5DFLA

Crystal structure of ube2k~ubiquitin conjugate
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
199
structure length
199
Chain Sequence
AANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAIKLDILRDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLSAMGFDRNAVIVALSSKSWDVETATELLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis of lysine 48 ubiquitin chain synthesis by Ube2K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/signaling protein
molecule keywords Ubiquitin
total genus 68
structure length 199
sequence length 199
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00179 UQ_con Ubiquitin-conjugating enzyme
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 5dflA02
3.10.110.10 Alpha Beta Roll Ubiquitin Conjugating Enzyme Ubiquitin Conjugating Enzyme 5dflA01
2LVQD 2C2VB 4QPLB 5AIEB 1Z2UA 1SG9A 2PWQA 2A4DA 4W5VA 4G3OA 4BVUB 1IFYA 4EJEA 2KJHA 1KPSA 1J7DA 1MN3A 3E46A 2GRQA 1S1QA 2MROB 4FH1A 4S3OA 2QGXA 2F0RA 1T43A 2VRRA 5D0MA 3MMPA 1HJPA 3TGDA 2MR9A 4GEWA 1ZMVA 2EDIA 2KHHA 4Y1LA 2BF8A 1G41A 4CCGA 2WZJA 4F1IA 3ZQSA 2AYVA 3FRHA 3LCVB 3FSHA 3SY2C 3ONGB 4Q5EC 2DAKA 1YH2A 2HLWA 1XXHE 5D1LA 1PZVA 5AIUB 1T6OA 1Q34A 1G4AE 2DNAA 3OBQA 2AWFA 2JY5A 2LVAA 4ONLB 1ZMUA 2JZ1A 5F6EA 3L1YA 2BWEA 4MDKA 2LVPC 1WGLA 2DENA 1YLAA 1W4UA 2DAEA 1Y8XA 3SQVC 2CLWB 1CUKA 2ESPA 1WR1B 1FXTA 1FZYA 2EKKA 3UINA 4WP2A 2EBKA 2C2VC 1WGNA 2ZTCA 2JZ0A 3OBXA 4NRIB 4DHID 3B89A 4DHZF 2QNJA 2NVUC 4X57A 2B3TA 2KLYA 2OOBA 2O25C 1QZEA 2ESOA 2JNHA 4AUQA 1AIPC 2L4EA 4DBGB 3GLFE 3FN1B 4LADA 4NR3A 1IM2A 1DV0A 5F6YA 4WZ3A 3R42A 4LDTC 3H8KA 1ZUOA 2LXPA 3WE5A 4HEOA 2JY6B 2E2CA 2LVNC 3HCTB 2LVOC 3OBUA 4ONLA 4P5OG 5D0KA 2L2DA 2OO9A 2CLWA 5F6UA 1OQYA 3CEGA 2DAYA 4AP4B 3JVZA 4R62A 4II2C 2DHYA 2ESKA 3VONC 3HCUB 1WZWA 5KNLC 2KNZA 3E95A 4R71A 2PX9B 3BZHA 2PE6A 3ZNIC 3RZ3A 2F4ZA 1I7KA 1JATA 2HAKA 4NRIA 2UYZA 2GMIA 1DO0A 2DKLA 2GRPA 2JP7A 1C7YA 3F92A 1NV8A 4YC1A 2Z5DA 2OOAA 2MT6A 2DI0A 1JR3E 2YBFA 2CP8A 1VEGA 1VQ1A 1R4GA 3IHPA 4GPRA 1KYIA 4V3LA 2KNVA 2QHOB 3UGBA 4Y1LC 4F2LA 3PTFA 3BBZA 4NRGA 2YB6A 2DZLA 1ZV1A 4ONMA 3OBSA 3UIPA 3T6PA 1F4IA 1JATB 3RCZB 1M4PA 2H2YA 2YHOB 4IP3B 2EBMA 3VONB 3K9PA 1HT2E 3OJ4A 5AITD 3L1ZA 4V3KA 2EJSA 1YRVA 4Q5HC 2K07A 3JW0A 1ZMWA 3P9GA 4NR3B 1A3SA 1U9AA 5F6XA 1OKSA 1XB2B 1C4ZD 4ONNB 4DDGA 3EVXA 2AAKA 1TR8A 1VEJA 4YIIU 2LTUA 2GRNA 1BVSA 1WHCA 1Z3DA 1JBBA 1VEKA 5D1MA 2F4WA 2CWBA 2XWUA 4ZNYA 2GMIB 4JQUA 2C4PA 3E21A 2Z6PA 2L4FA 3A33A 5F6DA 5EGGA 1IXSA 1GO5A 1HQYE 3RPGA 1TTEA 1QCQA 1A5TA 2YZ0A 3P9HA 2ONUA 1X23A 3FRIA 1M4QA 2Y9PA 3A4SA 1AYZA 1HT1E 1UFZA 5F6WA 2LBCA 2OXQA 1WJ7A 4DS2A 1KPQA 1WZVA 2R0IA 2DAWA 5FQ2A 4DHJC 1UKXA 4Q7JA 5FERB 1J74A 5DFLA 2G3QA 3GLHE 4JUEA 3O2UA 2MJ5B 5JI2E 1FBVC 1Z5SA 4BWFA 2OB4A 3IECA 2UCZA 2FUHA 3H4JA 2JY8A 1VG5A 4A4CC 2FO3A 2A7LA 2DAXA 2JY7A 1OAIA 2Q0VA 4A4BC 3E95C 5AITB 1PGYA 4M1NA 1YF9A 1V92A 1DO2A 3EB6B 3R3QA 3LCUA 5F6VA 2KNAA 2DMFA 3GLIE 2BEPA 2MGWA 1Y8GA 3UIOA 5D1KA 2BWBA 2H5XA 2RRUA 1Q02A 5JNEB 1U9BA 4L83A 1VDLA 2ESQA 5IFRA 1EFUB 5D2MA 2GJDA 2GRRA 1NV9A 2DAIA 2HWJA 2Y9MA 2K9DA 4NRGB 2EKFA 2O25A 2Z6OA 2EKEA 2DAMA 3FE3A 1UZXA 2CYXA 3K9OA 4UN2B 1ZDNA 2R0JA 1J7DB 1JASA 4DDIA 2K0BX 1OTRA 2JUJA 2QSFX 2GROA 1G3IA 1E94E 3GLGE 3W31B 1P3QQ 1ZGUA 2ZTDA 1WIVA 4ONNA 5HPTC 1Y6LA 4TKPA 3KPAA 4ONMB 1KPPA 2DAGA 4A49B 2Y4WA
chains in the Genus database with same CATH superfamily
2LVQD 4K0KM 2C2VB 4AW4A 4BLCA 2XFTA 2UU9M 3J81S 3GQ3A 4JV5M 3UJNA 4QPLB 3GPPA 5AIEB 1SXJC 2FH0A 1Q3BA 3U6CA 5DNYA 1L2BA 3UZUA 1Z2UA 2HCBA 1SG9A 2PWQA 2A4DA 4W5VA 4G3OA 4DR2M 4MB7A 4BVUB 1NO1A 3SC3A 5EP3A 3DFZA 3C58A 3KS4A 4JI2M 1IFYA 3GRUA 1QYRA 2C9CA 3HU3A 4KT0F 3SATA 5BR8M 4EJEA 3SMSA 1IQPA 3J27B 3JR4A 3FD9A 2XZFA 2KJHA 4JI6M 1XNRM 2ZBKB 5F6XA 1NJGA 2KXEA 3L2AA 4CJ6A 3K2LA 1KPSA 4HL4A 4L6V6 1IBKM 4GITA 3KXEC 3IG5A 3A98B 1J7DA 1MN3A 2M60A 4BBAA 3U60B 3E46A 4G6ZA 4XGIA 2YNMD 2GRQA 3K92A 4GC5A 4LZZA 3RGSA 4PCZA 4X62M 1S1QA 1FNNA 3AKZA 2MROB 4M0WA 5EQTA 4FH1A 4S3OA 2R45A 2QGXA 1QVRA 4IBFA 4LF6M 2F0RA 1T43A 2VRRA 5D0MA 4DV6M 3MMPA 2R46A 1HJPA 3Q8GA 3TGDA 2MR9A 3KOYE 4GEWA 1ZMVA 2M5ZA 