1HNZM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hnzM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hnzM02
3GO8A 4B3RM 4DUZM 5ITUA 1N32M 4DV4M 1K3XA 3U6OA 1IBKM 2XZUA 1Z5CA 1K3WA 2F5QA 4GKJM 2UU9M 1PJIA 4DV2M 4DV7M 3U6EA 4GKKM 1Q3CA 3J80S 4LFBM 4X66M 4DV1M 1XNQM 1HNWM 4X62M 4LF5M 1TDHA 2EA0A 4JI5M 4G4OA 3J81S 1XC8A 4LF6M 4JI4M 3JR5A 2VQEM 2F5SA 3W0FA 1XNRM 3TWMA 4DR5M 3GPUA 1MU5A 4DR2M 3T1HM 1KFVA 1HNXM 1N34M 4B3TM 1IBLM 4DUYM 3TWLA 5ITRA 4PD2A 3A46A 3U6CA 5ITXA 5ITQA 1K82A 3GP1A 4JI1M 3U6PA 3GQ5A 2UUAM 2UXBM 3DOAA 3TWKA 4JV5M 4PDIA 4LF4M 2HHHM 3GPXA 2UXDM 1EE8A 3SAWA 4LF7M 4NRVA 2ZBKB 3U6MA 4K0KM 3A42A 4DV5M 1TDZA 3SAUA 1I94M 4X64M 5LMNM 5BR8M 4NXMM 4ITQA 1R2ZA 1HR0M 3A45A 3J7AS 3T1YM 5IT9S 4DR7M 1R2YA 4DR3M 4X65M 4AQYM 1IBMM 4MB7A 4JI0M 2UXCM 3OTOM 2UUBM 4NXNM 4NRWA 1Z5BA 4OX9M 1PM5A 2E5LM 4LFAM 3C58A 3GQ4A 1Q3BA 3GPPA 4JI7M 4YHHM 4LFCM 1FJGM 1L1ZA 4JI8M 2F4VM 4LF8M 4G4NA 4KHPM 4DV6M 4G4RA 5FLXS 1XMOM 1XMQM 3SASA 3U6QA 4DR4M 3JAMS 5LMUM 1HNZM 3JR4A 3VK8A 4JI2M 4B3MM 4DV0M 4LF9M 4DV3M 1MX0A 4PDGA 3SATA 4JYAM 2F5OA 3GQ3A 2ZM6M 3U6SA 4JI6M 1N33M 1L2BA 2HKJA 1L1TA 4PCZA 5IWAM 1N36M 4DR1M 3SARA 3U6DA 5ITTA 5A2QS 4CISA 1Z5AA 4B3SM 1Q39A 4JI3M 2XZFA 1PJJA 1NNJA 1J5EM 5ITYA 2F5PA 3U6LA 2UUCM 1L2DA 3VK7A 3GPYA 4DR6M 2Q2EB 1Z59A 3SAVA 1L2CA 4G4QA 2VQFM 3SBJA 2F5NA 4YY3M 5ITXE 2OQ4A 2OPFA
chains in the Genus database with same CATH superfamily
3GO8A 3FTFA 2ERCA 4DUZM 1D0LA 5ITUA 1E9RA 1N32M 1XB2B 3I01M 1H6UA 3HY5A 4MM3B 2XZUA 2JY8A 2N35A 3L28A 3THGA 3U6EA 4GKKM 1J7KA 1TR8A 2L2DA 2JP7A 2C98A 1VEJA 5EP4A 2QP9X 4X62M 3KFUG 1IXSB 4FWDA 4JI5M 1JR3D 3KP0E 3J81S 1QAQA 3FTDA 4PT5A 1XHBA 2XFTA 1PJQA 2KA6B 3W0FA 4ANRA 1XNRM 3TWMA 1IXSA 4DBGB 4DR5M 1ZQ9A 3GRUA 1HNXM 1G59A 4B3TM 2JZ0A 3A98B 3KS4A 1R4GA 4KO8A 3L2AA 4QNMA 1NO1A 4BBAA 2DNAA 3PFIA 3B74A 4LCBA 3UJNA 4PD2A 3RGPA 2DENA 3I4YA 4LZJA 5ITXA 4A3VB 5ITQA 2JA2A 1FNNA 2RGOA 3GQ5A 2UUAM 1QVRA 2R45A 3DOAA 3FUVA 3QYEA 2DI0A 3AOEA 4CGYB 4JV5M 3L25A 4LF4M 4LG2A 3GPXA 3UGJA 1SG9A 3HJQA 2WSFF 2K6BA 4IBDA 4NRVA 2ZBKB 2DZNB 3CTWB 3B7QA 4K0KM 1Q02A 1SXJC 3SAUA 3SHGB 4LGMA 4NXMM 4LJAA 1WHCA 1KYIA 3KSXA 4FWHA 1PJTA 1HR0M 3UK6A 3HGIA 3T1YM 2GNOA 1IXZA 2R65A 2XEPA 3CF2A 3FYCA 4DR3M 2R62A 3FTEA 4GMQA 2QCUA 1IBMM 4M0WA 4D82A 2LVPC 2M5ZA 4IBIA 1NV8A 4B7FA 3PNVA 1Z5BA 3LVWA 3HU1A 4NRWA 4OX9M 2C9OA 3C58A 1ZAEA 2XGNA 3GPPA 1IFYA 3D8BA 4YHHM 4LFCM 1IN4A 1FJGM 1DGHA 1IY1A 1OFHA 4JI8M 2F4VM 4FCWA 3FUTA 4DV6M 3PXGA 2GQFA 3AKZA 3K2LA 4LRSA 4S12A 1N33M 4FCVA 3PNYA 3U6QA 4DR4M 5EP1A 5KQDA 4QOSA 3AL0C 3HJ8A 3E9SA 4JYAM 3HU3A 2MR9A 1NY5A 4AW4A 2RGHA 3U6SA 2MGWA 2HKJA 3BXWA 1L1TA 2JXNA 3SYLA 1V92A 2V1UA 2BWBA 1TH3A 3FUWA 1JB0F 3VKGA 5ITTA 2QENA 2Y21A 4B3SM 2D7HA 1TF0B 3L26A 4JXJA 1E9SA 4WW0A 1T3TA 2F5PA 4FVMA 3LQQA 1J09A 1NV9A 2Y0QA 1IY0A 1QDRA 2Y0TA 3VLFB 3CGWA 1MN3A 3GPYA 4NSOB 3I4VA 3T38A 3U61B 3K1JA 4XGIA 5DYIA 5BPVA 1KSFX 3DA1A 3LCVB 2VQFM 2VF8A 2XSZD 1YLAA 3U61A 1NHGC 2OQ4A 4IBBA 5JI2E 2X49A 2YNMD 4GEWA 5EXPA 2FE8A 1VDLA 3KSJA 2DWZB 5C18A 3KVWA 4UN2B 4D80A 1DV0A 3RE8A 1OAIA 2FFJA 1Z5CA 2F5QA 2ZANA 2UU9M 1C1KA 2QHOB 1R6BX 1PJIA 4AKHA 2DZLA 3FD9A 3Q8XA 1Q3CA 5E6JA 1TDHA 1W5TA 2RRUA 4NSRA 2EA0A 4G4OA 2CUZA 1XC8A 4JI4M 4B08A 3ILKA 2DHYA 3GLHE 1PJSA 5EXXA 1UFZA 3K92A 1RU3A 4OU7A 1WIVA 1D0KA 3GPUA 3HHYA 3IG8A 2I7NA 2LBCA 4M0DA 4KLNA 3HJSA 3H4MA 4M9ZA 3MMPA 5GKNA 5ITRA 3DFZA 1C7YA 5KPRA 1IN5A 2KHHA 3W0LB 3GP1A 1HT1E 2XSZA 1K82A 2X4AA 2R4EA 2UXBM 2DAIA 1XWIA 2L4FA 3FTCA 1QAOA 3SHFA 3SFZA 3IG5A 2LXEA 5KPTA 1TGUA 3KS8A 1EE8A 1WR1B 2K47A 5IZ7D 3SAWA 3LVVA 3UZUA 3U6MA 4IBCA 3B89A 1ZV1A 3A42A 3TL4X 2J5YA 3LW5F 5C1BA 4DV5M 1I94M 2CV2A 3ZC7B 3HKPA 4IIWA 5LMNM 2DHRA 4GH9A 3EIHA 4BLCA 3SYKA 3HHZA 3C3DA 4Q7JA 3J7AS 3AJIB 3AOGA 3QAUA 3RGSA 2JY6B 5DNYA 3K8ZA 3CF6E 4MB7A 2UXCM 2MH8A 1OTRA 1YUBA 1S3SA 1UM8A 1D0MA 3HWSA 2JZ1A 3ZCBB 1NNUC 