5DFLA

Crystal structure of ube2k~ubiquitin conjugate
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
199
structure length
199
Chain Sequence
AANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAIKLDILRDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLSAMGFDRNAVIVALSSKSWDVETATELLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title The molecular basis of lysine 48 ubiquitin chain synthesis by Ube2K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/signaling protein
total genus 68
structure length 199
sequence length 199
ec nomenclature ec 2.3.2.23: E2 ubiquitin-conjugating enzyme.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00179 UQ_con Ubiquitin-conjugating enzyme
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 5dflA02
3.10.110.10 Alpha Beta Roll Ubiquitin Conjugating Enzyme Ubiquitin Conjugating Enzyme 5dflA01
3BBZA 1UZXA 2XWUA 4W5VA 3SQVC 2K0BX 3CEGA 5F6EA 2MT6A 2GROA 1DO2A 3E95A 1YLAA 1CUKA 3ONGB 2K07A 2MR9A 3GLIE 1DO0A 1VG5A 3B89A 1T6OA 3IECA 3GLFE 1IM2A 2JP7A 2RRUA 3VONC 1WHCA 4TKPA 3HCUB 2GMIB 3BZHA 4AUQA 2DAIA 4G3OA 4JQUA 2JZ1A 2DAWA 1ZMUA 3PTFA 2AAKA 4Y1LC 1YRVA 1HJPA 4AP4B 2O25C 2LXPA 3RCZB 4II2C 1Q34A 4ONNB 2YHOB 4S3OA 3E95C 3UIPA 4IP3B 3F92A 4LDTC 3TGDA 1FZYA 1WZWA 2CLWB 2DAGA 1VEJA 4UN2B 5FQ2A 1P3QQ 5F6VA 2H5XA 4Q5EC 1Q02A 4HEOA 3LCVB 4Q7JA 2A4DA 4BWFA 2BEPA 2BWEA 4NR3A 2YBFA 1WIVA 2ESKA 2ESPA 1X23A 5AITD 3UIOA 2KNAA 2JY6B 4MDKA 2ZTDA 1FBVC 1KYIA 2F0RA 4ONMB 2F4ZA 2AWFA 1J7DB 5AITB 2OOAA 1KPPA 1A3SA 4NRIB 2GRPA 3P9GA 2L2DA 3VONB 2AYVA 5FERB 2Z6PA 4F1IA 2QNJA 1JATB 3ZQSA 1OKSA 1OAIA 1WR1B 4A49B 2OOBA 4GEWA 1T43A 2LVOC 3OBUA 2QGXA 3P9HA 1WJ7A 5JNEB 2QHOB 2LVNC 4EJEA 1SG9A 3GLHE 1GO5A 1ZMWA 2FUHA 5F6XA 1Z5SA 1Y8XA 1AYZA 4WZ3A 1Y6LA 2VRRA 1MN3A 1U9BA 4YC1A 5EGGA 3H4JA 1VEKA 2LBCA 2DAEA 3OBSA 3EB6B 1VEGA 3W31B 1Z2UA 2YB6A 1G3IA 1ZGUA 1C7YA 2JNHA 2DKLA 2ZTCA 5KNLC 1WGNA 1XXHE 2ESOA 3L1ZA 2BF8A 2DNAA 2EKEA 2HAKA 3A33A 1I7KA 5F6YA 4V3KA 2DI0A 2GMIA 1PGYA 3HCTB 2DZLA 2JY8A 5F6UA 1NV8A 2C2VB 2ESQA 5D1LA 2YZ0A 5D1MA 4CCGA 4GPRA 1C4ZD 1FXTA 3IHPA 2MROB 1V92A 4V3LA 2PE6A 1VQ1A 5D0MA 4DS2A 2L4EA 1QZEA 2H2YA 2UCZA 4ONNA 4NRGA 2GRNA 1ZUOA 4NR3B 3R3QA 4ONLA 2PWQA 4M1NA 2CLWA 2JY7A 4F2LA 3OJ4A 1NV9A 2MGWA 2F4WA 1UFZA 2KNVA 3A4SA 1J74A 4YIIU 3E46A 2EJSA 4JUEA 5D0KA 2LTUA 2R0IA 2PX9B 4FH1A 3T6PA 2OB4A 3EVXA 5AIEB 2ONUA 1Y8GA 4ONMA 1M4QA 1G4AE 2OO9A 3FRIA 1J7DA 3JW0A 2LVQD 1IXSA 2EBMA 4NRIA 3UGBA 2HLWA 5HPTC 2QSFX 1PZVA 2FO3A 3ZNIC 3UINA 1JATA 3O2UA 2R0JA 3K9PA 1G41A 1VDLA 1JASA 2Z6OA 1A5TA 2JUJA 1JR3E 2KLYA 3L1YA 1KPSA 2LVPC 2K9DA 2DAYA 2CP8A 2Y9PA 2Q0VA 4Y1LA 1TTEA 2O25A 4Q5HC 3KPAA 1UKXA 1ZDNA 3R42A 3GLGE 2NVUC 1HQYE 4DDIA 4DBGB 2EDIA 1M4PA 3WE5A 1ZMVA 3H8KA 1U9AA 5AIUB 3E21A 1YH2A 5D2MA 1KPQA 4R71A 4P5OG 2DMFA 1DV0A 3LCUA 3FN1B 2GJDA 2KNZA 2EKFA 2LVAA 1OQYA 1BVSA 4A4BC 2DHYA 2WZJA 2DAXA 2Z5DA 2GRRA 3FRHA 4A4CC 2BWBA 1WZVA 4R62A 1W4UA 3OBXA 1E94E 2CWBA 4DHZF 5D1KA 3MMPA 2DAKA 4DHID 3JVZA 2DENA 2Y9MA 1R4GA 4NRGB 1ZV1A 4ONLB 2UYZA 3RZ3A 5DFLA 2EKKA 1EFUB 2L4FA 2KHHA 2GRQA 1HT1E 1QCQA 1HT2E 1S1QA 4X57A 4LADA 5IFRA 2OXQA 2E2CA 2JY5A 2MJ5B 1IFYA 5F6DA 3RPGA 3OBQA 1YF9A 3FSHA 4BVUB 2KJHA 4DHJC 2G3QA 1F4IA 5F6WA 3SY2C 1JBBA 4L83A 4QPLB 4DDGA 3K9OA 1AIPC 2C4PA 2CYXA 2EBKA 2B3TA 2DAMA 4WP2A 2C2VC 2HWJA 4ZNYA 3FE3A 2A7LA 1WGLA 2Y4WA 2JZ0A 1Z3DA 5JI2E 1TR8A 1OTRA 1XB2B
chains in the Genus database with same CATH superfamily
2C99A 2XWUA 5F6EA 2FH0A 1NNJA 2MT6A 1IXRC 3R9XB 2GROA 1YLAA 2UU9M 1D0KA 3TL4X 3A98B 1IBMM 4IBKA 1VG5A 3FUVA 4M9SA 1D2NA 1IM2A 3U6EA 3VONC 2VQFM 3HCUB 1ORYB 3GLFA 3KSJA 2O5RA 2KA6B 4MB7A 5EXPA 4IBFA 5A2QS 3T38A 1LV7A 2JZ1A 1EE8A 1L1ZA 4CJ6A 3PTFA 4Y1LC 1YRVA 4AP4B 2QZ4A 1Q34A 3E95C 1N32M 3V76A 3IG8A 4LFCM 3TGDA 4JI8M 1N78A 4FWHA 3HU1A 2CLWB 3AOEA 3GQ4A 1P3QQ 2H5XA 1NJFA 1DGBA 4BWFA 3VDPA 2BEPA 2BWEA 3SYLA 1R2YA 3RGSA 3AFHA 4D81A 4L16A 1WIVA 1RU3A 2CV0A 2KNAA 1FBVC 2F4ZA 2OOAA 2X8AA 4II7A 2D7GA 2GRPA 5FSWA 4TUWA 2WSFF 5EQTA 4DV7M 3ZQSA 2A5YB 2UUCM 1N36M 3PVSA 3KVWA 3HU2A 1IN6A 2VF7A 5FTMA 1T43A 5FTLA 2QHOB 3J7AS 2CHQA 2CHVA 1AUAA 1Z5SA 