4D81A 3FUUA 5KPTA 4P17A 2EDIA 1J5EM 2KHHA 5LMUM 3PNVA 4Y1LA 3J7BA 3W0LB 2J5YA 2LH0A 3I4YA 3KOXE 4LGMA 1G41A 2BF8A 4AKIA 4CCGA 5IT9S 3I51A 3KOWE 3K1JA 4Z6YA 3LW5F 4ONMA 2JA2A 2WZJA 3FUWA 5DYIA 4F1IA 3ZQSA 4JYAM 2LWXA 3L29A 2AYVA 4B7GA 2X8AA 1KSFX 4MGHA 3UIPA 4KO8A 4CGYB 2GQFA 3FRHA 3LCVB 4DR6M 1QAMA 2L6OA 7CATA 3FSHA 3ONGB 2KZSA 3SY2C 3U6PA 4IBKA 2APLA 2J7OA 4FCVA 4Q5EC 4B08A 2DAKA 2LHCA 4L15A 3VKGA 2Y0TA 3KDSE 1YH2A 4B3TM 1PRBA 1HR0M 1WXQA 2HLWA 4MGIE 1XXHE 5D1LA 1OAOC 3I04M 2ZANA 3MK6A 3GLIB 2Y0QA 4M9ZA 1K3XA 1PZVA 1IY0A 5AIUB 1T6OA 3HU1A 1Q34A 4W5WA 4PDGA 1OJLA 1XMOM 1G4AE 2DNAA 3OBQA 2AWFA 1PM5A 3CF2A 5ITTA 1GKIA 2C5RA 2JY5A 2DWLA 2LVAA 3TWKA 4DV1M 1ZMUA 3CGWA 4ONLB 2R18A 3QAUA 4IJEA 1E32A 1IN7A 4IBBA 3VDUA 2JZ1A 2W82A 3TL4X 4DUZM 2F5OA 3SHGB 1OIZA 3HGIA 2OPFA 1GJTA 4TUWA 4AG5A 2BWEA 3L1YA 4MDKA 4JI3M 3ZNIC 3HJ8A 4G4OA 3U6QA 2LVPC 1MJGM 3HHYA 3GQ5A 1WGLA 2DENA 1YLAA 3VFDA 1Z5BA 1W4UA 2DAEA 3TPZA 1L8QA 4A3VB 3AL0C 3M6AA 3U6SA 1Y8XA 2CLWB 1E9RA 4FWGA 1CUKA 3SQVC 2ESPA 1WR1B 4OX9M 1FXTA 4DV0M 1FZYA 3SAVA 2EKKA 2G5GX 1NJFA 3UINA 1LTMA 4WP2A 1Q39A 3R9XB 2EBKA 2C2VC 1DGBA 1WGNA 3E9SA 4DV3M 2ZTCA 3LQRA 3W0FA 5H37D 2LNHC 3AV0A 3VK7A 1QDRA 1Z6TA 3Q8XA 3TQSA 2JZ0A 3FYDA 4XK8F 1QANA 4GH9A 3GLFA 2R65A 2FE8A 1H6UA 2Z8YM 3SASA 3OBXA 3EIHA 4NRIB 4DHID 1N36M 4BB9A 3B89A 4DHZF 1L1ZA 2QNJA 2R44A 5FTKA 1DGFA 2QENA 3FUVA 3LMMA 4FCWA 3VK8A 1K82A 2NVUC 4X57A 1QAOA 4IJFA 1G8PA 1R7RA 2B3TA 3B7ZA 4MM3B 2KLYA 1TH3A 2OOBA 4LCBA 2O25C 2AHMA 2Y20A 1QZEA 4JI0M 2JNHA 2R6FA 2F5PA 1AIPC 2L4EA 4DBGB 2DVWB 4I4LA 1N33M 4B3RM 5F3WA 3GLFE 4LRSA 2UXBM 3FN1B 4LADA 4G4QA 1X37A 5IWAM 3HWSA 3WHLA 1QUSA 3GLGB 2XZUA 4ANRA 1IM2A 1DV0A 4NR3A 5F6YA 4WZ3A 3V76A 3R42A 1L2DA 2QP9X 2MH8A 4LDTC 3H8KA 1Z5AA 4DR1M 3VKHA 1ZUOA 2LXPA 3WE5A 4HEOA 2JY6B 2E2CA 3B7NA 2LVNC 3C3EA 3HCTB 3IG8A 2LVOC 2LHGA 3U5ZA 2UUBM 3OBUA 2O01F 3VDPA 4ONLA 4P5OG 3FYCA 1NHGC 3E4RA 4IBDA 5D0KA 2L2DA 3DA1A 2OO9A 2CLWA 5F6UA 1OQYA 1S3SA 3D8BA 3FUTA 2KEBA 1NNJA 3CEGA 1QZMA 4RKUF 2DAYA 1SXJD 1HNXM 4AP4B 3JVZA 4R62A 4MGYE 4LRTA 3I01M 4II2C 2CHQA 4LJ5A 2DHYA 2ESKA 3VONC 4FCTA 2CUZA 4PDIA 3L25A 3HCUB 1ZQ9A 4M9SA 4GHLA 3ZCBB 2VF8A 1JB0F 2KRKA 4DV5M 5BPVA 1WZWA 3VLFB 5KNLC 4LJ4A 1L2CA 3GQ4A 2KNZA 3GRRA 3ZQJA 3SAWA 1XC8A 3E95A 4X64M 2I7PA 5EP1A 3U6MA 5EP2A 4LJ9A 3FTEA 3KW6A 4IBEA 4MGZE 4R71A 1W5SA 2CHGA 1DGHA 3CF0A 2PX9B 3BZHA 2PE6A 2DHRA 3DZDA 3RZ3A 2KZUA 1I7KA 2FOIC 2KW0A 3B74A 5EXPA 1J7KA 4DR5M 1JATA 2F4ZA 2HAKA 2CFOA 2VQFM 4NRIA 2UYZA 3I4VA 3R3QA 1HNZM 2R4EA 3LQQA 2FFJA 4LJAA 3JAMS 2GMIA 1DO0A 1E9SA 2V1CA 2DKLA 3J2PB 2GRPA 2JP7A 4REZA 3KP1E 4DV2M 1C7YA 5EXSA 3F92A 3GPXA 1NHWC 1NV8A 1IN6A 8CATA 4YC1A 3HKPA 2Z5DA 2OOAA 4QHTA 5EJCA 2MT6A 5A2QS 1K3WA 2DI0A 4JN6A 3SFZA 1JR3E 4NXMM 1PJQA 5ITRA 2YBFA 3FTDA 2KA6B 1QUTA 3MJ5A 2CP8A 4GRIA 1VEGA 3FUXA 1VQ1A 2QZ4A 2HKJA 3L27A 1R4GA 2K6BA 1LV7A 2JXNA 3EIEA 3IHPA 4FWDA 4EIWA 1KYIA 5KQ8A 2KNVA 2QHOB 4LFCM 4GPRA 4V3LA 4AQYM 2UUCM 3FKEA 3GRVA 4R3DA 3UGBA 4Y1LC 3CTWB 5F6EA 4F2LA 3PTFA 3BBZA 4NRGA 2BJWA 2YB6A 1OFHA 4JI8M 2ZM6M 4P16A 3RGPA 2DZLA 1ZV1A 4AG6A 3OBSA 1IN8A 2UXDM 3T6PA 2XGNA 2OQ4A 1FJGM 1F4IA 2X4AA 4QNMA 4D80A 1JATB 2H1RA 5FSWA 2WSEF 1L1TA 1M4PA 3RCZB 2H2YA 4ITQA 3AOEC 2YHOB 4IP3B 1TDZA 3K8ZA 4NSOB 3TWLA 2EBMA 3VONB 2KRUA 3K9PA 1NNUC 2VIIA 2Z3XA 1J09A 1XXHB 4II7A 1HT2E 3T15A 3OJ4A 5AITD 5ITQA 1EE8A 3GLHB 1PJJA 3L1ZA 4G4RA 4V3KA 3KP0E 2EJSA 1I4WA 4MH0E 2XH9A 1AUAA 2EO2A 2XSZA 3AOGA 3T1HM 3M0EA 4GKKM 1YRVA 4Q5HC 2K07A 1OIPA 1Z59A 4R7GA 4NRWA 3JW0A 4RF1A 1I94M 2C9OA 5DYGA 1Z5CA 1ZMWA 3P9GA 4LFAM 1A3SA 1U9AA 4NR3B 1IN4A 4NSRA 4GC9A 4B7HA 1N75A 2DWMA 1QAQA 1IN5A 1QDTA 3L28A 3KVWA 3LVVA 2NQ8C 4KLNA 4KODA 5FTNA 3UGJA 1OKSA 1XB2B 3B9PA 5E6JA 2CV0A 2YQZA 3KFUG 1C4ZD 1D0MA 4FWHA 3GRYA 3SAUA 4JI1M 3EVXA 4ONNB 4JI4M 4MGKE 4DDGA 2LXEA 2F5SA 4WW0A 1GL7A 2AAKA 1TR8A 1N32M 2DZNB 4QOZC 3A42A 3KOZE 3HY5A 1VEJA 4YIIU 4QNRA 1JR3D 2LTUA 2XFSA 2GRNA 4LJ7A 1BVSA 1NY5A 1TDHA 1WHCA 2QPAA 2HL7A 2HHHM 1JBBA 1Z3DA 1VEKA 3AFHA 3NBIA 2VDBB 1YSYA 3MHVC 4WURA 5D1MA 3SYKA 2G8LA 3WHKA 3B7QA 3SHFA 4NOOB 4RNAA 2BJVA 2F4WA 3C3DA 4OW0A 4HLQA 2CWBA 