5DFLA

Crystal structure of ube2k~ubiquitin conjugate
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
199
structure length
199
Chain Sequence
AANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAIKLDILRDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLSAMGFDRNAVIVALSSKSWDVETATELLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis of lysine 48 ubiquitin chain synthesis by Ube2K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/signaling protein
molecule keywords Ubiquitin
total genus 68
structure length 199
sequence length 199
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00179 UQ_con Ubiquitin-conjugating enzyme
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 5dflA02
3.10.110.10 Alpha Beta Roll Ubiquitin Conjugating Enzyme Ubiquitin Conjugating Enzyme 5dflA01
4A4BC 4GPRA 2LBCA 4NRIA 4LADA 1OTRA 4S3OA 4JQUA 2BF8A 4AP4B 2ZTDA 3P9HA 3E21A 3EB6B 2KNVA 3VONC 1IM2A 2L4FA 1U9AA 1NV9A 3OBXA 3UGBA 1M4QA 2GRNA 1FZYA 3H4JA 2KNZA 3K9PA 2RRUA 4MDKA 2MR9A 2Z6OA 4JUEA 1Z3DA 4DHZF 4BVUB 4F2LA 3P9GA 1VEGA 2O25A 5D0KA 3GLGE 4ONNA 2MROB 1I7KA 4NRGB 1P3QQ 1TR8A 1PGYA 4M1NA 2OB4A 2GJDA 3LCUA 3FRIA 1SG9A 2DZLA 2QNJA 3O2UA 2ESQA 4DHID 4HEOA 2EBMA 4YIIU 4DS2A 4QPLB 2DAXA 2EJSA 1YLAA 1G3IA 2DNAA 3OBQA 1WJ7A 2UCZA 3JVZA 5EGGA 2JP7A 3HCTB 2OO9A 2A4DA 2EDIA 3E95A 4NRIB 2ESPA 2MJ5B 2JZ0A 1VG5A 1HT2E 2DHYA 1KPPA 4UN2B 2OOAA 2YHOB 2KHHA 1A3SA 4II2C 5D0MA 3K9OA 3UIOA 2C4PA 2GROA 1Q02A 2JUJA 4WP2A 2JY6B 2R0JA 1VDLA 1AYZA 2JNHA 2KNAA 2LVPC 3SQVC 2FO3A 3MMPA 2K07A 1Y6LA 4Y1LA 4ONLB 4A4CC 4Q7JA 1JATA 3IHPA 3JW0A 2C2VC 3OBSA 4Q5EC 5F6XA 2DI0A 3VONB 3GLFE 1KPSA 4F1IA 2Z6PA 2EBKA 3RZ3A 1EFUB 2GMIA 1Z2UA 2Q0VA 4Q5HC 2EKKA 1XB2B 2CWBA 5F6YA 4NR3A 2OXQA 5D1KA 1DO0A 2C2VB 1YF9A 5D2MA 4ONNB 2BWBA 2L4EA 2CLWA 3TGDA 3H8KA 1JR3E 2WZJA 2EKFA 3CEGA 2O25C 1MN3A 5AIEB 2YBFA 1J74A 3ZQSA 4A49B 3L1YA 2JZ1A 2QHOB 4V3LA 1Q34A 3UINA 2DMFA 2CP8A 2KLYA 4P5OG 5F6WA 5AITB 5F6UA 1JATB 2LVAA 3F92A 1NV8A 4V3KA 1VEJA 2DENA 2ONUA 2G3QA 1WHCA 1YH2A 1DV0A 2H5XA 4BWFA 3KPAA 1OAIA 1IFYA 1U9BA 2GMIB 3E95C 4EJEA 2BEPA 3A33A 1E94E 5D1LA 2AAKA 1G4AE 5AITD 4L83A 2F4ZA 4DDGA 2ZTCA 4LDTC 1FXTA 4TKPA 1WGLA 2YB6A 1C7YA 1W4UA 3T6PA 5FERB 1WR1B 1PZVA 4NRGA 5HPTC 1HQYE 2DAWA 5KNLC 1S1QA 1TTEA 3ZNIC 2HLWA 1JBBA 3GLHE 5F6DA 1A5TA 1BVSA 1WZWA 5AIUB 4GEWA 3ONGB 1ZDNA 3FRHA 5FQ2A 4AUQA 3RCZB 1JASA 3BBZA 3FE3A 4R62A 2GRPA 4Y1LC 4IP3B 1ZMUA 4ONMA 5D1MA 4CCGA 4ZNYA 3WE5A 1V92A 2DAEA 4X57A 2Y9MA 2LVOC 4DHJC 1C4ZD 5IFRA 1ZGUA 3RPGA 3SY2C 3L1ZA 2DAYA 3UIPA 1WZVA 2JY8A 5JI2E 1CUKA 2QGXA 2LTUA 3EVXA 2UYZA 2Z5DA 1T6OA 2PE6A 1XXHE 1Y8GA 1ZMVA 1F4IA 1J7DB 2DKLA 4DBGB 2K9DA 3GLIE 3B89A 4R71A 4YC1A 2LVQD 1KYIA 1WGNA 2LXPA 1FBVC 3PTFA 4WZ3A 2JY5A 1WIVA 1T43A 2OOBA 2DAIA 2R0IA 1OQYA 2HAKA 2L2DA 3A4SA 3HCUB 2KJHA 3OBUA 4G3OA 2Y9PA 2CLWB 5F6EA 4FH1A 4DDIA 3OJ4A 2VRRA 3IECA 2F4WA 1Y8XA 2BWEA 2B3TA 1KPQA 4W5VA 2CYXA 2MGWA 3BZHA 1QCQA 5F6VA 2DAGA 3E46A 1QZEA 1M4PA 3R3QA 2DAMA 1HT1E 1GO5A 5DFLA 4ONMB 1R4GA 1J7DA 2ESOA 1VQ1A 2GRQA 3R42A 1VEKA 2EKEA 2K0BX 3FSHA 2DAKA 4ONLA 2JY7A 1X23A 2HWJA 1ZMWA 1G41A 2LVNC 1UFZA 1YRVA 1OKSA 3LCVB 2AWFA 1AIPC 2A7LA 1UZXA 2ESKA 2NVUC 1ZUOA 3W31B 1Z5SA 1IXSA 2YZ0A 5JNEB 2MT6A 4NR3B 2FUHA 2AYVA 2GRRA 1HJPA 2PWQA 2H2YA 2PX9B 1ZV1A 1DO2A 2QSFX 3FN1B 2XWUA 2F0RA 2E2CA 2Y4WA 1UKXA
chains in the Genus database with same CATH superfamily
4A4BC 2F4VM 3RE8A 4IBJA 1MU5A 4RF0A 4GPRA 1QVRA 2FOIC 2J5YA 3CF2A 2LBCA 4WURA 4NRIA 1DGBA 2QBYA 1G71A 3UJNA 3FUUA 4AG5A 3J2PB 1QYRA 3A98B 1OTRA 2M5ZA 2YNMD 4LJ8A 4LADA 4S3OA 4NRGB 3MJ5A 4LJ9A 4JQUA 2BF8A 3TPZA 4AP4B 2ZTDA 3P9HA 4X66M 1ZQ9A 3E21A 1VDDA 3EB6B 2KNVA 1E9SA 5BR8M 3VONC 3WHLA 4B7HA 2YR0A 1IM2A 3HZJA 4XK8F 4AQYM 2C9OA 2DVWB 2L4FA 4M9ZA 1NV9A 1ORYB 4LGYA 5EJCA 4BBAA 1U9AA 3SARA 3OBXA 3W0LB 3UGBA 1L1TA 2R44A 1JQJC 4FVMA 4GHAA 1M4QA 3W68A 1IY0A 2MH8A 3GO8A 1J09A 1FZYA 4GC5A 2GRNA 2K6BA 4B3RM 5KPTA 1GJTA 2KA6B 3H4JA 4CGYB 4LFAM 1V33A 2EUCA 1OJLA 3W0FA 2KNZA 3K9PA 2CV2A 2RRUA 1RU3A 3GLHB 1JB0F 4Z6YA 2MR9A 5ITXE 4DR2M 4DR5M 1N32M 2I7NA 1I94M 1Z3DA 2Z6OA 4JUEA 4BVUB 1IN8A 5EP1A 