4PD2A 1Y8XA 3DZDA 3CGWA 1HNZM 4WZ3A 1Y6LA 4DR2M 1GKIA 3SMSA 2Y21A 2I7PA 4QNMA 2LBCA 3OBSA 2DHRA 2ERCA 1GABA 3TPZA 1YE9A 2YB6A 2F5OA 1ZGUA 4GHAA 2FS1A 1XNQM 1WGNA 3SAUA 3U6CA 2K47A 2BF8A 2DNAA 1I7KA 3GQ5A 2GMIA 5KPZA 2H1RA 5BR8M 2YZ0A 1VDDA 2MROB 4IJEA 2J7NA 4V3LA 2QPAA 4DS2A 4KHPM 2UCZA 2YNMD 2JWSA 1ZUOA 4NR3B 4ONLA 2PWQA 4G6ZA 3GO8A 4F2LA 3OJ4A 1NV9A 4FCVA 4AZFA 3TWLA 4I5SA 3C3EA 3J2PB 1J5EM 5EP3A 3KS4A 3T6PA 2OB4A 4G4OA 2XSZA 2XFTA 3J81S 2UXBM 3GQ3A 4DV1M 4ONMA 1G4AE 3UJNA 1L2DA 3FRIA 3MJ5A 1DGHA 1ZQ9A 3A46A 1J7DA 2EBMA 3CTWB 3UGBA 3GRYA 4IJFA 2QSFX 1MU5A 1OIPA 2R0JA 2Y0QA 3K9PA 4G4RA 1G41A 1XMQM 5LMNM 3B74A 2KEBA 1VDLA 1A5TA 2LVPC 2RGHA 2DAYA 2O01F 4Z6YA 2O25A 3FUTA 5ITXE 3KPAA 1ZDNA 3R42A 3GLFB 3ILKA 4RKUF 1M4PA 2XFSA 3GLGA 3I51A 4B3MM 3GPPA 4R71A 2JA2A 3L25A 1DV0A 3FN1B 2KNZA 2KZUA 2VQEM 1OQYA 1IXZA 1BVSA 3PNYA 4LRSA 2DAXA 2GRRA 3FRHA 5FTKA 3CF6E 1W4UA 4DHZF 3K92A 4M0DA 3JVZA 2DENA 2Y9MA 4NRGB 4LF4M 2C9OA 1EFUB 1L2BA 2L4FA 3GPXA 3J27B 3VK8A 2WSEF 2E2CA 3LW5F 1IN7A 3AOGA 5F6DA 3OBQA 1GJSA 1XHBA 4BVUB 2R62A 4DHJC 4L83A 1OFIA 3W67A 2C9CA 4DDGA 3KOXE 4JI0M 2Z8YM 2R4JA 3SC3A 2A7LA 1WGLA 3GLHB 3LQRA 4NRWA 2F4VM 4W5VA 3SQVC 3CEGA 1FJGM 1DO2A 4NC6A 1C1KA 3HGIA 3NBIA 4W5WA 2OPFA 3ZQJA 3D8BA 3U61A 2QQ8A 3HY5A 3B89A 3FUXA 3IECA 4HLQA 1DGGA 1HNWM 4DR5M 1XXHB 2GMIB 4NRVA 3FD9A 4LGMA 1NNUC 1NY5A 1QVRA 3SARA 3JAMS 3PFIA 5FTJA 2D7HA 1L8QA 4AW4A 2R65A 2LXPA 2YHOB 1NJGA 4LZZA 4LDTC 5E6JA 1NY6A 5FTNA 5FLXS 1FZYA 3HJSA 4DV5M 4FD2A 3U6SA 3LCVB 4Q7JA 4BB9A 1Z5AA 3KP0E 2XSZD 2GNOA 4NR3A 1X23A 4L8RC 5EXTA 4LG2A 5AITD 5ITQA 3I4VA 4GH9A 1KYIA 3GRUA 1QANA 4NSOB 4ONMB 1DGHB 4XGIA 3I4YA 1J7DB 5AITB 3NWLA 1KPPA 1A3SA 1QYRA 2L2DA 3QYEA 2AYVA 1L2CA 2W82A 4P17A 3SFZA 1OKSA 1OAIA 1WR1B 2Z4SA 2OOBA 4GEWA 4GRIA 2QGXA 3P9HA 1WJ7A 4JI2M 2LVNC 2X4AA 3SAWA 3C58A 1ZMWA 2LWXA 4REZA 1XNRM 5ITTA 1QAOA 3M7GA 3FYCA 1R6BX 1IBLM 4X62M 4RF0A 2G8LA 1U9BA 2UUBM 3GLGB 4FWGA 3B7QA 2XLJA 3W0LB 2DWNA 3U6LA 1VEKA 1OJLA 2DAEA 4LF9M 1K82A 4DR1M 3EB6B 3W31B 2L7IA 1Z2UA 4K0KM 4S12A 2JNHA 4DV3M 2ZTCA 4GKJM 4DR7M 3L1ZA 1V34A 2VIIA 5ITRA 4L4UA 3A33A 2EO2A 2DI0A 1QUTA 4JYAM 1SXJC 1NV8A 2C2VB 4QOSA 1R5LA 3LVVA 5D1MA 4ZPXA 4GPRA 4AG5A 1FXTA 1IY1A 2KZSA 1QZEA 2F5QA 1T3TA 4ONNA 1N75A 4NRGA 2CRUA 4A3VB 3R3QA 4M1NA 4DUZM 4Z8XA 2FFJA 2F4WA 1J74A 4IBIA 4JUEA 4NL4H 2R0IA 4AG6A 4JXJA 2Z4RA 3VLFB 5AIEB 3I01M 2V6ZM 4KO8A 2YR0A 2GQFA 2DXIA 2G5GX 3JW0A 2MH8A 4MGIE 3L28A 4MGZE 3VDUA 1PZVA 2FO3A 4QHTA 3ZNIC 3UINA 1JATA 3O2UA 4LJAA 3KFUG 2M5ZA 3GLHA 2Z6OA 3U61B 1JR3E 2NQ8C 2L09A 1IQPA 1PJTA 1IBKM 4JI4M 2CP8A 2Y9PA 2Q0VA 4L78A 4I8OA 4Y1LA 1TTEA 1UKXA 3UGJA 1HQYE 2BJVA 4DBGB 1IY0A 3HZJA 2R45A 1G8PA 7CATA 5ITXA 4AKHA 3HHWA 4LCBA 2ZM6M 3FUUA 1G71A 3LCUA 1XXHA 2F5NA 1PJQA 2L7HA 5H37D 4OX9M 2R6FA 4IBJA 2XZUA 2WZJA 4IBEA 4PDGA 3QYBA 2APLA 1GLNA 4LF5M 4A4CC 2BWBA 1WZVA 1E94E 3D8LA 4JI6M 3CF2A 1QDTA 3MMPA 2DAKA 1R4GA 2BJWA 2LHCA 2UUAM 2DVWB 2UYZA 5DFLA 2EKKA 4FVMA 5KQ8A 1NHGC 2GRQA 1HT1E 2Y20A 3HHXA 1TGUA 3AKZA 4DV4M 1TDHA 3KSXA 3U5ZA 4B3SM 5IFRA 4DR6M 2OXQA 5L8RF 2C96A 2JY5A 3U60A 1NHWC 3KXEC 1GL7A 1YF9A 3FSHA 4XK8F 2KJHA 2XEPA 2G3QA 1F4IA 5F6WA 3SY2C 1JBBA 4CIZA 4LGYA 4AKGA 4AKIA 2Y0TA 5E26A 4ANRA 2DAMA 4WP2A 2C2VC 4ZNYA 4WW0A 4IBGA 3GRRA 2CV1A 2Y4WA 2JZ0A 1Z3DA 1TR8A 3BBZA 1SXJE 1UZXA 2K0BX 1PRBA 1TH2A 2XF3A 1QAMA 3ZCBB 2LXEA 2DZNB 4JI5M 1CUKA 1Z5CA 3ONGB 2K07A 2MR9A 4M9ZA 4XBOA 3GLIE 2EUCA 1DO0A 1T6OA 1EIJA 2C5RA 1Z6TA 2JP7A 2RRUA 3K8ZA 1WHCA 4TKPA 3HU3A 3BZHA 4GC9A 1Q3BA 4JI1M 2VDBB 8CATA 2P5TA 2DAWA 1L1TA 1ZMUA 4NXMM 4FCWA 3RCZB 3L26A 4ITQA 4ONNB 4S3OA 4IP3B 3F92A 1NSFA 4DR4M 1WZWA 4CHTB 2DAGA 2M60A 3CF0A 4UN2B 2BNKA 1E9RA 1PJIA 3HHZA 3GPUA 1PM5A 4B3TM 3RE8A 4MGYE 3HJ8A 2YBFA 2ESKA 5KPTA 4G4QA 1H6UA 2JY6B 1OIZA 3TE6A 4YY3M 2ZTDA 3L29A 1TH3A 2HCBA 5EJCA 4OU7A 3P9GA 3VONB 5DYIA 3KOYE 2Z6PA 1XMOM 4F1IA 1JATB 4A49B 3T1YM 2XH9A 1Q3CA 2LVOC 3OBUA 5JNEB 1JB0F 4EJEA 1SG9A 1GO5A 2RGOA 1GJTA 3B9PA 4B7GA 2FUHA 5C18A 4D82A 4P16A 3VKHA 1AYZA 3GP1A 2VRRA 1MN3A 3UK6A 3RFWA 4DUYM 3DOAA 4YC1A 4GIPA 5EGGA 3H4JA 2V1CA 5F3WA 4YHHM 3FTEA 5KNLC 2ESOA 2CEAA 2CUZA 3LVWA 2HAKA 