1HNZM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hnzM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hnzM02
1Z5CA 4DV1M 3VK8A 5ITQA 1PJIA 1J5EM 4KHPM 4DV3M 3JR5A 2ZM6M 3U6EA 4JI8M 3GPPA 4K0KM 3U6DA 1K3XA 3TWKA 4DV6M 2UUAM 3TWLA 1R2YA 1L2CA 1Q3BA 1K82A 1HNWM 3W0FA 2UUBM 3SATA 2VQFM 5ITYA 1IBKM 4OX9M 3GO8A 4G4RA 4B3MM 3U6QA 1NNJA 4LF4M 3GQ5A 2ZBKB 3GQ4A 3GP1A 3U6OA 2E5LM 3U6CA 1N32M 5LMUM 2F4VM 4DV0M 4DR1M 4ITQA 4PDGA 1L2DA 4NRVA 4NXNM 1IBLM 4JI7M 4PCZA 3C58A 2F5OA 5FLXS 4DR7M 2HKJA 4LF5M 3J80S 1Q3CA 1XMQM 3A45A 1N34M 4JYAM 1PM5A 2OQ4A 1Z5AA 3A46A 4B3RM 4X62M 1MX0A 4JV5M 3U6PA 1I94M 4AQYM 1HR0M 4X64M 1N33M 4MB7A 4DR4M 1HNZM 4LF9M 4NXMM 4DR6M 1IBMM 2F5SA 4DV4M 5ITXA 1Z59A 2F5PA 2UXBM 3SARA 2XZFA 4NRWA 2UUCM 3SAVA 4YY3M 3VK7A 4JI2M 1L2BA 3GQ3A 1Q39A 4GKJM 4PD2A 5IWAM 2OPFA 1XC8A 3SAUA 3TWMA 3U6SA 3GPYA 3A42A 4CISA 3U6LA 3JAMS 1MU5A 2Q2EB 4DV2M 4LF8M 4DV5M 2VQEM 3SBJA 1KFVA 4LFCM 1XNRM 1TDHA 1PJJA 1XMOM 3DOAA 4G4QA 3T1HM 1FJGM 5IT9S 4DUYM 4LFBM 2HHHM 1Z5BA 4X65M 4LF6M 3T1YM 4JI5M 1L1ZA 2UU9M 4DR3M 1TDZA 5BR8M 4JI1M 3GPXA 4G4NA 2UXDM 4DR5M 4G4OA 1EE8A 2F5QA 4JI4M 1XNQM 3GPUA 1L1TA 2EA0A 4JI0M 4JI3M 5ITXE 2UXCM 4YHHM 4X66M 3SASA 4LF7M 5ITTA 4DUZM 5ITRA 3OTOM 1N36M 3U6MA 2XZUA 4GKKM 4LFAM 4JI6M 1HNXM 4B3TM 4PDIA 5A2QS 3J81S 1K3WA 2F5NA 4DV7M 3J7AS 3SAWA 4B3SM 5LMNM 1R2ZA 5ITUA 3JR4A 4DR2M
chains in the Genus database with same CATH superfamily
1MN3A 1J7KA 1QAQA 2DVWB 4NSOB 2R4EA 1N78A 5KQDA 4MGZE 1EIJA 1C1KA 2DZLA 2ZM6M 4LGYA 4D82A 4B7HA 2W82A 4M9SA 3TWKA 2CHVA 3KOZE 2WSEF 2ERCA 4W5WA 5DFLA 1L2CA 2UUAM 4FCTA 2KEBA 5BPVA 3KS8A 2G3QA 2R65A 1IBKM 3PNVA 2AHMA 3VDUA 1D2NA 1VG5A 4PT5A 4LF4M 3GQ5A 1D0LA 3U60A 1IN6A 3U6OA 2V6ZM 3AOEC 3U6CA 1NSFA 2L09A 3L2AA 4CHTB 2CV2A 3KSXA 2GNOA 4LJ6A 3IG5A 4DBGB 2MJ5B 3B89A 1VDDA 2XH9A 3HKPA 3SC3A 1GVNA 3SFZA 4BBAA 1NJFA 3LVWA 1E94E 1QDRA 4L6V6 4MGKE 4OVZB 5FLXS 2JY6B 4EIWA 4FVMA 3ZCBB 2CRUA 2BJWA 3VDPA 2JZ0A 1N34M 4QOZC 4JYAM 2DKLA 2KNAA 3CTWB 2ZANA 2QSFX 1PJQA 2KHHA 1JR3D 1NJGA 1MX0A 1T3TA 2OO9A 4X62M 3HGIA 1OFHA 1I94M 2DZOB 2R45A 4RKUF 1S3SA 2LVPC 5DNYA 4MB7A 2MGWA 1HNZM 4LJ4A 2L7HA 4LJ8A 4NXMM 2F5SA 3E9SA 1IN8A 3WHLA 4R7GA 3FUVA 3GLFA 3GLIB 2L4EA 4MH0E 2UUCM 2Z4SA 4MM3B 2JP7A 3GLIA 2J7NA 1OAIA 2LHCA 3LCUA 1PJTA 1IY1A 1ZMWA 2Y0TA 2C5RA 3TWMA 4M0WA 3U6SA 3L28A 3GPYA 2I7NA 3QWLA 4Z8XA 4F1IA 2DWNA 1OKSA 1MU5A 5KO3A 2C9OA 3J27B 8CATA 2VQEM 2DAIA 1W5TA 3BOSA 4AG5A 1G41A 3BXWA 5IT9S 3HU3A 3SMPA 3CF2A 3R8FA 1D0KA 1I4WA 4II7A 3IG8A 3FYDA 4LF6M 4LJ9A 2DI0A 4MGIE 3V76A 1V33A 4A3VB 2LWXA 4F2LA 4QOSA 4JI1M 2LVQD 3UK6A 1AIPC 2HL7A 4IBFA 3LW5F 4QHTA 2KDLA 2UXDM 1ZMUA 3HY5A 1GLNA 2M60A 1VDLA 3U61A 2QHOB 2JA2A 3H4JA 4UN2B 4JI0M 4CGYB 1SG9A 1TH4A 4LGMA 3AV0A 4LRSA 2Y0QA 3U6MA 3K8ZA 2XZUA 4JI6M 2KZUA 4PDIA 2APLA 4DV7M 4KO8A 3TPZA 4G3OA 4IBDA 2EKKA 4JN6A 1T43A 2WSFF 2DNAA 4IBEA 1DV0A 4P16A 3UGJA 2R4JA 2V1CA 1PJIA 3WHKA 1G4AE 4DV3M 3HJSA 2X49A 1IXZA 4HL4A 4K0KM 1IM2A 2R44A 5EJCA 3U6DA 3TL4X 3TQSA 1Q3BA 2ZTDA 3FRHA 1QVRA 3VKGA 3QAUA 1QUTA 2HAKA 5ITYA 2H1RA 4B08A 1UM8A 3GO8A 4M9XA 2RGHA 3C3DA 2G8LA 2A5YB 1WHCA 2YNMD 4FCVA 5FTLA 2KNZA 1T6OA 4P17A 3LQQA 2ZBKB 4AZFA 3GQ4A 1N77A 2CV1A 1JQJC 1HT1E 2FFJA 4HEOA 1WIVA 1N32M 3IHPA 1R5LA 1IN7A 4GEWA 2FE8A 2DENA 3PXGA 4BLCA 4DR1M 4PDGA 1ZQ9A 4ANRA 3NBIA 1OIZA 3LCVB 1W5SA 4M0DA 2X4AA 3M7GA 3C58A 3KXEC 4DR7M 1IQPA 2I7PA 2HKJA 3T6PA 3HHYA 3J80S 3KFUG 1Q3CA 2EUCA 3GLHA 3HHZA 1PM5A 1GJTA 2CFOA 1Z5AA 3A46A 3ILKA 3E46A 3L25A 5IZ7D 4JV5M 1J09A 3CF6E 1HT2E 2QZ4A 4XGIA 2CEAA 3HJ8A 3KDSE 2XLJA 3QYEA 2BWEA 5FTJA 4I5SA 2FH0A 5ITXA 4KT0F 2DWLA 2F5PA 1GO5A 1DGGA 2C99A 1NY5A 4NRWA 1GL6A 5L8RF 2O5RA 3MHVC 5JI3E 1E9SA 1SXJD 2C98A 1Q39A 2P5TA 4GC5A 4GHLA 4AI6A 3SAUA 2JWSA 1NO1A 2KW0A 5EP3A 2M5ZA 2HCBA 1QDTA 2QCUA 2RGOA 4XBOA 2XFTA 2K47A 2Q2EB 3JAMS 4DV2M 3ZQJA 1TTEA 4LF8M 1Q02A 1TDHA 4WURA 5IREB 1XXHE 