1OFHA

Asymmetric complex between hslv and i-domain deleted hslu (h. influenzae)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
309
structure length
309
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLTDSAGGAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-DEPENDENT HSL PROTEASE ATP-BINDING SUBUNIT HSLU
publication title Structure and Reactivity of an Asymmetric Complex between Hslv and I-Domain Deleted Hslu, a Prokaryotic Homolog of the Eukaryotic Proteasome
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 102
structure length 309
sequence length 309
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1ofhA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ofhA01
4LYHA 1AGRA 4MRSA 5EE0A 4KU4A 2NO0A 1XMVA 2BJVA 1DG1G 1F60A 3VLFB 2ZYWX 3DM5A 2QTVB 4IDOA 2HXYA 1H8HA 2VIIA 1G8HA 4PPGA 2IYWA 3LH5A 4KSCA 5EXSA 1NSTA 3G82C 4CIDA 3U5ZB 4Q47A 2EFEB 2RCNA 2V54A 4KAXA 2OFWA 2REBA 3GJ0A 3LBIA 3B1YA 3AF4A 2GBLC 1GNRA 1GSIA 1VKJA 2BMJA 1TNDA 2IXGA 3AVOA 4JVNA 2IA5A 3AF2A 1SHZA 3X1DA 4A4DA 2VYFA 4KI0A 1J8MF 4F91B 1ETUA 2FSIA 4TYYA 4DSNA 2X8AA 2ZAMA 2OBNA 1UEJA 5DO9A 1LV7A 1NF3A 1U99A 1P2TA 5FPSA 4P4UA 1M74A 3T61A 2OAP1 2ZSBA 2BM0A 4WA7A 2VF8A 4O25A 3NC1C 4IEEA 4DZZA 1AM4D 5GJWC 4W5WA 4OI2A 1OXTA 3UG7A 1NJFA 2PJRA 3PEVA 1W0KD 4QHYA 2WSMA 4NH0A 4KJZA 3U7FB 3GP8A 1XMJA 1KJZA 3NBZC 3OE7D 4TWZA 3ZZTA 2AXNA 2VHUA 3N5CA 2UZ3A 4PAQA 3CNOA 4YMVA 4BEBA 4JT2A 2ZVQX 3TR0A 3QQ5A 5HCIA 2ZANA 3U4QA 1XTRA 2EFDB 2ZRCA 3KUCA 4NYMR 1ZD9A 3BJIC 1E2MA 1H8ED 2YOHA 3EG5A 5DIFA 5C4GB 1U90A 2BC9A 2FN4A 1ODFA 5KYKA 3B78A 2IBMA 4OI4A 3AKDA 1J8YF 3I4LA 5LDDC 3ZD7A 3QXSA 2O8EA 2WJYA 4CEJB 4MUBA 1NVUQ 3W8NA 5J47A 5JCZA 2ZRPA 2WJJA 2XNDA 3K0FA 3ZQJA 3VNUA 2W58A 4RKFA 3IQWA 5LD2B 3C5CA 4KCGA 2QE7D 3MGCA 3BH6A 1FQKA 1T5LA 4M9ZA 5D3QA 3QE0A 4UNQA 2OM2A 4XSGA 2UZIR 3AH8A 2AHOA 5AJYA 2GK7A 3WP0A 1AZTA 5BN3A 1U8ZA 1Q1BA 1R0YA 3DVLA 3NBFA 3GLHA 2L0XA 1NN5A 3CZPA 2RKOA 1M2OB 2G0NA 4GOXA 3BWDD 4OQFA 4XJXA 3ICQB 3NDBB 2PBRA 5AR1A 5SZKB 1JQJC 1C9KA 5EP4A 1H8HD 5FOVA 4EPVA 3CWQA 4AC9A 4NYIR 3TLXA 2VL7A 1XWIA 3UATA 4WAUA 1KY3A 2X2FA 5L3VA 2QI9C 3AVXA 1W5SA 1Q1EA 2J45A 1GRQA 3AV0B 2JLYA 2HUPA 1CBUA 3ZVRA 1S9DA 2O8FA 3GJ8A 4OK6A 1MV5A 1ZP6A 3WNBA 4URVR 1DAKA 3K09C 3RVBA 4MKHA 4HATA 4A8JA 1AS3A 1IONA 1J2JA 2PT7A 1EX7A 3KQNA 4IW3B 1AA9A 2LKCA 3BD9A 2ZSFA 3SHWA 1ESNA 1ZIPA 1YZQA 4GSYA 4ACBA 1W1WA 5CDFA 2FV8A 2EWWA 1G64A 4RD6A 2IYUA 5L3SA 1TU4A 2ZRDA 3ZDQA 2EYQA 3SC3A 3B8HA 3NBYC 4CEIB 3K70C 1NBME 4B43A 2IS2A 3C41J 3DDCA 3QF4B 1YZTA 3RS0A 3OZXA 1SZPA 2F6RA 5HKKA 2NO6A 1KKMA 1IM2A 5CYPA 5L3QA 4Q7MB 4C7OA 4PQYA 5L3RA 1W2GA 2G1KA 2Q6TA 4ZPXA 2DFNA 2WJHA 1CKEA 1V43A 2XJ4A 4QBFA 1AZSC 4C0AC 5TY0A 4EIWA 4YMSA 1TU3A 1JJVA 3Q5EA 3QXJA 4LHWA 2ATVA 4ZIRB 4I1VA 2XB4A 2QU8A 4WIAA 3F3YA 3BERA 3UWOA 3TSOA 3QKSB 2O5VA 4TZ0A 1SKYB 2XNDD 5J4YA 2GAAA 3KFXA 2YINC 4GP6A 1VTKA 2FA9A 4NU0A 4V0ME 4DEXA 3DEFA 1IJEA 3EARA 3SN6A 2P0EA 1G6HA 1RRPA 1U8YA 2F43A 1DG3A 5J4LA 3R8FA 1E2LA 2MSEB 2ODEA 3AVUA 2DWZB 2OLKA 1OFTA 2RB4A 3BFKA 4MGZR 5AUOB 2XGJA 3X1YA 4M21A 4GMXA 4PXAA 1C4OA 1Q21A 3HPQA 2CCJA 3SYLA 4HLUC 3LXXA 4PZYA 2VHJA 3VHLB 3IIKA 1GILA 2P67A 4N0DA 1XCPA 1Y3AA 4MDFA 5FOTA 3M6AA 2DFKB 4HZUA 2H8KA 4Q1CA 1FOEB 1NLYA 1YVDA 5AJXA 2W0MA 2ZUCA 4LJ6A 3B85A 3TW4A 2G9NA 2FX3A 2IYXA 3TSZA 5BQ5A 1W36C 3B13B 1II8B 1PVOA 3AUYA 5KSPA 2OBLA 4NBSA 3RAPR 3T15A 1ELOA 4OJKA 1ZRHA 4JVLA 4Q5IA 2PX0A 4C0QC 3RANA 1T91A 1SVWA 1DOAA 1Q22A 4QHSA 3SJZA 3ZS8A 2SHKA 4B3FX 1SVLA 2WOOA 1NN0A 3K1JA 2DFTA 2FEMA 2QTFA 1XTQA 4H1VA 5IRCD 4LBZA 2QT1A 5K8LA 2BBWA 3B7GA 1XMIA 1YZGA 3T35A 3GLFA 4PQRA 1NG9A 2JATA 5HKKD 3PEUA 2GXQA 4XSHA 2G1JA 1W4AA 2J87A 3ICEA 4I81A 5EQTA 2BBOA 2IUTA 5CIQA 1Z6YA 4XIGS 1EXMA 1TPZA 4B3GA 1IJFA 4AD8A 2PMKA 3W6OA 5CJPA 1GUAA 4MKFA 2QNRA 5KOYA 4TTRA 3CONA 5FL3A 3GLGB 1YU9A 4ZI3A 2X77A 4YXWA 2F9LA 2MSDB 2V55B 2EW1A 2IF0A 3EZ7A 1P62B 1F2UB 4B73A 3R8CA 4JVMA 2O8DA 1UKVY 5CYOA 2WAXA 4HDQB 1ZMXA 4ACAA 1A5TA 4CZ2A 4KSBA 2ZRMA 5EP3A 1OSNA 2H5EA 2HV8A 2RGNC 1TUIA 1KI6B 3Q5DA 1I2DA 3SHFA 4PO9A 1L8QA 2V7QA 5TVKA 1WBDA 1RJ9A 3LX8A 3I72A 1AKEA 2P3SA 2XX3A 4DLWA 4EAQA 3B60A 1FP7A 2YWGA 3QEOA 4YDHB 1VHTA 2V6JA 1RRFA 4BUJA 3CNNA 3O8DA 4BZXA 3TKLA 4OL0A 4B3DA 5J5CA 1VCIA 2D2EA 4WZBE 3AUXA 4IKEA 3KXKA 4KFTA 4NP6A 5ANRB 5EE9A 3QVUA 1P6XA 5H68A 3UG6A 2CJWA 1Q57A 3C14C 2QM7A 2H1LA 2A9KA 1XDBA 1E1QA 2ZRAA 4BFYA 4IDQA 2HXSA 2GEUA 4TLEA 1RE0A 4BASA 3I8XA 4DLUA 4OYHA 3UXMA 4C0BA 2KI5A 3QBTA 2D7CA 2VSOA 2QAGC 2GEVA 3ADBA 1ZM2A 3GJ5A 1XPOA 3RRYA 3CPEA 2JLSA 2RGEA 3IUYA 3HWSA 4L15A 2XZPA 2WICA 2ERXA 2C99A 3F0TA 2NTYC 2WWFA 3DKPA 3JZAA 3IPYA 4KFRA 3S1AB 1OH6A 1FMJA 2ZI6A 3A6PC 4M0LA 3EPLA 3B6EA 4QOSA 1HH4A 1G3UA 1WA5A 1OLOA 3KKQA 3LFUA 3X2SA 5EXPA 4ZCMA 3VX4A 1W7AA 4FWDA 2KSQA 1U98A 4MGIR 4ZV4A 3ZJYA 4B6FA 3RRZA 2PEZA 1G8YA 1GFIA 1XZQA 4ZCIA 3K9HA 3WBJA 1BKDR 3B1WA 3K9GA 4JYBA 1ZVQA 2WZQA 1HE1C 2ZVPX 1G3IA 1HTWA 3KJHA 3RS4A 4BFVA 1Z0AA 1Q1QA 2ZXUA 4NONA 4BLOA 3MRSA 1NRJB 4TL9A 4YXWD 2FZ4A 1W2HA 4IOLA 1JBKA 2YC4C 2OHFA 4G01B 2AFHE 2A5YB 1KO5A 