2R18A 4F2LA 3P9GA 2XH9A 3IG5A 1VEGA 3LW5F 2O25A 4L15A 5EXXA 5D0KA 3A46A 1L1ZA 3U6CA 3E9SA 4OX9M 3GLGE 2R62A 3SHGB 4ONNA 3NBXX 3J7BA 4AKHA 2MROB 1EE8A 1I7KA 2Y4WA 2C9CA 1P3QQ 1TR8A 2JWSA 3FD9A 3PXGA 3SBJA 3GPPA 1PGYA 1GABA 2R4EA 4M1NA 2KRUA 2HL7A 4IBGA 2OB4A 1XNQM 3LCUA 3GLFB 2GJDA 2O01F 2ZBKB 1SG9A 2DZLA 3FRIA 3FTDA 5ITYA 1JR3A 2QNJA 2XSZA 8CATA 3GPYA 4DV3M 3SMSA 2ESQA 3O2UA 4HEOA 4BWFA 4DHID 2EBMA 4YIIU 1PJTA 4QHTA 2QZ4A 5FTNA 5FTLA 4DS2A 4YHHM 2D7HA 3QYBA 4GMQA 2EJSA 7CATA 2DAXA 4QPLB 1YLAA 3KP0E 2UXDM 1GL7A 4FCWA 1G3IA 1XXHA 3FTCA 2DNAA 4LRTA 5ITUA 2Y0TA 4AZFA 3OBQA 1WJ7A 3V76A 4DV0M 4GITA 3KOZE 2UCZA 1SXJA 3LVWA 3JVZA 2VDBB 1XNRM 4K0KM 5EGGA 3GRVA 1PJQA 2F5PA 2JP7A 1IQPA 3HCTB 3GRRA 4LCBA 2OO9A 5E6JA 2A4DA 4D80A 3C9PA 5DYIA 3UZUA 1GJSA 4EIWA 2EDIA 4B7GA 3E95A 3HKPA 4NRIB 4MGIE 5IT9S 3AJIB 2ESPA 5KPRA 2MJ5B 4OVZA 1L2BA 1D0MA 2JZ0A 4JN6A 3B7NA 3PNYA 1VG5A 2KZSA 1HT2E 4JV5M 3KOWE 3M6AA 2DHYA 4M9XA 1MJGM 3LQRA 3JR4A 1KPPA 4UN2B 2OOAA 4QOZC 2YHOB 1LV7A 2CUZA 2KHHA 1A3SA 4II2C 5L8RF 3B9PA 1Q3CA 5D0MA 3SATA 3TQSA 3K9OA 3B7QA 4B3MM 3UIOA 2ZM6M 1OAOC 1N33M 2C4PA 4PDGA 2GROA 4P17A 3SMPA 5KQ8A 1Q02A 1QZMA 1OFIA 3MK6A 1IN7A 2JUJA 4WP2A 2LH0A 3VFDA 2V1UA 4DR3M 1H6UA 2JY6B 3JAMS 2GQFA 1VDLA 2R0JA 2EA0A 4GKKM 1E32A 5EXSA 5IWAM 1AYZA 3AKZA 1YRVA 3A42A 2VQEM 2JNHA 3U6PA 3U61B 2KNAA 2EO2A 3FUTA 1IXRC 2LVPC 4NL4H 2XFTA 3SQVC 2X4AA 2FO3A 3MMPA 2Z4RA 4NSOB 2UXCM 2K07A 3HJSA 2L09A 4PDIA 1QAMA 1Y6LA 4Y1LA 4ONLB 4A4CC 1HNZM 2ZANA 4I5SA 3SASA 2N35A 4IBKA 3IHPA 4Q7JA 4MH0E 1JATA 4FWGA 2X8AA 2C2VC 3JW0A 5LMNM 3OBSA 4Q5EC 5F6XA 2HCBA 2CHGA 3K1JA 3LVVA 2YFQA 1XMOM 2FS1A 3U6OA 1QUTA 1Z6TA 2DI0A 1T3TA 4HL4A 3GLFE 3VKGA 3VONB 1KPSA 1WXQA 2WSCF 4MGKE 3M0EA 3PVSA 2Q2EB 4LZZA 4F1IA 2EBKA 4S12A 2Y0QA 4Y28F 2Z6PA 1EFUB 4GKJM 3RZ3A 2GMIA 4NSRA 3L26A 1Z2UA 2Q0VA 4Q5HC 2EKKA 3KVWA 5IREB 2FH0A 3EIHA 4LJ7A 1Z5CA 4PT5A 1XB2B 2BJWA 1HR0M 3QAUA 2ZAMA 2CWBA 5F6YA 1IN5A 4M0WA 4NR3A 4FCTA 2OXQA 5D1KA 3FUWA 3GP1A 1DO0A 2C2VB 1YF9A 3HGIA 3QWLA 1R7RA 5D2MA 4ONNB 1FNNA 4DR1M 2BWBA 2L4EA 2CLWA 3TGDA 5EXPA 3H8KA 1JR3E 3A45A 1IBLM 2WZJA 2EKFA 3CEGA 1L8QA 1IBKM 3K92A 4LF5M 4JI0M 2O25C 2Z4SA 1MN3A 3PFIA 4GC9A 4LJ4A 5AIEB 1S3SA 2H1RA 2XEPA 4FD2A 1J74A 1D0LA 4CIZA 2YBFA 3ZQSA 2CEAA 3KXEC 3NBIA 2LHGA 4KT0F 3L1YA 2KDLA 4LZJA 4A49B 1Z59A 4L4UA 2JZ1A 2VQFM 2DWNA 4MDKA 4DV6M 2QBYB 3GQ5A 2CV0A 4AI6A 2CV1A 1IBMM 2QHOB 1XMQM 3D8BA 2BJVA 2UXBM 2J7OA 1IN4A 3GLGA 4PD2A 3J7AS 1Q34A 3KS4A 1SXJE 3DZDA 4OW0A 4V3LA 3UINA 2DMFA 2W82A 2CP8A 2KLYA 1QAQA 5KO3A 4P16A 3KS8A 2OPFA 5EP3A 4P5OG 5AITB 5F6WA 5F6UA 3GQ4A 1JR3D 1JATB 4DR7M 1TGUA 2WSFF 1DGGA 3ZQJA 2F5QA 1W5TA 3HHWA 3UK6A 5BPVA 3FUVA 2APLA 2LVAA 3F92A 1PJJA 2C99A 2DWMA 1NV8A 2XFSA 3HHYA 3U5ZB 1W5SA 2QCUA 1VEJA 2DENA 1QAOA 3L2AA 4IBFA 3R9XB 2ONUA 3U61A 4DV7M 2G3QA 1NJFA 4LFBM 3I4VA 1WHCA 1HQCA 3KSJA 1YH2A 1R5LA 1DV0A 2C5RA 4L78A 3VK7A 2QENA 2H5XA 3SHFA 3C3DA 1D0KA 4B7FA 1NHWC 2QP9X 3KOXE 4I4LA 5E26A 3OTOM 4AKGA 2FNAA 3KPAA 1OAIA 1SXJD 4IBCA 1IFYA 4MGHA 4DHZF 1NJGA 1U9BA 3D8LA 4ZPXA 3W67A 5F3WA 2F5OA 2R45A 5FLXS 2GMIB 3MHVC 3E95C 1PM5A 3U6EA 1IY1A 2L7HA 3GLFA 4FWDA 3IG8A 4CISA 4EJEA 2BEPA 3A33A 2J7NA 1E94E 5D1LA 2AAKA 1G4AE 5AITD 1SXJC 3SAVA 5A2QS 4L83A 4RKUF 4MGZE 4X64M 4PCZA 1Z5AA 2F4ZA 4DDGA 4AG6A 5FSWA 2ZTCA 3GRYA 4LJAA 4LDTC 1FXTA 4L16A 2UUBM 3B7ZA 3AL0C 4MGYE 1WGLA 4B08A 1R2YA 4I81A 2YB6A 2A5YB 3GLHA 1J7KA 1C7YA 4LG2A 3HJ8A 1HNXM 1W4UA 2UU9M 1SXJB 3SYLA 3T6PA 1N78A 4AKIA 4XGIA 5FERB 4NC6A 1E9RA 2KZUA 4G4OA 1WR1B 2G5GX 4X62M 1PZVA 4DR4M 3SYKA 4QNRA 4DUYM 4NRGA 3U60B 2C96A 3QYEA 4W5WA 5HPTC 4TKPA 1HQYE 3I01M 2NQ8C 2DAWA 3K2LA 1IN6A 5KNLC 4FWHA 3HX3A 1TTEA 1S1QA 2KEBA 3TL4X 1AUAA 1NO1A 4Z8XA 3U5ZA 4KO8A 3ZNIC 2HLWA 3BOSA 5EXTA 1YE9A 4DV1M 3U6DA 2DXIA 2R65A 3GLHE 1JBBA 5F6DA 3T15A 3KW6A 3Q8XA 4ANRA 1A5TA 1MX0A 4KODA 4LY6A 3AOGA 1BVSA 3BXWA 2D7GA 3VDPA 3UMMA 2HHHM 4LF6M 2DZNB 4L6V6 1K82A 1WZWA 4CJ6A 4RF1A 5AIUB 5H37D 5ITQA 1K3WA 4GEWA 4RNAA 3ONGB 3UGJA 1ZDNA 3FRHA 5FQ2A 3L29A 4OU7A 4AUQA 3GLGB 3RCZB 4B3TM 1N34M 1JASA 3WHKA 3BBZA 4R7GA 3FE3A 4LRSA 4R62A 2DWZB 2GRPA 4Y1LC 2BNKA 4YY3M 4ITQA 