5DFLA

Crystal structure of ube2k~ubiquitin conjugate
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
199
structure length
199
Chain Sequence
AANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAIKLDILRDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLSAMGFDRNAVIVALSSKSWDVETATELLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis of lysine 48 ubiquitin chain synthesis by Ube2K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/signaling protein
molecule keywords Ubiquitin
total genus 68
structure length 199
sequence length 199
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00179 UQ_con Ubiquitin-conjugating enzyme
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 5dflA02
3.10.110.10 Alpha Beta Roll Ubiquitin Conjugating Enzyme Ubiquitin Conjugating Enzyme 5dflA01
1JATB 1T43A 2FO3A 4F1IA 2MROB 1ZMUA 1AYZA 2DAKA 1NV9A 3GLGE 2ESKA 5D0MA 2YHOB 3HCTB 2GMIA 2Z5DA 3E95A 2QSFX 1ZMVA 2CP8A 1TR8A 2GRNA 2ESOA 5F6XA 1HT1E 1M4PA 1QCQA 4ONLA 2MR9A 5AITB 2NVUC 3HCUB 1HJPA 4M1NA 2B3TA 5JNEB 1JATA 1OTRA 2JY7A 2HWJA 5D1LA 1WIVA 2L2DA 3L1YA 2KNAA 1PZVA 2CLWB 2PWQA 1MN3A 3EB6B 2CLWA 2KJHA 2L4EA 1YLAA 3FRIA 2DAGA 2JUJA 1F4IA 3E95C 2Y4WA 4ONMB 3RCZB 2PE6A 3JW0A 4WZ3A 2MT6A 1DV0A 1KPSA 1ZMWA 1OAIA 5FQ2A 2Q0VA 1J7DA 3BBZA 4GEWA 1Z3DA 2JY8A 4NRIA 1Z5SA 3E21A 4LDTC 1VEJA 2OOAA 1ZUOA 2EKEA 1M4QA 1QZEA 2AWFA 2WZJA 3VONB 2GMIB 2ONUA 1I7KA 3FN1B 4JQUA 5AITD 3KPAA 1W4UA 1ZDNA 2CWBA 3EVXA 4ZNYA 4ONNB 4JUEA 2H2YA 1CUKA 5DFLA 1SG9A 1TTEA 4TKPA 2O25A 2G3QA 5D2MA 1J7DB 2JZ1A 3H8KA 1C4ZD 1FBVC 4MDKA 2PX9B 4QPLB 3P9HA 5F6UA 1WR1B 3R3QA 2MJ5B 1Q34A 5AIUB 4YC1A 2DAMA 4II2C 5F6YA 1OKSA 4Y1LC 4S3OA 2LTUA 2EJSA 2GROA 1UZXA 1XXHE 1VEKA 3K9OA 1IM2A 2YB6A 4AUQA 1BVSA 1UKXA 3FSHA 2BEPA 3TGDA 2RRUA 1YH2A 3OJ4A 2Z6PA 3GLFE 3H4JA 2LVOC 4YIIU 4EJEA 2DKLA 1KPPA 4LADA 5AIEB 2DNAA 4P5OG 2LBCA 1IFYA 4DHJC 1VG5A 4ONLB 4HEOA 1Y6LA 2DAEA 3GLIE 2AAKA 5FERB 5EGGA 4Y1LA 3A4SA 2K07A 2EBMA 1A3SA 4R71A 3ZNIC 2EBKA 4L83A 3IECA 1G3IA 3LCUA 2Y9PA 1Y8XA 2R0JA 4V3LA 1R4GA 3LCVB 4Q5HC 2BWEA 2DZLA 3BZHA 4F2LA 2JY6B 2JY5A 3A33A 1PGYA 2DMFA 2YZ0A 1Y8GA 1ZV1A 3WE5A 4Q7JA 3OBUA 2KNZA 3O2UA 1XB2B 4A49B 2K0BX 1WHCA 2Y9MA 3B89A 2EDIA 2A7LA 4DDGA 1EFUB 5F6WA 5KNLC 3UINA 3FRHA 2F4WA 2CYXA 1YRVA 3VONC 4Q5EC 2KNVA 1U9AA 2ESPA 1T6OA 2HAKA 4BWFA 2A4DA 2OXQA 1KYIA 2R0IA 4DDIA 3SY2C 3RZ3A 1YF9A 3E46A 4W5VA 4NRGA 3T6PA 2L4FA 2E2CA 1KPQA 2ZTDA 4ONNA 3OBXA 2OOBA 5D1KA 3L1ZA 2ZTCA 1VQ1A 1ZGUA 2K9DA 4FH1A 5D0KA 1UFZA 4IP3B 3FE3A 1AIPC 2LVAA 2DAYA 2LXPA 2C2VC 2ESQA 1VDLA 2C4PA 1U9BA 2BWBA 2KLYA 5D1MA 2GRQA 4V3KA 3UGBA 1WGNA 1WGLA 3SQVC 4BVUB 4DBGB 4UN2B 2JZ0A 3ONGB 1A5TA 3GLHE 1Q02A 2BF8A 4A4CC 3K9PA 2OB4A 1JR3E 5HPTC 1IXSA 2YBFA 4DS2A 1G41A 1JBBA 3OBSA 1X23A 1HT2E 4ONMA 2C2VB 2OO9A 1WJ7A 1FZYA 3IHPA 2F4ZA 2EKFA 1S1QA 3R42A 4NRGB 3F92A 4DHZF 1NV8A 4AP4B 3JVZA 1FXTA 2H5XA 1GO5A 5IFRA 1WZVA 2AYVA 1JASA 3CEGA 3W31B 2LVNC 2DHYA 5F6VA 2EKKA 1E94E 2MGWA 1DO0A 1C7YA 4NRIB 2DI0A 2DAWA 5F6EA 2GJDA 4A4BC 2KHHA 2XWUA 3ZQSA 2QGXA 3PTFA 2GRRA 1WZWA 3MMPA 2UYZA 4GPRA 4R62A 1J74A 3UIOA 1HQYE 3P9GA 4NR3B 1VEGA 1DO2A 2LVQD 2QNJA 4X57A 2Z6OA 4CCGA 1OQYA 1Z2UA 2HLWA 2JNHA 4G3OA 1G4AE 3UIPA 1V92A 4WP2A 3RPGA 2VRRA 5F6DA 2O25C 4DHID 2DAIA 2FUHA 2UCZA 5JI2E 1P3QQ 2QHOB 3OBQA 2F0RA 2JP7A 2DENA 2LVPC 4NR3A 2DAXA 2GRPA
chains in the Genus database with same CATH superfamily
2O01F 4DV1M 4M9ZA 4M9XA 1JATB 2QPAA 3RGPA 3RCZB 1T43A 3SAUA 3W68A 1AUAA 3GP1A 1I4WA 3U6OA 2CHQA 2FO3A 4FW9A 4F1IA 2MROB 1ZMUA 3VLFB 1AYZA 2DAKA 1IN4A 4LJ6A 1NV9A 3GLGE 1JR3D 4D81A 2ESKA 5D0MA 2QP9X 3HZJA 2YHOB 3HCTB 4IJEA 2GMIA 2Z5DA 1T3TA 4BBAA 3K1JA 3E95A 4I8OA 2QSFX 3I01M 3M7GA 2R18A 3U5ZA 3HJQA 4JI5M 1ZMVA 2CP8A 1TR8A 3A42A 2GRNA 3GQ4A 1MJGM 2FFJA 2DZNB 5C18A 5KPTA 5EJCA 5KQ8A 1R2ZA 2ESOA 5F6XA 2ZBKB 1HT1E 5IZ7D 3W67A 2C96A 4LCBA 3GPXA 1M4PA 1QCQA 4LF8M 4PDIA 4ONLA 2MR9A 5AITB 3J2PB 1E9SA 4AI6A 5H37D 2KXEA 2NVUC 3HCUB 5EXXA 1NVMA 2AHMA 3CGWA 4CIZA 1HJPA 1XXHA 5EQTA 3TE6A 4M1NA 2K47A 3RE8A 2B3TA 3HJSA 4L16A 2BNKA 2KRKA 4GHAA 1JATA 5JNEB 1OTRA 2JY7A 3I4YA 1L2DA 4CGYB 2HWJA 5D1LA 