2VLIA 2F9MA 3OEHD 3TH5A 4AKGA 4BLRA 1OKKD 3VR3A 4N3NA 3GEEA 3DO6A 3VAAA 4Q00A 3I62A 1N0VC 2YHSA 2PZEA 4WZAE 3RWMB 3FPAA 5CB6A 3ASYA 2IS1A 2I1QA 1Q12A 2V7QD 3ND8A 4A8JB 1LF0A 1DELA 2F1IA 1E9RA 4DDUA 1EESA 1GZSA 3I8SA 5A0FA 3U61B 1OJLA 4CEJA 2XXAA 4M22A 2WMNB 4FCWA 3CM0A 3EAQA 2G3YA 4UNRA 2ZJ5A 2YWHA 1FFHA 3QPWA 2VRWA 4W5HA 3X1ZA 5HTKA 1OXUA 1KK2A 721PA 3OHMA 3U3MA 1XF9A 4TYPA 2JLUA 2JDID 2GNOA 1RYHA 1IN8A 1FP6A 1PLLA 3P20A 4OK5A 3THOA 1D2MA 2LWIA 3K53A 1E1QD 1JR3E 3H0KA 1AS2A 2ZR9A 2PLFA 4NCIA 1E94E 5UKDA 2E1RA 1FTNA 2PL3A 4C7OB 2GVDC 3LO5A 4R7ZA 3GFTA 6Q21A 4Z8YA 1HV8A 1XD8A 4B3XA 4ASUD 4C2TA 2LKDA 1J90A 2ZE8A 2YJTD 2IHYA 3DHWC 5KNCA 1TEVA 1BH2A 1FUKA 3DOFA 2IW3A 3F8TA 5FPKA 4FXPA 2BCJQ 2J7PA 2PZFA 1ZNZA 4JZKA 4AYXA 1WB9A 1E9SA 2GAOA 1XB2A 5BN4A 1E4YA 3LLUA 4JBYA 1GP2A 4FW9A 1S1CA 4DCSA 1JXMA 3LA6A 2C9YA 3E70C 4GT1A 2FFBA 4POAA 1HE8B 1P9NA 4Q21A 2F43B 4QJ4A 2O0KA 2EYUA 1RZ3A 3BBPA 4NCJA 3CPHA 4X8MA 5FTLA 2A30A 3MSXA 2IYLD 4CEIA 3ZZUA 5J4KA 1G8GA 1UJ2A 2GJ9A 3FFAA 1E6CA 1E0JA 5JSZB 3KQLA 5FTJA 2R2AA 4MYHA 5JFGA 1U9IC 2WKQA 3QKUA 4JN6A 4OHYA 1AQUA 1N3BA 1SVOA 1E3MA 3K0SA 2PEYA 3CLVA 4A6XA 1AJEA 1CS4C 1QHXA 2F1JA 3PV0A 2JCSA 3QPUA 3SS8A 3WMEA 4LHVA 2D62A 1YR9A 1U2RA 4AYTA 1K8RA 2CMKA 4BEJA 4XWOA 1XFAA 2XAUA 2YOFA 3KJEA 4JKYA 4GL2A 2X2EA 2GCOA 2O52A 3QNUA 4KFSA 2OFOA 4LZZA 3VTKA 4W5JA 1E1RA 1K5DA 2OAQ1 3B5JA 3MWKA 4IJMA 4LPKA 1IN5A 3QKSA 5KO2A 1WBBA 1OIVA 1SQ5A 2X19A 1GNPA 2ZI7A 1WQ1R 3EZ9A 1Q3TA 5CK5A 5FBQB 1FX0B 5E7IA 3THYB 3QIAA 3AQ4A 3DM9B 1XX6A 3UMRA 3GEHA 2HEIA 5FR1A 1NKSA 4O2RA 1E9EA 3PVSA 1UKEA 2Q21A 1TMKA 2OV2A 4BFUA 1KYIA 4OQMA 3AGQA 3VR2A 1RYFA 1E0SA 2YOGA 1GRNA 3EC2A 5FOWA 1G18A 1NI3A 4MGYR 3CUEF 2KBEA 4M9XA 4ZCLA 3SYKA 2GXAA 4R98A 3A4NA 1NLZA 1N2CE 3AVVA 3L82B 1X86B 4QRHA 1CEEA 5LB2A 1GKUB 2J7PD 1W36D 4WZ6A 4TQUS 3HR8A 2YZ2A 3JZMA 1SXJC 4MYUA 5BN5A 4OK3A 4HZIA 2P6RA 5JWHA 1QHHB 3OE7A 4E22A 1KZ7B 3ONWA 4C0SA 2O8DB 4DB4A 3A4MA 1NP6A 4B48A 1VG1A 2HLDD 4Q7JB 3H2YA 3OAAD 4B44A 1H8EA 2IEZA 5HPYB 2WWWA 3WYFA 3FWYA 1UM8A 5JBQA 3A58B 1DAFA 4J0QA 2ZUBA 1ZU4A 4N0EA 4HUTA 4Z1MD 5HZHA 1JEEA 4H9GA 3GQBA 2C8VA 2GILA 2HYDA 1SHKA 1RJ9B 4IDHA 1N6IA 3EPJA 1W4CA 4CYMA 3AVWA 3FE2A 3CW2A 5FTNA 1RC8A 2DBYA 1ZCAA 4DRZA 1U0LA 1G1MA 2E87A 3VR4A 3BGWA 2RH5A 3B9QA 1G4AE 2QE7A 5KSYA 4A15A 4CF7A 2BBSA 1UDXA 3VKHA 1E9AA 3OIUA 1QVAA 2W6JA 4DDVA 3P4XA 3T5DA 2WWIA 1Z0DA 3NXSA 4MDEA 2CK3A 1B23P 3GLGA 3RS7A 2CLSA 5A5GA 3R7WB 1W49A 2XZOA 4C4PA 1CIPA 2B7BA 1E1RD 3ETLA 3A1SA 3GJ7A 4TMWA 4B33A 4U7DA 5D3MB 1F2UA 1P2UA 1GWNA 2BJWA 4QM7A 2VQSA 3REFA 3D31A 2WMOB 3IGFA 1MRNA 2ORWA 4D4MA 1N5IA 1SULA 2A5JA 3PUWA 3IEVA 1KSFX 2ZSAA 3K0EA 621PA 1KI6A 2WAYA 1US8A 4JLVA 2JLWA 3A1VA 4B2IA 1TF5A 4QC2A 3QKRB 4D4JA 5K8TA 4TN1A 1YR7A 4DIDA 4KHZA 1R5NA 2ZYVX 4B3BA 1N25A 5H8WA 3U6BA 3ZQ6A 3W3ZB 1NSFA 3IHLA 4NCNA 4BLTA 2F1RA 4CRWB 2AKYA 1A2BA 2ODWA 1Z22A 4PR0A 3VHXA 3AVTA 1MOZA 2ZRIA 1KOFA 3WBKA 2ZE5A 3CB4A 3U3RA 4QBHA 4PSKA 2IYVA 2ORIA 3A8TA 1DE0A 4C0LA 1LFDB 1OB2A 2VHQA 1WRBA 3BH7A 1I4LD 2NQ2C 1DAIA 4TTQA 4XD7D 2HCJB 5FI1B 1SKQA 1NVXQ 4NTZA 4TMTA 1KO7A 4PC7A 3T1QA 3KXIA 4NYJR 3LDAA 3ND9A 5DH9A 1G3RA 5JS8A 1KI8A 4MRRA 4BFXA 4PPNA 1J7KA 1SXJE 2Q3MA 3LXRA 5KHOC 3SQWA 5H1YA 1OT3A 2JJ8A 4NCHA 5C18A 2OEPA 2W00A 5DHFA 1AS0A 1IQPA 2RGCA 1X3SA 4KVAA 4HUQA 3SDZA 3S1AA 2ZJAA 4LUCA 4M8NE 2ONKA 2HF9A 4OI1A 2XXAB 2IS6A 1OXSC 4X8LA 2IF2A 4LK2A 4URWR 2VHCA 3W5IA 3GLHE 1Z2AA 4PO8A 2GCPA 1BMFD 3CH5A 2AR7A 4D26A 4A3VB 2ZR7A 4FWGA 2HT6A 2QBYB 1KHTA 1QG4A 1Q0UA 4JLNA 2GA8A 2W6JD 2YWEA 2CL0X 3GLIE 2JLZA 4KFUA 4V0LA 1IXSB 3EA5A 1XU4A 2IXFA 3X1XA 2O8BA 3JVUA 2GKSA 2CK3D 3UMFA 5TARA 1CJTC 1F5NA 1BYUA 4Q4LA 5LPNA 1KI9A 1QHYA 1FPMA 2FWRA 4LX0A 1XZPA 1ZNXA 1UKYA 4XVRA 1VYUA 2AK3A 2D74A 4RFVA 4DWJA 2VP2A 3ZGXA 3CR7A 4JIMA 4LBVA 1W36B 4CT5A 2WV9A 1E9FA 3HU3A 1XJ0A 4DLRA 4E09A 3ZVNA 4HAXA 4A2PA 4A2QA 5AJZA 4CT4B 1Z63A 1G5TA 2ZM5A 2DVWB 3EPKA 1Q1ZA 1TF2A 4D0NA 4DLVA 1ZD8A 2BMFA 1N5JA 3CF6R 2XNSA 4W9MC 1PV4A 1S2MA 2DFLA 1CULC 1E2JA 1R8SA 3UMSA 4TYNA 2QSZA 2GEDA 1NMXA 2C03A 1GM5A 1I2MA 3LD9A 3MHVC 4G5SA 4URZR 2ZROA 3KW6A 2J0VA 821PA 4HSEA 2GHIA 3WHKA 2AFIE 3CRW1 4XTRA 1OIWA 2ZRLA 5FUXA 3EPHA 3FFBA 4MRNA 4LCBA 2C5LA 3VR5A 2FFHA 3FMOB 4Z8XA 1IN4A 1CJUC 3MJHA 5FI0B 5JJLA 1XEWY 3KKPA 1KI4A 3T34A 2REXB 4TT3A 4LDJA 2VO1A 4YLGA 5F3WB 2AN9A 4NL4H 2YNMA 3NBXX 1TADA 4LJ5A 2ZU6A 3PXGA 2G77B 4HI0E 1HA3A 4LY6A 2QMEA 2GCOB 2GK6A 4Q02A 4YONB 2CHQA 3TQFA 3ADDA 1TX4B 3P32A 4A82A 3EIEA 2RHDA 2IYRA 1C1YA 1O3YA 2QMHA 2XJ9A 4MKGA 3KQKA 2QRNA 3AEZA 4BZPA 4LGMA 1NBMA 5CM9C 4Q1EA 2VA8A 4R9UC 1EFRA 3QEJA 1DVRA 5KSZA 3AKEA 4ON9A 2NZJA 4MUAA 4JKIA 2C96A 4JLJA 4TLCA 3RLFA 1CJMA 4CEHA 2AWOA 2NPIA 4LRSA 2KE5A 3PUZA 3I5YA 1EGAA 3EIHA 2OCYC 1XTJA 3VMFA 4M1SA 3FHOA 2WIBA 3U3KA 2OXCA 2Q9BA 1JR6A 3SFVA 1N5KA 2FSHA 5HR5A 1K5GA 2BKUA 2IT1A 3MJRA 5JSZA 2GWHA 2CE2X 4BZQA 1II0A 2JIZA 3QUSA 2CDNA 4OHZA 2ANCA 2IHBA 2CVFA 2WHXA 3Q7PA 3MMPA 4DT1B 1MT0A 4C3ZA 4LYAA 1RIFA 4BFZA 4DC9A 2W6IA 4JL8A 3OEED 3C7KA 2WBLC 4EQ6A 5GJBA 5CM8B 2OCPA 1UKZA 1YZLA 3B9PA 4BRWA 4LJ7A 3CZQA 