4BB9A 4IP3B 1ZMUA 1Q3BA 2KXEA 3KOYE 3JR5A 3L27A 4ONMA 5D1MA 2F5SA 3SFZA 2QQ8A 3I4YA 1HNWM 2WSEF 1OIPA 3THGA 3C58A 4CCGA 4LF7M 4ZNYA 3SC3A 3WE5A 1V92A 4WW0A 4G4QA 3TWLA 1V34A 2DAEA 4JI6M 4X57A 4JI4M 2L7IA 5ITTA 2Y9MA 2LVOC 4DHJC 2RKOA 3NWLA 1C4ZD 5IFRA 3HJQA 1ZGUA 3R8FA 2RGOA 4DV4M 3U6LA 5DNYA 1DGHB 3RPGA 1J5EM 4LF9M 1TDHA 2LHCA 3EIEA 3ZC7B 3L1ZA 4KHPM 2DAYA 4D81A 3SY2C 2KW0A 1Z5BA 2DHRA 1NNUC 2Z7JA 3AFHA 1L2CA 3RFWA 4JI7M 1WZVA 4LF4M 3UIPA 4DR6M 4KLNA 1YUBA 2JY8A 1IY2A 3I04M 5JI2E 1CUKA 2QGXA 1KFVA 2LTUA 1QUSA 3EVXA 2QPAA 1GKIA 2XF3A 2I7PA 2UUCM 2UYZA 2Z5DA 4JYAM 1N36M 3ILKA 1T6OA 2FE8A 4GRIA 5C1BA 1TDZA 2VF8A 5ITXA 3GLIB 4I8OA 3HWSA 3M7GA 4IBEA 2PE6A 1XXHE 3U6SA 4JI1M 3BZHA 3HHZA 4FW9A 1TH4A 2O5RA 2R46A 3KP1E 1Y8GA 1ZMVA 1F4IA 3AV0A 2AHMA 2JA2A 3RGPA 1J7DB 4X65M 2DKLA 4DBGB 1PRBA 2DZOB 2XLJA 2K9DA 2LNHC 3GLIE 2V6ZM 4LGMA 3B89A 1QDTA 4IBIA 4D82A 4R71A 2X49A 3VK8A 5GKNA 4LF8M 3ZH9B 4NXMM 2XSZD 2F5NA 3LQQA 2LVQD 1NY5A 5EP4A 5EQTA 1KYIA 2GNOA 1ZAEA 1WGNA 2VIIA 4MM3B 5ITRA 2JXNA 4FCVA 2LXPA 3CGWA 1PJSA 1FBVC 2CHQA 4DUZM 3PTFA 3U60A 4WZ3A 3C3EA 3HU3A 2JY5A 3GLIA 2LXEA 4OVZB 1WIVA 3E4RA 1T43A 2OOBA 2DWLA 1TH3A 1Q39A 4MB7A 4NXNM 5KPZA 2DAIA 2RGHA 3VLFB 1R2ZA 1QDRA 2G8LA 2R0IA 1OQYA 2HAKA 4M9SA 4XBOA 3FKEA 2L2DA 3HHXA 3H4MA 2OQ4A 2Z3XA 1G59A 1GVNA 3A4SA 3U6MA 1L2DA 3HCUB 4A3VB 2KJHA 3AOEA 2R6FA 5C18A 3OBUA 4G3OA 5JI3E 3K8ZA 2Y9PA 2CLWB 1YSYA 4QHSA 2CRUA 3J27B 2XZFA 4IIWA 5F6EA 4NRWA 4FH1A 4DDIA 4R3DA 1I4WA 3SAWA 3OJ4A 5EP2A 1UM8A 3DA1A 1OIZA 2VF7A 3TWMA 3HU2A 2VRRA 3IECA 4JI2M 1QQWA 2F4WA 1G8PA 1GL6A 1Y8XA 2HKJA 3HY5A 3T1HM 1NNJA 1C1KA 2Y20A 4JI8M 2BWEA 2B3TA 3GRUA 4DV2M 4JI5M 5F6VA 2YQZA 4HLQA 1KPQA 1TF0B 4W5VA 4NRVA 3FYCA 2CYXA 1XC8A 3FUXA 2MGWA 4LJ5A 1GLNA 2R4JA 3LMMA 2D7EA 2UUAM 2C98A 1QCQA 4DV5M 2DAGA 3E46A 3KSXA 4G4NA 4LFCM 1QZEA 1M4PA 4JXJA 3HU1A 3VDUA 4IBBA 2E5LM 4L8RC 1NVMA 3R3QA 4IBDA 1XWIA 4YC1A 5FTMA 1QANA 2DAMA 1HT1E 1X37A 3T1YM 3AOEC 1N77A 1GO5A 3DFZA 5DFLA 3FTEA 4ONMB 4V3KA 2LWXA 1R4GA 2KRKA 5FTKA 1OFHA 1J7DA 3B74A 2CHVA 3I51A 3CF6E 3Q8GA 2ESOA 1N75A 4JI3M 4QOSA 1VQ1A 4REZA 2GRQA 3R42A 1DGHA 1VEKA 2EKEA 2K47A 1LTMA 4GH9A 3ZCBB 3J80S 3T38A 2FFJA 2K0BX 1NHGC 3FSHA 2P5TA 2DAKA 4NOOB 2JY7A 1X23A 2CE7A 1ZMWA 2HWJA 4ONLA 4IJFA 5LMUM 4GHLA 1G41A 1NY6A 4QNMA 3GPUA 1EIJA 2LVNC 1XHBA 1UFZA 3CF0A 2Z8YM 3PNVA 3L28A 3U6QA 4M0DA 2M60A 2V1CA 2XZUA 1DGFA 4CHTB 1OKSA 3LCVB 5IZ7D 1FJGM 2AWFA 1AIPC 2A7LA 1UZXA 1XXHB 2ESKA 3CTWB 3TWKA 1PJIA 1R6BX 4II7A 3GPXA 1KSFX 2NVUC 1ZUOA 4IJEA 3W31B 5DYGA 4AW4A 3J81S 1Z5SA 1IXSA 3SAUA 2YZ0A 5JNEB 2ZAOA 2MT6A 3VKHA 4NR3B 3TE6A 4BLCA 2FUHA 1TH2A 3KFUG 1K3XA 3KDSE 2AYVA 2GRRA 1HJPA 4TUWA 2PWQA 5FTJA 3DOAA 2H2YA 1IXSB 2PX9B 1ZV1A 2XGNA 2L6OA 1DO2A 1NSFA 2Y21A 4GIPA 4LJ6A 3FYDA 1IXZA 2CFOA 2QSFX 4G6ZA 4B3SM 3L25A 2XWUA 4G4RA 3FN1B 5KQDA 3FTFA 2F0RA 2E2CA 3RGSA 3GQ3A 2ERCA 1D2NA 1UKXA
chains in the Genus database with same CATH topology
4A4BC 4GPRA 2LBCA 4NRIA 4LADA 1OTRA 4S3OA 4JQUA 2BF8A 4AP4B 2ZTDA 3P9HA 3E21A 3EB6B 2KNVA 3VONC 1IM2A 2L4FA 1U9AA 1NV9A 3OBXA 3UGBA 1M4QA 2GRNA 1FZYA 3H4JA 2KNZA 3K9PA 2RRUA 4MDKA 2MR9A 2Z6OA 4JUEA 1Z3DA 4DHZF 4BVUB 4F2LA 3P9GA 1VEGA 2O25A 5D0KA 3GLGE 4ONNA 2MROB 1I7KA 4NRGB 1P3QQ 1TR8A 1PGYA 4M1NA 2OB4A 2GJDA 3LCUA 3FRIA 1SG9A 2DZLA 2QNJA 3O2UA 2ESQA 4DHID 4HEOA 2EBMA 4YIIU 4DS2A 4QPLB 2DAXA 2EJSA 1YLAA 1G3IA 2DNAA 3OBQA 1WJ7A 2UCZA 3JVZA 5EGGA 2JP7A 3HCTB 2OO9A 2A4DA 2EDIA 3E95A 4NRIB 2ESPA 2MJ5B 2JZ0A 1VG5A 1HT2E 2DHYA 1KPPA 4UN2B 2OOAA 2YHOB 2KHHA 1A3SA 4II2C 5D0MA 3K9OA 3UIOA 2C4PA 2GROA 1Q02A 2JUJA 4WP2A 2JY6B 2R0JA 1VDLA 1AYZA 2JNHA 2KNAA 2LVPC 3SQVC 2FO3A 3MMPA 2K07A 1Y6LA 4Y1LA 4ONLB 4A4CC 4Q7JA 1JATA 3IHPA 3JW0A 2C2VC 3OBSA 4Q5EC 5F6XA 2DI0A 3VONB 3GLFE 1KPSA 4F1IA 2Z6PA 2EBKA 3RZ3A 1EFUB 2GMIA 1Z2UA 2Q0VA 4Q5HC 2EKKA 1XB2B 2CWBA 5F6YA 4NR3A 2OXQA 5D1KA 1DO0A 2C2VB 1YF9A 5D2MA 4ONNB 2BWBA 2L4EA 2CLWA 3TGDA 3H8KA 1JR3E 2WZJA 2EKFA 3CEGA 2O25C 1MN3A 5AIEB 2YBFA 1J74A 3ZQSA 4A49B 3L1YA 2JZ1A 2QHOB 4V3LA 1Q34A 3UINA 2DMFA 2CP8A 2KLYA 4P5OG 5F6WA 5AITB 5F6UA 1JATB 2LVAA 3F92A 1NV8A 4V3KA 1VEJA 2DENA 2ONUA 2G3QA 