1IQPA 2APLA 1PM5A 3PVSA 3TQSA 3WHLA 1Q3BA 5H37D 5EQTA 4JI7M 2R4JA 2KNVA 2C96A 4G6ZA 1L1ZA 2DWNA 3FUXA 2L4EA 4LJ9A 5IREB 1NJFA 3VDPA 1ZMWA 5FLXS 3H4JA 1XMQM 3U5ZB 1HT2E 3MK6A 5LMUM 1HNZM 4II7A 3VK8A 4JI2M 4DV0M 2D7GA 1ORYB 1MJGM 2I7PA 3B7NA 4P16A 4DV3M 4PDGA 1JR3A 2DWMA 3KOZE 4I5SA 2ZM6M 3U5ZA 2V6ZM 1NVMA 3GRYA 4NL4H 3R9XB 2P5TA 4I8OA 2CHQA 1CUKA 4CHTB 5A2QS 3U6DA 1IN7A 3UMMA 2LNHC 1Q39A 2ZTDA 5KPZA 1VG5A 2R6FA 2Y20A 1NNJA 1J5EM 5ITYA 1EIJA 1L8QA 1QUSA 1LV7A 4FCTA 3U6LA 3HZJA 1L2DA 2YR0A 4B7GA 5JI3E 4REZA 1X37A 1XXHE 2Q2EB 2LVAA 1Z59A 4F2LA 3SAVA 1GABA 1NHWC 1Z6TA 2FNAA 2BNKA 2QBYB 1YSYA 3FE3A 2L7IA 3GLFE 2QSFX 3SBJA 1T6OA 2KRUA 4D81A 1SXJE 4AG5A 5KQ8A 3M6AA 2XF3A 4CJ6A 2QBYA 4B3RM 4FD2A 1TH2A 1AUAA 2R18A 3W67A 5FTMA 2KZUA 3RFWA 2XLJA 4RF1A 2Z3XA 4GKJM 4AZFA 4DV2M 2BJVA 2KEBA 5E26A 4LFBM 1ZMVA 4I81A 2O5RA 2DAKA 4R3DA 4HEOA 5EJCA 4L6V6 1DGFA 1GL6A 1G41A 2LWXA 2VQEM 2F5SA 3J2PB 2EKKA 1PRBA 2LHCA 2EJSA 2WSCF 2JNHA 3GLGE 4HL4A 3SMSA 4DR2M 2KNAA 1DO2A 1KFVA 4QHSA 3QYBA 3BOSA 2L09A 4DUYM 3LQRA 4FW9A 4WP2A 2VIIA 4LGYA 3A46A 3U6CA 4AI6A 2NQ8C 1VEKA 1GLNA 2VDBB 4PDIA 3FRHA 1W5SA 5FSWA 2DWLA 2HHHM 1T43A 3GRRA 2UXDM 1DGGA 2K9DA 2ZTCA 4AKGA 3GLHB 4Z6YA 2DXIA 2R0IA 2B3TA 3IHPA 2L7HA 1IXRC 4EIWA 4KODA 4ITQA 4LJ5A 1IY2A 2FH0A 2H1RA 3GLHA 2C5RA 3WHKA 1R2YA 5IT9S 4GC9A 4X65M 3KOXE 1GJTA 1QZEA 4AQYM 3HU2A 4MGYE 4JI0M 4AG6A 2CP8A 2CWBA 4P17A 2JY7A 4LRTA 3OTOM 3VFDA 4NXNM 2DAGA 4LY6A 2FOIC 2ZAOA 2KXEA 1EFUB 3QWLA 5EP2A 3GLIE 1IM2A 3MJ5A 2E5LM 2DAEA 3GQ4A 2FS1A 3J27B 4GHLA 1GVNA 3GRVA 4IJFA 4MGZE 8CATA 2G3QA 4QHTA 4LF8M 4G4NA 2QQ8A 2Z4SA 3NBXX 4RF0A 1XMOM 2EUCA 1WGNA 2KDLA 2VF7A 1OQYA 3JR4A 2R44A 2Z4RA 3FYDA 4LF9M 4AKIA 1MX0A 2CEAA 3AOEC 2F5OA 1V34A 1N78A 4FWGA 3GQ3A 1G71A 4LJ6A 2LVOC 1OJLA 1QANA 2A5YB 2KZSA 2J7NA 2G5GX 1HQYE 4PCZA 3EIEA 3FUUA 4DR1M 3BBZA 3M0EA 2Z7JA 2DVWB 1YE9A 4LJ8A 4XK8F 4GHAA 1NJGA 1QZMA 1PJJA 1P3QQ 1G3IA 2C99A 2DKLA 3FRIA 3KOYE 3T6PA 4LJ7A 2YQZA 1LTMA 1BVSA 2J7OA 2MJ5B 5FTNA 4GRIA 4MH0E 4DR6M 2OOBA 1QQWA 1VDDA 1TTEA 4G4QA 4IJEA 4W5WA 1D2NA 3ZH9B 3NWLA 3ZQJA 1GJSA 2JY5A 1Y8GA 2QPAA 2OOAA 4JN6A 1NSFA 1SXJD 2QZ4A 3KOWE 5FTKA 4YY3M 5ITXE 2EO2A 2KNZA 3B7ZA 2OPFA 3E46A 3B9PA 3L27A 1G4AE 1IN6A 2CHVA 3U60B 1OIPA 4DV4M 4NOOB 3SMPA 1K3XA 3U6OA 5F3WA 1IBKM 2D7EA 1K3WA 3R8FA 3CF0A 4DV7M 3J80S 4X66M 4DV1M 1XNQM 1HNWM 4LF5M 3U60A 3K9PA 1XXHB 1G8PA 2BJWA 1WXQA 4LJ4A 4QOZC 2KRKA 4LF6M 3E4RA 1JR3E 1VEGA 3C3EA 3NBIA 4R7GA 2JUJA 3JR5A 5EP3A 4ZPXA 3GLFB 2C9CA 2HCBA 1XXHA 2W82A 3HHXA 4GC5A 4L78A 1HJPA 1MU5A 4MGKE 1SXJB 1NY6A 4G3OA 4I4LA 5FTJA 3W68A 3T1HM 2WZJA 1N34M 2Z8YM 1IBLM 1N75A 2JWSA 3TWLA 1VQ1A 1F4IA 2O25A 3GLFA 2EKFA 1DGHB 4XBOA 5DFLA 1PGYA 1SXJA 2HAKA 2ZAMA 3Q8GA 4JI1M 3U6PA 3D8LA 3KXEC 3TWKA 4RKUF 1ZMUA 4B7HA 1A5TA 1JQJC 3I51A 1QUTA 2L6OA 4LF7M 1OIZA 4F1IA 1GKIA 4IBGA 1TH4A 2HL7A 3VDUA 2XH9A 5L8RF 1TDZA 2CV0A 3IECA 3KW6A 4BB9A 4X64M 3GLGB 1WGLA 3E21A 2LHGA 4CIZA 2QNJA 3LMMA 5BR8M 1R2ZA 2YFQA 3A45A 5FTLA 1HQCA 4DR7M 5EXSA 3C9PA 4GITA 4L8RC 2WSEF 3GLGA 4R71A 3KDSE 5KO3A 2UUBM 4Y28F 2M60A 2H5XA 1OAOC 1OKSA 1L2BA 1WJ7A 1QAMA 2G8LA 1DGBA 4LFAM 2K0BX 2LVNC 1R7RA 3LCUA 3SC3A 2V1CA 4QNRA 2CE7A 2HWJA 4MGHA 4KHPM 2CRUA 4G4RA 3KP1E 5EXTA 1AIPC 3TPZA 3SASA 2AHMA 3JAMS 3TE6A 2CV1A 3J7BA 4B3MM 4TUWA 2LTUA 2DZOB 1GL7A 3F92A 2CHGA 4L15A 4M9SA 3HX3A 1N77A 3SATA 4GIPA 3DZDA 4MGIE 4Z8XA 1GO5A 2OO9A 4LZZA 4JI6M 3AFHA 4IBEA 4HLQA 1E32A 5IWAM 1QDTA 1N36M 1V33A 3V76A 1I4WA 2MROB 3GLIB 3SARA 2LH0A 3T15A 4CISA 1Z5AA 1DO0A 2O01F 4JI3M 2XZFA 1OFIA 2XFSA 4IBKA 2R46A 4OVZB 2KW0A 4IBFA 4L16A 1E94E 3MHVC 4RNAA 4L4UA 2DAMA 3HHWA 7CATA 2UUCM 3GLIA 1R5LA 3VK7A 2LVQD 3FKEA 4OVZA 2X8AA 2BWEA 1L2CA 1QYRA 4IBJA 3K9OA 4OW0A 3L29A 1IN8A 3M7GA 4KT0F 2CFOA 3AV0A 2F5NA 4M9XA 3VKHA 5DYGA 2RKOA 4NC6A 3I04M 4WURA
chains in the Genus database with same CATH topology