2D7GA 1IY2A 3U60A 1G59A 3PVSA 3PXGA 3ILKA 1HNWM 2XWUA 2QBYA 2CV2A 4ZNYA 4LZJA 2GMIB 1NSFA 4S12A 4G4NA 4LGYA 2C4PA 3E21A 2Z6PA 4JQUA 2JWSA 1PJSA 2CRUA 2L4FA 3GLFB 3A33A 5F6DA 3U6DA 5EGGA 1IXSA 3ZC7B 3SBJA 4OU7A 1GO5A 2BNKA 4I5SA 1HQYE 5FLXS 5FTMA 1ORYB 2EUCA 4LJ6A 4B7FA 3U61B 4B3SM 3LVWA 1NVMA 3RPGA 2CHVA 1TTEA 1QCQA 4DR3M 1A5TA 4OVZB 4I8OA 2YZ0A 2ONUA 1X23A 3P9HA 5GKNA 3FRIA 2XLJA 2ESOA 2J7NA 1M4QA 2Y9PA 1V34A 3A4SA 1C1KA 5IREB 1DGGA 1HT1E 1AYZA 3A46A 1UFZA 2QQ8A 2D7EA 2X49A 3GPUA 1PJIA 5F6WA 2LBCA 4RF0A 1WJ7A 2OXQA 4DS2A 1KPQA 1OFIA 5ITXE 1WZVA 4PD2A 2R0IA 5KPRA 4GKJM 2Y21A 3H4MA 3HHWA 3U61A 2DAWA 3U6LA 5FQ2A 1UKXA 4DHJC 1RU3A 2ERCA 5E26A 1NY6A 2XEPA 4Q7JA 4M9XA 5KO3A 5FERB 1J74A 1V33A 1MX0A 4YY3M 2I7NA 4DR7M 4NRVA 5DFLA 1XNQM 2Z4SA 3RE8A 2G3QA 2Q2EB 3GPYA 1SXJE 3HHXA 3GLHE 2VF7A 1IXZA 3A45A 3KSXA 4JUEA 4OVZA 1EIJA 1VDDA 3O2UA 2MJ5B 4XBOA 1D2NA 5JI2E 1FBVC 1Z5SA 3D8LA 3RFWA 1MU5A 3W68A 3R8FA 4BWFA 5JI3E 1HQCA 2WSCF 1N34M 2OB4A 1N77A 1GL6A 4B3MM 3OTOM 3L26A 3IECA 4X65M 2UCZA 4QHSA 5LMNM 3H4JA 2JY8A 1VG5A 3GLGA 1KFVA 2FUHA 4A4CC 2ZAOA 4IBGA 1IY1A 4IBIA 2F4VM 3KS8A 2A7LA 2R4JA 4Z8XA 3W67A 2DAXA 2FO3A 2JY7A 1OAIA 3CF6E 3FTCA 3QWLA 3GO8A 3SMPA 1JR3A 2KDLA 2Q0VA 4A4BC 3PNYA 4M0DA 4LF4M 2XF3A 2L09A 3HU2A 4FVMA 4LF8M 4AI6A 4CIZA 4ZPXA 1ZAEA 2RGHA 4DV4M 3E95C 2RGOA 1GJSA 4GMQA 5AITB 2F5NA 1PGYA 3FTFA 4M1NA 2UUAM 1G71A 2YR0A 3NWLA 2V1UA 4NL4H 5KPZA 4JI7M 1YF9A 3U6OA 1V92A 2FS1A 1DGHB 1R2ZA 1DO2A 3HZJA 1YUBA 1IXSB 1IXRC 2D7HA 2N35A 2WSFF 2C99A 3HJQA 3LCUA 3NBXX 3QYBA 2KNAA 1GLNA 2GNOA 5F6VA 2YFQA 2E5LM 3M7GA 2DMFA 4LF5M 2QCUA 2DWZB 3AJIB 5C1BA 3GLIE 2BEPA 1N78A 1SXJB 2MGWA 3UMMA 4JI5M 2FNAA 1GABA 1Y8GA 3HHZA 4LG2A 3U6EA 1T3TA 4LFBM 2QBYB 5D1KA 3UIOA 5KQDA 4GHAA 1PJTA 1XHBA 5IZ7D 2L7IA 1IBLM 2CE7A 2BWBA 4LY6A 2RKOA 3SYLA 5EXTA 1Q3CA 3AOEA 4LJ8A 4NXNM 1QQWA 3T1YM 5FTJA 2H5XA 3T38A 4AZFA 4DUYM 2RRUA 1Q02A 5JNEB 2C98A 2EA0A 5EP4A 3GLHA 3HJSA 4FD2A 2UXCM 5EXXA 5L8RF 1U9BA 1XXHA 2Z4RA 4GIPA 4CISA 4L83A 1VDLA 3ZH9B 3EB6B 4X66M 2ZAMA 3DOAA 3GLIA 3J7AS 1D0LA 4YHHM 4LF9M 2R62A 1EFUB 2ESQA 5IFRA 4D82A 1UM8A 5C18A 2GJDA 3C9PA 2P5TA 5D2MA 3QYEA 4Y28F 5ITYA 2CEAA 5ITXA 1IBMM 2GRRA 4FW9A 1NV9A 1TH4A 2DAIA 2HWJA 2F5QA 4CHTB 2Y9MA 1R2YA 1GVNA 3BOSA 2DZOB 2K9DA 4AKGA 1TH2A 3UK6A 4NRGB 2O25A 1W5TA 1TGUA 2EKFA 2EKEA 2DAMA 4DV7M 4DR4M 2Z6OA 3FE3A 4NC6A 1UZXA 4L4UA 5FTLA 1XWIA 3K9OA 4LF7M 2CYXA 4UN2B 3BXWA 1ZDNA 3PFIA 2R0JA 3J80S 1J7DB 1JASA 4DDIA 2K0BX 4QOSA 1OTRA 2JUJA 3GP1A 1TF0B 2QSFX 3THGA 3TE6A 2GROA 1JQJC 2Z7JA 4L16A 4L8RC 2VQEM 4L78A 1G3IA 3SARA 4IIWA 1E94E 2K47A 3GLGE 4I81A 3W31B 2DWNA 3JR5A 1P3QQ 1ZGUA 2L7HA 1D0KA 4KHPM 2ZTDA 1WIVA 3KSJA 1XMQM 4ONNA 5HPTC 3HX3A 2CV1A 1Y6LA 4TKPA 4AKHA 1R5LA 2O5RA 5ITUA 3KPAA 4ONMB 1YE9A 1KPPA 2DAGA 1SXJA 4JXJA 4AUQA 1R6BX 2DXIA 2XSZD 4IBCA 3TWMA 2C96A 3U5ZB 4A49B 2Y4WA 4PT5A 2A5YB 4IBJA 2V6ZM
chains in the Genus database with same CATH topology
2LVQD 2C2VB 4QPLB 5AIEB 1Z2UA 1SG9A 2PWQA 2A4DA 4W5VA 4G3OA 4BVUB 1IFYA 4EJEA 2KJHA 1KPSA 1J7DA 1MN3A 3E46A 2GRQA 1S1QA 2MROB 4FH1A 4S3OA 2QGXA 2F0RA 1T43A 2VRRA 5D0MA 3MMPA 1HJPA 3TGDA 2MR9A 4GEWA 1ZMVA 2EDIA 2KHHA 4Y1LA 2BF8A 1G41A 4CCGA 2WZJA 4F1IA 3ZQSA 2AYVA 3FRHA 3LCVB 3FSHA 3SY2C 3ONGB 4Q5EC 2DAKA 1YH2A 2HLWA 1XXHE 5D1LA 1PZVA 5AIUB 1T6OA 1Q34A 1G4AE 2DNAA 3OBQA 2AWFA 2JY5A 2LVAA 4ONLB 1ZMUA 2JZ1A 5F6EA 3L1YA 2BWEA 4MDKA 2LVPC 1WGLA 2DENA 1YLAA 1W4UA 2DAEA 1Y8XA 3SQVC 2CLWB 1CUKA 2ESPA 1WR1B 1FXTA 1FZYA 2EKKA 3UINA 4WP2A 2EBKA 2C2VC 1WGNA 2ZTCA 2JZ0A 3OBXA 4NRIB 4DHID 3B89A 4DHZF 2QNJA 2NVUC 4X57A 2B3TA 2KLYA 2OOBA 2O25C 1QZEA 2ESOA 2JNHA 4AUQA 1AIPC 2L4EA 4DBGB 3GLFE 3FN1B 4LADA 4NR3A 1IM2A 1DV0A 5F6YA 4WZ3A 3R42A 4LDTC 3H8KA 1ZUOA 2LXPA 3WE5A 4HEOA 2JY6B 2E2CA 2LVNC 3HCTB 2LVOC 3OBUA 4ONLA 4P5OG 5D0KA 2L2DA 2OO9A 2CLWA 5F6UA 1OQYA 3CEGA 2DAYA 4AP4B 3JVZA 4R62A 4II2C 2DHYA 2ESKA 3VONC 3HCUB 1WZWA 5KNLC 2KNZA 3E95A 4R71A 2PX9B 3BZHA 2PE6A 3ZNIC 3RZ3A 2F4ZA 1I7KA 1JATA 2HAKA 4NRIA 2UYZA 2GMIA 1DO0A 2DKLA 2GRPA 2JP7A 1C7YA 3F92A 1NV8A 4YC1A 2Z5DA 2OOAA 2MT6A 2DI0A 1JR3E 2YBFA 2CP8A 1VEGA 1VQ1A 1R4GA 3IHPA 4GPRA 