5DFLA

Crystal structure of ube2k~ubiquitin conjugate
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
199
structure length
199
Chain Sequence
AANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAIKLDILRDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLSAMGFDRNAVIVALSSKSWDVETATELLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/signaling protein
molecule keywords Ubiquitin
publication title The molecular basis of lysine 48 ubiquitin chain synthesis by Ube2K.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 199
sequence length 199
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00179 UQ_con Ubiquitin-conjugating enzyme
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 5dflA02
3.10.110.10 Alpha Beta Roll Ubiquitin Conjugating Enzyme Ubiquitin Conjugating Enzyme 5dflA01
4UN2B 3K9PA 2LVOC 2GRRA 2DAYA 2DAWA 4NRIA 1ZMWA 2OXQA 2Y9PA 4ONLA 1U9BA 4R71A 3CEGA 2WZJA 2GROA 4HEOA 4TKPA 3ONGB 1CUKA 1QCQA 2BWEA 3PTFA 4Q5EC 1VEGA 2ONUA 1VDLA 2VRRA 1M4QA 2UYZA 4V3KA 2R0IA 3RCZB 2LBCA 3RZ3A 2EKFA 2MJ5B 5AITB 4DS2A 4ONMB 2ESKA 5F6YA 2RRUA 2KLYA 2AAKA 2Y9MA 2KNAA 3W31B 2F0RA 1G3IA 1I7KA 1J74A 2DAIA 2H5XA 2KHHA 2QSFX 3SY2C 2Z6PA 4R62A 2EDIA 5D0MA 4JUEA 2YBFA 1UFZA 3SQVC 3EVXA 3E46A 2G3QA 4DDGA 3JVZA 3EB6B 1TTEA 2L4FA 2EKKA 1G4AE 5F6XA 2YZ0A 2LVQD 2F4ZA 1ZMUA 2JZ0A 4AP4B 2JY6B 1ZDNA 1R4GA 1VQ1A 1OKSA 3OJ4A 1JR3E 3A4SA 2K0BX 1KPQA 1IFYA 4M1NA 3UIOA 1X23A 2PE6A 4Q7JA 1PGYA 2DAMA 1Y8GA 2BF8A 5AIEB 5D1KA 2A7LA 1G41A 5JNEB 4G3OA 2ESQA 3IECA 3P9HA 2O25C 2DMFA 4DDIA 4AUQA 3L1ZA 5F6DA 1HT2E 5AIUB 3UIPA 5HPTC 1Z3DA 2DZLA 2OO9A 3B89A 4X57A 4Y1LA 2Y4WA 1UKXA 1ZGUA 5DFLA 2Z5DA 2EJSA 1ZUOA 2YHOB 3LCVB 5D0KA 3UINA 1WZWA 2JY5A 4II2C 4L83A 2HWJA 1AIPC 5IFRA 4CCGA 4S3OA 2LXPA 1Z2UA 2GRQA 5JI2E 2L2DA 2GMIB 2QNJA 2GRNA 5D2MA 1WIVA 1BVSA 4GPRA 4NR3A 1T6OA 1WJ7A 5D1MA 4YC1A 1C7YA 2FUHA 3FRHA 2OOBA 3R42A 2R0JA 2KNVA 4WZ3A 1WZVA 1Q34A 2F4WA 1HJPA 3A33A 2JP7A 1PZVA 1KPSA 3P9GA 3OBSA 2HAKA 4EJEA 2ESOA 2ZTDA 5F6EA 2H2YA 2Z6OA 2CYXA 2LVAA 3ZQSA 3FSHA 3FN1B 1YRVA 2EBKA 1A5TA 4F2LA 2B3TA 4WP2A 4DHJC 2AWFA 1VEKA 3K9OA 1Z5SA 4F1IA 1KPPA 4NRGB 1OAIA 4JQUA 4GEWA 3RPGA 3OBUA 3GLHE 1WGNA 4A4BC 2GMIA 2YB6A 4QPLB 2JZ1A 1U9AA 2MR9A 4W5VA 3L1YA 2C4PA 1XB2B 1VEJA 1JATB 3E95C 1OTRA 2DAXA 1QZEA 2CWBA 3MMPA 4NRIB 5KNLC 4ONMA 1HQYE 1MN3A 3GLGE 2OOAA 3FRIA 3H4JA 1VG5A 2KNZA 1E94E 1IXSA 3UGBA 1DV0A 2C2VB 2K07A 3R3QA 2AYVA 2DAEA 1EFUB 3BBZA 2GRPA 1YF9A 3KPAA 1HT1E 3ZNIC 1AYZA 1NV9A 2ESPA 2KJHA 4NRGA 1ZMVA 2ZTCA 2DKLA 2JY7A 4Q5HC 1W4UA 2O25A 4ONNB 1A3SA 1XXHE 4LADA 4DHZF 5EGGA 3HCTB 1WGLA 2EKEA 3GLIE 2C2VC 4BWFA 1TR8A 2MROB 4V3LA 2FO3A 1FBVC 3VONC 1JATA 2DI0A 3T6PA 1WR1B 2LVPC 4IP3B 3GLFE 2NVUC 5F6WA 4DBGB 1DO2A 1GO5A 2MT6A 2JNHA 3TGDA 1KYIA 2CLWB 4YIIU 2LVNC 2A4DA 3BZHA 1YLAA 4MDKA 3F92A 1JASA 1DO0A 1C4ZD 2PX9B 4A4CC 1YH2A 1JBBA 2BWBA 3HCUB 1WHCA 1J7DB 5FQ2A 1FZYA 1OQYA 5AITD 2OB4A 2PWQA 2LTUA 4ONNA 5FERB 2K9DA 1IM2A 2DAKA 2L4EA 2CP8A 2DENA 4P5OG 3IHPA 4A49B 3E21A 1T43A 1Y6LA 4ONLB 3O2UA 2CLWA 2GJDA 1F4IA 1S1QA 2DAGA 2EBMA 2E2CA 2JUJA 2JY8A 3FE3A 1P3QQ 4DHID 2QHOB 4ZNYA 4NR3B 1Y8XA 2HLWA 1UZXA 4Y1LC 3JW0A 5F6UA 2BEPA 3H8KA 1NV8A 2DHYA 1J7DA 2XWUA 2MGWA 3VONB 1FXTA 1SG9A 3E95A 2UCZA 3OBXA 2QGXA 1M4PA 4FH1A 1ZV1A 1Q02A 5F6VA 3WE5A 4BVUB 4LDTC 1V92A 2DNAA 3LCUA 3OBQA 2Q0VA 5D1LA
chains in the Genus database with same CATH superfamily
3CF6E 3QAUA 1QANA 1ZMWA 2OXQA 3KDSE 2Y9PA 5ITXA 3CEGA 2CFOA 2WZJA 4B3RM 2BWEA 4L6V6 1VEGA 2ONUA 2VRRA 4LJ9A 2DVWB 3RCZB 3R9XB 1PJSA 4DS2A 2QZ4A 4XBOA 4LJAA 1N77A 4DV7M 2AAKA 1IQPA 3W31B 2KNAA 4CHTB 3SAUA 3FTFA 4LF7M 1J74A 3GPYA 4DR1M 3B7NA 3M0EA 3VDUA 4JI7M 4R62A 2KZUA 4JUEA 1XMOM 4PDIA 3SQVC 3U6MA 2L4FA 4FWGA 1HNZM 4RF0A 2F4ZA 4NSRA 5IREB 1XNQM 2GNOA 2JZ0A 3K2LA 1ZDNA 1IN4A 4LF5M 2YNMD 4L78A 2EO2A 4X66M 3PVSA 3FKEA 1X23A 1TF0B 5KQ8A 4LF9M 2YFQA 1L8QA 2R4JA 4L15A 1XXHB 4DV1M 1XC8A 4M9ZA 2BF8A 5AIEB 5JNEB 4G3OA 1JR3A 2O25C 5GKNA 4DV3M 2AHMA 2DZLA 3UK6A 3B89A 4Y1LA 3HJQA 4IBBA 1UKXA 2Z5DA 4K0KM 1UM8A 4IIWA 1IBKM 4KO8A 5D0KA 3UINA 2BNKA 3HU2A 4KHPM 3RE8A 5IFRA 5ITTA 4S3OA 1L1ZA 2LXPA 