1HNZM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hnzM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hnzM02
1HR0M 1KFVA 3GPUA 4JI8M 3DOAA 2UU9M 4PD2A 1J5EM 1Q3CA 3T1YM 3A45A 4X64M 4DV7M 3U6CA 3SBJA 2HKJA 4JYAM 1HNZM 5ITRA 4B3MM 4JI4M 5FLXS 1K3WA 1Q3BA 4B3TM 1R2ZA 2UXCM 1HNWM 3SATA 4LF6M 4LFCM 1XC8A 3T1HM 1L1ZA 4DV2M 1K82A 4G4QA 1N36M 2UXDM 4LF4M 4KHPM 1I94M 2EA0A 4LF7M 1IBMM 4DR3M 4JI3M 1TDHA 1IBLM 1R2YA 3TWMA 2F4VM 3GP1A 1MX0A 1L2BA 5LMNM 2F5OA 4JI2M 3GPYA 4NRVA 5ITYA 1Q39A 1Z59A 1L2CA 4B3RM 5ITTA 4DR1M 1TDZA 2UUBM 4LF5M 1XMQM 4X66M 4K0KM 2UUCM 2F5PA 4DR2M 1Z5BA 5ITXE 4G4NA 4LFAM 4DUYM 4JI7M 5IWAM 3SARA 3W0FA 3GQ3A 2OPFA 5ITUA 3TWKA 1IBKM 2F5SA 5BR8M 2ZBKB 4OX9M 4PCZA 3SAVA 1EE8A 3SASA 2VQFM 4YHHM 5ITXA 4AQYM 3U6SA 4DR6M 5IT9S 1Z5AA 3GQ4A 3J80S 3U6MA 2XZFA 3A46A 3SAUA 4JI5M 2F5NA 3JAMS 4DV6M 1N32M 3JR5A 1XNQM 2UUAM 4DV1M 4GKKM 4LF8M 4MB7A 2VQEM 2XZUA 1PJJA 3JR4A 4DV5M 4GKJM 3J7AS 4DV0M 4X65M 4LF9M 4X62M 3U6DA 4DR5M 4NXNM 2F5QA 1NNJA 3U6OA 3J81S 4DR4M 3SAWA 1PM5A 2E5LM 3GQ5A 4DR7M 3C58A 1XMOM 3GO8A 1K3XA 3GPXA 4NXMM 3A42A 3OTOM 4G4RA 3U6LA 1L1TA 3TWLA 4CISA 4JI1M 1MU5A 4ITQA 4JV5M 4PDGA 4DV4M 1FJGM 2OQ4A 3GPPA 1Z5CA 5ITQA 3VK8A 1N34M 4B3SM 4G4OA 5LMUM 1HNXM 4JI6M 1L2DA 5A2QS 1N33M 1XNRM 4DV3M 2HHHM 3U6PA 4LFBM 4NRWA 4PDIA 2ZM6M 4DUZM 4JI0M 3U6QA 1PJIA 2UXBM 3U6EA 3VK7A 4YY3M 2Q2EB
chains in the Genus database with same CATH superfamily
1H6UA 2QBYB 2KXEA 3DOAA 1J5EM 3SMPA 2K0BX 1PRBA 4IJEA 3U6CA 4X64M 1V33A 2FNAA 4LGMA 4G6ZA 2R6FA 3CF0A 3QAUA 4LJ5A 5FLXS 1OFIA 1JR3A 2X4AA 1HNWM 3SATA 2LVOC 4LF6M 4LFCM 2L4FA 3T1HM 3AKZA 1K82A 4G4QA 2UXDM 1OQYA 4RNAA 3SFZA 4QOZC 1BVSA 4AKHA 4KO8A 5EP2A 1IXSA 1G8PA 4I4LA 8CATA 1IN7A 2D7HA 1R2YA 4AW4A 4B7FA 2DWLA 1R6BX 1L2BA 5LMNM 2WSEF 3PVSA 3KFUG 2F5OA 4JI2M 2JY6B 3FRIA 2CFOA 1G4AE 4KLNA 4BBAA 1MJGM 1G3IA 3AOGA 2CHQA 5ITYA 3K9OA 3PNVA 