3GO8A 3FTFA 2ERCA 4DUZM 5ITUA 1N32M 1E9RA 1H6UA 4MM3B 2XZUA 3L28A 3THGA 3U6EA 4GKKM 1J7KA 3KFUG 2C98A 5EP4A 2QP9X 4X62M 1IXSB 4FWDA 4JI5M 1JR3D 3KP0E 3J81S 1QAQA 3FTDA 4PT5A 1XHBA 2XFTA 2KA6B 3W0FA 1XNRM 3TWMA 4DR5M 1ZQ9A 3GRUA 1HNXM 1G59A 4B3TM 3A98B 3KS4A 4KO8A 3L2AA 4QNMA 4BBAA 4LCBA 3PFIA 3UJNA 4PD2A 3RGPA 3I4YA 4LZJA 5ITXA 4A3VB 5ITQA 2JA2A 1FNNA 2RGOA 3GQ5A 2UUAM 1QVRA 2R45A 3DOAA 3FUVA 4CGYB 4JV5M 3AOEA 3L25A 4LF4M 4LG2A 3GPXA 3UGJA 3HJQA 4IBDA 4NRVA 2ZBKB 2DZNB 3CTWB 4K0KM 3SAUA 1SXJC 3SHGB 4LGMA 4NXMM 4LJAA 3KSXA 1KYIA 4FWHA 1HR0M 3UK6A 3HGIA 3T1YM 1IXZA 2R65A 2XEPA 3CF2A 3FYCA 4DR3M 2R62A 3FTEA 4GMQA 2QCUA 1IBMM 4M0WA 4D82A 2M5ZA 4IBIA 4B7FA 3PNVA 1Z5BA 3LVWA 3HU1A 4NRWA 4OX9M 2C9OA 3C58A 1ZAEA 2XGNA 3GPPA 3D8BA 4YHHM 4LFCM 1IN4A 1FJGM 1DGHA 1IY1A 1OFHA 4JI8M 2F4VM 4FCWA 3FUTA 4DV6M 3PXGA 3AKZA 3K2LA 4LRSA 4S12A 4FCVA 3PNYA 3U6QA 4DR4M 5EP1A 5KQDA 4QOSA 3AL0C 3HJ8A 3E9SA 4JYAM 3HU3A 1NY5A 4AW4A 2RGHA 3U6SA 2HKJA 1L1TA 3SYLA 2V1UA 1TH3A 3FUWA 3VKGA 5ITTA 2QENA 2Y21A 4B3SM 2D7HA 3L26A 4JXJA 1E9SA 4WW0A 1T3TA 2F5PA 4FVMA 3LQQA 1J09A 2Y0QA 3VLFB 1IY0A 2Y0TA 3GPYA 4NSOB 3I4VA 3T38A 3U61B 3K1JA 4XGIA 5DYIA 5BPVA 1KSFX 3DA1A 2VQFM 2XSZD 3U61A 1NHGC 2OQ4A 4IBBA 5JI2E 2X49A 2YNMD 5EXPA 2FE8A 5C18A 3KSJA 2DWZB 3KVWA 4D80A 3RE8A 2FFJA 1Z5CA 2F5QA 2ZANA 2UU9M 1C1KA 1R6BX 1PJIA 4AKHA 3FD9A 3Q8XA 1Q3CA 5E6JA 1TDHA 1W5TA 4NSRA 2EA0A 4G4OA 2CUZA 1XC8A 4JI4M 4B08A 3ILKA 5EXXA 3K92A 4OU7A 3GPUA 3HHYA 3IG8A 2I7NA 4M0DA 4KLNA 3HJSA 3H4MA 4M9ZA 5GKNA 5ITRA 3DFZA 5KPRA 1IN5A 3W0LB 3GP1A 1HT1E 2XSZA 1K82A 2X4AA 2R4EA 2UXBM 3FTCA 1XWIA 3SHFA 3SFZA 1QAOA 3IG5A 2LXEA 5KPTA 1TGUA 3KS8A 1EE8A 3SAWA 2K47A 5IZ7D 3LVVA 3UZUA 3U6MA 4IBCA 3A42A 4DV5M 3TL4X 2CV2A 5C1BA 1I94M 3ZC7B 3HKPA 4IIWA 5LMNM 2DHRA 4GH9A 3EIHA 4BLCA 3SYKA 3HHZA 3J7AS 3AJIB 3AOGA 3QAUA 3RGSA 5DNYA 3K8ZA 3CF6E 4MB7A 2UXCM 1YUBA 1S3SA 1UM8A 3HWSA 3ZCBB 1NNUC 1IQPA 1PM5A 3PVSA 3TQSA 3WHLA 1Q3BA 5H37D 5EQTA 4JI7M 2R4JA 2C96A 4G6ZA 1L1ZA 2DWNA 3FUXA 4LJ9A 5IREB 1NJFA 3VDPA 5FLXS 1XMQM 3U5ZB 1HT2E 3MK6A 5LMUM 1HNZM 4II7A 3VK8A 4JI2M 4DV0M 2D7GA 1ORYB 2I7PA 4P16A 4DV3M 4PDGA 1JR3A 2DWMA 3KOZE 4I5SA 2ZM6M 3U5ZA 2V6ZM 1NVMA 3GRYA 4NL4H 3R9XB 2P5TA 4I8OA 2CHQA 4CHTB 5A2QS 3U6DA 1IN7A 3UMMA 2LNHC 1Q39A 5KPZA 2Y20A 1NNJA 1J5EM 5ITYA 1L8QA 1LV7A 4FCTA 3U6LA 1L2DA 2YR0A 4B7GA 5JI3E 4REZA 1X37A 2Q2EB 1Z59A 3SAVA 1NHWC 1Z6TA 2FNAA 2BNKA 2QBYB 1YSYA 2L7IA 3SBJA 2KRUA 4D81A 1SXJE 4AG5A 5KQ8A 3M6AA 2XF3A 2QBYA 4B3RM 4FD2A 1TH2A 2R18A 5FTMA 2KZUA 3RFWA 2XLJA 4RF1A 2Z3XA 4GKJM 4AZFA 4DV2M 2BJVA 2KEBA 5E26A 4LFBM 4I81A 2O5RA 4R3DA 5EJCA 1DGFA 1GL6A 1G41A 2LWXA 2VQEM 2F5SA 3J2PB 4HL4A 3SMSA 4DR2M 1DO2A 1KFVA 4QHSA 3BOSA 2L09A 4DUYM 3LQRA 4FW9A 2VIIA 4LGYA 3A46A 3U6CA 4AI6A 2NQ8C 1GLNA 4PDIA 2DWLA 1W5SA 5FSWA 2HHHM 3GRRA 2UXDM 1DGGA 4AKGA 3GLHB 4Z6YA 2DXIA 2L7HA 1IXRC 4EIWA 4KODA 4ITQA 4LJ5A 1IY2A 2H1RA 3GLHA 5IT9S 2C5RA 3WHKA 1R2YA 4GC9A 4X65M 3KOXE 4AQYM 3HU2A 4MGYE 4JI0M 4AG6A 3OTOM 4LRTA 3VFDA 4NXNM 4LY6A 2FOIC 2ZAOA 2KXEA 3QWLA 5EP2A 2E5LM 1IM2A 3MJ5A 3GQ4A 3J27B 4GHLA 1GVNA 3GRVA 4IJFA 4MGZE 8CATA 4QHTA 4LF8M 4G4NA 2Z4SA 4RF0A 1XMOM 2EUCA 3JR4A 2Z4RA 3FYDA 4LF9M 4AKIA 1MX0A 2CEAA 3AOEC 2F5OA 1N78A 4FWGA 3GQ3A 4LJ6A 1L2BA 1OJLA 1N33M 1QANA 2A5YB 2KZSA 2J7NA 2G5GX 1HQYE 4PCZA 3EIEA 3FUUA 4DR1M 3M0EA 2Z7JA 2DVWB 1YE9A 4LJ8A 4GHAA 1NJGA 1QZMA 1PJJA 1G3IA 2C99A 3KOYE 4LJ7A 2YQZA 2J7OA 5FTNA 4GRIA 4MH0E 4DR6M 1QQWA 1VDDA 4G4QA 4IJEA 4W5WA 1D2NA 3ZH9B 3NWLA 2QPAA 5FTKA 4JN6A 1NSFA 1SXJD 2QZ4A 3KOWE 4YY3M 5ITXE 2EO2A 2OPFA 3B9PA 3L27A 1G4AE 1IN6A 2CHVA 3U60B 4DV4M 4NOOB 3SMPA 1K3XA 3U6OA 5F3WA 1IBKM 2D7EA 1K3WA 3R8FA 3CF0A 4DV7M 3J80S 4X66M 4DV1M 1XNQM 1HNWM 4LF5M 3U60A 1XXHB 1G8PA 2BJWA 1WXQA 4LJ4A 4QOZC 2KRKA 4LF6M 3E4RA 4R7GA 3NBIA 3JR5A 5EP3A 4ZPXA 3GLFB 2C9CA 2HCBA 1XXHA 2W82A 3HHXA 4GC5A 4L78A 1MU5A 4MGKE 1SXJB 1NY6A 4I4LA 5FTJA 3T1HM 1N34M 