2A5YB 1S3SA 3KP1E 4D80A 5ITUA 2DWLA 2CUZA 1WIVA 2L2DA 3L1YA 1YUBA 3M0EA 1XHBA 2DZOB 1NHWC 1OFHA 4XGIA 3JR5A 1MU5A 1J7KA 2KNAA 1PZVA 2CLWB 2PWQA 5KPZA 4NC6A 1OJLA 1ZQ9A 3FYDA 3QWLA 1MN3A 3EB6B 2P5TA 3L26A 2CLWA 4GKKM 2L4EA 4GC5A 2R44A 3B74A 1YLAA 4M0DA 3UZUA 2KJHA 2R62A 3HKPA 1G8PA 2G5GX 2RGHA 3FRIA 2DAGA 3NWLA 3LQQA 5EP2A 2JUJA 1PJJA 3SC3A 1IXRC 2R46A 3SFZA 4LF4M 1F4IA 2FNAA 2Y4WA 3SBJA 1PM5A 2PE6A 3E95C 4ONMB 4LJ4A 3JW0A 3AOGA 3L29A 4KLNA 4R7GA 2OQ4A 3A45A 4DUZM 4DV6M 3C3EA 2XFTA 4IIWA 3T1YM 4K0KM 2MT6A 4WZ3A 1DV0A 1Q3CA 3B7NA 1QQWA 3CF2A 4LRTA 1KPSA 1ZMWA 3PFIA 3VDUA 3U60B 1OAIA 1IN7A 2ZAOA 2QBYB 1XNQM 2EA0A 4GRIA 1ORYB 2HCBA 5FQ2A 1K3XA 1OAOC 2Q0VA 1J7DA 3HX3A 3THGA 4NL4H 3BBZA 4GEWA 1Z3DA 1N36M 2JY8A 2H1RA 3AJIB 1E32A 4NRIA 1Z5SA 3E21A 2VF7A 4D82A 1VEJA 2OOAA 1HNZM 1ZUOA 4LDTC 2O5RA 1D0LA 1OFIA 1L1TA 2EKEA 3UGJA 3L25A 2W82A 1M4QA 1QZEA 2KDLA 4AG5A 3C58A 3HU3A 2J7NA 2AWFA 4DUYM 2UXDM 1L8QA 4Z8XA 2XLJA 2WZJA 5LMNM 1L2BA 4TUWA 3VONB 2GMIB 1QZMA 3QAUA 2ONUA 1I7KA 3FN1B 3TWLA 4B7GA 4GIPA 4I5SA 4MGZE 4JQUA 1XXHB 4YHHM 5AITD 5DYGA 4KHPM 1I94M 3FUUA 1W4UA 3KPAA 3UMMA 1ZDNA 2LXPA 2CWBA 3EVXA 4MM3B 3A98B 4ONNB 4II7A 4ZNYA 4JUEA 2DXIA 3GLGA 2H2YA 4LJ8A 1CUKA 5DFLA 1SG9A 3KW6A 1TTEA 1TH4A 1GABA 3HHYA 3GLGB 3MHVC 4LFBM 4TKPA 2O25A 3U6DA 2G3QA 5D2MA 4LZZA 1J7DB 4S12A 4G4RA 2Z7JA 4RKUF 3SHGB 3W0FA 2UUCM 3HWSA 2DWNA 4DR6M 2JZ1A 4MH0E 3ZC7B 2UXBM 4GKJM 3H8KA 4LZJA 4Z6YA 4CISA 4AKGA 1C4ZD 2XGNA 1W5SA 1D2NA 3U6EA 2XZFA 2DAYA 1FBVC 3GLFA 4MDKA 1HQCA 1V33A 2PX9B 4QPLB 1QUTA 3P9HA 5F6UA 1WR1B 1Z6TA 2LNHC 2MH8A 2R65A 3TPZA 3R3QA 4ANRA 3PNYA 2FOIC 5IREB 3K2LA 1NJGA 3U6MA 4MGYE 5ITYA 1XNRM 3JAMS 4JI8M 1GLNA 4FCTA 2MJ5B 3HHXA 3U60A 3GQ5A 1D0MA 1Q34A 3NBIA 2KA6B 5AIUB 4X66M 3KOWE 1NO1A 5A2QS 1QAQA 4YC1A 2YNMD 2DAMA 4JI0M 4II2C 3HY5A 4MGKE 2F5PA 5F6YA 2UU9M 1OKSA 4Y1LC 4B3MM 4LJAA 4S3OA 4IJFA 4OVZB 2LTUA 1SXJE 2WSFF 4PCZA 3GLIA 4AKHA 2EJSA 2ZANA 1HR0M 1N78A 2GROA 1SXJC 3SY2C 1UZXA 5EP3A 5FLXS 1XXHE 4L6V6 1EIJA 1TF0B 2KZUA 1TDZA 3FUWA 2RKOA 1R2YA 3WHLA 5IWAM 1Z5AA 4PT5A 4DV5M 3SARA 1VEKA 3K9OA 2FS1A 1G71A 1IM2A 4FVMA 2XFSA 2YB6A 4AUQA 3FTFA 3LW5F 3VKGA 3UK6A 1BVSA 1UKXA 3FSHA 3KVWA 2BEPA 2OPFA 3J7AS 1X37A 2X8AA 3DZDA 2WSEF 3GRRA 5EXSA 3AL0C 1DGFA 4B08A 2RRUA 1PRBA 3LVWA 1YH2A 3OJ4A 2Z6PA 3TGDA 2CV2A 3GLFE 3H4JA 3VFDA 4DR2M 2LVOC 3I4VA 3L28A 1JQJC 2Y0QA 4JV5M 3FUVA 4YIIU 2I7PA 4EJEA 3W0LB 2HKJA 2DKLA 1KPPA 4FCVA 4LADA 5AIEB 2DNAA 2KEBA 3Q8XA 1TDHA 3IG5A 4JXJA 2DVWB 4P5OG 4OVZA 2LBCA 3ILKA 5ITXE 1IFYA 2I7NA 3BOSA 4DHJC 1GJSA 1VG5A 2V1UA 4ONLB 1JR3A 1HNWM 1PJSA 4HEOA 2F4VM 4P17A 2DAEA 1SXJA 3GLIE 3KOZE 1G59A 1Y6LA 2AAKA 3KS4A 4M0WA 5FERB 1Z5CA 3V76A 4FD2A 2QQ8A 1SXJB 2R45A 3MK6A 4Y1LA 2M5ZA 5EGGA 2DWZB 2K07A 3A4SA 4G4QA 3AKZA 4GITA 4YY3M 1A3SA 2EBMA 1QDTA 4QHSA 4KT0F 4R71A 3DA1A 3GRVA 1K82A 2EBKA 2YR0A 7CATA 4B7HA 4RNAA 4L83A 4DR7M 3IECA 4ZPXA 4JI4M 1G3IA 2KW0A 2D7HA 3LCUA 2Z8YM 1IBLM 3CF0A 2Y9PA 1Y8XA 2R0JA 4V3LA 2R4EA 1R4GA 4FWGA 3LCVB 3SHFA 3QYEA 4JN6A 1L2CA 3M6AA 4WW0A 2BWEA 3D8LA 4Q5HC 1DGBA 2DZLA 3BZHA 3ZH9B 4F2LA 5FTKA 1ZAEA 2JY6B 5L8RF 3ZQJA 2JY5A 4LGMA 4EIWA 4DV3M 3A33A 1PGYA 4DV4M 4NSRA 5BR8M 4LF7M 4IBCA 2DMFA 3E9SA 2YZ0A 2XSZD 1Y8GA 4RF0A 2CFOA 2Z4SA 3MJ5A 1ZV1A 5BPVA 3WE5A 3FKEA 4Q7JA 3OBUA 1RU3A 2KNZA 4W5WA 3J80S 1JB0F 3RFWA 3O2UA 4IBKA 1XB2B 5LMUM 3C9PA 3KSJA 4LF6M 1YSYA 1D0KA 4A49B 4NOOB 2K0BX 2LHCA 2X4AA 2NQ8C 3U61A 2L7HA 1WHCA 4LGYA 2Y9MA 3B89A 1IBKM 2N35A 1IN6A 1IY2A 3GLHB 2EDIA 4AG6A 2A7LA 3J81S 4B3SM 4JI3M 2JWSA 4IBGA 1PJQA 4DDGA 3H4MA 3SATA 1VDDA 3AFHA 4DR1M 4JI1M 4NRWA 1EFUB 1N77A 2KRUA 5ITRA 1XC8A 1K3WA 2EO2A 4FWDA 3TWMA 5F6WA 3UINA 5KNLC 3HU1A 3FRHA 1IQPA 2F4WA 2ZM6M 2F5SA 2CYXA 1NNUC 2VQFM 1YRVA 3VONC 4Q5EC 2KNVA 1NY5A 1U9AA 2ESPA 1T6OA 3SAVA 2HAKA 5EP4A 3E4RA 4L8RC 1GVNA 3KSXA 3GO8A 2A4DA 2OXQA 4BWFA 2R0IA 1KYIA 4DDIA 1N75A 1J5EM 3BXWA 1PJTA 4NRVA 3L27A 3C3DA 3K8ZA 5IT9S 4GHLA 2C99A 4XBOA 3TL4X 3UJNA 3T1HM 3FTEA 3RZ3A 4MGIE 2C9CA 1NJFA 1YF9A 3SMPA 3A46A 3E46A 1QAOA 4W5VA 4NRGA 3T6PA 2L4FA 4REZA 2C5RA 4X64M 2LH0A 2E2CA 1SXJD 1KPQA 3GQ3A 2QBYA 3DOAA 4IBFA 3HGIA 1Z5BA 5E26A 