1OFHA

Asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
309
structure length
309
Chain Sequence
b'SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAGGAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
publication title Structure and Reactivity of an Asymmetric Complex between Hslv and I-Domain Deleted Hslu, a Prokaryotic Homolog of the Eukaryotic Proteasome
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 102
structure length 309
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ofhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ofhA01
1XCGB 4D26A 1IXSB 2HF8A 4Q9IA 3PUWA 3MD0A 5K8UA 3QIAA 5J5CA 2WAXA 3MAAC 3EG5A 1Z0DA 3RABA 3A58B 3FE2A 3SQWA 2N42A 1GOTA 4RSGA 5FOSA 4W5HA 4PQFA 4LCBA 4ZI3A 1NBMD 1VG9B 4HUQB 4DXAA 2GJAA 5FR1A 2XSZD 4UQOA 2O8FA 2A2ZA 1PLLA 2Q9CA 3KB1A 3VFDA 1KIMA 3EXAA 5CB6A 3BB1A 2OLKA 3TW4A 3KL4A 2ODEA 1VYTA 2D2FA 2WIAA 4JKYA 4MGYR 4AC9A 1OFUX 2G0NA 821PA 2FJUA 1JPNA 3GQBA 2P6RA 2JJ1A 2QSYA 4TQ9A 3LXRA 4HSEA 1QG2A 1QBKC 4NCJA 3A1SA 1UBCA 1P2TA 2VO1A 4DLTA 1SVIA 1LS6A 4DLWA 5DHFA 2NMVA 5E7JA 1PLKA 4OJKA 3LW7A 2QAJA 2JJ2A 4N3NA 5EE3A 1DO2A 3S1AA 1AM4D 4PC3A 4DSUA 1ZD9A 5G53C 4DSOA 4DVGA 3ZZ0A 4B6FA 1TEXA 4RKFA 1DEKA 1E2NA 4JLOA 4Q4AA 5B64A 5K8IA 3TVTA 5EXSA 1YKSA 4AYXA 3OIUA 4TYNA 2ZE8A 1ZP6A 4US0R 1XTIA 2UKDA 5L3SB 3AVQA 2O8BA 3EIEA 1G6OA 4JJZA 4P32A 4HAXA 5UKDA 3UWKA 5FPYA 3M4YA 4U00A 3EWAA 3NC1C 3PITA 3VR4A 4DLVA 4US2R 3L43A 2X1VA 4C0LA 1P60A 2CNWD 4FWHA 5BQ5A 3OEHD 3C41J 3THWB 1TUEA 2MMGA 2CMKA 5JJLA 2IUUA 4IXMA 5DI3A 5FI0B 1CBUA 1F48A 1M6NA 221PA 3R20A 4G5GA 3REFA 2YWEA 3KKQA 1P3JA 1WDTA 2GVZC 1XEXB 2CCGA 4NYIR 1EFCA 4A8JA 5CLQA 4WBSA 3MFYA 1Q3HA 2F43A 1GM5A 5KDDA 2I3BA 4QXAA 4NL4H 3AF0A 4FWDA 3PEYA 1GIAA 4YXWA 1DG3A 3E2IA 1LS1A 2F6RA 1BS1A 3RS7A 4IRUB 5EUMA 3W90A 2GCOA 1W5SA 1E2PA 3QJYA 1IXZA 2YC4C 4PHHA 1Q12A 4C7OA 4PC7A 1VG8A 4QNMA 2AN9A 1HQCA 4WOPA 1DS6A 3SDZA 3ZZTA 3KW6A 3HYRA 2OAP1 1AKYA 3TKLA 1WE2A 4A82A 1KI9A 2G1JA 2ZYVX 5KSOA 2IX3A 4XD7D 1HE8B 3DHWC 1C9KA 3L2OB 1IY1A 3C16C 1HV8A 1JEDA 1VDZA 3TQCA 4EFLA 1MO3A 4WAUA 2OUKA 4LJ9A 2EFDB 4PAMA 2GCPA 1GDDA 2ZRDA 3K0FB 3GLGB 2GKSA 3D7MA 1ZAKA 3QUSA 2W6ID 2ZS8A 4C4PA 4U7DA 1VCMA 1GKYA 4LJ8A 1N3BA 1M74A 3D3QA 2VQSA 2X2EA 2ATVA 1W5TA 1PLJA 2VP6A 3SC3A 1Q0UA 4MKHA 3DM9B 4DLYA 1US8A 3A8TA 3NHBA 5FBWB 1IAQA 2C03A 1F6BA 1VIYA 4Q4LA 4BASA 2CL7X 4D0GA 1VECA 3VTKA 3I8XA 4TWZA 2NO9A 1FL9A 4FIDA 4TL9A 1G6HA 2VA8A 1G8YA 4O0MA 4EIWA 4BGDA 3U7GA 1OKKD 4PC1A 2JJ8A 2CE2X 2KB0A 1S3GA 2WBLC 5JWOA 3C14C 3BH7A 1OFIA 1ZUHA 2IS6A 4GITA 2Z4SA 4R2IA 5K8TA 4B3FX 2NO1A 1S9HA 2GAOA 3OESA 4Q4JB 2G83A 2JAQA 2PLFA 4D80A 3AVOA 1AA9A 2FSGA 1NG9A 4PQYA 3IIKA 3BWDD 4NDZA 3SOPA 4EQ6A 3WYGA 1W2GA 5JBQA 4D81A 2Q3HA 1CKEA 1XZQA 4B43A 3W6PA 1IXRC 4ZV4A 5IT5A 5C18A 1CR2A 3RS5A 4Q01A 4WZBE 1ESNA 4I4LA 3H0KA 2YZ2A 4DLZA 2OE2A 4P31A 2ZPTX 3I3SR 4CEHB 1OT3A 1A4RA 3VX3A 3N70A 3X1WA 3GJ8A 4GBMA 5L3QB 2V54A 4IEEA 4PHFA 3EZ6A 1N5KA 4II7A 1LVGA 2BBTA 2P2LA 2PJRA 4LHWA 1HTWA 1KHTA 2GXUA 5IK2A 2PLRA 3CM0A 3KJGA 1KDPA 1OXVA 1EWQA 1TX4B 4A2WA 1MABA 2OXRA 3LX8A 5AJXA 1W49A 4KO8A 3DKPA 1LB1B 2HUPA 3CRQA 3SYNA 4LRWA 4NBSA 1FQKA 1UKYA 4MRVA 1XEFA 1IY2A 2R44A 1C1YA 4HZIA 3GPLA 1E2GA 2DFLA 4DCTA 2FX3A 2JLXA 2Q9BA 5JMTA 4XSGA 1ZYUA 4TT3D 5E7IA 5EQTA 4QJ3A 3BJIC 4URVR 1QRAA 1JQJC 4KBFA 3ECCA 2G0TA 4P4TA 1NMYA 5E3HA 4LUCA 2B92A 1I4DD 3CX8A 4I1OA 2O8FB 3SN6A 3AVWA 2KRKA 3CB4A 4AD8A 1W36B 5TB5A 3QXXA 1WBBA 3VNVA 3IQXA 1OXSC 4GI7A 4XSHA 1XF9A 3GJ3A 1Y3AA 4QHSA 5GVSA 3R8CA 2AKYA 3GEIA 2XJ9A 3LA6A 4O25A 1KK3A 4CZ2A 4FWGA 2XAUA 5FTJA 4US1R 5CIQA 3AVVA 2OBNA 3GCGA 1DE0A 3NEJA 4E09A 1R0WA 4Q1BA 2DFKB 2V6ZM 1SVOA 2H57A 3REGA 3S1AB 4A0HA 4CVNA 4EDHA 2JLVA 4TMWA 4C0QC 4MGZR 1G17A 4MRPA 3T1QA 3ETLA 4YMVA 4Q4AB 1PUIA 1Q3TA 1VPLA 1LNZA 4FCTA 2DB3A 4HLCA 3W9YA 3FKQA 1U94A 5DN6A 4TMTA 1CTQA 2RHDA 1M1YE 4C3ZA 3AVUA 4PSKA 1UF9A 2R6AA 3MWJA 3IIMA 3GLHA 4UJ5A 1VHTA 4EPTA 1G3RA 4QJ5A 2O8BB 1XB2A 1SQ5A 4Z1MD 1W7AA 3I61A 4Z54A 2F3RA 2WWHA 4Q7JB 2GNOA 4UNQA 1Z0AA 2ZREA 3SR0A 5GJBA 3PEUA 4K8OA 5DYIA 3RSLA 1OHHA 4BEJA 1A5TA 1KGDA 3RDPA 1KJWA 3K0CA 4M4SA 1XFAA 4JVSB 5DI3B 1UKVY 4GZLA 3TAHA 1G21E 1Z6GA 1SVLA 3AP3A 4A9AA 3PIRA 1YHNA 3K09A 4P4SA 4BE7B 2WIBA 4A8JB 1A7JA 1XMVA 3DOEA 4OK3A 2QRZA 1HH4A 1L2TA 2VEDA 1SXJC 1Z08A 5CYPA 1N5LA 3GJ4A 4DUGA 1S1CA 5BYKA 4Q19A 2QAGA 4OK5A 2KE5A 3HJNA 2Z0MA 3U61B 4M22A 4NU0A 3ZDQA 2ORWA 5FPKA 3QOFA 5JJKA 5CK5A 5AR1A 3AV0B 2PEZA 3ICEA 1KMHA 3U3MA 4OJQA 2VHUA 3L0PA 3TVDA 3DM5A 1O3YA 1P5ZB 4Q4HA 4YMTA 2IBMA 1Z0KA 1QVAA 3ADKA 4HDQB 1OLOA 3EZ7A 3WMEA 5CITA 3V4FA 2JLQA 3F5FA 1EWRA 2ZJ2A 1CR1A 4RZXA 1KI6B 3LY5A 4JSYA 5HTKA 3AF4A 4B32A 3K0AA 2G6BA 4AKHA 2WM9B 1U8ZA 5TMPA 1KDTA 3ZS9A 3SHFA 1P61B 1QZXA 2BHRA 2PZEA 2B7CA 1F5NA 3GJ6A 4BPBA 1HYQA 4J0QA 5EP3A 3O8DA 4DCVA 1AJEA 3CO5A 3ZIAD 3VMFA 2QMHA 4B3CA 4D2IA 2ZJAA 1ZIPA 1US8B 1IQPA 3DZ8A 2FZ4A 2VYFA 1YU9A 4HLQB 5C4GB 1E9AA 4C0KA 4IOMA 4JBWA 4R7ZA 3N5CA 3BS4A 2PJZA 5DSZA 2FFAA 2WSSD 5FBQB 3RWMB 4OHYA 1FTSA 1XTQA 3L8ZA 1Z0IA 2GWHA 2A5DA 2ZQ5A 3NBFA 