1IBLM 1N75A 3TWLA 3GLFA 1DGHB 4XBOA 1SXJA 2ZAMA 4JI1M 3U6PA 3D8LA 3KXEC 3TWKA 4B7HA 3I51A 1JQJC 2L6OA 4LF7M 1GKIA 4IBGA 1TH4A 2HL7A 3VDUA 2XH9A 1TDZA 2CV0A 3KW6A 4BB9A 4X64M 3GLGB 3LMMA 5BR8M 1R2ZA 2YFQA 3A45A 5FTLA 1HQCA 4DR7M 5EXSA 4GITA 4L8RC 3GLGA 3KDSE 5KO3A 2UUBM 2M60A 1QAMA 2G8LA 1DGBA 4LFAM 1R7RA 3SC3A 2V1CA 4QNRA 2CE7A 4MGHA 4KHPM 4G4RA 3KP1E 5EXTA 3TPZA 3SASA 2AHMA 3JAMS 3TE6A 2CV1A 3J7BA 4B3MM 4TUWA 2DZOB 1GL7A 4L15A 2CHGA 4M9SA 1N77A 3SATA 4GIPA 3DZDA 4MGIE 4Z8XA 4LZZA 4JI6M 3AFHA 4IBEA 4HLQA 1E32A 5IWAM 1N36M 1I4WA 3GLIB 3SARA 2LH0A 3T15A 4CISA 1Z5AA 1DO0A 4JI3M 2XZFA 1OFIA 2XFSA 4IBKA 2R46A 4OVZB 2KW0A 4IBFA 4L16A 1E94E 3MHVC 4RNAA 4L4UA 3HHWA 7CATA 2UUCM 3GLIA 3VK7A 3FKEA 4OVZA 2X8AA 1L2CA 1QYRA 4IBJA 4OW0A 3L29A 1IN8A 3M7GA 2CFOA 3AV0A 2F5NA 4M9XA 3VKHA 5DYGA 2RKOA 4WURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GO8 A;  4B3R M;  4DUZ M;  5ITU A;  1N32 M;  4DV4 M;  1K3X A;  3U6O A;  1IBK M;  2XZU A;  1Z5C A;  1K3W A;  2F5Q A;  4GKJ M;  2UU9 M;  1PJI A;  4DV2 M;  4DV7 M;  3U6E A;  4GKK M;  1Q3C A;  3J80 S;  4LFB M;  4X66 M;  4DV1 M;  1XNQ M;  1HNW M;  4X62 M;  4LF5 M;  1TDH A;  2EA0 A;  4JI5 M;  4G4O A;  3J81 S;  1XC8 A;  4LF6 M;  4JI4 M;  3JR5 A;  2VQE M;  2F5S A;  3W0F A;  1XNR M;  3TWM A;  4DR5 M;  3GPU A;  1MU5 A;  4DR2 M;  3T1H M;  1KFV A;  1HNX M;  1N34 M;  4B3T M;  1IBL M;  4DUY M;  3TWL A;  5ITR A;  4PD2 A;  3A46 A;  3U6C A;  5ITX A;  5ITQ A;  1K82 A;  3GP1 A;  4JI1 M;  3U6P A;  3GQ5 A;  2UUA M;  2UXB M;  3DOA A;  3TWK A;  4JV5 M;  4PDI A;  4LF4 M;  2HHH M;  3GPX A;  2UXD M;  1EE8 A;  3SAW A;  4LF7 M;  4NRV A;  2ZBK B;  3U6M A;  4K0K M;  3A42 A;  4DV5 M;  1TDZ A;  3SAU A;  1I94 M;  4X64 M;  5LMN M;  5BR8 M;  4NXM M;  4ITQ A;  1R2Z A;  1HR0 M;  3A45 A;  3J7A S;  3T1Y M;  5IT9 S;  4DR7 M;  1R2Y A;  4DR3 M;  4X65 M;  4AQY M;  1IBM M;  4MB7 A;  4JI0 M;  2UXC M;  3OTO M;  2UUB M;  4NXN M;  4NRW A;  1Z5B A;  4OX9 M;  1PM5 A;  2E5L M;  4LFA M;  3C58 A;  3GQ4 A;  1Q3B A;  3GPP A;  4JI7 M;  4YHH M;  4LFC M;  1FJG M;  1L1Z A;  4JI8 M;  2F4V M;  4LF8 M;  4G4N A;  4KHP M;  4DV6 M;  4G4R A;  5FLX S;  1XMO M;  1XMQ M;  3SAS A;  3U6Q A;  4DR4 M;  3JAM S;  5LMU M;  1HNZ M;  3JR4 A;  3VK8 A;  4JI2 M;  4B3M M;  4DV0 M;  4LF9 M;  4DV3 M;  1MX0 A;  4PDG A;  3SAT A;  4JYA M;  2F5O A;  3GQ3 A;  2ZM6 M;  3U6S A;  4JI6 M;  1N33 M;  1L2B A;  2HKJ A;  1L1T A;  4PCZ A;  5IWA M;  1N36 M;  4DR1 M;  3SAR A;  3U6D A;  5ITT A;  5A2Q S;  4CIS A;  1Z5A A;  4B3S M;  1Q39 A;  4JI3 M;  2XZF A;  1PJJ A;  1NNJ A;  1J5E M;  5ITY A;  2F5P A;  3U6L A;  2UUC M;  1L2D A;  3VK7 A;  3GPY A;  4DR6 M;  2Q2E B;  1Z59 A;  3SAV A;  1L2C A;  4G4Q A;  2VQF M;  3SBJ A;  2F5N A;  4YY3 M;  5ITX E;  2OQ4 A;  2OPF A; 
#chains in the Genus database with same CATH topology
 3GO8 A;  3FTF A;  2ERC A;  4DUZ M;  1D0L A;  5ITU A;  1E9R A;  1N32 M;  1XB2 B;  3I01 M;  1H6U A;  3HY5 A;  4MM3 B;  2XZU A;  2JY8 A;  2N35 A;  3L28 A;  3THG A;  3U6E A;  4GKK M;  1J7K A;  1TR8 A;  2L2D A;  2JP7 A;  2C98 A;  1VEJ A;  5EP4 A;  2QP9 X;  4X62 M;  3KFU G;  1IXS B;  4FWD A;  4JI5 M;  1JR3 D;  3KP0 E;  3J81 S;  1QAQ A;  3FTD A;  4PT5 A;  1XHB A;  2XFT A;  1PJQ A;  2KA6 B;  3W0F A;  4ANR A;  1XNR M;  3TWM A;  1IXS A;  4DBG B;  4DR5 M;  1ZQ9 A;  3GRU A;  1HNX M;  1G59 A;  4B3T M;  2JZ0 A;  3A98 B;  3KS4 A;  1R4G A;  4KO8 A;  3L2A A;  4QNM A;  1NO1 A;  4BBA A;  2DNA A;  3PFI A;  3B74 A;  4LCB A;  3UJN A;  4PD2 A;  3RGP A;  2DEN A;  3I4Y A;  4LZJ A;  5ITX A;  4A3V B;  5ITQ A;  2JA2 A;  1FNN A;  2RGO A;  3GQ5 A;  2UUA M;  1QVR A;  2R45 A;  3DOA A;  3FUV A;  3QYE A;  2DI0 A;  3AOE A;  4CGY B;  4JV5 M;  3L25 A;  4LF4 M;  4LG2 A;  3GPX A;  3UGJ A;  1SG9 A;  3HJQ A;  2WSF F;  2K6B A;  4IBD A;  4NRV A;  2ZBK B;  2DZN B;  3CTW B;  3B7Q A;  4K0K M;  1Q02 A;  1SXJ C;  3SAU A;  3SHG B;  4LGM A;  4NXM M;  