1EX6A 1Z6AA 2H7VA 4I99A 2V1UA 4RZUA 1LTQA 4V0MA 4EJSB 1Z2CA 2IYYA 521PA 4DXAA 4MRPA 3O8RA 4ZDIA 1X8LA 5JJIA 1ANKA 4FINA 4QM6A 2QENA 4UQOA 4HLCA 2VH5R 2KB0A 1KAOA 2Q0HA 2VSFA 4U5XA 1IY2A 1KJYA 3BRWD 4GPTA 3VR1A 4DLSA 5KNBA 3K0AB 2ZU0C 4TLAA 5FOUA 5B2ZA 3T1VA 3GLFE 3HU1A 4NYMQ 2CLDX 1FX0A 3KDSE 2O0HA 4G3XA 3THYA 2RGXA 2ZRJA 4M1TA 2C9OA 5EP2A 1VG0B 2ZRHA 2ZRGA 4Q9JA 2DWQA 3BB4A 3G0HA 1GL7A 1Z0KA 3KQUA 1XXHE 2ATXA 4Q4HB 3W6PA 4LJ9A 2ZRKA 5LB4A 3QVVA 5JS7A 3BFVA 2JLQA 2GF0A 1EWRA 4TYWA 3L0OA 4QGFA 5K8UA 1A7JA 4TT3D 3EZ2A 5HE8A 4US1R 3IHWA 1II9A 1Z47A 2CCKA 3V9PA 2QPOA 1HUQA 2AK2A 1SVIA 1RVDA 1NY6A 1JPJA 1XTIA 2P5SA 3FDIA 3TE6A 5IT5A 2GDJA 2CNWA 5AUQA 5GADl 3OIVA 1EWQA 5DI3A 1VYTA 1C1KA 1U0HC 1R10A 4D4LA 1CJVC 3K09A 4KODA 5FPYA 3CIOA 1QHHA 4GP7A 4GZLA 5LD2C 1UBFA 5BW8A 2NGRA 5FOSA 1NBMD 3OEHA 3LQQA 1P73A 3M1IA 1OKKA 1EFRD 1FZQA 1KZGB 5FL7A 1MRSA 1OPXA 3QOFA 4C9BA 4IRUB 1FL9A 4IDPA 5CB8A 1US8B 4E5UA 1Z06A 1R7RA 1FQJA 3W6NA 1W0JA 3WRXC 1E9BA 2GXSA 3ECCA 1OXVA 2P2LA 4HB0A 1E2GA 1KAGA 1GITA 3LWNA 3ZH9B 4DEYA 2JIZD 3GJ3A 4JL6A 3PEWA 3IIMA 2JLVA 2VF7A 2IC5A 4GITA 3NEYA 4M53A 3L0IB 3PIRA 1T8UA 1UBCA 2W6ID 4HB2A 5E7MA 5JEEA 4PZZA 2Z5FA 1KK3A 2B6HA 2JDIA 3I92A 1L4YA 1KO1A 1KMHA 4QNRA 2KBFA 4PZLA 1LF5A 3KZ1E 2BWJA 3EW9A 1ZNWA 4GDFA 2GJ8A 3NDPA 4RFSB 3TW8B 2OFXA 3CPJB 3TBKA 2FPMA 4Q1AA 5FBRB 1UF9A 1IN7A 2HCBA 3THXA 3R7WA 2Q3HA 4RD1A 3IPXA 3MD0A 4LI0A 1ZC3A 2EU8A 2A7QA 5D3MA 4ASUA 3MWYW 4MYCA 2W2TA 2RGGA 1R5OA 2ZJYA 5JMTA 4OQLA 5B64A 1IXRC 3KXLA 4JLMA 4JMPA 3LRPA 1CRPA 5C46F 2AD5A 1PUIA 4HUQB 3D6TB 1GKYA 3RHFA 1Z3IX 4Z51A 1R4AA 1AKYA 2QL6A 3IKJA 4FI3C 5CITA 3KX2A 2IYTA 2IWRA 1JECA 3QKRA 3DMDA 2LCFA 1SGWA 5KDDA 3VNVA 4HLUA 2TMKA 2NPFA 1RPZA 3RSOA 2PH1A 1KIMA 3W9YA 4ESHA 2JJ1D 1N6OA 1AGPA 1XD9A 1LY1A 3EC1A 1D9ZA 2BEJA 2Z0MA 4G5RA 2H16A 2HJVA 2H92A 3BFXA 2O8BB 2ZTSA 2CNWD 1YQTA 1KSGA 3WP1B 1S1MA 2IUUA 1UBGA 4BFTA 1GL9B 1SXJB 3L43A 4GI7A 4QJ5A 3T1TA 3D3QA 2A5DA 2FJUA 4Q9KA 4B3CA 3LAWA 3SU8A 5FR2A 4V02A 2QY9A 3QENA 2D7DA 4M1WA 2QP3A 3VX3A 2PCLA 3KKOA 1HY3A 3V4RA 3NKVA 2ZJOA 2WWYA 1G7CA 4I1OA 5FL7D 2G6BA 3TSWA 2C04A 1OYWA 1GIAA 2R6GA 3LX5A 4GOKA 4RCYA 5BXQC 1G8PA 4Q1DA 4B71A 2V8OA 1QHGA 3K70D 3RDPA 1Q20A 1X6VA 1W0JD 1N0WA 4IVPA 1VCOA 1DADA 2QUZA 3MWJA 4EPXA 1QRAA 1XEFA 2FZLA 2Y8EA 1ZBDA 2AX4A 3GLIB 3HJNA 2OESA 5TDHA 4PSAA 4EPYA 5JWOA 4ESVA 1HT2E 3NG1A 1XEWX 4D4KA 1DO0A 3LBNA 3TMKA 4M1KA 4B74A 3NIBA 1NVWQ 2BIFA 2XZLA 2P6NA 3EZ6A 3RSLA 3KL4A 1NN1A 2CLCX 2QBYA 1CR4A 1DAGA 1E2EA 2YC2C 4R2IA 3T06B 1BS1A 2IXEA 4DLYA 1P3JA 2OSBA 4ZO4A 4AKIA 4ZDJA 2QP9X 2ODNA 1M7GA 4UXHA 4JSTA 1Z0IA 1W47A 4K81B 4TZ6A 1I4DD 4LC0A 3SOPA 4OI0A 1G20E 4NE2A 4A1FA 4Q4JB 2ERYA 1NLFA 4PTLA 1PLKA 4QJ3A 4HLDA 3PUXA 2OXRA 1NVVR 3NWJA 3Q85A 3BB3A 1T9HA 2IK8A 2FFAA 3FVQA 4GMDA 4AY2A 4ZI2A 2FMXA 1S9HA 2RGNA 4PC6A 3RRMA 4FMDB 2OG2A 3AF0A 4GNKA 5JJKA 5KDOA 5F98A 2Q9CA 4HDCA 1KSJA 4U02A 2IX3A 2QP4A 3EZFA 2O8CA 4W7SA 1IAQA 3L0SA 4FWIB 2HLDA 4CEHB 4XOIA 3OAAA 4F93B 4X8OA 1XEXA 4WVFA 1JR3A 4LRWA 4ZDWA 5FBWB 3AP2A 1Z6GA 4GOJA 4Z1MA 1R5BA 5DNYB 3G5UA 4N1AA 2GZDA 3SFZA 2R65A 2MMCA 4NMMA 3SZRA 4KO8A 2GTPA 5TMPA 1X8JA 2ORVA 3GEIA 2VP5A 3KFVA 2FPKA 3PENA 2P5TB 4JBWA 3MFYA 1NJGA 4PHFA 1GTVA 4RY2A 3I3SR 4P3YA 2J0QA 1QBKC 3CRRA 1LW7A 2K5UA 3PUVA 1E9DA 2JLRA 1DBSA 2QAGA 1KDTA 2ZJ8A 4OHWA 1JEDA 2G88A 2Z83A 4DB2A 4BLSA 1DAMA 4L16A 3A1TA 4EQ6B 2FDCA 4A0FA 4YC7A 2C9CA 2DB3A 4WBSA 4LRTA 3R20A 1SKYE 4YMWA 2EFHB 4QL3A 4IOJA 1G4UR 3IBGA 2IL1A 3UK6A 4URXR 3BK7A 2WSSD 3AB3A 2HDNB 3B1XA 5F9FA 1XTSA 1WCV1 3A1UA 3TVDA 3AF1A 3D7MA 3U3JA 2ZJ2A 3DKVA 4KYUA 4AURA 2FGJA 1ZUHA 2VP0A 1RW4A 2KRKA 1E0AA 1W48A 1W5TA 4ITRC 1ZD1A 2ZREA 4CDGA 3DZ8A 4GFDA 3Q7QA 5BWMA 1F3OA 2V1XA 5AUPB 3SBDA 3UPUA 2VHTA 3E2IA 4D25A 3LBHA 4AKEA 2BDTA 2ZEJA 3IDQA 2W2VA 3LVRE 4AG5A 2GF9A 1NVMA 4JJZA 1IHUA 3QBVA 4Q9IA 5BYJA 1E32A 4FMCB 4F7WA 3C16C 4QBGB 2N46A 1TEXA 1NL3A 1AQYA 2OT3B 4PANA 2Q3FA 2YVUA 4OQXA 3AM1A 4QGHA 4M9SA 1M1YE 5B58C 1I4TD 1XTKA 2ONJA 3WNCA 4FCVA 4DT1A 2CHVA 3IQXA 1EFCA 5DSZA 1J99A 1P4SA 1MO3A 2J46A 3FB4A 3L8ZA 2E9SA 1KK1A 1T8TA 3SYNA 3H1TA 2R9VA 2R6FA 4LJAA 2ZETA 2OE2A 3MAAC 221PA 1ZC4A 3WMGA 1Z6TA 4XD7A 5DI3B 1UAAA 2GRJA 5E7JA 4US0R 4EJSA 1G5PA 1NY5A 1NIPA 2NMVA 3EIQA 1Z08A 2GZHA 4TTPA 4LV8B 3WHLA 4UXIA 4IXMA 1TQDA 1E2QA 4C0KA 3OESA 1T3HA 2GESA 2DZOB 3JVVA 4A0RA 3H84A 1P2VA 3K0AA 4F4IA 3B82A 3N70A 1JR3D 2YYZA 1XXHB 2D4HA 3B1ZA 3CRQA 3LV8A 4DLXA 3PEYA 4K46A 4TL6A 4MGKR 2XTZA 2IYSA 4G5QA 3K70B 3MCAA 2D2FA 4Q1FA 4L9WA 3AF3A 3U44A 3TGPA 2J5XA 3K8YA 1JAHA 5CLLA 4DCVA 1YZKA 4DVGA 4DDWA 5KPDA 4JYCA 2C77A 3WY9A 3FYHA 3PCRB 3UWKA 2ZE6A 1RRCA 4Q4HA 4YMUA 5EUQB 3SE0A 2WWXA 5DE3A 1BMFA 4M4SA 3CO5A 2ZQ5A 4BFSA 3DZDA 1HT1E 4Q03A 4TLDA 4QKQA 4PFSA 2B7CA 1KMHB 2IYQA 2NZ8A 4GRAA 4BGDA 2KWIA 3I32A 5H70A 1R2QA 5CIWA 2NG1A 5F9HA 3AVYA 1EFTA 2QMOA 3IILA 2DWOA 1JJ7A 4Y0VA 4A8JC 3EASA 3E1SA 3AVQA 4LYJA 1RRGA 4HLQB 3HDTA 3THXB 1YJ5A 5JECA 4U00A 3KTAB 4JBXA 1AIPA 1JI0A 2F3TA 2NO1A 3BS4A 1ZAKA 4M2LA 4R2HA 1KDRA 4RCZA 2DYKA 4AIIA 4G0NA 4B76A 2HYIC 1L2TA 1P61B 1MH1A 1XCGB 