3SBDA 3WP1B 3KB2A 1Q21A 4KFSA 1W47A 2QM7A 2YOHA 3FB4A 2N1BA 3GD7A 3KQKA 2V1UA 3FFAA 3KQUA 4TLBA 4AKIA 1A2BA 1DELA 2VIIA 1XEWX 3QKSB 2ZRFA 3KFXA 3HR7A 4Q9HA 3O8RA 4PPFA 4XH9B 4MYTA 3SJBA 2D74A 1P62B 4XWAA 4L4UA 2R2AA 3FTQA 2IUSA 2JIZD 3VLFB 5AUPB 3B78A 1E94E 1KK2A 3LRPA 3EPHA 3W6OA 4U02A 4BRUA 2QPAA 1YVDA 3OHMA 1IN8A 2A78A 1KI1A 3TSOA 2Q9AA 1ZM9A 2C96A 1NF3A 2P5SA 2DYKA 2D4HA 1N5JA 5GADl 4F92B 4C0AC 4YMUA 1ZU4A 1XRJA 4IOJA 2PMKA 2ERYA 5FOWA 4N1AA 2AFHE 4DB2A 3FOZA 2NO6A 3B8HA 4HEJA 2H17A 3KTAB 3QF4A 1OH6A 2LCFA 1JPJA 5KNDA 1P2SA 1UM8A 4KSBA 3TMKA 6Q21A 1W44A 4M9XA 2CCKA 3AP1A 4ZKEA 5FBRB 4M9SA 4OHWA 4RZUA 5FL7A 1MABB 2BMEA 4LK2A 2GILA 1D2NA 1KY2A 3F0TA 4IOLA 2I1VB 1Z63A 1HQYE 3H2YA 1E2HA 3H1TA 2GJKA 1TNDA 1EFRA 4Q18A 1E32A 1N6LA 1P4SA 4BLPA 3IILA 4DIEA 1NN3A 3LW8A 2N46A 2ZS7A 2VP9A 4FW9A 3GJ0A 4HZUA 2FZLA 2JLZA 2ZANA 2QQ0A 1KMQA 1EFHA 4P4UA 1K6MA 2VHCA 2ZI7A 1L7VC 4K81B 3UIEA 2OG2A 4YQFA 1E1RA 3ZQ6A 3PR1A 4MH0R 4NP6A 1U99A 4E5UA 4DDVA 1YR8A 2IHBA 1G5PA 2FF7A 4JJKA 1CLUA 1H8EA 1G41A 2MSEB 3CW2A 3LBHA 5HCNA 5CDFA 4TSFA 1KI4A 1NLFA 3QG1A 2D06A 3THXA 3SQXA 3AVYA 4PPQA 2KI5A 1ZM7A 3RS4A 2IUTA 3VNUA 1NVMA 3HYTA 1NMZA 1SVSA 4ESVA 1S8FA 2FWRA 2QE7D 2ZRGA 3SHWA 4GT1A 3LBIA 1RYHA 1TPZA 1U98A 4FINA 5J4KA 4RVCA 3RS2A 4CYMA 2JLYA 1MO4A 1NVXQ 5FUVA 4TQUS 2B8TA 2BKUA 5EXTA 2BDTA 3IO5A 4URYR 4Q9LA 2ZRIA 5HZHA 2ZRPA 4JLJA 1YZTA 4Y0AA 4CGZA 2RAPA 5FL3A 1T91A 3LLMA 3T06B 4AIIA 4IDPA 1ELOA 1NI3A 4RJLA 4DJTA 4D0NA 1Z29A 2NG1A 5HPYB 3TE6A 2GETA 3SS8A 4LHYA 3P32A 1BYIA 2ATXA 3AF1A 1DO0A 1ZD8A 1DAGA 2FFHA 3D31A 1HA3A 4BFWA 2FV8A 2VSFA 1V5WA 4M1WA 1AKEA 1QHXA 2OM2A 3MJHA 2E9SA 5H1YA 1XDBA 4DEXA 4X8MA 4B2LA 3LLUA 3RNLA 621PA 4AWXA 1DG1G 2ZYWX 3IBYA 5JRZA 2PBRA 4JLBA 4MQBA 4LPSA 4QGAA 5AK0A 4LJ6A 1GUAA 4QJ4A 1JAHA 2G9NA 2HJVA 4EUNA 4F4JA 1KSJA 4P4SB 4ZDIA 2FSFA 3QVVA 5L8VA 4ERNA 2FEOA 3EZ9A 4RD6A 4YMSA 1D9ZA 1E98A 3CWQA 4HDOB 2Y8EA 1V43A 2J87A 3UANA 2QAGB 3NTUA 2O8DB 3R7WA 4ZO4A 4G0NA 3SJCA 4URWR 3IUYA 1ZBDA 1AS0A 4QGFA 4TZ0A 4G5QA 4PQRA 3EPJA 2GJ9A 2W2TA 5DNYB 2CE7A 1KMHB 2HCJB 4JMPA 4Q7LA 2GDJA 4MDFA 4LY6A 4BECA 3QKRA 3DMDA 3FFBA 1P2UA 1W36D 3EIQA 1GWNA 521PA 1II9A 3UK6A 4LYHA 5EP1A 2JJ1D 5FBVB 1COWA 3TK1A 1OF1A 1IJEA 3LD9A 4CT5A 4GDFA 1WQ1R 4HDCA 2ZI3A 3K0AB 4IEIA 3GEHA 3U3RA 2IT1A 3OF5A 3KUCA 1CS4C 3L0IB 4IVRA 1W0KA 2JJ2D 1Z5ZA 2DY1A 4JBYA 2ZE6A 2P67A 2QENA 1P75A 4TQAA 4KYUA 3R8FA 2ERXA 1XD2A 1I4TD 1SVKA 4AK9A 4URUR 2XXAA 2D3WA 4S2EA 2OHFA 3FWYA 3KFVA 4C30A 5J4LA 5AUNB 1D8TA 1HT1E 2C95A 2XZOA 1XP8A 1Z6TA 1BIFA 2BMJA 2OT3B 4URXR 3T61A 4V0LA 1CJVC 1Z2AA 3IKJA 1N0VC 3D6TB 1ZMXA 2ZRMA 2ZYTX 1TF2A 2W6JA 2ZROA 5A0FA 2H18A 2HXSA 2J5XA 2H1LA 1NVVQ 4JLKA 2FSHA 1FP7A 3OFNA 2ZUBA 4TLEA 3MMPA 2ORVA 3QPWA 4ACAA 4B48A 2CEAA 1ZCBA 1DAEA 4I99A 2ONKA 5M04A 2WJGA 4Z8YA 2GCNA 2ZU6A 5J40A 3SZRA 2QUZA 3THOA 4A2PA 1TQ4A 3W3AA 3ZVMA 2CXXA 5D3QA 1U0HC 4N0DA 3V00A 4MKGA 1NVVR 3AGPA 2DR3A 2YJTD 1T3LA 1YR6A 4BFZA 3U44A 4MYCA 2YWHA 1A1VA 4TYPA 1YZUA 1O87A 3AM1A 2H5EA 3LV8A 5CM8B 3K70B 4YXWD 2REXB 3AVTA 2C2HA 2VBCA 3BD9A 2HCBA 1ZNZA 2GZHA 2QROA 3EC2A 2OFOA 3QNUA 1U90A 2WKQA 3CKLA 5A5GA 3LO5A 4BQSA 5EP2A 1XJQA 1IBRA 1N0UA 4FMBB 4CEIA 4GFDA 4KJZA 4A6PA 1JQLB 2QEQA 3CPEA 3QF7A 4IXNA 3QF4B 4M21A 2NTYC 5KTYA 3U7FB 1WBDA 3K9HA 1OW3B 4CIDA 4NYJQ 4RFSA 4LBVA 2FFQA 2P3SA 3WBKA 1H8HA 4CDGA 2VLIA 4TYYA 1FP6A 4BFSA 4QL3A 1XBTA 3VR3A 4D4KA 2EU8A 1H65A 3QENA 4GOXA 2ZVPX 5HKKA 1UAAA 3IQWA 4E22A 1Z06A 1W2HA 1T9HA 5DHAA 1CJMA 3R9IA 4QGGA 3DKVA 3LVRE 4LOAA 1HEIA 5KNCA 4L15A 2CLDX 2GBLC 3Q5DA 3T1OA 2Z6VA 4LGMA 1VHLA 2ZI5A 4FCVA 5HR5A 2RGXA 2J7PA 2BWJA 2KJQA 3P4XA 5IF9A 4ZDJA 1KY3A 1M8PA 1M7BA 3MWLA 3WYFA 2RKOA 3VR6A 3U6BA 4Q9KA 4A8JC 3BOSA 1HURA 3QPVA 2DFNA 5CK4A 5FUXA 4IW3B 1ZW6A 3ZH9B 121PA 3Q9LA 4HATA 1FTNA 4IHQA 4V0MA 2GEDA 3ZVLA 5K8LA 1QHNA 2NZJA 3X2SA 1KJYA 3OIWA 3ZLJA 1VG1A 2QA5A 3PXGA 1CRPA 1E2MA 1VYUA 1TUIA 2XJ4A 4JYCA 3IEUA 2YINC 3THXB 1RW4A 1ZJ6A 4KAXA 4Z51A 3U2QA 1G20E 2PX0A 3BB3A 4LRTA 2QY9A 3O47A 5JHHB 2ZVQX 4AKEA 4BLTA 3EIHA 3JVVA 1X8LA 3CIOA 2ZR7A 1Q22A 2ASEA 4PSAA 2EW1A 1S4QA 4KU4A 4A0FA 1U81A 2XTNA 2HYDA 3BFKA 1M2OB 1DPFA 2HEIA 1VKJA 3IIJA 1GG2A 2BBOA 1FX0B 1R0YA 1AK2A 4YDSA 4DWJA 1QF9A 3AH8A 4QKQA 1CF4A 4BRWA 2QZ4A 2XOKD 4RCZA 1YZQA 2PL3A 1KSFX 1WMSA 2VHQA 1ZNWA 3DVLA 3NH6A 2R6DA 3VR5A 4JVNA 4IDNA 2CHQA 5JCZA 1P9WA 4JLNA 4MKFA 2WMOB 3U4QB 5JJIA 1DAIA 1P2VA 2ZJ8A 4XVUA 2A30A 5C46F 1E79D 1G4AE 2ZRCA 4B34A 2CJWB 2ODNA 5IK2D 2GEVA 5FOTA 1RJ9A 4EPVA 1QHIA 4AYTA 4CEJB 1G7CA 1T0JB 1XJ0A 3HPRA 1I4LD 4JBXA 2ODBA 2ZJBA 5H70A 4JSTA 2XTZA 2AL7A 1NVUQ 1TMKA 3GFOA 3Q72A 1ZM2A 4TLDA 3TIFA 4ILEA 1G7RA 3WNBA 4C9BA 2G77B 1KNQA 1GITA 1N2CE 2REOA 2WWIA 4KXFB 2O8EB 4KITB 5KPDA 5CYOA 4TYQA 1X86B 3QEOA 2CK3A 3THYA 3OEEA 4ARZA 1DAMA 3R7WB 4TMVA 4EJSC 1UKZA 1GNRA 1JJVA 2X2FA 3AF3A 4X8LA 4F7WA 4K46A 2YYZA 2ZEJA 721PA 1B0UA 2V4ZA 3U7EB 3T35A 2CNWA 4AY2A 1Q44A 4IVPA 1TADA 3KZ1E 1BO6A 3AF2A 3IBGA 3OEHA 5AJWA 4KLNA 2IXGA 2XNDA 3X1XA 1SHZA 2BMDA 3BH6A 1R5NA 4RD2A 1E0SA 1NRJB 5B57C 3PJRA 3NDBB 1J99A 3BXZA 3P27A 