4B7GA 5KQ8A 3HWSA 3T1HM 1QZEA 1FJGM 3GRYA 1NVMA 2OOAA 4DUYM 4LFBM 2XEPA 2JY7A 1NV8A 1C7YA 3B9PA 1Z5BA 4X65M 4MGYE 3T1YM 3GLFB 1L1ZA 4AG6A 1IXRC 3FTCA 4IBJA 4DR3M 3IECA 5BR8M 3D8LA 1Y8GA 3R9XB 2DZNB 3K2LA 4MGHA 3W68A 4LCBA 4L8RC 2R6FA 4AKIA 2BJVA 2QQ8A 1EE8A 1YUBA 2F5QA 2K0BX 2LVAA 2RKOA 4LJ7A 4OW0A 3FKEA 3GPUA 3CGWA 1YE9A 3GLIE 2WSCF 4LJAA 5EP1A 4KODA 1L8QA 4YHHM 3SASA 3I04M 3RGSA 4DUZM 4RF1A 1AUAA 1X37A 2XGNA 3EIHA 4QHSA 7CATA 4IIWA 4QNRA 1WXQA 4OVZA 4I4LA 5FTNA 3VLFB 1R6BX 5A2QS 3KP1E 1PRBA 2DAMA 3B74A 1G8PA 4R71A 2EO2A 3H4MA 4L15A 3GLGE 4AKHA 1VEGA 3KP0E 5FSWA 4DV1M 1G71A 3SHGB 1SXJA 3MK6A 3VK8A 1J5EM 2C9CA 4NC6A 4KHPM 3E21A 3KOWE 4KLNA 2LBCA 4JI8M 1K3XA 1NV9A 1R2YA 1E9RA 3U60B 4AKGA 2ZAMA 1HNWM 2K9DA 2DWMA 1IY2A 2VQFM 2LTUA 2UUBM 3GLGB 3C9PA 2CHGA 4FD2A 2ZAOA 3U6QA 1NNJA 3DZDA 4Z6YA 1CUKA 3HHXA 5C18A 1WJ7A 2MH8A 4RNAA 3GP1A 3AFHA 2CUZA 3HX3A 2KRUA 3FTFA 3T38A 3E4RA 1XXHA 2O01F 4GITA 5E26A 5LMUM 3Q8GA 4ITQA 4GC9A 2KZSA 2QNJA 2VF8A 4NXNM 1IBLM 3AJIB 4JI7M 1FNNA 1KSFX 2LVOC 2KNVA 3GRRA 1DGHB 1R7RA 5EP4A 4Q7JA 4RF0A 3FE3A 3KOXE 5E6JA 3TE6A 1Z6TA 1DGBA 3NBXX 4NL4H 4LF5M 1XMQM 3B7ZA 3A45A 3NWLA 3BBZA 4B3RM 1SXJC 2H5XA 3K92A 4L4UA 3B7QA 1JR3A 4X64M 1N33M 4D80A 4LRTA 3UZUA 1JR3E 1TH2A 2L4FA 4DR6M 1TH3A 2LH0A 2NQ8C 2Y20A 3I01M 4DV4M 1IBMM 4LG2A 1NHGC 3AL0C 4LJ5A 3SARA 1EFUB 2XZFA 2UXBM 1GKIA 3VK7A 2KXEA 1IY0A 1L2BA 1V34A 2DWZB 2JY8A 3GQ3A 1R4GA 4GKJM 2FNAA 4AW4A 5IWAM 3MMPA 2OPFA 2JZ1A 3I4VA 1XC8A 4R3DA 3F92A 1MJGM 3M0EA 2K6BA 5H37D 2GQFA 1IN4A 5FTKA 2DAEA 2LXEA 3A42A 3HU1A 3U6LA 1NNUC 4CISA 1YSYA 1WR1B 3HU2A 1GL7A 2XSZA 3KVWA 4FWGA 1RU3A 1KFVA 2Z8YM 3VFDA 4LFCM 3FD9A 4G6ZA 4XK8F 3RFWA 2KRKA 3DOAA 4G4QA 3HZJA 4GH9A 1HJPA 5GKNA 2EJSA 3FUWA 3AKZA 2WZJA 2D7HA 3HHWA 2EKFA 4IBKA 3SYKA 2HHHM 3THGA 5KPTA 4JI5M 2LNHC 3W67A 4Y28F 2J7OA 2JNHA 3KW6A 1VEKA 1QAOA 2LHGA 1XXHB 4JXJA 2BWBA 4OU7A 5EXPA 3MJ5A 4DR5M 2MROB 3AOGA 2ZTCA 1G59A 1XNQM 2XFSA 1L1TA 1SXJE 4HLQA 2EA0A 3GLFE 2CP8A 2YR0A 4JI3M 5EXSA 2DHYA 2O25A 3GLGA 1IXSA 4LF7M 5ITTA 1N36M 3OTOM 1F4IA 1HQYE 3M6AA 3FUUA 1K3WA 2F5NA 3FTDA 1WGLA 3QYBA 3LMMA 5LMNM 3SAWA 4B3SM 1IFYA 2MR9A 3JR4A 1VEJA 1Z5CA 4I8OA 2QP9X 3DA1A 1ZV1A 1D0MA 1SXJB 2G5GX 4IBIA 5ITQA 3U5ZA 1E32A 3JR5A 2X8AA 3FYCA 4ZPXA 3GPPA 3U6EA 2LVNC 4L16A 4DV6M 2QENA 1QANA 3TWLA 1OIPA 3RGPA 3RE8A 1K82A 3FTEA 4GRIA 5EXXA 2KA6B 3AOEA 3W0FA 3K9OA 3SATA 2DHRA 3B7NA 4FW9A 5KPRA 4QNMA 2VDBB 2V1UA 4OX9M 2C96A 4G4RA 2YFQA 5JI2E 1A5TA 4B3MM 4TUWA 3SHFA 3VKHA 3KS4A 1IN5A 2FOIC 3L27A 1H6UA 3LVVA 4IBGA 4FCWA 4REZA 2Z3XA 4JI4M 5EXTA 4B7FA 2E5LM 2DAGA 3U5ZB 3A98B 2JY5A 3UJNA 4DV0M 2F4VM 3SYLA 1V92A 1XB2B 3PVSA 3L26A 3K1JA 1L2DA 4NRVA 3D8BA 1NHWC 1N75A 2CWBA 4M9ZA 2FS1A 3DFZA 4LY6A 4PCZA 2F5OA 1WGNA 1ORYB 4CJ6A 3Q8XA 2Z7JA 1XHBA 2CHQA 1TGUA 4FWDA 3UMMA 1IXSB 4WW0A 2VF7A 3I51A 2DXIA 4LZJA 1XWIA 3U61B 2DAKA 3T15A 2OQ4A 1OFIA 3FUXA 3PNYA 5KPZA 2CV0A 3I4YA 3U6PA 1GABA 3C3EA 4AQYM 2B3TA 2XF3A 3PFIA 1HR0M 3ZC7B 1TR8A 2HWJA 2RRUA 4IJEA 2J5YA 1VQ1A 2QBYA 4DR4M 5EP2A 4LF9M 2OOBA 2R62A 1ZMVA 5DYIA 1Z59A 1ZAEA 1QUSA 2D7EA 3ZH9B 3SAVA 4YY3M 1QAMA 3GLHE 4I81A 4JI2M 1PGYA 4LZZA 4D81A 1G3IA 4IBCA 2YQZA 3HJQA 2R18A 4PD2A 2QBYB 3KSJA 5EQTA 1P3QQ 2CE7A 4WP2A 1YLAA 1OTRA 3LQRA 3SMSA 3GRUA 3EIEA 1DO0A 3J2PB 4DV5M 3GLHB 3SBJA 2XSZD 4CIZA 1XNRM 1QYRA 1XMOM 1PJJA 1QZMA 5F3WA 5ITUA 2JUJA 3L29A 4S12A 4GHAA 2QPAA 2Z4RA 4IJFA 1BVSA 4BB9A 1OQYA 1LTMA 1NY6A 2BNKA 3K9PA 1PJSA 1QQWA 4L78A 1KYIA 2R0IA 3KOYE 1OAOC 2UU9M 1LV7A 2D7GA 2L7IA 3W0LB 1TDZA 1OJLA 2Y21A 2R46A 3GPXA 4IBBA 1DGFA 3J7BA 4NSRA 4G4NA 5DYGA 4FWHA 1GJSA 2VIIA 1UFZA 4G4OA 4NOOB 5C1BA 2L6OA 3GRVA 1TF0B 5ITXE 1JB0F 1HQCA 4GMQA 4X66M 2UXCM 5FTMA 4GIPA 2JXNA 3FRIA 5ITRA 4GKKM 1DO2A 4LFAM 1DGHA 1HNXM 3CF0A 4B3TM 3J81S 3J7AS 2L2DA 1R2ZA 3FUTA 2N35A 4DR2M
chains in the Genus database with same CATH topology