1KYIA 4V3LA 2KNVA 2QHOB 3UGBA 4Y1LC 4F2LA 3PTFA 3BBZA 4NRGA 2YB6A 2DZLA 1ZV1A 4ONMA 3OBSA 3UIPA 3T6PA 1F4IA 1JATB 3RCZB 1M4PA 2H2YA 2YHOB 4IP3B 2EBMA 3VONB 3K9PA 1HT2E 3OJ4A 5AITD 3L1ZA 4V3KA 2EJSA 1YRVA 4Q5HC 2K07A 3JW0A 1ZMWA 3P9GA 4NR3B 1A3SA 1U9AA 5F6XA 1OKSA 1XB2B 1C4ZD 4ONNB 4DDGA 3EVXA 2AAKA 1TR8A 1VEJA 4YIIU 2LTUA 2GRNA 1BVSA 1WHCA 1Z3DA 1JBBA 1VEKA 5D1MA 2F4WA 2CWBA 2XWUA 4ZNYA 2GMIB 4JQUA 2C4PA 3E21A 2Z6PA 2L4FA 3A33A 5F6DA 5EGGA 1IXSA 1GO5A 1HQYE 3RPGA 1TTEA 1QCQA 1A5TA 2YZ0A 3P9HA 2ONUA 1X23A 3FRIA 1M4QA 2Y9PA 3A4SA 1AYZA 1HT1E 1UFZA 5F6WA 2LBCA 2OXQA 1WJ7A 4DS2A 1KPQA 1WZVA 2R0IA 2DAWA 5FQ2A 4DHJC 1UKXA 4Q7JA 5FERB 1J74A 5DFLA 2G3QA 3GLHE 4JUEA 3O2UA 2MJ5B 5JI2E 1FBVC 1Z5SA 4BWFA 2OB4A 3IECA 2UCZA 2FUHA 3H4JA 2JY8A 1VG5A 4A4CC 2FO3A 2A7LA 2DAXA 2JY7A 1OAIA 2Q0VA 4A4BC 3E95C 5AITB 1PGYA 4M1NA 1YF9A 1V92A 1DO2A 3EB6B 3R3QA 3LCUA 5F6VA 2KNAA 2DMFA 3GLIE 2BEPA 2MGWA 1Y8GA 3UIOA 5D1KA 2BWBA 2H5XA 2RRUA 1Q02A 5JNEB 1U9BA 4L83A 1VDLA 2ESQA 5IFRA 1EFUB 5D2MA 2GJDA 2GRRA 1NV9A 2DAIA 2HWJA 2Y9MA 2K9DA 4NRGB 2EKFA 2O25A 2Z6OA 2EKEA 2DAMA 3FE3A 1UZXA 2CYXA 3K9OA 4UN2B 1ZDNA 2R0JA 1J7DB 1JASA 4DDIA 2K0BX 1OTRA 2JUJA 2QSFX 2GROA 1G3IA 1E94E 3GLGE 3W31B 1P3QQ 1ZGUA 2ZTDA 1WIVA 4ONNA 5HPTC 1Y6LA 4TKPA 3KPAA 4ONMB 1KPPA 2DAGA 4A49B 2Y4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVQ D;  2C2V B;  4QPL B;  5AIE B;  1Z2U A;  1SG9 A;  2PWQ A;  2A4D A;  4W5V A;  4G3O A;  4BVU B;  1IFY A;  4EJE A;  2KJH A;  1KPS A;  1J7D A;  1MN3 A;  3E46 A;  2GRQ A;  1S1Q A;  2MRO B;  4FH1 A;  4S3O A;  2QGX A;  2F0R A;  1T43 A;  2VRR A;  5D0M A;  3MMP A;  1HJP A;  3TGD A;  2MR9 A;  4GEW A;  1ZMV A;  2EDI A;  2KHH A;  4Y1L A;  2BF8 A;  1G41 A;  4CCG A;  2WZJ A;  4F1I A;  3ZQS A;  2AYV A;  3FRH A;  3LCV B;  3FSH A;  3SY2 C;  3ONG B;  4Q5E C;  2DAK A;  1YH2 A;  2HLW A;  1XXH E;  5D1L A;  1PZV A;  5AIU B;  1T6O A;  1Q34 A;  1G4A E;  2DNA A;  3OBQ A;  2AWF A;  2JY5 A;  2LVA A;  4ONL B;  1ZMU A;  2JZ1 A;  5F6E A;  3L1Y A;  2BWE A;  4MDK A;  2LVP C;  1WGL A;  2DEN A;  1YLA A;  1W4U A;  2DAE A;  1Y8X A;  3SQV C;  2CLW B;  1CUK A;  2ESP A;  1WR1 B;  1FXT A;  1FZY A;  2EKK A;  3UIN A;  4WP2 A;  2EBK A;  2C2V C;  1WGN A;  2ZTC A;  2JZ0 A;  3OBX A;  4NRI B;  4DHI D;  3B89 A;  4DHZ F;  2QNJ A;  2NVU C;  4X57 A;  2B3T A;  2KLY A;  2OOB A;  2O25 C;  1QZE A;  2ESO A;  2JNH A;  4AUQ A;  1AIP C;  2L4E A;  4DBG B;  3GLF E;  3FN1 B;  4LAD A;  4NR3 A;  1IM2 A;  1DV0 A;  5F6Y A;  4WZ3 A;  3R42 A;  4LDT C;  3H8K A;  1ZUO A;  2LXP A;  3WE5 A;  4HEO A;  2JY6 B;  2E2C A;  2LVN C;  3HCT B;  2LVO C;  3OBU A;  4ONL A;  4P5O G;  5D0K A;  2L2D A;  2OO9 A;  2CLW A;  5F6U A;  1OQY A;  3CEG A;  2DAY A;  4AP4 B;  3JVZ A;  4R62 A;  4II2 C;  2DHY A;  2ESK A;  3VON C;  3HCU B;  1WZW A;  5KNL C;  2KNZ A;  3E95 A;  4R71 A;  2PX9 B;  3BZH A;  2PE6 A;  3ZNI C;  3RZ3 A;  2F4Z A;  1I7K A;  1JAT A;  2HAK A;  4NRI A;  2UYZ A;  2GMI A;  1DO0 A;  2DKL A;  2GRP A;  2JP7 A;  1C7Y A;  3F92 A;  1NV8 A;  4YC1 A;  2Z5D A;  2OOA A;  2MT6 A;  2DI0 A;  1JR3 E;  2YBF A;  2CP8 A;  1VEG A;  1VQ1 A;  1R4G A;  3IHP A;  4GPR A;  1KYI A;  4V3L A;  2KNV A;  2QHO B;  3UGB A;  4Y1L C;  4F2L A;  3PTF A;  3BBZ A;  4NRG A;  2YB6 A;  2DZL A;  1ZV1 A;  4ONM A;  3OBS A;  3UIP A;  3T6P A;  1F4I A;  1JAT B;  3RCZ B;  1M4P A;  2H2Y A;  2YHO B;  4IP3 B;  2EBM A;  3VON B;  3K9P A;  1HT2 E;  3OJ4 A;  5AIT D;  3L1Z A;  4V3K A;  2EJS A;  1YRV A;  4Q5H C;  2K07 A;  3JW0 A;  1ZMW A;  3P9G A;  4NR3 B;  1A3S A;  1U9A A;  5F6X A;  1OKS A;  1XB2 B;  1C4Z D;  4ONN B;  4DDG A;  3EVX A;  2AAK A;  1TR8 A;  1VEJ A;  4YII U;  2LTU A;  2GRN A;  1BVS A;  1WHC A;  1Z3D A;  1JBB A;  1VEK A;  5D1M A;  2F4W A;  2CWB A;  2XWU A;  4ZNY A;  2GMI B;  4JQU A;  2C4P A;  3E21 A;  2Z6P A;  2L4F A;  3A33 A;  5F6D A;  5EGG A;  1IXS A;  1GO5 A;  1HQY E;  3RPG A;  1TTE A;  1QCQ A;  1A5T A;  2YZ0 A;  3P9H A;  2ONU A;  1X23 A;  3FRI A;  1M4Q A;  2Y9P A;  3A4S A;  1AYZ A;  1HT1 E;  1UFZ A;  5F6W A;  2LBC A;  2OXQ A;  1WJ7 A;  4DS2 A;  1KPQ A;  1WZV A;  2R0I A;  2DAW A;  5FQ2 A;  4DHJ C;  1UKX A;  