5F3WB 1UADA 4LV8B 2C9YA 3U60B 1R10A 1U9IC 2IYSA 1S3SA 2BBSA 3T1VA 1E1QA 1G64A 2C77A 1DOAA 1IY0A 4RD3A 3I4LA 2IYLD 3BC1A 3PUVA 1OB5A 3O8CA 1GL7A 5FFMA 4ASUA 1II8B 4M1MA 1GTVA 2D7CA 3SEAA 2MSDB 3P4YA 4TLAA 1XD2B 1OIXA 2B8WA 2HJGA 3WBJA 1UPTA 1NP6A 2OLJA 3MGCA 5JI2E 5CDFE 5JZVA 2BKEA 2YWFA 5LB4A 5DN6D 2RH5A 2XGJA 1N6IA 4PPNA 2J0QA 4FXPA 4AKGA 1GSIA 1E4VA 3IGFA 3CNLA 2AKAB 1SKQA 1SVMA 2F1RA 4OHXA 2DWOA 1Z6XA 2IYQA 3B6EA 3W34A 4LYFA 2BCJQ 3SFZA 5G3YA 5J4YA 4C0JA 2QRNA 3RS3A 3CNOA 2DFTA 4H9GA 3X1YA 2J3EA 4LDJA 4JLDA 2P5TB 4U5XA 5TY0A 2FNAA 4CF7A 4XVRA 3I1FA 2AHOA 2IYXA 4PZYA 1HY3A 3RYTC 4B73A 2WOJA 3CRRA 5EZ6B 3VKHA 1VIAA 3WNDA 1LF0A 4BFVA 5DO9A 1EFTA 1DTSA 2IWRA 2I4IA 1DVRA 5F98A 3WNCA 2O0JA 2V1XA 1G5RA 1JR3A 4QHYA 4M1KA 4JL5A 2KBEA 1HT2E 2QMEA 2ZJ5A 1F3OA 3U44B 3ZD7A 2QBYA 3IEVA 3RC3A 2WWWA 4DUGD 3G0HA 4F91B 2IYYA 2Q6TA 1OKKA 1Y63A 1SKYB 3FHCB 2O8CA 4E03A 4B44A 4HAZA 1JECA 1IN6A 4HLUC 1OH8A 2ECKA 1IJFA 2YWGA 4BLSA 5FUYA 2FMXA 3ZJYA 3Q5EA 3A1VA 1E9CA 1RKBA 3DPUA 5F9HA 1CP2A 2WPDD 4EPWA 2KWIA 2F7SA 4EFMA 1YZGA 4GP7A 4PPGA 4RFSB 1W4RA 3ZYCA 3I5YA 3EA0A 4OI2A 2AXNA 4B76A 1PUJA 3MCAA 1X8KA 5KHOC 3AVXA 3SI7A 3RANA 1XWIA 5KNBA 4D4JA 5EZ5A 3CBQA 1FW6A 4P33A 3FKSA 4B2IA 2PH1A 5SZJA 2VP0A 3B1XA 2X8AA 3L82B 1AS2A 2WV9A 3WXMA 1TQDA 4DDUA 1OXTA 4G01B 1L4UA 4A1FA 2IHYA 4G5OA 1UEIA 2IS1A 4ZI2A 4A2QA 1Z8FA 4Q02A 1QVRA 1DAFA 2P6NA 3NKVA 1NSTA 1XD8A 3HU3A 1KOFA 1W0JA 2O0KA 2SHKA 3P1JA 4GMDA 1WXQA 3RRNA 3TH5A 2RGNC 1G16A 2R65A 5FBLB 4L16A 2KSQA 3DOFA 3V9PA 3A37A 3NBZC 1G8FA 3CZQA 1E2DA 2F43B 4M1YA 3I5XA 3JZMA 2C99A 4TL6A 4NE2A 1S9DA 1TAGA 5FPTA 4BLRA 3C8UA 3QKUA 2ZRLA 3CRVA 4XOIA 2GCOB 5EUQB 1IONA 4CW7A 3T1TA 4I1VA 4M1SA 3RC8A 3RWOA 4F4CA 2C9CA 4JKIA 1VCNA 4BZQA 4D6PA 4C7OB 3A1WA 4UNRA 1QZMA 1G8HA 1ZC3A 3LAWA 1SZPA 3GJXC 3IO3A 1QG4A 2QGNA 3K70D 1R0XA 1C1KA 2LWIA 1UBGA 1W4BA 1SXJA 1EXMA 4BFTA 2QG6A 3CPJB 1T8TA 4HI0E 4IFBA 3LWNA 4Q1FA 4TTQA 4XIGS 2WJYA 3B82A 3EZFA 3UG6A 2AD5A 2RGGA 4JN6A 1LW7A 1KO8A 4OI4A 4R9UC 5DISB 1R8QA 2JATA 4ZIRA 1YJ5A 1SKYE 3CONA 5EE1A 5P21A 4LHXA 1PZNA 4IDHA 2ZRJA 2VL7A 4LJ5A 3ADDA 2G88A 5FL7D 1SGWA 3L8YA 3VHLB 1F2TA 2DBYA 1W4CA 3K0EA 4GSYA 3QBTA 1LFDB 2J0SA 1BOFA 1Z0FA 3P20A 3QVUA 2ZR9A 3EWSA 3QE0A 1NJFA 5JEEA 2H16A 1U0LA 2R8RA 4DC9A 2JLRA 3B2EA 3RSOA 4Z1MA 4PX9A 2QMUA 4BZPA 3THYB 2IC5A 5FOVA 4ARZB 4MRRA 1GL6A 1EK0A 2Q21A 5CJPA 3TSZA 1AIPA 1L4YA 4Q1CA 2DHRA 1N6OA 2QN6A 3IDQA 2XZPA 2IF0A 3QBVA 2C8VA 1P73A 2GK7A 3JVUA 3TAUA 4BFXA 1E1RD 5B58C 2FH5B 4QM7A 5E7MA 2OESA 1OIVA 1OE0A 4QOSA 4EQ6B 3F8TA 1Q1EA 3FMIA 5EP4A 2PEYA 1RRFA 3C7KA 4B2PA 1XPUA 1E9EA 3QPUA 4B3XA 1H8ED 3IPXA 3KDSE 4QGHA 3K70C 1XPOA 1WRBA 3WP0A 3WHKA 4NCHA 4LX0A 2FG5A 1UKEA 5KOYA 1BYUA 2W2XA 3UMRA 4WZAE 3IPYA 4RKEA 2RB4A 5BXQC 3Q3JB 1FUKA 4W5JA 4OQNA 2RCNA 5JEDA 4V0ME 5BN3A 3QXSA 1QHYA 1TL7C 3BAFA 2IWHA 3CH5A 2ZSBA 1OXUA 5FH9A 2UZIR 4D25A 1KYIA 2DZNB 4NMMA 2ZE5A 2FDCA 1K5DA 1TU3A 3CX6A 4M8NE 4JLAA 2MMCA 1CXZA 1WCV1 5EXPA 3KQHA 1T4GA 4RD4A 1GZSA 3T12A 4R71A 1N5IA 5KSPA 1F2UA 1AZSC 4UXJA 2V6IA 1Z6YA 4WXPA 5B30A 2JLUA 2JGNA 5F9FA 3TUZC 5LD2B 2V7QA 2EWVA 1D2EA 3KX2A 3SU8A 1GFIA 2JCSA 4MYUA 3BK7A 2UVQA 5G3ZA 1C4OA 1MT0A 2WHXA 2JA1A 3CPHA 1ZRHA 2QTFA 3SJZA 1CJTC 4QBFA 1N6NA 3TQFA 2E1RA 3PV0A 5FPHA 3ZIAA 2ZYUX 4PZLA 1VYVA 2NPIA 2CDNA 2EYUA 1W1WA 1AGRA 3AVPA 1GRQA 3GFTA 2GESA 4KBGA 1ZM4A 3B1YA 3RRYA 5L3SA 3K53A 2ZUDA 3KQLA 5LPNA 1JXMA 2QBYB 1P9RA 2FFBA 2P0EA 3B1ZA 5EXXA 1CRQA 1E2JA 3HR8A 1ANKA 2IYVA 4MKIA 3CX7A 2H7VA 2XTMA 4EPYA 3T5GA 1ETUA 3EARA 2OO7A 4B75A 3EW9A 1VMAA 3TJZA 1K5GA 4LJ7A 2C9OA 1XNJA 3MSXA 4Y0VA 5GJCA 3THWA 3NVAA 5CIWA 3OE7D 3RRMA 5D3MA 4POAA 3VU9A 1GRNA 1P6XA 3ND8A 4OL0A 1SHKA 1TU4A 2P65A 3C5HA 4AG6A 3OAAD 4G1UC 4KSCA 4PR0A 2BM0A 3FMPB 1XEXA 2QU8A 2Z83A 1R8SA 2IA5A 1QHGA 2R62A 1WP9A 4NHOA 1QHSA 4V0KA 4FI3C 2JIZA 2QI9C 1W0KD 4QNRA 1RE0A 2ZTSA 4P3YA 5SZIA 2P6UA 4BEBA 4YONB 2FPKA 3GLHB 4C2UA 1LTQA 5J4VA 2J0UA 3WRYC 2FU5C 1X6VA 2JLSA 2QNRA 5JS8A 2V8OA 1E2QA 4Q1AA 1X1RA 4JT2A 1NMXA 4RFVA 5HE8A 4JYBA 4PSVA 4D0LB 2DWPA 4W9MC 4DHEA 1E3MA 4KVAA 2ZRNA 2AX4A 2V9PA 4DRZA 2GRJA 3PEVA 4V03A 2A5GA 3CNNA 1CJUC 421PA 1JAIA 1D6JA 3Q8XB 4M1OA 2HDNB 3MWKA 1G3IA 4FWIB 2YV5A 3KKMA 3CLVA 4GZMA 3OFND 5ANRB 5KDOA 3A4NA 1SVWA 4M53A 3KUDA 4GL2A 3LQRA 3LBNA 1WF3A 2OBLA 4OI1A 3PUXA 3GLGA 4CRWB 1E9BA 1M7GA 2CL6X 3DEFA 4NCNA 4JT4A 2DVWB 2E87A 4QG7A 1BMFA 1OSNA 3TNFA 1KKMA 1NIPA 1SULA 4Q9JA 1Z28A 1M34E 1DADA 4JL6A 4BLQA 3LXXA 3K0SA 5EE0A 3PVSA 5LB2A 3T5DA 2QP9X 1J7KA 1UDXA 1S1MA 1VCIA 2JEOA 2NIPA 1RRGA 4HB3A 1MH1A 3E70C 4OHVA 4Q4HB 4M1TA 3TGPA 1XEWY 3QI2A 4C2TA 4GP6A 1OYYA 4C0HA 1NVWQ 2F1IA 3BE4A 4WIAA 3H84A 3AP2A 1SXJB 2A7QA 2WVJA 4DIDA 2GJSA 2IEYA 1JR3E 1XXHA 5E95A 4QBHA 2PZFA 4RZ3A 4XWOA 2IXEA 1X37A 3D8BA 1IHUA 3LH5A 3GLIA 5KYKA 4ABYA 1MOZA 2IF2A 2ZIAA 2IS2A 4ON9A 2Z43A 3WYAA 3H86A 1OH5A 4OI0A 3TSWA 2OAQ1 4LHVA 3TBKA 1RFLA 2QP3A 1T8UA 1G1MA 2EVWX 3C15C 4ZDKA 3KKNA 4NZYA 3I92A 4JVLA 4NYMQ 1G291 1H8HD 3QKTA 5DE3A 4S35A 3SYLA 1F2TB 1ZNYA 1ZUIA 2JDIA 3WMFA 4A3VB 4A0GA 1GVNB 2J7KA 4NKRA 3B13B 