1J7KA 1QAQA 2DVWB 4NSOB 2R4EA 1N78A 5KQDA 4MGZE 1C1KA 2ZM6M 4LGYA 4D82A 4B7HA 2W82A 4M9SA 3TWKA 2CHVA 3KOZE 2UUAM 2ERCA 4W5WA 1L2CA 4FCTA 2KEBA 5BPVA 3KS8A 2R65A 1IBKM 3PNVA 2AHMA 3VDUA 1D2NA 4PT5A 4LF4M 3GQ5A 3U60A 1IN6A 3U6OA 2V6ZM 3AOEC 3U6CA 1NSFA 2L09A 3L2AA 4CHTB 2CV2A 3KSXA 4LJ6A 3IG5A 3HKPA 1VDDA 2XH9A 3SC3A 1GVNA 3SFZA 4BBAA 1NJFA 3LVWA 1E94E 4OVZB 5FLXS 4MGKE 4EIWA 4FVMA 3ZCBB 2BJWA 3VDPA 1N34M 4QOZC 4JYAM 3CTWB 2ZANA 1JR3D 1NJGA 1MX0A 1T3TA 4X62M 3HGIA 1OFHA 1I94M 2DZOB 2R45A 1S3SA 5DNYA 4MB7A 1HNZM 4LJ4A 2L7HA 4LJ8A 4NXMM 2F5SA 3E9SA 1IN8A 3WHLA 4R7GA 3FUVA 3GLFA 3GLIB 4MH0E 2UUCM 2Z4SA 4MM3B 3GLIA 2J7NA 1IY1A 2Y0TA 2C5RA 3TWMA 4M0WA 3U6SA 3L28A 3GPYA 2I7NA 3QWLA 4Z8XA 2DWNA 1MU5A 5KO3A 2C9OA 3J27B 8CATA 2VQEM 1W5TA 3BOSA 4AG5A 1G41A 5IT9S 3HU3A 3SMPA 3CF2A 3R8FA 4II7A 1I4WA 3IG8A 3FYDA 4LF6M 4LJ9A 4MGIE 4A3VB 2LWXA 4QOSA 4JI1M 3UK6A 2HL7A 4IBFA 4QHTA 2UXDM 1GLNA 2M60A 3U61A 2JA2A 4JI0M 4CGYB 1TH4A 4LRSA 4LGMA 3AV0A 2Y0QA 3U6MA 3K8ZA 2XZUA 4JI6M 2KZUA 4PDIA 4DV7M 4KO8A 3TPZA 4IBDA 4JN6A 4IBEA 4P16A 3UGJA 2R4JA 2V1CA 1PJIA 3WHKA 1G4AE 4DV3M 3HJSA 2X49A 1IXZA 4HL4A 4K0KM 1IM2A 3U6DA 5EJCA 3TL4X 3TQSA 1Q3BA 1QVRA 3VKGA 3QAUA 5ITYA 2H1RA 4B08A 1UM8A 3GO8A 4M9XA 2RGHA 2G8LA 2A5YB 2YNMD 4FCVA 5FTLA 3LQQA 2ZBKB 4AZFA 3GQ4A 1N77A 2CV1A 1JQJC 1HT1E 2FFJA 1N32M 1IN7A 4BLCA 2FE8A 3PXGA 4DR1M 4PDGA 1ZQ9A 3NBIA 1W5SA 4M0DA 2X4AA 3M7GA 3C58A 3KXEC 4DR7M 1IQPA 2I7PA 2HKJA 3HHYA 3J80S 3KFUG 1Q3CA 2EUCA 3GLHA 3HHZA 1PM5A 2CFOA 1Z5AA 3A46A 3ILKA 3L25A 5IZ7D 4JV5M 1J09A 3CF6E 1HT2E 2QZ4A 4XGIA 2CEAA 3HJ8A 3KDSE 2XLJA 5FTJA 4I5SA 5ITXA 2DWLA 2F5PA 1DGGA 2C99A 1NY5A 4NRWA 1GL6A 2O5RA 3MHVC 5JI3E 1E9SA 1SXJD 2C98A 1Q39A 2P5TA 4GC5A 4GHLA 4AI6A 3SAUA 5EP3A 2KW0A 2M5ZA 2HCBA 2QCUA 2RGOA 4XBOA 2XFTA 2K47A 2Q2EB 3JAMS 4DV2M 4LF8M 1TDHA 4WURA 5IREB 4B7GA 5KQ8A 3HWSA 3T1HM 1FJGM 3GRYA 1NVMA 4DUYM 4LFBM 2XEPA 3B9PA 1Z5BA 4X65M 4MGYE 3T1YM 3GLFB 1L1ZA 4AG6A 1IXRC 3FTCA 4IBJA 4DR3M 5BR8M 3D8LA 3R9XB 2DZNB 3K2LA 4MGHA 4LCBA 4L8RC 4AKIA 2BJVA 1EE8A 1YUBA 2F5QA 4JI4M 2RKOA 4LJ7A 4OW0A 3FKEA 3GPUA 1YE9A 4LJAA 5EP1A 4KODA 1L8QA 4YHHM 3SASA 3RGSA 4DUZM 4RF1A 1X37A 2XGNA 3EIHA 7CATA 4QHSA 4IIWA 4QNRA 1WXQA 4OVZA 4I4LA 5FTNA 3VLFB 1R6BX 5A2QS 3KP1E 4AKHA 1G8PA 2EO2A 3H4MA 4L15A 3KP0E 5FSWA 4DV1M 3SHGB 1SXJA 3MK6A 3VK8A 1J5EM 2C9CA 4KHPM 3KOWE 4KLNA 4JI8M 1K3XA 1R2YA 1E9RA 3U60B 4AKGA 2ZAMA 1HNWM 2DWMA 2UUBM 1IY2A 2VQFM 3GLGB 2CHGA 4FD2A 2ZAOA 3U6QA 1NNJA 3DZDA 4Z6YA 3HHXA 5C18A 4RNAA 3GP1A 3AFHA 2CUZA 3FTFA 2KRUA 3T38A 3E4RA 1XXHA 5E26A 4GITA 5LMUM 4ITQA 4GC9A 2KZSA 4NXNM 1IBLM 3AJIB 4JI7M 1FNNA 1KSFX 3GRRA 1DGHB 1R7RA 5EP4A 4RF0A 3KOXE 5E6JA 3TE6A 1Z6TA 1DGBA 4LF5M 4NL4H 1XMQM 3NWLA 3A45A 4B3RM 1SXJC 3K92A 4L4UA 1JR3A 4X64M 1N33M 4D80A 4LRTA 3UZUA 1TH2A 4DR6M 1TH3A 2LH0A 2NQ8C 2Y20A 4DV4M 1IBMM 4LG2A 3AL0C 1NHGC 2UXBM 4LJ5A 3SARA 2XZFA 1GKIA 3VK7A 2KXEA 1IY0A 1L2BA 2DWZB 3GQ3A 4GKJM 2FNAA 4AW4A 5IWAM 2OPFA 3I4VA 1XC8A 4R3DA 3M0EA 5H37D 5FTKA 1IN4A 2LXEA 3A42A 3HU1A 3U6LA 4CISA 1NNUC 1YSYA 3HU2A 1GL7A 2XSZA 3KVWA 4FWGA 1KFVA 3VFDA 4LFCM 3FD9A 4G6ZA 3RFWA 2KRKA 3DOAA 4G4QA 4GH9A 5GKNA 3FUWA 3AKZA 2D7HA 3HHWA 4IBKA 3SYKA 2HHHM 3THGA 5KPTA 4JI5M 2LNHC 2J7OA 3KW6A 1QAOA 1XXHB 4JXJA 4OU7A 5EXPA 3MJ5A 4DR5M 3AOGA 1G59A 1XNQM 2XFSA 1L1TA 1SXJE 4HLQA 2EA0A 2YR0A 4JI3M 5EXSA 3GLGA 4LF7M 5ITTA 1N36M 3OTOM 1HQYE 3M6AA 3FUUA 1K3WA 2F5NA 3FTDA 3SAWA 4B3SM 3LMMA 5LMNM 3JR4A 1Z5CA 4I8OA 2QP9X 3DA1A 1SXJB 2G5GX 4IBIA 5ITQA 3U5ZA 1E32A 3JR5A 2X8AA 3FYCA 4ZPXA 3GPPA 3U6EA 4L16A 4DV6M 2QENA 1QANA 3TWLA 3RGPA 3RE8A 1K82A 3FTEA 4GRIA 5EXXA 2KA6B 3AOEA 3W0FA 3SATA 2DHRA 4FW9A 2V1UA 5KPRA 4QNMA 4OX9M 2C96A 4G4RA 2YFQA 5JI2E 4B3MM 3VKHA 4TUWA 3SHFA 3KS4A 1IN5A 2FOIC 3L27A 1H6UA 3LVVA 4IBGA 4FCWA 4REZA 2Z3XA 5EXTA 4B7FA 2E5LM 3U5ZB 3A98B 2F4VM 3UJNA 4DV0M 3SYLA 3L26A 3PVSA 1L2DA 3K1JA 4NRVA 3D8BA 1NHWC 1N75A 4M9ZA 3DFZA 