I4LA 3ZH9B 1HT1E 1P5ZB 2RAPA 4OBEA 4UQOA 1WQ1R 2O0KA 4KSCA 3K70B 5JS8A 5DHAA 4BPBA 1Y63A 3DOFA 4DLUA 5DN6D 4WZAE 3U7EB 4OQMA 2J59A 4IXMA 1US8B 3QJYA 3CPEA 2PEYA 1E96A 4FMDF 4IKEA 2I4IA 2VEDA 3RHFA 2ASEA 5JFGA 1OIXA 2R6FA 3H84A 4FCVA 2BCGY 4K81B 1PLJA 1XJQA 3BXZA 3HDTA 1ZNWA 2CHQA 4MUAA 3P27A 1XU4A 2ZYVX 1E2GA 3CNLA 2IYRA 3MLEA 4ON9A 3GJ8A 5L3SB 5A0FA 1YR7A 5JMTA 2A5JA 2ZRMA 1AKYA 4CEIB 3Q5EA 3ZYCA 1SHKA 2YOFA 3QY0A 4RJLA 1U8AA 2VP4A 1FZQA 5DI9A 5H68A 1P72A 1SGWA 4JLKA 5IF9A 4AI6A 4ZKDA 3AV0B 2Q9AA 3KUDA 4Q19A 4PHTA 5FBLB 3TRFA 3TJZA 2YOHA 2CCJA 4ERNA 2NMVA 3IBGA 4LV6A 3A1SA 2F6RA 1W5SA 1OXXK 2DB3A 2BV3A 4XD7D 1US8A 4FXPA 3Q85A 2FFAA 1E69A 1FP7A 1G7CA 4XWKA 2LWIA 1P2TA 2GXSA 3CLVA 1FL9A 3SYNA 4G5RA 5CJPA 5IDVA 3K70D 4NH0A 4LI0A 1RRGA 1KOFA 2YINC 3FHOA 1W2GA 4DXAA 2Y8EA 2DFNA 5L3SA 1CBUA 4OHYA 1JAHA 4R2IA 2AN9A 4DLTA 1LS1A 1XMIA 821PA 4CEIA 5A4JA 2CE7A 3N2IA 4M9ZA 3T06B 4RZ3A 1GKYA 4L16A 4WZBE 3AF4A 4X8MA 3QKUA 4PQFA 3TMKA 2MSDB 3C5HA 2CLSA 3G5UA 4DLRA 4CRWB 1AJEA 3ZDQA 4UJ5A 2JLQA 1P73A 4TSFD 2J45A 2QTHA 1P61B 2VHUA 1V5WA 4PO9A 2VLIA 4DB2A 1OB2A 2LKDA 2FDCA 3U3KA 1E9SA 1DVRA 1JAIA 2OUKA 1DELA 4LRTA 3NDPA 2EFCB 1MO5A 5FBQB 2PT7A 4B3FX 1NG9A 3RC8A 3AVVA 3U61B 4PO8A 2R6AA 3W34A 3KXLA 2P2LA 1N3BA 1E9BA 1Z63A 1SXJC 5AUQA 4TLEA 1E0JA 3MWKA 2IS2A 3MAAC 3QUSA 4V02A 2ZXUA 2PJRA 2MSEB 4A0FA 2DPXA 2YHSA 2HT1A 1CRPA 5LPNA 2PZFA 4XVUA 1LW7A 1OKKD 1CTQA 3CRVA 3F8TA 2ZUCA 2IHBA 2WKPA 1P3JA 2IWRA 1S8FA 1AGRA 2DFKB 1R0ZA 2HJVA 4LBZA 4RKFA 1ZD9A 4CT4B 2CMKA 2ZI9A 3QPUA 3PFIA 2W6ID 3HR8A 3LY5A 4B75A 2QUZA 4E22A 1IN5A 2D3WA 3WRXC 1H8EA 4KU4A 3OEEA 1R5OA 2C78A 2H57A 3GJ7A 5FUXA 4IOKA 4BFSA 5B64A 1NIJA 1QZMA 3MJHA 4M1OA 2BVNA 2GVDC 4R7ZA 3LVRE 3X1DA 3H1TA 4B32A 1OH5A 1T4GA 1VIAA 3LV8A 3BRWD 5FBWB 4ZDIA 1H8ED 3OEED 2VHCA 2Q0HA 4Q4JB 4Q9IA 3B13B 2IWHA 4GOKA 1NVMA 4V0MA 3AB3A 2WWHA 5DO9A 5EQTA 5P21A 5M04A 3SC3A 3B1XA 1D2MA 2ZJOA 2H7VA 2ZJZA 4H1VA 1JI0A 2BKEA 3UMFA 3PITA 2F3TA 3EPKA 1NNEA 3PUWA 3M1IA 3WRYC 2CK3D 3FKQA 4GDFA 4P33A 2ZANA 4EUNA 4DLWA 3SYKA 3QI2A 5EP4A 2C95A 1N0VC 3QF4B 4QFMA 4BLRA 4BLTA 2IYTA 3PENA 2QAGC 3RRNA 2JJ1D 4U5XA 1WP9A 4M9QA 1DOAA 1G17A 1M1YE 1TMKA 2EU8A 1RZ3A 2IUTA 2W0SA 1E0KA 2FPKA 4JLBA 3RWMB 5HKKD 3O8BA 4M1WA 1ZCBA 2XZOA 1XCPA 3U7FB 4LJYA 3EC1A 2C04A 1JPNA 2YWFA 2XTZA 1OSNA 4UNSA 3CH4B 1ZU4A 2ZR0A 4Q1DA 3DKVA 2UVQA 1A7JA 3IIKA 4MGKR 1KIMA 2W00A 1CR2A 4D25A 3B5JA 2NO6A 5CLLA 2Z43A 4FCTA 5KUTA 4RFSB 2RGBA 4WVFA 3U6KA 4AD8A 5TARA 5DYGA 4WW0A 3VQTA 4LJ8A 4D4KA 3CZQA 3B7GA 3K9GA 3PQCA 4DKXA 1ZM2A 1WB9A 3CKLA 2O8CA 4US0R 1FFHA 1KI6B 1V43A 4JL5A 2ZI3A 2Q21A 1QHIA 4DDWA 1N6HA 3X1WA 3CF0A 4QGAA 2J5XA 2ZJ5A 3ZJYA 2ERXA 2JA1A 3P32A 4YMVA 4EFNA 4TYWA 3PG5A 3QIAA 4DDUA 5EE9A 4DUGA 3FOZA 1NVUQ 1U0JA 1N6NA 2B8WA 2ZYUX 3L0OA 1YVDA 4TT3D 2WIBA 1UADA 3T1TA 2N46A 5JHGB 2HV8A 4DWJA 3NEYA 2QMUA 2ZS7A 3QNUA 2G1JA 3VKGA 5DSZA 3AGPA 1G3RA 4ZCLA 3VNUA 1ZD8A 3I4LA 2RGNA 4B2LA 1ONBA 1S1CA 1J70A 5IK2A 3ZIAA 3EZ2A 2RGDA 4MRNA 2A3RA 1SQ5A 5HR5A 2MMCA 4RFSA 4KODA 1XMJA 1AS2A 4OKSA 4TQ9A 2OZEA 4V0ME 1CRQA 2WSMA 1G9XA 1B0UA 2HYIC 2ZSBA 5IRCD 2CEAA 4MRSA 1NMYA 1Z2AA 4Q7KA 1KK1A 4URXR 2KBEA 1KI6A 4BEJA 1Q57A 2G1KA 3T1VA 1KAGA 3S1AB 3WP1B 5AUNB 3CPJB 1KMQA 4M1MA 2JLXA 4KSBA 2BOVA 4C0QC 5H8WA 3KQKA 4I99A 3WP0A 1Z6AA 3BIFA 1R2QA 2EVWX 1RFLA 2ZIAA 4HAXA 4II7A 2O8FB 1Z6YA 4A15A 1WMSA 1SVLA 1XD8A 2IK8A 2R6GA 1A2BA 1O87A 1YZQA 5EUMA 2NO7A 4RD0A 1DS6A 5EJEA 2CL0X 4Q7MB 4URZR 1VECA 1XEWY 2FSHA 2P6UA 3U3OA 2QMEA 4LGMA 3MGCA 4FMCF 3TAUA 5GJCA 1JBKA 3BAFA 3RC3A 1ZJ6A 4B3BA 4XH9B 4H9GA 4HDQB 1G1MA 3VFDA 1AKEA 4GOXA 1TQ4A 2ZRFA 5FPHA 1II9A 3CRRA 2QPTA 2ZSFA 2GBLC 2BMFA 5LBIA 5J4LA 3O47A 2XZPA 1VPLA 4M2LA 1HH4A 4LRWA 2C5LA 2AD5A 1AZSC 1AS3A 2H1LA 5TXGA 3A58B 2QZ4A 1OB5A 2NQ2C 2GILA 3RABA 1FPMA 1P2SA 4OJKA 2WWGA 4Q9KA 3ETLA 3LVQE 3S1AA 4QGGA 3AVOA 1K6MA 2RGAA 2IYQA 2IYWA 2H16A 4A82A 4KFTA 4MH0R 4W9MC 1G64A 3AKCA 1OXSC 2JCSA 2XTMA 5FPKA 1E9DA 2GJAA 3UPUA 3C15C 2F3RA 1ZC4A 1PJRA 2FPLA 1EGAA 4Z54A 2GWHA 5G3YA 1OF1A 1FP6A 4HYYA 5BYKA 2GJKA 4P32A 2C9YA 4A6XA 1F60A 4KXFB 3GJ5A 4JLVA 3NHAA 3GLHB 4JVLA 1E2LA 2JLZA 1NN0A 4HUTA 4EPYA 1FTNA 4NYIQ 2F1RA 3OAAA 4ASUA 3RS3A 4DT1B 2GEUA 2QSZA 1NN3A 3CX7A 4AURA 5F9HA 1N6OA 1GNQA 2OBNA 2OFWA 4H1UA 1KMHB 4KI0A 1IY2A 5TB5A 1CR1A 4M9SA 2PH1A 4C4PA 4ASUD 2B92A 3UWOA 5D3MB 1RC8A 3DVLA 1K5DA 1TU3A 2WTUA 