4GIPA 5ITTA 4DR1M 3KW6A 3PFIA 3RFWA 5DYIA 3J2PB 4JI8M 2F5PA 1ZMWA 3B74A 1X37A 1HT2E 3E21A 3GLFB 4S12A 4DUYM 4JI7M 2DENA 3QWLA 1Q02A 3NBIA 3UZUA 3K1JA 2DHRA 3L25A 4OVZB 2G5GX 2EKFA 3W0FA 2OPFA 3UK6A 4LJAA 1IBKM 2O25A 2YNMD 3W67A 4OX9M 4PCZA 4JXJA 4M9SA 3ZCBB 3SASA 3B7QA 4IIWA 2VQFM 2K47A 2KZUA 1DO2A 4AQYM 1J09A 1GL7A 2JP7A 4Y28F 3U6SA 1WJ7A 2I7PA 3GRUA 3J7BA 3LCUA 3HHWA 3KVWA 3BOSA 1Z5AA 4QNRA 3A46A 1IY0A 2DAEA 2F5NA 4DV6M 3CF2A 4FW9A 1IM2A 3JR5A 1IY2A 2UUAM 1ZMVA 4DV1M 2L4EA 1G71A 3KP1E 3NWLA 3R8FA 1IN8A 1SXJE 4LJ8A 2XEPA 3L28A 4NOOB 4AG6A 4GITA 3JR4A 1PJJA 2RGHA 2A5YB 2CRUA 3SHGB 3U6DA 3GLFA 2XSZA 4I81A 1WHCA 4D81A 1ORYB 4GEWA 4DR5M 4NXNM 2F5QA 4L8RC 3FUWA 3LVWA 2QP9X 1PM5A 1QANA 2OOBA 2G3QA 2E5LM 3GQ5A 1HQCA 5FTMA 4DR7M 4F1IA 1XXHB 4FD2A 1K3XA 3KXEC 3I4YA 1D2NA 1SXJA 4IBDA 2FOIC 4L78A 4MGYE 4KT0F 2R44A 2R46A 3U61B 4CISA 4PDGA 2QENA 5KPZA 2DXIA 3FTEA 2YQZA 1YLAA 2JWSA 2FS1A 2CV0A 1QQWA 4MGHA 4B3SM 1N34M 4MGKE 3MK6A 1R5LA 2KDLA 4LZZA 3E4RA 1L2DA 5C18A 2DAKA 2RGOA 2HHHM 1GABA 1LTMA 4DUZM 1E9SA 1NNUC 2QCUA 3GLIA 1QUTA 3FUXA 4CJ6A 5E6JA 2J7OA 1HR0M 3THGA 3GPUA 2X8AA 2KRKA 2VF8A 3EIHA 3SMSA 3KOWE 2W82A 4PD2A 3VK8A 2HCBA 1JB0F 1TGUA 4DV7M 1TH4A 2HAKA 4JYAM 1QZMA 4B3MM 4FCWA 3HY5A 3IHPA 1HJPA 4B3TM 2UXCM 1XC8A 3W68A 2V6ZM 1N36M 1DGBA 5F3WA 1WIVA 4LF4M 1NY5A 4D80A 1KSFX 1PGYA 2JZ1A 1DO0A 4QHTA 4GC5A 4NL4H 5EQTA 4LZJA 2JY7A 3R9XB 3TL4X 2G8LA 2YR0A 2DWZB 4AKGA 2Y20A 3UGJA 3GPYA 1YE9A 2BJVA 2R62A 2RKOA 1Q39A 1ZAEA 3WHKA 1L2CA 1QZEA 4B3RM 1OAOC 1TDZA 3LQQA 3VDUA 2UUBM 4LF5M 4K0KM 2DAIA 1VDDA 3RGSA 1JR3E 3I4VA 5ITXE 1S3SA 1JR3D 2QSFX 1E9RA 3ZQJA 3IG8A 1GVNA 1RU3A 2H1RA 2Y0QA 4EIWA 3GLIE 1PJQA 1XXHE 2LVPC 4IBEA 3KOXE 4LRSA 3SARA 4IBFA 3GQ3A 4QNMA 5KO3A 3UJNA 3W0LB 2ERCA 2J5YA 3L29A 2XFTA 3I51A 1SXJB 3M7GA 1W5SA 1OJLA 2KNAA 3HHZA 1TF0B 2XH9A 3VLFB 2DWMA 1N78A 2M60A 4HEOA 2MROB 3FTCA 3RGPA 4RF0A 