4Q7J A;  5FER B;  1J74 A;  5DFL A;  2G3Q A;  3GLH E;  4JUE A;  3O2U A;  2MJ5 B;  5JI2 E;  1FBV C;  1Z5S A;  4BWF A;  2OB4 A;  3IEC A;  2UCZ A;  2FUH A;  3H4J A;  2JY8 A;  1VG5 A;  4A4C C;  2FO3 A;  2A7L A;  2DAX A;  2JY7 A;  1OAI A;  2Q0V A;  4A4B C;  3E95 C;  5AIT B;  1PGY A;  4M1N A;  1YF9 A;  1V92 A;  1DO2 A;  3EB6 B;  3R3Q A;  3LCU A;  5F6V A;  2KNA A;  2DMF A;  3GLI E;  2BEP A;  2MGW A;  1Y8G A;  3UIO A;  5D1K A;  2BWB A;  2H5X A;  2RRU A;  1Q02 A;  5JNE B;  1U9B A;  4L83 A;  1VDL A;  2ESQ A;  5IFR A;  1EFU B;  5D2M A;  2GJD A;  2GRR A;  1NV9 A;  2DAI A;  2HWJ A;  2Y9M A;  2K9D A;  4NRG B;  2EKF A;  2O25 A;  2Z6O A;  2EKE A;  2DAM A;  3FE3 A;  1UZX A;  2CYX A;  3K9O A;  4UN2 B;  1ZDN A;  2R0J A;  1J7D B;  1JAS A;  4DDI A;  2K0B X;  1OTR A;  2JUJ A;  2QSF X;  2GRO A;  1G3I A;  1E94 E;  3GLG E;  3W31 B;  1P3Q Q;  1ZGU A;  2ZTD A;  1WIV A;  4ONN A;  5HPT C;  1Y6L A;  4TKP A;  3KPA A;  4ONM B;  1KPP A;  2DAG A;  4A49 B;  2Y4W A; 
#chains in the Genus database with same CATH topology
 2LVQ D;  4K0K M;  2C2V B;  4AW4 A;  4BLC A;  2XFT A;  2UU9 M;  3J81 S;  3GQ3 A;  4JV5 M;  3UJN A;  4QPL B;  3GPP A;  5AIE B;  1SXJ C;  2FH0 A;  1Q3B A;  3U6C A;  5DNY A;  1L2B A;  3UZU A;  1Z2U A;  2HCB A;  1SG9 A;  2PWQ A;  2A4D A;  4W5V A;  4G3O A;  4DR2 M;  4MB7 A;  4BVU B;  1NO1 A;  3SC3 A;  5EP3 A;  3DFZ A;  3C58 A;  3KS4 A;  4JI2 M;  1IFY A;  3GRU A;  1QYR A;  2C9C A;  3HU3 A;  4KT0 F;  3SAT A;  5BR8 M;  4EJE A;  3SMS A;  1IQP A;  3J27 B;  3JR4 A;  3FD9 A;  2XZF A;  2KJH A;  4JI6 M;  1XNR M;  2ZBK B;  5F6X A;  1NJG A;  2KXE A;  3L2A A;  4CJ6 A;  3K2L A;  1KPS A;  4HL4 A;  4L6V 6;  1IBK M;  4GIT A;  3KXE C;  3IG5 A;  3A98 B;  1J7D A;  1MN3 A;  2M60 A;  4BBA A;  3U60 B;  3E46 A;  4G6Z A;  4XGI A;  2YNM D;  2GRQ A;  3K92 A;  4GC5 A;  4LZZ A;  3RGS A;  4PCZ A;  4X62 M;  1S1Q A;  1FNN A;  3AKZ A;  2MRO B;  4M0W A;  5EQT A;  4FH1 A;  4S3O A;  2R45 A;  2QGX A;  1QVR A;  4IBF A;  4LF6 M;  2F0R A;  1T43 A;  2VRR A;  5D0M A;  4DV6 M;  3MMP A;  2R46 A;  1HJP A;  3Q8G A;  3TGD A;  2MR9 A;  3KOY E;  4GEW A;  1ZMV A;  2M5Z A;  4D81 A;  3FUU A;  5KPT A;  4P17 A;  2EDI A;  1J5E M;  2KHH A;  5LMU M;  3PNV A;  4Y1L A;  3J7B A;  3W0L B;  2J5Y A;  2LH0 A;  3I4Y A;  3KOX E;  4LGM A;  1G41 A;  2BF8 A;  4AKI A;  4CCG A;  5IT9 S;  3I51 A;  3KOW E;  3K1J A;  4Z6Y A;  3LW5 F;  4ONM A;  2JA2 A;  2WZJ A;  3FUW A;  5DYI A;  4F1I A;  3ZQS A;  4JYA M;  2LWX A;  3L29 A;  2AYV A;  4B7G A;  2X8A A;  1KSF X;  4MGH A;  3UIP A;  4KO8 A;  4CGY B;  2GQF A;  3FRH A;  3LCV B;  4DR6 M;  1QAM A;  2L6O A;  7CAT A;  3FSH A;  3ONG B;  2KZS A;  3SY2 C;  3U6P A;  4IBK A;  2APL A;  2J7O A;  4FCV A;  4Q5E C;  4B08 A;  2DAK A;  2LHC A;  4L15 A;  3VKG A;  2Y0T A;  3KDS E;  1YH2 A;  4B3T M;  1PRB A;  1HR0 M;  1WXQ A;  2HLW A;  4MGI E;  1XXH E;  5D1L A;  1OAO C;  3I04 M;  2ZAN A;  3MK6 A;  3GLI B;  2Y0Q A;  4M9Z A;  1K3X A;  1PZV A;  1IY0 A;  5AIU B;  1T6O A;  3HU1 A;  1Q34 A;  4W5W A;  4PDG A;  1OJL A;  1XMO M;  1G4A E;  2DNA A;  3OBQ A;  2AWF A;  1PM5 A;  3CF2 A;  5ITT A;  1GKI A;  2C5R A;  2JY5 A;  2DWL A;  2LVA A;  3TWK A;  4DV1 M;  1ZMU A;  3CGW A;  4ONL B;  2R18 A;  3QAU A;  4IJE A;  1E32 A;  1IN7 A;  4IBB A;  3VDU A;  2JZ1 A;  2W82 A;  3TL4 X;  4DUZ M;  2F5O A;  3SHG B;  1OIZ A;  3HGI A;  2OPF A;  1GJT A;  4TUW A;  4AG5 A;  2BWE A;  3L1Y A;  4MDK A;  4JI3 M;  3ZNI C;  3HJ8 A;  4G4O A;  3U6Q A;  2LVP C;  1MJG M;  3HHY A;  3GQ5 A;  1WGL A;  2DEN A;  1YLA A;  3VFD A;  1Z5B A;  1W4U A;  2DAE A;  3TPZ A;  1L8Q A;  4A3V B;  3AL0 C;  3M6A A;  3U6S A;  1Y8X A;  2CLW B;  1E9R A;  4FWG A;  1CUK A;  3SQV C;  2ESP A;  1WR1 B;  4OX9 M;  1FXT A;  4DV0 M;  1FZY A;  3SAV A;  2EKK A;  2G5G X;  1NJF A;  3UIN A;  1LTM A;  4WP2 A;  1Q39 A;  3R9X B;  2EBK A;  2C2V C;  1DGB A;  1WGN A;  3E9S A;  4DV3 M;  2ZTC A;  3LQR A;  3W0F A;  5H37 D;  2LNH C;  3AV0 A;  3VK7 A;  1QDR A;  1Z6T A;  3Q8X A;  3TQS A;  2JZ0 A;  3FYD A;  4XK8 F;  1QAN A;  4GH9 A;  3GLF A;  2R65 A;  2FE8 A;  1H6U A;  2Z8Y M;  3SAS A;  3OBX A;  3EIH A;  4NRI B;  4DHI D;  1N36 M;  4BB9 A;  