4XVQA 1D8TA 2CBZA 4JSYA 2FF7A 2W0SA 2WWGA 5EE1A 2WJVA 1JAIA 1MO5A 4B32A 1WE2A 3NTUA 4BWYA 3REGA 1Q3HA 3SJCA 4MQBA 4B2PA 4P4SA 1QHSA 2OLJA 1HURA 3A4LA 1PJRA 4RZ2A 1FMLA 4LJYA 1IXZA 5DISB 5KU1A 2Z6VA 2VTKA 4OQNA 1U9IA 3TUJC 3AKYA 1H65A 5EE5B 1E2DA 3EWSA 1X1SA 5KDLA 3R9IA 2F1HA 2PZGA 4D80A 4RZ3A 4AG6A 2WWHA 4M1MA 2ZSEA 1PUJA 2V6ZM 2W83A 5G3ZA 5M04A 4IOMA 2R6CA 1Z5ZA 5AUNB 3SJBA 2CEAA 4RKEA 1P2SA 4RFSA 1OB5A 3RC3A 4NDZA 4QGAA 1LNZA 1E2KA 4A2WA 4MITA 4DDTA 4HAWA 2NOAA 3TJZA 4QG7A 1EG7A 1P9WA 3EA0A 2ZI5A 3K9NA 4BPBA 5TV2A 4XH9B 3C4JA 4UKDA 1OFHA 1BYIA 1XD2A 3A1WA 1UPTA 3GJ4A 3QG1A 2AL7A 2FSGA 1N5LA 2IEYA 2IYZA 1G8FA 1KDPA 5G3YA 2BOVA 4IFBA 3W90A 2QM8A 2BEKA 4BRUA 2JEOA 3PITA 4LV5B 5KUTA 4B2LA 4E03A 4TMKA 2B8WA 4PC2A 2V6IA 4PHGA 1E2IA 1G7RA 3LQRA 2HF8A 3L8YA 1G21E 3C15C 4DJTA 2A78A 4RD4A 3P26A 4NCKA 2QQEA 3QXHA 5J40A 4YDSA 2UKDA 1KO8A 5G40A 5AK0A 4PPQA 1R0XA 2REOA 1T0HB 2J9RA 4BFWA 1S4QA 1RFLA 1N0UA 1VIYA 2VP9A 3QG5A 1TUEA 3W8RA 4LSGA 1YR8A 1F2TB 2FGKA 1UFQA 2BBTA 2DWPA 3HR7A 4S2EA 5E4FA 3KQHA 4LJ8A 1E98A 3SJAA 3QXXA 5L8VA 3V00A 3K0CA 4C0JA 1P75A 5B57C 3AP3A 1SXJA 4JT4A 5JHHB 1JQLB 1N6RA 1TF7A 1LVGA 1P5ZB 2WTUA 2FH5B 2JGNA 1J70A 1WXQA 1SVMA 2G83A 4US2R 1ZINA 3LVQE 4CVNA 3N2EA 4ZKEA 4LHYA 3OEEA 2QEQA 4LYFA 4Z54A 4IFEA 4JS0A 4KV9A 4LC1A 2GZAA 3CX6A 2UVQA 5CDFE 1G3MA 1S3SA 4GBMA 5SZIA 1UDWA 4UXJA 4LBYA 1XCMA 4TL8A 3WYGA 3VFDA 2NO7A 2O8CB 3NHBA 1DS6A 3L0PA 4EFLA 3VKGA 3GLIA 1S8FA 2CL6X 3U60B 2BMDA 1XEXB 3CBQA 3U7GA 4ILEA 5FTMA 2R44A 4O0MA 4UNSA 4URUR 3CNLA 3I1FA 1VHLA 4I1SA 4ARZB 5DGXA 1CR1A 5CJ2A 1CXZA 1LS6A 3FMPB 2GETA 4OJQA 5GJCA 1VPLA 4L8GA 2NIPA 4MKIA 5JWRA 2ZYTX 4HAZA 4AKHA 1OYYA 1ZIOA 2OCAA 2JASA 4YMTA 1QZXA 2C78A 2GVZC 5J4HA 1YKSA 4TL7A 5E95A 4EDHA 4FMBB 3UANA 2QG6A 3T5GA 2QAGB 3FKSA 3D8BA 4A92A 3OIYA 3KJIA 4Q4JA 1Z28A 2AKAB 2ZS7A 4HDOB 1N6PA 3LW8A 1M8PA 4B35A 4PC1A 3R9XA 4YQFA 1WDTA 3TQCA 1XMSA 4RZXA 3PR1A 2PCJA 2BMEA 2GBLA 2W2XA 3VU9B 1OIXA 2GXUA 5KNDA 4S35A 2V4ZA 1EFUA 3GPLA 4PAMA 3FOZA 1VMAA 4L5BA 2ZS8A 2CCGA 2YV5A 2EVWX 1COWA 3WMFA 4B6EA 4NHOA 1Z6XA 2DR3A 4F4CA 4C2UA 4ERNA 3DL0A 2QA5A 5GVSA 4KBFA 1QHNA 2XOKA 3BH0A 2R6AA 5HE9A 1T3LA 4F4JA 1F48A 5EXXA 1E2NA 1R0WA 1XRJA 4D81A 5FBVB 2QZ4A 5DN6A 2WJIA 3Q9LA 5LBIA 4CW7A 4TYQA 2YWFA 1SXJD 4F38A 3QPVA 1ZNYA 1GVNB 1ZUIA 1KI7A 4FIDA 4Y0AA 4FWHA 2IWHA 5C2JB 2JLXA 1U81A 2QORA 4X8HA 5KSOA 4DCUA 3L2OB 3KB1A 4XWKA 1KMQA 1JNYA 4DCTA 1KGDA 1W46A 3VR6A 2CE7A 3FTQA 1MO4A 1UEIA 3NVAA 5K8IA 4KLNA 2QGNA 2HT1A 2BVNA 1A2KC 1CR0A 1NMYA 3LY5A 4A0GA 1E2FA 1KI3A 4JLBA 1TQ4A 1Z83A 4IOKA 4URYR 4D0GA 3W34A 4LPSA 4NYJQ 3GJXC 1IN6A 3OFNA 5IK2A 2XB2A 4D2IA 3T12A 2GJKA 4AI6A 5KPJA 4UNPA 4KBGA 1A82A 3EXAA 3KKMA 3MUFA 2QRZA 4RSGA 4RD0A 1CLUA 1DTSA 1CTQA 2BV3A 4EPWA 1NKTA 1JPNA 3U44B 4R71A 4O2LA 4MA4A 4RD2A 3E5HA 5JI3E 4FN5A 3ZIAA 4WXPA 2V3CC 4P4TA 1VYVA 5JZVA 1E79A 4M9QA 3IIJA 3ZZ0A 1JALA 1K6MA 4A36A 1G7TA 4KLZA 3BAFA 2XTMA 3W3AA 4PHTA 3FKSD 1VCMA 2WIAA 1TL7C 2JJ1A 2ZUDA 4BECA 4DIEA 1XNJA 1T0JB 1JB1A 3TR5A 2RGBA 1UADA 1FTSA 2A5FA 5IHPA 1M34E 5JRJA 2ZRBA 1ZUNB 5CLQA 1R8QA 2OUKA 3U6KA 1KTVA 2ZJBA 5C1BA 2Z43A 4P33A 1AN0A 5DYGA 1OH8A 2XEXA 4NZYA 4AYWA 2QMUA 1V5WA 2XSZA 3GFOA 4QGGA 5GVRA 1E96A 1UBEA 1FNNA 1G6OA 3RABA 1COWD 3T1OA 2I3BA 1L7VC 2MMGA 4Q4AA 2R8RA 1D9XA 4NYIQ 1E2HA 4KITB 2ZPTX 4DSUA 2XOKD 4Q7KA 4V0NA 1XXHA 1E4VA 1DO2A 121PA 1FUUA 4C30A 4A0HA 4DCNA 4P4SB 3ADKA 4DKXA 3UIEA 2I4IA 4UJ5A 1IBRA 1Q44A 4K8OA 4OKSA 4QHTA 4FD2A 5DN6D 3A37A 1EK0A 5FUWA 1RKBA 2J59A 4BE7B 3BXZA 1MABA 1PZNA 1XP8A 2N42A 4V0KA 1OW3B 3TIFA 1HQYE 1IOZA 4G5GA 2B21A 4FMDF 3Q8XB 1ONBA 1TAGA 3IBYA 4Q9LA 1G5RA 1NG1A 2XTNA 3RNLA 3WXMA 5BYKA 4WOPA 5JHGB 2J0UA 3TK1A 4FCTA 3GD7A 4C0HA 1P9RA 4EPRA 4P32A 1G9XA 3C5HA 3DOEA 2CVHA 4Q1BA 2ANBA 3M0EA 2RGDA 4G1UC 3DMNA 4XTCS 3RYTC 2RGAA 2JJ2A 3THWA 3AGPA 3NC0C 1L4UA 1GAJA 3OF5A 3SBEA 3MWLA 1M7BA 3KTAA 3HYRA 4BLQA 5AJWA 4ZDKA 5FTKA 5JI2E 3O8CA 1OH5A 4RVCA 1XD2B 4PX9A 1HEIA 3TUIC 4AK9A 1A4RA 2D3WA 3OFND 3Q72A 5IK2D 4MRVA 4I4LA 5AJVB 1R6BX 4JLKA 3P4YA 2IS4A 2C2HA 2N1BA 4WW0A 5EP1A 1CU1A 3BOSA 2ECKA 3BB1A 2Z4SA 2WM9B 4HAVA 3RS2A 3TAUA 2A3RA 2P65A 4B47A 5JCPA 4LOAA 4Q18A 3ZIAD 3GFPA 5FPTA 2GCNA 2J7KA 1BOFA 1E79D 1XBTA 3U4QB 1MR3F 1Z0JA 2ZIAA 4M1YA 4HAUA 1XPRA 1JXOA 2ZSDA 2QSYA 2MSCB 2H18A 1G291 2ZI3A 1PLJA 5FUVA 1YHNA 4Q66C 4D82A 1D2EA 5AWFC 1U8AA 5G41A 3CWZA 1S0UA 2ZI4A 1YRBA 1VIAA 3QJYA 4PC3A 4TSFA 4KVGA 1O87A 2ZRFA 1P72A 2ZR0A 4DUGA 2O8EB 4BQSA 4PHHA 1TQ2A 1ZM3A 5J4VA 2VEDA 2G0TA 3H4MA 2FNAA 4JJKA 3K0FB 4I1UA 3NH6A 1TQ6A 2R62A 4NKRA 2XSZD 3GMTA 2FPLA 2DHRA 2VPPA 4PAOA 4EPTA 2B8TA 3GCGA 4WXRA 4DLZA 4XVUA 2OBMA 1N6KA 4JLDA 3F5FA 4IXNA 1KSHA 5SZHB 1IY0A 2H17A 1VG9B 4FMCF 3GLHB 3WRYC 4TMZA 1G17A 2QQ0A 2D06A 3ZS9A 3I61A 1Z8FA 5B30A 3VKWA 1E2PA 2B92A 2WSSA 1CRQA 2FG5A 2OZEA 4LHZA 3KUDA 4IVQA 1F6BA 1KY2A 1KNXA 3VQTA 2YKGA 4D0LB 1N6HA 1QVRA 2EQBA 2WOJA 4EFNA 5ELXA 2EWVA 1DEKA 2AWNA 3MG9A 4Q48A 4RD3A 1KNQA 2EFCB 5KTYA 3AKCA 5DHAA 3J81k 2PX3A 2O8FB 2RAPA 2QPAA 3HPRA 4EJSC 1F2TA 4UJ3A 2WKRA 2QGZA 2VP4A 1VECA 3CKLA 4DHEA 4LWZA 2Z4RA 3I73A 