3TQSA 2ZTDA 2Z3XA 2Y21A 3JR4A 4B3TM 3KFUG 4B7FA 5KQDA 3GRYA 4G4NA 3OBXA 2OOBA 1QAMA 5D1KA 2UUAM 1W5TA 3L1ZA 3ZNIC 3GLIB 3HHZA 4DV0M 2CV1A 2ZTCA 1XWIA 1VQ1A 3B9PA 1H6UA 2K9DA 4IBBA 1ZGUA 4FH1A 1UFZA 4IP3B 5D0KA 2QCUA 2BJWA 3FE3A 2XF3A 4XK8F 4X65M 5F3WA 1AIPC 2C9OA 3U6CA 2Q2EB 3GPUA 3U6LA 2JA2A 1R5LA 1EE8A 2LVAA 1N34M 4IBDA 4PDGA 4MGHA 3I04M 4G6ZA 4KODA 5FTLA 4HL4A 1OIZA 1DGHB 1LTMA 2C2VC 2ESQA 1VDLA 3U6PA 3VKHA 2C4PA 1U9BA 1DGHA 2BWBA 2KLYA 5D1MA 2E5LM 2APLA 3FTCA 2GRQA 2K6BA 4V3KA 2VF8A 3KXEC 2HL7A 2Y20A 1KFVA 2DWMA 1GL6A 2L09A 3KP0E 4LF5M 4L15A 3HJ8A 5KPRA 2XSZA 1WXQA 3UGBA 3AOEA 4WURA 3R9XB 2R6FA 1WGNA 4A3VB 3B7ZA 1YE9A 3ZCBB 1WGLA 3SQVC 4MB7A 3VK7A 4AZFA 4LFAM 5ITQA 4DBGB 4BVUB 4IBIA 4DV7M 2R4JA 2XH9A 2JZ0A 4UN2B 4JI6M 4LFCM 4DR3M 1IBMM 4QNRA 2EUCA 3ONGB 2WSCF 1A5TA 4L78A 3GLHE 3HU2A 2CHGA 5KO3A 4LG2A 1Q02A 2BF8A 2F5OA 4LJ9A 4A4CC 3K9PA 4AW4A 3L2AA 1NNJA 2OB4A 2ZAMA 3KOYE 2Y0TA 4GH9A 4AKIA 1JR3E 5FTJA 4JI7M 5HPTC 2X49A 1IXSA 5EXTA 4G4OA 2BJVA 2GQFA 2V1CA 3LVVA 5EP1A 2XZUA 1G41A 1JBBA 2YBFA 3OBSA 4DS2A 2C98A 1X23A 1HT2E 3GLFB 4ONMA 2C2VB 4HLQA 2OO9A 1WJ7A 4QOZC 3IHPA 4AQYM 1FZYA 4I4LA 3GPPA 1FNNA 2F4ZA 5FTMA 3KOXE 4DR5M 2CE7A 2CEAA 2M60A 3EIHA 2EKFA 3CF6E 4X62M 1S1QA 1IN8A 5EXPA 4OU7A 3R42A 5C1BA 4NRGB 4QNMA 3F92A 3QYBA 1J09A 8CATA 3PXGA 3U6SA 2FH0A 3I51A 3GPYA 4DHZF 1IN5A 1NV8A 2LXEA 5E6JA 3SAWA 1XMQM 4AP4B 3JVZA 2J7OA 2GNOA 4QHTA 1IY0A 4BLCA 1FXTA 2H5XA 3D8BA 2RGOA 2LHGA 3KDSE 3LMMA 3VDPA 1NHGC 2HHHM 1GO5A 3FYCA 3U61B 5IFRA 1QDRA 5DNYA 4OX9M 1WZVA 1IXZA 4LJ5A 3SYKA 2XEPA 5FSWA 2AYVA 2G8LA 1JASA 3PNVA 1N32M 3CEGA 4RF1A 3W31B 2LVNC 3AV0A 4LJ7A 1PJIA 4P16A 4DR4M 2DHYA 2D7GA 1Z59A 5F6VA 2JXNA 4L4UA 1DGGA 3LQRA 2EKKA 1E94E 2QENA 3SMSA 4GC9A 5ITXA 3U6QA 2QZ4A 4FWHA 4OW0A 2MGWA 1DO0A 1C7YA 4KO8A 4NRIB 1QANA 2DI0A 4DV2M 3K92A 1NY6A 3T38A 2UUBM 3J27B 2DAWA 4R3DA 5F6EA 1KSFX 4NXNM 3VK8A 2GJDA 1Q39A 3IG8A 4I81A 4LRSA 4A4BC 4LY6A 2CHVA 2J5YA 3FD9A 1N33M 3CTWB 1UM8A 2KHHA 2XWUA 3ZQSA 2D7EA 3B7QA 1OIPA 1L1ZA 3TWKA 4GMQA 2QGXA 1MX0A 1HNXM 2GRRA 3PTFA 3HHWA 1WZWA 2VDBB 3MMPA 3GRUA 2UYZA 1E9RA 4GPRA 4R62A 3SASA 3FUXA 4B3RM 5DYIA 2VQEM 1J74A 1QYRA 1LV7A 4JYAM 1HQYE 3RGSA 2F5NA 3UIOA 3P9GA 1V34A 4NR3B 1VEGA 2FE8A 1GKIA 4IBEA 2KZSA 1DO2A 2LVQD 2QNJA 2V6ZM 3NBXX 4PD2A 2Z6OA 4X57A 1GJTA 4Y28F 2YFQA 1XMOM 4NXMM 4CCGA 1OQYA 4CHTB 1Z2UA 5FTNA 3KS8A 2HLWA 2DHRA 5ITTA 1TH2A 1QVRA 2ERCA 3SYLA 2CV0A 3FTDA 2JNHA 3DFZA 3GLHA 4G3OA 4NSOB 3U5ZB 3J7BA 1G4AE 4IBJA 3UIPA 1V92A 3Q8GA 4WP2A 3RPGA 2YQZA 1C1KA 1R6BX 3OTOM 4JI2M 2VRRA 1NSFA 5F6DA 2F5QA 2O25C 4DHID 2Z4RA 2DAIA 1Q3BA 1GL7A 3R8FA 2UXCM 2FUHA 3FUTA 4LF9M 1TH3A 3T15A 4QOSA 1R7RA 2L6OA 4CJ6A 2UCZA 5JI2E 3AOEC 1QUSA 4ITQA 1P3QQ 2QHOB 5GKNA 3OBQA 2L7IA 3EIEA 1FJGM 2F0RA 2JP7A 2DENA 5JI3E 1IY1A 3WHKA 2LVPC 4M9SA 4NR3A 2DAXA 1TGUA 1IXSB 2CRUA 2LWXA 4FCWA 4BB9A 2VIIA 2GRPA 4ONNA 3PVSA
chains in the Genus database with same CATH topology
1JATB 1T43A 2FO3A 4F1IA 2MROB 1ZMUA 1AYZA 2DAKA 1NV9A 3GLGE 2ESKA 5D0MA 2YHOB 3HCTB 2GMIA 2Z5DA 3E95A 2QSFX 1ZMVA 2CP8A 1TR8A 2GRNA 2ESOA 5F6XA 1HT1E 1M4PA 1QCQA 4ONLA 2MR9A 5AITB 2NVUC 3HCUB 1HJPA 4M1NA 2B3TA 5JNEB 1JATA 1OTRA 2JY7A 2HWJA 5D1LA 1WIVA 2L2DA 3L1YA 2KNAA 1PZVA 2CLWB 2PWQA 1MN3A 3EB6B 2CLWA 2KJHA 2L4EA 1YLAA 3FRIA 2DAGA 2JUJA 1F4IA 3E95C 2Y4WA 4ONMB 3RCZB 2PE6A 3JW0A 4WZ3A 2MT6A 1DV0A 1KPSA 1ZMWA 1OAIA 5FQ2A 2Q0VA 1J7DA 3BBZA 4GEWA 1Z3DA 2JY8A 4NRIA 1Z5SA 3E21A 4LDTC 1VEJA 2OOAA 1ZUOA 2EKEA 1M4QA 1QZEA 2AWFA 2WZJA 3VONB 2GMIB 2ONUA 1I7KA 3FN1B 4JQUA 5AITD 3KPAA 1W4UA 1ZDNA 2CWBA 3EVXA 4ZNYA 4ONNB 4JUEA 2H2YA 1CUKA 5DFLA 1SG9A 1TTEA 4TKPA 2O25A 2G3QA 5D2MA 1J7DB 2JZ1A 3H8KA 1C4ZD 1FBVC 4MDKA 2PX9B 4QPLB 3P9HA 5F6UA 1WR1B 3R3QA 2MJ5B 1Q34A 5AIUB 4YC1A 2DAMA 4II2C 5F6YA 1OKSA 4Y1LC 4S3OA 2LTUA 2EJSA 2GROA 1UZXA 1XXHE 1VEKA 3K9OA 1IM2A 2YB6A 4AUQA 1BVSA 1UKXA 3FSHA 2BEPA 3TGDA 2RRUA 1YH2A 3OJ4A 2Z6PA 3GLFE 3H4JA 2LVOC 4YIIU 4EJEA 2DKLA 1KPPA 4LADA 5AIEB 2DNAA 4P5OG 2LBCA 1IFYA 4DHJC 1VG5A 4ONLB 4HEOA 1Y6LA 2DAEA 3GLIE 2AAKA 5FERB 5EGGA 4Y1LA 3A4SA 2K07A 2EBMA 1A3SA 4R71A 3ZNIC 2EBKA 4L83A 3IECA 1G3IA 3LCUA 