3B89 A;  4DHZ F;  1L1Z A;  2QNJ A;  2R44 A;  5FTK A;  1DGF A;  2QEN A;  3FUV A;  3LMM A;  4FCW A;  3VK8 A;  1K82 A;  2NVU C;  4X57 A;  1QAO A;  4IJF A;  1G8P A;  1R7R A;  2B3T A;  3B7Z A;  4MM3 B;  2KLY A;  1TH3 A;  2OOB A;  4LCB A;  2O25 C;  2AHM A;  2Y20 A;  1QZE A;  4JI0 M;  2JNH A;  2R6F A;  2F5P A;  1AIP C;  2L4E A;  4DBG B;  2DVW B;  4I4L A;  1N33 M;  4B3R M;  5F3W A;  3GLF E;  4LRS A;  2UXB M;  3FN1 B;  4LAD A;  4G4Q A;  1X37 A;  5IWA M;  3HWS A;  3WHL A;  1QUS A;  3GLG B;  2XZU A;  4ANR A;  1IM2 A;  1DV0 A;  4NR3 A;  5F6Y A;  4WZ3 A;  3V76 A;  3R42 A;  1L2D A;  2QP9 X;  2MH8 A;  4LDT C;  3H8K A;  1Z5A A;  4DR1 M;  3VKH A;  1ZUO A;  2LXP A;  3WE5 A;  4HEO A;  2JY6 B;  2E2C A;  3B7N A;  2LVN C;  3C3E A;  3HCT B;  3IG8 A;  2LVO C;  2LHG A;  3U5Z A;  2UUB M;  3OBU A;  2O01 F;  3VDP A;  4ONL A;  4P5O G;  3FYC A;  1NHG C;  3E4R A;  4IBD A;  5D0K A;  2L2D A;  3DA1 A;  2OO9 A;  2CLW A;  5F6U A;  1OQY A;  1S3S A;  3D8B A;  3FUT A;  2KEB A;  1NNJ A;  3CEG A;  1QZM A;  4RKU F;  2DAY A;  1SXJ D;  1HNX M;  4AP4 B;  3JVZ A;  4R62 A;  4MGY E;  4LRT A;  3I01 M;  4II2 C;  2CHQ A;  4LJ5 A;  2DHY A;  2ESK A;  3VON C;  4FCT A;  2CUZ A;  4PDI A;  3L25 A;  3HCU B;  1ZQ9 A;  4M9S A;  4GHL A;  3ZCB B;  2VF8 A;  1JB0 F;  2KRK A;  4DV5 M;  5BPV A;  1WZW A;  3VLF B;  5KNL C;  4LJ4 A;  1L2C A;  3GQ4 A;  2KNZ A;  3GRR A;  3ZQJ A;  3SAW A;  1XC8 A;  3E95 A;  4X64 M;  2I7P A;  5EP1 A;  3U6M A;  5EP2 A;  4LJ9 A;  3FTE A;  3KW6 A;  4IBE A;  4MGZ E;  4R71 A;  1W5S A;  2CHG A;  1DGH A;  3CF0 A;  2PX9 B;  3BZH A;  2PE6 A;  2DHR A;  3DZD A;  3RZ3 A;  2KZU A;  1I7K A;  2FOI C;  2KW0 A;  3B74 A;  5EXP A;  1J7K A;  4DR5 M;  1JAT A;  2F4Z A;  2HAK A;  2CFO A;  2VQF M;  4NRI A;  2UYZ A;  3I4V A;  3R3Q A;  1HNZ M;  2R4E A;  3LQQ A;  2FFJ A;  4LJA A;  3JAM S;  2GMI A;  1DO0 A;  1E9S A;  2V1C A;  2DKL A;  3J2P B;  2GRP A;  2JP7 A;  4REZ A;  3KP1 E;  4DV2 M;  1C7Y A;  5EXS A;  3F92 A;  3GPX A;  1NHW C;  1NV8 A;  1IN6 A;  8CAT A;  4YC1 A;  3HKP A;  2Z5D A;  2OOA A;  4QHT A;  5EJC A;  2MT6 A;  5A2Q S;  1K3W A;  2DI0 A;  4JN6 A;  3SFZ A;  1JR3 E;  4NXM M;  1PJQ A;  5ITR A;  2YBF A;  3FTD A;  2KA6 B;  1QUT A;  3MJ5 A;  2CP8 A;  4GRI A;  1VEG A;  3FUX A;  1VQ1 A;  2QZ4 A;  2HKJ A;  3L27 A;  1R4G A;  2K6B A;  1LV7 A;  2JXN A;  3EIE A;  3IHP A;  4FWD A;  4EIW A;  1KYI A;  5KQ8 A;  2KNV A;  2QHO B;  4LFC M;  4GPR A;  4V3L A;  4AQY M;  2UUC M;  3FKE A;  3GRV A;  4R3D A;  3UGB A;  4Y1L C;  3CTW B;  5F6E A;  4F2L A;  3PTF A;  3BBZ A;  4NRG A;  2BJW A;  2YB6 A;  1OFH A;  4JI8 M;  2ZM6 M;  4P16 A;  3RGP A;  2DZL A;  1ZV1 A;  4AG6 A;  3OBS A;  1IN8 A;  2UXD M;  3T6P A;  2XGN A;  2OQ4 A;  1FJG M;  1F4I A;  2X4A A;  4QNM A;  4D80 A;  1JAT B;  2H1R A;  5FSW A;  2WSE F;  1L1T A;  1M4P A;  3RCZ B;  2H2Y A;  4ITQ A;  3AOE C;  2YHO B;  4IP3 B;  1TDZ A;  3K8Z A;  4NSO B;  3TWL A;  2EBM A;  3VON B;  2KRU A;  3K9P A;  1NNU C;  2VII A;  2Z3X A;  1J09 A;  1XXH B;  4II7 A;  1HT2 E;  3T15 A;  3OJ4 A;  5AIT D;  5ITQ A;  1EE8 A;  3GLH B;  1PJJ A;  3L1Z A;  4G4R A;  4V3K A;  3KP0 E;  2EJS A;  1I4W A;  4MH0 E;  2XH9 A;  1AUA A;  2EO2 A;  2XSZ A;  3AOG A;  3T1H M;  3M0E A;  4GKK M;  1YRV A;  4Q5H C;  2K07 A;  1OIP A;  1Z59 A;  4R7G A;  4NRW A;  3JW0 A;  4RF1 A;  1I94 M;  2C9O A;  5DYG A;  1Z5C A;  1ZMW A;  3P9G A;  4LFA M;  1A3S A;  1U9A A;  4NR3 B;  1IN4 A;  4NSR A;  4GC9 A;  4B7H A;  1N75 A;  2DWM A;  1QAQ A;  1IN5 A;  1QDT A;  3L28 A;  3KVW A;  3LVV A;  2NQ8 C;  4KLN A;  4KOD A;  5FTN A;  3UGJ A;  1OKS A;  1XB2 B;  3B9P A;  5E6J A;  2CV0 A;  2YQZ A;  3KFU G;  1C4Z D;  1D0M A;  4FWH A;  3GRY A;  3SAU A;  4JI1 M;  3EVX A;  4ONN B;  4JI4 M;  4MGK E;  4DDG A;  2LXE A;  2F5S A;  4WW0 A;  1GL7 A;  2AAK A;  1TR8 A;  1N32 M;  2DZN B;  4QOZ C;  3A42 A;  3KOZ E;  3HY5 A;  1VEJ A;  4YII U;  4QNR A;  1JR3 D;  2LTU A;  2XFS A;  2GRN A;  4LJ7 A;  1BVS A;  1NY5 A;  1TDH A;  1WHC A;  2QPA A;  2HL7 A;  2HHH M;  1JBB A;  1Z3D A;  1VEK A;  3AFH A;  3NBI A;  2VDB B;  1YSY A;  3MHV C;  4WUR A;  5D1M A;  3SYK A;  2G8L A;  3WHK A;  3B7Q A;  3SHF A;  4NOO B;  