4LY6A 4PCZA 2F5OA 1ORYB 3Q8XA 2Z7JA 1XHBA 2CHQA 1TGUA 4FWDA 3UMMA 1IXSB 4WW0A 3I51A 2DXIA 4LZJA 1XWIA 3U61B 3T15A 2OQ4A 1OFIA 3FUXA 3PNYA 5KPZA 2CV0A 3I4YA 3U6PA 4AQYM 2XF3A 3PFIA 1HR0M 3ZC7B 4IJEA 2QBYA 4DR4M 5EP2A 4LF9M 2R62A 5DYIA 1Z59A 1ZAEA 2D7EA 3ZH9B 3SAVA 4YY3M 1QAMA 4JI2M 4I81A 4LZZA 4D81A 1G3IA 4IBCA 2YQZA 3HJQA 2R18A 4PD2A 2QBYB 3KSJA 5EQTA 2CE7A 3LQRA 3SMSA 3GRUA 3EIEA 1DO0A 3J2PB 4DV5M 3GLHB 3SBJA 2XSZD 1XNRM 1QYRA 1XMOM 1PJJA 1QZMA 5F3WA 5ITUA 4S12A 3L29A 4GHAA 2QPAA 2Z4RA 4IJFA 4BB9A 1NY6A 2BNKA 1QQWA 4L78A 1KYIA 3KOYE 2UU9M 1LV7A 2D7GA 2L7IA 3W0LB 1TDZA 1OJLA 2Y21A 2R46A 3GPXA 4IBBA 1DGFA 3J7BA 4NSRA 4G4NA 5DYGA 4FWHA 2VIIA 4G4OA 4NOOB 5C1BA 2L6OA 3GRVA 5ITXE 1HQCA 2UXCM 4GMQA 4X66M 5FTMA 4GIPA 5ITRA 4GKKM 1DO2A 4LFAM 1DGHA 1HNXM 3CF0A 4B3TM 3J81S 3J7AS 1R2ZA 3FUTA 4DR2M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5C A;  4DV1 M;  3VK8 A;  5ITQ A;  1PJI A;  1J5E M;  4KHP M;  4DV3 M;  3JR5 A;  2ZM6 M;  3U6E A;  4JI8 M;  3GPP A;  4K0K M;  3U6D A;  1K3X A;  3TWK A;  4DV6 M;  2UUA M;  3TWL A;  1R2Y A;  1L2C A;  1Q3B A;  1K82 A;  1HNW M;  3W0F A;  2UUB M;  3SAT A;  2VQF M;  5ITY A;  1IBK M;  4OX9 M;  3GO8 A;  4G4R A;  4B3M M;  3U6Q A;  1NNJ A;  4LF4 M;  3GQ5 A;  2ZBK B;  3GQ4 A;  3GP1 A;  3U6O A;  2E5L M;  3U6C A;  1N32 M;  5LMU M;  2F4V M;  4DV0 M;  4DR1 M;  4ITQ A;  4PDG A;  1L2D A;  4NRV A;  4NXN M;  1IBL M;  4JI7 M;  4PCZ A;  3C58 A;  2F5O A;  5FLX S;  4DR7 M;  2HKJ A;  4LF5 M;  3J80 S;  1Q3C A;  1XMQ M;  3A45 A;  1N34 M;  4JYA M;  1PM5 A;  2OQ4 A;  1Z5A A;  3A46 A;  4B3R M;  4X62 M;  1MX0 A;  4JV5 M;  3U6P A;  1I94 M;  4AQY M;  1HR0 M;  4X64 M;  1N33 M;  4MB7 A;  4DR4 M;  1HNZ M;  4LF9 M;  4NXM M;  4DR6 M;  1IBM M;  2F5S A;  4DV4 M;  5ITX A;  1Z59 A;  2F5P A;  2UXB M;  3SAR A;  2XZF A;  4NRW A;  2UUC M;  3SAV A;  4YY3 M;  3VK7 A;  4JI2 M;  1L2B A;  3GQ3 A;  1Q39 A;  4GKJ M;  4PD2 A;  5IWA M;  2OPF A;  1XC8 A;  3SAU A;  3TWM A;  3U6S A;  3GPY A;  3A42 A;  4CIS A;  3U6L A;  3JAM S;  1MU5 A;  2Q2E B;  4DV2 M;  4LF8 M;  4DV5 M;  2VQE M;  3SBJ A;  1KFV A;  4LFC M;  1XNR M;  1TDH A;  1PJJ A;  1XMO M;  3DOA A;  4G4Q A;  3T1H M;  1FJG M;  5IT9 S;  4DUY M;  4LFB M;  2HHH M;  1Z5B A;  4X65 M;  4LF6 M;  3T1Y M;  4JI5 M;  1L1Z A;  2UU9 M;  4DR3 M;  1TDZ A;  5BR8 M;  4JI1 M;  3GPX A;  4G4N A;  2UXD M;  4DR5 M;  4G4O A;  1EE8 A;  2F5Q A;  4JI4 M;  1XNQ M;  3GPU A;  1L1T A;  2EA0 A;  4JI0 M;  4JI3 M;  5ITX E;  2UXC M;  4YHH M;  4X66 M;  3SAS A;  4LF7 M;  5ITT A;  4DUZ M;  5ITR A;  3OTO M;  1N36 M;  3U6M A;  2XZU A;  4GKK M;  4LFA M;  4JI6 M;  1HNX M;  4B3T M;  4PDI A;  5A2Q S;  3J81 S;  1K3W A;  2F5N A;  4DV7 M;  3J7A S;  3SAW A;  4B3S M;  5LMN M;  1R2Z A;  5ITU A;  3JR4 A;  4DR2 M; 
#chains in the Genus database with same CATH topology
 1MN3 A;  1J7K A;  1QAQ A;  2DVW B;  4NSO B;  2R4E A;  1N78 A;  5KQD A;  4MGZ E;  1EIJ A;  1C1K A;  2DZL A;  2ZM6 M;  4LGY A;  4D82 A;  4B7H A;  2W82 A;  4M9S A;  3TWK A;  2CHV A;  3KOZ E;  2WSE F;  2ERC A;  4W5W A;  5DFL A;  1L2C A;  2UUA M;  4FCT A;  2KEB A;  5BPV A;  3KS8 A;  2G3Q A;  2R65 A;  1IBK M;  3PNV A;  2AHM A;  3VDU A;  1D2N A;  1VG5 A;  4PT5 A;  4LF4 M;  3GQ5 A;  1D0L A;  3U60 A;  1IN6 A;  3U6O A;  2V6Z M;  3AOE C;  3U6C A;  1NSF A;  2L09 A;  3L2A A;  4CHT B;  2CV2 A;  3KSX A;  2GNO A;  4LJ6 A;  3IG5 A;  4DBG B;  2MJ5 B;  3B89 A;  1VDD A;  2XH9 A;  3HKP A;  3SC3 A;  1GVN A;  3SFZ A;  4BBA A;  1NJF A;  3LVW A;  1E94 E;  1QDR A;  4L6V 6;  4MGK E;  4OVZ B;  5FLX S;  2JY6 B;  4EIW A;  4FVM A;  3ZCB B;  2CRU A;  2BJW A;  3VDP A;  2JZ0 A;  1N34 M;  4QOZ C;  4JYA M;  2DKL A;  2KNA A;  3CTW B;  2ZAN A;  2QSF X;  1PJQ A;  2KHH A;  1JR3 D;  1NJG A;  1MX0 A;  1T3T A;  2OO9 A;  4X62 M;  3HGI A;  1OFH A;  1I94 M;  2DZO B;  2R45 A;  4RKU F;  1S3S A;  2LVP C;  5DNY A;  4MB7 A;  2MGW A;  1HNZ M;  4LJ4 A;  