1WHCA 1YH2A 1DV0A 2H5XA 4BWFA 3KPAA 1OAIA 1IFYA 1U9BA 2GMIB 3E95C 4EJEA 2BEPA 3A33A 1E94E 5D1LA 2AAKA 1G4AE 5AITD 4L83A 2F4ZA 4DDGA 2ZTCA 4LDTC 1FXTA 4TKPA 1WGLA 2YB6A 1C7YA 1W4UA 3T6PA 5FERB 1WR1B 1PZVA 4NRGA 5HPTC 1HQYE 2DAWA 5KNLC 1S1QA 1TTEA 3ZNIC 2HLWA 1JBBA 3GLHE 5F6DA 1A5TA 1BVSA 1WZWA 5AIUB 4GEWA 3ONGB 1ZDNA 3FRHA 5FQ2A 4AUQA 3RCZB 1JASA 3BBZA 3FE3A 4R62A 2GRPA 4Y1LC 4IP3B 1ZMUA 4ONMA 5D1MA 4CCGA 4ZNYA 3WE5A 1V92A 2DAEA 4X57A 2Y9MA 2LVOC 4DHJC 1C4ZD 5IFRA 1ZGUA 3RPGA 3SY2C 3L1ZA 2DAYA 3UIPA 1WZVA 2JY8A 5JI2E 1CUKA 2QGXA 2LTUA 3EVXA 2UYZA 2Z5DA 1T6OA 2PE6A 1XXHE 1Y8GA 1ZMVA 1F4IA 1J7DB 2DKLA 4DBGB 2K9DA 3GLIE 3B89A 4R71A 4YC1A 2LVQD 1KYIA 1WGNA 2LXPA 1FBVC 3PTFA 4WZ3A 2JY5A 1WIVA 1T43A 2OOBA 2DAIA 2R0IA 1OQYA 2HAKA 2L2DA 3A4SA 3HCUB 2KJHA 3OBUA 4G3OA 2Y9PA 2CLWB 5F6EA 4FH1A 4DDIA 3OJ4A 2VRRA 3IECA 2F4WA 1Y8XA 2BWEA 2B3TA 1KPQA 4W5VA 2CYXA 2MGWA 3BZHA 1QCQA 5F6VA 2DAGA 3E46A 1QZEA 1M4PA 3R3QA 2DAMA 1HT1E 1GO5A 5DFLA 4ONMB 1R4GA 1J7DA 2ESOA 1VQ1A 2GRQA 3R42A 1VEKA 2EKEA 2K0BX 3FSHA 2DAKA 4ONLA 2JY7A 1X23A 2HWJA 1ZMWA 1G41A 2LVNC 1UFZA 1YRVA 1OKSA 3LCVB 2AWFA 1AIPC 2A7LA 1UZXA 2ESKA 2NVUC 1ZUOA 3W31B 1Z5SA 1IXSA 2YZ0A 5JNEB 2MT6A 4NR3B 2FUHA 2AYVA 2GRRA 1HJPA 2PWQA 2H2YA 2PX9B 1ZV1A 1DO2A 2QSFX 3FN1B 2XWUA 2F0RA 2E2CA 2Y4WA 1UKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4B C;  4GPR A;  2LBC A;  4NRI A;  4LAD A;  1OTR A;  4S3O A;  4JQU A;  2BF8 A;  4AP4 B;  2ZTD A;  3P9H A;  3E21 A;  3EB6 B;  2KNV A;  3VON C;  1IM2 A;  2L4F A;  1U9A A;  1NV9 A;  3OBX A;  3UGB A;  1M4Q A;  2GRN A;  1FZY A;  3H4J A;  2KNZ A;  3K9P A;  2RRU A;  4MDK A;  2MR9 A;  2Z6O A;  4JUE A;  1Z3D A;  4DHZ F;  4BVU B;  4F2L A;  3P9G A;  1VEG A;  2O25 A;  5D0K A;  3GLG E;  4ONN A;  2MRO B;  1I7K A;  4NRG B;  1P3Q Q;  1TR8 A;  1PGY A;  4M1N A;  2OB4 A;  2GJD A;  3LCU A;  3FRI A;  1SG9 A;  2DZL A;  2QNJ A;  3O2U A;  2ESQ A;  4DHI D;  4HEO A;  2EBM A;  4YII U;  4DS2 A;  4QPL B;  2DAX A;  2EJS A;  1YLA A;  1G3I A;  2DNA A;  3OBQ A;  1WJ7 A;  2UCZ A;  3JVZ A;  5EGG A;  2JP7 A;  3HCT B;  2OO9 A;  2A4D A;  2EDI A;  3E95 A;  4NRI B;  2ESP A;  2MJ5 B;  2JZ0 A;  1VG5 A;  1HT2 E;  2DHY A;  1KPP A;  4UN2 B;  2OOA A;  2YHO B;  2KHH A;  1A3S A;  4II2 C;  5D0M A;  3K9O A;  3UIO A;  2C4P A;  2GRO A;  1Q02 A;  2JUJ A;  4WP2 A;  2JY6 B;  2R0J A;  1VDL A;  1AYZ A;  2JNH A;  2KNA A;  2LVP C;  3SQV C;  2FO3 A;  3MMP A;  2K07 A;  1Y6L A;  4Y1L A;  4ONL B;  4A4C C;  4Q7J A;  1JAT A;  3IHP A;  3JW0 A;  2C2V C;  3OBS A;  4Q5E C;  5F6X A;  2DI0 A;  3VON B;  3GLF E;  1KPS A;  4F1I A;  2Z6P A;  2EBK A;  3RZ3 A;  1EFU B;  2GMI A;  1Z2U A;  2Q0V A;  4Q5H C;  2EKK A;  1XB2 B;  2CWB A;  5F6Y A;  4NR3 A;  2OXQ A;  5D1K A;  1DO0 A;  2C2V B;  1YF9 A;  5D2M A;  4ONN B;  2BWB A;  2L4E A;  2CLW A;  3TGD A;  3H8K A;  1JR3 E;  2WZJ A;  2EKF A;  3CEG A;  2O25 C;  1MN3 A;  5AIE B;  2YBF A;  1J74 A;  3ZQS A;  4A49 B;  3L1Y A;  2JZ1 A;  2QHO B;  4V3L A;  1Q34 A;  3UIN A;  2DMF A;  2CP8 A;  2KLY A;  4P5O G;  5F6W A;  5AIT B;  5F6U A;  1JAT B;  2LVA A;  3F92 A;  1NV8 A;  4V3K A;  1VEJ A;  2DEN A;  2ONU A;  2G3Q A;  1WHC A;  1YH2 A;  1DV0 A;  2H5X A;  4BWF A;  3KPA A;  1OAI A;  1IFY A;  1U9B A;  2GMI B;  3E95 C;  4EJE A;  2BEP A;  3A33 A;  1E94 E;  5D1L A;  2AAK A;  1G4A E;  5AIT D;  4L83 A;  2F4Z A;  4DDG A;  2ZTC A;  4LDT C;  1FXT A;  4TKP A;  1WGL A;  2YB6 A;  1C7Y A;  1W4U A;  3T6P A;  5FER B;  1WR1 B;  1PZV A;  4NRG A;  5HPT C;  1HQY E;  2DAW A;  5KNL C;  1S1Q A;  1TTE A;  3ZNI C;  2HLW A;  1JBB A;  3GLH E;  5F6D A;  1A5T A;  1BVS A;  1WZW A;  5AIU B;  4GEW A;  3ONG B;  1ZDN A;  3FRH A;  5FQ2 A;  4AUQ A;  3RCZ B;  1JAS A;  3BBZ A;  3FE3 A;  4R62 A;  2GRP A;  4Y1L C;  4IP3 B;  1ZMU A;  4ONM A;  5D1M A;  4CCG A;  4ZNY A;  3WE5 A;  1V92 A;  2DAE A;  4X57 A;  2Y9M A;  2LVO C;  4DHJ C;  1C4Z D;  5IFR A;  1ZGU A;  3RPG A;  3SY2 C;  3L1Z A;  2DAY A;  3UIP A;  1WZV A;  2JY8 A;  5JI2 E;  1CUK A;  2QGX A;  2LTU A;  3EVX A;  2UYZ A;  2Z5D A;  1T6O A;  2PE6 A;  1XXH E;  1Y8G A;  1ZMV A;  1F4I A;  1J7D B;  2DKL A;  4DBG B;  2K9D A;  3GLI E;  