4LJA A;  1WHC A;  1KYI A;  3KSX A;  4FWH A;  1PJT A;  1HR0 M;  3UK6 A;  3HGI A;  3T1Y M;  2GNO A;  1IXZ A;  2R65 A;  2XEP A;  3CF2 A;  3FYC A;  4DR3 M;  2R62 A;  3FTE A;  4GMQ A;  2QCU A;  1IBM M;  4M0W A;  4D82 A;  2LVP C;  2M5Z A;  4IBI A;  1NV8 A;  4B7F A;  3PNV A;  1Z5B A;  3LVW A;  3HU1 A;  4NRW A;  4OX9 M;  2C9O A;  3C58 A;  1ZAE A;  2XGN A;  3GPP A;  1IFY A;  3D8B A;  4YHH M;  4LFC M;  1IN4 A;  1FJG M;  1DGH A;  1IY1 A;  1OFH A;  4JI8 M;  2F4V M;  4FCW A;  3FUT A;  4DV6 M;  3PXG A;  2GQF A;  3AKZ A;  3K2L A;  4LRS A;  4S12 A;  1N33 M;  4FCV A;  3PNY A;  3U6Q A;  4DR4 M;  5EP1 A;  5KQD A;  4QOS A;  3AL0 C;  3HJ8 A;  3E9S A;  4JYA M;  3HU3 A;  2MR9 A;  1NY5 A;  4AW4 A;  2RGH A;  3U6S A;  2MGW A;  2HKJ A;  3BXW A;  1L1T A;  2JXN A;  3SYL A;  1V92 A;  2V1U A;  2BWB A;  1TH3 A;  3FUW A;  1JB0 F;  3VKG A;  5ITT A;  2QEN A;  2Y21 A;  4B3S M;  2D7H A;  1TF0 B;  3L26 A;  4JXJ A;  1E9S A;  4WW0 A;  1T3T A;  2F5P A;  4FVM A;  3LQQ A;  1J09 A;  1NV9 A;  2Y0Q A;  1IY0 A;  1QDR A;  2Y0T A;  3VLF B;  3CGW A;  1MN3 A;  3GPY A;  4NSO B;  3I4V A;  3T38 A;  3U61 B;  3K1J A;  4XGI A;  5DYI A;  5BPV A;  1KSF X;  3DA1 A;  3LCV B;  2VQF M;  2VF8 A;  2XSZ D;  1YLA A;  3U61 A;  1NHG C;  2OQ4 A;  4IBB A;  5JI2 E;  2X49 A;  2YNM D;  4GEW A;  5EXP A;  2FE8 A;  1VDL A;  3KSJ A;  2DWZ B;  5C18 A;  3KVW A;  4UN2 B;  4D80 A;  1DV0 A;  3RE8 A;  1OAI A;  2FFJ A;  1Z5C A;  2F5Q A;  2ZAN A;  2UU9 M;  1C1K A;  2QHO B;  1R6B X;  1PJI A;  4AKH A;  2DZL A;  3FD9 A;  3Q8X A;  1Q3C A;  5E6J A;  1TDH A;  1W5T A;  2RRU A;  4NSR A;  2EA0 A;  4G4O A;  2CUZ A;  1XC8 A;  4JI4 M;  4B08 A;  3ILK A;  2DHY A;  3GLH E;  1PJS A;  5EXX A;  1UFZ A;  3K92 A;  1RU3 A;  4OU7 A;  1WIV A;  1D0K A;  3GPU A;  3HHY A;  3IG8 A;  2I7N A;  2LBC A;  4M0D A;  4KLN A;  3HJS A;  3H4M A;  4M9Z A;  3MMP A;  5GKN A;  5ITR A;  3DFZ A;  1C7Y A;  5KPR A;  1IN5 A;  2KHH A;  3W0L B;  3GP1 A;  1HT1 E;  2XSZ A;  1K82 A;  2X4A A;  2R4E A;  2UXB M;  2DAI A;  1XWI A;  2L4F A;  3FTC A;  1QAO A;  3SHF A;  3SFZ A;  3IG5 A;  2LXE A;  5KPT A;  1TGU A;  3KS8 A;  1EE8 A;  1WR1 B;  2K47 A;  5IZ7 D;  3SAW A;  3LVV A;  3UZU A;  3U6M A;  4IBC A;  3B89 A;  1ZV1 A;  3A42 A;  3TL4 X;  2J5Y A;  3LW5 F;  5C1B A;  4DV5 M;  1I94 M;  2CV2 A;  3ZC7 B;  3HKP A;  4IIW A;  5LMN M;  2DHR A;  4GH9 A;  3EIH A;  4BLC A;  3SYK A;  3HHZ A;  3C3D A;  4Q7J A;  3J7A S;  3AJI B;  3AOG A;  3QAU A;  3RGS A;  2JY6 B;  5DNY A;  3K8Z A;  3CF6 E;  4MB7 A;  2UXC M;  2MH8 A;  1OTR A;  1YUB A;  1S3S A;  1UM8 A;  1D0M A;  3HWS A;  2JZ1 A;  3ZCB B;  1NNU C;  1IQP A;  2APL A;  1PM5 A;  3PVS A;  3TQS A;  3WHL A;  1Q3B A;  5H37 D;  5EQT A;  4JI7 M;  2R4J A;  2KNV A;  2C96 A;  4G6Z A;  1L1Z A;  2DWN A;  3FUX A;  2L4E A;  4LJ9 A;  5IRE B;  1NJF A;  3VDP A;  1ZMW A;  5FLX S;  3H4J A;  1XMQ M;  3U5Z B;  1HT2 E;  3MK6 A;  5LMU M;  1HNZ M;  4II7 A;  3VK8 A;  4JI2 M;  4DV0 M;  2D7G A;  1ORY B;  1MJG M;  2I7P A;  3B7N A;  4P16 A;  4DV3 M;  4PDG A;  1JR3 A;  2DWM A;  3KOZ E;  4I5S A;  2ZM6 M;  3U5Z A;  2V6Z M;  1NVM A;  3GRY A;  4NL4 H;  3R9X B;  2P5T A;  4I8O A;  2CHQ A;  1CUK A;  4CHT B;  5A2Q S;  3U6D A;  1IN7 A;  3UMM A;  2LNH C;  1Q39 A;  2ZTD A;  5KPZ A;  1VG5 A;  2R6F A;  2Y20 A;  1NNJ A;  1J5E M;  5ITY A;  1EIJ A;  1L8Q A;  1QUS A;  1LV7 A;  4FCT A;  3U6L A;  3HZJ A;  1L2D A;  2YR0 A;  4B7G A;  5JI3 E;  4REZ A;  1X37 A;  1XXH E;  2Q2E B;  2LVA A;  1Z59 A;  4F2L A;  3SAV A;  1GAB A;  1NHW C;  1Z6T A;  2FNA A;  2BNK A;  2QBY B;  1YSY A;  3FE3 A;  2L7I A;  3GLF E;  2QSF X;  3SBJ A;  1T6O A;  2KRU A;  4D81 A;  1SXJ E;  4AG5 A;  5KQ8 A;  3M6A A;  2XF3 A;  4CJ6 A;  2QBY A;  4B3R M;  4FD2 A;  1TH2 A;  1AUA A;  2R18 A;  3W67 A;  5FTM A;  2KZU A;  3RFW A;  2XLJ A;  4RF1 A;  2Z3X A;  4GKJ M;  4AZF A;  4DV2 M;  2BJV A;  2KEB A;  5E26 A;  4LFB M;  1ZMV A;  4I81 A;  2O5R A;  