2SHKA 2X1VA 2MSCB 2QG6A 3LBHA 3QG5A 2ZJYA 5HE8A 3QKRB 1AZTA 1SXJD 4TYPA 1C4OA 2PZEA 1SKQA 3SNHA 3MCAA 4MITA 3WNBA 5EP2A 3H86A 4A36A 1RKBA 1ZVQA 2O8DB 2V7QA 2VP2A 5JECA 4TMZA 5H70A 1FW6A 3IO3A 2NG1A 2V1XA 2ZE5A 3DM9B 1ZM3A 1RYFA 2QQEA 3K09A 5EE3A 4EJSC 1G4UR 2VF8A 4TYNA 4F92B 3I72A 4GRAA 1OXVA 3W6PA 3BERA 3RAPR 1OXUA 2ZSDA 1H8HD 3GLHA 4UNPA 5H1YA 3SQXA 1ZM9A 1DO0A 2HEIA 1U99A 1EFHA 1Z22A 4OYHA 4LBVA 3ICEA 1MRSA 4DT1A 4TTQA 4Z51A 1P62B 1I4TD 1TF7A 2GZDA 2NZJA 5C4MA 1UBCA 1W4BA 4OJQA 3VR6A 1KMHA 4XSGA 5JBQA 3I73A 2FGKA 5FBVB 4A8JC 3THXB 5HE9A 2ATXA 2HLDD 5BW8A 1HTWA 4TLAA 1OHHA 1QHYA 1VHLA 2WPDA 1QHXA 3A37A 3U4QB 1HUQA 1XMSA 2FEMA 4LJ6A 4LBYA 5D3MA 3QF7A 3SR0A 3FHTA 1NVXQ 4JT4A 1HY3A 1KSGA 3EPLA 1N2CE 1QVRA 1UKZA 3CWZA 3U44B 1GDDA 4BZPA 4DJTA 3EW9A 3DOEA 3QKRA 2XOKD 4OK5A 2QROA 1OHHD 2V6JA 2WPDD 3IQXA 1L8QA 4HAVA 4PAMA 1OFUX 2O8DA 4QNRA 2KJQA 2EWVA 4Q1EA 4QBFA 2B21A 2W6JA 4JLPA 1Z6GA 5EZ5A 3AVPA 2VSFA 4NZYA 4MRRA 4R9UC 4KVAA 4P3YA 1CR0A 1EWQA 1ZUIA 4US2R 1TF5A 2FOLA 3GJ3A 4OQLA 3FMOB 4DCVA 5BQ5A 3FYHA 3MWLA 4FN5A 1RJ9B 1OJLA 3A1TA 3A1VA 4BLSA 2W6JD 2IS6A 3Q9LA 2VL7A 3KQLA 2JASA 2UZIR 1ZBDA 1Y3AA 2ZI5A 5FR2A 4ACBA 4KITB 1VYVA 5KDDA 1XTQA 3AP1A 1DG3A 1N6LA 1ZNYA 2OEPA 4B33A 5BWMA 3THXA 5JRJA 4DLXA 1E2IA 2HCBA 2BIFA 5JCZA 3FMIA 4BRWA 4Z1MD 3U4QA 3Q8XB 2WSSD 4BASA 1NMZA 2XITA 3KKOA 4V0KA 1U2RA 3DPUA 1O3YA 1UDXA 4JBXA 3ECCA 4AG6A 3U44A 4CIDA 3SQWA 4BZQA 2WKQA 3QBTA 3AVYA 1E1RA 2V54A 1NMXA 1IXSB 2OLKA 4QRHA 2D7CA 1II0A 2DCUA 3NVAA 2Q3MA 4DLVA 2HJGA 4KBGA 1A82A 4JSTA 4QJ5A 3RSLA 3OIWA 4L4UA 3GFTA 1E1RD 1Q1ZA 3I62A 2MMGA 2GKSA 3L43A 3GLHE 2R65A 2GEDA 4NE2A 4OI1A 1RJ9A 1HE8B 1TPZA 1GILA 2C96A 4RD4A 4ZDWA 4ZCIA 4C0BA 3AEZA 2W58A 4A2QA 4Q18A 4JJKA 5IT5A 5JJIA 1HQCA 2G83A 4JYBA 3OE7A 4LPSA 4BGDA 4ZO4A 4IW3B 4JKYA 4Q7JB 5FPSA 4M9XA 2OV2A 4W5WA 2FFHA 5LD2C 4O0MA 4N1AA 1R8SA 4GI7A 5JS7A 3KJGA 1LNZA 3VR4A 3OIVA 1BMFA 1AIPA 1MH1A 4GL2A 3PIRA 2W0MA 3LXXA 1Q1EA 5CITA 1NJFA 1G20E 3T1QA 3B1ZA 2RHMA 3TSWA 5SZHB 2HF9A 1JQLB 2IS4A 2IX3A 4KAXA 1E2EA 4P0TA 3MRSA 3CNNA 4OK6A 1EK0A 1GNPA 3UXMA 3U6BA 2OG2A 1E1QD 1GL7A 3VLFB 2QMOA 5KSOA 3ZLJA 1QHHB 4DEYA 5E7MA 2RB4A 4PXAA 5ELXA 2J41A 2R2AA 1W0KA 4GBMA 1UEIA 3ZVMA 2QRZA 4BFYA 2G9NA 4FWDA 4AKEA 1XCGB 4LJ5A 3ASZA 3VU9B 3HU1A 1VG9B 1HURA 5HTKA 5SZKB 4M0LA 1W0KD 2DFTA 5F98A 4HZIA 1JQJC 2FNAA 3KZ1E 1DADA 1ZNXA 2DBYA 4TYQA 5KDLA 3ICQB 2G0NA 3PCRB 1W49A 3GLIB 1GZSA 5F9FA 1VIYA 1SVKA 3I5YA 2AFIE 3NH6A 4L8GA 3GJ4A 4LK2A 1OV4A 4CGZA 3TKLA 1EFCA 4FINA 3TSZA 2H18A 2UZ3A 2A9KA 3FPAA 1KSFX 4DC9A 1KK3A 4DHEA 1HEIA 3MUFA 2J7PD 2FJUA 4GP7A 5JCPA 2O8BB 2YVUA 1YHNA 1TQ6A 4AYWA 3PVSA 4B3CA 1X37A 1OH8A 2QE7A 3NKVA 3KB2A 4MYUA 4QL3A 1QHHA 3DKPA 1E3MA 2DWZB 4DRZA 1BKDR 1XCMA 3VKHA 1TF2A 2Q3HA 4OHZA 5JJKA 2FPMA 2OFXA 2GDJA 3NBXX 4G3XA 3VX3A 3VU9A 1KSHA 2QE7D 5EE0A 4F91B 1U9IC 1I2DA 3SBEA 2RHDA 1E2QA 3RRYA 1A1VA 4ACAA 2JIZD 4KYUA 4Q1AA 4TN1A 3T61A 3BFKA 2H17A 2XNSA 2ZYTX 1N25A 1RYHA 4F93B 3WNDA 4EIWA 3GLIA 4NYJR 3RS0A 3PUXA 1PVOA 2R6DA 4NYIR 5FTJA 1F5NA 2DWQA 2XX3A 1E2DA 4A1FA 5LB4A 2VRWA 6Q21A 4LYFA 2OESA 3CRMA 3AUXA 5FBRB 3CF2A 4NONA 4ARZA 5JLJA 2W2VA 2FFBA 3OESA 4P4UA 2ZS8A 3QVVA 4B6FA 4ZCMA 2CHGA 3LFUA 2KE5A 1DARA 4A4DA 4MDFA 1UJ2A 3A36A 2O8BA 4XOIA 2BWJA 3NG1A 2O0HA 3SU8A 1TU4A 1EFTA 4Q48A 4XD7A 4IFEA 2EFDB 3AKYA 4P4TA 2GK7A 2V1UA 1G3QA 5GJBA 2YOGA 2EQBA 1FMJA 4NU0A 2WBLC 4PTLA 3KQUA 1I4LD 4G1UC 1JXOA 1Q20A 4X8LA 3JVVA 1E9EA 4NCHA 1J2JA 1T3LA 5G3ZA 2BHRA 2VP5A 4A6PA 1MRNA 4F4CA 3SJCA 4CW7A 4QC2A 3B82A 4D4LA 4RCZA 5C4GB 2PEZA 1EESA 1DAKA 2BC9A 3WYAA 5TVKA 2V6ZM 3P4YA 4BUJA 1OPXA 2A5GA 2A78A 3EZ9A 3TUZC 1SULA 2ZVQX 3O8DA 4KLZA 1ESNA 5BN5A 4MUBA 1KK0A 2WWXA 4BLOA 4TSFA 1VG8A 3N5CA 4U00A 3RWOA 3ZVNA 3FMFA 3SFZA 2G0TA 2GCNA 4IDHA 1BS1A 1Q22A 3ADKA 1LY1A 1VG0B 4QGFA 4C0KA 4C2UA 2ANCA 5B30A 1A4RA 1YR9A 1G5PA 1DAHA 4JVNA 4AKGA 4DLZA 3KQHA 1GL6A 4RZUA 3L8ZA 5CB8A 2FGJA 2QGZA 4LUCA 4B43A 2OCYC 4BLPA 1XPUA 3AF1A 1T3HA 3EWSA 1U81A 3LX5A 1IXZA 3SYLA 4RVCA 4LYHA 2AD1A 5JI3E 1XWIA 2F1IA 4MDEA 1MO3A 3I32A 1ZM4A 3Q7QA 1FOEB 4JBWA 1OKKA 3SN6A 1G7TA 1QHSA 3UKDA 1DG1G 3K9HA 4V03A 3ZQJA 2ZRDA 4B48A 2H92A 3BD9A 4HUQB 4BFVA 2AWOA 3F0TA 4JS0A 5KHOC 1VCNA 4JL6A 3AVWA 2W6IA 3QEJA 3U7HB 4KHZA 4GFDA 4IDNA 2VYFA 3LBIA 4UNNA 3GLIE 1IM2A 1ZRHA 1NKTA 1CJUC 2OE2A 4GPTA 3UG7A 3TGPA 1RPZA 2Z4RA 1DAEA 1IBRA 421PA 