3U60B 5IT9S 1GJSA 1VDLA 3U6MA 1W5TA 4JI5M 2JY5A 3LMMA 4B7HA 2Z3XA 3SYLA 1EIJA 3GLIB 4XK8F 4MH0E 4L15A 1V92A 1OIZA 1TR8A 2KEBA 2ZANA 2LHGA 4II7A 4MB7A 3DZDA 2D7EA 4FWHA 1D0LA 2KA6B 1AUAA 2C96A 1ZQ9A 4GKJM 3PNYA 4X65M 3KSXA 1NVMA 4HL4A 3CF6E 3MJ5A 2DWNA 1OKSA 1NJFA 1ZMUA 2GQFA 2WSCF 3U6OA 3KS4A 4WW0A 3HZJA 4IBJA 3J81S 4DR4M 2C5RA 4A3VB 2XFSA 4W5WA 2QPAA 3GLHB 2JUJA 2C9OA 2LTUA 1R7RA 4IBCA 3BBZA 3PXGA 3K8ZA 4G4RA 1L1TA 2FH0A 3TWLA 3U5ZA 4FVMA 1MU5A 4UN2B 1SXJC 4B7GA 4KODA 2FE8A 3GLGB 4QOSA 3GPPA 1T6OA 1IXSB 3LW5F 2MGWA 4WURA 1TH3A 1IY1A 4JI6M 1QDTA 5BPVA 5A2QS 2KNZA 1N75A 2QZ4A 1I4WA 1DGFA 3HU1A 3IECA 4LY6A 5EJCA 5KPRA 2Y0TA 2APLA 2OO9A 2CWBA 3U6PA 3KP0E 4NRWA 2DAMA 2C98A 4F2LA 1QAOA 1VEJA 1KFVA 3K9PA 4MGIE 3GLHE 2UU9M 1Q3CA 4WP2A 3T1YM 4NSRA 3LVVA 5EXTA 4Z8XA 4AZFA 2HKJA 3HHYA 3C9PA 3HHXA 4CHTB 5ITRA 2P5TA 2LH0A 2RRUA 4JI4M 2R45A 4CGYB 1Q3BA 2L2DA 1QVRA 1K3WA 1R2ZA 1G59A 1QDRA 2V1UA 4XGIA 2ZAOA 3AV0A 3D8BA 3KOZE 2QNJA 1I94M 3GRRA 2MJ5B 1NJGA 4JI3M 3RE8A 3TWMA 3KS8A 1XWIA 2CE7A 2XGNA 1SG9A 2R4JA 1E94E 3CGWA 4AI6A 1P3QQ 1GLNA 4NRVA 3GRVA 1SXJD 4HLQA 1Z59A 3KSJA 4B08A 3E46A 2EKKA 1UFZA 1NO1A 1V34A 3DA1A 4DBGB 1NHWC 4RF1A 2UUCM 1Y8GA 1Z5BA 2CUZA 1CUKA 1OAIA 1T3TA 1QUSA 1ZV1A 2DKLA 4GHAA 1VQ1A 3T38A 4FWGA 2V1CA 1GKIA 3D8LA 1LV7A 4G3OA 4LFAM 1IN5A 1C7YA 1L8QA 2D7GA 3HJ8A 3QYBA 4OU7A 4BB9A 1IQPA 3FUVA 1GL6A 2F5SA 3C3EA 5BR8M 2Z8YM 1XXHA 2FFJA 2Z4SA 3SAVA 2XF3A 1EE8A 1KYIA 2LNHC 3U5ZB 3Q8XA 1TH2A 3GLGA 4LJ4A 4YHHM 5ITXA 1UM8A 3SYKA 1Z6TA 1NV8A 2DZLA 3M6AA 3MMPA 4MM3B 3KDSE 4IJFA 2Z7JA 1NY6A 3SAUA 2KHHA 4RKUF 1D0MA 2JY8A 2L7IA 3JAMS 1WGNA 4L16A 4ANRA 1N32M 3GLGE 2ZTDA 5EP4A 5GKNA 4GHLA 1PJTA 2JA2A 3ZC7B 4JN6A 3L26A 2HL7A 4LCBA 5KQ8A 3FTFA 1EFUB 3T6PA 3J7AS 4DV0M 2EUCA 1WXQA 2X49A 4LF9M 4MGZE 3B7ZA 4X62M 2EO2A 3FYDA 5E26A 3HU3A 3E9SA 3GRYA 4FCVA 2LVNC 2DHYA 3FD9A 2LHCA 2EJSA 1HQYE 4GRIA 4R7GA 