3B89 A;  4R71 A;  4YC1 A;  2LVQ D;  1KYI A;  1WGN A;  2LXP A;  1FBV C;  3PTF A;  4WZ3 A;  2JY5 A;  1WIV A;  1T43 A;  2OOB A;  2DAI A;  2R0I A;  1OQY A;  2HAK A;  2L2D A;  3A4S A;  3HCU B;  2KJH A;  3OBU A;  4G3O A;  2Y9P A;  2CLW B;  5F6E A;  4FH1 A;  4DDI A;  3OJ4 A;  2VRR A;  3IEC A;  2F4W A;  1Y8X A;  2BWE A;  2B3T A;  1KPQ A;  4W5V A;  2CYX A;  2MGW A;  3BZH A;  1QCQ A;  5F6V A;  2DAG A;  3E46 A;  1QZE A;  1M4P A;  3R3Q A;  2DAM A;  1HT1 E;  1GO5 A;  5DFL A;  4ONM B;  1R4G A;  1J7D A;  2ESO A;  1VQ1 A;  2GRQ A;  3R42 A;  1VEK A;  2EKE A;  2K0B X;  3FSH A;  2DAK A;  4ONL A;  2JY7 A;  1X23 A;  2HWJ A;  1ZMW A;  1G41 A;  2LVN C;  1UFZ A;  1YRV A;  1OKS A;  3LCV B;  2AWF A;  1AIP C;  2A7L A;  1UZX A;  2ESK A;  2NVU C;  1ZUO A;  3W31 B;  1Z5S A;  1IXS A;  2YZ0 A;  5JNE B;  2MT6 A;  4NR3 B;  2FUH A;  2AYV A;  2GRR A;  1HJP A;  2PWQ A;  2H2Y A;  2PX9 B;  1ZV1 A;  1DO2 A;  2QSF X;  3FN1 B;  2XWU A;  2F0R A;  2E2C A;  2Y4W A;  1UKX A; 
#chains in the Genus database with same CATH topology
 4A4B C;  2F4V M;  3RE8 A;  4IBJ A;  1MU5 A;  4RF0 A;  4GPR A;  1QVR A;  2FOI C;  2J5Y A;  3CF2 A;  2LBC A;  4WUR A;  4NRI A;  1DGB A;  2QBY A;  1G71 A;  3UJN A;  3FUU A;  4AG5 A;  3J2P B;  1QYR A;  3A98 B;  1OTR A;  2M5Z A;  2YNM D;  4LJ8 A;  4LAD A;  4S3O A;  4NRG B;  3MJ5 A;  4LJ9 A;  4JQU A;  2BF8 A;  3TPZ A;  4AP4 B;  2ZTD A;  3P9H A;  4X66 M;  1ZQ9 A;  3E21 A;  1VDD A;  3EB6 B;  2KNV A;  1E9S A;  5BR8 M;  3VON C;  3WHL A;  4B7H A;  2YR0 A;  1IM2 A;  3HZJ A;  4XK8 F;  4AQY M;  2C9O A;  2DVW B;  2L4F A;  4M9Z A;  1NV9 A;  1ORY B;  4LGY A;  5EJC A;  4BBA A;  1U9A A;  3SAR A;  3OBX A;  3W0L B;  3UGB A;  1L1T A;  2R44 A;  1JQJ C;  4FVM A;  4GHA A;  1M4Q A;  3W68 A;  1IY0 A;  2MH8 A;  3GO8 A;  1J09 A;  1FZY A;  4GC5 A;  2GRN A;  2K6B A;  4B3R M;  5KPT A;  1GJT A;  2KA6 B;  3H4J A;  4CGY B;  4LFA M;  1V33 A;  2EUC A;  1OJL A;  3W0F A;  2KNZ A;  3K9P A;  2CV2 A;  2RRU A;  1RU3 A;  3GLH B;  1JB0 F;  4Z6Y A;  2MR9 A;  5ITX E;  4DR2 M;  4DR5 M;  1N32 M;  2I7N A;  1I94 M;  1Z3D A;  2Z6O A;  4JUE A;  4BVU B;  1IN8 A;  5EP1 A;  2R18 A;  4F2L A;  3P9G A;  2XH9 A;  3IG5 A;  1VEG A;  3LW5 F;  2O25 A;  4L15 A;  5EXX A;  5D0K A;  3A46 A;  1L1Z A;  3U6C A;  3E9S A;  4OX9 M;  3GLG E;  2R62 A;  3SHG B;  4ONN A;  3NBX X;  3J7B A;  4AKH A;  2MRO B;  1EE8 A;  1I7K A;  2Y4W A;  2C9C A;  1P3Q Q;  1TR8 A;  2JWS A;  3FD9 A;  3PXG A;  3SBJ A;  3GPP A;  1PGY A;  1GAB A;  2R4E A;  4M1N A;  2KRU A;  2HL7 A;  4IBG A;  2OB4 A;  1XNQ M;  3LCU A;  3GLF B;  2GJD A;  2O01 F;  2ZBK B;  1SG9 A;  2DZL A;  3FRI A;  3FTD A;  5ITY A;  1JR3 A;  2QNJ A;  2XSZ A;  8CAT A;  3GPY A;  4DV3 M;  3SMS A;  2ESQ A;  3O2U A;  4HEO A;  4BWF A;  4DHI D;  2EBM A;  4YII U;  1PJT A;  4QHT A;  2QZ4 A;  5FTN A;  5FTL A;  4DS2 A;  4YHH M;  2D7H A;  3QYB A;  4GMQ A;  2EJS A;  7CAT A;  2DAX A;  4QPL B;  1YLA A;  3KP0 E;  2UXD M;  1GL7 A;  4FCW A;  1G3I A;  1XXH A;  3FTC A;  2DNA A;  4LRT A;  5ITU A;  2Y0T A;  4AZF A;  3OBQ A;  1WJ7 A;  3V76 A;  4DV0 M;  4GIT A;  3KOZ E;  2UCZ A;  1SXJ A;  3LVW A;  3JVZ A;  2VDB B;  1XNR M;  4K0K M;  5EGG A;  3GRV A;  1PJQ A;  2F5P A;  2JP7 A;  1IQP A;  3HCT B;  3GRR A;  4LCB A;  2OO9 A;  5E6J A;  2A4D A;  4D80 A;  3C9P A;  5DYI A;  3UZU A;  1GJS A;  4EIW A;  2EDI A;  4B7G A;  3E95 A;  3HKP A;  4NRI B;  4MGI E;  5IT9 S;  3AJI B;  2ESP A;  5KPR A;  2MJ5 B;  4OVZ A;  1L2B A;  1D0M A;  2JZ0 A;  4JN6 A;  3B7N A;  3PNY A;  1VG5 A;  2KZS A;  1HT2 E;  4JV5 M;  3KOW E;  3M6A A;  2DHY A;  4M9X A;  1MJG M;  3LQR A;  3JR4 A;  1KPP A;  4UN2 B;  2OOA A;  4QOZ C;  2YHO B;  1LV7 A;  2CUZ A;  2KHH A;  1A3S A;  4II2 C;  5L8R F;  3B9P A;  1Q3C A;  5D0M A;  3SAT A;  3TQS A;  3K9O A;  3B7Q A;  4B3M M;  3UIO A;  2ZM6 M;  1OAO C;  1N33 M;  2C4P A;  4PDG A;  2GRO A;  4P17 A;  3SMP A;  5KQ8 A;  1Q02 A;  1QZM A;  1OFI A;  3MK6 A;  1IN7 A;  2JUJ A;  4WP2 A;  2LH0 A;  3VFD A;  2V1U A;  4DR3 M;  1H6U A;  2JY6 B;  3JAM S;  2GQF A;  1VDL A;  2R0J A;  2EA0 A;  4GKK M;  1E32 A;  5EXS A;  5IWA M;  1AYZ A;  3AKZ A;  1YRV A;  3A42 A;  2VQE M;  2JNH A;  