4NXMM 1LTMA 2GMIB 2Z8YM 3FUWA 4IBEA 1T6OA 4YC1A 2DZNB 2FUHA 5BR8M 3GLHB 3UGJA 2OOBA 2F5NA 1IXRC 1HJPA 3HHYA 3GQ4A 1N36M 2R65A 4X62M 4CGYB 1IY1A 3P9GA 2DHRA 2ESOA 2ZTDA 4IBFA 2CV0A 3NBXX 3FTCA 2EBKA 1DGHB 4LJ8A 2B3TA 1TGUA 4MM3B 5H37D 4QNMA 1Z5SA 1NHGC 4EIWA 4GEWA 3OBUA 1WGNA 4I5SA 1W5SA 3SASA 4A4BC 2RGHA 3RGSA 2GMIA 5KPZA 1U9AA 3A46A 3FUTA 4GRIA 3SMSA 4JI5M 3T38A 4QOZC 1G71A 4JI0M 4DR2M 2G8LA 3MMPA 3GLHA 3M7GA 4IJEA 5KNLC 2XZFA 3FRIA 4MGYE 4DUZM 2D7EA 3UGBA 2C2VB 2K07A 3VK7A 3I4VA 2C96A 3FUUA 1DGHA 1EFUB 2GRPA 1GL7A 1HT1E 1D0MA 1NY5A 3VFDA 4IBGA 1NV9A 1NJGA 4ANRA 2KJHA 1SXJC 3DOAA 2O25A 4CISA 3PNYA 5EGGA 3W67A 1OIZA 3KS8A 1SXJE 3GLIE 2R4EA 1TR8A 4GH9A 2MROB 1FBVC 2DI0A 1QDRA 2FNAA 4FCVA 4D80A 5F6WA 3RGPA 5FTNA 2JNHA 4IBKA 3U61B 2LVNC 3SYLA 4M0WA 1D2NA 5E26A 1FNNA 5EQTA 4MDKA 1NO1A 4DR5M 1C4ZD 2L7HA 4A4CC 4NOOB 1JBBA 2BWBA 2XFSA 4DV5M 4YHHM 3A98B 4W5WA 1TDHA 2Z7JA 2VF7A 1OQYA 4I4LA 5L8RF 2XH9A 4GMQA 1EIJA 2CHQA 4LRSA 2UUBM 2K9DA 2UXBM 1HNXM 1IY0A 5LMNM 1Y6LA 4ONLB 3O2UA 2GJDA 2A5YB 3GPXA 2JUJA 1P3QQ 2QHOB 2KDLA 1E9RA 4WW0A 3BOSA 2ZAMA 3W0FA 5IWAM 1NV8A 4QHTA 1FXTA 3OBXA 1M4PA 1N34M 4HLQA 5EXSA 2C99A 5EP3A 3E4RA 4L16A 2UXCM 3LQQA 4LDTC 3LCUA 3OBQA 3Q8XA 2Q0VA 5KO3A 2J7OA 3L2AA 5D1LA 4M9XA 4UN2B 3VK8A 3K9PA 2LVOC 7CATA 4LGYA 2DAYA 4WURA 4NRIA 4ONLA 4IBIA 4R3DA 4R71A 2R46A 2GROA 3ONGB 2K47A 1VDLA 3ZH9B 2LBCA 1E9SA 2EKFA 3KOXE 1I4WA 2HKJA 2ESKA 2RRUA 2FFJA 4P16A 4MB7A 2KHHA 3H4MA 5D0MA 1UFZA 3KSJA 3U6DA 3EB6B 3L25A 2J5YA 2N35A 4OX9M 3B7QA 1R4GA 3UZUA 4G4RA 4M0DA 1JR3E 3A4SA 2K0BX 3SATA 2MH8A 1RU3A 1PGYA 2DAMA 1Y8GA 5D1KA 2A7LA 3ZCBB 1EE8A 3K92A 2ESQA 1GJSA 3IECA 1GLNA 2OQ4A 1NJFA 5AIUB 3UIPA 2FE8A 5HPTC 1Z3DA 2ERCA 3KOZE 1N75A 2R45A 4G4QA 2OO9A 4JI3M 1Z5CA 5EP2A 1ZGUA 3SHGB 1Z59A 4B3MM 2VF8A 3TWKA 1WZWA 4II2C 4L83A 3J80S 1R6BX 1AIPC 4BB9A 3L27A 4CCGA 4G4NA 4MGHA 4KODA 5JI2E 2APLA 2QNJA 3A42A 3KOYE 4L4UA 3PNVA 5D1MA 2HCBA 5FTMA 4TUWA 2DWMA 4WZ3A 1WZVA 1Q34A 2F4WA 1IXSB 5IZ7D 4MH0E 3R8FA 4FCTA 4NRVA 4LZJA 2HAKA 3SMPA 1YE9A 4EJEA 2KZSA 2H2YA 1A5TA 4DR6M 4F2LA 4WP2A 2AWFA 1QYRA 2I7NA 1ORYB 1LV7A 3FUVA 4NRGB 4HL4A 3L26A 3GLHE 2YB6A 4QPLB 2MR9A 4W5VA 3FD9A 2K6BA 3PXGA 4AZFA 2F5OA 3U6OA 2EUCA 2J7NA 1XB2B 1OTRA 2DAXA 2CWBA 2ZM6M 2XLJA 1HQYE 1MN3A 3H4JA 1VG5A 5FLXS 1IXSA 5KPTA 3LQRA 1DV0A 3GLFB 2CUZA 3SBJA 1SXJD 3TWLA 4NL4H 3D8LA 2DAEA 1YF9A 4JI4M 3ZNIC 1AYZA 3T1HM 2D7HA 2ESPA 4NRGA 4LFCM 2JY7A 3C9PA 1OFIA 1OIPA 3GRRA 1NY6A 4REZA 1PJIA 1JQJC 3HCTB 1WGLA 2EKEA 2C2VC 4BWFA 4AI6A 4V3LA 2FO3A 3VONC 3T6PA 2L6OA 1XXHA 4DBGB 1GO5A 4DV0M 3KP1E 2NQ8C 3A45A 3UMMA 4JXJA 3GLFA 4GKKM 3F92A 1XWIA 4LFAM 1WHCA 1J7DB 2LH0A 2G5GX 1FZYA 2V1CA 2DWLA 5F3WA 1KFVA 4RNAA 2QENA 2O01F 2V1UA 2DWZB 2DENA 4P5OG 3T1YM 3IHPA 1XNRM 4NRWA 5A2QS 4LJ6A 5FSWA 4Y28F 4LCBA 4AG5A 4LG2A 4AKGA 2JY8A 2L7IA 3FE3A 3DFZA 3C3DA 1J09A 2KRKA 4GHAA 4NR3B 2WSEF 1IXZA 2HLWA 3KXEC 3JW0A 3H8KA 2DHYA 1J7DA 2XWUA 3VONB 2UU9M 4ITQA 2CE7A 2XSZA 1V33A 8CATA 2QGXA 4FH1A 4LRTA 1XMQM 2JWSA 1Q02A 2R62A 4OW0A 4LF8M 3FYCA 5F6VA 2X4AA 4BVUB 1V92A 4KLNA 1GJTA 3Q8GA 4IBCA 4LJ5A 3U60B 4OVZB 4RKUF 2GRRA 4B7HA 5FTKA 1HQCA 4D81A 2DAWA 1GVNA 2FS1A 1QAQA 2Z4RA 4FWHA 1Z5BA 3SAWA 4QOSA 1Z5AA 1MX0A 4TKPA 5KQDA 4XK8F 1CUKA 1OFHA 3JAMS 5ITQA 2XEPA 2W82A 2UYZA 1QUSA 3RZ3A 3JR5A 1IN8A 4ONMB 4PD2A 3W68A 2F0RA 1G3IA 2JA2A 2O5RA 4GHLA 1I7KA 2DAIA 2H5XA 2CHVA 3SY2C 2Z6PA 3GRVA 2Q2EB 3U60A 4OVZA 2YBFA 1JR3D 3KFUG 3THGA 2KA6B 2KXEA 4NC6A 2G3QA 4DDGA 3RFWA 2R6FA 5ITRA 1G4AE 2QQ8A 4DR3M 4R7GA 3AKZA 1PM5A 2YZ0A 1D0LA 3U61A 2JY6B 3GRYA 2C5RA 2F5QA 3OJ4A 3M6AA 1IFYA 4M1NA 3UIOA 4MGKE 2LHCA 1NHWC 4Q7JA 3W0LB 1TDZA 3SFZA 1I94M 3P9HA 4DDIA 4NSOB 4AUQA 1VDDA 3L1ZA 3AFHA 3L28A 3QYEA 3UJNA 4X57A 2Y4WA 5DYGA 3FTDA 2YR0A 1ZUOA 2YHOB 2CV2A 3AV0A 3LCVB 2CRUA 4PT5A 2JY5A 3ZQJA 3C3EA 1QUTA 1Z2UA 4JI2M 4FVMA 2DWNA 2GRNA 2WSCF 5D2MA 1NSFA 3HJSA 1BVSA 3U6QA 1R2ZA 1W5TA 4GPRA 4DV6M 1WJ7A 1C7YA 2L09A 3R42A 2R0JA 4FW9A 3B74A 3LW5F 3A33A 2JP7A 3B7ZA 2JXNA 5LMUM 1PZVA 3KOWE 4MGZE 3AOEC 1KPSA 4CJ6A 2XGNA 3OBSA 4JYAM 3GLGB 4D82A 5F6EA 2Z6OA 2CYXA 3ZQSA 3FSHA 3FN1B 4B3TM 3GPPA 4B08A 4DHJC 3K9OA 