1AK2A 1KDOA 5E3HA 2ZE7A 1G41A 2JJ2D 2ZI9A 4UNNA 4E07A 3I5XA 1BO6A 1YR6A 1OE0A 3NH9A 3DPUA 1ZJ6A 4MH0R 1WP9A 5JRZA 2ZAOA 1GG2A 1Z0FA 1ZU5A 2I1VB 1D2NA 2A2ZA 3FHCB 4P31A 1XJCA 1GOTA 2DPXA 2P6UA 3B2EA 5FUYA 5HZKA 2VSXA 1T4GA 5L3SB 1N6LA 2BCGY 1CJKC 1OFUX 1SVKA 3CRVA 4JL5A 4PPFA 4DLTA 8OHMA 3Q3JB 3BIFA 1NMZA 2DZNB 3X1WA 5DLQC 1P7CA 2JA1A 1ZYUA 3PUYA 1T3SA 4JLAA 4FWTA 3RS5A 5L3QB 2J0SA 4IVRA 2KJQA 3KB2A 4TMXA 1E99A 1OF1A 4O3MA 1DAHA 1LS1A 2PJZA 1T6NA 1XJQA 1A1VA 3BE4A 3EWAA 4RJLA 4NPHA 1P60A 1G19A 2OCBA 3KKNA 3FKQA 4DBLC 2GJSA 5TB5A 2CXXA 3H86A 5FBLB 4ARZA 5CK4A 3P27A 1B0UA 421PA 1OHHA 4TSFD 5C4MA 2BHRA 1M7HA 2ZJZA 4DUGD 5JLJA 4TQAA 3LW7A 1WF3A 1HYQA 3P1JA 4EUNA 3PFIA 5GJVC 1Z07A 3M4YA 2AXPA 4G5OA 3QF7A 4P0TA 3TUZC 1VCNA 4EFMA 3ADCA 3U7HB 3QKTA 1GNQA 4H1UA 3CF0A 1DPFA 5FH9A 1FNMA 2NO9A 2WPDA 5EZ6B 3SR0A 5TXGA 2PMDA 4JVSB 3RC8A 2FE4A 3C8UA 5FFMA 3SEAA 3SQXA 1D6JA 3B1VA 2XITA 3SI7A 5IF9A 2OILA 2J3EA 1XPUA 5DYIA 4IHQA 1OXXK 1YE8A 2BM1A 2GJAA 3BC1A 4HB3A 1OH7A 3NEJA 2DCUA 1QDEA 4Q7LA 4EKDA 3FMIA 3TRFA 3ZD6A 3QF4A 4TMVA 3LNCA 3VU9A 3ZVLA 3IEUA 2CHGA 3CR8A 5HCNA 2C98A 3WYAA 4JLOA 1GRRA 1GKIA 2Q9AA 3QSYA 2OO7A 3ASZA 4A6PA 4HZUB 5A4JA 3OIWA 3IO5A 4B75A 4BLPA 2VP6A 2WKPA 2H57A 1GDDA 4GZMA 4LHXA 2J41A 4Q9HA 3KJGA 2IUSA 1KJWA 4L9SA 4F92B 1DARA 4HEJA 1CP2A 3AVPA 2A5GA 1X8KA 4A9AA 1SVSA 4D6PA 2J1LA 3GJ6A 4ZIRA 2FSFA 1MO6A 3BORA 3MLEA 4KXFB 3U7EB 1NIJA 1QG2A 2F3RA 3O47A 2RHMA 3CX7A 4OHXA 2FEOA 4HB4A 5EZ5A 2QT0A 1NN3A 3LLMA 2QROA 1YRAA 2FFQA 1IY1A 1TTTA 4PSVA 4L4UA 4QFMA 3TVTA 4ZKDA 5JEDA 1X37A 1N6NA 1E9CA 1M6NA 1WMSA 4QBIA 3K9LA 3NHAA 4V0OA 3FHTA 4OBEA 3ZLJA 2DY1A 2WVJA 2QPTA 4HYYA 1GL6A 5DI9A 3WNDA 3GLFB 5FOXA 2QAJA 3AJIB 1S96A 1YZUA 2ZRNA 1MKYA 1ZM7A 3U3OA 2R6DA 3HU2A 1G16A 1QZMA 5EJEA 2WJGA 3TAHA 3N2IA 1KI1A 4Q01A 2X1VA 4PQFA 2F7SA 4V03A 1W44A 1ZW6A 4Q4AB 2O0JA 4TQ9A 3PQCA 3IO3A 4M1OA 4DSOA 1OV4A 4KYIB 1E0KA 1LB1B 2VBCA 1BIFA 4LBWA 2CL7X 2PLRA 1G7SA 4TLBA 4IEIA 3K0CC 4ABYA 3UKDA 2ASEA 1OHHD 1S3GA 1W4BA 3QY0A 2FOLA 1W0KA 2PT5A 1FW6A 1II8A 2F55A 4CGZA 4DSTA 3ZYCA 1MABB 1OFIA 2QN6A 1QF9A 3AP1A 3PG5A 4LJ4A 1KO4A 2ODBA 2QTHA 1VDZA 3EX7C 4Q19A 3GLGE 5F2EA 1D5CA 5FPHA 2WPDD 4B34A 1ESMA 1U94A 1ZM9A 4JLPA 5IDVA 1T5IA 3V4FA 3PJRA 4PO1A 2JAQA 2ZYUX 3R9WA 4HAYA 5EUMA 2J0UB 1HQCA 4II7A 3A36A 3RS3A 3RWOA 3CH4B 1ZCBA 3CF2A 1DAEA 1EFHA 2ZS9A 3CRMA 1NNEA 5EXTA 1CR2A 2C95A 3FMFA 3TNFA 1W4RA 1YZNA 1R0ZA 3THWB 1Y63A 3RRNA 1VG8A 3U2QA 2V9PA 1U0JA 3O8BA 3QXCA 5SZJA 4AWXA 2ZITA 1QHIA 1E69A 3HYTA 2AD1A 3CX8A 3W5JA 4XWAA 2FU5C 4MYTA 4OHVA 5P21A 3SNHA 5EE3A 2RMKA 3FGNA 1CF4A 1G3QA 1KK0A 1KI2A 4QXAA 1Z29A 2CJWB 3HP1A 3QI2A 4LV6A 4QNMA 2BKEA 3ZVMA 1NVVQ 4IDNA 5G53C 1KKLA 1ZM4A 1X1RA 2EFGA 2HJGA
chains in the Genus database with same CATH superfamily
3EPRA 4UTRA 5KU7A 1ZL2A 3MEQA 2C9MA 1Y8QB 5ECGC 1F60A 4MUFA 3CT4A 2HXYA 2YL2A 5HOQA 1T1JA 4D45A 4LRYA 2V54A 2H48A 2REBA 4FK8A 2H4WA 4S1NA 2GSDA 4JVNA 1A8HA 3G49A 1RQ2A 3GFSA 3C7CB 3QX7A 2EKQA 4EJFA 5DEOA 3F2IA 2J7NA 2BM0A 4CMEA 2F8SA 3L4KA 3MFQA 5F3DA 3EMVA 4BX9A 1OXTA 3WL3A 1J0BA 5AHKA 3PHLA 4F5ZA 1VKZA 4NABA 4TWBA 2A9FA 3KQMA 3EG5A 4UHBA 1U90A 3F6EX 2IBMA 3PUJA 1NVUQ 5J47A 5JCZA 4J6EA 3UPTA 3A6ZA 5JH7A 3JRNA 4M9ZA 3QE0A 3CLKA 1QB7A 1Y4DE 2HN9A 3AH8A 3PGA1 3GUHA 4P81A 3QFSA 1KYWA 2FEKA 1NN5A 1Z38A 2G0NA 3SLGA 3PC6A 2IKSA 4J6FA 1SG6A 5FOVA 2AE2A 4Q3AA 5C3UA 1YQ9A 1Q1EA 3IQHX 4C06A 4GP9A 1ZP6A 4HATA 3A10A 4DYHA 2XODA 2ZSFA 5F9MA 2J9XB 3U4MA 3LT5A 2C7GA 2FV8A 3BSFA 1YSCA 2IYUA 2XUJA 3K70C 4M0DA 1YZTA 4N5LA 4P34A 3QEMB 4CCYA 1SZPA 2F6RA 2CXQA 4H1TA 2IVFA 3H6KA 2VJBA 5D01A 1QOPB 3K96A 2G1KA 3BM5A 4DUPA 3IAAA 3UICA 1A77A 2UZAA 2UYCA 4WIAA 1EJ2A 3F3YA 3ZDXB 1QRSA 2XMDA 2XRMA 5ER6A 4J7CA 3DEFA 4X6UA 3UJ9A 3AVUA 4MGZR 3G59A 1E77A 1X80A 2Y20A 4JB3A 5JMOA 1XCPA 1PFUA 2BY4A 2VUUA 5HG0A 4EJ2A 4FOTA 2G4LA 3F4BA 5AJXA 4C7XA 2W0MA 3SSOA 3B7NA 2BRUA 3NBMA 5LQNA 4QIHA 2OL4A 1BCSB 2D54A 3L7OA 4F85A 4X20B 4CISA 2GZSA 2QRJA 2V5AA 1FMCA 1L2BA 3T35A 4EY3A 3G23A 1U7OA 4NK5A 2BBOA 3MWDB 3W6OA 3IP3A 2AOUB 1N2SA 3CISA 4LVNA 4ARBA 4BEWA 1Y4UA 1FFDA 3IC5A 3LYLA 4NV1A 4CLEA 4MM3B 3QX8A 2LTAA 2RGNC 2O50A 3E9RA 1RJ9A 2P9BA 1NPYA 1VFPA 3MT0A 3TKLA 2WD7B 4AUEA 3Q6NA 4KFTA 1Z5NA 1DZIA 2WHRA 3ZD8A 3SD7A 3IFSA 3TFWA 3AEKA 1SQSA 4B4DA 4F45A 1GVHA 4EG3A 2H1FA 2E6UX 1XPOA 1AUOA 1C30A 3S5JA 1B1CA 1OH6A 3IPYA 2XXBA 4EYEA 3EPLA 4XA8A 1OLOA 5CG2A 4ZCMA 4AZVA 3BZUA 1TR8A 3ZJYA 1V16B 5LMNB 1ZVQA 1MC4A 1HTWA 1SPBS 3BHIA 3IALA 1Q1QA 3O4VA 3BSSA 5IZ4A 5BV2P 3T41A 1QQAA 1P7WA 1U3GA 3HYNA 1JBKA 3O26A 2EJCA 2WUFA 5T41A 3A6LA 3OZAA 4D9NA 4BLRA 4G85A 3DO6A 1N0VC 2CP8A 4E4YA 5HM8A 2BGLA 3QHAA 4R2LA 4S3MA 1E9RA 1IM5A 1EESA 1UUFA 3JPYA 3H16A 5BMOA 3QPWA 3KWMA 1Z7EA 3SF0A 5HTKA 1DKMA 4TYPA 3NKLA 1H0HA 1YBAA 2CYBA 3EFOB 3DT9A 1EE9A 4YWJA 4KWHA 3DD1A 2AN3A 1XAGA 1QCYA 4E46A 4GHLA 2IHYA 3DHWC 2RHBA 2PV0A 1UKBA 3FCXA 1Y1SA 3RBVA 1ZNZA 4KNWA 2B37A 5E9AA 4ETIA 4QUIA 4G4OA 3KVOA 4ID3A 3QPCA 5MF6A 4FW9A 2X42A 4F11A 2ICAA 1EXNA 1XIVA 1QUFA 1QK3A 2FUG1 1G8GA 3FFAA 3BXGA 1T8SA 3FTNA 1CS4C 1WJGA 1AHNA 3AW8A 