2EKEA 5F6YA 4V3KA 1W5TA 4DR3M 3LQQA 2JY8A 5F6UA 1PJJA 2ESQA 3LMMA 4CCGA 2N35A 3QWLA 1C4ZD 1Q39A 1V92A 2PE6A 1VQ1A 4L15A 5D0MA 4D80A 4JV5M 3Q8XA 1GVNA 2ZANA 2GRNA 2L6OA 2QBYA 3U5ZB 3M6AA 3U60B 2JY7A 4OVZA 2MGWA 3FYDA 1UFZA 4MH0E 3SBJA 2HHHM 2FNAA 2EJSA 1G59A 2LTUA 2R44A 4LJ7A 3EVXA 4I4LA 3AOEC 2OO9A 2CV2A 1WXQA 5ITUA 1IXSA 3J7BA 3KS8A 4NRIA 4LF6M 2HLWA 5HPTC 1N33M 4X65M 2KDLA 4PT5A 3U6PA 4LJ6A 3WHKA 2KLYA 2F5SA 3L1YA 1KPSA 2K9DA 3B7ZA 3VFDA 3JR5A 1JR3A 4LF7M 1S3SA 4DDIA 4RF1A 1TH4A 1E9SA 3WE5A 3H8KA 1U9AA 2HL7A 4GMQA 3E21A 1YH2A 5D2MA 1KPQA 4P5OG 2KXEA 2DMFA 5EP2A 2GJDA 2EKFA 4LJ4A 2CFOA 3U6DA 2F5PA 3E4RA 3H4MA 1R2ZA 4A4BC 2DHYA 3BOSA 4AQYM 2Z5DA 3ZC7B 1XC8A 4X64M 4R62A 2V1UA 2CWBA 1K3XA 5IZ7D 3KW6A 5D1KA 3U6QA 3EIEA 1X37A 1TDZA 4BLCA 4B08A 3ZH9B 5JI3E 3RZ3A 5EP4A 2LH0A 3GPYA 5GKNA 3HX3A 3SHGB 4M0WA 1HT2E 1S1QA 4GKKM 5ITYA 5KPRA 2UXDM 2MJ5B 3SHFA 5EXXA 1YUBA 3TQSA 4IBBA 4QPLB 4PCZA 2B3TA 3KOWE 5IWAM 3C9PA 5JI2E 4LFBM 2R18A 1OTRA 3SASA 1XB2B 4QNRA 1IY2A 5KO3A 3R8FA 2CHGA 5KQDA 3L27A 3HHYA 3C3DA 2KRKA 3VK7A 1KFVA 1MX0A 3K1JA 1QAQA 3E95A 1SXJA 1HNXM 1LTMA 1TF0B 3GLFE 4LF8M 2E5LM 3UMMA 3GLIA 2VF8A 1FNNA 2KRUA 4AUQA 4BBAA 4LFAM 3MHVC 2DAIA 4G3OA 4JQUA 3FKEA 4IIWA 3THGA 4M9XA 2AAKA 3M0EA 3A42A 4B7HA 1HJPA 1IN8A 2O25C 2J7OA 4II2C 1Z59A 3A45A 3UIPA 2QBYB 2RKOA 1I4WA 3AJIB 2I7NA 1N77A 3FTCA 4LJ5A 2WSCF 1VEJA 4OVZB 1GL6A 5FQ2A 1DGFA 3HKPA 1JQJC 3VKGA 5F6VA 4Q5EC 1Q02A 4HEOA 2A4DA 1V33A 3B7NA 2FOIC 3DA1A 2ESPA 3UIOA 4MDKA 4L6V6 2DWZB 1J09A 2F0RA 1PJSA 2AWFA 2C98A 2UXCM 3TWKA 4WURA 1IXSB 3SAVA 4NRIB 1W5SA 5FERB 2LHGA 4MGHA 2QNJA 3SATA 2JXNA 2D7EA 5BPVA 4RNAA 2YQZA 2OQ4A 4I81A 1JR3D 2Q2EB 3GLHE 5F6XA 1IN5A 2CE7A 3BXWA 4X66M 3T1HM 2ZAMA 1QZMA 2HKJA 3OTOM 2ZAOA 2FE8A 1D0LA 4LY6A 1R7RA 2QENA 4HL4A 4GC5A 1VEGA 2DWMA 1G3IA 1C7YA 1OAOC 2DKLA 1XXHE 1QQWA 2QCUA 3QAUA 4B3RM 4FWDA 1Z5BA 1MJGM 3KDSE 2DZOB 4IBDA 1PGYA 3HCTB 2DWLA 2XZFA 5EP1A 2DZLA 2LNHC 4JI7M 5D1LA 4LJ8A 5LMUM 3IHPA 1E32A 4QHSA 4NSRA 2L4EA 3AL0C 1D0MA 2H2YA 4KODA 4DV0M 3J80S 4R7GA 2CLWA 1KSFX 3TWMA 1ZAEA 4KT0F 2KNVA 1NO1A 3A4SA 4YIIU 4GHLA 3E46A 4AI6A 5D0KA 2PX9B 4FH1A 1YSYA 3GRVA 3RGPA 2ONUA 4MM3B 1Y8GA 3L2AA 1M4QA 5IREB 4FCTA 2Z7JA 2LVQD 1HQCA 3HWSA 1SXJD 4LJ9A 4NOOB 3FTDA 3MK6A 4OW0A 5DYGA 1SXJB 2EA0A 2XGNA 3UZUA 3W68A 5C1BA 1JASA 4CISA 1QDRA 2JUJA 2KW0A 3I04M 1OFHA 4FW9A 3GLIB 4Q5HC 2YFQA 3GLGE 2NVUC 2EDIA 4NXNM 1ZMVA 3T15A 4R3DA 4MGKE 5AIUB 4PDIA 3K2LA 5EXSA 2X49A 2LVAA 3KOZE 1UM8A 2Z3XA 3PNVA 5DNYA 4DV6M 2R4EA 3OBXA 3FTFA 5IT9S 4IBCA 3SYKA 4KLNA 4DHID 1NVMA 3Q8GA 3U6OA 3WHLA 2AHMA 2R46A 1HR0M 1ZV1A 4ONLB 3U6MA 2KHHA 4CGYB 4B7FA 1QCQA 3PXGA 3IG5A 3W0FA 4LRTA 2ZBKB 4X57A 3EIHA 4LADA 1QUSA 2QP9X 3E9SA 3DFZA 1IFYA 3RPGA 3SMPA 1I94M 3NBXX 1IN4A 4QOZC 4LZJA 3JR4A 3HJQA 1K3WA 1N34M 2J5YA 2K6BA 3K9OA 1AIPC 4GITA 2C4PA 2CYXA 3AV0A 1J7KA 2EBKA 4EIWA 4JN6A 2HWJA 3FE3A 4Y28F 3FUWA 3KP1E 1XWIA 4JI3M 4G4NA 4DV2M
chains in the Genus database with same CATH topology
3BBZA 1UZXA 2XWUA 4W5VA 3SQVC 2K0BX 3CEGA 5F6EA 2MT6A 2GROA 1DO2A 3E95A 1YLAA 1CUKA 3ONGB 2K07A 2MR9A 3GLIE 1DO0A 1VG5A 3B89A 1T6OA 3IECA 3GLFE 1IM2A 2JP7A 2RRUA 3VONC 1WHCA 4TKPA 3HCUB 2GMIB 3BZHA 4AUQA 2DAIA 4G3OA 4JQUA 2JZ1A 2DAWA 1ZMUA 3PTFA 2AAKA 4Y1LC 1YRVA 1HJPA 4AP4B 2O25C 2LXPA 3RCZB 4II2C 1Q34A 4ONNB 2YHOB 4S3OA 3E95C 3UIPA 4IP3B 3F92A 4LDTC 3TGDA 1FZYA 1WZWA 2CLWB 2DAGA 1VEJA 4UN2B 5FQ2A 1P3QQ 5F6VA 2H5XA 4Q5EC 1Q02A 4HEOA 3LCVB 4Q7JA 2A4DA 4BWFA 2BEPA 2BWEA 4NR3A 2YBFA 1WIVA 2ESKA 2ESPA 1X23A 5AITD 3UIOA 2KNAA 2JY6B 4MDKA 2ZTDA 1FBVC 1KYIA 2F0RA 4ONMB 2F4ZA 2AWFA 1J7DB 5AITB 2OOAA 1KPPA 1A3SA 4NRIB 2GRPA 3P9GA 2L2DA 3VONB 2AYVA 5FERB 2Z6PA 4F1IA 2QNJA 1JATB 3ZQSA 1OKSA 1OAIA 1WR1B 4A49B 2OOBA 4GEWA 1T43A 2LVOC 3OBUA 2QGXA 3P9HA 1WJ7A 5JNEB 2QHOB 2LVNC 4EJEA 1SG9A 3GLHE 1GO5A 1ZMWA 2FUHA 5F6XA 1Z5SA 1Y8XA 1AYZA 4WZ3A 1Y6LA 2VRRA 1MN3A 1U9BA 4YC1A 5EGGA 3H4JA 1VEKA 2LBCA 2DAEA 3OBSA 3EB6B 1VEGA 3W31B 1Z2UA 2YB6A 1G3IA 1ZGUA 1C7YA 2JNHA 2DKLA 2ZTCA 5KNLC 1WGNA 1XXHE 2ESOA 3L1ZA 2BF8A 2DNAA 2EKEA 2HAKA 3A33A 1I7KA 5F6YA 4V3KA 2DI0A 2GMIA 1PGYA 3HCTB 2DZLA 2JY8A 5F6UA 1NV8A 