3U6P A;  3U61 B;  2KNA A;  2EO2 A;  3FUT A;  1IXR C;  2LVP C;  4NL4 H;  2XFT A;  3SQV C;  2X4A A;  2FO3 A;  3MMP A;  2Z4R A;  4NSO B;  2UXC M;  2K07 A;  3HJS A;  2L09 A;  4PDI A;  1QAM A;  1Y6L A;  4Y1L A;  4ONL B;  4A4C C;  1HNZ M;  2ZAN A;  4I5S A;  3SAS A;  2N35 A;  4IBK A;  3IHP A;  4Q7J A;  4MH0 E;  1JAT A;  4FWG A;  2X8A A;  2C2V C;  3JW0 A;  5LMN M;  3OBS A;  4Q5E C;  5F6X A;  2HCB A;  2CHG A;  3K1J A;  3LVV A;  2YFQ A;  1XMO M;  2FS1 A;  3U6O A;  1QUT A;  1Z6T A;  2DI0 A;  1T3T A;  4HL4 A;  3GLF E;  3VKG A;  3VON B;  1KPS A;  1WXQ A;  2WSC F;  4MGK E;  3M0E A;  3PVS A;  2Q2E B;  4LZZ A;  4F1I A;  2EBK A;  4S12 A;  2Y0Q A;  4Y28 F;  2Z6P A;  1EFU B;  4GKJ M;  3RZ3 A;  2GMI A;  4NSR A;  3L26 A;  1Z2U A;  2Q0V A;  4Q5H C;  2EKK A;  3KVW A;  5IRE B;  2FH0 A;  3EIH A;  4LJ7 A;  1Z5C A;  4PT5 A;  1XB2 B;  2BJW A;  1HR0 M;  3QAU A;  2ZAM A;  2CWB A;  5F6Y A;  1IN5 A;  4M0W A;  4NR3 A;  4FCT A;  2OXQ A;  5D1K A;  3FUW A;  3GP1 A;  1DO0 A;  2C2V B;  1YF9 A;  3HGI A;  3QWL A;  1R7R A;  5D2M A;  4ONN B;  1FNN A;  4DR1 M;  2BWB A;  2L4E A;  2CLW A;  3TGD A;  5EXP A;  3H8K A;  1JR3 E;  3A45 A;  1IBL M;  2WZJ A;  2EKF A;  3CEG A;  1L8Q A;  1IBK M;  3K92 A;  4LF5 M;  4JI0 M;  2O25 C;  2Z4S A;  1MN3 A;  3PFI A;  4GC9 A;  4LJ4 A;  5AIE B;  1S3S A;  2H1R A;  2XEP A;  4FD2 A;  1J74 A;  1D0L A;  4CIZ A;  2YBF A;  3ZQS A;  2CEA A;  3KXE C;  3NBI A;  2LHG A;  4KT0 F;  3L1Y A;  2KDL A;  4LZJ A;  4A49 B;  1Z59 A;  4L4U A;  2JZ1 A;  2VQF M;  2DWN A;  4MDK A;  4DV6 M;  2QBY B;  3GQ5 A;  2CV0 A;  4AI6 A;  2CV1 A;  1IBM M;  2QHO B;  1XMQ M;  3D8B A;  2BJV A;  2UXB M;  2J7O A;  1IN4 A;  3GLG A;  4PD2 A;  3J7A S;  1Q34 A;  3KS4 A;  1SXJ E;  3DZD A;  4OW0 A;  4V3L A;  3UIN A;  2DMF A;  2W82 A;  2CP8 A;  2KLY A;  1QAQ A;  5KO3 A;  4P16 A;  3KS8 A;  2OPF A;  5EP3 A;  4P5O G;  5AIT B;  5F6W A;  5F6U A;  3GQ4 A;  1JR3 D;  1JAT B;  4DR7 M;  1TGU A;  2WSF F;  1DGG A;  3ZQJ A;  2F5Q A;  1W5T A;  3HHW A;  3UK6 A;  5BPV A;  3FUV A;  2APL A;  2LVA A;  3F92 A;  1PJJ A;  2C99 A;  2DWM A;  1NV8 A;  2XFS A;  3HHY A;  3U5Z B;  1W5S A;  2QCU A;  1VEJ A;  2DEN A;  1QAO A;  3L2A A;  4IBF A;  3R9X B;  2ONU A;  3U61 A;  4DV7 M;  2G3Q A;  1NJF A;  4LFB M;  3I4V A;  1WHC A;  1HQC A;  3KSJ A;  1YH2 A;  1R5L A;  1DV0 A;  2C5R A;  4L78 A;  3VK7 A;  2QEN A;  2H5X A;  3SHF A;  3C3D A;  1D0K A;  4B7F A;  1NHW C;  2QP9 X;  3KOX E;  4I4L A;  5E26 A;  3OTO M;  4AKG A;  2FNA A;  3KPA A;  1OAI A;  1SXJ D;  4IBC A;  1IFY A;  4MGH A;  4DHZ F;  1NJG A;  1U9B A;  3D8L A;  4ZPX A;  3W67 A;  5F3W A;  2F5O A;  2R45 A;  5FLX S;  2GMI B;  3MHV C;  3E95 C;  1PM5 A;  3U6E A;  1IY1 A;  2L7H A;  3GLF A;  4FWD A;  3IG8 A;  4CIS A;  4EJE A;  2BEP A;  3A33 A;  2J7N A;  1E94 E;  5D1L A;  2AAK A;  1G4A E;  5AIT D;  1SXJ C;  3SAV A;  5A2Q S;  4L83 A;  4RKU F;  4MGZ E;  4X64 M;  4PCZ A;  1Z5A A;  2F4Z A;  4DDG A;  4AG6 A;  5FSW A;  2ZTC A;  3GRY A;  4LJA A;  4LDT C;  1FXT A;  4L16 A;  2UUB M;  3B7Z A;  3AL0 C;  4MGY E;  1WGL A;  4B08 A;  1R2Y A;  4I81 A;  2YB6 A;  2A5Y B;  3GLH A;  1J7K A;  1C7Y A;  4LG2 A;  3HJ8 A;  1HNX M;  1W4U A;  2UU9 M;  1SXJ B;  3SYL A;  3T6P A;  1N78 A;  4AKI A;  4XGI A;  5FER B;  4NC6 A;  1E9R A;  2KZU A;  4G4O A;  1WR1 B;  2G5G X;  4X62 M;  1PZV A;  4DR4 M;  3SYK A;  4QNR A;  4DUY M;  4NRG A;  3U60 B;  2C96 A;  3QYE A;  4W5W A;  5HPT C;  4TKP A;  1HQY E;  3I01 M;  2NQ8 C;  2DAW A;  3K2L A;  1IN6 A;  5KNL C;  4FWH A;  3HX3 A;  1TTE A;  1S1Q A;  2KEB A;  3TL4 X;  1AUA A;  1NO1 A;  4Z8X A;  3U5Z A;  4KO8 A;  3ZNI C;  2HLW A;  3BOS A;  5EXT A;  1YE9 A;  4DV1 M;  3U6D A;  2DXI A;  2R65 A;  3GLH E;  1JBB A;  5F6D A;  3T15 A;  3KW6 A;  3Q8X A;  4ANR A;  1A5T A;  1MX0 A;  4KOD A;  4LY6 A;  3AOG A;  1BVS A;  3BXW A;  2D7G A;  3VDP A;  3UMM A;  2HHH M;  4LF6 M;  2DZN B;  4L6V 6;  1K82 A;  1WZW A;  4CJ6 A;  4RF1 A;  5AIU B;  5H37 D;  5ITQ A;  1K3W A;  4GEW A;  4RNA A;  3ONG B;  3UGJ A;  1ZDN A;  3FRH A;  5FQ2 A;  3L29 A;  4OU7 A;  4AUQ A;  3GLG B;  3RCZ B;  4B3T M;  1N34 M;  1JAS A;  3WHK A;  3BBZ A;  4R7G A;  3FE3 A;  4LRS A;  