2DAK A;  4R3D A;  4HEO A;  5EJC A;  4L6V 6;  1DGF A;  1GL6 A;  1G41 A;  2LWX A;  2VQE M;  2F5S A;  3J2P B;  2EKK A;  1PRB A;  2LHC A;  2EJS A;  2WSC F;  2JNH A;  3GLG E;  4HL4 A;  3SMS A;  4DR2 M;  2KNA A;  1DO2 A;  1KFV A;  4QHS A;  3QYB A;  3BOS A;  2L09 A;  4DUY M;  3LQR A;  4FW9 A;  4WP2 A;  2VII A;  4LGY A;  3A46 A;  3U6C A;  4AI6 A;  2NQ8 C;  1VEK A;  1GLN A;  2VDB B;  4PDI A;  3FRH A;  1W5S A;  5FSW A;  2DWL A;  2HHH M;  1T43 A;  3GRR A;  2UXD M;  1DGG A;  2K9D A;  2ZTC A;  4AKG A;  3GLH B;  4Z6Y A;  2DXI A;  2R0I A;  2B3T A;  3IHP A;  2L7H A;  1IXR C;  4EIW A;  4KOD A;  4ITQ A;  4LJ5 A;  1IY2 A;  2FH0 A;  2H1R A;  3GLH A;  2C5R A;  3WHK A;  1R2Y A;  5IT9 S;  4GC9 A;  4X65 M;  3KOX E;  1GJT A;  1QZE A;  4AQY M;  3HU2 A;  4MGY E;  4JI0 M;  4AG6 A;  2CP8 A;  2CWB A;  4P17 A;  2JY7 A;  4LRT A;  3OTO M;  3VFD A;  4NXN M;  2DAG A;  4LY6 A;  2FOI C;  2ZAO A;  2KXE A;  1EFU B;  3QWL A;  5EP2 A;  3GLI E;  1IM2 A;  3MJ5 A;  2E5L M;  2DAE A;  3GQ4 A;  2FS1 A;  3J27 B;  4GHL A;  1GVN A;  3GRV A;  4IJF A;  4MGZ E;  8CAT A;  2G3Q A;  4QHT A;  4LF8 M;  4G4N A;  2QQ8 A;  2Z4S A;  3NBX X;  4RF0 A;  1XMO M;  2EUC A;  1WGN A;  2KDL A;  2VF7 A;  1OQY A;  3JR4 A;  2R44 A;  2Z4R A;  3FYD A;  4LF9 M;  4AKI A;  1MX0 A;  2CEA A;  3AOE C;  2F5O A;  1V34 A;  1N78 A;  4FWG A;  3GQ3 A;  1G71 A;  4LJ6 A;  2LVO C;  1OJL A;  1QAN A;  2A5Y B;  2KZS A;  2J7N A;  2G5G X;  1HQY E;  4PCZ A;  3EIE A;  3FUU A;  4DR1 M;  3BBZ A;  3M0E A;  2Z7J A;  2DVW B;  1YE9 A;  4LJ8 A;  4XK8 F;  4GHA A;  1NJG A;  1QZM A;  1PJJ A;  1P3Q Q;  1G3I A;  2C99 A;  2DKL A;  3FRI A;  3KOY E;  3T6P A;  4LJ7 A;  2YQZ A;  1LTM A;  1BVS A;  2J7O A;  2MJ5 B;  5FTN A;  4GRI A;  4MH0 E;  4DR6 M;  2OOB A;  1QQW A;  1VDD A;  1TTE A;  4G4Q A;  4IJE A;  4W5W A;  1D2N A;  3ZH9 B;  3NWL A;  3ZQJ A;  1GJS A;  2JY5 A;  1Y8G A;  2QPA A;  2OOA A;  4JN6 A;  1NSF A;  1SXJ D;  2QZ4 A;  3KOW E;  5FTK A;  4YY3 M;  5ITX E;  2EO2 A;  2KNZ A;  3B7Z A;  2OPF A;  3E46 A;  3B9P A;  3L27 A;  1G4A E;  1IN6 A;  2CHV A;  3U60 B;  1OIP A;  4DV4 M;  4NOO B;  3SMP A;  1K3X A;  3U6O A;  5F3W A;  1IBK M;  2D7E A;  1K3W A;  3R8F A;  3CF0 A;  4DV7 M;  3J80 S;  4X66 M;  4DV1 M;  1XNQ M;  1HNW M;  4LF5 M;  3U60 A;  3K9P A;  1XXH B;  1G8P A;  2BJW A;  1WXQ A;  4LJ4 A;  4QOZ C;  2KRK A;  4LF6 M;  3E4R A;  1JR3 E;  1VEG A;  3C3E A;  3NBI A;  4R7G A;  2JUJ A;  3JR5 A;  5EP3 A;  4ZPX A;  3GLF B;  2C9C A;  2HCB A;  1XXH A;  2W82 A;  3HHX A;  4GC5 A;  4L78 A;  1HJP A;  1MU5 A;  4MGK E;  1SXJ B;  1NY6 A;  4G3O A;  4I4L A;  5FTJ A;  3W68 A;  3T1H M;  2WZJ A;  1N34 M;  2Z8Y M;  1IBL M;  1N75 A;  2JWS A;  3TWL A;  1VQ1 A;  1F4I A;  2O25 A;  3GLF A;  2EKF A;  1DGH B;  4XBO A;  5DFL A;  1PGY A;  1SXJ A;  2HAK A;  2ZAM A;  3Q8G A;  4JI1 M;  3U6P A;  3D8L A;  3KXE C;  3TWK A;  4RKU F;  1ZMU A;  4B7H A;  1A5T A;  1JQJ C;  3I51 A;  1QUT A;  2L6O A;  4LF7 M;  1OIZ A;  4F1I A;  1GKI A;  4IBG A;  1TH4 A;  2HL7 A;  3VDU A;  2XH9 A;  5L8R F;  1TDZ A;  2CV0 A;  3IEC A;  3KW6 A;  4BB9 A;  4X64 M;  3GLG B;  1WGL A;  3E21 A;  2LHG A;  4CIZ A;  2QNJ A;  3LMM A;  5BR8 M;  1R2Z A;  2YFQ A;  3A45 A;  5FTL A;  1HQC A;  4DR7 M;  5EXS A;  3C9P A;  4GIT A;  4L8R C;  2WSE F;  3GLG A;  4R71 A;  3KDS E;  5KO3 A;  2UUB M;  4Y28 F;  2M60 A;  2H5X A;  1OAO C;  1OKS A;  1L2B A;  1WJ7 A;  1QAM A;  2G8L A;  1DGB A;  4LFA M;  2K0B X;  2LVN C;  1R7R A;  3LCU A;  3SC3 A;  2V1C A;  4QNR A;  2CE7 A;  2HWJ A;  4MGH A;  4KHP M;  2CRU A;  4G4R A;  3KP1 E;  5EXT A;  1AIP C;  3TPZ A;  3SAS A;  2AHM A;  3JAM S;  3TE6 A;  2CV1 A;  3J7B A;  4B3M M;  4TUW A;  2LTU A;  2DZO B;  1GL7 A;  3F92 A;  2CHG A;  4L15 A;  4M9S A;  3HX3 A;  1N77 A;  3SAT A;  4GIP A;  3DZD A;  4MGI E;  4Z8X A;  1GO5 A;  2OO9 A;  4LZZ A;  4JI6 M;  3AFH A;  4IBE A;  4HLQ A;  1E32 A;  5IWA M;  1QDT A;  1N36 M;  1V33 A;  3V76 A;  1I4W A;  2MRO B;  3GLI B;  3SAR A;  2LH0 A;  3T15 A;  4CIS A;  1Z5A A;  1DO0 A;  2O01 F;  4JI3 M;  2XZF A;  1OFI A;  2XFS A;  4IBK A;  2R46 A;  4OVZ B;  2KW0 A;  4IBF A;  4L16 A;  1E94 E;  3MHV C;  4RNA A;  4L4U A;  2DAM A;  3HHW A;  7CAT A;  2UUC M;  3GLI A;  1R5L A;  3VK7 A;  2LVQ D;  3FKE A;  4OVZ A;  2X8A A;  2BWE A;  1L2C A;  1QYR A;  4IBJ A;  3K9O A;  4OW0 A;  3L29 A;  1IN8 A;  3M7G A;  4KT0 F;  2CFO A;  3AV0 A;  2F5N A;  4M9X A;  3VKH A;  5DYG A;  2RKO A;  4NC6 A;  3I04 M;  4WUR A; 