4F1IA 2F4VM 4Z8XA 1KPPA 1QZMA 1OAIA 3I51A 4JQUA 2XSZD 2VIIA 2OPFA 3RPGA 4JN6A 2QPAA 2EA0A 3SYKA 2JZ1A 4DV4M 1S3SA 1AUAA 1QDTA 3VKGA 1VEJA 2UXDM 3E95C 3PFIA 4AKHA 1QZEA 1NNUC 2RKOA 3HZJA 4B7GA 4I81A 4JI6M 2XZUA 2QBYB 4CIZA 3U6CA 2KNZA 1E94E 5C1BA 5KPRA 2P5TA 1ZAEA 5BPVA 3MK6A 3R3QA 3GLGA 4NXNM 1JB0F 3KPAA 1GKIA 3C58A 3T15A 3HHZA 4Q5HC 3B9PA 1V34A 1A3SA 1XXHE 4AG6A 3GQ5A 5ITYA 2CHGA 1YSYA 4S12A 1T3TA 1WR1B 2LVPC 4IP3B 2DZOB 3GLFE 1L1TA 1DO2A 1L2BA 3J27B 2MT6A 3HY5A 2QBYA 3TE6A 3TGDA 3TQSA 1KYIA 4LY6A 1R7RA 3OTOM 3CF2A 3BZHA 4MGIE 2DXIA 1YLAA 2CEAA 3D8BA 2HL7A 4LF6M 1PJQA 4QHSA 1JASA 2FH0A 1DO0A 2KEBA 1GABA 2Y20A 3QYBA 5EXXA 2H1RA 2R18A 1QAOA 3TL4X 2ZANA 2LTUA 3CTWB 3AOEA 4AKIA 2R44A 2QCUA 1IM2A 2CP8A 4AQYM 3MHVC 4A49B 2LHGA 1TH4A 1PRBA 1T43A 1H6UA 1F4IA 2I7PA 1FJGM 2M5ZA 4IBDA 3K8ZA 4DHID 3J7BA 4ZNYA 1Y8XA 1UZXA 1IN6A 2BEPA 2HHHM 3E95A 1SG9A 1Q3BA 4AW4A 4M9SA 4LJ7A 2BJVA 4A3VB 3SARA 3K1JA 1TH2A 1J5EM 4IJFA 1J7KA 3HGIA 1KSFX 1IN7A 4PCZA 2ZBKB 1MJGM 2XFTA 1IBLM 1N33M 4DUYM 3SC3A 3I04M 1U9BA 4G4OA 2ZAOA 3J2PB 3WHKA 4HEOA 2LNHC 1QCQA 3PTFA 4Q5EC 1IBMM 1M4QA 4V3KA 3LVWA 2R0IA 4I8OA 3MJ5A 2MJ5B 5AITB 5F6YA 4L8RC 2KLYA 2Y9MA 1OAOC 2C9OA 2C9CA 1R2YA 2KW0A 3HWSA 3KSXA 1PJJA 2QSFX 1N78A 1DGBA 2EDIA 3HX3A 1TH3A 3EVXA 3E46A 1R5LA 3BXWA 1K3WA 3JVZA 1TTEA 1K3XA 2EKKA 5F6XA 3GO8A 2LVQD 3QWLA 4LZZA 5FTLA 1ZMUA 4AP4B 5EP4A 3CGWA 1E32A 3IG5A 1VQ1A 5DNYA 5C18A 1OKSA 1KPQA 2UUAM 2Y21A 5EXPA 2PE6A 3CF0A 1D0KA 3J7AS 1G41A 2VQEM 2GQFA 2F5PA 3HJ8A 4GC5A 2DMFA 4LF4M 4GIPA 5F6DA 1HT2E 2VQFM 1DGGA 1QAMA 2QP9X 5DFLA 2EJSA 3VLFB 3DZDA 1Q39A 2UUCM 1G8PA 4RF1A 2HWJA 4LGMA 3GP1A 1HR0M 3L29A 2GRQA 2L2DA 4BBAA 2WSFF 1WIVA 4NR3A 1WXQA 3E9SA 2VDBB 3FRHA 2M60A 2KNVA 3U5ZB 4QNRA 1Q3CA 2Y0TA 1YUBA 1PJTA 3I4YA 4B7FA 4G6ZA 3WHLA 3V76A 2LVAA 4GKJM 4P17A 1K82A 1YRVA 4GC9A 3HU3A 3J81S 3FTEA 4FWDA 1VEKA 3KS4A 1N32M 3HU1A 1X37A 1DGFA 3SAVA 4LJ4A 3KVWA 3FYDA 2C98A 5E6JA 3GPUA 3AOGA 3L1YA 2C4PA 2Z4SA 3NWLA 1JATB 3IG8A 4NRIB 4ONMA 3U5ZA 3GLGE 2OOAA 4B3SM 2XF3A 1SXJB 3GLIB 4JI1M 5ITUA 4XGIA 3AJIB 3I01M 1G59A 1NVMA 3TPZA 3LMMA 2AYVA 4IBJA 1OJLA 3BBZA 2F5SA 3LVVA 4OU7A 3VDPA 3GRUA 1ZMVA 2ZTCA 2DKLA 1W4UA 4ONNB 3TWMA 4LADA 5ITXE 4DHZF 2X49A 2CV1A 4X64M 4X65M 2Y0QA 1JATA 3EIHA 4PDGA 1QVRA 1IY2A 2NVUC 1C1KA 5IT9S 1XHBA 3EIEA 4YY3M 3GQ3A 2CLWB 1SXJA 3GLIA 4YIIU 2A4DA 2RGOA 4LFBM 3ILKA 1MU5A 2Z3XA 5DYIA 1L2DA 2BJWA 2PX9B 1ZQ9A 1YH2A 4BLCA 3DA1A 1NNJA 4GITA 3HCUB 2X8AA 3SHFA 5FQ2A 5JI3E 3JR4A 2E5LM 3KP0E 5EP1A 5AITD 2FOIC 2OB4A 2PWQA 4ONNA 5FTJA 5EJCA 2D7GA 3KW6A 5FERB 1GL6A 3HHWA 3ZC7B 2DAKA 2L4EA 1QQWA 4JV5M 2YQZA 4FCWA 3U6EA 3VKHA 4II7A 3E21A 2CLWA 3AL0C 3U6SA 1IN5A 1HNWM 1Z6TA 4Z6YA 1S1QA 2DAGA 2V6ZM 2E2CA 2EBMA 1L2CA 4DR4M 3U6PA 4Y1LC 5EXTA 5F6UA 2MGWA 3FUXA 2UCZA 2KRUA 3NBIA 3HHXA 4DR7M 2LWXA 4DV2M 1ZV1A 4FD2A 4ZPXA 3HKPA 3WE5A 3U6LA 2DNAA 2LXEA 4JI8M 4KT0F
chains in the Genus database with same CATH topology
4UN2B 3K9PA 2LVOC 2GRRA 2DAYA 2DAWA 4NRIA 1ZMWA 2OXQA 2Y9PA 4ONLA 1U9BA 4R71A 3CEGA 2WZJA 2GROA 4HEOA 4TKPA 3ONGB 1CUKA 1QCQA 2BWEA 3PTFA 4Q5EC 1VEGA 2ONUA 1VDLA 2VRRA 1M4QA 2UYZA 4V3KA 2R0IA 3RCZB 2LBCA 3RZ3A 2EKFA 2MJ5B 5AITB 4DS2A 4ONMB 2ESKA 5F6YA 2RRUA 2KLYA 2AAKA 2Y9MA 2KNAA 3W31B 2F0RA 1G3IA 1I7KA 1J74A 2DAIA 2H5XA 2KHHA 2QSFX 3SY2C 2Z6PA 4R62A 2EDIA 5D0MA 4JUEA 2YBFA 1UFZA 3SQVC 3EVXA 3E46A 2G3QA 4DDGA 3JVZA 3EB6B 1TTEA 2L4FA 2EKKA 1G4AE 5F6XA 2YZ0A 2LVQD 2F4ZA 1ZMUA 2JZ0A 4AP4B 2JY6B 1ZDNA 1R4GA 1VQ1A 1OKSA 3OJ4A 1JR3E 3A4SA 2K0BX 1KPQA 1IFYA 4M1NA 3UIOA 1X23A 2PE6A 4Q7JA 1PGYA 2DAMA 1Y8GA 2BF8A 5AIEB 5D1KA 2A7LA 1G41A 5JNEB 4G3OA 2ESQA 3IECA 3P9HA 2O25C 2DMFA 4DDIA 4AUQA 3L1ZA 5F6DA 1HT2E 5AIUB 3UIPA 5HPTC 1Z3DA 2DZLA 2OO9A 3B89A 4X57A 4Y1LA 2Y4WA 1UKXA 1ZGUA 5DFLA 2Z5DA 2EJSA 1ZUOA 2YHOB 3LCVB 5D0KA 3UINA 1WZWA 2JY5A 4II2C 4L83A 2HWJA 1AIPC 5IFRA 4CCGA 4S3OA 2LXPA 1Z2UA 2GRQA 5JI2E 2L2DA 2GMIB 2QNJA 2GRNA 5D2MA 1WIVA 1BVSA 4GPRA 4NR3A 1T6OA 1WJ7A 5D1MA 4YC1A 1C7YA 2FUHA 3FRHA 2OOBA 3R42A 2R0JA 2KNVA 4WZ3A 1WZVA 1Q34A 2F4WA 1HJPA 3A33A 2JP7A 1PZVA 1KPSA 3P9GA 3OBSA 2HAKA 4EJEA 2ESOA 2ZTDA 5F6EA 2H2YA 2Z6OA 