2L7H A;  4LJ8 A;  4NXM M;  2F5S A;  3E9S A;  1IN8 A;  3WHL A;  4R7G A;  3FUV A;  3GLF A;  3GLI B;  2L4E A;  4MH0 E;  2UUC M;  2Z4S A;  4MM3 B;  2JP7 A;  3GLI A;  2J7N A;  1OAI A;  2LHC A;  3LCU A;  1PJT A;  1IY1 A;  1ZMW A;  2Y0T A;  2C5R A;  3TWM A;  4M0W A;  3U6S A;  3L28 A;  3GPY A;  2I7N A;  3QWL A;  4Z8X A;  4F1I A;  2DWN A;  1OKS A;  1MU5 A;  5KO3 A;  2C9O A;  3J27 B;  8CAT A;  2VQE M;  2DAI A;  1W5T A;  3BOS A;  4AG5 A;  1G41 A;  3BXW A;  5IT9 S;  3HU3 A;  3SMP A;  3CF2 A;  3R8F A;  1D0K A;  1I4W A;  4II7 A;  3IG8 A;  3FYD A;  4LF6 M;  4LJ9 A;  2DI0 A;  4MGI E;  3V76 A;  1V33 A;  4A3V B;  2LWX A;  4F2L A;  4QOS A;  4JI1 M;  2LVQ D;  3UK6 A;  1AIP C;  2HL7 A;  4IBF A;  3LW5 F;  4QHT A;  2KDL A;  2UXD M;  1ZMU A;  3HY5 A;  1GLN A;  2M60 A;  1VDL A;  3U61 A;  2QHO B;  2JA2 A;  3H4J A;  4UN2 B;  4JI0 M;  4CGY B;  1SG9 A;  1TH4 A;  4LGM A;  3AV0 A;  4LRS A;  2Y0Q A;  3U6M A;  3K8Z A;  2XZU A;  4JI6 M;  2KZU A;  4PDI A;  2APL A;  4DV7 M;  4KO8 A;  3TPZ A;  4G3O A;  4IBD A;  2EKK A;  4JN6 A;  1T43 A;  2WSF F;  2DNA A;  4IBE A;  1DV0 A;  4P16 A;  3UGJ A;  2R4J A;  2V1C A;  1PJI A;  3WHK A;  1G4A E;  4DV3 M;  3HJS A;  2X49 A;  1IXZ A;  4HL4 A;  4K0K M;  1IM2 A;  2R44 A;  5EJC A;  3U6D A;  3TL4 X;  3TQS A;  1Q3B A;  2ZTD A;  3FRH A;  1QVR A;  3VKG A;  3QAU A;  1QUT A;  2HAK A;  5ITY A;  2H1R A;  4B08 A;  1UM8 A;  3GO8 A;  4M9X A;  2RGH A;  3C3D A;  2G8L A;  2A5Y B;  1WHC A;  2YNM D;  4FCV A;  5FTL A;  2KNZ A;  1T6O A;  4P17 A;  3LQQ A;  2ZBK B;  4AZF A;  3GQ4 A;  1N77 A;  2CV1 A;  1JQJ C;  1HT1 E;  2FFJ A;  4HEO A;  1WIV A;  1N32 M;  3IHP A;  1R5L A;  1IN7 A;  4GEW A;  2FE8 A;  2DEN A;  3PXG A;  4BLC A;  4DR1 M;  4PDG A;  1ZQ9 A;  4ANR A;  3NBI A;  1OIZ A;  3LCV B;  1W5S A;  4M0D A;  2X4A A;  3M7G A;  3C58 A;  3KXE C;  4DR7 M;  1IQP A;  2I7P A;  2HKJ A;  3T6P A;  3HHY A;  3J80 S;  3KFU G;  1Q3C A;  2EUC A;  3GLH A;  3HHZ A;  1PM5 A;  1GJT A;  2CFO A;  1Z5A A;  3A46 A;  3ILK A;  3E46 A;  3L25 A;  5IZ7 D;  4JV5 M;  1J09 A;  3CF6 E;  1HT2 E;  2QZ4 A;  4XGI A;  2CEA A;  3HJ8 A;  3KDS E;  2XLJ A;  3QYE A;  2BWE A;  5FTJ A;  4I5S A;  2FH0 A;  5ITX A;  4KT0 F;  2DWL A;  2F5P A;  1GO5 A;  1DGG A;  2C99 A;  1NY5 A;  4NRW A;  1GL6 A;  5L8R F;  2O5R A;  3MHV C;  5JI3 E;  1E9S A;  1SXJ D;  2C98 A;  1Q39 A;  2P5T A;  4GC5 A;  4GHL A;  4AI6 A;  3SAU A;  2JWS A;  1NO1 A;  2KW0 A;  5EP3 A;  2M5Z A;  2HCB A;  1QDT A;  2QCU A;  2RGO A;  4XBO A;  2XFT A;  2K47 A;  2Q2E B;  3JAM S;  4DV2 M;  3ZQJ A;  1TTE A;  4LF8 M;  1Q02 A;  1TDH A;  4WUR A;  5IRE B;  1XXH E;  4B7G A;  5KQ8 A;  3HWS A;  3T1H M;  1QZE A;  1FJG M;  3GRY A;  1NVM A;  2OOA A;  4DUY M;  4LFB M;  2XEP A;  2JY7 A;  1NV8 A;  1C7Y A;  3B9P A;  1Z5B A;  4X65 M;  4MGY E;  3T1Y M;  3GLF B;  1L1Z A;  4AG6 A;  1IXR C;  3FTC A;  4IBJ A;  4DR3 M;  3IEC A;  5BR8 M;  3D8L A;  1Y8G A;  3R9X B;  2DZN B;  3K2L A;  4MGH A;  3W68 A;  4LCB A;  4L8R C;  2R6F A;  4AKI A;  2BJV A;  2QQ8 A;  1EE8 A;  1YUB A;  2F5Q A;  2K0B X;  2LVA A;  2RKO A;  4LJ7 A;  4OW0 A;  3FKE A;  3GPU A;  3CGW A;  1YE9 A;  3GLI E;  2WSC F;  4LJA A;  5EP1 A;  4KOD A;  1L8Q A;  4YHH M;  3SAS A;  3I04 M;  3RGS A;  4DUZ M;  4RF1 A;  1AUA A;  1X37 A;  2XGN A;  3EIH A;  4QHS A;  7CAT A;  4IIW A;  4QNR A;  1WXQ A;  4OVZ A;  4I4L A;  5FTN A;  3VLF B;  1R6B X;  5A2Q S;  3KP1 E;  1PRB A;  2DAM A;  3B74 A;  1G8P A;  4R71 A;  2EO2 A;  3H4M A;  4L15 A;  3GLG E;  4AKH A;  1VEG A;  3KP0 E;  5FSW A;  4DV1 M;  1G71 A;  3SHG B;  1SXJ A;  3MK6 A;  3VK8 A;  1J5E M;  2C9C A;  4NC6 A;  4KHP M;  3E21 A;  3KOW E;  4KLN A;  2LBC A;  4JI8 M;  1K3X A;  1NV9 A;  1R2Y A;  1E9R A;  3U60 B;  4AKG A;  2ZAM A;  1HNW M;  2K9D A;  2DWM A;  1IY2 A;  2VQF M;  2LTU A;  2UUB M;  3GLG B;  3C9P A;  2CHG A;  4FD2 A;  2ZAO A;  3U6Q A;  1NNJ A;  3DZD A;  4Z6Y A;  1CUK A;  3HHX A;  5C18 A;  