3UXMA 2J45A 2AR7A 2KBFA 4HB0A 3NBXX 4PHTA 2A9KA 3MLEA 2FA9A 1WA5A 2GJ8A 1KDRA 2J1LA 4LHZA 4PC6A 1OJLA 8OHMA 2PX3A 1S2MA 2VF7A 1NY5A 5L3QA 4Q7KA 1QDEA 4DLUA 3GMTA 4H1VA 1OXXK 4V0NA 2HLDA 1GAJA 3GLHE 4DDWA 3Q7QA 2QORA 4BWYA 2A3RA 3U7HB 2J7PD 3CH4B 1E96A 3KJIA 4BLOA 1CU1A 1JBKA 1DARA 4IVQA 3BFVA 2BVNA 3OZXA 4LPKA 1Q20A 1GP2A 2F1HA 1W36C 3HDTA 2QSZA 1G8GA 1EG7A 3KKOA 4FMDF 1IOZA 5G41A 4Q21A 4FD2A 4M2LA 3UMFA 4DCUA 4A4DA 2IYWA 4LYAA 1GKIA 4ITRC 5C4MA 3RS0A 2RGCA 4QHTA 1AGPA 3UWOA 1TEVA 4UXHA 3X1ZA 2F9MA 4OQMA 4WW0A 3B1WA 3GEEA 2F55A 3QXJA 2EFEB 2ZITA 5BW8A 5FOUA 1CULC 1EX7A 1JALA 1F2UB 1ZM3A 2C5LA 2IXFA 1NLYA 4BUJA 1GNQA 4PO8A 5HE9A 5BWMA 5LDDC 2RHMA 5CB8A 3BBPA 4PZZA 2R6CA 5IHPA 3P26A 4PFSA 5EE9A 2ZSFA 4JLVA 1KDOA 4HAWA 4HAVA 1G18A 2QPTA 3AQ4A 1KSGA 1SXJE 4Q47A 5BN4A 2BJWA 4O3MA 4DLXA 5EJEA 1JR6A 3MJRA 4MUAA 2H92A 5TARA 5HZKA 1VTKA 2HT6A 4HZUB 2WMNB 2WZQA 2J59A 4NYJR 3FHTA 1JXOA 2NQ2C 3ZGXA 1RC8A 5L3VA 4KYIB 4GRAA 4HUTA 3JZAA 3NBYC 1NJGA 1I2MA 3MUFA 2HF9A 4Z8XA 2WICA 2YNMA 1XMIA 3EA5A 1XD9A 2VHJA 4GNKA 2YOFA 4QC2A 2AK3A 2CK3D 3OEED 2YC2C 3SYKA 4NYIQ 4PAQA 3Q85A 3K9LA 4OKSA 1BH2A 1G3UA 3VX4A 3NEYA 1X3SA 3PFIA 2GTPA 1CIPA 3HWSA 2GBLA 2OILA 3TR5A 2XNDD 1FUUA 1XTSA 4GOJA 4YMWA 2W0SA 5D3MB 3VU9B 2BC9A 1KI8A 2VSXA 3NG1A 2CCJA 2O52A 5B2ZA 2QGZA 1U2RA 1E0JA 1UFQA 1PV4A 2GXSA 1NBMA 2BEKA 3AUYA 3QY0A 4LWZA 4AG5A 2DWQA 1W48A 2XSZA 1LF5A 1ZVQA 1E1QD 5BYJA 3AKYA 1OPXA 3CZPA 2HXYA 2ZI9A 5JS7A 1OH7A 2EFCB 2AXPA 2W2VA 3N2EA 4NPHA 1J8YF 3PQCA 3W6NA 1KTVA 4G5SA 1ESMA 4UXIA 4B33A 3R9WA 4ASUD 2X77A 1E6CA 3I32A 2VP2A 1N6PA 2J0UB 2QP4A 3FYHA 2XITA 4LC1A 1TQ6A 1NKTA 1E99A 4NCIA 3BIFA 1XZPA 2NPFA 4TTPA 3EX7C 3PUYA 4HB4A 5JWHA 1NSFA 2HV8A 3L0OA 2QMOA 3OIYA 1ZC4A 2D2EA 5F2EA 4DLSA 2VRWA 2IW3A 3R9XA 2BJVA 4Q1DA 3ND9A 3F3YA 3U3JA 2IEZA 4NCKA 2GZAA 1E4YA 2GK6A 4M9ZA 4Q00A 3MG9A 3WHLA 2CHGA 1G8PA 2VTKA 4QM6A 1KI6A 4EFNA 4I81A 4F38A 1G9XA 1XCMA 2GA8A 4TMKA 3X1DA 5FUWA 3SE0A 2QTVB 3OIVA 4C0BA 4KV9A 4DBLC 4BFYA 4B3GA 3TLXA 4ZCLA 4XWKA 2C04A 1FNMA 4C0SA 2X19A 2ZE7A 4LYJA 4MRSA 1IN4A 1QHHA 4GMXA 1MO5A 2Q3MA 2GXAA 3I72A 5J47A 2EWWA 2Z5FA 3ICQB 3LFUA 4UNSA 1KI2A 2D62A 2CVHA 3RRZA 2GXQA 5TV2A 2ZAMA 3NWJA 2OV2A 1G19A 1JR3D 1AS3A 5FTKA 3FMOB 2OCAA 2AWNA 3QKRB 4BZXA 1OYWA 2BEJA 2YKGA 4NONA 3B85A 1FNNA 4MA4A 1KK0A 4B3BA 3UPUA 4B71A 5H8WA 4Q03A 1TF7A 4AI6A 3VAAA 4XTCS 1Q57A 4FMDB 3CRMA 3W3ZB 4DT1A 1GRRA 4EAQA 4LBWA 1XXHB 3LVQE 1YRAA 2ZRAA 3AEZA 4EJSA 4KFRA 1EX6A 3A36A 4JLPA 2OZEA 4KCGA 1VCOA 3BH0A 3ASZA 3GLIB 2GAAA 1P72A 2NOAA 3UG7A 1R5BA 4Q48A 3FGNA 3QKSA 2XXAB 2WAYA 5JLJA 4O2LA 1TTTA 1NLZA 2IL1A 1N0WA 4LZZA 2IYUA 2OXCA 4FCWA 2WTUA 1G3MA 1U9IA 5CM9C 2IS4A 2WJIA 5DGXA 1L8QA 1E2EA 4A15A 4PTLA 5JI3E 1AQUA 2PZGA 1ZCAA 2JLWA 1Q1QA 2JASA 2LKDA 3ADCA 3A6PC 4FMCF 4XD7A 4A36A 5LD2C 3ONWA 3SJAA 3UMSA 3NDPA 3FKSD 3KJEA 1U8AA 1KO1A 1ZNXA 2XOKA 5JSZA 2ANBA 4A0RA 3AJIB 2QT0A 4TN1A 2GF9A 4MITA 1OHHD 2O0HA 2W83A 3KTAA 1E2KA 2GF0A 2W6IA 4O2RA 3ZVRA 1JI0A 2WOOA 1TQ2A 4KVGA 1U0JA 4DSNA 1E79A 3HP1A 4HB2A 1W0JD 4EPRA 4EPXA 2ZJOA 3B60A 2DCUA 2WJVA 5CLLA 1GILA 3NC0C 1X8JA 2VPPA 1G7SA 4HYYA 1OIWA 2WWXA 1XMJA 4DCSA 1E0AA 1G3QA 2Q3FA 5TVKA 2BOVA 3EAQA 1E9DA 2DPXA 1RIFA 1NN0A 1P7CA 2CLCX 1XTRA 1KZGB 2YHSA 4OYHA 5LBIA 2R9VA 3BB4A 1J90A 4OBEA 1CJKC 1KI3A 3M1IA 3B7GA 1OV4A 3KJHA 4DDTA 2YVUA 1R0ZA 3C4JA 3B9PA 1MKYA 2MSCB 2D7DA 4ESHA 2J46A 3BRWD 4W7SA 2OEPA 1AZTA 3KXLA 3GLGE 4CEIB 4FWTA 3B1VA 1XTJA 3QQ5A 1IN7A 1XU4A 5JFGA 1E2FA 4R98A 2Q0HA 3K9GA 1MRSA 4B3DA 1R4AA 2CBZA 2AWOA 4PANA 4UNNA 1SXJD 2CHVA 2WWYA 4L9WA 1Z2CA 4GPTA 4ZKDA 2I1QA 5AJZA 1NKSA 4PO9A 2FPMA 4Q66C 3BGWA 1T5IA 4Q1EA 3VQTA 2TMKA 5C2JB 1YRBA 2RGEA 3FVQA 3I73A 4I1SA 3J81k 4HLUA 2ZI6A 1MV5A 4Q7MB 3DO6A 3CUEF 1XJCA 3O8BA 3W5IA 3GLFA 4XTRA 1PVOA 4ZCMA 2EFGA 1XXHE 3A4LA 5IDVA 1T0HB 3VR1A 1R6BX 3LQQA 4WZ6A 2ZUCA 1KI7A 3K0CC 3GLIE 2ZAOA 4KHZA 4F93B 1DAKA 5FI1B 4TZ6A 1OB2A 2ZSDA 2IYTA 3AUXA 1NNEA 5KPJA 2L0XA 3K09C 2DWZB 2ZJYA 3MWYW 4WA7A 5KU1A 1KK1A 1JB1A 3G82C 3T34A 4LBYA 2ZRHA 1KAOA 2XNSA 2QM8A 1GNPA 4IJMA 5KDLA 1M7HA 1JJ7A 1AQYA 2QAGC 3TR0A 3DZDA 4KODA 1I2DA 1U8YA 4LI0A 3EC1A 4M9QA 1NG1A 4TT3A 5EE5B 2QT1A 4IFEA 2G3YA 2QPOA 1B23P 2A5YB 2NGRA 1P9NA 2PCJA 2XX3A 2O5VA 4TTRA 2V6JA 4WVFA 2RGNA 5DYGA 1GL9B 4N0EA 2VP4A 2XB2A 5BN5A 1R7RA 2K5UA 3DMNA 2FGKA 1YZLA 1G7TA 4MGKR 2VHTA 4DEYA 5DLQC 1KNXA 2AFIE 2O8DA 1G5TA 1VG0B 1MO6A 3E5HA 4JZKA 1HE1C 5JHGB 3U3KA 1LV7A 4TL7A 3AKEA 2PMDA 3PG5A 2OFWA 1D9XA 1JNYA 5FTMA 3TRFA 4LJYA 4L5BA 1E69A 2FOLA 2QQEA 4G3XA 5JWRA 1Z22A 4MUBA 2OCBA 2ZXUA 2WPDA 2CVFA 1YZKA 3BERA 4ZPXA 1MR3F 1RJ9B 4XVQA 4OHZA 3VHXA 4TYWA 4XJXA 1N6HA 3MRSA 2V7QD 4TL8A 2B6HA 3CR8A 5DIFA 1NIJA 2ZRBA 4FMCB 3QEJA 1NN1A 2IYZA 1RZ3A 1WB9A 4NTZA 5JRJA 3V4RA 2C98A 2HT1A 1KO5A 1EFRD 2B21A 5SZKB 1Z0JA 2XEXA 1BKDR 1D5CA 1QHHB 3Q7PA 2ZI4A 3BORA 2VP5A 4YLGA 4PO1A 4DZZA 4B47A 4W5WA 3WY9A 4RD1A 5GJWC 2RGAA 1UEJA 2ZR0A 3N2IA 3U6KA 4QBGB 3GP8A 3B9QA 5FPSA 3AGQA 4LV5B 1Z83A 3CR7A 2WWFA 4QBIA 5AJYA 3TW8B 3K8YA 1YZNA 1PJRA 4MRNA 1KO4A 1J2JA 1F60A 3K1JA 4LC0A 1DBSA 