2CYXA 2LVAA 3ZQSA 3FSHA 3FN1B 1YRVA 2EBKA 1A5TA 4F2LA 2B3TA 4WP2A 4DHJC 2AWFA 1VEKA 3K9OA 1Z5SA 4F1IA 1KPPA 4NRGB 1OAIA 4JQUA 4GEWA 3RPGA 3OBUA 3GLHE 1WGNA 4A4BC 2GMIA 2YB6A 4QPLB 2JZ1A 1U9AA 2MR9A 4W5VA 3L1YA 2C4PA 1XB2B 1VEJA 1JATB 3E95C 1OTRA 2DAXA 1QZEA 2CWBA 3MMPA 4NRIB 5KNLC 4ONMA 1HQYE 1MN3A 3GLGE 2OOAA 3FRIA 3H4JA 1VG5A 2KNZA 1E94E 1IXSA 3UGBA 1DV0A 2C2VB 2K07A 3R3QA 2AYVA 2DAEA 1EFUB 3BBZA 2GRPA 1YF9A 3KPAA 1HT1E 3ZNIC 1AYZA 1NV9A 2ESPA 2KJHA 4NRGA 1ZMVA 2ZTCA 2DKLA 2JY7A 4Q5HC 1W4UA 2O25A 4ONNB 1A3SA 1XXHE 4LADA 4DHZF 5EGGA 3HCTB 1WGLA 2EKEA 3GLIE 2C2VC 4BWFA 1TR8A 2MROB 4V3LA 2FO3A 1FBVC 3VONC 1JATA 2DI0A 3T6PA 1WR1B 2LVPC 4IP3B 3GLFE 2NVUC 5F6WA 4DBGB 1DO2A 1GO5A 2MT6A 2JNHA 3TGDA 1KYIA 2CLWB 4YIIU 2LVNC 2A4DA 3BZHA 1YLAA 4MDKA 3F92A 1JASA 1DO0A 1C4ZD 2PX9B 4A4CC 1YH2A 1JBBA 2BWBA 3HCUB 1WHCA 1J7DB 5FQ2A 1FZYA 1OQYA 5AITD 2OB4A 2PWQA 2LTUA 4ONNA 5FERB 2K9DA 1IM2A 2DAKA 2L4EA 2CP8A 2DENA 4P5OG 3IHPA 4A49B 3E21A 1T43A 1Y6LA 4ONLB 3O2UA 2CLWA 2GJDA 1F4IA 1S1QA 2DAGA 2EBMA 2E2CA 2JUJA 2JY8A 3FE3A 1P3QQ 4DHID 2QHOB 4ZNYA 4NR3B 1Y8XA 2HLWA 1UZXA 4Y1LC 3JW0A 5F6UA 2BEPA 3H8KA 1NV8A 2DHYA 1J7DA 2XWUA 2MGWA 3VONB 1FXTA 1SG9A 3E95A 2UCZA 3OBXA 2QGXA 1M4PA 4FH1A 1ZV1A 1Q02A 5F6VA 3WE5A 4BVUB 4LDTC 1V92A 2DNAA 3LCUA 3OBQA 2Q0VA 5D1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UN2 B;  3K9P A;  2LVO C;  2GRR A;  2DAY A;  2DAW A;  4NRI A;  1ZMW A;  2OXQ A;  2Y9P A;  4ONL A;  1U9B A;  4R71 A;  3CEG A;  2WZJ A;  2GRO A;  4HEO A;  4TKP A;  3ONG B;  1CUK A;  1QCQ A;  2BWE A;  3PTF A;  4Q5E C;  1VEG A;  2ONU A;  1VDL A;  2VRR A;  1M4Q A;  2UYZ A;  4V3K A;  2R0I A;  3RCZ B;  2LBC A;  3RZ3 A;  2EKF A;  2MJ5 B;  5AIT B;  4DS2 A;  4ONM B;  2ESK A;  5F6Y A;  2RRU A;  2KLY A;  2AAK A;  2Y9M A;  2KNA A;  3W31 B;  2F0R A;  1G3I A;  1I7K A;  1J74 A;  2DAI A;  2H5X A;  2KHH A;  2QSF X;  3SY2 C;  2Z6P A;  4R62 A;  2EDI A;  5D0M A;  4JUE A;  2YBF A;  1UFZ A;  3SQV C;  3EVX A;  3E46 A;  2G3Q A;  4DDG A;  3JVZ A;  3EB6 B;  1TTE A;  2L4F A;  2EKK A;  1G4A E;  5F6X A;  2YZ0 A;  2LVQ D;  2F4Z A;  1ZMU A;  2JZ0 A;  4AP4 B;  2JY6 B;  1ZDN A;  1R4G A;  1VQ1 A;  1OKS A;  3OJ4 A;  1JR3 E;  3A4S A;  2K0B X;  1KPQ A;  1IFY A;  4M1N A;  3UIO A;  1X23 A;  2PE6 A;  4Q7J A;  1PGY A;  2DAM A;  1Y8G A;  2BF8 A;  5AIE B;  5D1K A;  2A7L A;  1G41 A;  5JNE B;  4G3O A;  2ESQ A;  3IEC A;  3P9H A;  2O25 C;  2DMF A;  4DDI A;  4AUQ A;  3L1Z A;  5F6D A;  1HT2 E;  5AIU B;  3UIP A;  5HPT C;  1Z3D A;  2DZL A;  2OO9 A;  3B89 A;  4X57 A;  4Y1L A;  2Y4W A;  1UKX A;  1ZGU A;  5DFL A;  2Z5D A;  2EJS A;  1ZUO A;  2YHO B;  3LCV B;  5D0K A;  3UIN A;  1WZW A;  2JY5 A;  4II2 C;  4L83 A;  2HWJ A;  1AIP C;  5IFR A;  4CCG A;  4S3O A;  2LXP A;  1Z2U A;  2GRQ A;  5JI2 E;  2L2D A;  2GMI B;  2QNJ A;  2GRN A;  5D2M A;  1WIV A;  1BVS A;  4GPR A;  4NR3 A;  1T6O A;  1WJ7 A;  5D1M A;  4YC1 A;  1C7Y A;  2FUH A;  3FRH A;  2OOB A;  3R42 A;  2R0J A;  2KNV A;  4WZ3 A;  1WZV A;  1Q34 A;  2F4W A;  1HJP A;  3A33 A;  2JP7 A;  1PZV A;  1KPS A;  3P9G A;  3OBS A;  2HAK A;  4EJE A;  2ESO A;  2ZTD A;  5F6E A;  2H2Y A;  2Z6O A;  2CYX A;  2LVA A;  3ZQS A;  3FSH A;  3FN1 B;  1YRV A;  2EBK A;  1A5T A;  4F2L A;  2B3T A;  4WP2 A;  4DHJ C;  2AWF A;  1VEK A;  3K9O A;  1Z5S A;  4F1I A;  1KPP A;  4NRG B;  1OAI A;  4JQU A;  4GEW A;  3RPG A;  3OBU A;  3GLH E;  1WGN A;  4A4B C;  2GMI A;  2YB6 A;  4QPL B;  2JZ1 A;  1U9A A;  2MR9 A;  4W5V A;  3L1Y A;  2C4P A;  1XB2 B;  1VEJ A;  1JAT B;  3E95 C;  1OTR A;  2DAX A;  1QZE A;  2CWB A;  3MMP A;  4NRI B;  5KNL C;  4ONM A;  1HQY E;  1MN3 A;  3GLG E;  2OOA A;  3FRI A;  3H4J A;  1VG5 A;  2KNZ A;  1E94 E;  1IXS A;  3UGB A;  1DV0 A;  2C2V B;  2K07 A;  3R3Q A;  2AYV A;  2DAE A;  1EFU B;  3BBZ A;  2GRP A;  1YF9 A;  3KPA A;  1HT1 E;  3ZNI C;  1AYZ A;  1NV9 A;  2ESP A;  2KJH A;  4NRG A;  1ZMV A;  2ZTC A;  2DKL A;  2JY7 A;  4Q5H C;  1W4U A;  2O25 A;  4ONN B;  1A3S A;  1XXH E;  4LAD A;  4DHZ F;  5EGG A;  3HCT B;  1WGL A;  2EKE A;  3GLI E;  2C2V C;  4BWF A;  1TR8 A;  2MRO B;  4V3L A;  2FO3 A;  1FBV C;  3VON C;  1JAT A;  2DI0 A;  