2C2VB 2ESQA 5D1LA 2YZ0A 5D1MA 4CCGA 4GPRA 1C4ZD 1FXTA 3IHPA 2MROB 1V92A 4V3LA 2PE6A 1VQ1A 5D0MA 4DS2A 2L4EA 1QZEA 2H2YA 2UCZA 4ONNA 4NRGA 2GRNA 1ZUOA 4NR3B 3R3QA 4ONLA 2PWQA 4M1NA 2CLWA 2JY7A 4F2LA 3OJ4A 1NV9A 2MGWA 2F4WA 1UFZA 2KNVA 3A4SA 1J74A 4YIIU 3E46A 2EJSA 4JUEA 5D0KA 2LTUA 2R0IA 2PX9B 4FH1A 3T6PA 2OB4A 3EVXA 5AIEB 2ONUA 1Y8GA 4ONMA 1M4QA 1G4AE 2OO9A 3FRIA 1J7DA 3JW0A 2LVQD 1IXSA 2EBMA 4NRIA 3UGBA 2HLWA 5HPTC 2QSFX 1PZVA 2FO3A 3ZNIC 3UINA 1JATA 3O2UA 2R0JA 3K9PA 1G41A 1VDLA 1JASA 2Z6OA 1A5TA 2JUJA 1JR3E 2KLYA 3L1YA 1KPSA 2LVPC 2K9DA 2DAYA 2CP8A 2Y9PA 2Q0VA 4Y1LA 1TTEA 2O25A 4Q5HC 3KPAA 1UKXA 1ZDNA 3R42A 3GLGE 2NVUC 1HQYE 4DDIA 4DBGB 2EDIA 1M4PA 3WE5A 1ZMVA 3H8KA 1U9AA 5AIUB 3E21A 1YH2A 5D2MA 1KPQA 4R71A 4P5OG 2DMFA 1DV0A 3LCUA 3FN1B 2GJDA 2KNZA 2EKFA 2LVAA 1OQYA 1BVSA 4A4BC 2DHYA 2WZJA 2DAXA 2Z5DA 2GRRA 3FRHA 4A4CC 2BWBA 1WZVA 4R62A 1W4UA 3OBXA 1E94E 2CWBA 4DHZF 5D1KA 3MMPA 2DAKA 4DHID 3JVZA 2DENA 2Y9MA 1R4GA 4NRGB 1ZV1A 4ONLB 2UYZA 3RZ3A 5DFLA 2EKKA 1EFUB 2L4FA 2KHHA 2GRQA 1HT1E 1QCQA 1HT2E 1S1QA 4X57A 4LADA 5IFRA 2OXQA 2E2CA 2JY5A 2MJ5B 1IFYA 5F6DA 3RPGA 3OBQA 1YF9A 3FSHA 4BVUB 2KJHA 4DHJC 2G3QA 1F4IA 5F6WA 3SY2C 1JBBA 4L83A 4QPLB 4DDGA 3K9OA 1AIPC 2C4PA 2CYXA 2EBKA 2B3TA 2DAMA 4WP2A 2C2VC 2HWJA 4ZNYA 3FE3A 2A7LA 1WGLA 2Y4WA 2JZ0A 1Z3DA 5JI2E 1TR8A 1OTRA 1XB2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBZ A;  1UZX A;  2XWU A;  4W5V A;  3SQV C;  2K0B X;  3CEG A;  5F6E A;  2MT6 A;  2GRO A;  1DO2 A;  3E95 A;  1YLA A;  1CUK A;  3ONG B;  2K07 A;  2MR9 A;  3GLI E;  1DO0 A;  1VG5 A;  3B89 A;  1T6O A;  3IEC A;  3GLF E;  1IM2 A;  2JP7 A;  2RRU A;  3VON C;  1WHC A;  4TKP A;  3HCU B;  2GMI B;  3BZH A;  4AUQ A;  2DAI A;  4G3O A;  4JQU A;  2JZ1 A;  2DAW A;  1ZMU A;  3PTF A;  2AAK A;  4Y1L C;  1YRV A;  1HJP A;  4AP4 B;  2O25 C;  2LXP A;  3RCZ B;  4II2 C;  1Q34 A;  4ONN B;  2YHO B;  4S3O A;  3E95 C;  3UIP A;  4IP3 B;  3F92 A;  4LDT C;  3TGD A;  1FZY A;  1WZW A;  2CLW B;  2DAG A;  1VEJ A;  4UN2 B;  5FQ2 A;  1P3Q Q;  5F6V A;  2H5X A;  4Q5E C;  1Q02 A;  4HEO A;  3LCV B;  4Q7J A;  2A4D A;  4BWF A;  2BEP A;  2BWE A;  4NR3 A;  2YBF A;  1WIV A;  2ESK A;  2ESP A;  1X23 A;  5AIT D;  3UIO A;  2KNA A;  2JY6 B;  4MDK A;  2ZTD A;  1FBV C;  1KYI A;  2F0R A;  4ONM B;  2F4Z A;  2AWF A;  1J7D B;  5AIT B;  2OOA A;  1KPP A;  1A3S A;  4NRI B;  2GRP A;  3P9G A;  2L2D A;  3VON B;  2AYV A;  5FER B;  2Z6P A;  4F1I A;  2QNJ A;  1JAT B;  3ZQS A;  1OKS A;  1OAI A;  1WR1 B;  4A49 B;  2OOB A;  4GEW A;  1T43 A;  2LVO C;  3OBU A;  2QGX A;  3P9H A;  1WJ7 A;  5JNE B;  2QHO B;  2LVN C;  4EJE A;  1SG9 A;  3GLH E;  1GO5 A;  1ZMW A;  2FUH A;  5F6X A;  1Z5S A;  1Y8X A;  1AYZ A;  4WZ3 A;  1Y6L A;  2VRR A;  1MN3 A;  1U9B A;  4YC1 A;  5EGG A;  3H4J A;  1VEK A;  2LBC A;  2DAE A;  3OBS A;  3EB6 B;  1VEG A;  3W31 B;  1Z2U A;  2YB6 A;  1G3I A;  1ZGU A;  1C7Y A;  2JNH A;  2DKL A;  2ZTC A;  5KNL C;  1WGN A;  1XXH E;  2ESO A;  3L1Z A;  2BF8 A;  2DNA A;  2EKE A;  2HAK A;  3A33 A;  1I7K A;  5F6Y A;  4V3K A;  2DI0 A;  2GMI A;  1PGY A;  3HCT B;  2DZL A;  2JY8 A;  5F6U A;  1NV8 A;  2C2V B;  2ESQ A;  5D1L A;  2YZ0 A;  5D1M A;  4CCG A;  4GPR A;  1C4Z D;  1FXT A;  3IHP A;  2MRO B;  1V92 A;  4V3L A;  2PE6 A;  1VQ1 A;  5D0M A;  4DS2 A;  2L4E A;  1QZE A;  2H2Y A;  2UCZ A;  4ONN A;  4NRG A;  2GRN A;  1ZUO A;  4NR3 B;  3R3Q A;  4ONL A;  2PWQ A;  4M1N A;  2CLW A;  2JY7 A;  4F2L A;  3OJ4 A;  1NV9 A;  2MGW A;  2F4W A;  1UFZ A;  2KNV A;  3A4S A;  1J74 A;  4YII U;  3E46 A;  2EJS A;  4JUE A;  5D0K A;  2LTU A;  2R0I A;  2PX9 B;  4FH1 A;  3T6P A;  2OB4 A;  3EVX A;  5AIE B;  2ONU A;  1Y8G A;  4ONM A;  1M4Q A;  1G4A E;  2OO9 A;  3FRI A;  1J7D A;  3JW0 A;  2LVQ D;  1IXS A;  2EBM A;  4NRI A;  3UGB A;  2HLW A;  5HPT C;  2QSF X;  1PZV A;  2FO3 A;  3ZNI C;  3UIN A;  1JAT A;  3O2U A;  2R0J A;  3K9P A;  1G41 A;  1VDL A;  1JAS A;  2Z6O A;  1A5T A;  2JUJ A;  1JR3 E;  2KLY A;  3L1Y A;  1KPS A;  2LVP C;  2K9D A;  2DAY A;  2CP8 A;  2Y9P A;  2Q0V A;  4Y1L A;  1TTE A;  2O25 A;  4Q5H C;  3KPA A;  1UKX A;  1ZDN A;  3R42 A;  3GLG E;  2NVU C;  1HQY E;  4DDI A;  