1ZW6A 1M8PA 2VO1A 1E4VA 1ZUNB 2PMDA 3C14C 4BE7B 2O0JA 4NP6A 1NY5A 3MWYW 1NF3A 4PC3A 4Q00A 1DAGA 2ZE7A 4LJ4A 4K46A 4JVSB 4O2LA 3QSYA 4GP6A 1YR8A 1KI9A 2HXSA 5FFMA 1XRJA 4Q01A 3WMGA 1S3SA 4BFUA 4LHXA 1XJ0A 4YMTA 2CJWB 3W9YA 2ECKA 2BM1A 3AP2A 2DY1A 3B2EA 5FI0B 3OFND 4TTRA 1KO8A 4EPWA 4C0LA 4NTZA 4OI4A 2GAOA 3KJEA 1P6XA 1W0JD 2CLCX 2CK3A 4HDCA 5L3RA 2P6NA 4Z8XA 4PC1A 2XB4A 121PA 1NBMD 2B7BA 2DR3A 4P31A 3KKQA 3OZXA 3IKJA 4JVMA 2JJ1A 2OHFA 2IUSA 2QSYA 3QVUA 2YYZA 2JLUA 5HKKA 3WY9A 1QZXA 4LJAA 4C2TA 3ZQ6A 4MGZR 1FQJA 2FSGA 2EWWA 2GCPA 3CH5A 4GT1A 5AJWA 3B78A 4EFMA 4EPXA 1MABB 2REBA 2WM9B 3R7WA 4MRPA 2CNWD 3H0KA 1E2KA 4WOPA 1OFIA 1R5NA 1R0WA 2GK6A 3C5CA 3KJIA 4KLNA 1FNMA 1PUJA 2A5FA 3DHWC 4CT5A 4ZDKA 3TR0A 3FGNA 3KQNA 4DCSA 3QG1A 5KSPA 1M6NA 4NYMR 2QP4A 4B2PA 1GTVA 3OIYA 2BBOA 2AR7A 2JJ2A 4HB0A 2QY9A 4HEJA 5ANRB 4NL4H 1JR3D 3U3MA 4Q4JA 2EW1A 1NY6A 3W5JA 3EASA 3LD9A 3AVQA 1E2HA 3QEOA 4XIGS 4OK3A 4YXWA 5HCNA 4V0OA 2JJ2D 3ZZUA 4B2IA 4FIDA 3R9XA 2VHJA 5FTMA 4TT3A 5KOYA 3NBZC 4G5OA 1ESMA 1XFAA 2IYSA 4A92A 4HLUA 1D5CA 2V9PA 1ZC3A 4FI3C 2QM7A 3PXGA 5CM9C 5FTKA 3QF4A 4W5JA 5JSZB 2XJ4A 4YXWD 3GP8A 1Q0UA 1NIPA 2B8TA 2FSFA 3DMNA 4E5UA 4BEBA 2GJSA 2W2XA 3A1WA 4YDHB 2J87A 1MABA 4PPGA 3LO5A 4IDOA 3Q5DA 1SKYB 3KL4A 1Z0DA 2FE4A 2HF8A 1CULC 2WJHA 3I3SR 4C0JA 2WMNB 2REOA 4BWYA 5FH9A 2DYKA 4WXRA 3QQ5A 4KYIB 3K0AB 5BN4A 3LQRA 4WBSA 4EKDA 2JLWA 2PLFA 1FUKA 1G5TA 1KI3A 1IN6A 3RSOA 5KNCA 3LLMA 1TEXA 3ONWA 4LV5B 1RE0A 1HE1C 2O5VA 5L3VA 3TAHA 3MFYA 2D7DA 4OHVA 4BECA 1T0JB 2ZREA 1VKJA 5GVRA 5KDOA 2XB2A 1E9CA 2Z0MA 4B76A 1KNQA 1NVVQ 1IHUA 2ZUBA 1XZQA 1OFTA 1VTKA 2IYZA 3PV0A 4HZUB 4QJ4A 3RNLA 5KPJA 1QF9A 1W44A 2VHTA 3E5HA 3LWNA 4IDQA 4O25A 2REXB 3KTAB 4QBIA 4XTCS 5EUQB 3KKMA 3JVUA 4POAA 4YMSA 4W5HA 4Q66C 1JB1A 5JSZA 2C03A 2J0QA 4GMDA 1NLYA 3CPHA 4CDGA 4ESHA 3ZS8A 2EFEB 1OLOA 4TMWA 1CJTC 4JJZA 2IYUA 3PR1A 2NO0A 1ANKA 5JHHB 4FWIB 3K0CC 4UXJA 1JEEA 4U02A 1GITA 3TR5A 2WHXA 4F7WA 2NGRA 2OILA 1G8PA 3U5ZB 1Q1QA 3Q3JB 3K0AA 5CYOA 3B85A 1GNRA 2CLDX 4DSOA 1W7AA 2GJ9A 2OAP1 1F6BA 4K8OA 4TZ6A 1W5TA 4Q1FA 1P9NA 3W5IA 3QXJA 4Q9HA 1ZAKA 4PANA 3DM5A 1R0YA 1OH6A 1KAOA 1KI4A 4NDZA 1CU1A 1GKIA 4JSYA 1F3OA 4XJXA 3BFVA 4DBLC 1SXJB 1E79D 1YR6A 5F2EA 5FOUA 4HZUA 5G40A 1P9RA 2WKRA 1X1SA 2ZAOA 3GEEA 2Q6TA 5AUOB 5KNBA 1T8UA 3CUEF 3HYRA 3KTAA 5HCIA 2QM8A 2QGNA 1Z0AA 5HZHA 1GP2A 3TK1A 2ZE6A 2BDTA 1DBSA 5GADl 5B58C 2O8FA 2AXPA 5J40A 4AKHA 4GZMA 4LY6A 1G7SA 3CWQA 2EYQA 3K9NA 2ATVA 1SVOA 2IYVA 2P65A 1T5IA 2A5YB 4EAQA 1G16A 4BQSA 4CF7A 2DZOB 2P5TB 1YZLA 3IHWA 3KXIA 3ND9A 1S0UA 4RCYA 4X8HA 4JKIA 4BLQA 3DMDA 3SHWA 5DHFA 2XJ9A 1CJMA 4PAOA 4A0RA 1CKEA 3W3AA 2FN4A 3BB1A 4FMBB 3U3JA 1ZMXA 2QENA 3KFXA 1EWRA 3BGWA 4URWR 4UJ3A 4IDPA 4G5GA 4DSUA 1MV5A 4YONB 1U0HC 4IXNA 1KKMA 1QG4A 2JLSA 3W8RA 2BMEA 621PA 3CF6R 1SXJA 1SVSA 5E7IA 2J46A 4PAQA 4PR0A 4YMWA 2QT1A 1AM4D 1W47A 3EA5A 3B1WA 1U8YA 4PSVA 2KRKA 5EE5B 1EX6A 2WOOA 2GF9A 3DL0A 1XXHB 3MSXA 4DSNA 1PLLA 3WXMA 1JPJA 1H65A 3KB1A 2A2ZA 2XEXA 1H8HA 2BEKA 3EXAA 4CEHB 1Q12A 3LNCA 5JEEA 3D8BA 1UBGA 1YU9A 1P9WA 4M1TA 2QAGB 2PMKA 4D0LB 1SKYE 2ZRIA 4B3DA 2KWIA 3TLXA 1R7RA 1X1RA 5B2ZA 4DCTA 1D9XA 1KHTA 5IHPA 1K5GA 3BH6A 1KJYA 1IAQA 1KO1A 1D2EA 1NJGA 5FL3A 1CXZA 1UPTA 2AHOA 3RANA 1KI2A 3T34A 2HLDA 3I92A 2D4HA 2J0SA 2HUPA 1LS6A 1R8QA 2UKDA 1I2MA 1SVWA 5KTYA 2EFGA 4A2PA 4N0EA 3VTKA 3E70C 5G53C 2ZEJA 3UK6A 1F2UB 1LF0A 2XOKA 3A4LA 1X8LA 4Q02A 4E09A 4F4JA 5AJXA 1XD9A 2WICA 2W83A 2AKYA 1W36C 3QPWA 4QBGB 4A0HA 4TL9A 1XXHA 3G0HA 3IEVA 2DZNB 1MR3F 3K70C 4JLDA 2DVWB 1DEKA 2ODNA 1J8YF 1OIVA 1Z3IX 4QHSA 4CEHA 1NSFA 2F1HA 4RD1A 4L9WA 4LHVA 4HATA 4RD3A 1GIAA 3CZPA 4TWZA 2B7CA 3UG6A 2Q3FA 4JLOA 3ZD6A 3G82C 2GXAA 1UFQA 2P3SA 3NC1C 3QOFA 2GJ8A 2P67A 3SBDA 1IQPA 3I8SA 1CS4C 4Z1MA 5C1BA 4PHGA 4Q5IA 2KSQA 2WSSA 4MRVA 4BRUA 2YWEA 1W48A 3BB3A 5JWHA 4AWXA 1JR6A 5EXPA 1F2UA 1KDRA 3LXRA 1OYYA 2NO9A 3EC2A 5DNYB 5CIQA 3GLFB 3CO5A 2OXCA 3OEHA 4WZ6A 4MYTA 1SXJE 1E4YA 3LRPA 1KO4A 1XEWX 5B57C 4E03A 5LB2A 5KU1A 1OW3B 1SVMA 4TQUS 2QPOA 3BS4A 1G8FA 3GFPA 4KCGA 5EE1A 3QXCA 1DTSA 1YKSA 5FR1A 1R4AA 1KDTA 1IY1A 3OEHD 4B3GA 2AX4A 1CF4A 4KBFA 4OHWA 4LCBA 2D06A 1LVGA 1M34E 3PUVA 2AK3A 1G291 5KSZA 5EZ6B 3IO5A 2C8VA 2AXNA 3K9LA 2GRJA 2DFLA 3GD7A 3ZGXA 4JMPA 1S4QA 1YZUA 1OH7A 3AVTA 1S2MA 4NHOA 5DH9A 3EG5A 1ZYUA 1XD2B 1WCV1 4G01B 1KO7A 5DI3B 4ZKEA 4BFXA 2BMDA 