1WJ7 A;  2MH8 A;  4RNA A;  3GP1 A;  3AFH A;  2CUZ A;  3HX3 A;  2KRU A;  3FTF A;  3T38 A;  3E4R A;  1XXH A;  2O01 F;  4GIT A;  5E26 A;  5LMU M;  3Q8G A;  4ITQ A;  4GC9 A;  2KZS A;  2QNJ A;  2VF8 A;  4NXN M;  1IBL M;  3AJI B;  4JI7 M;  1FNN A;  1KSF X;  2LVO C;  2KNV A;  3GRR A;  1DGH B;  1R7R A;  5EP4 A;  4Q7J A;  4RF0 A;  3FE3 A;  3KOX E;  5E6J A;  3TE6 A;  1Z6T A;  1DGB A;  3NBX X;  4NL4 H;  4LF5 M;  1XMQ M;  3B7Z A;  3A45 A;  3NWL A;  3BBZ A;  4B3R M;  1SXJ C;  2H5X A;  3K92 A;  4L4U A;  3B7Q A;  1JR3 A;  4X64 M;  1N33 M;  4D80 A;  4LRT A;  3UZU A;  1JR3 E;  1TH2 A;  2L4F A;  4DR6 M;  1TH3 A;  2LH0 A;  2NQ8 C;  2Y20 A;  3I01 M;  4DV4 M;  1IBM M;  4LG2 A;  1NHG C;  3AL0 C;  4LJ5 A;  3SAR A;  1EFU B;  2XZF A;  2UXB M;  1GKI A;  3VK7 A;  2KXE A;  1IY0 A;  1L2B A;  1V34 A;  2DWZ B;  2JY8 A;  3GQ3 A;  1R4G A;  4GKJ M;  2FNA A;  4AW4 A;  5IWA M;  3MMP A;  2OPF A;  2JZ1 A;  3I4V A;  1XC8 A;  4R3D A;  3F92 A;  1MJG M;  3M0E A;  2K6B A;  5H37 D;  2GQF A;  1IN4 A;  5FTK A;  2DAE A;  2LXE A;  3A42 A;  3HU1 A;  3U6L A;  1NNU C;  4CIS A;  1YSY A;  1WR1 B;  3HU2 A;  1GL7 A;  2XSZ A;  3KVW A;  4FWG A;  1RU3 A;  1KFV A;  2Z8Y M;  3VFD A;  4LFC M;  3FD9 A;  4G6Z A;  4XK8 F;  3RFW A;  2KRK A;  3DOA A;  4G4Q A;  3HZJ A;  4GH9 A;  1HJP A;  5GKN A;  2EJS A;  3FUW A;  3AKZ A;  2WZJ A;  2D7H A;  3HHW A;  2EKF A;  4IBK A;  3SYK A;  2HHH M;  3THG A;  5KPT A;  4JI5 M;  2LNH C;  3W67 A;  4Y28 F;  2J7O A;  2JNH A;  3KW6 A;  1VEK A;  1QAO A;  2LHG A;  1XXH B;  4JXJ A;  2BWB A;  4OU7 A;  5EXP A;  3MJ5 A;  4DR5 M;  2MRO B;  3AOG A;  2ZTC A;  1G59 A;  1XNQ M;  2XFS A;  1L1T A;  1SXJ E;  4HLQ A;  2EA0 A;  3GLF E;  2CP8 A;  2YR0 A;  4JI3 M;  5EXS A;  2DHY A;  2O25 A;  3GLG A;  1IXS A;  4LF7 M;  5ITT A;  1N36 M;  3OTO M;  1F4I A;  1HQY E;  3M6A A;  3FUU A;  1K3W A;  2F5N A;  3FTD A;  1WGL A;  3QYB A;  3LMM A;  5LMN M;  3SAW A;  4B3S M;  1IFY A;  2MR9 A;  3JR4 A;  1VEJ A;  1Z5C A;  4I8O A;  2QP9 X;  3DA1 A;  1ZV1 A;  1D0M A;  1SXJ B;  2G5G X;  4IBI A;  5ITQ A;  3U5Z A;  1E32 A;  3JR5 A;  2X8A A;  3FYC A;  4ZPX A;  3GPP A;  3U6E A;  2LVN C;  4L16 A;  4DV6 M;  2QEN A;  1QAN A;  3TWL A;  1OIP A;  3RGP A;  3RE8 A;  1K82 A;  3FTE A;  4GRI A;  5EXX A;  2KA6 B;  3AOE A;  3W0F A;  3K9O A;  3SAT A;  2DHR A;  3B7N A;  4FW9 A;  5KPR A;  4QNM A;  2VDB B;  2V1U A;  4OX9 M;  2C96 A;  4G4R A;  2YFQ A;  5JI2 E;  1A5T A;  4B3M M;  4TUW A;  3SHF A;  3VKH A;  3KS4 A;  1IN5 A;  2FOI C;  3L27 A;  1H6U A;  3LVV A;  4IBG A;  4FCW A;  4REZ A;  2Z3X A;  4JI4 M;  5EXT A;  4B7F A;  2E5L M;  2DAG A;  3U5Z B;  3A98 B;  2JY5 A;  3UJN A;  4DV0 M;  2F4V M;  3SYL A;  1V92 A;  1XB2 B;  3PVS A;  3L26 A;  3K1J A;  1L2D A;  4NRV A;  3D8B A;  1NHW C;  1N75 A;  2CWB A;  4M9Z A;  2FS1 A;  3DFZ A;  4LY6 A;  4PCZ A;  2F5O A;  1WGN A;  1ORY B;  4CJ6 A;  3Q8X A;  2Z7J A;  1XHB A;  2CHQ A;  1TGU A;  4FWD A;  3UMM A;  1IXS B;  4WW0 A;  2VF7 A;  3I51 A;  2DXI A;  4LZJ A;  1XWI A;  3U61 B;  2DAK A;  3T15 A;  2OQ4 A;  1OFI A;  3FUX A;  3PNY A;  5KPZ A;  2CV0 A;  3I4Y A;  3U6P A;  1GAB A;  3C3E A;  4AQY M;  2B3T A;  2XF3 A;  3PFI A;  1HR0 M;  3ZC7 B;  1TR8 A;  2HWJ A;  2RRU A;  4IJE A;  2J5Y A;  1VQ1 A;  2QBY A;  4DR4 M;  5EP2 A;  4LF9 M;  2OOB A;  2R62 A;  1ZMV A;  5DYI A;  1Z59 A;  1ZAE A;  1QUS A;  2D7E A;  3ZH9 B;  3SAV A;  4YY3 M;  1QAM A;  3GLH E;  4I81 A;  4JI2 M;  1PGY A;  4LZZ A;  4D81 A;  1G3I A;  4IBC A;  2YQZ A;  3HJQ A;  2R18 A;  4PD2 A;  2QBY B;  3KSJ A;  5EQT A;  1P3Q Q;  2CE7 A;  4WP2 A;  1YLA A;  1OTR A;  3LQR A;  3SMS A;  3GRU A;  3EIE A;  1DO0 A;  3J2P B;  4DV5 M;  3GLH B;  3SBJ A;  2XSZ D;  4CIZ A;  1XNR M;  1QYR A;  1XMO M;  1PJJ A;  1QZM A;  5F3W A;  5ITU A;  2JUJ A;  3L29 A;  4S12 A;  4GHA A;  2QPA A;  2Z4R A;  4IJF A;  1BVS A;  4BB9 A;  1OQY A;  1LTM A;  1NY6 A;  2BNK A;  3K9P A;  1PJS A;  1QQW A;  4L78 A;  1KYI A;  2R0I A;  3KOY E;  1OAO C;  2UU9 M;  1LV7 A;  2D7G A;  2L7I A;  3W0L B;  1TDZ A;  1OJL A;  2Y21 A;  2R46 A;  3GPX A;  4IBB A;  1DGF A;  3J7B A;  4NSR A;  4G4N A;  5DYG A;  4FWH A;  1GJS A;  2VII A;  1UFZ A;  4G4O A;  4NOO B;  5C1B A;  2L6O A;  3GRV A;  1TF0 B;  5ITX E;  1JB0 F;  1HQC A;  4GMQ A;  4X66 M;  2UXC M;  5FTM A;  4GIP A;  2JXN A;  3FRI A;  5ITR A;  4GKK M;  1DO2 A;  4LFA M;  1DGH A;  1HNX M;  3CF0 A;  4B3T M;  3J81 S;  3J7A S;  2L2D A;  1R2Z A;  3FUT A;  2N35 A;  4DR2 M; 