4RNA A;  2BJV A;  2F4W A;  3C3D A;  4OW0 A;  4HLQ A;  2CWB A;  2D7G A;  1IY2 A;  3U60 A;  1G59 A;  3PVS A;  3PXG A;  3ILK A;  1HNW M;  2XWU A;  2QBY A;  2CV2 A;  4ZNY A;  4LZJ A;  2GMI B;  1NSF A;  4S12 A;  4G4N A;  4LGY A;  2C4P A;  3E21 A;  2Z6P A;  4JQU A;  2JWS A;  1PJS A;  2CRU A;  2L4F A;  3GLF B;  3A33 A;  5F6D A;  3U6D A;  5EGG A;  1IXS A;  3ZC7 B;  3SBJ A;  4OU7 A;  1GO5 A;  2BNK A;  4I5S A;  1HQY E;  5FLX S;  5FTM A;  1ORY B;  2EUC A;  4LJ6 A;  4B7F A;  3U61 B;  4B3S M;  3LVW A;  1NVM A;  3RPG A;  2CHV A;  1TTE A;  1QCQ A;  4DR3 M;  1A5T A;  4OVZ B;  4I8O A;  2YZ0 A;  2ONU A;  1X23 A;  3P9H A;  5GKN A;  3FRI A;  2XLJ A;  2ESO A;  2J7N A;  1M4Q A;  2Y9P A;  1V34 A;  3A4S A;  1C1K A;  5IRE B;  1DGG A;  1HT1 E;  1AYZ A;  3A46 A;  1UFZ A;  2QQ8 A;  2D7E A;  2X49 A;  3GPU A;  1PJI A;  5F6W A;  2LBC A;  4RF0 A;  1WJ7 A;  2OXQ A;  4DS2 A;  1KPQ A;  1OFI A;  5ITX E;  1WZV A;  4PD2 A;  2R0I A;  5KPR A;  4GKJ M;  2Y21 A;  3H4M A;  3HHW A;  3U61 A;  2DAW A;  3U6L A;  5FQ2 A;  1UKX A;  4DHJ C;  1RU3 A;  2ERC A;  5E26 A;  1NY6 A;  2XEP A;  4Q7J A;  4M9X A;  5KO3 A;  5FER B;  1J74 A;  1V33 A;  1MX0 A;  4YY3 M;  2I7N A;  4DR7 M;  4NRV A;  5DFL A;  1XNQ M;  2Z4S A;  3RE8 A;  2G3Q A;  2Q2E B;  3GPY A;  1SXJ E;  3HHX A;  3GLH E;  2VF7 A;  1IXZ A;  3A45 A;  3KSX A;  4JUE A;  4OVZ A;  1EIJ A;  1VDD A;  3O2U A;  2MJ5 B;  4XBO A;  1D2N A;  5JI2 E;  1FBV C;  1Z5S A;  3D8L A;  3RFW A;  1MU5 A;  3W68 A;  3R8F A;  4BWF A;  5JI3 E;  1HQC A;  2WSC F;  1N34 M;  2OB4 A;  1N77 A;  1GL6 A;  4B3M M;  3OTO M;  3L26 A;  3IEC A;  4X65 M;  2UCZ A;  4QHS A;  5LMN M;  3H4J A;  2JY8 A;  1VG5 A;  3GLG A;  1KFV A;  2FUH A;  4A4C C;  2ZAO A;  4IBG A;  1IY1 A;  4IBI A;  2F4V M;  3KS8 A;  2A7L A;  2R4J A;  4Z8X A;  3W67 A;  2DAX A;  2FO3 A;  2JY7 A;  1OAI A;  3CF6 E;  3FTC A;  3QWL A;  3GO8 A;  3SMP A;  1JR3 A;  2KDL A;  2Q0V A;  4A4B C;  3PNY A;  4M0D A;  4LF4 M;  2XF3 A;  2L09 A;  3HU2 A;  4FVM A;  4LF8 M;  4AI6 A;  4CIZ A;  4ZPX A;  1ZAE A;  2RGH A;  4DV4 M;  3E95 C;  2RGO A;  1GJS A;  4GMQ A;  5AIT B;  2F5N A;  1PGY A;  3FTF A;  4M1N A;  2UUA M;  1G71 A;  2YR0 A;  3NWL A;  2V1U A;  4NL4 H;  5KPZ A;  4JI7 M;  1YF9 A;  3U6O A;  1V92 A;  2FS1 A;  1DGH B;  1R2Z A;  1DO2 A;  3HZJ A;  1YUB A;  1IXS B;  1IXR C;  2D7H A;  2N35 A;  2WSF F;  2C99 A;  3HJQ A;  3LCU A;  3NBX X;  3QYB A;  2KNA A;  1GLN A;  2GNO A;  5F6V A;  2YFQ A;  2E5L M;  3M7G A;  2DMF A;  4LF5 M;  2QCU A;  2DWZ B;  3AJI B;  5C1B A;  3GLI E;  2BEP A;  1N78 A;  1SXJ B;  2MGW A;  3UMM A;  4JI5 M;  2FNA A;  1GAB A;  1Y8G A;  3HHZ A;  4LG2 A;  3U6E A;  1T3T A;  4LFB M;  2QBY B;  5D1K A;  3UIO A;  5KQD A;  4GHA A;  1PJT A;  1XHB A;  5IZ7 D;  2L7I A;  1IBL M;  2CE7 A;  2BWB A;  4LY6 A;  2RKO A;  3SYL A;  5EXT A;  1Q3C A;  3AOE A;  4LJ8 A;  4NXN M;  1QQW A;  3T1Y M;  5FTJ A;  2H5X A;  3T38 A;  4AZF A;  4DUY M;  2RRU A;  1Q02 A;  5JNE B;  2C98 A;  2EA0 A;  5EP4 A;  3GLH A;  3HJS A;  4FD2 A;  2UXC M;  5EXX A;  5L8R F;  1U9B A;  1XXH A;  2Z4R A;  4GIP A;  4CIS A;  4L83 A;  1VDL A;  3ZH9 B;  3EB6 B;  4X66 M;  2ZAM A;  3DOA A;  3GLI A;  3J7A S;  1D0L A;  4YHH M;  4LF9 M;  2R62 A;  1EFU B;  2ESQ A;  5IFR A;  4D82 A;  1UM8 A;  5C18 A;  2GJD A;  3C9P A;  2P5T A;  5D2M A;  3QYE A;  4Y28 F;  5ITY A;  2CEA A;  5ITX A;  1IBM M;  2GRR A;  4FW9 A;  1NV9 A;  1TH4 A;  2DAI A;  2HWJ A;  2F5Q A;  4CHT B;  2Y9M A;  1R2Y A;  1GVN A;  3BOS A;  2DZO B;  2K9D A;  4AKG A;  1TH2 A;  3UK6 A;  4NRG B;  2O25 A;  1W5T A;  1TGU A;  2EKF A;  2EKE A;  2DAM A;  4DV7 M;  4DR4 M;  2Z6O A;  3FE3 A;  4NC6 A;  1UZX A;  4L4U A;  5FTL A;  1XWI A;  3K9O A;  4LF7 M;  2CYX A;  4UN2 B;  3BXW A;  1ZDN A;  3PFI A;  2R0J A;  3J80 S;  1J7D B;  1JAS A;  4DDI A;  2K0B X;  4QOS A;  1OTR A;  2JUJ A;  3GP1 A;  1TF0 B;  2QSF X;  3THG A;  3TE6 A;  2GRO A;  1JQJ C;  2Z7J A;  4L16 A;  4L8R C;  2VQE M;  4L78 A;  1G3I A;  3SAR A;  4IIW A;  1E94 E;  2K47 A;  3GLG E;  4I81 A;  3W31 B;  2DWN A;  3JR5 A;  1P3Q Q;  1ZGU A;  2L7H A;  1D0K A;  4KHP M;  2ZTD A;  1WIV A;  3KSJ A;  1XMQ M;  4ONN A;  5HPT C;  3HX3 A;  2CV1 A;  1Y6L A;  4TKP A;  4AKH A;  1R5L A;  2O5R A;  5ITU A;  3KPA A;  4ONM B;  1YE9 A;  1KPP A;  2DAG A;  1SXJ A;  4JXJ A;  4AUQ A;  1R6B X;  2DXI A;  2XSZ D;  4IBC A;  3TWM A;  2C96 A;  3U5Z B;  4A49 B;  2Y4W A;  4PT5 A;  2A5Y B;  4IBJ A;  2V6Z M; 