2FX3A 1OE0A 3I5XA 2WZQA 1CLUA 1FQKA 1N5LA 3HWSA 2YNMA 2ZPTX 4AIIA 5JWOA 3THYB 4A2WA 4I1VA 1J8MF 1XDBA 3W3ZB 1MO6A 3IUYA 4TZ0A 4V0LA 4TL8A 2BCJQ 4MKIA 5FI1B 2ZYWX 3THWB 4HLCA 3CX6A 4FD2A 1L7VC 3HU3A 2CDNA 3GLFA 5JI2E 2PL3A 5FOTA 4DLSA 3C4JA 4PFSA 3WYGA 2G3YA 2E1RA 3D7MA 1Z28A 1JALA 4YDSA 2Z4SA 2IT1A 4ILEA 4B47A 4CYMA 2X2EA 4MKGA 5EP3A 2X19A 1EXMA 1XXHE 4QOSA 2HT6A 2WMOB 1XTRA 4D82A 1E1QA 1G8HA 2KB0A 3LA6A 4WXPA 1PLKA 1M74A 3NHBA 3C8UA 3BBPA 4IOJA 1HQYE 2VTKA 1KKLA 3IPXA 1GVNB 4M22A 2V8OA 1VCOA 1RRFA 2A30A 3FE2A 3AVUA 2FA9A 2NPFA 2HYDA 2ZTSA 2QAJA 2WAXA 2FU5C 4LPKA 1R5BA 2JDIA 2D2FA 1XD2A 5DI3A 3D3QA 3X1XA 1TQ2A 4WAUA 2ZE8A 4AY2A 3VX4A 3THYA 5SZJA 4DVGA 1VCMA 1SZPA 1ZCAA 4WA7A 5E7JA 2JDID 4LRSA 2GBLA 5EXSA 1VHTA 1BIFA 1NRJB 3THWA 4LC1A 2OM2A 4LHYA 3HU2A 4PQRA 3K0SA 4O3MA 3E1SA 4LYAA 2Z6VA 2ERYA 1WA5A 2VSXA 1KSJA 1R0XA 2C9OA 4KFUA 2J7PA 3GEIA 2ZJ2A 4PX9A 5FUVA 3TBKA 2NZ8A 1C1KA 1AQYA 2AWNA 3IIMA 3L2OB 4GSYA 4ITRC 2YKGA 1UM8A 2Z5FA 1G6HA 5HPYB 2QPAA 4DDVA 4MYHA 4O2RA 5AK0A 1S96A 2BKUA 2ZS9A 4PPFA 1CIPA 1E98A 2BBSA 5LDDC 4EPTA 5KYKA 2AKAB 2FFQA 4D4JA 2RKOA 1LFDB 2IHYA 2ONJA 4PPQA 1XTSA 4Q7LA 4EJSB 4YQFA 2GETA 1Z0KA 8OHMA 1GFIA 4HLUC 2OAQ1 3TW4A 3VR2A 2JATA 2CXXA 1KI8A 1S9DA 3QBVA 4JZKA 4N3NA 4XTRA 3EAQA 1T6NA 2BJVA 5EXTA 2JIZA 4PHHA 5GVSA 4QJ3A 1TUIA 2OBLA 2I1QA 1IN4A 1HA3A 1XZPA 3GJXC 4R2HA 4HAYA 4UNQA 4KO8A 2HCJB 4I1UA 2NOAA 4AKIA 1U94A 2F7SA 4HI0E 4IRUB 2IUUA 3REFA 3GLFE 1IY0A 1KZ7B 1CP2A 1RRPA 4LJ9A 1L4YA 4A8JB 3BOSA 3TIFA 1E9RA 1G8YA 1G18A 3EIEA 1VYTA 3BB4A 2ZSAA 2RGNC 3GEHA 4XVQA 4DIDA 2QI9C 1Z0JA 1LB1B 5J4KA 5EXXA 2J7KA 3VHLB 3IGFA 2IW3A 1E94E 3BH7A 2VA8A 3U3RA 4B35A 5EP1A 2JLVA 4IOMA 4DCUA 4PQYA 2VPPA 2PLRA 1Q1BA 4LZZA 1VYUA 1JJVA 3RRMA 3UWKA 2YC2C 3UATA 4KV9A 4EJSA 2QEQA 1G21E 1M2OB 1DAIA 1KY2A 1PZNA 2GESA 2WOJA 1KDOA 4URUR 2ZETA 3U2QA 2RCNA 1CJVC 1R6BX 1ZUHA 221PA 3BJIC 3T5DA 5D3QA 2BBTA 4I81A 2JJ8A 4JLAA 1WXQA 5CLQA 3TQCA 3GPLA 3GJ0A 3CBQA 2QP3A 2ANBA 3DO6A 3PUZA 3EWAA 4TLCA 4FMCB 2JLYA 2TMKA 3CIOA 2FWRA 4M1KA 1G3MA 1YJ5A 1ZD1A 5AWFC 1WBDA 3R8FA 2CBZA 3DZ8A 3L82B 3ADDA 1U90A 4HAUA 2VSOA 2W2TA 1ZNZA 2PCLA 5KSYA 4A8JA 5CDFA 1JECA 4TMXA 1ZINA 2FZLA 3AKEA 3UIEA 2Q9BA 3IEUA 2GAAA 3W6OA 1D8TA 1P7CA 4R98A 3M6AA 1D9ZA 1P75A 2QU8A 1N5IA 3ZZ0A 1YZKA 2IYYA 1KJWA 1Q44A 2IF0A 4URVR 1GM5A 2WJYA 4D26A 5FPYA 3GFOA 5GJWC 3CR7A 1FNNA 3SOPA 3IQWA 1J90A 1GOTA 3CX8A 1W36D 2CL6X 4QBHA 3UMRA 2BBWA 4HLDA 2IYXA 3AJIB 1E2NA 2ZU0C 3TNFA 1EFRA 5FTNA 4OI2A 1MKYA 2QTFA 2F9MA 2X2FA 3SJZA 5KO2A 1LV7A 5A5GA 5DISB 2YZ2A 3EA0A 2AK2A 3J81k 3L0IB 3T1OA 4PPNA 1W4CA 2J1LA 4LBWA 3OHMA 2WJJA 2ZRJA 3B9QA 4C30A 1EFRD 4GMXA 4URYR 3LDAA 3EZFA 1XEFA 2P5SA 3WMFA 4S35A 2F43B 3QENA 1WF3A 3SE0A 2RGEA 3MHVC 3LBNA 3C7KA 1E2FA 4PSAA 4AG5A 3ZVRA 3WYFA 1P4SA 1UEJA 1XJCA 2GHIA 3KUCA 4XSHA 1TAGA 2N1BA 1NLZA 5LD2B 2BMJA 3WBKA 1RVDA 2HDNB 1VG1A 1U0LA 3FWYA 2WV9A 2DWOA 3JZMA 1XBTA 4FCWA 4PO1A 2ODBA 2VP0A 2YWHA 5DIFA 1WBBA 4UXIA 3U7GA 3VR1A 2JGNA 4LV8B 4FW9A 1QDEA 3LH5A 5FUWA 3HPQA 2E87A 3OFNA 3IPYA 2PCJA 3WMEA 1W4AA 1IJFA 1UF9A 2ZI4A 1AA9A 1NP6A 4X8OA 1J7KA 3B1YA 2HXYA 5J5CA 2FEOA 5FUYA 2GVZC 2ZR7A 4ESVA 1W0JA 1X8KA 3HR7A 3ZZTA 4HAWA 4Z8YA 4OHXA 1Z83A 4PZYA 2ZITA 4C0SA 3VNVA 4JBYA 4IEEA 4EQ6B 1SHZA 5E95A 1NBMA 1MT0A 2BM0A 1G8GA 2D62A 2P6RA 4M8NE 3SJAA 4R71A 3GMTA 1AS0A 2O52A 2OLJA 4NMMA 1DO2A 5FPTA 3K09C 4Q9LA 3T15A 2F43A 1SVIA 1NI3A 3LX8A 4PHFA 4YC7A 3R9WA 1S9HA 4XWOA 3TH5A 3DZDA 4HSEA 4NBSA 1UKVY 3SEAA 2ZRCA 4HUQA 1T0HB 3WNCA 1PUIA 1UDWA 3FMPB 4GOJA 4M4SA 5CDFE 5HZKA 5J4VA 2FH5B 4Q03A 1UKEA 3R7WB 2CNWA 1BYIA 3KJHA 2PJZA 2XAUA 4N0DA 3GQBA 4D6PA 5TY0A 1T91A 2N42A 2RH5A 2V4ZA 5C18A 3FFBA 1TL7C 4B34A 2YJTD 2JAQA 2YWGA 1Q21A 5JZVA 3REGA 1GKUB 3CNOA 2OXRA 4C3ZA 5UKDA 1JR3A 2XGJA 1GRQA 2WWYA 3LW7A 2O8CB 2J3EA 1GL9B 4PC7A 2PX0A 1YE8A 1KI1A 1KJZA 5C2JB 5TMPA 1E2JA 3HPRA 4NCNA 4F38A 2QL6A 2CJWA 3AKDA 3X1YA 2XTNA 1TX4B 4EQ6A 2ZRGA 1KDPA 3CR8A 3NXSA 3TUIC 1S1MA 1BH2A 3ASYA 3KX2A 3N70A 3I8XA 2XSZA 1NVWQ 1N5KA 4TMKA 5C46F 5E4FA 4E07A 3LLUA 4IVRA 5AJVB 2IXGA 1E2MA 3NC0C 3RVBA 1OT3A 1N0UA 4JLNA 1LTQA 4KFSA 1E2PA 4JYCA 3HJNA 4TQAA 1E0SA 2H5EA 2ODEA 2QT0A 3MWJA 4M1SA 3TSOA 3L0PA 3RS2A 3MJRA 1NN1A 1G41A 2XSZD 2IA5A 2ZR9A 2R9VA 1T9HA
chains in the Genus database with same CATH superfamily