4DBG B;  2EDI A;  1M4P A;  3WE5 A;  1ZMV A;  3H8K A;  1U9A A;  5AIU B;  3E21 A;  1YH2 A;  5D2M A;  1KPQ A;  4R71 A;  4P5O G;  2DMF A;  1DV0 A;  3LCU A;  3FN1 B;  2GJD A;  2KNZ A;  2EKF A;  2LVA A;  1OQY A;  1BVS A;  4A4B C;  2DHY A;  2WZJ A;  2DAX A;  2Z5D A;  2GRR A;  3FRH A;  4A4C C;  2BWB A;  1WZV A;  4R62 A;  1W4U A;  3OBX A;  1E94 E;  2CWB A;  4DHZ F;  5D1K A;  3MMP A;  2DAK A;  4DHI D;  3JVZ A;  2DEN A;  2Y9M A;  1R4G A;  4NRG B;  1ZV1 A;  4ONL B;  2UYZ A;  3RZ3 A;  5DFL A;  2EKK A;  1EFU B;  2L4F A;  2KHH A;  2GRQ A;  1HT1 E;  1QCQ A;  1HT2 E;  1S1Q A;  4X57 A;  4LAD A;  5IFR A;  2OXQ A;  2E2C A;  2JY5 A;  2MJ5 B;  1IFY A;  5F6D A;  3RPG A;  3OBQ A;  1YF9 A;  3FSH A;  4BVU B;  2KJH A;  4DHJ C;  2G3Q A;  1F4I A;  5F6W A;  3SY2 C;  1JBB A;  4L83 A;  4QPL B;  4DDG A;  3K9O A;  1AIP C;  2C4P A;  2CYX A;  2EBK A;  2B3T A;  2DAM A;  4WP2 A;  2C2V C;  2HWJ A;  4ZNY A;  3FE3 A;  2A7L A;  1WGL A;  2Y4W A;  2JZ0 A;  1Z3D A;  5JI2 E;  1TR8 A;  1OTR A;  1XB2 B; 
#chains in the Genus database with same CATH topology
 2C99 A;  2XWU A;  5F6E A;  2FH0 A;  1NNJ A;  2MT6 A;  1IXR C;  3R9X B;  2GRO A;  1YLA A;  2UU9 M;  1D0K A;  3TL4 X;  3A98 B;  1IBM M;  4IBK A;  1VG5 A;  3FUV A;  4M9S A;  1D2N A;  1IM2 A;  3U6E A;  3VON C;  2VQF M;  3HCU B;  1ORY B;  3GLF A;  3KSJ A;  2O5R A;  2KA6 B;  4MB7 A;  5EXP A;  4IBF A;  5A2Q S;  3T38 A;  1LV7 A;  2JZ1 A;  1EE8 A;  1L1Z A;  4CJ6 A;  3PTF A;  4Y1L C;  1YRV A;  4AP4 B;  2QZ4 A;  1Q34 A;  3E95 C;  1N32 M;  3V76 A;  3IG8 A;  4LFC M;  3TGD A;  4JI8 M;  1N78 A;  4FWH A;  3HU1 A;  2CLW B;  3AOE A;  3GQ4 A;  1P3Q Q;  2H5X A;  1NJF A;  1DGB A;  4BWF A;  3VDP A;  2BEP A;  2BWE A;  3SYL A;  1R2Y A;  3RGS A;  3AFH A;  4D81 A;  4L16 A;  1WIV A;  1RU3 A;  2CV0 A;  2KNA A;  1FBV C;  2F4Z A;  2OOA A;  2X8A A;  4II7 A;  2D7G A;  2GRP A;  5FSW A;  4TUW A;  2WSF F;  5EQT A;  4DV7 M;  3ZQS A;  2A5Y B;  2UUC M;  1N36 M;  3PVS A;  3KVW A;  3HU2 A;  1IN6 A;  2VF7 A;  5FTM A;  1T43 A;  5FTL A;  2QHO B;  3J7A S;  2CHQ A;  2CHV A;  1AUA A;  1Z5S A;  4PD2 A;  1Y8X A;  3DZD A;  3CGW A;  1HNZ M;  4WZ3 A;  1Y6L A;  4DR2 M;  1GKI A;  3SMS A;  2Y21 A;  2I7P A;  4QNM A;  2LBC A;  3OBS A;  2DHR A;  2ERC A;  1GAB A;  3TPZ A;  1YE9 A;  2YB6 A;  2F5O A;  1ZGU A;  4GHA A;  2FS1 A;  1XNQ M;  1WGN A;  3SAU A;  3U6C A;  2K47 A;  2BF8 A;  2DNA A;  1I7K A;  3GQ5 A;  2GMI A;  5KPZ A;  2H1R A;  5BR8 M;  2YZ0 A;  1VDD A;  2MRO B;  4IJE A;  2J7N A;  4V3L A;  2QPA A;  4DS2 A;  4KHP M;  2UCZ A;  2YNM D;  2JWS A;  1ZUO A;  4NR3 B;  4ONL A;  2PWQ A;  4G6Z A;  3GO8 A;  4F2L A;  3OJ4 A;  1NV9 A;  4FCV A;  4AZF A;  3TWL A;  4I5S A;  3C3E A;  3J2P B;  1J5E M;  5EP3 A;  3KS4 A;  3T6P A;  2OB4 A;  4G4O A;  2XSZ A;  2XFT A;  3J81 S;  2UXB M;  3GQ3 A;  4DV1 M;  4ONM A;  1G4A E;  3UJN A;  1L2D A;  3FRI A;  3MJ5 A;  1DGH A;  1ZQ9 A;  3A46 A;  1J7D A;  2EBM A;  3CTW B;  3UGB A;  3GRY A;  4IJF A;  2QSF X;  1MU5 A;  1OIP A;  2R0J A;  2Y0Q A;  3K9P A;  4G4R A;  1G41 A;  1XMQ M;  5LMN M;  3B74 A;  2KEB A;  1VDL A;  1A5T A;  2LVP C;  2RGH A;  2DAY A;  2O01 F;  4Z6Y A;  2O25 A;  3FUT A;  5ITX E;  3KPA A;  1ZDN A;  3R42 A;  3GLF B;  3ILK A;  4RKU F;  1M4P A;  2XFS A;  3GLG A;  3I51 A;  4B3M M;  3GPP A;  4R71 A;  2JA2 A;  3L25 A;  1DV0 A;  3FN1 B;  2KNZ A;  2KZU A;  2VQE M;  1OQY A;  1IXZ A;  1BVS A;  3PNY A;  4LRS A;  2DAX A;  2GRR A;  3FRH A;  5FTK A;  3CF6 E;  1W4U A;  4DHZ F;  3K92 A;  4M0D A;  3JVZ A;  2DEN A;  2Y9M A;  4NRG B;  4LF4 M;  2C9O A;  1EFU B;  1L2B A;  2L4F A;  3GPX A;  3J27 B;  3VK8 A;  2WSE F;  2E2C A;  3LW5 F;  1IN7 A;  3AOG A;  5F6D A;  3OBQ A;  1GJS A;  1XHB A;  4BVU B;  2R62 A;  4DHJ C;  4L83 A;  1OFI A;  3W67 A;  2C9C A;  4DDG A;  3KOX E;  4JI0 M;  2Z8Y M;  2R4J A;  3SC3 A;  2A7L A;  1WGL A;  3GLH B;  3LQR A;  4NRW A;  2F4V M;  4W5V A;  3SQV C;  3CEG A;  1FJG M;  1DO2 A;  4NC6 A;  1C1K A;  3HGI A;  3NBI A;  4W5W A;  2OPF A;  3ZQJ A;  3D8B A;  3U61 A;  2QQ8 A;  3HY5 A;  3B89 A;  3FUX A;  3IEC A;  4HLQ A;  1DGG A;  1HNW M;  4DR5 M;  1XXH B;  2GMI B;  4NRV A;  3FD9 A;  4LGM A;  1NNU C;  1NY5 