3T6P A;  1WR1 B;  2LVP C;  4IP3 B;  3GLF E;  2NVU C;  5F6W A;  4DBG B;  1DO2 A;  1GO5 A;  2MT6 A;  2JNH A;  3TGD A;  1KYI A;  2CLW B;  4YII U;  2LVN C;  2A4D A;  3BZH A;  1YLA A;  4MDK A;  3F92 A;  1JAS A;  1DO0 A;  1C4Z D;  2PX9 B;  4A4C C;  1YH2 A;  1JBB A;  2BWB A;  3HCU B;  1WHC A;  1J7D B;  5FQ2 A;  1FZY A;  1OQY A;  5AIT D;  2OB4 A;  2PWQ A;  2LTU A;  4ONN A;  5FER B;  2K9D A;  1IM2 A;  2DAK A;  2L4E A;  2CP8 A;  2DEN A;  4P5O G;  3IHP A;  4A49 B;  3E21 A;  1T43 A;  1Y6L A;  4ONL B;  3O2U A;  2CLW A;  2GJD A;  1F4I A;  1S1Q A;  2DAG A;  2EBM A;  2E2C A;  2JUJ A;  2JY8 A;  3FE3 A;  1P3Q Q;  4DHI D;  2QHO B;  4ZNY A;  4NR3 B;  1Y8X A;  2HLW A;  1UZX A;  4Y1L C;  3JW0 A;  5F6U A;  2BEP A;  3H8K A;  1NV8 A;  2DHY A;  1J7D A;  2XWU A;  2MGW A;  3VON B;  1FXT A;  1SG9 A;  3E95 A;  2UCZ A;  3OBX A;  2QGX A;  1M4P A;  4FH1 A;  1ZV1 A;  1Q02 A;  5F6V A;  3WE5 A;  4BVU B;  4LDT C;  1V92 A;  2DNA A;  3LCU A;  3OBQ A;  2Q0V A;  5D1L A; 
#chains in the Genus database with same CATH topology
 3CF6 E;  3QAU A;  1QAN A;  1ZMW A;  2OXQ A;  3KDS E;  2Y9P A;  5ITX A;  3CEG A;  2CFO A;  2WZJ A;  4B3R M;  2BWE A;  4L6V 6;  1VEG A;  2ONU A;  2VRR A;  4LJ9 A;  2DVW B;  3RCZ B;  3R9X B;  1PJS A;  4DS2 A;  2QZ4 A;  4XBO A;  4LJA A;  1N77 A;  4DV7 M;  2AAK A;  1IQP A;  3W31 B;  2KNA A;  4CHT B;  3SAU A;  3FTF A;  4LF7 M;  1J74 A;  3GPY A;  4DR1 M;  3B7N A;  3M0E A;  3VDU A;  4JI7 M;  4R62 A;  2KZU A;  4JUE A;  1XMO M;  4PDI A;  3SQV C;  3U6M A;  2L4F A;  4FWG A;  1HNZ M;  4RF0 A;  2F4Z A;  4NSR A;  5IRE B;  1XNQ M;  2GNO A;  2JZ0 A;  3K2L A;  1ZDN A;  1IN4 A;  4LF5 M;  2YNM D;  4L78 A;  2EO2 A;  4X66 M;  3PVS A;  3FKE A;  1X23 A;  1TF0 B;  5KQ8 A;  4LF9 M;  2YFQ A;  1L8Q A;  2R4J A;  4L15 A;  1XXH B;  4DV1 M;  1XC8 A;  4M9Z A;  2BF8 A;  5AIE B;  5JNE B;  4G3O A;  1JR3 A;  2O25 C;  5GKN A;  4DV3 M;  2AHM A;  2DZL A;  3UK6 A;  3B89 A;  4Y1L A;  3HJQ A;  4IBB A;  1UKX A;  2Z5D A;  4K0K M;  1UM8 A;  4IIW A;  1IBK M;  4KO8 A;  5D0K A;  3UIN A;  2BNK A;  3HU2 A;  4KHP M;  3RE8 A;  5IFR A;  5ITT A;  4S3O A;  1L1Z A;  2LXP A;  4NXM M;  1LTM A;  2GMI B;  2Z8Y M;  3FUW A;  4IBE A;  1T6O A;  4YC1 A;  2DZN B;  2FUH A;  5BR8 M;  3GLH B;  3UGJ A;  2OOB A;  2F5N A;  1IXR C;  1HJP A;  3HHY A;  3GQ4 A;  1N36 M;  2R65 A;  4X62 M;  4CGY B;  1IY1 A;  3P9G A;  2DHR A;  2ESO A;  2ZTD A;  4IBF A;  2CV0 A;  3NBX X;  3FTC A;  2EBK A;  1DGH B;  4LJ8 A;  2B3T A;  1TGU A;  4MM3 B;  5H37 D;  4QNM A;  1Z5S A;  1NHG C;  4EIW A;  4GEW A;  3OBU A;  1WGN A;  4I5S A;  1W5S A;  3SAS A;  4A4B C;  2RGH A;  3RGS A;  2GMI A;  5KPZ A;  1U9A A;  3A46 A;  3FUT A;  4GRI A;  3SMS A;  4JI5 M;  3T38 A;  4QOZ C;  1G71 A;  4JI0 M;  4DR2 M;  2G8L A;  3MMP A;  3GLH A;  3M7G A;  4IJE A;  5KNL C;  2XZF A;  3FRI A;  4MGY E;  4DUZ M;  2D7E A;  3UGB A;  2C2V B;  2K07 A;  3VK7 A;  3I4V A;  2C96 A;  3FUU A;  1DGH A;  1EFU B;  2GRP A;  1GL7 A;  1HT1 E;  1D0M A;  1NY5 A;  3VFD A;  4IBG A;  1NV9 A;  1NJG A;  4ANR A;  2KJH A;  1SXJ C;  3DOA A;  2O25 A;  4CIS A;  3PNY A;  5EGG A;  3W67 A;  1OIZ A;  3KS8 A;  1SXJ E;  3GLI E;  2R4E A;  1TR8 A;  4GH9 A;  2MRO B;  1FBV C;  2DI0 A;  1QDR A;  2FNA A;  4FCV A;  4D80 A;  5F6W A;  3RGP A;  5FTN A;  2JNH A;  4IBK A;  3U61 B;  2LVN C;  3SYL A;  4M0W A;  1D2N A;  5E26 A;  1FNN A;  5EQT A;  4MDK A;  1NO1 A;  4DR5 M;  1C4Z D;  2L7H A;  4A4C C;  4NOO B;  1JBB A;  2BWB A;  2XFS A;  4DV5 M;  4YHH M;  3A98 B;  4W5W A;  1TDH A;  2Z7J A;  2VF7 A;  1OQY A;  4I4L A;  5L8R F;  2XH9 A;  4GMQ A;  1EIJ A;  2CHQ A;  4LRS A;  2UUB M;  2K9D A;  2UXB M;  1HNX M;  1IY0 A;  5LMN M;  1Y6L A;  4ONL B;  3O2U A;  2GJD A;  2A5Y B;  3GPX A;  2JUJ A;  1P3Q Q;  2QHO B;  2KDL A;  1E9R A;  4WW0 A;  3BOS A;  2ZAM A;  3W0F A;  5IWA M;  1NV8 A;  4QHT A;  1FXT A;  3OBX A;  1M4P A;  1N34 M;  4HLQ A;  5EXS A;  2C99 A;  5EP3 A;  3E4R A;  4L16 A;  2UXC M;  3LQQ A;  4LDT C;  3LCU A;  3OBQ A;  3Q8X A;  2Q0V A;  5KO3 A;  2J7O A;  3L2A A;  5D1L A;  4M9X A;  4UN2 B;  3VK8 A;  3K9P A;  2LVO C;  7CAT A;  4LGY A;  2DAY A;  4WUR A;  4NRI A;  4ONL A;  4IBI A;  