4GU5A 2EA0A 4ZI5A 3D8NA 3C9PA 3ZTTA 5BYJA 1H23A 3L7BA 4LZAA 1TTTA 2ONKA 1I0IA 4WT7A 1IH8A 1K8ZB 3BXWA 4RY0A 2J9RA 1QH8B 4BC1A 2FX2A 5B7NA 1YZTA 2PBFA 2A7QA 2FPRA 3DZBA 2BYTA 2OCAA 2VZEA 4UHJA 3UAVA 3WAGA 2VQSA 5IVPA 3PUYA 4R31A 1GRNA 4NXNB 2PX3A 3AR7A 3K0FB 1CZLA 4MUNA 2VAVA 2ZTDA 1YL6A 4PDIA 4DZRA 4CEJB 1CDZA 3GVCA 3R20A 2NV6A 3GHHA 3LUAA 3NHZA 2B5VA 1KXJA 3UANA 5AI4A 2WF5A 3LPDA 2JIOA 1T6YA 4TL6A 3F6EX 4Q1CA 1HV8A 3L0SA 1FJGM 4C0HA 2KA6B 4S12A 3L7OA 1ZISA 2GBGA 2W2QA 3LECA 4NI5A 2L19A 5BV0A 3P20A 3CV3A 2Z56A 5DGCA 3DDHA 5BSRA 4HLQB 3L0DA 2CNKA 3LUFA 3U6CA 3K0EA 4RDXA 5J4YA 3BE4A 1R4NA 4DRXA 5C53B 2O1EA 3DOUA 1PQUA 1EBFA 4IQ4A 1ZVVA 5EJIA 4DQLA 2QP9X 1YQGA 2CY0A 3LQQA 3FUTA 3TLJA 1D6NA 1TH3A 1XNGA 2LCFA 1YCFA 4JI0M 5DX8A 1XB2B 1M1NA 4IIFA 5TNXA 3COPA 5BSTA 2DUWA 2WWWA 1HFJA 2C5GA 3FPLA 4NDAA 3IBYA 2Q0SA 3D4PA 1Y1LA 2PU7A 1L3CA 1R88A 4BO7A 3MD0A 1TI7A 4B4UA 3GJ6A 1TADA 2I2DA 2FE8A 1D2CA 3UM9A 2QAGA 1X8JA 2YJNA 5HNKA 3UMSA 5AYVA 1CR4A 2JHFA 2JEOA 4H4DA 4FHEA 1M3SA 1V8DA 1L7NA 2XFTA 3X2EA 2IS1A 1W46A 3GDHA 1J07A 2XBUA 2B6HA 3JYHA 2BGMA 4CNBA 4HGNA 2J4DA 5HKOA 2C8LA 1CS0B 5LYJB 2C2MA 1RP7A 3RQIA 1JNXX 3S81A 3VMFA 2GJ4A 2HU7A 3RDPA 2JD1A 1P77A 4DYHA 4H7DA 3BTUA 1CQZA 1JHRA 1IHYA 4UDYX 1SOUA 4RD2A 3WL3A 4PZDA 3STVA 4DYDA 2NPIA 3LLSA 1FX0B 4FT2A 3PNBA 3HXLA 1OFHA 4YR7A 4ESEA 3DOCA 2DH5A 3R0JA 4B6EA 1CUYA 3QVKA 4P1ZA 1JEYB 3EZ7A 3M4ZA 5EQFA 3L6BA 4UU1A 1QIMA 3FYDA 3PXEA 3TVTA 3DDUA 4GXRA 5EFOA 1E1LA 3KOOA 1UBUS 2LVPC 3H9BA 4M8KA 4N49A 5B1DA 4D8TA 4XASA 4ROTA 4ZV4A 2ZYDA 1F48A 1RI1A 1X19A 1PU2A 2CP8A 3G79A 1AUVA 1C1HA 1TYAE 4N40A 4NLLA 3L6UA 2PH3A 4TRNA 2JVJA 3QOWA 2OBBA 4DMFA 1AZLA 3EVEA 2HPZA 2PXCA 1L4UA 1Z29A 4KGDA 1NXOA 2QRKA 2VKQA 1K8RA 1W36B 1X9IA 4FOPA 4BP9A 4HX2A 5JS8A 1MQAA 1X7YA 1ICIA 3RHFA 4ZARA 1T8PA 4HRXA 1N32B 1PEDA 3Q5EA 3K5PA 1T2UA 3S2GA 1APBA 1N8SA 2VUSA 5DI9A 3FYUA 1DBQA 2CXRA 4Z7JA 3L7MA 3E05A 5I7UA 2Q9AA 5EGSA 4OF4A 2F4VB 1RKQA 5G2OA 4OL9A 3MIZA 4PSCA 3RC2A 4L08A 4XFDA 3TLAA 2OAEA 3LF1A 4W5OA 1L5LA 5IDVA 3K70D 5BUSA 1VLZA 2AB0A 3NMUF 1U2QA 3DLIA 1K3FA 1XMIA 4K1XA 4D98A 1CFJA 2I03A 4HAOA 2AOWA 4OKIA 4GZ5A 3PU6A 4PO9A 2MSNA 3HGTA 4BMYA 2EFCB 3PUHA 3B51X 1CY8A 4BX9A 2IYFA 4KT0F 1LW7A 4GGMX 1DSSG 2ID9A 4NECA 4D9IA 1RHJA 3G2LA 5KOHA 1AUAA 3QY9A 1PNOA 1V45E 5TQ2A 3K2LA 2H57A 5AH0A 1E3EA 3NTOA 5G4LA 1VRVA 5DBIA 1L4BA 4KMMA 3OEED 2ODAA 4Q9IA 3ZW8A 4CNQA 4GOKA 5DTIA 4LOLA 4K05A 3PRHA 2P9TA 5M04A 4EA9A 1D2MA 4DL9A 4MEBA 4BX3A 1XA4A 2ODPA 5ILQA 3FWNA 4O4LF 2RARA 1K5HA 2DJ5A 4K6HA 2FPKA 5BORA 5CA1F 4GYWA 2M32A 3KCNA 1JPNA 4MR9A 5K4AA 4KW7A 3DFUA 2X4DA 2YIJA 4MGKR 1D1TA 3JYPA 2M1XA 2CLIB 4GSLA 3I4YA 1I0ZA 2JA2A 3MJCA 5ES3A 3DV0A 4RA9A 1JZQA 3VQTA 5J43A 8ADHA 4K9QA 1SELA 4UN2B 1WPXA 5JDIC 3GJQA 2Z5GA 4CR6A 3IJPA 5EYPB 1RYBA 3M6LA 4DUGA 2NQ8A 4KQMA 3TG8A 1QIKA 2WIBA 3A06A 1QAMA 4LY0A 4DIFA 1KZHA 3W6ZA 4U2DA 1ZA2A 5HR5A 4Y7DA 2FPIB 4GXTA 1MX3A 5D1HA 4GLLA 1E4OA 1I2CA 4N3CA 1TU0A 4Q15A 2FRXA 1Z6PA 2XA1A 1NUPA 3O0DA 1R2QA 1C30A 4HAXA 2H48A 1VI6A 1Y3DE 1RPTA 3N7AA 4ZD6A 3CKKA 4MZDA 2CL0X 1VBKA 4WNYA 2JB9A 4GOXA 1IRIA 2ZRFA 3DV2A 1LK5A 1BX1A 4MWOA 4IHJB 4PU0A 4M2LA 3EEBA 2JY5A 1AZSC 4I5EA 2QLTA 4K40A 2NQ2C 4W8GA 1SCBA 4HXGA 1TZ2A 3PF8A 4Q9KA 3ETLA 5DFLA 1Z35A 1YBFA 1YL7A 3AVOA 1K6MA 2PE5A 2WQZA 3BCSA 4TXMA 4JK3A 1ZC4A 1YDEA 4MAAA 2LVAA 1F60A 3M3HA 2V7UA 4OTZA 3U7QA 3OQIA 3O5AA 2GEUA 4P22A 3ZQ4A 1GADO 4PLVA 3AERA 4ASUD 2B92A 4TV8B 1UBRS 1ADCA 2R60A 2BR3A 1AZTA 2PZEA 4TMZA 1DIHA 3WL6A 3ZK8A 4ZT5A 3LCCA 2PLNA 2F1KA 3SQXA 3SZGA 3LFTA 3QVJA 2UUAM 4LBVA 3BPSA 2FUCA 4G2TA 3R5HA 3U4QB 3F71A 3TQTA 4KR9A 1EI9A 2JANA 3CWZA 1GDDA 2EW8A 3EW9A 2Q3DA 2QROA 2JD2A 1LSUA 1O08A 4IUCS 3K35A 3SF8A 1A0OA 2J3HA 2H3HA 1CQJB 1GFSA 3UCXA 2H7CA 5BO5A 2RI0A 3FYHA 1RJ9B 4I1RA 1XZCA 2RHHA 4U39A 3ZY2A 3DMGA 1Y33E 3TL3A 1QFMA 5BWMA 2L4EA 4LF4M 3OX1A 3JTMA 3W2IA 1M6WA 3B6IA 2B1RA 4N0MA 3TLKA 4ZT6A 1BX3A 4G0ZA 1TMGE 3IP8A 2DCUA 2Z3VA 3NVAA 5FO0A 1S7GA 2CC2A 4GKBA 4U2EA 3OMXA 3L43A 2GKSA 4ZDWA 4N18A 4XEHA 4WLUA 2OCDA 3CF6E 3CMCO 2QTBA 3RE1A 3U4DA 1J6UA 4O0MA 4KXUA 5JPIA 4GWKA 2W0MA 3U9SA 3TD6A 3T1QA 1XHFA 1IOVA 4KAXA 1E2EA 3ZGNA 3CNNA 1D6MA 3P45A 1QGDA 3NS7A 4IBBA 1MVNA 5KSOA 3ZLJA 4UBOA 1QHHB 4HVLA 4PXAA 2R2AA 4WFKA 3MBKA 3VU9B 1QQAA 3LSYA 2IZZA 2DFTA 3BULA 2FNAA 4TMYA 3GLIB 1VIYA 3ZHRA 4PG7A 4CGZA 2LP4Y 4FINA 3SMPA 3FPAA 5E38A 5IJZA 3NT5A 1QX3A 1CZNA 5FAKA 5JAQA 1X37A 3NKVA 4TKMA 