A;  1QVR A;  3SAR A;  3JAM S;  3PFI A;  5FTJ A;  2D7H A;  1L8Q A;  4AW4 A;  2R65 A;  2LXP A;  2YHO B;  1NJG A;  4LZZ A;  4LDT C;  5E6J A;  1NY6 A;  5FTN A;  5FLX S;  1FZY A;  3HJS A;  4DV5 M;  4FD2 A;  3U6S A;  3LCV B;  4Q7J A;  4BB9 A;  1Z5A A;  3KP0 E;  2XSZ D;  2GNO A;  4NR3 A;  1X23 A;  4L8R C;  5EXT A;  4LG2 A;  5AIT D;  5ITQ A;  3I4V A;  4GH9 A;  1KYI A;  3GRU A;  1QAN A;  4NSO B;  4ONM B;  1DGH B;  4XGI A;  3I4Y A;  1J7D B;  5AIT B;  3NWL A;  1KPP A;  1A3S A;  1QYR A;  2L2D A;  3QYE A;  2AYV A;  1L2C A;  2W82 A;  4P17 A;  3SFZ A;  1OKS A;  1OAI A;  1WR1 B;  2Z4S A;  2OOB A;  4GEW A;  4GRI A;  2QGX A;  3P9H A;  1WJ7 A;  4JI2 M;  2LVN C;  2X4A A;  3SAW A;  3C58 A;  1ZMW A;  2LWX A;  4REZ A;  1XNR M;  5ITT A;  1QAO A;  3M7G A;  3FYC A;  1R6B X;  1IBL M;  4X62 M;  4RF0 A;  2G8L A;  1U9B A;  2UUB M;  3GLG B;  4FWG A;  3B7Q A;  2XLJ A;  3W0L B;  2DWN A;  3U6L A;  1VEK A;  1OJL A;  2DAE A;  4LF9 M;  1K82 A;  4DR1 M;  3EB6 B;  3W31 B;  2L7I A;  1Z2U A;  4K0K M;  4S12 A;  2JNH A;  4DV3 M;  2ZTC A;  4GKJ M;  4DR7 M;  3L1Z A;  1V34 A;  2VII A;  5ITR A;  4L4U A;  3A33 A;  2EO2 A;  2DI0 A;  1QUT A;  4JYA M;  1SXJ C;  1NV8 A;  2C2V B;  4QOS A;  1R5L A;  3LVV A;  5D1M A;  4ZPX A;  4GPR A;  4AG5 A;  1FXT A;  1IY1 A;  2KZS A;  1QZE A;  2F5Q A;  1T3T A;  4ONN A;  1N75 A;  4NRG A;  2CRU A;  4A3V B;  3R3Q A;  4M1N A;  4DUZ M;  4Z8X A;  2FFJ A;  2F4W A;  1J74 A;  4IBI A;  4JUE A;  4NL4 H;  2R0I A;  4AG6 A;  4JXJ A;  2Z4R A;  3VLF B;  5AIE B;  3I01 M;  2V6Z M;  4KO8 A;  2YR0 A;  2GQF A;  2DXI A;  2G5G X;  3JW0 A;  2MH8 A;  4MGI E;  3L28 A;  4MGZ E;  3VDU A;  1PZV A;  2FO3 A;  4QHT A;  3ZNI C;  3UIN A;  1JAT A;  3O2U A;  4LJA A;  3KFU G;  2M5Z A;  3GLH A;  2Z6O A;  3U61 B;  1JR3 E;  2NQ8 C;  2L09 A;  1IQP A;  1PJT A;  1IBK M;  4JI4 M;  2CP8 A;  2Y9P A;  2Q0V A;  4L78 A;  4I8O A;  4Y1L A;  1TTE A;  1UKX A;  3UGJ A;  1HQY E;  2BJV A;  4DBG B;  1IY0 A;  3HZJ A;  2R45 A;  1G8P A;  7CAT A;  5ITX A;  4AKH A;  3HHW A;  4LCB A;  2ZM6 M;  3FUU A;  1G71 A;  3LCU A;  1XXH A;  2F5N A;  1PJQ A;  2L7H A;  5H37 D;  4OX9 M;  2R6F A;  4IBJ A;  2XZU A;  2WZJ A;  4IBE A;  4PDG A;  3QYB A;  2APL A;  1GLN A;  4LF5 M;  4A4C C;  2BWB A;  1WZV A;  1E94 E;  3D8L A;  4JI6 M;  3CF2 A;  1QDT A;  3MMP A;  2DAK A;  1R4G A;  2BJW A;  2LHC A;  2UUA M;  2DVW B;  2UYZ A;  5DFL A;  2EKK A;  4FVM A;  5KQ8 A;  1NHG C;  2GRQ A;  1HT1 E;  2Y20 A;  3HHX A;  1TGU A;  3AKZ A;  4DV4 M;  1TDH A;  3KSX A;  3U5Z A;  4B3S M;  5IFR A;  4DR6 M;  2OXQ A;  5L8R F;  2C96 A;  2JY5 A;  3U60 A;  1NHW C;  3KXE C;  1GL7 A;  1YF9 A;  3FSH A;  4XK8 F;  2KJH A;  2XEP A;  2G3Q A;  1F4I A;  5F6W A;  3SY2 C;  1JBB A;  4CIZ A;  4LGY A;  4AKG A;  4AKI A;  2Y0T A;  5E26 A;  4ANR A;  2DAM A;  4WP2 A;  2C2V C;  4ZNY A;  4WW0 A;  4IBG A;  3GRR A;  2CV1 A;  2Y4W A;  2JZ0 A;  1Z3D A;  1TR8 A;  3BBZ A;  1SXJ E;  1UZX A;  2K0B X;  1PRB A;  1TH2 A;  2XF3 A;  1QAM A;  3ZCB B;  2LXE A;  2DZN B;  4JI5 M;  1CUK A;  1Z5C A;  3ONG B;  2K07 A;  2MR9 A;  4M9Z A;  4XBO A;  3GLI E;  2EUC A;  1DO0 A;  1T6O A;  1EIJ A;  2C5R A;  1Z6T A;  2JP7 A;  2RRU A;  3K8Z A;  1WHC A;  4TKP A;  3HU3 A;  3BZH A;  4GC9 A;  1Q3B A;  4JI1 M;  2VDB B;  8CAT A;  2P5T A;  2DAW A;  1L1T A;  1ZMU A;  4NXM M;  4FCW A;  3RCZ B;  3L26 A;  4ITQ A;  4ONN B;  4S3O A;  4IP3 B;  3F92 A;  1NSF A;  4DR4 M;  1WZW A;  4CHT B;  2DAG A;  2M60 A;  3CF0 A;  4UN2 B;  2BNK A;  1E9R A;  1PJI A;  3HHZ A;  3GPU A;  1PM5 A;  4B3T M;  3RE8 A;  4MGY E;  3HJ8 A;  2YBF A;  2ESK A;  5KPT A;  4G4Q A;  1H6U A;  2JY6 B;  1OIZ A;  3TE6 A;  4YY3 M;  2ZTD A;  3L29 A;  1TH3 A;  2HCB A;  5EJC A;  4OU7 A;  3P9G A;  3VON B;  5DYI A;  3KOY E;  2Z6P A;  1XMO M;  4F1I A;  1JAT B;  4A49 B;  3T1Y M;  2XH9 A;  1Q3C A;  2LVO C;  3OBU A;  5JNE B;  1JB0 F;  4EJE A;  1SG9 A;  1GO5 A;  2RGO A;  1GJT A;  3B9P A;  4B7G A;  2FUH A;  5C18 A;  4D82 A;  4P16 A;  3VKH A;  1AYZ A;  3GP1 A;  2VRR A;  1MN3 A;  3UK6 A;  3RFW A;  4DUY M;  3DOA A;  4YC1 A;  4GIP A;  5EGG A;  3H4J A;  2V1C A;  5F3W A;  4YHH M;  3FTE A;  5KNL C;  2ESO A;  2CEA A;  2CUZ A;  3LVW