3KXKA 1A2KC 3A1UA 5HCIA 5FTNA 4MGIR 1S0UA 1XTKA 1XX6A 4HAYA 4DT1B 4TSFD 5AJVB 4I1UA 2WJHA 2BMFA 2OBMA 3QXCA 4EJSB 3HPQA 3DDCA 4ACBA 2ZJZA 4JIMA 4NH0A 1YR7A 5E4FA 1E0KA 3PCRB 3CF2A 4RCYA 4RY2A 1FQJA 2GVDC 2F3TA 1NN5A 2BBWA 2ZU0C 3HU1A 4AURA 4DB4A 5AUQA 1DAHA 3H4MA 3UKDA 3TUJC 4HUQA 2W58A 4YDHB 1KKLA 3FPAA 1S96A 1ZU5A 2OCYC 4L9SA 3B5JA 1IM2A 4PC2A 3EZ2A 4OQLA 1ZIOA 2NO7A 3FDIA 1EGAA 2R6FA 2ZRKA 3VR2A 1NBME 4HAUA 1A82A 1ZINA 3NH9A 4D4LA 4V02A 1EESA 3KKPA 4QFMA 5JSZB 2AK2A 2BIFA 3PEWA 1JEEA 2IK8A 4LV6A 3W5JA 1KZ7B 2GEUA 2WKRA 3NHAA 4KFTA 1MRNA 2LKCA 5IRCD 2WSMA 4TMZA 1J70A 3AKCA 4LSGA 3NIBA 4LJ4A 4DKXA 1KAGA 5C1BA 2OSBA 2G1KA 2EYQA 3G5UA 5TDHA 3W8NA 3E1SA 2H8KA 1CEEA 5KSZA 3L0SA 3T15A 4EKDA 4B74A 4JL8A 4KFUA 3ZQJA 3AKDA 2F9LA 2V55B 3CF6R 1RVDA 2FEMA 4DLRA 2WSSA 4TLCA 2OFXA 5AWFC 1BMFD 1YR9A 3GFPA 1UJ2A 3I8SA 3RHFA 1ZUNB 3VKWA 1RPZA 1N6RA 2O8CB 1RRCA 2REBA 3ZZUA 3ZS8A 5FOXA 3U3OA 2VH5R 1IN5A 2Z4RA 3KQNA 2V3CC 1J8MF 4F4IA 4PXAA 2AD1A 5TXGA 4GOKA 3W8RA 3LX5A 1W46A 1D2MA 3M0EA 1X1SA 1K8RA 1FZQA 2FN4A 5KUTA 1COWD 2PT7A 4X8OA 3VKGA 3I62A 1W4AA 1ODFA 3RVBA 1T6NA 4DCNA 1FFHA 1XPRA 4OQFA 1Z47A 2XB4A 1LY1A 3SBEA 4LBZA 2ZETA 4MDEA 3ZD6A 3CF0A 1Z07A 2J0VA 1HUQA 1CR0A 3A1TA 5FR2A 1Q1ZA 3TUIC 5AUOB 2OCPA 4R2HA 1NL3A 3ZVNA 4D4MA 2CL0X 3WRXC 5J4HA 5SZHB 2WKPA 5G40A 3GLFB 3NXSA 1UBEA 2FGJA 2F1JA 3IHLA 1XCPA 2ODWA 3ASYA 4H1UA 4JS0A 4RD0A 2UZ3A 3ADBA 1R2QA 1N25A 4P0TA 4IDOA 3MHVC 2JDID 1FX0A 2GHIA 4HLDA 4CT4B 2W00A 2B7BA 4A6XA 1II0A 2QL6A 2C78A 2W6JD 3M6AA 5JECA 2ZSEA 5JCPA 2QTHA 1Q1BA 1OFHA 2RGBA 4BFUA 3K0FA 2PT5A 3U5ZB 4IOKA 3PENA 2HLDD 5DI9A 2A5FA 3FMFA 3A4MA 1UBFA 2A5JA 3KXIA 4OQXA 4Q5IA 3U4QA 2BV3A 2DZOB 1OFTA 4YC7A 4KLZA 3PUZA 1EFUA 2CJWA 2RGDA 2FE4A 2R6GA 4UJ3A 5GJVC 4D82A 4CEJA 3LDAA 4MYHA 1E9FA 1FPMA 2BCGY 2ZS9A 1CR4A 1YQTA 1FOEB 3QXHA 4IKEA 4JVMA 5CJ2A 2HYIC 2IYRA 1YE8A 1E9SA 3RLFA 2FPLA 2BM1A 2VSOA 4ZDWA 4AYWA 2J41A 4E07A 2O8EA 2ZSAA 3IHWA 2EQBA 4WXRA 2WWGA 5DH9A 4B6EA 2NO0A 1ZD1A 2ONJA 1Z3IX 2XZLA 1TF5A 1G4UR 3AB3A 1N6KA 3CWZA 1KSHA 4Q4JA 4DSTA 4OK6A 3OE7A 4IDQA 2WJJA 4ZIRB 5ELXA 1NY6A 5H68A 4V0OA 2W0MA 3UATA 2FSIA 1RYFA 3OAAA 4L8GA 1T3SA 1FMLA 2QE7A 3FHOA 1UDWA 3QSYA 1ONBA 3CRW1 3GJ7A 4LJAA 3SNHA 2CLSA 4A92A 2PCLA 4KI0A 3K9NA 4ZCIA 3EASA 1GKUB 5KO2A 5FTLA 4X8HA 1T3HA 1KO7A 5HKKD 1E2IA 1AN0A 2ZM5A 4G5RA 5KSYA 3HU2A 1II8A 2ANCA 4PAOA 5A4JA 3EPKA 4CEHA 4UNPA 3BFXA 4UKDA 2ORIA 1T5LA 1RRPA 4LRSA 3SFVA 4TMXA 1E9RA 1Z6AA 4QRHA 4NYMR 3WMGA 3RAPR 3QG5A 4M0LA 3DL0A 1E2LA 3EPLA 3LNCA 4URZR 5GVRA 5L3RA 1FMJA 2GZDA 2NZ8A 2VF8A 1KJZA 2EFHB 4PHGA 4RZ2A 1R5OA 3GJ5A 4B35A 1XMSA 2YOGA 3C5CA 3GLFE 4JLMA 4FN5A 2RMKA 2J9RA
chains in the Genus database with same CATH superfamily
5TMBA 4F5WA 4AP9A 5A5VA 2GAJA 4UBJA 5H16A 1KE1A 3EG5A 5BR8M 3PQEA 2SKDA 1XQ6A 4ZI3A 4DXAA 1BE0A 1RLJA 5FR1A 2XSZD 4NFLA 3KL4A 5GV7A 2D2FA 2I1LA 4Z4FA 3B48A 3VDRA 3H83A 5DCUA 3E23A 5LMCA 5HSGA 1ZVKA 3LW7A 1XE3A 4FHEA 4PC3A 3QSGA 1I5OA 3GA0A 5E8JA 5LOVA 3FVWA 1E3IA 2AA3A 2DWNA 1AY0A 4Z9YA 2C5EA 3DTVD 4XM0A 5FPYA 1C3VA 1IYZA 1UJCA 3QX3A 2IOQA 2IUUA 5FA5A 2GVZC 3EWNA 1I6WA 4HWOA 4A8JA 2R8OA 2OYRA 4F2WA 4UM8B 3ZHOA 5FNVA 3I52A 4I1IA 4O5OA 2PKQO 4I66A 2F6RA 2K9DA 1O1YA 2HDHA 4GXNA 4Q34A 4XE5A 2PN1A 1MO2A 1YAHA 3B51X 5EJFA 4O5AA 3SDZA 3KCNA 5D6NA 4XD7D 1CY4A 4ZRDA 2GB4A 1J5PA 3ODPA 2GCPA 1R8YA 1T3ZA 4BE9A 1B7GO 4F1KA 4DLYA 4PFKA 2X5NA 2XECA 1ZK1A 3IVAA 2CL7X 1ZV1A 3NASA 3RVMA 3WYDA 3LI2A 1CYDA 2AHMA 1MGOA 1E6UA 1OKKD 1V6SA 1SD2A 4Y30A 1SHLA 2O07A 4XFJA 3ABZA 2BGKA 4YAKA 2NO1A 1H3FA 1JG4A 4A0SA 3FY4A 2I76A 2FE1A 4ZVRA 1EFLA 5IT5A 4Z9XA 3OT1B 3L7OA 3FNBA 1A4RA 1Y7HA 3I2HA 2C9DA 3L7MA 1ISSA 4MQEB 4N5DA 4MWSA 1BVRA 1LJ8A 4PLGA 3D9QX 2G80A 1L2BA 4HOYA 1LB1B 2X22A 2HLPA 1OWNA 4D8YA 3EW7A 3E2PA 2G9QA 3QFFA 4K26A 5KYNA 3JRXA 4FYYA 2VK4A 3LP8A 3ZJ5A 2PJUA 1XF9A 2H7YA 4X93A 4NEQA 2GVNA 5JS6A 5ITTA 1YR3A 4Q1BA 4A0HA 1LWOA 3DT9A 1DNPA 2Y6UA 4WLEA 4IRMA 5A7GA 5A3RA 1XL1A 5JAMA 2V1CA 3KXPA 2I54A 4COOA 2OOKA 5KMGA 2I2WA 5DASA 4CM8A 2ODAA 4P4LA 2VVTA 4R0MA 4TKLA 1KMIY 9MHTA 2AMLA 1MENA 4B8ZA 4OK3A 1Z45A 1CUFA 5AMXA 1ML3A 1TVEA 1V1JA 2P30A 3BFJA 4O4HA 2Z0MA 3EA4A 4L4RA 3BMOB 5JY1A 2LD4A 2BONA 4XK8F 2PS0A 2G5GX 1P5ZB 2PS9A 3W2GA 4MUNA 2C94A 1XZNA 4NJMB 3DE2X 1TD9A 4W4TA 2FSVA 2B7CA 3PXAA 4UASA 5EP3A 1AIPC 3RC1A 3H5TA 2O3QA 1QYDA 4F2DA 4FGWA 5AOAA 1Q2XA 2FZ4A 1XA0A 3E9CA 1NVFA 1R88A 4Q15A 4CMEA 2EEZA 2PJZA 5GIPE 2XQKA 5DSZA 5DHPA 1CZKA 4K88A 3ZBPA 1WZ2A 3R3YA 4F4FA 3TCNA 4AUNA 3PNBA 4YUYA 1QRDA 5TJHA 5C7LO 2PO7A 1ZY2A 2QLTA 3HH8A 1R6UA 3EQ2A 1EJ0A 4CHGA 2IPNA 3OLCX 3IQIX 3QU5A 4P53A 5MGNA 2C3UA 1OFVA 2AXEA 1N5JA 5DMXA 3GMSA 1P81A 5ECYA 1ILEA 3UAOA 3WO0A 2PX2A 2ILVA 1X87A 2CFSA 2PSJA 4XASA 1SVUA 2QXUA 4W1PA 3PNSA 5FBRB 5KAPA 2GM4A 4Y2GA 4ZQCB 4YRDA 5GOTA 1FDSA 3KOOA 1GV1A 1E32A 4DIEA 3IILA 2P9JA 4EGSA 4BX2A 2JLZA 1KMQA 4DOMA 1L7VC 1PD1A 1N5DA 2WNIA 3U5TA 3OQVA 1IHXA 1CLUA 4N0QA 4BMNA 3I05A 1YB2A 3DBRA 1JU4A 2FWIA 4KPGA 2PA0A 1J4AA 3UK2A 3PX7A 2IZ1A 2RGOA 2FWRA 4XYBA 3CVVA 2Y66A 1K63A 1JKMA 2MOKA 3IO5A 4URYR 4Q9LA 