1TF2A 2Q3HA 5JJKA 2PD6A 2Z57A 4GD3Q 5EE0A 4B0OA 5FV4A 1I2DA 3I0MA 5J3JA 4B7HA 2P1ZA 5JOQA 4NYIR 3CMMA 1E2DA 3DDWA 3VJLA 4E1AA 1ACLA 2XD9A 3E5NA 5CBPA 4MDFA 3RSSA 4UHKA 3UEOA 1YI0A 4K5QA 3FOWA 4AJNA 2NU8A 7ABPA 2YOGA 5KVCA 1I4LD 4G1UC 1GT91 2TRSB 1A8QA 3DMTC 4R2WA 2BEVA 3FWZA 1DAKA 3ZU6A 2HRRA 4EY4A 2A5GA 4GIBA 4BLOA 4U00A 4M99A 4X54A 5DMHA 1BS1A 1Q22A 1V41E 4C2UA 1XZNA 1YR9A 3G2KA 4P3PA 3C5VA 4LUCA 2ZJ0A 5BYBA 3CF4A 3BGIA 3E7FA 4CHTB 3GARA 4R3DA 2BZ0A 4UULA 2NV0A 1ADBA 3B38A 4GM0A 4QLOA 3GQBB 5LXTA 1DU4A 4QAJA 3M5PA 2QRHA 2PMDA 2IEIA 3QV2A 3PR2B 4C7VA 4IJWA 2XUGA 3R4CA 2I62A 3GJRA 4N5LA 1S3SA 1PV1A 4UTVA 1ENOA 5JPCA 2ET6A 2V0NA 2D5LA 2NUTA 3V5NA 1IY8A 3RFUA 2DR3A 4TXJA 1J1IA 5IC5A 4BMOB 2WU1A 3QX9A 5FX2A 8CATA 1ZGHA 4LJAA 3L9WA 4K3UA 3NBQA 3PJGA 1IEWA 2GCPA 1W73A 1CRWG 1ONSA 2QVXX 3WQSB 2AC7A 4DCCA 2QOEA 4PNZA 1FNMA 1VG5A 1Z5UA 2YW2A 4FC6A 1EWTA 5IKOA 1VL5A 3LD9A 4LMPA 4IGEA 1V11A 5IT4A 1RC0A 5KOYA 1FUIA 3SEFA 3EA4A 4HADA 3A1WA 1PL0A 2EIHA 2J87A 3C87A 4EMSA 1JW9B 4BWYA 1E59A 4LYDA 3MQ4A 1SUWA 4FGSA 3KR0A 5DULA 4GAEA 1SB8A 3ZC3A 3ZGOA 4KACA 3HCBA 3BMCB 4Y7CA 4XTCS 1Q2UA 4J7XA 3HWRA 4DC1A 2VNAA 1EE1A 3N75A 1U5BA 4DADA 4ZMSA 1GPNA 3D02A 2OILA 1Q1QA 1UFOA 4YK7A 2W6QA 3KUKA 4FBMA 5ENZA 1GKIA 3PFFA 3HKDB 1X1SA 3W4JA 1QFZA 2QM8A 3QGMA 3L1IA 5ALDA 1IHXA 3LLCA 3I39X 2GTHA 1S0UA 2XJ9A 3A9WA 4DNPA 4FMBB 5DEOA 4KWTA 3WGKA 4G5GA 1M2JA 2DXIA 2UXCB 2PDAA 4II2A 4FYMA 4B3SB 1QLHA 1M6YA 4EJFA 5IHPA 2VN8A 4MAMA 4ARSA 4DA7A 4JUDX 2C2ZA 3UK0A 1PRBA 4BYMA 1DEOA 3A4LA 1ZJZA 4MPRA 4QBGB 3WDLA 2WZBA 5E0KB 4RVDA 4TL9A 3G0HA 2TECE 2PUJA 4NQZA 7GPBA 4MPPA 4HNTA 4RD3A 5K3CA 1RXCA 5IREB 1CC1S 3K9QO 4OOFA 4IZOA 2CXQA 3CO5A 3BWXA 5B57C 4DQXA 3GFQA 1M2WA 5ALSA 4HMOA 3AUUA 5AVZA 5H37D 2AEFA 2QKYA 3OEHD 3RIYA 3FUUA 2GBPA 4GECA 1A9OA 2GN9A 1Y6GA 1QOQB 3SMQA 2DFLA 2PIAA 1G21B 4KHPM 3K1TA 1KHHA 4TLLB 2VRCA 2ZPTX 3THYB 3QJ5A 1JH8A 1JQDA 4RY8A 5IABA 4HLCA 4KQKA 4XQCA 2Z4SA 5GTDA 1JB0F 1X2EA 3X44A 3LUHA 4ZAYA 3KEFA 4WXPA 3W2HA 3BBPA 2IYNA 1E89A 1ICEA 1P31A 2PKQO 4UVHA 1VCOA 1U2GC 3O4IA 2FA9A 3BTOA 4BIIA 2D2FA 2MYTA 3ZYZA 2LTUA 1D0MA 1E4EA 1NPDA 2BFDB 3N3AC 5IASA 4MR7A 3NM5A 4DR6B 3C6XA 4H1HA 1QVZA 3ITKA 1UINA 2X7JA 2QG4A 4PF1A 3DBRA 2Z5FA 3KHTA 4X71A 3EXHC 4DG9A 4XRRA 2IHYA 1XTSA 2CFSA 4N3NA 3ORFA 4GPZA 1RWKA 1HA3A 1LTMA 1YLAA 3GJXC 3HI4A 3ZI7A 2O7NA 2UUPA 1KZ7B 2Y68A 1BDJA 3JR5A 1Z0SA 1UKCA 1XOIA 2WNSA 4DCUA 4HO1X 4RS4A 5D51S 4FYJA 3DQQA 2RCNA 4OM8A 1G2OA 2DBZA 4YALA 3BJIC 3AHHA 4GX1A 2OQRA 5AWFC 4HAUA 3UA3A 1YJBA 3IEUA 3C2QA 4WEQA 2CBXA 2KS6A 1WXIA 2IYYA 3NBIA 4QDJA 3CX8A 1W36D 1SUAA 4ZQGA 3O4GA 5FTNA 3EHDA 3P4UA 1EJBA 1O0BA 4MA5A 4CLRB 2A1UA 1U3WA 3VSCA 3T1OA 3E21A 4NRWA 3QV1A 1H6UA 5H83A 1Q7RA 4URYR 1H6DA 1Y8QB 1XMPA 1WF3A 3MHVC 3FDZA 2LR0A 4CUKA 2QUHA 1HNWM 1NW8A 3FCEA 1L7QA 4JBNA 3IOMA 4IJUA 4C4RA 4OHPA 1FFXA 5FUYA 2Q3JA 4NV3A 2YZNA 4HAWA 1VYHA 2AEJA 3R09A 2V9CA 3K09C 1Z5VA 4N3AA 3T15A 1S9HA 3HJQA 3SZOA 5B36A 1S7CA 3MD9A 4D6PA 1KS2A 3WZLA 5TY0A 3REGA 1GKUB 1AG9A 2OXRA 3PFCA 4C3ZA 4X92A 3KJNA 5D6NA 2PVSA 3RF7A 2IP4A 3OZDA 4N0PA 1BH2A 4JJ4A 3I8XA 1Y82A 5C7IO 1E2MA 4M76B 2QLJA 2J5QA 3CX3A 5E6RA 1ISHA 1YR1A 2ODEA 3RS2A 3MJRA 4LDRA 3C3DA 2YWBA 5FOSA 2C98A 2VTVA 1Z07A 2GD0A 1KARA 5K09A 5EKUA 1A8PA 3WG9A 1GO2A 3EXG1 2P9YA 3KKKA 1WKCA 3NH9A 3OZUA 4KDEA 3DE4X 1UMKA 5JXJA 4C0AC 2VHWA 2G9RA 3T8YA 3S7TA 4BNTA 1XK7A 4C7XA 3SFVA 1Z5AA 2NP6A 2BKAA 3WADA 1JFFA 3NAZA 1Y9EA 4QUAA 2XEPA 4LGVA 3E3NA 2PL5A 1MQ8B 1M75A 3VV3A 3EQ6A 3VHQA 2CWWA 2M2IA 3ANTA 2QN1A 2ZTCA 1TR8A 2WG2A 1JU9A 1P4RA 4M98A 4ZAVA 2JCXA 2QORA 3DS8A 3S68A 3L5OA 1J8QA 4KQCA 1KZGB 5KWVA 3ZS9A 3IIJA 1FTSA 2FZ5A 3JQGA 1ZXXA 1JILA 2EKKA 2ZCVA 1ECBA 4UOZA 3Q6MA 4JQZA 1AHHA 2XCRB 2CE2X 4OQXA 1XTUA 2YY6A 2B9VA 1R8JA 2FMHA 5JAZA 2AL7A 2O4CA 3HY5A 1NJSA 4LWZA 3EMKA 1XTPA 4HB3A 4KR0A 4E6EA 1Q3BA 3C41J 5CIYA 4EKGA 4YHHB 2ENWA 3PQ4A 1ESZA 4QVGA 5JY6A 3BE8A 1IIBA 2IOFK 4I8IA 4NFSA 3LDHA 1A72A 4H0CA 4N6NA 2JBAA 4FFLA 2E4ZA 2A1TR 4QULA 3WGHA 3KBOA 1MX9A 1CYEA 1KYTA 4IS2A 1F38A 4L57A 1CUHA 5ENDA 3JQAA 4A9AA 4XQ9A 4PZZA 4ZVRA 1O96A 3NTUA 2QJWA 2B4KA 1G71A 2GEJA 2OSBA 2XXAB 1KQOA 3Q2IA 4OB6A 2GZAA 4F12A 2J5BA 4HAZA 1KL7A 3L8HA 2F9LA 4FE7A 4Q12A 2HDHA 3Q7SA 2L42A 1VE5A 4YMUA 3MCWA 2IZ6A 3S99A 4PVDA 4QG7A 4PC6A 2ON6A 3F5FA 2FOIA 2QTVA 4DC0A 3UJ7A 2Y1EA 2CUTA 5I7EA 4MH0E 5LMUB 3O8LA 