2HV9A 2ZCUA 4V24A 5JQGB 4GVPA 5IKMA 4N0MA 1I7NA 1ZUWA 1BEUB 3VTKA 2JFOA 3WYCA 4WKGA 5CK5A 3QIAA 1JX6A 8LDHA 3PC2A 3AWIA 2I29A 1RI5A 4RZHA 1G18A 3V8MA 4H6PA 4XR9A 4R98A 5K3OA 1YNSA 4D44A 1QR6A 4FB5A 3NO4A 4H59A 2D59A 1DWOA 3SKVA 3PHBE 2PS0A 5IJ0A 1BCSA 3LT1A 3W8DA 1YVUA 3HUEA 3ZKAA 1NOIA 2LNDA 4B44A 2WUVA 4X20A 5ALIA 5HZHA 4Y9RA 3PTLA 4C04A 3UJ7A 3NVMB 3D2CA 5AI5A 3EQZA 2R85A 5K8CA 5C1IA 4OQQA 1AQIA 1M0SA 2OVBA 1R8JA 3AL0C 4K9QA 3P4XA 1SQ6A 1Z0DA 4ZTZB 1E1RD 3A1SA 5EG5A 2QRKA 3NWOA 4IJWA 4TWAA 4RK6A 4ND4A 5LC1A 1P1HA 2F4VB 2BHSA 1UBMS 3PE3A 1DGBA 2WD7A 1PBNA 2ZE5A 2X0JA 1K6JA 1DAIA 3TOSA 2HCJB 3LUCA 1W88B 3OCVA 1YJXA 5DH9A 4EECA 1E7MA 1U28C 3D0OA 1Z12A 4PS0A 3QJ5A 4DQVA 2Z08A 3VDMA 1OAOC 2HHAA 3K16A 3ND5A 3H9JA 2AR7A 3BG5A 2HGZA 3EA5A 1M0TA 1WPQA 4LFCM 2JVKA 3PZBA 2QRLA 3UMFA 3IVMA 1POWA 2AN1A 4UU1A 4FDTA 4XVRA 1GKKA 4RPLA 4JIMA 4CT4B 4LWPA 3EPKA 5JYEA 1ULBA 1XR3A 2ACKA 5GPBA 1W4LA 4Y9SA 3EXFB 4RAQA 2GEDA 1I2MA 1XZ8A 3EFOA 4INZA 1V2GA 2QN2A 3HVUA 4DDKA 3F5DA 3C8ZA 3GEMA 2HPAA 2IYNA 2A4KA 1Z39A 2NU7B 2ZDQA 2CHQA 5K03A 3P32A 2RHDA 4UMFA 2QMHA 4RSMA 1ODJA 1DT3A 1DVRA 4TLCA 4I0WB 3LG2A 2P3LA 3ABRB 4WEQA 1NWHA 5E1OA 5ITZA 3FHOA 3O2QB 4EY6A 1QM5A 3UK1A 1HDXA 4QOFA 5CA1A 5DNDA 4M0UA 1SBYA 2PSJA 1QH1A 5B6JA 1TZCA 5JQGA 4I99A 2WSIA 3VU1A 2IYYA 4DXAA 4KRXA 4KL8S 4MB6A 1ANKA 5FF9A 3FTFA 3AR6A 5EZQA 4EF4A 5PGMA 1KXJA 4FDAA 4FQ8A 2XUGA 5DB4A 3HWX1 5K6RA 2ZRJA 1YWGO 1FQOA 1JQBA 2IY9A 4KYTA 2YN4A 2Q4RA 1H2BA 1E18A 2GF0A 1O6CA 4I6JA 4IWYA 4QGFA 4Y2HA 1OI3A 5SICE 2CCKA 3SIPA 3V9PA 1XTIA 2HFKA 1BZYA 2B4YA 2Z8ZA 1NBMD 3M1IA 1XSEA 1KZGB 4NEQA 2OTCA 3O2NA 4IDPA 3ORSA 1QG6A 3AUAA 3DTVD 2VK8A 4GKAA 4EI9A 1X8XA 2WRZA 1LF5A 3OP4A 1VKRA 3U4HA 3W9BA 4B7GA 3RH0A 1X77A 4YDQA 1WUIS 2AD5A 1ENPA 3RHFA 1GPYA 3T7RA 1K5HA 4HNTA 3N3BC 3E82A 5FEUA 4G4IA 3SX0A 2JJ1D 1KWGA 3PQ6A 3OG9A 4JR2A 2IZ5A 2FUKA 1KSGA 3T1TA 4FR5A 3WYEA 3OP1A 1W88A 1TJ4A 1GA4A 4OFBA 2J32A 3H2GA 3Q0TA 4EYQA 4I19A 1N1EA 1X6VA 3PLRA 2NZWA 4O4LF 1L8OA 1JFSA 1L4KA 1CUVA 1DO0A 4L9RA 2DU8A 4OGKA 2WKSA 4I5DA 2KLBA 5CIYA 3MPOA 5JAOA 4BIIA 1NN1A 1XYGA 4GSKA 3S6JA 1XKXA 1CB7A 4MGKE 1MD9A 4NAUA 1O57A 3OZBA 1K0UA 3C1OA 2FY8A 4WZAA 1PT9A 1FVHA 3H0CA 5KOHB 5DHUA 5IHXA 4FFLA 3FVQA 3RPEA 5NULA 1FUIA 2XCQA 3AW9A 1SCQA 3EXFA 5AKHA 1X8JA 1H3FA 2FPKA 3GNLA 2FPIA 4PYMA 3GK3A 3CTWB 2X0NA 5D6NA 3TEMA 3WK4A 2FOIC 5IG2A 4F60A 1BEZA 1YI1A 1T5SA 1WO8A 2DH6A 3ZHQA 1XMOM 1ZGBA 4MIEA 2P2YA 2Y0DA 1E0AA 2QLFA 1W5TA 5EEGA 3I9MA 1B2RA 3Q7QA 5BWMA 3E27A 1BWSA 1H1DA 2ZEJA 2GF9A 1C7RA 2L2QA 1TEXA 4GXQA 2H8GA 2VDVE 1GVNA 1KFJB 3HKEB 4CM4B 4KK4A 1MO3A 5I4CA 2OOBA 4LJAA 3K94A 3PNSA 4ZOBA 2IPNA 3IDFA 2JGIA 5DM1A 3HJTA 5E6SA 4OL9A 1E2QA 2DZOB 1O4WA 4A0RA 2D4HA 1H2WA 1IBMM 4WINA 4LDRA 2D2FA 4L9WA 4Q6BA 4DVGA 5AM5A 2F59A 2FW6A 4KX3A 3G2IA 2NXCA 1FP1D 1KMHB 1XQVA 5CIWA 2NG1A 3P9YA 3EASA 4WN9A 3HDTA 1FIUA 3THXB 1R15A 4HEQA 2O2DA 1AIPA 4M2LA 2DYKA 3KS8A 3QFCA 4BV2A 4BGUA 5JNWA 1U0EA 1WR8A 2NO4A 4FT4A 1EUCB 2GHQA 5DOVA 3IECA 3ELWA 5DISB 4NDNE 2R6JA 1E2DA 5KDLA 3WLAA 4I50A 1ZEMA 4IOMA 1C7QA 1ETHA 4NDZA 1T25A 3O8LA 3GGSA 3KFLA 4ERXA 1YB4A 4NZPA 4WJZA 1AKVA 2VDBB 3W90A 2XNJA 3JQDA 4Q05A 3CVVA 3EGIA 1LSJA 6YASA 2JEZA 1QIMA 4PHGA 1OLXB 4RKRA 3C15C 1KS9A 2H4HA 1RFLA 2DY0A 3F1LA 4GPD1 1NAHA 3K0CA 1IATA 3BD7A 5LYJF 1P5ZB 3G6KA 1VE6A 3HN6A 3G0DA 4LHYA 4IFEA 4MX8A 4I8DA 4Y9DA 2RHHA 1L7OA 4Y2SA 4TL8A 4HWGA 4A8PA 4JODA 2LXEA 3OA0A 2PK3A 1H5QA 4UNSA 4FHDA 4PLCA 2M9MA 1ODCA 3HRIA 3QWLA 1IU9A 1OYYA 1YKSA 5A3SA 4EOGA 5CDGA 3TBHA 3VC1A 4DPKA 4RZXA 3PR1A 3EEYA 5LOVB 5A5VA 1CPYA 2YV5A 3I64A 4A2CA 4NHOA 4EA6A 2I2AA 4W99A 1UQRA 4F38A 3DE4X 1XROA 2CFRA 4G25A 5H4HA 4X9XA 1K88A 3WDKA 2I5PO 5KYXB 3KU4A 3VR6A 3Q12A 3FTQA 1NMYA 1E2FA 1TQ4A 4URYR 4NEHB 4NYJQ 4HDSA 5EESA 1BDHA 4KBGA 3LCVB 4C5AA 2AI3A 2XGNA 3FWKA 4R71A 3ISTA 1X7ZB 2XTMA 2FEAA 1GPWB 2WIAA 2JFHA 3F7MA 3NHKA 4CM4A 4N9QA 3I53A 5BSTA 1Q77A 3PBKA 2ZJBA 1SK9A 4P33A 1AN0A 4BP1A 4AYWA 3O8QB 3C85A 2I03A 4L75A 2CWWA 4IWNA 5IU6A 1WGNA 4PDIA 4Z4HA 4Q4AA 1KZ4A 4E7OA 3WLJA 3P2EA 1YDHA 1PM5A 1Q44A 1VBNA 3I5MA 1WCIB 2BFFB 4AJ9A 2HDHA 3H8WA 3Q8XB 5BW4A 1UC5B 3RNLA 1OVMA 2QQGA 3GHHA 3WSVA 2A9OA 1P9RA 4AO6A 4EPRA 4C08A 1DRVA 3PX3A 4OHRA 3NC0C 2V58A 1HEIA 5CFOA 1N32M 4HAVA 3WZLA 5G4KB 2Y4OA 3KCQA 1PGPA 3IJRA 1P0FA 4FYWA 2H18A 3STWA 4CF5A 2BEVB 5FUVA 1D4FA 1T6XA 1Z2OX 4E5NA 4RXMA 4C4OA 3TB6A 1H9BA 4B4VA 3M6MD 5HM6A 3WOVA 3H13A 3CJQA 3L4EA 1NW7A 1LA2A 4WXRA 4KV7A 3NTRA 3GLHB 4RXTA 1FFYA 1GZVA 4G36A 1Z7YA 2IIPA 1KNXA 4CQLB 3VQTA 1CVLA 4EF6A 3RB8A 3RVJA 1OOEA 2GBFA 2RAPA 3AR7A 3FRHA 1U11A 2PVPA 2WKRA 3EZYA 1KEKA 2VAVA 1AK2A 3BJZA 4B2YA 1YGPA 4Z6YA 5CLGA 5A06A 3H1BA 3UWPA 4INAA 1C8VB 4H4CA 3CEPB 3R9XB 4JL5A 1UKAA 1BE1A 1MUUA 1JP7A 4MV7A 2NVUA 1C81A 3PUYA 5E3IA 1G19A 4HZGA 1NDUA 5KQ8A 1GAQA 4D79A 5FBLB 4ZYTA 1M7HA 4A91A 4DUGD 2EAUA 3MS4A 3LYAA 1W30A 3ND7A 3LC7O 1ZQ9A 4JEUA 3CEHA 5A4JA 4EATA 4LS3A 2XWJI 1HI9A 4F6RB 2J41A 4L9SA 2R47A 1L5FA 4MYRA 3LLMA 1YRAA 3S1SA 2WFAA 3GF4A 4OAPA 5K3BA 4C3VA 1VL8A 9ATCA 1MKYA 4RUKA 3PNYA 2X1VA 1R1DA 1BWPA 1ZBQA 4LTMA 