4Z6YA 3SAWA 3MHVC 3HJSA 3C58A 4ZPXA 2B3TA 1DV0A 3GO8A 1J7KA 4M0DA 3GPXA 4NXMM 3A42A 5C1BA 5EXSA 1DGHB 3U6LA 4AKIA 4JI1M 1IXZA 2HWJA 5IZ7D 1FJGM 5FSWA 1VEKA 3C3DA 5ITQA 2ZAMA 2QHOB 5JI2E 1HNXM 2QBYA 3H4JA 1C1KA 2QQ8A 2KNVA 5DNYA 3U60A 3EIEA 1XNRM 2K6BA 4DV3M 4LFBM 4PDIA 1PJIA 2H5XA 3U6QA 2UXBM 3QYEA 3U6EA 2DAGA 2LXEA 2DVWB 4FCTA 2CEAA 7CATA 2M5ZA 4TUWA 4D82A 3I04M 2CP8A 5EXPA 2O5RA 3AFHA 1NHGC 3B89A 3BXWA 2ZTCA 3HU2A 3A45A 3KOYE 3SBJA 3VDPA 4M9ZA 4XBOA 4LJ6A 4LJ7A 1HNZM 5EP1A 4FWDA 2CV2A 2VIIA 2Z4RA 2CV1A 2Y21A 3FKEA 4L4UA 1IXRC 1WGLA 4NSOB 1L1ZA 2DZOB 4Q7JA 4DV2M 2O01F 3DFZA 3ILKA 3FUUA 2DNAA 3GLFE 4KHPM 2EA0A 4LF7M 5KPTA 3LQRA 1WR1B 2LVQD 4DR3M 1IBMM 1A5TA 1TDHA 1IBLM 3AOEC 3FRHA 2F4VM 3GP1A 1MX0A 5L8RF 2JNHA 4P16A 2MR9A 2WZJA 4NC6A 3TPZA 2DZNB 1HT1E 1IN6A 3FTDA 3H4MA 4GC9A 4LGYA 2JZ0A 3SHFA 2BWEA 1XB2B 1YSYA 3TE6A 5EXXA 3K2LA 4LRTA 2AHMA 5DYGA 2XLJA 1XMQM 4X66M 5FTLA 1XHBA 4I5SA 4DR2M 5FTKA 1N77A 3AJIB 4BLCA 4G4NA 2NQ8C 1VG5A 5JI3E 2L09A 5IWAM 3T15A 2LVAA 3UMMA 1MN3A 1VEGA 5ITUA 3K92A 3TWKA 2BWBA 3GLHA 1TTEA 2ZBKB 1F4IA 5EP3A 3VFDA 2LWXA 3AOEA 3V76A 1DGHA 2LBCA 5DFLA 4R71A 3U61A 3ZH9B 1IFYA 3VKGA 2XSZD 3B7NA 2MH8A 4OVZA 3HX3A 3F92A 1E32A 3M0EA 2KRUA 4PT5A 2WSFF 4DR6M 1AIPC 3J27B 4IBBA 3GQ4A 1OFHA 1G41A 2N35A 3FE3A 4QHSA 3J80S 2XZFA 4M0WA 3WHLA 3TQSA 3L2AA 1R4GA 1XNQM 1JQJC 4IBKA 1OTRA 2BJWA 3HWSA 4GKKM 5KQDA 4LF8M 2VQEM 2XZUA 1D0KA 4DV5M 2R4EA 2L6OA 4LG2A 1FNNA 1GO5A 2VF7A 1NSFA 2R65A 3AL0C 2I7NA 4AG5A 5H37D 3FYCA 1PJSA 1QAMA 3IG5A 3NBXX 4I8OA 4CIZA 1IN4A 1NNJA 4LJ9A 2C9CA 2K9DA 4IBIA 1YUBA 3HJQA 3HKPA 4GMQA 4REZA 2KW0A 1XMOM 2BNKA 4IBGA 3Q8GA 2VDBB 3OTOM 5IREB 4P17A 4ITQA 4M9XA 4JV5M 4DV4M 2JXNA 1NV9A 2CHVA 2L7HA 3FUTA 3L27A 2OQ4A 2DI0A 1QYRA 1OIPA 4GH9A 2OOAA 1Z5CA 2GNOA 2KZSA 2R18A 3CTWB 4R3DA 3I01M 3B9PA 5FTNA 3SC3A 5LMUM 1DGGA 1QAQA 4G4OA 3VKHA 1N33M 3A98B 4L6V6 4OW0A 2J7NA 3LCVB 2ZM6M 1GJTA 4JI0M 3VK7A 1T43A 4YY3M 2CHGA 5FTJA 2R0IA 2C99A 2YFQA 2Q2EB 3HGIA