#chains in the Genus database with same CATH homology
 1J7K A;  1QAQ A;  2DVW B;  4NSO B;  2R4E A;  1N78 A;  5KQD A;  4MGZ E;  1C1K A;  2ZM6 M;  4LGY A;  4D82 A;  4B7H A;  2W82 A;  4M9S A;  3TWK A;  2CHV A;  3KOZ E;  2UUA M;  2ERC A;  4W5W A;  1L2C A;  4FCT A;  2KEB A;  5BPV A;  3KS8 A;  2R65 A;  1IBK M;  3PNV A;  2AHM A;  3VDU A;  1D2N A;  4PT5 A;  4LF4 M;  3GQ5 A;  3U60 A;  1IN6 A;  3U6O A;  2V6Z M;  3AOE C;  3U6C A;  1NSF A;  2L09 A;  3L2A A;  4CHT B;  2CV2 A;  3KSX A;  4LJ6 A;  3IG5 A;  3HKP A;  1VDD A;  2XH9 A;  3SC3 A;  1GVN A;  3SFZ A;  4BBA A;  1NJF A;  3LVW A;  1E94 E;  4OVZ B;  5FLX S;  4MGK E;  4EIW A;  4FVM A;  3ZCB B;  2BJW A;  3VDP A;  1N34 M;  4QOZ C;  4JYA M;  3CTW B;  2ZAN A;  1JR3 D;  1NJG A;  1MX0 A;  1T3T A;  4X62 M;  3HGI A;  1OFH A;  1I94 M;  2DZO B;  2R45 A;  1S3S A;  5DNY A;  4MB7 A;  1HNZ M;  4LJ4 A;  2L7H A;  4LJ8 A;  4NXM M;  2F5S A;  3E9S A;  1IN8 A;  3WHL A;  4R7G A;  3FUV A;  3GLF A;  3GLI B;  4MH0 E;  2UUC M;  2Z4S A;  4MM3 B;  3GLI A;  2J7N A;  1IY1 A;  2Y0T A;  2C5R A;  3TWM A;  4M0W A;  3U6S A;  3L28 A;  3GPY A;  2I7N A;  3QWL A;  4Z8X A;  2DWN A;  1MU5 A;  5KO3 A;  2C9O A;  3J27 B;  8CAT A;  2VQE M;  1W5T A;  3BOS A;  4AG5 A;  1G41 A;  5IT9 S;  3HU3 A;  3SMP A;  3CF2 A;  3R8F A;  4II7 A;  1I4W A;  3IG8 A;  3FYD A;  4LF6 M;  4LJ9 A;  4MGI E;  4A3V B;  2LWX A;  4QOS A;  4JI1 M;  3UK6 A;  2HL7 A;  4IBF A;  4QHT A;  2UXD M;  1GLN A;  2M60 A;  3U61 A;  2JA2 A;  4JI0 M;  4CGY B;  1TH4 A;  4LRS A;  4LGM A;  3AV0 A;  2Y0Q A;  3U6M A;  3K8Z A;  2XZU A;  4JI6 M;  2KZU A;  4PDI A;  4DV7 M;  4KO8 A;  3TPZ A;  4IBD A;  4JN6 A;  4IBE A;  4P16 A;  3UGJ A;  2R4J A;  2V1C A;  1PJI A;  3WHK A;  1G4A E;  4DV3 M;  3HJS A;  2X49 A;  1IXZ A;  4HL4 A;  4K0K M;  1IM2 A;  3U6D A;  5EJC A;  3TL4 X;  3TQS A;  1Q3B A;  1QVR A;  3VKG A;  3QAU A;  5ITY A;  2H1R A;  4B08 A;  1UM8 A;  3GO8 A;  4M9X A;  2RGH A;  2G8L A;  2A5Y B;  2YNM D;  4FCV A;  5FTL A;  3LQQ A;  2ZBK B;  4AZF A;  3GQ4 A;  1N77 A;  2CV1 A;  1JQJ C;  1HT1 E;  2FFJ A;  1N32 M;  1IN7 A;  4BLC A;  2FE8 A;  3PXG A;  4DR1 M;  4PDG A;  1ZQ9 A;  3NBI A;  1W5S A;  4M0D A;  2X4A A;  3M7G A;  3C58 A;  3KXE C;  4DR7 M;  1IQP A;  2I7P A;  2HKJ A;  3HHY A;  3J80 S;  3KFU G;  1Q3C A;  2EUC A;  3GLH A;  3HHZ A;  1PM5 A;  2CFO A;  1Z5A A;  3A46 A;  3ILK A;  3L25 A;  5IZ7 D;  4JV5 M;  1J09 A;  3CF6 E;  1HT2 E;  2QZ4 A;  4XGI A;  2CEA A;  3HJ8 A;  3KDS E;  2XLJ A;  5FTJ A;  4I5S A;  5ITX A;  2DWL A;  2F5P A;  1DGG A;  2C99 A;  1NY5 A;  4NRW A;  1GL6 A;  2O5R A;  3MHV C;  5JI3 E;  1E9S A;  1SXJ D;  2C98 A;  1Q39 A;  2P5T A;  4GC5 A;  4GHL A;  4AI6 A;  3SAU A;  5EP3 A;  2KW0 A;  2M5Z A;  2HCB A;  2QCU A;  2RGO A;  4XBO A;  2XFT A;  2K47 A;  2Q2E B;  3JAM S;  4DV2 M;  4LF8 M;  1TDH A;  4WUR A;  5IRE B;  4B7G A;  5KQ8 A;  3HWS A;  3T1H M;  1FJG M;  3GRY A;  1NVM A;  4DUY M;  4LFB M;  2XEP A;  3B9P A;  1Z5B A;  4X65 M;  4MGY E;  3T1Y M;  3GLF B;  1L1Z A;  4AG6 A;  1IXR C;  3FTC A;  4IBJ A;  4DR3 M;  5BR8 M;  3D8L A;  3R9X B;  2DZN B;  3K2L A;  4MGH A;  4LCB A;  4L8R C;  4AKI A;  2BJV A;  1EE8 A;  1YUB A;  2F5Q A;  4JI4 M;  2RKO A;  4LJ7 A;  4OW0 A;  3FKE A;  3GPU A;  1YE9 A;  4LJA A;  5EP1 A;  4KOD A;  1L8Q A;  4YHH M;  3SAS A;  3RGS A;  4DUZ M;  4RF1 A;  1X37 A;  2XGN A;  3EIH A;  7CAT A;  4QHS A;  