4R3D A;  4R71 A;  2R46 A;  2GRO A;  3ONG B;  2K47 A;  1VDL A;  3ZH9 B;  2LBC A;  1E9S A;  2EKF A;  3KOX E;  1I4W A;  2HKJ A;  2ESK A;  2RRU A;  2FFJ A;  4P16 A;  4MB7 A;  2KHH A;  3H4M A;  5D0M A;  1UFZ A;  3KSJ A;  3U6D A;  3EB6 B;  3L25 A;  2J5Y A;  2N35 A;  4OX9 M;  3B7Q A;  1R4G A;  3UZU A;  4G4R A;  4M0D A;  1JR3 E;  3A4S A;  2K0B X;  3SAT A;  2MH8 A;  1RU3 A;  1PGY A;  2DAM A;  1Y8G A;  5D1K A;  2A7L A;  3ZCB B;  1EE8 A;  3K92 A;  2ESQ A;  1GJS A;  3IEC A;  1GLN A;  2OQ4 A;  1NJF A;  5AIU B;  3UIP A;  2FE8 A;  5HPT C;  1Z3D A;  2ERC A;  3KOZ E;  1N75 A;  2R45 A;  4G4Q A;  2OO9 A;  4JI3 M;  1Z5C A;  5EP2 A;  1ZGU A;  3SHG B;  1Z59 A;  4B3M M;  2VF8 A;  3TWK A;  1WZW A;  4II2 C;  4L83 A;  3J80 S;  1R6B X;  1AIP C;  4BB9 A;  3L27 A;  4CCG A;  4G4N A;  4MGH A;  4KOD A;  5JI2 E;  2APL A;  2QNJ A;  3A42 A;  3KOY E;  4L4U A;  3PNV A;  5D1M A;  2HCB A;  5FTM A;  4TUW A;  2DWM A;  4WZ3 A;  1WZV A;  1Q34 A;  2F4W A;  1IXS B;  5IZ7 D;  4MH0 E;  3R8F A;  4FCT A;  4NRV A;  4LZJ A;  2HAK A;  3SMP A;  1YE9 A;  4EJE A;  2KZS A;  2H2Y A;  1A5T A;  4DR6 M;  4F2L A;  4WP2 A;  2AWF A;  1QYR A;  2I7N A;  1ORY B;  1LV7 A;  3FUV A;  4NRG B;  4HL4 A;  3L26 A;  3GLH E;  2YB6 A;  4QPL B;  2MR9 A;  4W5V A;  3FD9 A;  2K6B A;  3PXG A;  4AZF A;  2F5O A;  3U6O A;  2EUC A;  2J7N A;  1XB2 B;  1OTR A;  2DAX A;  2CWB A;  2ZM6 M;  2XLJ A;  1HQY E;  1MN3 A;  3H4J A;  1VG5 A;  5FLX S;  1IXS A;  5KPT A;  3LQR A;  1DV0 A;  3GLF B;  2CUZ A;  3SBJ A;  1SXJ D;  3TWL A;  4NL4 H;  3D8L A;  2DAE A;  1YF9 A;  4JI4 M;  3ZNI C;  1AYZ A;  3T1H M;  2D7H A;  2ESP A;  4NRG A;  4LFC M;  2JY7 A;  3C9P A;  1OFI A;  1OIP A;  3GRR A;  1NY6 A;  4REZ A;  1PJI A;  1JQJ C;  3HCT B;  1WGL A;  2EKE A;  2C2V C;  4BWF A;  4AI6 A;  4V3L A;  2FO3 A;  3VON C;  3T6P A;  2L6O A;  1XXH A;  4DBG B;  1GO5 A;  4DV0 M;  3KP1 E;  2NQ8 C;  3A45 A;  3UMM A;  4JXJ A;  3GLF A;  4GKK M;  3F92 A;  1XWI A;  4LFA M;  1WHC A;  1J7D B;  2LH0 A;  2G5G X;  1FZY A;  2V1C A;  2DWL A;  5F3W A;  1KFV A;  4RNA A;  2QEN A;  2O01 F;  2V1U A;  2DWZ B;  2DEN A;  4P5O G;  3T1Y M;  3IHP A;  1XNR M;  4NRW A;  5A2Q S;  4LJ6 A;  5FSW A;  4Y28 F;  4LCB A;  4AG5 A;  4LG2 A;  4AKG A;  2JY8 A;  2L7I A;  3FE3 A;  3DFZ A;  3C3D A;  1J09 A;  2KRK A;  4GHA A;  4NR3 B;  2WSE F;  1IXZ A;  2HLW A;  3KXE C;  3JW0 A;  3H8K A;  2DHY A;  1J7D A;  2XWU A;  3VON B;  2UU9 M;  4ITQ A;  2CE7 A;  2XSZ A;  1V33 A;  8CAT A;  2QGX A;  4FH1 A;  4LRT A;  1XMQ M;  2JWS A;  1Q02 A;  2R62 A;  4OW0 A;  4LF8 M;  3FYC A;  5F6V A;  2X4A A;  4BVU B;  1V92 A;  4KLN A;  1GJT A;  3Q8G A;  4IBC A;  4LJ5 A;  3U60 B;  4OVZ B;  4RKU F;  2GRR A;  4B7H A;  5FTK A;  1HQC A;  4D81 A;  2DAW A;  1GVN A;  2FS1 A;  1QAQ A;  2Z4R A;  4FWH A;  1Z5B A;  3SAW A;  4QOS A;  1Z5A A;  1MX0 A;  4TKP A;  5KQD A;  4XK8 F;  1CUK A;  1OFH A;  3JAM S;  5ITQ A;  2XEP A;  2W82 A;  2UYZ A;  1QUS A;  3RZ3 A;  3JR5 A;  1IN8 A;  4ONM B;  4PD2 A;  3W68 A;  2F0R A;  1G3I A;  2JA2 A;  2O5R A;  4GHL A;  1I7K A;  2DAI A;  2H5X A;  2CHV A;  3SY2 C;  2Z6P A;  3GRV A;  2Q2E B;  3U60 A;  4OVZ A;  2YBF A;  1JR3 D;  3KFU G;  3THG A;  2KA6 B;  2KXE A;  4NC6 A;  2G3Q A;  4DDG A;  3RFW A;  2R6F A;  5ITR A;  1G4A E;  2QQ8 A;  4DR3 M;  4R7G A;  3AKZ A;  1PM5 A;  2YZ0 A;  1D0L A;  3U61 A;  2JY6 B;  3GRY A;  2C5R A;  2F5Q A;  3OJ4 A;  3M6A A;  1IFY A;  4M1N A;  3UIO A;  4MGK E;  2LHC A;  1NHW C;  4Q7J A;  3W0L B;  1TDZ A;  3SFZ A;  1I94 M;  3P9H A;  4DDI A;  4NSO B;  4AUQ A;  1VDD A;  3L1Z A;  3AFH A;  3L28 A;  3QYE A;  3UJN A;  4X57 A;  2Y4W A;  5DYG A;  3FTD A;  2YR0 A;  1ZUO A;  2YHO B;  2CV2 A;  3AV0 A;  3LCV B;  2CRU A;  4PT5 A;  2JY5 A;  3ZQJ A;  3C3E A;  1QUT A;  1Z2U A;  4JI2 M;  4FVM A;  2DWN A;  2GRN A;  2WSC F;  5D2M A;  1NSF A;  3HJS A;  1BVS A;  3U6Q A;  1R2Z A;  1W5T A;  4GPR A;  4DV6 M;  1WJ7 A;  1C7Y A;  2L09 A;  3R42 A;  2R0J A;  4FW9 A;  3B74 A;  3LW5 F;  3A33 A;  2JP7 A;  3B7Z A;  2JXN A;  5LMU M;  1PZV A;  3KOW E;  4MGZ E;  3AOE C;  1KPS A;  4CJ6 A;  2XGN A;  3OBS A;  4JYA M;  3GLG B;  4D82 A;  5F6E A;  2Z6O A;  2CYX A;  3ZQS