4R62 A;  2DWZ B;  2GRP A;  4Y1L C;  2BNK A;  4YY3 M;  4ITQ A;  4BB9 A;  4IP3 B;  1ZMU A;  1Q3B A;  2KXE A;  3KOY E;  3JR5 A;  3L27 A;  4ONM A;  5D1M A;  2F5S A;  3SFZ A;  2QQ8 A;  3I4Y A;  1HNW M;  2WSE F;  1OIP A;  3THG A;  3C58 A;  4CCG A;  4LF7 M;  4ZNY A;  3SC3 A;  3WE5 A;  1V92 A;  4WW0 A;  4G4Q A;  3TWL A;  1V34 A;  2DAE A;  4JI6 M;  4X57 A;  4JI4 M;  2L7I A;  5ITT A;  2Y9M A;  2LVO C;  4DHJ C;  2RKO A;  3NWL A;  1C4Z D;  5IFR A;  3HJQ A;  1ZGU A;  3R8F A;  2RGO A;  4DV4 M;  3U6L A;  5DNY A;  1DGH B;  3RPG A;  1J5E M;  4LF9 M;  1TDH A;  2LHC A;  3EIE A;  3ZC7 B;  3L1Z A;  4KHP M;  2DAY A;  4D81 A;  3SY2 C;  2KW0 A;  1Z5B A;  2DHR A;  1NNU C;  2Z7J A;  3AFH A;  1L2C A;  3RFW A;  4JI7 M;  1WZV A;  4LF4 M;  3UIP A;  4DR6 M;  4KLN A;  1YUB A;  2JY8 A;  1IY2 A;  3I04 M;  5JI2 E;  1CUK A;  2QGX A;  1KFV A;  2LTU A;  1QUS A;  3EVX A;  2QPA A;  1GKI A;  2XF3 A;  2I7P A;  2UUC M;  2UYZ A;  2Z5D A;  4JYA M;  1N36 M;  3ILK A;  1T6O A;  2FE8 A;  4GRI A;  5C1B A;  1TDZ A;  2VF8 A;  5ITX A;  3GLI B;  4I8O A;  3HWS A;  3M7G A;  4IBE A;  2PE6 A;  1XXH E;  3U6S A;  4JI1 M;  3BZH A;  3HHZ A;  4FW9 A;  1TH4 A;  2O5R A;  2R46 A;  3KP1 E;  1Y8G A;  1ZMV A;  1F4I A;  3AV0 A;  2AHM A;  2JA2 A;  3RGP A;  1J7D B;  4X65 M;  2DKL A;  4DBG B;  1PRB A;  2DZO B;  2XLJ A;  2K9D A;  2LNH C;  3GLI E;  2V6Z M;  4LGM A;  3B89 A;  1QDT A;  4IBI A;  4D82 A;  4R71 A;  2X49 A;  3VK8 A;  5GKN A;  4LF8 M;  3ZH9 B;  4NXM M;  2XSZ D;  2F5N A;  3LQQ A;  2LVQ D;  1NY5 A;  5EP4 A;  5EQT A;  1KYI A;  2GNO A;  1ZAE A;  1WGN A;  2VII A;  4MM3 B;  5ITR A;  2JXN A;  4FCV A;  2LXP A;  3CGW A;  1PJS A;  1FBV C;  2CHQ A;  4DUZ M;  3PTF A;  3U60 A;  4WZ3 A;  3C3E A;  3HU3 A;  2JY5 A;  3GLI A;  2LXE A;  4OVZ B;  1WIV A;  3E4R A;  1T43 A;  2OOB A;  2DWL A;  1TH3 A;  1Q39 A;  4MB7 A;  4NXN M;  5KPZ A;  2DAI A;  2RGH A;  3VLF B;  1R2Z A;  1QDR A;  2G8L A;  2R0I A;  1OQY A;  2HAK A;  4M9S A;  4XBO A;  3FKE A;  2L2D A;  3HHX A;  3H4M A;  2OQ4 A;  2Z3X A;  1G59 A;  1GVN A;  3A4S A;  3U6M A;  1L2D A;  3HCU B;  4A3V B;  2KJH A;  3AOE A;  2R6F A;  5C18 A;  3OBU A;  4G3O A;  5JI3 E;  3K8Z A;  2Y9P A;  2CLW B;  1YSY A;  4QHS A;  2CRU A;  3J27 B;  2XZF A;  4IIW A;  5F6E A;  4NRW A;  4FH1 A;  4DDI A;  4R3D A;  1I4W A;  3SAW A;  3OJ4 A;  5EP2 A;  1UM8 A;  3DA1 A;  1OIZ A;  2VF7 A;  3TWM A;  3HU2 A;  2VRR A;  3IEC A;  4JI2 M;  1QQW A;  2F4W A;  1G8P A;  1GL6 A;  1Y8X A;  2HKJ A;  3HY5 A;  3T1H M;  1NNJ A;  1C1K A;  2Y20 A;  4JI8 M;  2BWE A;  2B3T A;  3GRU A;  4DV2 M;  4JI5 M;  5F6V A;  2YQZ A;  4HLQ A;  1KPQ A;  1TF0 B;  4W5V A;  4NRV A;  3FYC A;  2CYX A;  1XC8 A;  3FUX A;  2MGW A;  4LJ5 A;  1GLN A;  2R4J A;  3LMM A;  2D7E A;  2UUA M;  2C98 A;  1QCQ A;  4DV5 M;  2DAG A;  3E46 A;  3KSX A;  4G4N A;  4LFC M;  1QZE A;  1M4P A;  4JXJ A;  3HU1 A;  3VDU A;  4IBB A;  2E5L M;  4L8R C;  1NVM A;  3R3Q A;  4IBD A;  1XWI A;  4YC1 A;  5FTM A;  1QAN A;  2DAM A;  1HT1 E;  1X37 A;  3T1Y M;  3AOE C;  1N77 A;  1GO5 A;  3DFZ A;  5DFL A;  3FTE A;  4ONM B;  4V3K A;  2LWX A;  1R4G A;  2KRK A;  5FTK A;  1OFH A;  1J7D A;  3B74 A;  2CHV A;  3I51 A;  3CF6 E;  3Q8G A;  2ESO A;  1N75 A;  4JI3 M;  4QOS A;  1VQ1 A;  4REZ A;  2GRQ A;  3R42 A;  1DGH A;  1VEK A;  2EKE A;  2K47 A;  1LTM A;  4GH9 A;  3ZCB B;  3J80 S;  3T38 A;  2FFJ A;  2K0B X;  1NHG C;  3FSH A;  2P5T A;  2DAK A;  4NOO B;  2JY7 A;  1X23 A;  2CE7 A;  1ZMW A;  2HWJ A;  4ONL A;  4IJF A;  5LMU M;  4GHL A;  1G41 A;  1NY6 A;  4QNM A;  3GPU A;  1EIJ A;  2LVN C;  1XHB A;  1UFZ A;  3CF0 A;  2Z8Y M;  3PNV A;  3L28 A;  3U6Q A;  4M0D A;  2M60 A;  2V1C A;  2XZU A;  1DGF A;  4CHT B;  1OKS A;  3LCV B;  5IZ7 D;  1FJG M;  2AWF A;  1AIP C;  2A7L A;  1UZX A;  1XXH B;  2ESK A;  3CTW B;  3TWK A;  1PJI A;  1R6B X;  4II7 A;  3GPX A;  1KSF X;  2NVU C;  1ZUO A;  4IJE A;  3W31 B;  5DYG A;  4AW4 A;  3J81 S;  1Z5S A;  1IXS A;  3SAU A;  2YZ0 A;  5JNE B;  2ZAO A;  2MT6 A;  3VKH A;  4NR3 B;  3TE6 A;  4BLC A;  2FUH A;  1TH2 A;  3KFU G;  1K3X A;  3KDS E;  2AYV A;  2GRR A;  1HJP A;  4TUW A;  2PWQ A;  5FTJ A;  3DOA A;  2H2Y A;  1IXS B;  2PX9 B;  1ZV1 A;  2XGN A;  2L6O A;  1DO2 A;  1NSF A;  2Y21 A;  4GIP A;  4LJ6 A;  3FYD A;  1IXZ A;  2CFO A;  2QSF X;  4G6Z A;  4B3S M;  3L25 A;  2XWU A;  4G4R A;  3FN1 B;  5KQD A;  3FTF A;  2F0R A;  2E2C A;  3RGS A;  3GQ3 A;  2ERC A;  1D2N A;  1UKX A; 