2ZRPA 1RADA 4CGZA 1UR5A 2JL1A 4DV7B 2P9HA 2Y4NA 3M2TA 3FN4A 3Q9NA 3AF1A 3VM6A 2FUCA 1HA3A 2IIPA 4M1WA 5CTJA 4N40A 4AWXA 4OLJA 2AOXA 4MEBA 1WQ3A 1N1EA 4ZDIA 5L8VA 2UAGA 1CZOA 3FHJA 2QAGB 3AMVA 1MW8X 1WHTB 1N4AA 5E6JA 1QE0A 1QYXA 4TZ0A 2JGDA 4FZ5A 4B6SA 4G5QA 1MB3A 3NUGA 2R8XA 2IXDA 1WTAA 2HU7A 2E6UX 2I4NA 2HHJA 2EBFX 3I6YA 4YREA 3QZUA 3S70A 1P75A 4KYUA 2K7FA 1Y34E 4C30A 3GEMA 5AUNB 1OI3A 3CZ9A 3K2QA 5C31A 1Z6TA 4MLPA 1SK8A 1L3BA 4B87A 3ZCVA 1THTA 4DTIA 2X15A 3H2ZA 3UUWA 2R6HA 1JSXA 1PHRA 1SURA 1QIIA 2ZUBA 2W6CX 2G1PA 1ZCBA 2GCNA 5CBPA 4A2PA 5C5DA 4K8RB 3PZBA 2YJTD 4DREA 5CVEA 1YZUA 3G8AA 1TIKA 3BD9A 5AKYA 4CKEA 1SC6A 3WKDA 4IIEA 4O33A 3WB2A 5BT8A 4B7HA 5EERA 1U1GA 4MUKA 1TK3A 4G3OA 1ZOSA 5I9TA 3L0ZA 5JQWA 3U62A 2Q2QA 4X41A 4BFSA 3TSCA 1U8XX 1Y82A 1MC5A 5K1ZA 4FVTA 1LPSA 4MMXB 5ELLA 3RUCA 4LA4A 4RENA 4LOAA 5JIBA 3QTTA 3T1OA 4LGMA 1MX1A 1A5AB 4CMIA 1VHLA 3OOEA 4LGCA 3D8SA 2WK1A 4OVKA 4H0NA 2A86A 2WT9A 1FTNA 3VDQA 1FXWA 4QULA 1P4JA 1DV0A 2JFYA 3RYCB 1ZJ6A 4KAXA 5DM4A 3FVTA 2RHOA 2R85A 1QGUB 1NVMB 1X8LA 1ZH4A 1T5DX 2A9QA 4M7WA 4N03A 5E2AA 2CMHA 1VKJA 1OU4A 4AX8A 1R0YA 3NUQA 3ORRA 1N8KA 1DV2A 4LYYA 4UAGA 3IAS6 2CHQA 1R16A 3WYCA 4R05A 3GLQA 4OQYA 4FLFA 1HDIA 4JSTA 1V7PC 3TIFA 3ZE1B 4BCBA 4QXQA 1EQAA 4TYQA 3DL4A 1BWQA 5LA6F 4GX2A 2VWPA 3RIHA 2VZ9A 1OAAA 2WF8A 3AHDA 3OEHA 3P9CA 3HKDA 2C8KA 1KJQA 2Z3ZA 2IYLD 5JAZA 1FC0A 4U9IS 1K8YB 3Q2IA 4GLFA 1QZ3A 1U3UA 5ULLA 4IBKA 4KUGA 3CISA 5LB4A 3F67A 2J0QA 2G1UA 1SVMA 1X2EA 4BX8A 2C4HA 4X00A 1H4QA 3VK8A 3AY6A 2P5TB 2FNAA 2NM0A 3LUHA 1M73E 3ZU2A 4CNBA 1CVLA 4EY6A 1V2HE 3NVKI 1JDPA 2P2GA 1X77A 2CMDA 3BM5A 3AR8A 4YCBA 3FHCB 1IJFA 2PLNA 5H3LA 1FSPA 4IIFA 4GXQA 1WCXA 3D7LA 1CZLA 3PWTA 1CWUA 4JFAA 4J3FA 3HKEA 4LXTA 1B8NA 3DAFA 3Q6MA 2VJAA 1GPDG 1P0QA 3MCAA 1X8KA 3CE9A 5KNBA 2HMWA 2NPOA 3ROQA 1B1AA 2ZWOA 4EZBA 2PKWA 3OTOB 1L4UA 4A2QA 1Z8FA 1QGDA 3NKVA 4JI7B 2CEKA 2WWTA 1Q39A 3ZWDA 1WSAA 4YV0A 3B38A 5B1HA 1O94D 4OA8A 4XOIA 2GN8A 1ZMTA 3GELA 1MMFB 1Y9DA 3PI7A 1QZMA 2NXJA 3AEQA 1Q74A 1UBGA 4BFTA 4C4OA 1U2QA 2Z6UA 2MWMA 4DV1B 4BP8A 1R9GA 4ZP1A 2RGGA 2GN9A 1JWLA 4JBIA 5CXXA 1IMJA 4YROA 2G88A 3H42B 1W4CA 3NALA 4JY7A 5JEEA 1BXGB 3PP8A 3HGQA 1NNLA 2GD2A 1OA1A 4ARZB 2NYVA 5CJPA 3IDQA 1RXUA 1ZHHA 1B16A 4I8XA 1P44A 2CXTA 4LI3X 3F8TA 1RRFA 4RV9A 4Q4CA 4OMCA 4V0RA 3W1EA 3EGDA 5HJEA 3CLSD 5EIWA 2P5UA 4XWWA 1UEXC 4PCZA 4MROA 4LNUA 1YL6A 5I4BA 3AB7A 3HSYA 1B26A 4EO7A 1IWOA 5M7EA 4BO1A 1BGXT 1K66A 3BQMB 4MICA 1GFIA 2QTFA 1IY9A 2WJZB 1JYFA 2EYUA 1T5BA 2ZB4A 2CVOA 3K53A 1P9RA 1Q7TA 3BRCA 2H7VA 4J4HA 1ETUA 3TJZA 4RTKA 5LWQA 1XNJA 3RRMA 3H8WA 3SVZA 1AMNA 4RM2A 1GFWA 5JYDA 5KOJB 3SQNA 2IA5A 1RIIA 3F97A 2VPYA 4BEBA 3W5VA 1FYDA 1FU4A 3GLHB 3NGLA 3UYKA 3VPHA 2DECA 2QNRA 5EKTA 3IELA 5KOIA 4Q1AA 1NMXA 5A4KA 3GDOA 1U2DA 4UTOA 1C4WA 2EERA 3FDXA 1XYVA 1ZMBA 4OI1A 2G06A 2Q4OA 2QS9A 3TLYA 3DHEA 2HI0A 1TZJA 4BJ5A 3A14A 1NPYA 4H7HA 4CKXA 2JKZA 2QUKA 2W6PA 2IEYA 2ESRA 3N0XA 2EGHA 3KHSA 1GPKA 1E2BA 4RZ3A 5KYKA 5BV2P 4IICA 4U2CA 4OI0A 3UMJA 4X94A 1IMOA 4PVCA 1DCKA 5DE3A 3B7ZA 4S35A 3H6KA 2XMGA 1IG0A 1GVNB 5EMMA 2KBFA 2GD6A 3NBXX 13PKA 3ONDA 5L3QA 4HQLA 3KYBA 2HGSA 3FF4A 5KOHA 3KR9A 1CU1A 1JFFB 2WD7B 1DARA 2ZBDA 1TUBA 3HU5A 2OB1A 5LMUB 2C7GA 1FFBA 2GR9A 1GP2A 2F1HA 4EG4A 4RY8A 1N2SA 5ED4A 1IOZA 3F6SA 5MFZA 5C4MA 2OQ4A 3WOVA 2IYFA 4WW0A 5FOUA 4EG7A 4KAAA 2IXFA 4OX9Y 1EBFA 2EW8A 3IUMA 3BBPA 1OILA 4LF8M 1DIGA 1RLUA 4Y18A 1TJPB 2IZZA 3DP7A 3IVGA 1G4HA 3T1YM 3KSXA 2AJLI 5AW4A 3UFBA 3LVFO 3LUKA 3BICA 3UV7A 4MR7A 4C03A 1GUBA 2PPLA 3GT4A 3RF6A 3SPXA 1X3SA 2YXPX 1T3TA 2OOAA 4U2DA 5D3MB 1WV0A 1UZUA 3VAZA 2P0AA 4XLTA 3AKYA 4OFWA 3Q8KA 1J8YF 3PQCA 4HN2A 1VJ1A 1ESMA 1VE3A 1KEEB 1VLMA 3DLHA 5LQKA 5EJ7A 1ZN8A 3L0OA 4MJXA 3SSNA 3IURA 3CHYA 4GLOA 4RQAA 3LQ2A 3G9QA 1KI6A 4PGGA 4JOSA 2GA8A 2X8WA 4KV9A 1CB0A 3M1YA 3H9BA 4NWIA 2XYVA 2QUAA 1W96A 3NWJA 1G19A 1Q6ZA 3FMOB 3G8YA 4KL8S 3MGKA 2CZQA 5BMVA 3UPUA 5GY7A 5HCUA 3N0VA 1XZLA 1VEGA 1SCJA 4DT1A 3EBLA 4RAOA 2QJWA 3NVDA 4TS4A 4H16A 2ZIUB 3IP7A 2W6MA 3FYTA 3QEBZ 2D5BA 2CFTA 1LPAB 2EZ4A 1FLDA 2IYUA 1DDOA 5D1NA 5IAAA 2AR0A 1Q1QA 1I7QB 1SAYA 2WVGA 2ANBA 1IJBA 1WBJB 2GF9A 4DLLA 2JGMA 2JAWA 1VBFA 5FI5A 4B3SB 4DSNA 3IKTA 1NNUC 4LZAA 2B1JA 2WJVA 2AFIB 3P0IA 2WQZA 3KWFA 4QRDA 4R2JA 4Y2XA 3A27A 4F3CA 4GUAA 1XKQA 1OV4A 1QJ4A 1XAIA 4PSUA 1VYHA 2OEPA 5DGTA 4FFVA 5JFGA 1E2FA 7ADHA 3DJYA 1TCBA 1F14A 1YRBA 3O7MA 4MS3A 1NNJA 3CUEF 1JV2B 1VE7A 1OFGA 2DLCX 2HIMA 1LCIA 1DQYA 2ZAOA 4TZ6A 3JQ9A 3T34A 1KAOA 4UZFA 4LFBM 1R1DA 2BR3A 4IJMA 4ZGBA 4KODA 3EGWA 4LI0A 2H7XA 3HJBA 1QRSA 5A6SA 4KI7A 3CTWB 5B53A 1PGPA 5DYGA 1R7RA 3HBLA 4UHBA 2K5UA 1VGRA 2QM3A 3LUBA 5BR8B 4K9NA 2YDXA 2LXEA 2YJ5A 5DNYA 1W5EA 1T1IA 1EXDA 3LWZA 4RIGA 4XJXA 3G2NA 4Y2SA 4NTZA 5BQOA 1YT5A 4BJ6A 3HC7A 2AKEA 4D41A 3WY9A 4J0KA 4FDLA 5FPSA 4LV5B 1QYWA 3DXZA 2ILTA 1PJRA 3V1NA 1OVGA 3VJMA 3OT5A 5AJVB 1G59A 1YR7A 4Z4IA 4GZ3A 4DA8A 4RVGA 3VC2A 4HUQA 4F5YA 4Y9UA 2A1UB 2XVYA 1N7HA 1R0BA 3FRJA 1GCGA 5IJ0B 2FG7C 4HG2A 3PNOA 3CC8A 4D4LA 4MHTA 2IEIA 3O1LA 1YIDA 1XTUA 4YRKA 2LKCA 2P27A 