1ZN9A 4B09A 1N5MA 4EY4A 1G7SA 1JQ3A 3SC4A 3TOVA 4OYYA 2ASEA 2FOLA 3SVTA 2R60A 3EZNA 4LJ4A 1X7ZA 4BJHB 3I2KA 4HOYA 5TMEA 2OXIA 2XYRA 1E3LA 2J0UB 3CH4B 3CRMA 1XF1A 4C2AA 5K1ZA 1YZNA 2YJ5A 1WXHA 2V9PA 3ISVA 3BDAA 3K9QO 4YUVA 3CX8A 4IBDA 3EBLA 4QXAA 2QN8A 4LV6A 4JJGA 2WHYA 1X1RA 3AI7A 3EULA 1ZCFA 2NO0A 1G5FA 1YKGA 1G8HA 5IYZF 4ALLA 2VATA 1ODKA 1I3CA 1NSTA 5M34A 3JWJA 3Q8XA 1ADGA 4G84A 2EOAA 4A10A 2V0GA 3AC0A 5IEJA 1YZFA 3CS3A 1LI5A 4G0YA 4TSRA 3R4VA 1NF3A 1P2TA 5JC8A 5ES3A 4O25A 3TI7A 4OV6B 2PSHA 2A1IA 1AM4D 4QT0A 5G4KA 4X00A 5TQJA 4H6XA 3V76A 1W0KD 1ZOPA 2BUBA 5E8RA 3TR0A 5HCIA 4RIEA 2GBGA 3TM5A 3ZLUA 5MN6A 1Z5AA 3A9RA 4HPXB 4ROSA 5HEKA 4QOHA 5LDDC 1J8YF 4OLBA 3TIGA 3TNDA 2WJYA 4EUFA 4X71A 5KQMA 4J16C 2A86A 1G60A 1TMYA 1FDUA 1DNPA 2RI1A 5B4TA 1V9LA 3GLHA 3CZPA 2RKOA 1USGA 1LDNA 3BWDD 2V3WA 2PS3A 1VRCA 1LJUA 2ZKLA 4AC9A 2DCMA 1CERA 4QEZA 2O25A 1E7RA 3LO8A 1L6RA 2B61A 5GM2A 3SHWA 4Q1VA 5GKNA 1AHHA 2WLTA 2L69A 5JALA 3WVNA 1RLTA 2FN9A 2IS2A 1YIOA 4JYAM 1L7RA 3OPXA 4WMLA 2A4MA 2XJ4A 5EIEA 1LQUA 4C0AC 4U7GA 1HOXA 5LMZA 3RKUA 4I1VA 3UK0A 3U3XA 3B6IA 1H23A 2MTBA 3QKSB 5D8DA 1B6RA 5ELLA 1A2OA 4WQMA 3OQBA 4IHJB 2FR8C 3IT3A 4B3IA 4HYQA 3SR4A 4X6XA 3G89A 5BVGA 4LCJA 4L02A 3HXPA 3QPAA 3EZGA 1G1AA 2ODPA 2P67A 1C4XA 4MDFA 4R8MA 3TIVA 3PXXA 1GAXA 1ZIXA 2F3QA 4LJ6A 1WD7A 4QPNA 4Y3UA 2FX3A 2PUJA 2LPMA 1DC6A 4P3OA 5KSPA 4G9BA 1ZRHA 2PX0A 3JASB 4W5RA 1OUMA 4O8CA 3RANA 1F38A 3COVA 5AVTA 4PPYA 3R23A 1V25A 2A92A 3RAEC 2VTBB 2CD7A 3M4ZA 3RSZA 4GM0A 4PG8A 3GY0A 1G55A 4PBTA 1NTRA 4D98A 3NT2A 2PH5A 2CEKA 1J24A 4TTRA 1UM9A 5BVHB 3RU9A 3GLGB 1SIUA 2E0IA 3TZKA 1XDWA 1XP5A 2R4TA 1UKVY 3H7AA 5KHAA 4RGBA 1A5TA 2ZRMA 5CCXA 1WBDA 3I72A 3FGPA 3W5AA 1TXGA 1VHTA 4TXLA 3C5WP 1Y6FA 4GO1A 3ER9A 1P6XA 3T99A 1XDBA 4GX5A 3RYCA 1W75A 2Z56A 2C4MA 1V8FA 4HFJA 4KYVA 1KEVA 3MZ0A 2R1VA 3DKPA 1R0BA 4DV7B 4GYYA 2P3OA 1GPKA 2KSQA 4WHMA 2Z8YM 1NMSA 1Z0AA 1UFRA 1UFVA 3WZ2A 1H2AS 2I7VA 1DXQA 3K15A 3F6CA 2VYND 4DJ5X 2I2BA 2OAGA 4JI2B 5C34B 1T26A 2I66A 1JKFA 3KSJA 4YJFB 4YHBA 3K0HA 2H4ZA 2HTEA 2YXNA 3VAAA 1ARZA 4D9MA 1DIAA 1CRZA 5KWIA 3ASYA 3ND8A 2VHYA 2CNLA 1P5HA 3MTIA 4PW0A 1W5AA 3FPLA 3QVMA 4BJ1A 2C5BA 3FF4A 1DRUA 4XRRA 4TUYF 2DX7A 1XV5A 3JQBA 3JQ9A 4BMSA 2RHGB 3UW1A 3DOFA 4YFYA 1M8GA 1HDOA 1XE3A 3DCNA 2WW8A 2BEUA 1XB2A 3I58A 3COPA 5G0WA 2VFAA 2F43B 4MXDA 1RZ3A 3HFSA 4GH5A 3HABA 5FTLA 2XADA 3DTVB 3FJ1A 3NPMA 4G63A 2EF0A 3KM0A 1I2ZA 2BGUA 4R1NA 4LF9M 4MI1A 3LFHA 3RVOA 5K4HA 2J6IA 5KNLA 4AUNA 4P80A 4ANRA 2RH8A 2C2ZA 5I3ZA 3QNUA 4LZZA 1E1RA 3SNKA 4AKSA 3FYDA 2D2XA 3QKSA 3V42A 1LPOA 1AF4A 2EKKA 1ZVVA 3AQ4A 2IUEA 4QXOA 3UMRA 3Q3EA 3LLVA 1VA4A 2DFDA 3NJ4A 4YLYA 4AZFA 1YDEA 4YAEA 1NLZA 4GI3A 1X86B 2M1XA 4R1TA 2IIBA 3VSDA 3MLBA 4RJ2A 2P6RA 4YQYA 1CUWA 1XLTC 1SA0A 3JASA 2PT9A 5JBQA 4ZI7A 2HL7A 3HVIA 1G6Q1 4N0EA 1KXZA 1R6AA 1FSFA 3WMXA 2C8VA 3G02A 2Z5GA 2VTBA 4CYMA 5GOZA 3GP3A 4EZEA 1Q02A 4RVGA 3KSMA 3Q7IA 4NFHA 2DQYA 1K6IA 3IV9A 2O23A 2E7ZA 5K6AC 5IASA 4XJTA 3KC2A 4YCMA 4NESA 1JF8A 4GE0A 1HZZC 4MDEA 5BVHA 3U4AA 3GLGA 2XTJA 3PQ4A 1XDGA 3RSSA 4ARAA 4UDOA 3F4KA 1MRNA 3F74A 3T7EA 1R6TA 1N2OA 4B2IA 4B3BA 4EW2A 3VR2D 1NSFA 4KAJA 1A2BA 2M6KA 4NZOA 2B4TO 4DBZA 1JIKA 3W1EA 2RD2A 1JYEA 1Y5LA 2A5LA 2HU7A 4ECEA 1OB2A 1YRQA 3L8DA 2AEEA 3AL3A 4G0PA 2C88A 1PL0A 3SDSA 3N6VA 2NZ2A 4Q9NA 4L74A 1BNCA 2JD1A 3WLEA 4BFXA 5AVSA 4AF7A 4Q93A 4EX6A 1BE8A 3SQWA 4I3FA 4V0RA 4CM3A 2BM9A 4E94A 2HJRA 5P8WA 4BC1A 2WYWA 1FVFA 3PJFA 1L5RA 5CDUA 3JCZA 2EL7A 5EN4A 4IKPA 4HEHA 4Q4LA 4FZJA 1OC4A 2BFMA 1FVOA 3UFXB 3KR0A 4IDAA 4YJFA 5I7AA 1W36B 7CATA 4EJ0A 4OXRA 4DLVA 4NSNA 4N47A 1UK6A 4EY8A 3UMSA 2XIJA 3RV4A 3IAXA 2DZDA 1U7TA 3HBMA 4HYEA 3WHKA 3EPHA 2EX4A 4UOEA 1F12A 1WS6A 4X45A 4NL4H 3NBXX 2ZU6A 1F1JA 2NU6B 4OA8A 4DXDA 3PNQA 5BUQA 4LY6A 2BFBA 3FPKA 2VVTA 2I2XB 2IYAA 4GU5A 3W05A 1NBMA 1UMBA 4R9UC 1UFKA 2M6SA 1EZZA 5JXWA 2R11A 4CV0A 2HEGA 1XTJA 5L53A 3DTVA 1JR6A 3CKMA 3VH4A 3PQ3A 3AHGA 1N7HA 2A33A 2MSKA 1J9EA 4LQ4A 4LYAA 4F9TA 3ESCA 5K0SA 2Q3BA 1YZLA 3ZXUB 1EX6A 2QSUA 4EJSB 3PXEA 3O38A 5TPWB 3QPDA 1I0ZA 4MS1B 1TJ5A 2DH5A 1KJYA 5IJZA 3K0AB 2ZU0C 5JJBA 1OLSB 3FTCA 1TCVA 4B84A 3PI7A 2PMBA 3BB4A 4FNAA 4MWBA 1XXHE 1V1JA 4HGRA 3PB3A 2VRNA 4P93A 4HC4A 1R3UA 4GKKB 4HVCA 2H1OA 1GTJ1 4GBJA 1JE1A 5KINB 1WNTA 1FZQA 3LPDA 5FRDA 2D0PB 4C9BA 1FL9A 1UBLS 2QJOA 5JYBA 4LSZA 3RM3A 1CQZA 1FFGA 1FQJA 1GV0A 3OJEA 3NX4A 1XDUA 4J43A 3M6LA 4IGKA 3WYNA 1MC1A 3PQFA 2Z7JA 3ROFA 4LI0A 3A98B 1ZC3A 4UN2B 1TGVA 3E46A 5BMVB 5IABA 4CN8A 2QL6A 3DMDA 2I4NA 2W48A 3D8SA 5H80A 4CG0A 1D9ZA 2VPQA 4UPEA 3JD4A 2O8BB 3VDUA 1NVAA 3WFZA 4Z2AA 2CNNA 3QP9A 2DFPA 2G9QA 3KP0E 2ZJOA 4I08A 1OYWA 2WR8A 5BSHA 5BXQC 2D5IA 2G80A 2OCIA 2J5BA 1L8XA 5F33A 1QRAA 1NDQA 3L18A 1EWKA 4D4KA 3TMKA 5BT8A 5TSDA 3NIBA 4ZOLF 1XTPA 1W19A 2WTBA 1SCJA 5HX7A 1DC7A 3K5HA 1P3JA 4HQNA 4ZGGA 4QDKA 5A5DA 4JI7B 3OZ7A 4LGYA 3A06A 3UFXA 5E7QA 3X1MA 4GMDA 3O83A 3AF0A 5DMXA 1KYQA 4HDCA 2Y3IA 2Y9MB 1ECCA 4L4XA 4ENWA 2JAXA 3SFZA 5ITXE 1PT6A 2L4FA 1FMFA 2C2OA 3ZC7B 4RY2A 3HXQA 1Z13A 3QUCA 5DCWA 1M6WA 4KB5A 4X64M 4L16A 2MSNA 2QUJA 