2Y9PA 1Y8XA 2R0JA 4V3LA 1R4GA 3LCVB 4Q5HC 2BWEA 2DZLA 3BZHA 4F2LA 2JY6B 2JY5A 3A33A 1PGYA 2DMFA 2YZ0A 1Y8GA 1ZV1A 3WE5A 4Q7JA 3OBUA 2KNZA 3O2UA 1XB2B 4A49B 2K0BX 1WHCA 2Y9MA 3B89A 2EDIA 2A7LA 4DDGA 1EFUB 5F6WA 5KNLC 3UINA 3FRHA 2F4WA 2CYXA 1YRVA 3VONC 4Q5EC 2KNVA 1U9AA 2ESPA 1T6OA 2HAKA 4BWFA 2A4DA 2OXQA 1KYIA 2R0IA 4DDIA 3SY2C 3RZ3A 1YF9A 3E46A 4W5VA 4NRGA 3T6PA 2L4FA 2E2CA 1KPQA 2ZTDA 4ONNA 3OBXA 2OOBA 5D1KA 3L1ZA 2ZTCA 1VQ1A 1ZGUA 2K9DA 4FH1A 5D0KA 1UFZA 4IP3B 3FE3A 1AIPC 2LVAA 2DAYA 2LXPA 2C2VC 2ESQA 1VDLA 2C4PA 1U9BA 2BWBA 2KLYA 5D1MA 2GRQA 4V3KA 3UGBA 1WGNA 1WGLA 3SQVC 4BVUB 4DBGB 4UN2B 2JZ0A 3ONGB 1A5TA 3GLHE 1Q02A 2BF8A 4A4CC 3K9PA 2OB4A 1JR3E 5HPTC 1IXSA 2YBFA 4DS2A 1G41A 1JBBA 3OBSA 1X23A 1HT2E 4ONMA 2C2VB 2OO9A 1WJ7A 1FZYA 3IHPA 2F4ZA 2EKFA 1S1QA 3R42A 4NRGB 3F92A 4DHZF 1NV8A 4AP4B 3JVZA 1FXTA 2H5XA 1GO5A 5IFRA 1WZVA 2AYVA 1JASA 3CEGA 3W31B 2LVNC 2DHYA 5F6VA 2EKKA 1E94E 2MGWA 1DO0A 1C7YA 4NRIB 2DI0A 2DAWA 5F6EA 2GJDA 4A4BC 2KHHA 2XWUA 3ZQSA 2QGXA 3PTFA 2GRRA 1WZWA 3MMPA 2UYZA 4GPRA 4R62A 1J74A 3UIOA 1HQYE 3P9GA 4NR3B 1VEGA 1DO2A 2LVQD 2QNJA 4X57A 2Z6OA 4CCGA 1OQYA 1Z2UA 2HLWA 2JNHA 4G3OA 1G4AE 3UIPA 1V92A 4WP2A 3RPGA 2VRRA 5F6DA 2O25C 4DHID 2DAIA 2FUHA 2UCZA 5JI2E 1P3QQ 2QHOB 3OBQA 2F0RA 2JP7A 2DENA 2LVPC 4NR3A 2DAXA 2GRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAT B;  1T43 A;  2FO3 A;  4F1I A;  2MRO B;  1ZMU A;  1AYZ A;  2DAK A;  1NV9 A;  3GLG E;  2ESK A;  5D0M A;  2YHO B;  3HCT B;  2GMI A;  2Z5D A;  3E95 A;  2QSF X;  1ZMV A;  2CP8 A;  1TR8 A;  2GRN A;  2ESO A;  5F6X A;  1HT1 E;  1M4P A;  1QCQ A;  4ONL A;  2MR9 A;  5AIT B;  2NVU C;  3HCU B;  1HJP A;  4M1N A;  2B3T A;  5JNE B;  1JAT A;  1OTR A;  2JY7 A;  2HWJ A;  5D1L A;  1WIV A;  2L2D A;  3L1Y A;  2KNA A;  1PZV A;  2CLW B;  2PWQ A;  1MN3 A;  3EB6 B;  2CLW A;  2KJH A;  2L4E A;  1YLA A;  3FRI A;  2DAG A;  2JUJ A;  1F4I A;  3E95 C;  2Y4W A;  4ONM B;  3RCZ B;  2PE6 A;  3JW0 A;  4WZ3 A;  2MT6 A;  1DV0 A;  1KPS A;  1ZMW A;  1OAI A;  5FQ2 A;  2Q0V A;  1J7D A;  3BBZ A;  4GEW A;  1Z3D A;  2JY8 A;  4NRI A;  1Z5S A;  3E21 A;  4LDT C;  1VEJ A;  2OOA A;  1ZUO A;  2EKE A;  1M4Q A;  1QZE A;  2AWF A;  2WZJ A;  3VON B;  2GMI B;  2ONU A;  1I7K A;  3FN1 B;  4JQU A;  5AIT D;  3KPA A;  1W4U A;  1ZDN A;  2CWB A;  3EVX A;  4ZNY A;  4ONN B;  4JUE A;  2H2Y A;  1CUK A;  5DFL A;  1SG9 A;  1TTE A;  4TKP A;  2O25 A;  2G3Q A;  5D2M A;  1J7D B;  2JZ1 A;  3H8K A;  1C4Z D;  1FBV C;  4MDK A;  2PX9 B;  4QPL B;  3P9H A;  5F6U A;  1WR1 B;  3R3Q A;  2MJ5 B;  1Q34 A;  5AIU B;  4YC1 A;  2DAM A;  4II2 C;  5F6Y A;  1OKS A;  4Y1L C;  4S3O A;  2LTU A;  2EJS A;  2GRO A;  1UZX A;  1XXH E;  1VEK A;  3K9O A;  1IM2 A;  2YB6 A;  4AUQ A;  1BVS A;  1UKX A;  3FSH A;  2BEP A;  3TGD A;  2RRU A;  1YH2 A;  3OJ4 A;  2Z6P A;  3GLF E;  3H4J A;  2LVO C;  4YII U;  4EJE A;  2DKL A;  1KPP A;  4LAD A;  5AIE B;  2DNA A;  4P5O G;  2LBC A;  1IFY A;  4DHJ C;  1VG5 A;  4ONL B;  4HEO A;  1Y6L A;  2DAE A;  3GLI E;  2AAK A;  5FER B;  5EGG A;  4Y1L A;  3A4S A;  2K07 A;  2EBM A;  1A3S A;  4R71 A;  3ZNI C;  2EBK A;  4L83 A;  3IEC A;  1G3I A;  3LCU A;  2Y9P A;  1Y8X A;  2R0J A;  4V3L A;  1R4G A;  3LCV B;  4Q5H C;  2BWE A;  2DZL A;  3BZH A;  4F2L A;  2JY6 B;  2JY5 A;  3A33 A;  1PGY A;  2DMF A;  2YZ0 A;  1Y8G A;  1ZV1 A;  3WE5 A;  4Q7J A;  3OBU A;  2KNZ A;  3O2U A;  1XB2 B;  4A49 B;  2K0B X;  1WHC A;  2Y9M A;  3B89 A;  2EDI A;  2A7L A;  4DDG A;  1EFU B;  5F6W A;  5KNL C;  3UIN A;  3FRH A;  2F4W A;  2CYX A;  1YRV A;  3VON C;  4Q5E C;  2KNV A;  1U9A A;  2ESP A;  1T6O A;  2HAK A;  4BWF A;  2A4D A;  2OXQ A;  1KYI A;  2R0I A;  4DDI A;  3SY2 C;  3RZ3 A;  1YF9 A;  3E46 A;  4W5V A;  4NRG A;  3T6P A;  2L4F A;  2E2C A;  1KPQ A;  2ZTD A;  4ONN A;  3OBX A;  2OOB A;  5D1K A;  3L1Z A;  2ZTC A;  1VQ1 A;  1ZGU A;  2K9D A;  4FH1 A;  5D0K A;  1UFZ A;  4IP3 B;  3FE3 A;  1AIP C;  2LVA A;  2DAY A;  2LXP A;  2C2V C;  2ESQ A;  1VDL A;  2C4P A;  1U9B A;  2BWB A;  2KLY A;  5D1M A;  2GRQ A;  4V3K A;  3UGB A;  1WGN A;  1WGL A;  3SQV C;  4BVU B;  4DBG B;  4UN2 B;  2JZ0 A;  3ONG B;  1A5T A;  3GLH E;  