4IIW A;  4QNR A;  1WXQ A;  4OVZ A;  4I4L A;  5FTN A;  3VLF B;  1R6B X;  5A2Q S;  3KP1 E;  4AKH A;  1G8P A;  2EO2 A;  3H4M A;  4L15 A;  3KP0 E;  5FSW A;  4DV1 M;  3SHG B;  1SXJ A;  3MK6 A;  3VK8 A;  1J5E M;  2C9C A;  4KHP M;  3KOW E;  4KLN A;  4JI8 M;  1K3X A;  1R2Y A;  1E9R A;  3U60 B;  4AKG A;  2ZAM A;  1HNW M;  2DWM A;  2UUB M;  1IY2 A;  2VQF M;  3GLG B;  2CHG A;  4FD2 A;  2ZAO A;  3U6Q A;  1NNJ A;  3DZD A;  4Z6Y A;  3HHX A;  5C18 A;  4RNA A;  3GP1 A;  3AFH A;  2CUZ A;  3FTF A;  2KRU A;  3T38 A;  3E4R A;  1XXH A;  5E26 A;  4GIT A;  5LMU M;  4ITQ A;  4GC9 A;  2KZS A;  4NXN M;  1IBL M;  3AJI B;  4JI7 M;  1FNN A;  1KSF X;  3GRR A;  1DGH B;  1R7R A;  5EP4 A;  4RF0 A;  3KOX E;  5E6J A;  3TE6 A;  1Z6T A;  1DGB A;  4LF5 M;  4NL4 H;  1XMQ M;  3NWL A;  3A45 A;  4B3R M;  1SXJ C;  3K92 A;  4L4U A;  1JR3 A;  4X64 M;  1N33 M;  4D80 A;  4LRT A;  3UZU A;  1TH2 A;  4DR6 M;  1TH3 A;  2LH0 A;  2NQ8 C;  2Y20 A;  4DV4 M;  1IBM M;  4LG2 A;  3AL0 C;  1NHG C;  2UXB M;  4LJ5 A;  3SAR A;  2XZF A;  1GKI A;  3VK7 A;  2KXE A;  1IY0 A;  1L2B A;  2DWZ B;  3GQ3 A;  4GKJ M;  2FNA A;  4AW4 A;  5IWA M;  2OPF A;  3I4V A;  1XC8 A;  4R3D A;  3M0E A;  5H37 D;  5FTK A;  1IN4 A;  2LXE A;  3A42 A;  3HU1 A;  3U6L A;  4CIS A;  1NNU C;  1YSY A;  3HU2 A;  1GL7 A;  2XSZ A;  3KVW A;  4FWG A;  1KFV A;  3VFD A;  4LFC M;  3FD9 A;  4G6Z A;  3RFW A;  2KRK A;  3DOA A;  4G4Q A;  4GH9 A;  5GKN A;  3FUW A;  3AKZ A;  2D7H A;  3HHW A;  4IBK A;  3SYK A;  2HHH M;  3THG A;  5KPT A;  4JI5 M;  2LNH C;  2J7O A;  3KW6 A;  1QAO A;  1XXH B;  4JXJ A;  4OU7 A;  5EXP A;  3MJ5 A;  4DR5 M;  3AOG A;  1G59 A;  1XNQ M;  2XFS A;  1L1T A;  1SXJ E;  4HLQ A;  2EA0 A;  2YR0 A;  4JI3 M;  5EXS A;  3GLG A;  4LF7 M;  5ITT A;  1N36 M;  3OTO M;  1HQY E;  3M6A A;  3FUU A;  1K3W A;  2F5N A;  3FTD A;  3SAW A;  4B3S M;  3LMM A;  5LMN M;  3JR4 A;  1Z5C A;  4I8O A;  2QP9 X;  3DA1 A;  1SXJ B;  2G5G X;  4IBI A;  5ITQ A;  3U5Z A;  1E32 A;  3JR5 A;  2X8A A;  3FYC A;  4ZPX A;  3GPP A;  3U6E A;  4L16 A;  4DV6 M;  2QEN A;  1QAN A;  3TWL A;  3RGP A;  3RE8 A;  1K82 A;  3FTE A;  4GRI A;  5EXX A;  2KA6 B;  3AOE A;  3W0F A;  3SAT A;  2DHR A;  4FW9 A;  2V1U A;  5KPR A;  4QNM A;  4OX9 M;  2C96 A;  4G4R A;  2YFQ A;  5JI2 E;  4B3M M;  3VKH A;  4TUW A;  3SHF A;  3KS4 A;  1IN5 A;  2FOI C;  3L27 A;  1H6U A;  3LVV A;  4IBG A;  4FCW A;  4REZ A;  2Z3X A;  5EXT A;  4B7F A;  2E5L M;  3U5Z B;  3A98 B;  2F4V M;  3UJN A;  4DV0 M;  3SYL A;  3L26 A;  3PVS A;  1L2D A;  3K1J A;  4NRV A;  3D8B A;  1NHW C;  1N75 A;  4M9Z A;  3DFZ A;  4LY6 A;  4PCZ A;  2F5O A;  1ORY B;  3Q8X A;  2Z7J A;  1XHB A;  2CHQ A;  1TGU A;  4FWD A;  3UMM A;  1IXS B;  4WW0 A;  3I51 A;  2DXI A;  4LZJ A;  1XWI A;  3U61 B;  3T15 A;  2OQ4 A;  1OFI A;  3FUX A;  3PNY A;  5KPZ A;  2CV0 A;  3I4Y A;  3U6P A;  4AQY M;  2XF3 A;  3PFI A;  1HR0 M;  3ZC7 B;  4IJE A;  2QBY A;  4DR4 M;  5EP2 A;  4LF9 M;  2R62 A;  5DYI A;  1Z59 A;  1ZAE A;  2D7E A;  3ZH9 B;  3SAV A;  4YY3 M;  1QAM A;  4JI2 M;  4I81 A;  4LZZ A;  4D81 A;  1G3I A;  4IBC A;  2YQZ A;  3HJQ A;  2R18 A;  4PD2 A;  2QBY B;  3KSJ A;  5EQT A;  2CE7 A;  3LQR A;  3SMS A;  3GRU A;  3EIE A;  1DO0 A;  3J2P B;  4DV5 M;  3GLH B;  3SBJ A;  2XSZ D;  1XNR M;  1QYR A;  1XMO M;  1PJJ A;  1QZM A;  5F3W A;  5ITU A;  4S12 A;  3L29 A;  4GHA A;  2QPA A;  2Z4R A;  4IJF A;  4BB9 A;  1NY6 A;  2BNK A;  1QQW A;  4L78 A;  1KYI A;  3KOY E;  2UU9 M;  1LV7 A;  2D7G A;  2L7I A;  3W0L B;  1TDZ A;  1OJL A;  2Y21 A;  2R46 A;  3GPX A;  4IBB A;  1DGF A;  3J7B A;  4NSR A;  4G4N A;  5DYG A;  4FWH A;  2VII A;  4G4O A;  4NOO B;  5C1B A;  2L6O A;  3GRV A;  5ITX E;  1HQC A;  2UXC M;  4GMQ A;  4X66 M;  5FTM A;  4GIP A;  5ITR A;  4GKK M;  1DO2 A;  4LFA M;  1DGH A;  1HNX M;  3CF0 A;  4B3T M;  3J81 S;  3J7A S;  1R2Z A;  3FUT A;  4DR2 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...