4HK4A 1HE5A 1H4TA 1YCDA 3F6CA 2EYQA 4CIWA 1P19A 2F8LA 4OATA 3TXAA 4UUNA 1GTG1 1OAOA 1XZHA 3DFIA 4ZCQA 2VH5R 5T8KC 3RAFC 2Q8QA 2JIPA 1D1TA 3BGDA 1N33M 3QPCA 1V26A 4QTZA 1EGVB 1FFHA 3O8LA 4CGYB 3HNRA 3RUAA 4ANFA 1XNHA 5SZHB 2PUEA 1PQUA 1ZDMA 3PLAE 1A04A 1R2QA 1N25A 2MSLA 1G55A 3GVHA 3GNTA 2W00A 2O2SA 3NCHA 1TTHA 1OI7A 2VSNA 1XP5A 3IVRA 3D4LA 3UMBA 3BYZA 2JLCA 5FLKA 4CEJA 4C87A 4KE6A 1FPMA 1I7PA 4JVMA 2ZS9A 4ZDWA 1EM8A 1AZWA 1R74A 1QFYA 2F62A 3ORSA 1G4UR 4F11A 4OB7A 4I19A 1IOVA 2JEZA 1LBEA 5H68A 1ZW1A 4ECAA 3P0EA 1NRXA 4KMRA 2CLSA 3LX4A 3E61A 1GKUB 1LJLA 2V5VA 1T9GR 3GVXA 2ZM5A 1II8A 2ES4A 3FETA 3STWA 1YL7A 4M0LA 2NZ8A 3EDYA 5JXIA 3OWXA 5KWJA 5FLXS 5BR7A 4JWTA 2PH7A 2HF8A 5K8UA 1EPUA 1KORA 4ND8A 5ARDA 2WAXA 3MAAC 2J07A 4C7XA 1SB9A 3VDXA 4LCBA 3Q11A 3JQAA 1JG6A 4UQOA 5IDWA 1D0IA 1GPMA 4JKYA 3PC2A 3AJEA 1EYZA 3HL4A 1JPNA 1VBMA 3EGVA 1YJXA 1QG2A 2B34A 4MCJA 1UDCA 5AVJA 2TYSB 2QAJA 3A6DA 1ND6A 4CF4A 2YY5A 1Z4OA 5D7BA 4HAXA 1HLFA 3A3NA 3B53X 4KQFA 2IEBA 2GOYA 3R41A 3N87A 3THWB 3KBOA 4KWIA 2XTJA 5CFNA 4EHFA 2FZ5A 4CUJA 3OX2A 1HPLA 5KDDA 1PJ8A 1RTKA 3L1VA 4MLCA 2A92A 2OGTA 5E9JA 2RK3A 3D8UA 3PICA 1Q12A 2OO9A 5GM2A 2RE8A 1WE2A 1HE8B 4G25A 4RYLA 4BNIA 1ZEMA 4CMHA 1ES9A 1H94A 3AIOA 4QYIA 5AKHA 2F17A 3AEUB 4IUCS 1EFUB 4UHFA 1VIYA 4PYIA 1ZAYA 1L4LA 1U4SA 1G6HA 2VA8A 3C3KA 3O21A 5KTOA 1EK5A 2PG3A 4TUYA 1VJRA 4Q4JB 3OESA 4I6EA 4D80A 4Z0NA 2WSFF 1TQ8A 1PWEA 4B43A 1I7DA 3W6PA 4IGFA 2ZATA 1CE8B 2FZCA 2OE2A 5JPDA 4D8TA 2H06A 1RI1A 4HO1X 3UUFA 4MIOA 2B35A 5IK2A 2PLRA 5K7SA 4ETMA 2Q2VA 2ZQZA 3ILXA 4CKCB 1MABA 5JPCA 4CN9A 3PQ5A 4Y2JA 1Z5UA 2HK8A 3JSXA 4BQRA 1A88A 2R44A 3WLKX 4DV6M 4FBGA 1D6SA 3P9RA 1KZYC 3JQ7B 5ALFA 4MDHA 1JUDA 1HE2A 3R44A 1OIZA 1NMYA 2ZZKA 1JVBA 3HG7A 3BN3A 3CG4A 1HLDA 2PZBA 5KYWA 3GJ3A 1XCJA 3MNFA 3I6MA 4KGVA 1L3IA 5CIQA 5HKAA 2PGDA 4DC0A 2H57A 3ZPXA 3FCYA 1F06A 1TQHA 1E1MA 1G17A 1NXVA 3C85A 2DB3A 3FKQA 1UXHA 1ZJ4A 2CF5A 4UDYX 3IIMA 4H59A 2F5PA 1AMOA 1XC8A 1Z0AA 2ZREA 3IOYA 4K8OA 1Z3CA 2VWHA 4IIJF 1WCIB 3GEBA 1GPNA 4KC0A 4BEJA 2J33A 2GI4A 4TYMA 4RK6A 3UICA 4M49A 1A72A 4CISA 1DBIA 5LLSA 1QV7A 4O59O 1A7JA 4PYLA 2WLSA 4F3NA 5F23A 5C8DA 2EKBA 5JAUA 2Q28A 1V5IA 4AVYA 1M1ZA 4WKCA 3ICEA 3GAAA 3OM9A 1PJ2A 4CM9D 1O3YA 1CEQA 1DUSA 1BQ3A 5KWSA 3REOA 4PWZA 1JFRA 3E5RA 1L5LA 4AKHA 1U8ZA 3HNPA 5TS2A 1ADJA 3U6PA 1EA5A 3HN2A 4GMKA 1CUWA 1YU9A 5C4GB 2I62A 4HQ6A 4RF5A 4Q3EA 1ICEA 3IAM6 1WW2A 2FFAA 3MJFA 5FBQB 3IB3A 4L6CA 1XRRA 2GWHA 5EPEA 4IY1A 2QM7A 5K0EA 2N1BA 3LCMA 2V1UA 1E4EB 5CAEB 4J7UA 7ABPA 3F4KA 2AEJA 1I9CA 3KFXA 2EKQA 4PPFA 1TTEA 5B4TA 2IY8A 4RTPA 1P62B 2ZB7A 5K6AA 1AGYA 2CF6A 3TD2A 3ZI0A 4DHWA 3VLFB 1TR8A 3M6UA 3QVTA 4ZT4A 3TSOA 3S8MA 3EHDA 1MJFA 3NHMA 1M6WA 1L2CA 5HKOA 3VGJA 1N7JA 3OI7A 2VHVA 6Q21A 4LK2A 3WGJA 3DD5A 5K2MA 4L5IA 1NN3A 1HBJA 3Q12A 3OUZA 4IIJB 2VYCA 3EZNA 1P8AA 2LTUA 1U1IA 4NEGA 2ZIWB 4J0HA 1ECPA 2PRSA 1H8EA 3EUWA 5HCNA 5TGZA 2M98A 1EXNA 2KI5A 2R4JA 5C1DA 5IC4A 2OZPA 2NUAA 2Y0DA 1VSVA 3N7UA 3ZEAA 1DQSA 1MO4A 5FUVA 1UWKA 4C5CA 3HHYA 2NXEA 3PF9A 2JFNA 1P7PA 1UP4A 2C5RA 3VU1A 2GETA 5DEIA 3QE2A 2NQ8C 4OM8A 1AKEA 1Z82A 4DEXA 4QODA 1JBEA 4QJ4A 4GX1A 3HCBA 3L6CA 1W93A 1L7PA 3EZ9A 3NTUA 5BVGA 1YLAA 1OV6A 3G59A 4IBGA 5FO1A 4JMPA 2FH0A 1XTPA 1SQ6A 3QU2A 4UTRA 4LYHA 3MJSA 5FBVB 1OF1A 4I4TF 3GFVA 3OBIA 3U3RA 3MELA 5A9SA 3JASA 3SQLA 3IE0A 4IV5A 1P77A 1AA6A 3PE6A 2C95A 4K86A 5EJ2A 3MJCA 1N7IA 5CT9A 1O6ZA 3AM5A 4YLYA 1ADBA 2H18A 2J5XA 1UM9A 1T25A 1NW3A 3MWFA 1A7UA 3EDRA 1TTQB 2H63A 3K35A 5D3QA 4K9MA 4Q1VA 1X1TA 5I01A 5CM8B 4YXWD 2IY9A 2OFOA 3SOZA 2E4XA 2ZW9A 1U90A 2ZAIA 3LO5A 4RS4A 1N0UA 3BJZA 1JQLB 4NAUA 4IXNA 3N2ZB 4CIDA 1YS1X 4IBFA 3DE6X 4MWGA 3O5AA 5EL0A 1PNVA 3AXTA 1O8CA 4C4ZA 1D2RA 3QENA 1UAAA 3AERB 4YT4A 1Z06A 5LQMA 2J30A 4M98A 2I3ZA 3Q5DA 4R6WA 4UM5A 5KTTA 5LIPA 1Y89A 1P17A 2XJ4A 4CLOA 5D8DA 4AKEA 4M54A 4HVLA 3ENZA 1S2IA 1M2OB 4C0WA 3PWZA 1AUOA 3NHFA 2I2DA 4I4TB 1AOXA 1ZNWA 1GGKA 4IDNA 3QW4B 1QS0B 4B34A 4JLWA 3JY6A 1NVUQ 3D8HA 2VK8A 3IAS1 4KXFB 3VVBA 1SOVA 1O95D 2WYHA 3KQWA 4DZRA 1DAMA 4OB6A 1A96A 1B0UA 4QSMA 3KKLA 4FWBA 4KLNA 5TQVA 1DINA 4Y3UA 1PFWA 1NRJB 3BXZA 1ZH8A 4CLRA 1Q7GA 1M2GA 1E1QA 4ZEXA 2FWJA 1I5EA 1PP4A 3V4OA 2DMRA 3V1MA 4WVLA 1N6IA 4FXPA 3MWEB 1SHJA 2BCJQ 3SFZA 1VC2A 3QBJA 1U5BA 2XNCA 4QYTA 1NW8A 3I1FA 4HDSB 1HY3A 3C43A 4F9GA 1LF0A 3SE7A 2I4IA 3AWDA 1TLFA 1GSAA 4L0QA 3SMPA 1OX4B 4HDMB 2ASVA 1WXEA 4BVJA 4I46A 3ZW7A 3DOCA 4HDKB 1PZGA 1WS6A 3H11B 3A2NA 2WI8A 1PX2A 2CVPA 1FW6A 4X92A 3FKSA 1QH1B 4TWIA 4CV1A 4FJ1A 4RV5A 2P6NA 3UAYA 3HU3A 1XD8A 3GUHA 1NMSA 1GXSA 1FU8A 3TLAA 3OP1A 1GDTA 3I5XA 1ZK4A 1WQ4A 3QX9A 3PNMA 3NHYA 4EG3A 1S9DA 2E6KA 4ZO8A 1I6KA 3SNKA 4QPZA 1FNSA 3CGGA 2MU1A 3LU1A 4GPAA 1LNSA 2H0RA 5SV2A 1INLA 2W2OA 3A2MA 4R5MA 1W4BA 4CKWA 4EYOA 4R9SA 5CB0A 1KO8A 2I8CA 4ZXPA 4ZIRA 4EH1A 1NI4B 5P21A 3M81A 5AVZA 4IWXA 1SUWA 3G2LA 4JNKA 2AZTA 2ZR9A 2IZOA 2H16A 4LDPA 3B2EA 4LF8B 5ICEA 1CP3A 2GTHA 1CUUA 3MJDA 2VOEA 1MC1A 3GRVA 3KUXA 1DEXA 3KQPA 3ONEA 3T1YB 4F8EA 2PMWB 4BFXA 3LUCA 4QM7A 4KPEC 1OE0A 2WUVA 5IZCC 1E9EA 1DC5A 3WJ7A 