1Q02 A;  2BF8 A;  4A4C C;  3K9P A;  2OB4 A;  1JR3 E;  5HPT C;  1IXS A;  2YBF A;  4DS2 A;  1G41 A;  1JBB A;  3OBS A;  1X23 A;  1HT2 E;  4ONM A;  2C2V B;  2OO9 A;  1WJ7 A;  1FZY A;  3IHP A;  2F4Z A;  2EKF A;  1S1Q A;  3R42 A;  4NRG B;  3F92 A;  4DHZ F;  1NV8 A;  4AP4 B;  3JVZ A;  1FXT A;  2H5X A;  1GO5 A;  5IFR A;  1WZV A;  2AYV A;  1JAS A;  3CEG A;  3W31 B;  2LVN C;  2DHY A;  5F6V A;  2EKK A;  1E94 E;  2MGW A;  1DO0 A;  1C7Y A;  4NRI B;  2DI0 A;  2DAW A;  5F6E A;  2GJD A;  4A4B C;  2KHH A;  2XWU A;  3ZQS A;  2QGX A;  3PTF A;  2GRR A;  1WZW A;  3MMP A;  2UYZ A;  4GPR A;  4R62 A;  1J74 A;  3UIO A;  1HQY E;  3P9G A;  4NR3 B;  1VEG A;  1DO2 A;  2LVQ D;  2QNJ A;  4X57 A;  2Z6O A;  4CCG A;  1OQY A;  1Z2U A;  2HLW A;  2JNH A;  4G3O A;  1G4A E;  3UIP A;  1V92 A;  4WP2 A;  3RPG A;  2VRR A;  5F6D A;  2O25 C;  4DHI D;  2DAI A;  2FUH A;  2UCZ A;  5JI2 E;  1P3Q Q;  2QHO B;  3OBQ A;  2F0R A;  2JP7 A;  2DEN A;  2LVP C;  4NR3 A;  2DAX A;  2GRP A; 
#chains in the Genus database with same CATH topology
 2O01 F;  4DV1 M;  4M9Z A;  4M9X A;  1JAT B;  2QPA A;  3RGP A;  3RCZ B;  1T43 A;  3SAU A;  3W68 A;  1AUA A;  3GP1 A;  1I4W A;  3U6O A;  2CHQ A;  2FO3 A;  4FW9 A;  4F1I A;  2MRO B;  1ZMU A;  3VLF B;  1AYZ A;  2DAK A;  1IN4 A;  4LJ6 A;  1NV9 A;  3GLG E;  1JR3 D;  4D81 A;  2ESK A;  5D0M A;  2QP9 X;  3HZJ A;  2YHO B;  3HCT B;  4IJE A;  2GMI A;  2Z5D A;  1T3T A;  4BBA A;  3K1J A;  3E95 A;  4I8O A;  2QSF X;  3I01 M;  3M7G A;  2R18 A;  3U5Z A;  3HJQ A;  4JI5 M;  1ZMV A;  2CP8 A;  1TR8 A;  3A42 A;  2GRN A;  3GQ4 A;  1MJG M;  2FFJ A;  2DZN B;  5C18 A;  5KPT A;  5EJC A;  5KQ8 A;  1R2Z A;  2ESO A;  5F6X A;  2ZBK B;  1HT1 E;  5IZ7 D;  3W67 A;  2C96 A;  4LCB A;  3GPX A;  1M4P A;  1QCQ A;  4LF8 M;  4PDI A;  4ONL A;  2MR9 A;  5AIT B;  3J2P B;  1E9S A;  4AI6 A;  5H37 D;  2KXE A;  2NVU C;  3HCU B;  5EXX A;  1NVM A;  2AHM A;  3CGW A;  4CIZ A;  1HJP A;  1XXH A;  5EQT A;  3TE6 A;  4M1N A;  2K47 A;  3RE8 A;  2B3T A;  3HJS A;  4L16 A;  2BNK A;  2KRK A;  4GHA A;  1JAT A;  5JNE B;  1OTR A;  2JY7 A;  3I4Y A;  1L2D A;  4CGY B;  2HWJ A;  5D1L A;  2A5Y B;  1S3S A;  3KP1 E;  4D80 A;  5ITU A;  2DWL A;  2CUZ A;  1WIV A;  2L2D A;  3L1Y A;  1YUB A;  3M0E A;  1XHB A;  2DZO B;  1NHW C;  1OFH A;  4XGI A;  3JR5 A;  1MU5 A;  1J7K A;  2KNA A;  1PZV A;  2CLW B;  2PWQ A;  5KPZ A;  4NC6 A;  1OJL A;  1ZQ9 A;  3FYD A;  3QWL A;  1MN3 A;  3EB6 B;  2P5T A;  3L26 A;  2CLW A;  4GKK M;  2L4E A;  4GC5 A;  2R44 A;  3B74 A;  1YLA A;  4M0D A;  3UZU A;  2KJH A;  2R62 A;  3HKP A;  1G8P A;  2G5G X;  2RGH A;  3FRI A;  2DAG A;  3NWL A;  3LQQ A;  5EP2 A;  2JUJ A;  1PJJ A;  3SC3 A;  1IXR C;  2R46 A;  3SFZ A;  4LF4 M;  1F4I A;  2FNA A;  2Y4W A;  3SBJ A;  1PM5 A;  2PE6 A;  3E95 C;  4ONM B;  4LJ4 A;  3JW0 A;  3AOG A;  3L29 A;  4KLN A;  4R7G A;  2OQ4 A;  3A45 A;  4DUZ M;  4DV6 M;  3C3E A;  2XFT A;  4IIW A;  3T1Y M;  4K0K M;  2MT6 A;  4WZ3 A;  1DV0 A;  1Q3C A;  3B7N A;  1QQW A;  3CF2 A;  4LRT A;  1KPS A;  1ZMW A;  3PFI A;  3VDU A;  3U60 B;  1OAI A;  1IN7 A;  2ZAO A;  2QBY B;  1XNQ M;  2EA0 A;  4GRI A;  1ORY B;  2HCB A;  5FQ2 A;  1K3X A;  1OAO C;  2Q0V A;  1J7D A;  3HX3 A;  3THG A;  4NL4 H;  3BBZ A;  4GEW A;  1Z3D A;  1N36 M;  2JY8 A;  2H1R A;  3AJI B;  1E32 A;  4NRI A;  1Z5S A;  3E21 A;  2VF7 A;  4D82 A;  1VEJ A;  2OOA A;  1HNZ M;  1ZUO A;  4LDT C;  2O5R A;  1D0L A;  1OFI A;  1L1T A;  2EKE A;  3UGJ A;  3L25 A;  2W82 A;  1M4Q A;  1QZE A;  2KDL A;  4AG5 A;  3C58 A;  3HU3 A;  2J7N A;  2AWF A;  4DUY M;  2UXD M;  1L8Q A;  4Z8X A;  2XLJ A;  2WZJ A;  5LMN M;  1L2B A;  4TUW A;  3VON B;  2GMI B;  1QZM A;  3QAU A;  2ONU A;  1I7K A;  3FN1 B;  3TWL A;  4B7G A;  4GIP A;  4I5S A;  4MGZ E;  4JQU A;  1XXH B;  4YHH M;  5AIT D;  5DYG A;  4KHP M;  1I94 M;  3FUU A;  1W4U A;  3KPA A;  3UMM A;  1ZDN A;  2LXP A;  2CWB A;  3EVX A;  4MM3 B;  3A98 B;  4ONN B;  4II7 A;  4ZNY A;  4JUE A;  2DXI A;  3GLG A;  2H2Y A;  4LJ8 A;  1CUK A;  5DFL A;  1SG9 A;  3KW6 A;  1TTE A;  1TH4 A;  1GAB A;  3HHY A;  3GLG B;  3MHV C;  4LFB M;  4TKP A;  2O25 A;  3U6D A;  2G3Q A;  5D2M A;  4LZZ A;  1J7D B;  