A;  3FSH A;  3FN1 B;  4B3T M;  3GPP A;  4B08 A;  4DHJ C;  3K9O A;  4F1I A;  2F4V M;  4Z8X A;  1KPP A;  1QZM A;  1OAI A;  3I51 A;  4JQU A;  2XSZ D;  2VII A;  2OPF A;  3RPG A;  4JN6 A;  2QPA A;  2EA0 A;  3SYK A;  2JZ1 A;  4DV4 M;  1S3S A;  1AUA A;  1QDT A;  3VKG A;  1VEJ A;  2UXD M;  3E95 C;  3PFI A;  4AKH A;  1QZE A;  1NNU C;  2RKO A;  3HZJ A;  4B7G A;  4I81 A;  4JI6 M;  2XZU A;  2QBY B;  4CIZ A;  3U6C A;  2KNZ A;  1E94 E;  5C1B A;  5KPR A;  2P5T A;  1ZAE A;  5BPV A;  3MK6 A;  3R3Q A;  3GLG A;  4NXN M;  1JB0 F;  3KPA A;  1GKI A;  3C58 A;  3T15 A;  3HHZ A;  4Q5H C;  3B9P A;  1V34 A;  1A3S A;  1XXH E;  4AG6 A;  3GQ5 A;  5ITY A;  2CHG A;  1YSY A;  4S12 A;  1T3T A;  1WR1 B;  2LVP C;  4IP3 B;  2DZO B;  3GLF E;  1L1T A;  1DO2 A;  1L2B A;  3J27 B;  2MT6 A;  3HY5 A;  2QBY A;  3TE6 A;  3TGD A;  3TQS A;  1KYI A;  4LY6 A;  1R7R A;  3OTO M;  3CF2 A;  3BZH A;  4MGI E;  2DXI A;  1YLA A;  2CEA A;  3D8B A;  2HL7 A;  4LF6 M;  1PJQ A;  4QHS A;  1JAS A;  2FH0 A;  1DO0 A;  2KEB A;  1GAB A;  2Y20 A;  3QYB A;  5EXX A;  2H1R A;  2R18 A;  1QAO A;  3TL4 X;  2ZAN A;  2LTU A;  3CTW B;  3AOE A;  4AKI A;  2R44 A;  2QCU A;  1IM2 A;  2CP8 A;  4AQY M;  3MHV C;  4A49 B;  2LHG A;  1TH4 A;  1PRB A;  1T43 A;  1H6U A;  1F4I A;  2I7P A;  1FJG M;  2M5Z A;  4IBD A;  3K8Z A;  4DHI D;  3J7B A;  4ZNY A;  1Y8X A;  1UZX A;  1IN6 A;  2BEP A;  2HHH M;  3E95 A;  1SG9 A;  1Q3B A;  4AW4 A;  4M9S A;  4LJ7 A;  2BJV A;  4A3V B;  3SAR A;  3K1J A;  1TH2 A;  1J5E M;  4IJF A;  1J7K A;  3HGI A;  1KSF X;  1IN7 A;  4PCZ A;  2ZBK B;  1MJG M;  2XFT A;  1IBL M;  1N33 M;  4DUY M;  3SC3 A;  3I04 M;  1U9B A;  4G4O A;  2ZAO A;  3J2P B;  3WHK A;  4HEO A;  2LNH C;  1QCQ A;  3PTF A;  4Q5E C;  1IBM M;  1M4Q A;  4V3K A;  3LVW A;  2R0I A;  4I8O A;  3MJ5 A;  2MJ5 B;  5AIT B;  5F6Y A;  4L8R C;  2KLY A;  2Y9M A;  1OAO C;  2C9O A;  2C9C A;  1R2Y A;  2KW0 A;  3HWS A;  3KSX A;  1PJJ A;  2QSF X;  1N78 A;  1DGB A;  2EDI A;  3HX3 A;  1TH3 A;  3EVX A;  3E46 A;  1R5L A;  3BXW A;  1K3W A;  3JVZ A;  1TTE A;  1K3X A;  2EKK A;  5F6X A;  3GO8 A;  2LVQ D;  3QWL A;  4LZZ A;  5FTL A;  1ZMU A;  4AP4 B;  5EP4 A;  3CGW A;  1E32 A;  3IG5 A;  1VQ1 A;  5DNY A;  5C18 A;  1OKS A;  1KPQ A;  2UUA M;  2Y21 A;  5EXP A;  2PE6 A;  3CF0 A;  1D0K A;  3J7A S;  1G41 A;  2VQE M;  2GQF A;  2F5P A;  3HJ8 A;  4GC5 A;  2DMF A;  4LF4 M;  4GIP A;  5F6D A;  1HT2 E;  2VQF M;  1DGG A;  1QAM A;  2QP9 X;  5DFL A;  2EJS A;  3VLF B;  3DZD A;  1Q39 A;  2UUC M;  1G8P A;  4RF1 A;  2HWJ A;  4LGM A;  3GP1 A;  1HR0 M;  3L29 A;  2GRQ A;  2L2D A;  4BBA A;  2WSF F;  1WIV A;  4NR3 A;  1WXQ A;  3E9S A;  2VDB B;  3FRH A;  2M60 A;  2KNV A;  3U5Z B;  4QNR A;  1Q3C A;  2Y0T A;  1YUB A;  1PJT A;  3I4Y A;  4B7F A;  4G6Z A;  3WHL A;  3V76 A;  2LVA A;  4GKJ M;  4P17 A;  1K82 A;  1YRV A;  4GC9 A;  3HU3 A;  3J81 S;  3FTE A;  4FWD A;  1VEK A;  3KS4 A;  1N32 M;  3HU1 A;  1X37 A;  1DGF A;  3SAV A;  4LJ4 A;  3KVW A;  3FYD A;  2C98 A;  5E6J A;  3GPU A;  3AOG A;  3L1Y A;  2C4P A;  2Z4S A;  3NWL A;  1JAT B;  3IG8 A;  4NRI B;  4ONM A;  3U5Z A;  3GLG E;  2OOA A;  4B3S M;  2XF3 A;  1SXJ B;  3GLI B;  4JI1 M;  5ITU A;  4XGI A;  3AJI B;  3I01 M;  1G59 A;  1NVM A;  3TPZ A;  3LMM A;  2AYV A;  4IBJ A;  1OJL A;  3BBZ A;  2F5S A;  3LVV A;  4OU7 A;  3VDP A;  3GRU A;  1ZMV A;  2ZTC A;  2DKL A;  1W4U A;  4ONN B;  3TWM A;  4LAD A;  5ITX E;  4DHZ F;  2X49 A;  2CV1 A;  4X64 M;  4X65 M;  2Y0Q A;  1JAT A;  3EIH A;  4PDG A;  1QVR A;  1IY2 A;  2NVU C;  1C1K A;  5IT9 S;  1XHB A;  3EIE A;  4YY3 M;  3GQ3 A;  2CLW B;  1SXJ A;  3GLI A;  4YII U;  2A4D A;  2RGO A;  4LFB M;  3ILK A;  1MU5 A;  2Z3X A;  5DYI A;  1L2D A;  2BJW A;  2PX9 B;  1ZQ9 A;  1YH2 A;  4BLC A;  3DA1 A;  1NNJ A;  4GIT A;  3HCU B;  2X8A A;  3SHF A;  5FQ2 A;  5JI3 E;  3JR4 A;  2E5L M;  3KP0 E;  5EP1 A;  5AIT D;  2FOI C;  2OB4 A;  2PWQ A;  4ONN A;  5FTJ A;  5EJC A;  2D7G A;  3KW6 A;  5FER B;  1GL6 A;  3HHW A;  3ZC7 B;  2DAK A;  2L4E A;  1QQW A;  4JV5 M;  2YQZ A;  4FCW A;  3U6E A;  3VKH A;  4II7 A;  3E21 A;  2CLW A;  3AL0 C;  3U6S A;  1IN5 A;  1HNW M;  1Z6T A;  4Z6Y A;  1S1Q A;  2DAG A;  2V6Z M;  2E2C A;  2EBM A;  1L2C A;  4DR4 M;  3U6P A;  4Y1L C;  5EXT A;  5F6U A;  2MGW A;  3FUX A;  2UCZ A;  2KRU A;  3NBI A;  3HHX A;  4DR7 M;  2LWX A;  4DV2 M;  1ZV1 A;  4FD2 A;  4ZPX A;  3HKP A;  3WE5 A;  3U6L A;  2DNA A;  2LXE A;  4JI8 M;  4KT0 F; 