A;  2HAK A;  2EKE A;  5F6Y A;  4V3K A;  1W5T A;  4DR3 M;  3LQQ A;  2JY8 A;  5F6U A;  1PJJ A;  2ESQ A;  3LMM A;  4CCG A;  2N35 A;  3QWL A;  1C4Z D;  1Q39 A;  1V92 A;  2PE6 A;  1VQ1 A;  4L15 A;  5D0M A;  4D80 A;  4JV5 M;  3Q8X A;  1GVN A;  2ZAN A;  2GRN A;  2L6O A;  2QBY A;  3U5Z B;  3M6A A;  3U60 B;  2JY7 A;  4OVZ A;  2MGW A;  3FYD A;  1UFZ A;  4MH0 E;  3SBJ A;  2HHH M;  2FNA A;  2EJS A;  1G59 A;  2LTU A;  2R44 A;  4LJ7 A;  3EVX A;  4I4L A;  3AOE C;  2OO9 A;  2CV2 A;  1WXQ A;  5ITU A;  1IXS A;  3J7B A;  3KS8 A;  4NRI A;  4LF6 M;  2HLW A;  5HPT C;  1N33 M;  4X65 M;  2KDL A;  4PT5 A;  3U6P A;  4LJ6 A;  3WHK A;  2KLY A;  2F5S A;  3L1Y A;  1KPS A;  2K9D A;  3B7Z A;  3VFD A;  3JR5 A;  1JR3 A;  4LF7 M;  1S3S A;  4DDI A;  4RF1 A;  1TH4 A;  1E9S A;  3WE5 A;  3H8K A;  1U9A A;  2HL7 A;  4GMQ A;  3E21 A;  1YH2 A;  5D2M A;  1KPQ A;  4P5O G;  2KXE A;  2DMF A;  5EP2 A;  2GJD A;  2EKF A;  4LJ4 A;  2CFO A;  3U6D A;  2F5P A;  3E4R A;  3H4M A;  1R2Z A;  4A4B C;  2DHY A;  3BOS A;  4AQY M;  2Z5D A;  3ZC7 B;  1XC8 A;  4X64 M;  4R62 A;  2V1U A;  2CWB A;  1K3X A;  5IZ7 D;  3KW6 A;  5D1K A;  3U6Q A;  3EIE A;  1X37 A;  1TDZ A;  4BLC A;  4B08 A;  3ZH9 B;  5JI3 E;  3RZ3 A;  5EP4 A;  2LH0 A;  3GPY A;  5GKN A;  3HX3 A;  3SHG B;  4M0W A;  1HT2 E;  1S1Q A;  4GKK M;  5ITY A;  5KPR A;  2UXD M;  2MJ5 B;  3SHF A;  5EXX A;  1YUB A;  3TQS A;  4IBB A;  4QPL B;  4PCZ A;  2B3T A;  3KOW E;  5IWA M;  3C9P A;  5JI2 E;  4LFB M;  2R18 A;  1OTR A;  3SAS A;  1XB2 B;  4QNR A;  1IY2 A;  5KO3 A;  3R8F A;  2CHG A;  5KQD A;  3L27 A;  3HHY A;  3C3D A;  2KRK A;  3VK7 A;  1KFV A;  1MX0 A;  3K1J A;  1QAQ A;  3E95 A;  1SXJ A;  1HNX M;  1LTM A;  1TF0 B;  3GLF E;  4LF8 M;  2E5L M;  3UMM A;  3GLI A;  2VF8 A;  1FNN A;  2KRU A;  4AUQ A;  4BBA A;  4LFA M;  3MHV C;  2DAI A;  4G3O A;  4JQU A;  3FKE A;  4IIW A;  3THG A;  4M9X A;  2AAK A;  3M0E A;  3A42 A;  4B7H A;  1HJP A;  1IN8 A;  2O25 C;  2J7O A;  4II2 C;  1Z59 A;  3A45 A;  3UIP A;  2QBY B;  2RKO A;  1I4W A;  3AJI B;  2I7N A;  1N77 A;  3FTC A;  4LJ5 A;  2WSC F;  1VEJ A;  4OVZ B;  1GL6 A;  5FQ2 A;  1DGF A;  3HKP A;  1JQJ C;  3VKG A;  5F6V A;  4Q5E C;  1Q02 A;  4HEO A;  2A4D A;  1V33 A;  3B7N A;  2FOI C;  3DA1 A;  2ESP A;  3UIO A;  4MDK A;  4L6V 6;  2DWZ B;  1J09 A;  2F0R A;  1PJS A;  2AWF A;  2C98 A;  2UXC M;  3TWK A;  4WUR A;  1IXS B;  3SAV A;  4NRI B;  1W5S A;  5FER B;  2LHG A;  4MGH A;  2QNJ A;  3SAT A;  2JXN A;  2D7E A;  5BPV A;  4RNA A;  2YQZ A;  2OQ4 A;  4I81 A;  1JR3 D;  2Q2E B;  3GLH E;  5F6X A;  1IN5 A;  2CE7 A;  3BXW A;  4X66 M;  3T1H M;  2ZAM A;  1QZM A;  2HKJ A;  3OTO M;  2ZAO A;  2FE8 A;  1D0L A;  4LY6 A;  1R7R A;  2QEN A;  4HL4 A;  4GC5 A;  1VEG A;  2DWM A;  1G3I A;  1C7Y A;  1OAO C;  2DKL A;  1XXH E;  1QQW A;  2QCU A;  3QAU A;  4B3R M;  4FWD A;  1Z5B A;  1MJG M;  3KDS E;  2DZO B;  4IBD A;  1PGY A;  3HCT B;  2DWL A;  2XZF A;  5EP1 A;  2DZL A;  2LNH C;  4JI7 M;  5D1L A;  4LJ8 A;  5LMU M;  3IHP A;  1E32 A;  4QHS A;  4NSR A;  2L4E A;  3AL0 C;  1D0M A;  2H2Y A;  4KOD A;  4DV0 M;  3J80 S;  4R7G A;  2CLW A;  1KSF X;  3TWM A;  1ZAE A;  4KT0 F;  2KNV A;  1NO1 A;  3A4S A;  4YII U;  4GHL A;  3E46 A;  4AI6 A;  5D0K A;  2PX9 B;  4FH1 A;  1YSY A;  3GRV A;  3RGP A;  2ONU A;  4MM3 B;  1Y8G A;  3L2A A;  1M4Q A;  5IRE B;  4FCT A;  2Z7J A;  2LVQ D;  1HQC A;  3HWS A;  1SXJ D;  4LJ9 A;  4NOO B;  3FTD A;  3MK6 A;  4OW0 A;  5DYG A;  1SXJ B;  2EA0 A;  2XGN A;  3UZU A;  3W68 A;  5C1B A;  1JAS A;  4CIS A;  1QDR A;  2JUJ A;  2KW0 A;  3I04 M;  1OFH A;  4FW9 A;  3GLI B;  4Q5H C;  2YFQ A;  3GLG E;  2NVU C;  2EDI A;  4NXN M;  1ZMV A;  3T15 A;  4R3D A;  4MGK E;  5AIU B;  4PDI A;  3K2L A;  5EXS A;  2X49 A;  2LVA A;  3KOZ E;  1UM8 A;  2Z3X A;  3PNV A;  5DNY A;  4DV6 M;  2R4E A;  3OBX A;  3FTF A;  5IT9 S;  4IBC A;  3SYK A;  4KLN A;  4DHI D;  1NVM A;  3Q8G A;  3U6O A;  3WHL A;  2AHM A;  2R46 A;  1HR0 M;  1ZV1 A;  4ONL B;  3U6M A;  2KHH A;  4CGY B;  4B7F A;  1QCQ A;  3PXG A;  3IG5 A;  3W0F A;  4LRT A;  2ZBK B;  4X57 A;  3EIH A;  4LAD A;  1QUS A;  2QP9 X;  3E9S A;  3DFZ A;  1IFY A;  3RPG A;  3SMP A;  1I94 M;  3NBX X;  1IN4 A;  4QOZ C;  4LZJ A;  3JR4 A;  3HJQ A;  1K3W A;  1N34 M;  2J5Y A;  2K6B A;  3K9O A;  1AIP C;  4GIT A;  2C4P A;  2CYX A;  3AV0 A;  1J7K A;  2EBK A;  4EIW A;  4JN6 A;  2HWJ A;  3FE3 A;  4Y28 F;  3FUW A;  3KP1 E;  1XWI A;  4JI3 M;  4G4N A;  4DV2 M; 