#chains in the Genus database with same CATH homology
 2LVQ D;  2C2V B;  4QPL B;  5AIE B;  1Z2U A;  1SG9 A;  2PWQ A;  2A4D A;  4W5V A;  4G3O A;  4BVU B;  1IFY A;  4EJE A;  2KJH A;  1KPS A;  1J7D A;  1MN3 A;  3E46 A;  2GRQ A;  1S1Q A;  2MRO B;  4FH1 A;  4S3O A;  2QGX A;  2F0R A;  1T43 A;  2VRR A;  5D0M A;  3MMP A;  1HJP A;  3TGD A;  2MR9 A;  4GEW A;  1ZMV A;  2EDI A;  2KHH A;  4Y1L A;  2BF8 A;  1G41 A;  4CCG A;  2WZJ A;  4F1I A;  3ZQS A;  2AYV A;  3FRH A;  3LCV B;  3FSH A;  3SY2 C;  3ONG B;  4Q5E C;  2DAK A;  1YH2 A;  2HLW A;  1XXH E;  5D1L A;  1PZV A;  5AIU B;  1T6O A;  1Q34 A;  1G4A E;  2DNA A;  3OBQ A;  2AWF A;  2JY5 A;  2LVA A;  4ONL B;  1ZMU A;  2JZ1 A;  5F6E A;  3L1Y A;  2BWE A;  4MDK A;  2LVP C;  1WGL A;  2DEN A;  1YLA A;  1W4U A;  2DAE A;  1Y8X A;  3SQV C;  2CLW B;  1CUK A;  2ESP A;  1WR1 B;  1FXT A;  1FZY A;  2EKK A;  3UIN A;  4WP2 A;  2EBK A;  2C2V C;  1WGN A;  2ZTC A;  2JZ0 A;  3OBX A;  4NRI B;  4DHI D;  3B89 A;  4DHZ F;  2QNJ A;  2NVU C;  4X57 A;  2B3T A;  2KLY A;  2OOB A;  2O25 C;  1QZE A;  2ESO A;  2JNH A;  4AUQ A;  1AIP C;  2L4E A;  4DBG B;  3GLF E;  3FN1 B;  4LAD A;  4NR3 A;  1IM2 A;  1DV0 A;  5F6Y A;  4WZ3 A;  3R42 A;  4LDT C;  3H8K A;  1ZUO A;  2LXP A;  3WE5 A;  4HEO A;  2JY6 B;  2E2C A;  2LVN C;  3HCT B;  2LVO C;  3OBU A;  4ONL A;  4P5O G;  5D0K A;  2L2D A;  2OO9 A;  2CLW A;  5F6U A;  1OQY A;  3CEG A;  2DAY A;  4AP4 B;  3JVZ A;  4R62 A;  4II2 C;  2DHY A;  2ESK A;  3VON C;  3HCU B;  1WZW A;  5KNL C;  2KNZ A;  3E95 A;  4R71 A;  2PX9 B;  3BZH A;  2PE6 A;  3ZNI C;  3RZ3 A;  2F4Z A;  1I7K A;  1JAT A;  2HAK A;  4NRI A;  2UYZ A;  2GMI A;  1DO0 A;  2DKL A;  2GRP A;  2JP7 A;  1C7Y A;  3F92 A;  1NV8 A;  4YC1 A;  2Z5D A;  2OOA A;  2MT6 A;  2DI0 A;  1JR3 E;  2YBF A;  2CP8 A;  1VEG A;  1VQ1 A;  1R4G A;  3IHP A;  4GPR A;  1KYI A;  4V3L A;  2KNV A;  2QHO B;  3UGB A;  4Y1L C;  4F2L A;  3PTF A;  3BBZ A;  4NRG A;  2YB6 A;  2DZL A;  1ZV1 A;  4ONM A;  3OBS A;  3UIP A;  3T6P A;  1F4I A;  1JAT B;  3RCZ B;  1M4P A;  2H2Y A;  2YHO B;  4IP3 B;  2EBM A;  3VON B;  3K9P A;  1HT2 E;  3OJ4 A;  5AIT D;  3L1Z A;  4V3K A;  2EJS A;  1YRV A;  4Q5H C;  2K07 A;  3JW0 A;  1ZMW A;  3P9G A;  4NR3 B;  1A3S A;  1U9A A;  5F6X A;  1OKS A;  1XB2 B;  1C4Z D;  4ONN B;  4DDG A;  3EVX A;  2AAK A;  1TR8 A;  1VEJ A;  4YII U;  2LTU A;  2GRN A;  1BVS A;  1WHC A;  1Z3D A;  1JBB A;  1VEK A;  5D1M A;  2F4W A;  2CWB A;  2XWU A;  4ZNY A;  2GMI B;  4JQU A;  2C4P A;  3E21 A;  2Z6P A;  2L4F A;  3A33 A;  5F6D A;  5EGG A;  1IXS A;  1GO5 A;  1HQY E;  3RPG A;  1TTE A;  1QCQ A;  1A5T A;  2YZ0 A;  3P9H A;  2ONU A;  1X23 A;  3FRI A;  1M4Q A;  2Y9P A;  3A4S A;  1AYZ A;  1HT1 E;  1UFZ A;  5F6W A;  2LBC A;  2OXQ A;  1WJ7 A;  4DS2 A;  1KPQ A;  1WZV A;  2R0I A;  2DAW A;  5FQ2 A;  4DHJ C;  1UKX A;  4Q7J A;  5FER B;  1J74 A;  5DFL A;  2G3Q A;  3GLH E;  4JUE A;  3O2U A;  2MJ5 B;  5JI2 E;  1FBV C;  1Z5S A;  4BWF A;  2OB4 A;  3IEC A;  2UCZ A;  2FUH A;  3H4J A;  2JY8 A;  1VG5 A;  4A4C C;  2FO3 A;  2A7L A;  2DAX A;  2JY7 A;  1OAI A;  2Q0V A;  4A4B C;  3E95 C;  5AIT B;  1PGY A;  4M1N A;  1YF9 A;  1V92 A;  1DO2 A;  3EB6 B;  3R3Q A;  3LCU A;  5F6V A;  2KNA A;  2DMF A;  3GLI E;  2BEP A;  2MGW A;  1Y8G A;  3UIO A;  5D1K A;  2BWB A;  2H5X A;  2RRU A;  1Q02 A;  5JNE B;  1U9B A;  4L83 A;  1VDL A;  2ESQ A;  5IFR A;  1EFU B;  5D2M A;  2GJD A;  2GRR A;  1NV9 A;  2DAI A;  2HWJ A;  2Y9M A;  2K9D A;  4NRG B;  2EKF A;  2O25 A;  2Z6O A;  2EKE A;  2DAM A;  3FE3 A;  1UZX A;  2CYX A;  3K9O A;  4UN2 B;  1ZDN A;  2R0J A;  1J7D B;  1JAS A;  4DDI A;  2K0B X;  1OTR A;  2JUJ A;  2QSF X;  2GRO A;  1G3I A;  1E94 E;  3GLG E;  3W31 B;  1P3Q Q;  1ZGU A;  2ZTD A;  1WIV A;  4ONN A;  5HPT C;  1Y6L A;  4TKP A;  3KPA A;  4ONM B;  1KPP A;  2DAG A;  4A49 B;  2Y4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...