2NU6A 5EHQA 1BHQ1 2WSBA 3CG4A 2FPGB 1RZVA 4JUAA 2IL1A 4CLXA 3R3JA 1XTSA 1QX3A 1WCV1 3TVDA 3D7MA 2EQ5A 2IHKA 3KOWE 4J7XA 3OA2A 4PIVA 1W48A 1BFDA 3L1UA 1ZQ1A 3TKAA 4L4ZA 2HK9A 4YI5A 4BFCA 3ANLA 2OT3B 4PANA 3NANA 5A9RA 5HKAA 3A42A 1AA6A 3NWPA 4PLHA 1MA0A 3G5LA 3SYNA 2R9VA 4WOKA 4IV8A 3P9PA 4EJSA 5TPWA 1ADYA 4MS1A 5JZBA 2Q1WA 4IXMA 1TQDA 4C0KA 3K0AA 4TKZA 2IU6A 2XW6A 2P30A 4ZMSA 1U80A 3M9XA 1TA4A 1D2AA 1WMAA 1PT8A 1FDVA 4BNDB 1HK7A 2WWXA 5B5SA 5DZSA 3C45A 1DKOA 1OTYA 4GWLA 3K6KA 1JJ7A 5JECA 3IEXA 4AIIA 1A9TA 2HYIC 1LJ8A 4OU4A 3T94A 2WWGA 2Z30A 1FRVA 3O4JA 1L2DA 4BWYA 1F8UA 4P92A 2VQEB 2VTKA 2I7XA 1T5TA 4D02A 1K3TA 3IP5A 3GU3A 1PUJA 3A6DA 1PX2A 4RH1A 1LNZA 2KRUA 4MITA 2X6RA 2NOAA 5IP5A 1EG7A 2ZI5A 4OKIA 4MS4B 4K9RA 3A1WA 2OVFA 2A0KA 3BICA 5L4NA 2QTNA 1QK4A 4RDXA 4X5OA 1RXSA 4I6EA 4IL5A 2C83A 4NCKA 5AK0A 3UK2A 2REOA 4JJFA 2XQVA 1O5TA 1ZL0A 3D4OA 3KQHA 3SJAA 3HBNA 1OX4A 3ZLVA 1JQLB 4E1VA 3SMQA 1JL3A 2G1PA 4BKOA 3LUJA 5CFMA 2PRSA 4GBMA 2PX8A 2IY8A 3NHBA 2CL6X 1GRVA 4N6NA 1Q7GA 4O0MA 2I7DA 4URUR 4RESA 1TM3E 1Y6RA 3U49A 1GA1A 4J0GA 4O4HF 1U8EA 4MAFA 1SUEA 4M7RA 1DRWA 4WFJA 2HWKA 1A5ZA 3TQCA 4PQGA 3GA0A 5EKTA 4NMXB 2GXUA 1X38A 2ACVA 5EKUA 3GAMA 4PVCA 3JQFC 3FOZA 3RTAA 1K6EA 4BNGA 1KFEB 4XEUA 5GQSA 2OQIA 3DOAA 4L1KA 1XNRB 5EWJB 4HMPA 1KI7A 4FIDA 4LMPA 1PD0A 1D0VA 3DB2A 4DCUA 3FXAA 2G76A 5TPZA 4NG5A 1QG0A 3EFHA 4JLUA 2FPGA 2OSVA 3P94A 1JWLA 2Q3LA 3MTQA 1A82A 3KKMA 1C5KA 2PX5A 3KLMX 5C5EA 1AV6A 3DMPA 3DMTA 4YH1A 2V96A 3M4NA 3GW8A 4RS3A 4MRAA 1NXTA 1RXEA 1VBMA 1XEAA 4AECA 3AETB 1NFFA 4U7WA 2BUAA 2XHEA 4TTSA 1JB1A 4MLPA 1XZJA 2FLVA 1V5WA 1WUHS 2ZPTX 1DO2A 4KP7A 2NZYA 1IBRA 3CV3A 5DBOA 1N2XA 4F96A 2WYOA 2VNAA 5T8KC 4ZJUA 1RKBA 2J59A 1KJQA 2SBTA 4V0KA 1QDTA 1DC8A 1YDMA 3LZ6A 4XEHA 1S89A 4BNDA 4AF8A 1RWPA 1SOVA 4G5GA 3V2UA 4ZJYA 2WTUA 4DIMA 2I91A 1G9XA 3ABSB 4IBCA 2OG1A 1L4UA 4BLQA 2B94A 2ENUA 1DJOA 4M37A 5EP1A 3BOSA 3BB1A 3AESB 4IDBA 3NZEA 2Q5IA 1Y8QA 1TU0A 3KEFA 5I6DA 1XRNA 3R2JA 1YHNA 4R1MA 2D7EA 4ZVQA 5K8JB 4PCZA 4PC3A 3M4JA 1P72A 4DUGA 4F3RA 2VEDA 3IJEB 2R62A 2XSZD 5DULA 3GMTA 4CKBB 5C51B 4KGDA 2QRPA 3I6BA 2BEWB 1G21B 3ZD9A 1BE0A 1CP3A 4WNAB 1ENOA 3DZHA 2EQBA 1E5DA 1CUJA 1TM2A 4XDYA 1XNGA 1P77A 2ZBKB 2IPXA 3TEJA 1GU0A 1V7PC 5HGJA 1GOTA 1U4SA 1QPBA 1SVKA 2DZNB 3A6GA 5DLQC 4RIFA 5CW1A 3M5CA 4B6OA 1YFLA 2WT4A 3DBVO 4R9VA 2IY7A 4HL4A 1VJ1A 1B8PA 5DSXA 4WJKB 4ZWNA 1GZ7A 3OHSX 3T9BA 4A3SA 1Z26A 2XV1A 3TQQA 1OTRA 3SEAA 3JVEA 4PGFA 3R0VA 5DYIA 5DTQA 3CGWA 5DJ5A 2GLXA 5LDGA 1UZNA 3ZD6A 3RU7A 4YYEA 2B78A 2ECQA 3ZVLA 5HCNA 3QEMA 2FZEA 1GRRA 1V5EA 3NIDB 2ORYA 1MPTA 3ZWBA 2FAXA 3IKTA 2IKQA 4MWZA 5EWJA 1N8KA 3X3HA 2RARA 3VO9A 2FFQA 3T3HA 5KNCH 5I8WA 4QFMA 2DY1A 2WVJA 2QPTA 2M2IA 3WNDA 1H4TA 3CCFA 3GAFA 3G2QA 3U3OA 1W1IA 1FYDA 1MB0A 4B40A 3DNMA 5EI5A 4CMBA 1Z37A 4ETWA 1BIFA 3VDQA 1ZW1A 2WSFF 2ID7A 1GGNA 1W0KA 2IDJA 1OFIA 1QK5A 4JVOA 1T1RA 3S3TA 3EX7C 3VSAA 3MVEA 1O7JA 3I23A 2BHTA 4F2GA 1QGUB 5IDVA 3WGGA 3M6XA 1SUCA 2E37A 2JI8A 1NONA 2LUOA 4DIUA 2HHCA 1JMVA 4MYTA 4AY5A 3PGMA 3MWDA 3ASVA 1NVVQ 4ZZ0A 2AOUA 1R4MB 2FSVA 1XMVA 4BYGA 2V8BA 3F98A 3U5ZB 4Q47A 2OFWA 5CB4B 1SUWA 2VYCA 2IXGA 4ENUA 2Z9BA 1QYVA 3S2YA 3X1DA 1ETUA 1K82A 1FDRA 4MVJH 4E13A 2PUWA 3KQOA 3FOBA 3LBFA 3LP5A 5KYNA 1X0VA 4XD2A 1C0PA 5IUKC 3AV3A 3F67A 4D4GA 1P5JA 3UG7A 3ZK8A 1DI0A 2OHHA 1ID1A 2AXNA 3N5CA 3WDLA 4P86A 1TIPA 5CHYA 2A0WA 3ZD7A 4BMZA 1R6UA 3DKRA 3FETA 1SUPA 1IOWA 4L6AA 2RH9B 1QGOA 3RCBA 1XQWA 1Z8NA 4KCGA 3R74A 2PQ6A 4CKBA 3FN4A 1V16A 2UZIR 2WSLA 1WSWA 3L1KA 4P84A 2BEWA 1G21A 3CRNA 4DARA 1XALA 4N9WA 4BMYA 2HREA 2E6KA 3QHPA 1N57A 1ZVMA 3GJ8A 1U65A 4OK6A 3WLIA 3MMZA 1UP6A 1AS3A 1J2JA 3KQNA 3VRHA 4GSYA 4KHPB 1YRWA 2BFCB 1IAVA 1AE1A 4CEIB 1PE0A 5TF0A 3QF4B 1PT7A 3L27A 1TCUA 2Q28A 4UEOA 4MR8B 1QXSA 1EDOA 1VSTA 4E5PA 3F5SA 4IMIB 4DQDA 2DFNA 4YMSA 2QU8A 4TRNA 3LF1A 1EQ2A 2K7ZA 5KVCA 4BLVA 1D2CA 2CSUA 5FCDA 2MSEB 4B4KA 2OPFA 4AJJA 4HLUC 2VHJA 2QVGA 1DQSA 3ZWOA 5FOTA 2JNWA 2KMLA 2ZUCA 4Y1RB 4TWRA 3AUUA 4OJKA 2L82A 3T54A 2QDXA 3DQQA 3ZCXA 2QTFA 3IXQA 1XO1A 1UPXA 2JNHA 3E6AA 3AOEA 4G5HA 2XOEA 5CIQA 3A2NA 3RJMA 3WGKA 2GM9A 3H2ZA 1XUOA 3GIDA 3VBEA 5I3CA 3N7AA 1YU9A 1XYYA 2VYNA 4O2BB 1X87A 3H5IA 1GUZA 2P2CA 2HIAA 4P2BA 3DLBA 2OBFA 4JVMA 5CCDA 1QGUA 4ZMBA 3FR7A 4CR6A 1IM8A 4E5DA 4GYKA 3SHFA 4JELA 1T6BY 3T9CA 3NT4A 3WKAA 3W67A 2G70A 3NYQA 2Y1FA 1GPAA 2XRFA 4YY3B 1YR2A 3UG6A 1Q57A 4EGSA 2HB6A 3RIHA 1JSLA 1RE0A 1U8XX 4BASA 1TT7A 1V1MB 3KSXA 2VSOA 2BR5A 2QAGC 3ADBA 1JDBC 3WGMA 4OQ4A 4ML3A 4X62B 1JG3A 5GONF 4AQYB 3KDAA 1Z8DA 2HF7A 2WI8A 3TNLA 3C3JA 1YIAA 1G8YA 1GFIA 1BKDR 1WW2A 1A96A 3IXMA 3B1WA 1CUUA 1CK4A 3H5VA 3KJHA 2ZIXB 1BSVA 4WL0A 2W8BB 5K0GA 2QV0A 2N9UA 2PZEA 3LBAA 1IPFA 4UM5A 3IPCA 1S4MA 2CVZA 3DLAA 4MPRA 5A0FA 4L9AA 3KVYA 4NK4A 1NYLA 1FTQA 4N7MA 1RI4A 2G3YA 4GPAA 3EHEA 3N5KA 4WKOA 4W5HA 3RTBA 2XB8A 1D2MA 1JR3E 3H0KA 2KZSA 2E1RA 1M1ZA 3AHFA 3L93A 3IHPA 1J90A 3F8TA 2IW3A 3BREA 3BN3A 4KH1A 3I30X 2R8ZA 3ZJ5A 4IRMA 3BXOA 1JXMA 2Z6QA 1SUIA 4HWSA 2FFBA 2GARA 4QJ4A 2O0KA 3ASUA 4NCJA 3ESAA 4CEIA 4UFOA 3ZZUA 3PRHA 3SQDA 2OGZA