1JKIA 4F9FA 4FU0A 2NO1A 2P9GA 3NT4A 3C8ZA 4AUEA 4CN9A 1FFDA 1FDRA 1X1EA 1KFBB 2DCMA 2VPXA 2QRNA 4E2ZA 3HUDA 4OMUA 3EARA 3R2JA 2I9KA 1YTLA 1TGUA 3TZHA 4CDNA 4L6CA 5L8VA 2YXPX 2K5UA 1TM5E 1V96A 1IBKM 4KGXA 4H4CA 3A1UA 1EIZA 1L5SA 4KH0A 3QA3E 3PEUA 4AJIA 3TL6A 3EGCA 2DWMA 1GG2A 4WCDA 1M6HA 1HNXM 3K4QA 3ADCA 1KEUA 2WDPA 3ZE1B 2J67A 1G0OA 1UBKS 3ZU3A 1ZRNA 1YQ9A 1GEEA 1RPJA 2Q0QA 2V6IA 1Z4MA 4WNAA 3HUTA 4W7SA 4Y2JA 1YRAA 5D84A 3NBYC 4RPKA 3PJRA 4HDOB 3IPAA 3AINA 3ZH9B 3P9YA 1SK8A 3EFOA 2AV6A 3ZKWA 3K70B 4DLUA 4U8GA 2X58A 3U49A 3BIWA 2A9JA 5MN6A 4R1QA 2AQ8A 1T5DX 2JI9A 1EZ4A 5A0FA 3OWXA 3KOWE 4B8WA 2NZUG 1YQDA 2HU5A 4KLCA 1Y6QA 1RXWA 4ZKDA 4OHKA 4BMSA 2Y2UA 4EO4A 1BJTA 3B3JA 1HT0A 4HBGA 3O91A 5DTMA 3KPWA 4FVTA 4MDYA 4XWKA 3GUUA 2LWIA 2C1XA 2H1RA 3CLVA 4ADSG 1KOFA 2ZAGA 2Y8EA 1TYEB 4DLTA 4M9ZA 1NQTA 4F96A 4M0CA 2GQFA 1GKYA 1MC1A 4WA8A 2XYQA 2QXTA 4GGPA 1DC5A 3EGXA 3JVIA 3OZEA 3MS4A 3RC8A 4PO8A 1WSDA 2H31A 3LRXA 3PXCX 4ZTZB 4PONA 2GH1A 1USVA 4WBNB 2XUQA 1QM5A 5HG0A 4L50A 1OFGA 4L8VA 1AGRA 3E2MA 3PFIA 2C2GA 4Z1OA 4DA8A 2C1EA 3AHEA 1SKMA 2C78A 3GJ7A 2HBQA 3A7EA 1WMFA 3H5VA 4YIHA 2XXBA 3UAXA 1CJBA 5DT9A 3D2CA 4BQFA 5P21A 2GN4A 4YS6A 3B1XA 1Y6RA 1JHPA 1QP8A 1DV2A 9MHTA 4MQLA 4INAA 4TN5A 2A84A 2VYNA 4QXPA 4DLWA 1A5SB 2OFPA 5TX7A 1XZJA 2YWFA 4KN6A 4PZUA 1B74A 3IIKA 4CODB 3PE6A 3B5JA 5I3ZA 4PSDA 5KUTA 3U5TA 1RJFA 3ZUPA 3FAZA 4DDKA 3VC2A 1ZSYA 3CKLA 5GV7A 1V43A 4G0PA 1JLLA 4CJXA 5EE9A 5ELMA 2B8WA 2VDWB 3LBAA 2HRZA 2OA0A 1TO2E 5JD5A 4RMNA 4BU1A 3GFRA 2V8BA 4ZCLA 1AB6A 3VNUA 4MJLA 1SOMA 3EZ2A 3BE5A 4WDRA 1T36B 4RFSA 4KODA 4F3RA 1OA1A 1Z2AA 1MOQA 4J3JA 2H1VA 1DLIA 5HIJA 4EEKA 4OIMA 4P17A 1MUUA 4OGLA 5H8WA 3T5AA 3BIFA 1AVTA 1EH5A 2O8FB 5H9VA 4EHJA 2ACKA 2NO7A 4RD0A 1L5KA 2P6UA 3U3OA 2QMEA 3MGCA 3LI2A 1UIRA 5C8VA 4MHSA 3SC2B 4HDQB 1A4XA 1G8JA 1P80A 2IVZA 4NBVA 3S3TA 2XHZA 1Z2NX 5HIAA 1C8BA 2JAPA 2PSJA 3VBEA 2AN5A 1UC5B 5KNBD 4P32A 2QV0A 2C7GA 4ZK2A 2H9AA 4HUTA 1A8IA 4YCBA 3OAAA 5JAMA 4P4LA 4XVHA 1FSGA 2XKJE 2WHEA 1KMHB 2PH1A 1VDMA 2BP7A 4NBTA 4HYTA 3HKBA 1OQYA 1NR7A 4HGYA 2J08A 4CI9A 5HE8A 5AQEA 1NJ1A 3E5RA 4OUDB 4BGUA 1YQUA 5H70A 4OH7A 3HCEA 4KR7A 5HP4A 2BELA 1WXGA 1DO0A 4BCBA 3KLMX 4TTQA 3P2OA 1ZMRA 3AL0C 2DAEA 2AMLA 1CUFA 2O05A 1P5FA 1SUPA 2XADA 5ALEA 1DKRA 3USCS 2V6JA 3D0KA 2B21A 2VH1A 3SR3A 4KSYA 3QOXA 1A98A 3GJ3A 3FMOB 4YLYA 3SEZA 1Z5OA 5C3MA 2JASA 2V6GA 1VYVA 5KDDA 4O6VA 2FWIA 3INTA 3NDJA 2X4AA 2X1LA 3HEBA 2HCBA 5JCZA 3FMIA 4ECAA 5AD1A 3RSQA 2I67A 1O3YA 1UODA 3IODA 1TYCA 3FI9A 3JRXA 2QAIA 1NMXA 4DV0B 3I51A 4CTKA 2KW0A 2JCGA 1LK7A 5KQ8A 1V25A 3A6EA 1VPDA 3LT0A 4CF6A 4RD4A 4BQQA 1NHGA 4B0PA 3ESAA 2HCFA 5K3OA 4U7TB 1B42A 2XQFA 3W7VA 3ID6C 1JFTA 3P0FA 1DDGA 3BXHA 2RHMA 3FROA 3OFJA 4CM4A 4ROSA 3KWJA 3CC8A 1U2PA 1DXYA 5E6UB 2DTXA 4JELA 2R7NA 4DLLA 5IANA 2KZSA 2GPSA 4DEYA 4BEWA 4IZHA 5IN5A 3HLTA 1DT5A 3G17A 3ZWQA 1SURA 1ZNXA 3OJFA 1XRQA 2XB6A 3SLGA 3A1CA 4LK2A 1DC4A 4P08A 3DMHA 1GPLA 5JZOA 3HCRA 1MAVA 2DT8A 3UPDA 3QYJA 3COSA 2CW5A 1M8FA 3RJZA 2RI6A 3HUEA 1KSHA 2V9ZA 1GPH1 2BMWA 1ZLXA 4UPVA 3SXUB 4GX2A 3QTTA 1WS6A 5B1YA 3FJOA 3B36A 2H3EA 4QX6A 1YB4A 2NZVG 1GAQA 3V3TA 3WSWA 1UJ2A 1CB0A 4Y6QA 3IH5A 1L3BA 5IKPA 4KN5A 1EBBA 2Y99A 3PRYA 5F7XA 5F23A 2RAVA 1E9EA 2JBHA 3HNOA 1VSQA 3E9EA 5TVKA 2LE0A 4NHEA 3W8EA 4TKVB 1KK0A 2AUTA 4IDHA 1SN7A 3V6LA 2A1IA 4GE3A 3R6WA 3CGWA 5A6SA 3RYFA 4LQCA 4O4IF 3NANA 1U6IA 4NJMA 3OP1A 2JGRA 3TDMA 1SC6A 3TPZA 4E5YA 1VP3A 4JWTA 2Q4RA 2ECFA 1QMGA 3GAZA 1RPZA 2CLLB 1D6SA 1ZW6A 1E18A 1KERA 1NF3A 2H65A 4Q00A 4LJ4A 3C6YA 3E15A 4YI3A 4ZVOA 2X22A 1XRJA 1N92A 4WCFB 1TGVA 2MJ5B 1A9XB 5FBKA 3SX0A 4XGNA 3I6ZA 3DFZA 1P6XA 3HO6A 5K2MA 5EIBD 2HNAA 3WA7A 3KKQA 3N9IA 1P0PA 2IUSA 5KTOA 4X1OA 1JHQA 5HIIA 4R1UA 4C2TA 2KHHA 3VYTB 2OGUA 4GXNA 4DV2M 2HHJA 3CH5A 4L1KA 4GT1A 1WF6A 1K9SA 1MABB 2J9GA 4OQZA 1Y9DA 3OSZA 5IF3A 3ZXIA 1DX6A 1V3QE 1Y5LA 3QG1A 1Z88A 4PG8A 1G5FA 3U3MA 2EW1A 1BQ4A 4M9UA 1PFWA 4C21A 1YBHA 4DV3B 2EFYA 2BFEB 4DJJA 4M6WB 1BGWA 1HO3A 1OQAA 5KYTA 4L4YA 5KTPA 1I0LA 4BEBA 3KB6A 2REOA 4DJFC 4OG2A 3DKIA 5EHQA 3ER6A 2QNBA 2HWWA 2Q4DA 2GYVA 4L8YA 3VOTA 5GVRA 1D2GA 3DDOA 4B76A 2VXBA 3L77A 1GARA 4NE7A 4IDQA 2HV9A 3DYBA 3NHMA 1ZPDA 2VPIA 4CDGA 2AYZA 4EA6A 4ESHA 1CJTC 4CMIA 1JGTA 4PYKA 2B1GA 1M8JA 4DSOA 1V3VA 3BDVA 2F5OA 1F6BA 1P9NA 4Q9HA 3AJDA 1ZAKA 3H9JA 1R0YA 1F3OA 1P5RA 5AOVA 2WSYB 3CUEF 