#chains in the Genus database with same CATH homology
 3BBZ A;  1UZX A;  2XWU A;  4W5V A;  3SQV C;  2K0B X;  3CEG A;  5F6E A;  2MT6 A;  2GRO A;  1DO2 A;  3E95 A;  1YLA A;  1CUK A;  3ONG B;  2K07 A;  2MR9 A;  3GLI E;  1DO0 A;  1VG5 A;  3B89 A;  1T6O A;  3IEC A;  3GLF E;  1IM2 A;  2JP7 A;  2RRU A;  3VON C;  1WHC A;  4TKP A;  3HCU B;  2GMI B;  3BZH A;  4AUQ A;  2DAI A;  4G3O A;  4JQU A;  2JZ1 A;  2DAW A;  1ZMU A;  3PTF A;  2AAK A;  4Y1L C;  1YRV A;  1HJP A;  4AP4 B;  2O25 C;  2LXP A;  3RCZ B;  4II2 C;  1Q34 A;  4ONN B;  2YHO B;  4S3O A;  3E95 C;  3UIP A;  4IP3 B;  3F92 A;  4LDT C;  3TGD A;  1FZY A;  1WZW A;  2CLW B;  2DAG A;  1VEJ A;  4UN2 B;  5FQ2 A;  1P3Q Q;  5F6V A;  2H5X A;  4Q5E C;  1Q02 A;  4HEO A;  3LCV B;  4Q7J A;  2A4D A;  4BWF A;  2BEP A;  2BWE A;  4NR3 A;  2YBF A;  1WIV A;  2ESK A;  2ESP A;  1X23 A;  5AIT D;  3UIO A;  2KNA A;  2JY6 B;  4MDK A;  2ZTD A;  1FBV C;  1KYI A;  2F0R A;  4ONM B;  2F4Z A;  2AWF A;  1J7D B;  5AIT B;  2OOA A;  1KPP A;  1A3S A;  4NRI B;  2GRP A;  3P9G A;  2L2D A;  3VON B;  2AYV A;  5FER B;  2Z6P A;  4F1I A;  2QNJ A;  1JAT B;  3ZQS A;  1OKS A;  1OAI A;  1WR1 B;  4A49 B;  2OOB A;  4GEW A;  1T43 A;  2LVO C;  3OBU A;  2QGX A;  3P9H A;  1WJ7 A;  5JNE B;  2QHO B;  2LVN C;  4EJE A;  1SG9 A;  3GLH E;  1GO5 A;  1ZMW A;  2FUH A;  5F6X A;  1Z5S A;  1Y8X A;  1AYZ A;  4WZ3 A;  1Y6L A;  2VRR A;  1MN3 A;  1U9B A;  4YC1 A;  5EGG A;  3H4J A;  1VEK A;  2LBC A;  2DAE A;  3OBS A;  3EB6 B;  1VEG A;  3W31 B;  1Z2U A;  2YB6 A;  1G3I A;  1ZGU A;  1C7Y A;  2JNH A;  2DKL A;  2ZTC A;  5KNL C;  1WGN A;  1XXH E;  2ESO A;  3L1Z A;  2BF8 A;  2DNA A;  2EKE A;  2HAK A;  3A33 A;  1I7K A;  5F6Y A;  4V3K A;  2DI0 A;  2GMI A;  1PGY A;  3HCT B;  2DZL A;  2JY8 A;  5F6U A;  1NV8 A;  2C2V B;  2ESQ A;  5D1L A;  2YZ0 A;  5D1M A;  4CCG A;  4GPR A;  1C4Z D;  1FXT A;  3IHP A;  2MRO B;  1V92 A;  4V3L A;  2PE6 A;  1VQ1 A;  5D0M A;  4DS2 A;  2L4E A;  1QZE A;  2H2Y A;  2UCZ A;  4ONN A;  4NRG A;  2GRN A;  1ZUO A;  4NR3 B;  3R3Q A;  4ONL A;  2PWQ A;  4M1N A;  2CLW A;  2JY7 A;  4F2L A;  3OJ4 A;  1NV9 A;  2MGW A;  2F4W A;  1UFZ A;  2KNV A;  3A4S A;  1J74 A;  4YII U;  3E46 A;  2EJS A;  4JUE A;  5D0K A;  2LTU A;  2R0I A;  2PX9 B;  4FH1 A;  3T6P A;  2OB4 A;  3EVX A;  5AIE B;  2ONU A;  1Y8G A;  4ONM A;  1M4Q A;  1G4A E;  2OO9 A;  3FRI A;  1J7D A;  3JW0 A;  2LVQ D;  1IXS A;  2EBM A;  4NRI A;  3UGB A;  2HLW A;  5HPT C;  2QSF X;  1PZV A;  2FO3 A;  3ZNI C;  3UIN A;  1JAT A;  3O2U A;  2R0J A;  3K9P A;  1G41 A;  1VDL A;  1JAS A;  2Z6O A;  1A5T A;  2JUJ A;  1JR3 E;  2KLY A;  3L1Y A;  1KPS A;  2LVP C;  2K9D A;  2DAY A;  2CP8 A;  2Y9P A;  2Q0V A;  4Y1L A;  1TTE A;  2O25 A;  4Q5H C;  3KPA A;  1UKX A;  1ZDN A;  3R42 A;  3GLG E;  2NVU C;  1HQY E;  4DDI A;  4DBG B;  2EDI A;  1M4P A;  3WE5 A;  1ZMV A;  3H8K A;  1U9A A;  5AIU B;  3E21 A;  1YH2 A;  5D2M A;  1KPQ A;  4R71 A;  4P5O G;  2DMF A;  1DV0 A;  3LCU A;  3FN1 B;  2GJD A;  2KNZ A;  2EKF A;  2LVA A;  1OQY A;  1BVS A;  4A4B C;  2DHY A;  2WZJ A;  2DAX A;  2Z5D A;  2GRR A;  3FRH A;  4A4C C;  2BWB A;  1WZV A;  4R62 A;  1W4U A;  3OBX A;  1E94 E;  2CWB A;  4DHZ F;  5D1K A;  3MMP A;  2DAK A;  4DHI D;  3JVZ A;  2DEN A;  2Y9M A;  1R4G A;  4NRG B;  1ZV1 A;  4ONL B;  2UYZ A;  3RZ3 A;  5DFL A;  2EKK A;  1EFU B;  2L4F A;  2KHH A;  2GRQ A;  1HT1 E;  1QCQ A;  1HT2 E;  1S1Q A;  4X57 A;  4LAD A;  5IFR A;  2OXQ A;  2E2C A;  2JY5 A;  2MJ5 B;  1IFY A;  5F6D A;  3RPG A;  3OBQ A;  1YF9 A;  3FSH A;  4BVU B;  2KJH A;  4DHJ C;  2G3Q A;  1F4I A;  5F6W A;  3SY2 C;  1JBB A;  4L83 A;  4QPL B;  4DDG A;  3K9O A;  1AIP C;  2C4P A;  2CYX A;  2EBK A;  2B3T A;  2DAM A;  4WP2 A;  2C2V C;  2HWJ A;  4ZNY A;  3FE3 A;  2A7L A;  1WGL A;  2Y4W A;  2JZ0 A;  1Z3D A;  5JI2 E;  1TR8 A;  1OTR A;  1XB2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...