#chains in the Genus database with same CATH homology
 3GO8 A;  3FTF A;  2ERC A;  4DUZ M;  5ITU A;  1N32 M;  1E9R A;  1H6U A;  4MM3 B;  2XZU A;  3L28 A;  3THG A;  3U6E A;  4GKK M;  1J7K A;  3KFU G;  2C98 A;  5EP4 A;  2QP9 X;  4X62 M;  1IXS B;  4FWD A;  4JI5 M;  1JR3 D;  3KP0 E;  3J81 S;  1QAQ A;  3FTD A;  4PT5 A;  1XHB A;  2XFT A;  2KA6 B;  3W0F A;  1XNR M;  3TWM A;  4DR5 M;  1ZQ9 A;  3GRU A;  1HNX M;  1G59 A;  4B3T M;  3A98 B;  3KS4 A;  4KO8 A;  3L2A A;  4QNM A;  4BBA A;  4LCB A;  3PFI A;  3UJN A;  4PD2 A;  3RGP A;  3I4Y A;  4LZJ A;  5ITX A;  4A3V B;  5ITQ A;  2JA2 A;  1FNN A;  2RGO A;  3GQ5 A;  2UUA M;  1QVR A;  2R45 A;  3DOA A;  3FUV A;  4CGY B;  4JV5 M;  3AOE A;  3L25 A;  4LF4 M;  4LG2 A;  3GPX A;  3UGJ A;  3HJQ A;  4IBD A;  4NRV A;  2ZBK B;  2DZN B;  3CTW B;  4K0K M;  3SAU A;  1SXJ C;  3SHG B;  4LGM A;  4NXM M;  4LJA A;  3KSX A;  1KYI A;  4FWH A;  1HR0 M;  3UK6 A;  3HGI A;  3T1Y M;  1IXZ A;  2R65 A;  2XEP A;  3CF2 A;  3FYC A;  4DR3 M;  2R62 A;  3FTE A;  4GMQ A;  2QCU A;  1IBM M;  4M0W A;  4D82 A;  2M5Z A;  4IBI A;  4B7F A;  3PNV A;  1Z5B A;  3LVW A;  3HU1 A;  4NRW A;  4OX9 M;  2C9O A;  3C58 A;  1ZAE A;  2XGN A;  3GPP A;  3D8B A;  4YHH M;  4LFC M;  1IN4 A;  1FJG M;  1DGH A;  1IY1 A;  1OFH A;  4JI8 M;  2F4V M;  4FCW A;  3FUT A;  4DV6 M;  3PXG A;  3AKZ A;  3K2L A;  4LRS A;  4S12 A;  4FCV A;  3PNY A;  3U6Q A;  4DR4 M;  5EP1 A;  5KQD A;  4QOS A;  3AL0 C;  3HJ8 A;  3E9S A;  4JYA M;  3HU3 A;  1NY5 A;  4AW4 A;  2RGH A;  3U6S A;  2HKJ A;  1L1T A;  3SYL A;  2V1U A;  1TH3 A;  3FUW A;  3VKG A;  5ITT A;  2QEN A;  2Y21 A;  4B3S M;  2D7H A;  3L26 A;  4JXJ A;  1E9S A;  4WW0 A;  1T3T A;  2F5P A;  4FVM A;  3LQQ A;  1J09 A;  2Y0Q A;  3VLF B;  1IY0 A;  2Y0T A;  3GPY A;  4NSO B;  3I4V A;  3T38 A;  3U61 B;  3K1J A;  4XGI A;  5DYI A;  5BPV A;  1KSF X;  3DA1 A;  2VQF M;  2XSZ D;  3U61 A;  1NHG C;  2OQ4 A;  4IBB A;  5JI2 E;  2X49 A;  2YNM D;  5EXP A;  2FE8 A;  5C18 A;  3KSJ A;  2DWZ B;  3KVW A;  4D80 A;  3RE8 A;  2FFJ A;  1Z5C A;  2F5Q A;  2ZAN A;  2UU9 M;  1C1K A;  1R6B X;  1PJI A;  4AKH A;  3FD9 A;  3Q8X A;  1Q3C A;  5E6J A;  1TDH A;  1W5T A;  4NSR A;  2EA0 A;  4G4O A;  2CUZ A;  1XC8 A;  4JI4 M;  4B08 A;  3ILK A;  5EXX A;  3K92 A;  4OU7 A;  3GPU A;  3HHY A;  3IG8 A;  2I7N A;  4M0D A;  4KLN A;  3HJS A;  3H4M A;  4M9Z A;  5GKN A;  5ITR A;  3DFZ A;  5KPR A;  1IN5 A;  3W0L B;  3GP1 A;  1HT1 E;  2XSZ A;  1K82 A;  2X4A A;  2R4E A;  2UXB M;  3FTC A;  1XWI A;  3SHF A;  3SFZ A;  1QAO A;  3IG5 A;  2LXE A;  5KPT A;  1TGU A;  3KS8 A;  1EE8 A;  3SAW A;  2K47 A;  5IZ7 D;  3LVV A;  3UZU A;  3U6M A;  4IBC A;  3A42 A;  4DV5 M;  3TL4 X;  2CV2 A;  5C1B A;  1I94 M;  3ZC7 B;  3HKP A;  4IIW A;  5LMN M;  2DHR A;  4GH9 A;  3EIH A;  4BLC A;  3SYK A;  3HHZ A;  3J7A S;  3AJI B;  3AOG A;  3QAU A;  3RGS A;  5DNY A;  3K8Z A;  3CF6 E;  4MB7 A;  2UXC M;  1YUB A;  1S3S A;  1UM8 A;  3HWS A;  3ZCB B;  1NNU C;  1IQP A;  1PM5 A;  3PVS A;  3TQS A;  3WHL A;  1Q3B A;  5H37 D;  5EQT A;  4JI7 M;  2R4J A;  2C96 A;  4G6Z A;  1L1Z A;  2DWN A;  3FUX A;  4LJ9 A;  5IRE B;  1NJF A;  3VDP A;  5FLX S;  1XMQ M;  3U5Z B;  1HT2 E;  3MK6 A;  5LMU M;  1HNZ M;  4II7 A;  3VK8 A;  4JI2 M;  4DV0 M;  2D7G A;  1ORY B;  2I7P A;  4P16 A;  4DV3 M;  4PDG A;  1JR3 A;  2DWM A;  3KOZ E;  4I5S A;  2ZM6 M;  3U5Z A;  2V6Z M;  1NVM