4S12 A;  4G4R A;  2Z7J A;  4RKU F;  3SHG B;  3W0F A;  2UUC M;  3HWS A;  2DWN A;  4DR6 M;  2JZ1 A;  4MH0 E;  3ZC7 B;  2UXB M;  4GKJ M;  3H8K A;  4LZJ A;  4Z6Y A;  4CIS A;  4AKG A;  1C4Z D;  2XGN A;  1W5S A;  1D2N A;  3U6E A;  2XZF A;  2DAY A;  1FBV C;  3GLF A;  4MDK A;  1HQC A;  1V33 A;  2PX9 B;  4QPL B;  1QUT A;  3P9H A;  5F6U A;  1WR1 B;  1Z6T A;  2LNH C;  2MH8 A;  2R65 A;  3TPZ A;  3R3Q A;  4ANR A;  3PNY A;  2FOI C;  5IRE B;  3K2L A;  1NJG A;  3U6M A;  4MGY E;  5ITY A;  1XNR M;  3JAM S;  4JI8 M;  1GLN A;  4FCT A;  2MJ5 B;  3HHX A;  3U60 A;  3GQ5 A;  1D0M A;  1Q34 A;  3NBI A;  2KA6 B;  5AIU B;  4X66 M;  3KOW E;  1NO1 A;  5A2Q S;  1QAQ A;  4YC1 A;  2YNM D;  2DAM A;  4JI0 M;  4II2 C;  3HY5 A;  4MGK E;  2F5P A;  5F6Y A;  2UU9 M;  1OKS A;  4Y1L C;  4B3M M;  4LJA A;  4S3O A;  4IJF A;  4OVZ B;  2LTU A;  1SXJ E;  2WSF F;  4PCZ A;  3GLI A;  4AKH A;  2EJS A;  2ZAN A;  1HR0 M;  1N78 A;  2GRO A;  1SXJ C;  3SY2 C;  1UZX A;  5EP3 A;  5FLX S;  1XXH E;  4L6V 6;  1EIJ A;  1TF0 B;  2KZU A;  1TDZ A;  3FUW A;  2RKO A;  1R2Y A;  3WHL A;  5IWA M;  1Z5A A;  4PT5 A;  4DV5 M;  3SAR A;  1VEK A;  3K9O A;  2FS1 A;  1G71 A;  1IM2 A;  4FVM A;  2XFS A;  2YB6 A;  4AUQ A;  3FTF A;  3LW5 F;  3VKG A;  3UK6 A;  1BVS A;  1UKX A;  3FSH A;  3KVW A;  2BEP A;  2OPF A;  3J7A S;  1X37 A;  2X8A A;  3DZD A;  2WSE F;  3GRR A;  5EXS A;  3AL0 C;  1DGF A;  4B08 A;  2RRU A;  1PRB A;  3LVW A;  1YH2 A;  3OJ4 A;  2Z6P A;  3TGD A;  2CV2 A;  3GLF E;  3H4J A;  3VFD A;  4DR2 M;  2LVO C;  3I4V A;  3L28 A;  1JQJ C;  2Y0Q A;  4JV5 M;  3FUV A;  4YII U;  2I7P A;  4EJE A;  3W0L B;  2HKJ A;  2DKL A;  1KPP A;  4FCV A;  4LAD A;  5AIE B;  2DNA A;  2KEB A;  3Q8X A;  1TDH A;  3IG5 A;  4JXJ A;  2DVW B;  4P5O G;  4OVZ A;  2LBC A;  3ILK A;  5ITX E;  1IFY A;  2I7N A;  3BOS A;  4DHJ C;  1GJS A;  1VG5 A;  2V1U A;  4ONL B;  1JR3 A;  1HNW M;  1PJS A;  4HEO A;  2F4V M;  4P17 A;  2DAE A;  1SXJ A;  3GLI E;  3KOZ E;  1G59 A;  1Y6L A;  2AAK A;  3KS4 A;  4M0W A;  5FER B;  1Z5C A;  3V76 A;  4FD2 A;  2QQ8 A;  1SXJ B;  2R45 A;  3MK6 A;  4Y1L A;  2M5Z A;  5EGG A;  2DWZ B;  2K07 A;  3A4S A;  4G4Q A;  3AKZ A;  4GIT A;  4YY3 M;  1A3S A;  2EBM A;  1QDT A;  4QHS A;  4KT0 F;  4R71 A;  3DA1 A;  3GRV A;  1K82 A;  2EBK A;  2YR0 A;  7CAT A;  4B7H A;  4RNA A;  4L83 A;  4DR7 M;  3IEC A;  4ZPX A;  4JI4 M;  1G3I A;  2KW0 A;  2D7H A;  3LCU A;  2Z8Y M;  1IBL M;  3CF0 A;  2Y9P A;  1Y8X A;  2R0J A;  4V3L A;  2R4E A;  1R4G A;  4FWG A;  3LCV B;  3SHF A;  3QYE A;  4JN6 A;  1L2C A;  3M6A A;  4WW0 A;  2BWE A;  3D8L A;  4Q5H C;  1DGB A;  2DZL A;  3BZH A;  3ZH9 B;  4F2L A;  5FTK A;  1ZAE A;  2JY6 B;  5L8R F;  3ZQJ A;  2JY5 A;  4LGM A;  4EIW A;  4DV3 M;  3A33 A;  1PGY A;  4DV4 M;  4NSR A;  5BR8 M;  4LF7 M;  4IBC A;  2DMF A;  3E9S A;  2YZ0 A;  2XSZ D;  1Y8G A;  4RF0 A;  2CFO A;  2Z4S A;  3MJ5 A;  1ZV1 A;  5BPV A;  3WE5 A;  3FKE A;  4Q7J A;  3OBU A;  1RU3 A;  2KNZ A;  4W5W A;  3J80 S;  1JB0 F;  3RFW A;  3O2U A;  4IBK A;  1XB2 B;  5LMU M;  3C9P A;  3KSJ A;  4LF6 M;  1YSY A;  1D0K A;  4A49 B;  4NOO B;  2K0B X;  2LHC A;  2X4A A;  2NQ8 C;  3U61 A;  2L7H A;  1WHC A;  4LGY A;  2Y9M A;  3B89 A;  1IBK M;  2N35 A;  1IN6 A;  1IY2 A;  3GLH B;  2EDI A;  4AG6 A;  2A7L A;  3J81 S;  4B3S M;  4JI3 M;  2JWS A;  4IBG A;  1PJQ A;  4DDG A;  3H4M A;  3SAT A;  1VDD A;  3AFH A;  4DR1 M;  4JI1 M;  4NRW A;  1EFU B;  1N77 A;  2KRU A;  5ITR A;  1XC8 A;  1K3W A;  2EO2 A;  4FWD A;  3TWM A;  5F6W A;  3UIN A;  5KNL C;  3HU1 A;  3FRH A;  1IQP A;  2F4W A;  2ZM6 M;  2F5S A;  2CYX A;  1NNU C;  2VQF M;  1YRV A;  3VON C;  4Q5E C;  2KNV A;  1NY5 A;  1U9A A;  2ESP A;  1T6O A;  3SAV A;  2HAK A;  5EP4 A;  3E4R A;  4L8R C;  1GVN A;  3KSX A;  3GO8 A;  2A4D A;  2OXQ A;  4BWF A;  2R0I A;  1KYI A;  4DDI A;  1N75 A;  1J5E M;  3BXW A;  1PJT A;  4NRV A;  3L27 A;  3C3D A;  3K8Z A;  5IT9 S;  4GHL A;  2C99 A;  4XBO A;  3TL4 X;  3UJN A;  3T1H M;  3FTE A;  3RZ3 A;  4MGI E;  2C9C A;  1NJF A;  1YF9 A;  3SMP A;  3A46 A;  3E46 A;  1QAO A;  4W5V A;  4NRG A;  3T6P A;  2L4F A;  4REZ A;  2C5R A;  4X64 M;  2LH0 A;  2E2C A;  1SXJ D;  1KPQ A;  