4UPEA 1I3CA 1UKEA 4YJKA 1P4AA 4WZAE 1FUKA 2GF2A 5JEDA 1YZHA 1IC6A 2ID7A 2PIAA 1KYIA 3R7AA 4INPA 2PBFA 1CXZA 1WCV1 4AULA 1T4GA 4YT2A 1WNTA 1JEYA 2JLUA 1A50B 4H3HB 1R9NA 1SIOA 4UTPA 4KE9A 3LT4A 3GFTA 2ZOSA 4DLAA 2PD6A 1WABA 3ZG6A 4KWCA 2PRJA 1K5GA 3OE7D 4YO8A 2R47A 4IMIB 4I3FA 4PR0A 3JQRA 3UUGA 4BQNA 1WP9A 1F17A 2I4TA 4HWPA 2BAGA 4Z7OB 1YVUA 4U2GA 1WSWA 2DENA 5T4HA 3ZHSA 8CATA 4RFVA 4B3SM 4PSVA 2KA6B 3GO8A 2X9QA 4KVAA 3UC5A 5CGQB 4KKVA 4JROA 1NBWB 1G3IA 1C7YA 2Y2VA 4M53A 2QTVA 4GL2A 4EYEA 4YCLA 1I14A 1RWMA 1BMFA 2PGXA 1B2LA 2Y0QA 3IYLW 1JA9A 1LLFA 4MLDA 1DADA 3R4VA 3TCKA 2C8JA 2PLWA 3A0UA 2G28A 1GUZA 4E32A 3UAGA 1W0CA 2WVJA 3L5OA 5AOBA 5E95A 1RXCA 3LH5A 5FX2A 4B3HA 3JQQA 1RACA 2RCYA 2QP3A 2MR6A 3HS3A 3C15C 2RGWA 4HAIA 3QKTA 2MDTA 2FP4B 2QN1A 4A0GA 4E4YA 3VR3D 3UXMA 1X9GA 3OEYA 2YHUA 5JTUA 5GIOE 4UEOA 2C2WA 3KP0E 4GUDA 4DC1A 3UGTA 2C61A 4BWYA 3U7HB 1Z56C 1WR1B 4ZQHA 3OZXA 4LPKA 4RLQA 2QSZA 3KKOA 3D3JA 4DIBA 5BWLA 3ZNPA 4F2HA 3E7WA 3H1FA 4ZEVA 1F7VA 4LFBB 2OAGA 3L7KA 1J6UA 3PIDA 2Y71A 4WN9B 3ZV4A 4RWZA 2Z8ZA 3IC5A 1ZM3A 2WTBA 3JQFA 4O63O 2AHRA 2A1TR 5ALSA 2J7OA 4FC7A 3AR6A 3ISTA 1M5UA 5L3VA 4E2FA 5A5DA 2VQDA 3NBYC 4H6WA 3WADA 1FVXA 4B4KA 1O96B 3KFLA 3L18A 5HKBA 4BNHA 1BH2A 2GTPA 4HGZA 3HWSA 2FZWA 4L07A 1C81A 4M7OA 4PD2A 4KR6A 3GQ5A 1LF5A 1KIFA 5TEVA 3F5MA 1J25A 2FDXA 1REQA 5BMOA 3R0IA 5AM5A 1OWPA 1SD5A 3T41A 3R76A 1K7CA 3CN7A 4YWHA 2GH1A 3CSDA 4J0EA 1IZ8A 1JHDA 3ZEIA 5B3AA 4CIZA 4KLAA 4FE4A 4BFYA 4I50A 5ABPA 2C04A 2ZE7A 2P40A 3C3DA 3LFUA 5KVVA 5ESDA 5EFZA 1BE6A 2YKGA 4FFNA 1W85B 4XQEA 3I9OA 4KCGA 4ESEA 4JZYA 1RHRA 1ORVA 4P36A 3CXUA 3HWX1 5FOQA 2NSJA 1TJ5A 1N33B 1KZHA 5CFMA 4D3ZA 1MN6A 2LKDA 4QXMA 4GBJA 3PC3A 4G8BA 4AP6A 4RGQA 3PFBA 3H9CA 4HB2A 1TIPA 3T3DA 3DEIA 1YDHA 5JY6A 1T9BA 2PWAA 3SQOA 3CNHA 2YHSA 5LBIA 4D8XA 2R9VA 1TEZA 3M1IA 1GZ6A 4EA9A 2WYUA 4IHKA 1S2OA 1XTJA 2I7DA 1ADGA 4MHSA 3G88A 4I3HA 5E2IA 4UNNA 1ISFA 3VQTA 4D57A 1MV5A 3A4LA 4LF5M 2WTMA 3VR1A 3L6BA 3LQQA 2YJZA 2ZUCA 5LJIA 5EJCA 3G8BA 2WMDA 3H87A 4KGDA 4OYLA 5KQPA 3BSFA 3SHOA 4RVUA 2QM8A 1TI7A 3S68A 4B3IA 3O0TA 3SCZA 5F73A 4MA5A 4TT3A 1IZ9A 1I10A 3TLKA 3GUCA 4AU1A 1CLEA 4MGKR 4KG7A 4I9GA 4AZWA 1C0IA 3KAKA 5IHXA 1N3YA 1MU0A 5EFOA 4PRZA 1ZUWA 2IUYA 1L7DA 2QQEA 5JWRA 2JFHA 3N0WA 3HRHA 1JR4A 3R0JA 2OXEA 3U1VA 5C9ZA 1EE1A 2L18A 3USES 5DX8A 3DVSX 5AVRA 4MW9A 1XQ9A 1NN1A 5SZKB 1H6BA 3EFOA 1RPAA 3U9LA 4XR9A 4MV5A 2H5IA 4QICA 1VKZA 2HSDA 4YRRA 5FTNA 3OO1A 3N2KB 3LMMA 1NYQA 1E0KA 2E2WA 3T7SA 1GZ5A 4AURA 3DWIA 3C6KA 3CEHA 2HA6A 5AO9A 4PC2A 3EZ2A 5D3ZA 2P9GA 1ZKDA 2WTNA 2Q45A 1NBME 5JD5A 2AMYA 3E2MA 2CXNA 3T4PA 1HTTA 2WKWA 5HZMA 5TF4A 3SSAA 4W6QA 3MQFA 1N2CA 2H59A 2GDZA 1KAGA 3P5BA 3E1SA 4NJEB 2OFXA 1U28A 4RMNA 4HXGA 1Y3HA 1RRCA 1KFEB 3CUUA 2FY8A 1ID8A 2BKXA 4G6ZA 4CTOA 1U80A 1SMKA 2FN4A 3WMWA 3PBKA 1N8SA 4XEUA 3F74A 1ZESA 1N32M 3HX3A 3CF0A 5DK4A 1W29A 4B45A 4KSYA 2C2YA 4DR3M 2XUZA 3VNRA 2H2IA 2F67A 3OQOA 5I51A 3GO4A 2RG7A 1AUAA 1FS4A 2FG6C 1GY8A 2QTHA 1LZKA 3BTUA 2XNHA 4BP9A 4XDGA 3ICCA 1ID1A 3GZJA 3ER6A 2APJA 3EEYA 2ZTVA 4RK5A 2RGDA 2DBQA 2Y27A 1UMCB 4XGQA 4KTVE 3ILHA 3I1IA 5CJ2A 2I6XA 3TLGB 1QK5A 2NO0A 3AW8A 3RFVA 2XZLA 4DV6B 1P74A 4RVFA 5F5LA 3QU4A 1A2OA 1Z37A 1DT3A 3OOYA 1FMLA 2QE7A 3FHOA 3GJ7A 1KXJA 4MQLA 1Z59A 2XZTA 2XVXA 2DUWA 1G21A 1QH0A 4TMXA 1ST3A 4EHLA 3RTCA 5KQGA 1JILA 5L3RA 4LOIA 3C1AA 3A06A 2YNMD 2O1EA 4FOPA 4PLTA 3BWVA 2Q8NA 3QIAA 1SK9A 3D6NB 3H4JA 4W5HA 1QDUA 2YASA 3GEDA 3H2BA 4LVNA 3UFXA 5D85A 2JJ1A 2QSYA 1P1CA 2YCLA 1W8DA 4PG7A 2H0QA 1SVIA 4EKYA 1EBUA 3ITDA 2NU6A 3QY9A 5EE3A 2IEAA 1DOHA 3EEQA 4U0JA 1KXZA 3ZZ0A 1H1LA 1DEKA 3UWSA 3GRUA 1EX9A 4XB6B 3U3DA 5KJ1A 1UWVA 3RSQA 4P7KA 4RWEA 4P32A 1D1QA 4QOZC 3I30X 1AQNA 3I8OA 4DCOA 3ZIDA 3TB4A 2CMKA 3F90A 2PNJA 2NVOA 3BQ9A 4G8DA 4IXMA 5FI0B 3FAZA 1XDWA 2YWEA 5KU7A 4R1OA 4QBTA 2IU4A 1U8TA 3ON5A 5BO5A 1L5RA 2OPFA 2EC5A 1BS1A 4IDGA 1LQTA 1IEVA 2YC4C 5IYZA 4DQLA 2O59A 1DS6A 2G71A 4UARA 4KOAA 1BNCA 3L2OB 4EKNB 2VYVD 5CXUA 3D7MA 3RAEC 1N3BA 4A6DA 5LUAA 1Q0UA 3KYCB 1CNFA 3DM9B 1DWUA 4FN4A 1SCNE 4BS9A 1FL9A 4FIDA 3CLHA 1YQDA 3FWNA 4CKYA 1WZNA 2NO5A 4DQDA 3ZGZA 2MYPA 3EAFA 1R64A 2HJRA 1AV7A 1S9HA 1TYCA 3AVOA 4GE3A 4PQYA 3WYGA 1JU3A 3KJFA 3QEMB 4LCJA 3AHFA 4ISBA 4Y67A 1OT3A 1JTEA 1F8GA 3WFZA 1YDGA 2V54A 4II7A 4B84A 4LSWA 2D0IA 4TKVB 4AQYM 1HTWA 1O97C 2B3DA 2V0CA 3M83A 4A2WA 1WMAA 1XVLA 3SYNA 4B7FA 1UKYA 4IO1A 3D8LA 2WYWA 4XSGA 2JXNA 5JCXA 3S2IA 2BF4A 4RAQA 4P4TA 5E3HA 3ZU4A 3U16A 2KRKA 4DYHA 1KS9A 1M2EA 2HWWA 5BYBA 4EFKA 1ISPA 2PUCA 3INYA 2HK7A 1UJ5A 1A9XA 2XJ9A 4CZ2A 1KK3A 5FTJA 3WV5A 1XVAA 4ZVLA 2H85A 1FEZA 2V6ZM 1A97A 3RD5A 1JQAA 1KR5A 4YMVA 4HGRA 2RHDA 1K6XA 3GLSA 2J5KA 2O8BB 3OTGA 3LY8A 4OL9A 5AI0A 3DZIA 4ND7A 4G4OA 4KQIA 2H51A 3VH2A 4GKJM 2OYSA 1UKVY 3GA5A 4I3GA 1IK6A 4A9AA 3TNLA 2XYQA 3MJVA 3K09A 4NU6A 4EA6A 4R1MA 2JAUA 1UT6A 5LA6B 1S1CA 3JARB 4J43A 1TD1A 4YRTA 3MUNA 4NU0A 2L4FA 2Q5EA 3H6HA 2R3SA 1I4OA 1PNTA 3DM5A 3V8MA 2NT3A 3ADKA 5KNBH 4NV0A 1F8XA 1CX9B 1OGYA 2QRPA 3VZCA 4FHFA 5C81A 4OHUA 3ENWA 4B3MM 5K6RA 4B4OA 3T4XA 2LHGA