#chains in the Genus database with same CATH homology
 4UN2 B;  3K9P A;  2LVO C;  2GRR A;  2DAY A;  2DAW A;  4NRI A;  1ZMW A;  2OXQ A;  2Y9P A;  4ONL A;  1U9B A;  4R71 A;  3CEG A;  2WZJ A;  2GRO A;  4HEO A;  4TKP A;  3ONG B;  1CUK A;  1QCQ A;  2BWE A;  3PTF A;  4Q5E C;  1VEG A;  2ONU A;  1VDL A;  2VRR A;  1M4Q A;  2UYZ A;  4V3K A;  2R0I A;  3RCZ B;  2LBC A;  3RZ3 A;  2EKF A;  2MJ5 B;  5AIT B;  4DS2 A;  4ONM B;  2ESK A;  5F6Y A;  2RRU A;  2KLY A;  2AAK A;  2Y9M A;  2KNA A;  3W31 B;  2F0R A;  1G3I A;  1I7K A;  1J74 A;  2DAI A;  2H5X A;  2KHH A;  2QSF X;  3SY2 C;  2Z6P A;  4R62 A;  2EDI A;  5D0M A;  4JUE A;  2YBF A;  1UFZ A;  3SQV C;  3EVX A;  3E46 A;  2G3Q A;  4DDG A;  3JVZ A;  3EB6 B;  1TTE A;  2L4F A;  2EKK A;  1G4A E;  5F6X A;  2YZ0 A;  2LVQ D;  2F4Z A;  1ZMU A;  2JZ0 A;  4AP4 B;  2JY6 B;  1ZDN A;  1R4G A;  1VQ1 A;  1OKS A;  3OJ4 A;  1JR3 E;  3A4S A;  2K0B X;  1KPQ A;  1IFY A;  4M1N A;  3UIO A;  1X23 A;  2PE6 A;  4Q7J A;  1PGY A;  2DAM A;  1Y8G A;  2BF8 A;  5AIE B;  5D1K A;  2A7L A;  1G41 A;  5JNE B;  4G3O A;  2ESQ A;  3IEC A;  3P9H A;  2O25 C;  2DMF A;  4DDI A;  4AUQ A;  3L1Z A;  5F6D A;  1HT2 E;  5AIU B;  3UIP A;  5HPT C;  1Z3D A;  2DZL A;  2OO9 A;  3B89 A;  4X57 A;  4Y1L A;  2Y4W A;  1UKX A;  1ZGU A;  5DFL A;  2Z5D A;  2EJS A;  1ZUO A;  2YHO B;  3LCV B;  5D0K A;  3UIN A;  1WZW A;  2JY5 A;  4II2 C;  4L83 A;  2HWJ A;  1AIP C;  5IFR A;  4CCG A;  4S3O A;  2LXP A;  1Z2U A;  2GRQ A;  5JI2 E;  2L2D A;  2GMI B;  2QNJ A;  2GRN A;  5D2M A;  1WIV A;  1BVS A;  4GPR A;  4NR3 A;  1T6O A;  1WJ7 A;  5D1M A;  4YC1 A;  1C7Y A;  2FUH A;  3FRH A;  2OOB A;  3R42 A;  2R0J A;  2KNV A;  4WZ3 A;  1WZV A;  1Q34 A;  2F4W A;  1HJP A;  3A33 A;  2JP7 A;  1PZV A;  1KPS A;  3P9G A;  3OBS A;  2HAK A;  4EJE A;  2ESO A;  2ZTD A;  5F6E A;  2H2Y A;  2Z6O A;  2CYX A;  2LVA A;  3ZQS A;  3FSH A;  3FN1 B;  1YRV A;  2EBK A;  1A5T A;  4F2L A;  2B3T A;  4WP2 A;  4DHJ C;  2AWF A;  1VEK A;  3K9O A;  1Z5S A;  4F1I A;  1KPP A;  4NRG B;  1OAI A;  4JQU A;  4GEW A;  3RPG A;  3OBU A;  3GLH E;  1WGN A;  4A4B C;  2GMI A;  2YB6 A;  4QPL B;  2JZ1 A;  1U9A A;  2MR9 A;  4W5V A;  3L1Y A;  2C4P A;  1XB2 B;  1VEJ A;  1JAT B;  3E95 C;  1OTR A;  2DAX A;  1QZE A;  2CWB A;  3MMP A;  4NRI B;  5KNL C;  4ONM A;  1HQY E;  1MN3 A;  3GLG E;  2OOA A;  3FRI A;  3H4J A;  1VG5 A;  2KNZ A;  1E94 E;  1IXS A;  3UGB A;  1DV0 A;  2C2V B;  2K07 A;  3R3Q A;  2AYV A;  2DAE A;  1EFU B;  3BBZ A;  2GRP A;  1YF9 A;  3KPA A;  1HT1 E;  3ZNI C;  1AYZ A;  1NV9 A;  2ESP A;  2KJH A;  4NRG A;  1ZMV A;  2ZTC A;  2DKL A;  2JY7 A;  4Q5H C;  1W4U A;  2O25 A;  4ONN B;  1A3S A;  1XXH E;  4LAD A;  4DHZ F;  5EGG A;  3HCT B;  1WGL A;  2EKE A;  3GLI E;  2C2V C;  4BWF A;  1TR8 A;  2MRO B;  4V3L A;  2FO3 A;  1FBV C;  3VON C;  1JAT A;  2DI0 A;  3T6P A;  1WR1 B;  2LVP C;  4IP3 B;  3GLF E;  2NVU C;  5F6W A;  4DBG B;  1DO2 A;  1GO5 A;  2MT6 A;  2JNH A;  3TGD A;  1KYI A;  2CLW B;  4YII U;  2LVN C;  2A4D A;  3BZH A;  1YLA A;  4MDK A;  3F92 A;  1JAS A;  1DO0 A;  1C4Z D;  2PX9 B;  4A4C C;  1YH2 A;  1JBB A;  2BWB A;  3HCU B;  1WHC A;  1J7D B;  5FQ2 A;  1FZY A;  1OQY A;  5AIT D;  2OB4 A;  2PWQ A;  2LTU A;  4ONN A;  5FER B;  2K9D A;  1IM2 A;  2DAK A;  2L4E A;  2CP8 A;  2DEN A;  4P5O G;  3IHP A;  4A49 B;  3E21 A;  1T43 A;  1Y6L A;  4ONL B;  3O2U A;  2CLW A;  2GJD A;  1F4I A;  1S1Q A;  2DAG A;  2EBM A;  2E2C A;  2JUJ A;  2JY8 A;  3FE3 A;  1P3Q Q;  4DHI D;  2QHO B;  4ZNY A;  4NR3 B;  1Y8X A;  2HLW A;  1UZX A;  4Y1L C;  3JW0 A;  5F6U A;  2BEP A;  3H8K A;  1NV8 A;  2DHY A;  1J7D A;  2XWU A;  2MGW A;  3VON B;  1FXT A;  1SG9 A;  3E95 A;  2UCZ A;  3OBX A;  2QGX A;  1M4P A;  4FH1 A;  1ZV1 A;  1Q02 A;  5F6V A;  3WE5 A;  4BVU B;  4LDT C;  1V92 A;  2DNA A;  3LCU A;  3OBQ A;  2Q0V A;  5D1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...