3GQ3 A;  2QBY A;  3DOA A;  4IBF A;  3HGI A;  1Z5B A;  5E26 A;  3TQS A;  2ZTD A;  2Z3X A;  2Y21 A;  3JR4 A;  4B3T M;  3KFU G;  4B7F A;  5KQD A;  3GRY A;  4G4N A;  3OBX A;  2OOB A;  1QAM A;  5D1K A;  2UUA M;  1W5T A;  3L1Z A;  3ZNI C;  3GLI B;  3HHZ A;  4DV0 M;  2CV1 A;  2ZTC A;  1XWI A;  1VQ1 A;  3B9P A;  1H6U A;  2K9D A;  4IBB A;  1ZGU A;  4FH1 A;  1UFZ A;  4IP3 B;  5D0K A;  2QCU A;  2BJW A;  3FE3 A;  2XF3 A;  4XK8 F;  4X65 M;  5F3W A;  1AIP C;  2C9O A;  3U6C A;  2Q2E B;  3GPU A;  3U6L A;  2JA2 A;  1R5L A;  1EE8 A;  2LVA A;  1N34 M;  4IBD A;  4PDG A;  4MGH A;  3I04 M;  4G6Z A;  4KOD A;  5FTL A;  4HL4 A;  1OIZ A;  1DGH B;  1LTM A;  2C2V C;  2ESQ A;  1VDL A;  3U6P A;  3VKH A;  2C4P A;  1U9B A;  1DGH A;  2BWB A;  2KLY A;  5D1M A;  2E5L M;  2APL A;  3FTC A;  2GRQ A;  2K6B A;  4V3K A;  2VF8 A;  3KXE C;  2HL7 A;  2Y20 A;  1KFV A;  2DWM A;  1GL6 A;  2L09 A;  3KP0 E;  4LF5 M;  4L15 A;  3HJ8 A;  5KPR A;  2XSZ A;  1WXQ A;  3UGB A;  3AOE A;  4WUR A;  3R9X B;  2R6F A;  1WGN A;  4A3V B;  3B7Z A;  1YE9 A;  3ZCB B;  1WGL A;  3SQV C;  4MB7 A;  3VK7 A;  4AZF A;  4LFA M;  5ITQ A;  4DBG B;  4BVU B;  4IBI A;  4DV7 M;  2R4J A;  2XH9 A;  2JZ0 A;  4UN2 B;  4JI6 M;  4LFC M;  4DR3 M;  1IBM M;  4QNR A;  2EUC A;  3ONG B;  2WSC F;  1A5T A;  4L78 A;  3GLH E;  3HU2 A;  2CHG A;  5KO3 A;  4LG2 A;  1Q02 A;  2BF8 A;  2F5O A;  4LJ9 A;  4A4C C;  3K9P A;  4AW4 A;  3L2A A;  1NNJ A;  2OB4 A;  2ZAM A;  3KOY E;  2Y0T A;  4GH9 A;  4AKI A;  1JR3 E;  5FTJ A;  4JI7 M;  5HPT C;  2X49 A;  1IXS A;  5EXT A;  4G4O A;  2BJV A;  2GQF A;  2V1C A;  3LVV A;  5EP1 A;  2XZU A;  1G41 A;  1JBB A;  2YBF A;  3OBS A;  4DS2 A;  2C98 A;  1X23 A;  1HT2 E;  3GLF B;  4ONM A;  2C2V B;  4HLQ A;  2OO9 A;  1WJ7 A;  4QOZ C;  3IHP A;  4AQY M;  1FZY A;  4I4L A;  3GPP A;  1FNN A;  2F4Z A;  5FTM A;  3KOX E;  4DR5 M;  2CE7 A;  2CEA A;  2M60 A;  3EIH A;  2EKF A;  3CF6 E;  4X62 M;  1S1Q A;  1IN8 A;  5EXP A;  4OU7 A;  3R42 A;  5C1B A;  4NRG B;  4QNM A;  3F92 A;  3QYB A;  1J09 A;  8CAT A;  3PXG A;  3U6S A;  2FH0 A;  3I51 A;  3GPY A;  4DHZ F;  1IN5 A;  1NV8 A;  2LXE A;  5E6J A;  3SAW A;  1XMQ M;  4AP4 B;  3JVZ A;  2J7O A;  2GNO A;  4QHT A;  1IY0 A;  4BLC A;  1FXT A;  2H5X A;  3D8B A;  2RGO A;  2LHG A;  3KDS E;  3LMM A;  3VDP A;  1NHG C;  2HHH M;  1GO5 A;  3FYC A;  3U61 B;  5IFR A;  1QDR A;  5DNY A;  4OX9 M;  1WZV A;  1IXZ A;  4LJ5 A;  3SYK A;  2XEP A;  5FSW A;  2AYV A;  2G8L A;  1JAS A;  3PNV A;  1N32 M;  3CEG A;  4RF1 A;  3W31 B;  2LVN C;  3AV0 A;  4LJ7 A;  1PJI A;  4P16 A;  4DR4 M;  2DHY A;  2D7G A;  1Z59 A;  5F6V A;  2JXN A;  4L4U A;  1DGG A;  3LQR A;  2EKK A;  1E94 E;  2QEN A;  3SMS A;  4GC9 A;  5ITX A;  3U6Q A;  2QZ4 A;  4FWH A;  4OW0 A;  2MGW A;  1DO0 A;  1C7Y A;  4KO8 A;  4NRI B;  1QAN A;  2DI0 A;  4DV2 M;  3K92 A;  1NY6 A;  3T38 A;  2UUB M;  3J27 B;  2DAW A;  4R3D A;  5F6E A;  1KSF X;  4NXN M;  3VK8 A;  2GJD A;  1Q39 A;  3IG8 A;  4I81 A;  4LRS A;  4A4B C;  4LY6 A;  2CHV A;  2J5Y A;  3FD9 A;  1N33 M;  3CTW B;  1UM8 A;  2KHH A;  2XWU A;  3ZQS A;  2D7E A;  3B7Q A;  1OIP A;  1L1Z A;  3TWK A;  4GMQ A;  2QGX A;  1MX0 A;  1HNX M;  2GRR A;  3PTF A;  3HHW A;  1WZW A;  2VDB B;  3MMP A;  3GRU A;  2UYZ A;  1E9R A;  4GPR A;  4R62 A;  3SAS A;  3FUX A;  4B3R M;  5DYI A;  2VQE M;  1J74 A;  1QYR A;  1LV7 A;  4JYA M;  1HQY E;  3RGS A;  2F5N A;  3UIO A;  3P9G A;  1V34 A;  4NR3 B;  1VEG A;  2FE8 A;  1GKI A;  4IBE A;  2KZS A;  1DO2 A;  2LVQ D;  2QNJ A;  2V6Z M;  3NBX X;  4PD2 A;  2Z6O A;  4X57 A;  1GJT A;  4Y28 F;  2YFQ A;  1XMO M;  4NXM M;  4CCG A;  1OQY A;  4CHT B;  1Z2U A;  5FTN A;  3KS8 A;  2HLW A;  2DHR A;  5ITT A;  1TH2 A;  1QVR A;  2ERC A;  3SYL A;  2CV0 A;  3FTD A;  2JNH A;  3DFZ A;  3GLH A;  4G3O A;  4NSO B;  3U5Z B;  3J7B A;  1G4A E;  4IBJ A;  3UIP A;  1V92 A;  3Q8G A;  4WP2 A;  3RPG A;  2YQZ A;  1C1K A;  1R6B X;  3OTO M;  4JI2 M;  2VRR A;  1NSF A;  5F6D A;  2F5Q A;  2O25 C;  4DHI D;  2Z4R A;  2DAI A;  1Q3B A;  1GL7 A;  3R8F A;  2UXC M;  2FUH A;  3FUT A;  4LF9 M;  1TH3 A;  3T15 A;  4QOS A;  1R7R A;  2L6O A;  4CJ6 A;  2UCZ A;  5JI2 E;  3AOE C;  1QUS A;  4ITQ A;  1P3Q Q;  2QHO B;  5GKN A;  3OBQ A;  2L7I A;  3EIE A;  1FJG M;  2F0R A;  2JP7 A;  2DEN A;  5JI3 E;  1IY1 A;  3WHK A;  2LVP C;  4M9S A;  4NR3 A;  2DAX A;  1TGU A;  1IXS B;  2CRU A;  2LWX A;  4FCW A;  4BB9 A;  2VII A;  2GRP A;  4ONN A;  3PVS A; 