#chains in the Genus database with same CATH homology
 4A4B C;  4GPR A;  2LBC A;  4NRI A;  4LAD A;  1OTR A;  4S3O A;  4JQU A;  2BF8 A;  4AP4 B;  2ZTD A;  3P9H A;  3E21 A;  3EB6 B;  2KNV A;  3VON C;  1IM2 A;  2L4F A;  1U9A A;  1NV9 A;  3OBX A;  3UGB A;  1M4Q A;  2GRN A;  1FZY A;  3H4J A;  2KNZ A;  3K9P A;  2RRU A;  4MDK A;  2MR9 A;  2Z6O A;  4JUE A;  1Z3D A;  4DHZ F;  4BVU B;  4F2L A;  3P9G A;  1VEG A;  2O25 A;  5D0K A;  3GLG E;  4ONN A;  2MRO B;  1I7K A;  4NRG B;  1P3Q Q;  1TR8 A;  1PGY A;  4M1N A;  2OB4 A;  2GJD A;  3LCU A;  3FRI A;  1SG9 A;  2DZL A;  2QNJ A;  3O2U A;  2ESQ A;  4DHI D;  4HEO A;  2EBM A;  4YII U;  4DS2 A;  4QPL B;  2DAX A;  2EJS A;  1YLA A;  1G3I A;  2DNA A;  3OBQ A;  1WJ7 A;  2UCZ A;  3JVZ A;  5EGG A;  2JP7 A;  3HCT B;  2OO9 A;  2A4D A;  2EDI A;  3E95 A;  4NRI B;  2ESP A;  2MJ5 B;  2JZ0 A;  1VG5 A;  1HT2 E;  2DHY A;  1KPP A;  4UN2 B;  2OOA A;  2YHO B;  2KHH A;  1A3S A;  4II2 C;  5D0M A;  3K9O A;  3UIO A;  2C4P A;  2GRO A;  1Q02 A;  2JUJ A;  4WP2 A;  2JY6 B;  2R0J A;  1VDL A;  1AYZ A;  2JNH A;  2KNA A;  2LVP C;  3SQV C;  2FO3 A;  3MMP A;  2K07 A;  1Y6L A;  4Y1L A;  4ONL B;  4A4C C;  4Q7J A;  1JAT A;  3IHP A;  3JW0 A;  2C2V C;  3OBS A;  4Q5E C;  5F6X A;  2DI0 A;  3VON B;  3GLF E;  1KPS A;  4F1I A;  2Z6P A;  2EBK A;  3RZ3 A;  1EFU B;  2GMI A;  1Z2U A;  2Q0V A;  4Q5H C;  2EKK A;  1XB2 B;  2CWB A;  5F6Y A;  4NR3 A;  2OXQ A;  5D1K A;  1DO0 A;  2C2V B;  1YF9 A;  5D2M A;  4ONN B;  2BWB A;  2L4E A;  2CLW A;  3TGD A;  3H8K A;  1JR3 E;  2WZJ A;  2EKF A;  3CEG A;  2O25 C;  1MN3 A;  5AIE B;  2YBF A;  1J74 A;  3ZQS A;  4A49 B;  3L1Y A;  2JZ1 A;  2QHO B;  4V3L A;  1Q34 A;  3UIN A;  2DMF A;  2CP8 A;  2KLY A;  4P5O G;  5F6W A;  5AIT B;  5F6U A;  1JAT B;  2LVA A;  3F92 A;  1NV8 A;  4V3K A;  1VEJ A;  2DEN A;  2ONU A;  2G3Q A;  1WHC A;  1YH2 A;  1DV0 A;  2H5X A;  4BWF A;  3KPA A;  1OAI A;  1IFY A;  1U9B A;  2GMI B;  3E95 C;  4EJE A;  2BEP A;  3A33 A;  1E94 E;  5D1L A;  2AAK A;  1G4A E;  5AIT D;  4L83 A;  2F4Z A;  4DDG A;  2ZTC A;  4LDT C;  1FXT A;  4TKP A;  1WGL A;  2YB6 A;  1C7Y A;  1W4U A;  3T6P A;  5FER B;  1WR1 B;  1PZV A;  4NRG A;  5HPT C;  1HQY E;  2DAW A;  5KNL C;  1S1Q A;  1TTE A;  3ZNI C;  2HLW A;  1JBB A;  3GLH E;  5F6D A;  1A5T A;  1BVS A;  1WZW A;  5AIU B;  4GEW A;  3ONG B;  1ZDN A;  3FRH A;  5FQ2 A;  4AUQ A;  3RCZ B;  1JAS A;  3BBZ A;  3FE3 A;  4R62 A;  2GRP A;  4Y1L C;  4IP3 B;  1ZMU A;  4ONM A;  5D1M A;  4CCG A;  4ZNY A;  3WE5 A;  1V92 A;  2DAE A;  4X57 A;  2Y9M A;  2LVO C;  4DHJ C;  1C4Z D;  5IFR A;  1ZGU A;  3RPG A;  3SY2 C;  3L1Z A;  2DAY A;  3UIP A;  1WZV A;  2JY8 A;  5JI2 E;  1CUK A;  2QGX A;  2LTU A;  3EVX A;  2UYZ A;  2Z5D A;  1T6O A;  2PE6 A;  1XXH E;  1Y8G A;  1ZMV A;  1F4I A;  1J7D B;  2DKL A;  4DBG B;  2K9D A;  3GLI E;  3B89 A;  4R71 A;  4YC1 A;  2LVQ D;  1KYI A;  1WGN A;  2LXP A;  1FBV C;  3PTF A;  4WZ3 A;  2JY5 A;  1WIV A;  1T43 A;  2OOB A;  2DAI A;  2R0I A;  1OQY A;  2HAK A;  2L2D A;  3A4S A;  3HCU B;  2KJH A;  3OBU A;  4G3O A;  2Y9P A;  2CLW B;  5F6E A;  4FH1 A;  4DDI A;  3OJ4 A;  2VRR A;  3IEC A;  2F4W A;  1Y8X A;  2BWE A;  2B3T A;  1KPQ A;  4W5V A;  2CYX A;  2MGW A;  3BZH A;  1QCQ A;  5F6V A;  2DAG A;  3E46 A;  1QZE A;  1M4P A;  3R3Q A;  2DAM A;  1HT1 E;  1GO5 A;  5DFL A;  4ONM B;  1R4G A;  1J7D A;  2ESO A;  1VQ1 A;  2GRQ A;  3R42 A;  1VEK A;  2EKE A;  2K0B X;  3FSH A;  2DAK A;  4ONL A;  2JY7 A;  1X23 A;  2HWJ A;  1ZMW A;  1G41 A;  2LVN C;  1UFZ A;  1YRV A;  1OKS A;  3LCV B;  2AWF A;  1AIP C;  2A7L A;  1UZX A;  2ESK A;  2NVU C;  1ZUO A;  3W31 B;  1Z5S A;  1IXS A;  2YZ0 A;  5JNE B;  2MT6 A;  4NR3 B;  2FUH A;  2AYV A;  2GRR A;  1HJP A;  2PWQ A;  2H2Y A;  2PX9 B;  1ZV1 A;  1DO2 A;  2QSF X;  3FN1 B;  2XWU A;  2F0R A;  2E2C A;  2Y4W A;  1UKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...