2FLWA 3GAMA 3FTFA 4OJNA 2DPGA 1V1MA 1G16A 4BQSA 1GZ4A 1YZLA 1QIDA 2Y0TA 4BLQA 2VXCA 4YWHA 2O1XA 3BMOA 3BGWA 3UNXA 4UJ3A 2O2XA 3LK7A 4YLEA 4DSUA 1A9RA 2YXLA 1SXJA 1ZRSA 4OLJA 2B0JA 2ZBEA 2GF9A 2HQOA 5HUQA 4DSNA 5DSTA 4KWCA 4IBIA 2OY0A 3LNCA 2NPOA 1WXDA 2V7TA 1KJYA 1IAQA 3DCYA 1MJNA 1H94A 1E6LA 5KREA 3H1AA 1GGKA 2JEZA 4MJ3A 2VQ3A 4BN4A 2IIPA 4WNIA 5H5JA 3NWPA 2CF5A 2BR4A 2X13A 5JDCC 1DEKA 1XGKA 1YJ8A 5BR8M 2GSDA 3C8DA 2Q99A 5TIIA 4PHGA 2GYWA 2YWEA 1IQ0A 4EUEA 1SXJE 1KO4A 5CHEA 4AB1A 1N2HA 4QG3A 5JQGF 4B3GA 1PZEA 3MT8A 3T5BA 3K9LA 2HK7A 2QD1A 1S2MA 5BQOA 8ATCA 3DE7X 2WVHA 1Y4ZA 2WZQA 1FQKA 4Z86A 2IEDA 5JC8A 3W3ZB 1XDBA 1C1DB 4QPZA 3RHTA 2CKDA 4RQTA 2MSKA 3A14A 3GVXA 3HU3A 5JI2E 3PDCA 2VDJA 3A04A 2TYSB 4FOOA 1XTRA 1DGGA 4PRKA 3NHBA 4JJ6A 4BJ6A 1UPAA 2R45A 2A30A 3HM2A 3FIUA 4UUPA 5DFAA 3VRHA 2JG3A 4RANA 4NIMA 5EWLB 5B1EA 3LW5F 1U1EA 1C7FA 1NRJB 4FFBB 2O54A 3HU2A 2JFUA 1JHUA 1WA5A 3CCBA 1F0PA 5BVHA 1PIWA 1R0XA 2GNPA 4DOMA 1X1DA 2ZS9A 3MIIA 3SHQA 1GRVA 2AKAB 4YY3B 4UW9A 5ER6A 2JATA 1NYLA 4AY6A 2YFKA 1PTKA 2KRUA 1LTKA 3NYWA 4HAYA 1HDIA 3GG2A 4KO8A 5H16A 2NOAA 3URKA 5TMEA 1CP2A 1JZSA 2L6OA 1CRZA 4K9SA 2YIDA 1TJNA 2VAWA 4ZT2A 1XL0A 3PC3A 3O4VA 3NRBA 1YRQA 4LFBM 3UATA 3IOCA 3BGVA 4L51A 3OC0A 3UUGA 1WXQA 1FYWA 4ND8B 4MI3A 2TMKA 2JFPA 4FTWA 3R8FA 1ULSA 2Q29A 4JOQA 3B7ZA 4NEHB 3ZY6A 3EDRA 1GM5A 5L3ZA 4WADA 5GJWC 3PDWA 5FLEX 4QBHA 5IAEA 1DCFA 1E63A 5EG5A 4DR3M 3SYRA 2HO5A 4LBWA 1XEFA 4Y1RA 3SE0A 3HDYA 2VT6A 3A6ZA 3LL7A 3WYFA 4P5DA 4OX9Y 3SIWA 1IG0A 3EODA 3MXTA 4PO1A 3T7AA 3BMNA 3LCJA 3RBXA 2POQX 3HPQA 1VIMA 2UVPB 1NUUA 3LMKA 4X8OA 1E61A 1IFXA 1X8KA 4P53A 5AW5A 3NUQA 4JA2A 2P6RA 3QIVA 1J9ZA 4WXYB 3ZX5A 4REQB 4U7WA 4R2LA 2ZRCA 5IDYA 2YRWA 4MROA 1BYIA 4EG8A 2Z2ZA 3CUYA 2V4ZA 1QV7A 4CWAA 4F8JA 1R2ZA 1MVLA 4E2WA 2FRDA 2C4MA 3N7TA 2FUKA 1IUNA 2AZDA 2XDWA 4F93B 5KMGA 1OLXA 5MFPA 1WIWA 1J8VA 4LFCB 2SECE 4LC0A 4IJQA 5A5VA 4C5AA 3DNPA 4D80A 1KYIA 4GZLA 1UQRA 2ABWA 4YRNA 1QQBA 3E9DA 4PAWA 2C42A 3CWCA 3LKDA 3SIPA 3ZDXB 2RIPA 1GU1A 1M7GA 1TVCA 1AK2A 3V3KA 1ZONA 5LMNM 4OAOA 2ID8A 4DVJA 1JG2A 1O9HA 3MT9A 1XZAA 5FTLA 3BIJA 4B6OA 1JDPA 1XAIA 3I0NA 1ZOOA 2HMUA 1CY1A 3AK4A 4PNPA 4FWTA 2GAJA 2JZOA 1CUGA 3JALA 5I7VA 2FLVA 1DX4A 1EM8A 3QKTA 3W5VA 1JUDA 3TDNA 4HEA1 5CB4A 3TLEA 2R84A 3FHCB 4TMVA 3GAAA 4YUAA 1NHWC 2P0EA 1QH1A 4AYXA 1EP3B 3F97A 2WYHA 1UDBA 1URPA 2DJIA 2YV5A 1O97C 4P3XA 3VR5A 4DB4A 3LY7A 1Z6XA 1OR8A 2JP7A 1G5RA 2LTAA 3ZEAA 3EPHA 3I6YA 4EOGA 1GHTA 4FHGA 4XK8F 2XYPA 4KXNA 3H2BA 3BD6A 3Q6NA 2XH8A 4FM9A 3H6KA 4OVZB 3AR4A 2IXEA 3PQ8A 1HL7A 1NOKA 4EJ0A 2H2HA 3GH3A 3JAWB 3LAWA 4IVQA 1CLEA 4ZI7A 3KT8A 1EDOA 2A5DA 4TTAA 3IRVA 3Q87B 1JI3A 3DUFB 4GKVA 3FVQA 5HJ2A 4IUBS 1ENYA 2I3BA 1DP4A 2HL6A 4D9NA 4CFYA 3R6TA 5E4YA 2I4NA 4CVNA 4AUKA 1QHGA 3DV9A 2I7TA 2YHIB 2WA1A 2EUCA 3OPXA 1GZVA 3MMXA 5KQPA 1N78A 1IHPA 2X7XA 3AM1A 2WHPA 4OVKA 1RIFA 2AOTA 2C2HA 4FILA 2Q2WA 4EJ2A 5G0SA 4JN6B 5CIWA 2VDBB 4EYEA 1L5OA 1ECFA 2AVDA 3QP9A 5B6IA 4D81A 2AT1A 4IRMA 4HXYA 5GONA 2QJOA 3OFSA 3HB7A 2HPVA 3E7DA 5DGXA 4ZA2A 3T7IA 1Y4SA 3FCAA 2BUCA 1YRBA 1WB6A 2WSBA 4EF5A 2Y1WA 2FP4B 4BJHB 1NRIA 5LWQA 1LVUA 4RNAA 3FLBA 1CY0A 4BKUA 4ZZ0A 4D3FA 3ADBA 4LYJA 4WZAA 3DD1A 1HE5A 2ZK7A 1KFEB 1YI8A 2I4TA 2IC5A 2F5QA 1RCUA 3DE2X 4NABA 4DY4A 2ZG6A 2OZVA 1N57A 1V8BA 4NYMQ 4UFNA 3ZCPA 2PZGA 2EYUA 3VNBA 2W22A 2HIHA 2JCYA 4ZPXA 1OBFO 1JZTA 4CQLB 1X7WB 2BSQA 3W6NA 4AXXA 3JV7A 2ZPUA 2Y6VA 2J0VA 5MN4A 5D01A 4Q47A 5KYGA 4I4TA 2LKCA 4RAQA 3ZD8A 5IJ0B 2YHBA 2QB5A 4KNWA 4LKOA 4XYGA 5JS6A 1UZUA 2PRZA 3AY3A 4KN9S 5DN6A 2BFCB 1YZ3A 3KNZA 3CUTA 3OM1A 2OXTA 1NM5C 3RV3A 1H2XA 7REQB 1RPNA 4WZAE 4MW4A 4XLZA 2IXAA 3QJYA 4CM5A 2PEYA 1WPGA 1E96A 4EG5A 2CXSA 1W1UA 5REQA 4EELA 3WLIA 1E2GA 2IYRA 2X9QA 3GJ8A 2GRAA 1FTGA 1N9GB 1XDUA 4OM7A 4J4BA 1F4PA 2AS0A 2AKEA 2C00A 4AI6A 1UJBA 3S7ZA 1V95A 3AFMA 3PLNA 1XTTA 2CXHA 2E85A 5A0TA 1V47A 1NPYA 4REOA 4ZU6X 3A2KA 3WTCA 3SBJA 3H2IA 4JV5B 3JARB 3EDCA 3SYNA 5D7NA 3FHOA 3ZTWA 4YECA 5TJ9A 1UFVA 1JAHA 3E9YA 1UPUA 5A4JA 4GWLA 4BDSA 3ENQA 3C5HA 4WSOA 2VHUA 2FDCA 2QVZX 1YZVA 3GVPA 4LK3A 4YPOA 1NVMB 3RB8A 1A9SA 4TLEA 1E0JA 2YS6A 2MSEB 1XDSA 4H18A 5JXWA 1SA0B 1PE0A 3RSZA 1Z0UA 4LBZA 2VJMA 2W6ID 2QUZA 2HAKA 1Y37A 1C3EA 3JZIA 5JT1A 3KAJA 2QL5A 1WW3A 2VTBB 1I4WA 3HB9A 3T7RA 3WBBA 3BRWD 4TTSA 2FDRA 2Q0HA 3R6LA 5AVJA 1XZBA 2ZIEA 1PGQA 2VZ8A 1LDYA 2MYNA 1BWQA