A;  3GRY A;  4NL4 H;  3R9X B;  2P5T A;  4I8O A;  2CHQ A;  4CHT B;  5A2Q S;  3U6D A;  1IN7 A;  3UMM A;  2LNH C;  1Q39 A;  5KPZ A;  2Y20 A;  1NNJ A;  1J5E M;  5ITY A;  1L8Q A;  1LV7 A;  4FCT A;  3U6L A;  1L2D A;  2YR0 A;  4B7G A;  5JI3 E;  4REZ A;  1X37 A;  2Q2E B;  1Z59 A;  3SAV A;  1NHW C;  1Z6T A;  2FNA A;  2BNK A;  2QBY B;  1YSY A;  2L7I A;  3SBJ A;  2KRU A;  4D81 A;  1SXJ E;  4AG5 A;  5KQ8 A;  3M6A A;  2XF3 A;  2QBY A;  4B3R M;  4FD2 A;  1TH2 A;  2R18 A;  5FTM A;  2KZU A;  3RFW A;  2XLJ A;  4RF1 A;  2Z3X A;  4GKJ M;  4AZF A;  4DV2 M;  2BJV A;  2KEB A;  5E26 A;  4LFB M;  4I81 A;  2O5R A;  4R3D A;  5EJC A;  1DGF A;  1GL6 A;  1G41 A;  2LWX A;  2VQE M;  2F5S A;  3J2P B;  4HL4 A;  3SMS A;  4DR2 M;  1DO2 A;  1KFV A;  4QHS A;  3BOS A;  2L09 A;  4DUY M;  3LQR A;  4FW9 A;  2VII A;  4LGY A;  3A46 A;  3U6C A;  4AI6 A;  2NQ8 C;  1GLN A;  4PDI A;  2DWL A;  1W5S A;  5FSW A;  2HHH M;  3GRR A;  2UXD M;  1DGG A;  4AKG A;  3GLH B;  4Z6Y A;  2DXI A;  2L7H A;  1IXR C;  4EIW A;  4KOD A;  4ITQ A;  4LJ5 A;  1IY2 A;  2H1R A;  3GLH A;  5IT9 S;  2C5R A;  3WHK A;  1R2Y A;  4GC9 A;  4X65 M;  3KOX E;  4AQY M;  3HU2 A;  4MGY E;  4JI0 M;  4AG6 A;  3OTO M;  4LRT A;  3VFD A;  4NXN M;  4LY6 A;  2FOI C;  2ZAO A;  2KXE A;  3QWL A;  5EP2 A;  2E5L M;  1IM2 A;  3MJ5 A;  3GQ4 A;  3J27 B;  4GHL A;  1GVN A;  3GRV A;  4IJF A;  4MGZ E;  8CAT A;  4QHT A;  4LF8 M;  4G4N A;  2Z4S A;  4RF0 A;  1XMO M;  2EUC A;  3JR4 A;  2Z4R A;  3FYD A;  4LF9 M;  4AKI A;  1MX0 A;  2CEA A;  3AOE C;  2F5O A;  1N78 A;  4FWG A;  3GQ3 A;  4LJ6 A;  1L2B A;  1OJL A;  1N33 M;  1QAN A;  2A5Y B;  2KZS A;  2J7N A;  2G5G X;  1HQY E;  4PCZ A;  3EIE A;  3FUU A;  4DR1 M;  3M0E A;  2Z7J A;  2DVW B;  1YE9 A;  4LJ8 A;  4GHA A;  1NJG A;  1QZM A;  1PJJ A;  1G3I A;  2C99 A;  3KOY E;  4LJ7 A;  2YQZ A;  2J7O A;  5FTN A;  4GRI A;  4MH0 E;  4DR6 M;  1QQW A;  1VDD A;  4G4Q A;  4IJE A;  4W5W A;  1D2N A;  3ZH9 B;  3NWL A;  2QPA A;  5FTK A;  4JN6 A;  1NSF A;  1SXJ D;  2QZ4 A;  3KOW E;  4YY3 M;  5ITX E;  2EO2 A;  2OPF A;  3B9P A;  3L27 A;  1G4A E;  1IN6 A;  2CHV A;  3U60 B;  4DV4 M;  4NOO B;  3SMP A;  1K3X A;  3U6O A;  5F3W A;  1IBK M;  2D7E A;  1K3W A;  3R8F A;  3CF0 A;  4DV7 M;  3J80 S;  4X66 M;  4DV1 M;  1XNQ M;  1HNW M;  4LF5 M;  3U60 A;  1XXH B;  1G8P A;  2BJW A;  1WXQ A;  4LJ4 A;  4QOZ C;  2KRK A;  4LF6 M;  3E4R A;  4R7G A;  3NBI A;  3JR5 A;  5EP3 A;  4ZPX A;  3GLF B;  2C9C A;  2HCB A;  1XXH A;  2W82 A;  3HHX A;  4GC5 A;  4L78 A;  1MU5 A;  4MGK E;  1SXJ B;  1NY6 A;  4I4L A;  5FTJ A;  3T1H M;  1N34 M;  1IBL M;  1N75 A;  3TWL A;  3GLF A;  1DGH B;  4XBO A;  1SXJ A;  2ZAM A;  4JI1 M;  3U6P A;  3D8L A;  3KXE C;  3TWK A;  4B7H A;  3I51 A;  1JQJ C;  2L6O A;  4LF7 M;  1GKI A;  4IBG A;  1TH4 A;  2HL7 A;  3VDU A;  2XH9 A;  1TDZ A;  2CV0 A;  3KW6 A;  4BB9 A;  4X64 M;  3GLG B;  3LMM A;  5BR8 M;  1R2Z A;  2YFQ A;  3A45 A;  5FTL A;  1HQC A;  4DR7 M;  5EXS A;  4GIT A;  4L8R C;  3GLG A;  3KDS E;  5KO3 A;  2UUB M;  2M60 A;  1QAM A;  2G8L A;  1DGB A;  4LFA M;  1R7R A;  3SC3 A;  2V1C A;  4QNR A;  2CE7 A;  4MGH A;  4KHP M;  4G4R A;  3KP1 E;  5EXT A;  3TPZ A;  3SAS A;  2AHM A;  3JAM S;  3TE6 A;  2CV1 A;  3J7B A;  4B3M M;  4TUW A;  2DZO B;  1GL7 A;  4L15 A;  2CHG A;  4M9S A;  1N77 A;  3SAT A;  4GIP A;  3DZD A;  4MGI E;  4Z8X A;  4LZZ A;  4JI6 M;  3AFH A;  4IBE A;  4HLQ A;  1E32 A;  5IWA M;  1N36 M;  1I4W A;  3GLI B;  3SAR A;  2LH0 A;  3T15 A;  4CIS A;  1Z5A A;  1DO0 A;  4JI3 M;  2XZF A;  1OFI A;  2XFS A;  4IBK A;  2R46 A;  4OVZ B;  2KW0 A;  4IBF A;  4L16 A;  1E94 E;  3MHV C;  4RNA A;  4L4U A;  3HHW A;  7CAT A;  2UUC M;  3GLI A;  3VK7 A;  3FKE A;  4OVZ A;  2X8A A;  1L2C A;  1QYR A;  4IBJ A;  4OW0 A;  3L29 A;  1IN8 A;  3M7G A;  2CFO A;  3AV0 A;  2F5N A;  4M9X A;  3VKH A;  5DYG A;  2RKO A;  4WUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...