#chains in the Genus database with same CATH homology
 1JAT B;  1T43 A;  2FO3 A;  4F1I A;  2MRO B;  1ZMU A;  1AYZ A;  2DAK A;  1NV9 A;  3GLG E;  2ESK A;  5D0M A;  2YHO B;  3HCT B;  2GMI A;  2Z5D A;  3E95 A;  2QSF X;  1ZMV A;  2CP8 A;  1TR8 A;  2GRN A;  2ESO A;  5F6X A;  1HT1 E;  1M4P A;  1QCQ A;  4ONL A;  2MR9 A;  5AIT B;  2NVU C;  3HCU B;  1HJP A;  4M1N A;  2B3T A;  5JNE B;  1JAT A;  1OTR A;  2JY7 A;  2HWJ A;  5D1L A;  1WIV A;  2L2D A;  3L1Y A;  2KNA A;  1PZV A;  2CLW B;  2PWQ A;  1MN3 A;  3EB6 B;  2CLW A;  2KJH A;  2L4E A;  1YLA A;  3FRI A;  2DAG A;  2JUJ A;  1F4I A;  3E95 C;  2Y4W A;  4ONM B;  3RCZ B;  2PE6 A;  3JW0 A;  4WZ3 A;  2MT6 A;  1DV0 A;  1KPS A;  1ZMW A;  1OAI A;  5FQ2 A;  2Q0V A;  1J7D A;  3BBZ A;  4GEW A;  1Z3D A;  2JY8 A;  4NRI A;  1Z5S A;  3E21 A;  4LDT C;  1VEJ A;  2OOA A;  1ZUO A;  2EKE A;  1M4Q A;  1QZE A;  2AWF A;  2WZJ A;  3VON B;  2GMI B;  2ONU A;  1I7K A;  3FN1 B;  4JQU A;  5AIT D;  3KPA A;  1W4U A;  1ZDN A;  2CWB A;  3EVX A;  4ZNY A;  4ONN B;  4JUE A;  2H2Y A;  1CUK A;  5DFL A;  1SG9 A;  1TTE A;  4TKP A;  2O25 A;  2G3Q A;  5D2M A;  1J7D B;  2JZ1 A;  3H8K A;  1C4Z D;  1FBV C;  4MDK A;  2PX9 B;  4QPL B;  3P9H A;  5F6U A;  1WR1 B;  3R3Q A;  2MJ5 B;  1Q34 A;  5AIU B;  4YC1 A;  2DAM A;  4II2 C;  5F6Y A;  1OKS A;  4Y1L C;  4S3O A;  2LTU A;  2EJS A;  2GRO A;  1UZX A;  1XXH E;  1VEK A;  3K9O A;  1IM2 A;  2YB6 A;  4AUQ A;  1BVS A;  1UKX A;  3FSH A;  2BEP A;  3TGD A;  2RRU A;  1YH2 A;  3OJ4 A;  2Z6P A;  3GLF E;  3H4J A;  2LVO C;  4YII U;  4EJE A;  2DKL A;  1KPP A;  4LAD A;  5AIE B;  2DNA A;  4P5O G;  2LBC A;  1IFY A;  4DHJ C;  1VG5 A;  4ONL B;  4HEO A;  1Y6L A;  2DAE A;  3GLI E;  2AAK A;  5FER B;  5EGG A;  4Y1L A;  3A4S A;  2K07 A;  2EBM A;  1A3S A;  4R71 A;  3ZNI C;  2EBK A;  4L83 A;  3IEC A;  1G3I A;  3LCU A;  2Y9P A;  1Y8X A;  2R0J A;  4V3L A;  1R4G A;  3LCV B;  4Q5H C;  2BWE A;  2DZL A;  3BZH A;  4F2L A;  2JY6 B;  2JY5 A;  3A33 A;  1PGY A;  2DMF A;  2YZ0 A;  1Y8G A;  1ZV1 A;  3WE5 A;  4Q7J A;  3OBU A;  2KNZ A;  3O2U A;  1XB2 B;  4A49 B;  2K0B X;  1WHC A;  2Y9M A;  3B89 A;  2EDI A;  2A7L A;  4DDG A;  1EFU B;  5F6W A;  5KNL C;  3UIN A;  3FRH A;  2F4W A;  2CYX A;  1YRV A;  3VON C;  4Q5E C;  2KNV A;  1U9A A;  2ESP A;  1T6O A;  2HAK A;  4BWF A;  2A4D A;  2OXQ A;  1KYI A;  2R0I A;  4DDI A;  3SY2 C;  3RZ3 A;  1YF9 A;  3E46 A;  4W5V A;  4NRG A;  3T6P A;  2L4F A;  2E2C A;  1KPQ A;  2ZTD A;  4ONN A;  3OBX A;  2OOB A;  5D1K A;  3L1Z A;  2ZTC A;  1VQ1 A;  1ZGU A;  2K9D A;  4FH1 A;  5D0K A;  1UFZ A;  4IP3 B;  3FE3 A;  1AIP C;  2LVA A;  2DAY A;  2LXP A;  2C2V C;  2ESQ A;  1VDL A;  2C4P A;  1U9B A;  2BWB A;  2KLY A;  5D1M A;  2GRQ A;  4V3K A;  3UGB A;  1WGN A;  1WGL A;  3SQV C;  4BVU B;  4DBG B;  4UN2 B;  2JZ0 A;  3ONG B;  1A5T A;  3GLH E;  1Q02 A;  2BF8 A;  4A4C C;  3K9P A;  2OB4 A;  1JR3 E;  5HPT C;  1IXS A;  2YBF A;  4DS2 A;  1G41 A;  1JBB A;  3OBS A;  1X23 A;  1HT2 E;  4ONM A;  2C2V B;  2OO9 A;  1WJ7 A;  1FZY A;  3IHP A;  2F4Z A;  2EKF A;  1S1Q A;  3R42 A;  4NRG B;  3F92 A;  4DHZ F;  1NV8 A;  4AP4 B;  3JVZ A;  1FXT A;  2H5X A;  1GO5 A;  5IFR A;  1WZV A;  2AYV A;  1JAS A;  3CEG A;  3W31 B;  2LVN C;  2DHY A;  5F6V A;  2EKK A;  1E94 E;  2MGW A;  1DO0 A;  1C7Y A;  4NRI B;  2DI0 A;  2DAW A;  5F6E A;  2GJD A;  4A4B C;  2KHH A;  2XWU A;  3ZQS A;  2QGX A;  3PTF A;  2GRR A;  1WZW A;  3MMP A;  2UYZ A;  4GPR A;  4R62 A;  1J74 A;  3UIO A;  1HQY E;  3P9G A;  4NR3 B;  1VEG A;  1DO2 A;  2LVQ D;  2QNJ A;  4X57 A;  2Z6O A;  4CCG A;  1OQY A;  1Z2U A;  2HLW A;  2JNH A;  4G3O A;  1G4A E;  3UIP A;  1V92 A;  4WP2 A;  3RPG A;  2VRR A;  5F6D A;  2O25 C;  4DHI D;  2DAI A;  2FUH A;  2UCZ A;  5JI2 E;  1P3Q Q;  2QHO B;  3OBQ A;  2F0R A;  2JP7 A;  2DEN A;  2LVP C;  4NR3 A;  2DAX A;  2GRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...