chains in the Genus database with same CATH topology
1H6UA 2QBYB 2KXEA 3DOAA 1J5EM 3SMPA 4IJEA 3U6CA 4X64M 2FNAA 4LGMA 4G6ZA 3CF0A 3QAUA 4LJ5A 5FLXS 1OFIA 1JR3A 2X4AA 1HNWM 3SATA 4LF6M 4LFCM 3T1HM 3AKZA 1K82A 4G4QA 2UXDM 4RNAA 3SFZA 4QOZC 4AKHA 4KO8A 5EP2A 1G8PA 4I4LA 8CATA 1IN7A 2D7HA 1R2YA 4AW4A 4B7FA 1R6BX 1L2BA 5LMNM 3PVSA 3KFUG 2F5OA 4JI2M 2CFOA 1G4AE 4KLNA 4BBAA 3AOGA 1G3IA 2CHQA 5ITYA 3PNVA 4GIPA 5ITTA 4DR1M 3KW6A 3PFIA 3RFWA 5DYIA 3J2PB 2F5PA 1X37A 1HT2E 3GLFB 4S12A 4DUYM 4JI7M 3QWLA 3NBIA 3UZUA 3K1JA 2DHRA 4OVZB 2G5GX 3W0FA 2OPFA 3UK6A 4LJAA 1IBKM 2YNMD 4OX9M 4PCZA 4JXJA 4M9SA 3ZCBB 3SASA 4IIWA 2VQFM 2K47A 2KZUA 1DO2A 4AQYM 1J09A 1GL7A 3U6SA 3GRUA 2I7PA 3J7BA 3HHWA 3KVWA 3BOSA 1Z5AA 4QNRA 3A46A 1IY0A 2F5NA 4DV6M 3CF2A 4FW9A 1IM2A 3JR5A 1IY2A 2UUAM 4DV1M 3KP1E 3R8FA 3NWLA 1IN8A 1SXJE 4LJ8A 2XEPA 3L28A 4NOOB 4AG6A 4GITA 3JR4A 1PJJA 2RGHA 2A5YB 3SHGB 3U6DA 3GLFA 2XSZA 4I81A 4D81A 1ORYB 4DR5M 4NXNM 2F5QA 4L8RC 3FUWA 3LVWA 2QP9X 1PM5A 1QANA 2E5LM 3GQ5A 1HQCA 5FTMA 4DR7M 1XXHB 4FD2A 1K3XA 3KXEC 3I4YA 1D2NA 1SXJA 4IBDA 2FOIC 4L78A 4MGYE 4CISA 2R46A 3U61B 4PDGA 2QENA 5KPZA 2DXIA 3FTEA 2YQZA 2CV0A 1QQWA 4MGHA 4B3SM 1N34M 4MGKE 3MK6A 4LZZA 3E4RA 1L2DA 5C18A 2RGOA 2HHHM 4DUZM 1E9SA 1NNUC 2QCUA 3GLIA 3FUXA 5E6JA 2J7OA 1HR0M 3THGA 3GPUA 2X8AA 2KRKA 3EIHA 3SMSA 4PD2A 3KOWE 2W82A 4JI8M 2HCBA 1TGUA 4DV7M 1TH4A 4JYAM 1QZMA 4B3MM 4FCWA 4B3TM 2UXCM 1XC8A 2V6ZM 1N36M 1DGBA 5F3WA 4LF4M 1NY5A 4D80A 1KSFX 1DO0A 4QHTA 4GC5A 4NL4H 5EQTA 4LZJA 3R9XB 3TL4X 2G8LA 2YR0A 2DWZB 4AKGA 2Y20A 3UGJA 3GPYA 1YE9A 2BJVA 2R62A 2RKOA 1Q39A 1ZAEA 3WHKA 1L2CA 4B3RM 1TDZA 3LQQA 3VDUA 2UUBM 4LF5M 4K0KM 1VDDA 3RGSA 3I4VA 5ITXE 1S3SA 1JR3D 1E9RA 3IG8A 1GVNA 2H1RA 2Y0QA 4EIWA 3L25A 4IBEA 4LRSA 3SARA 3KOXE 4IBFA 3GQ3A 4QNMA 5KO3A 3UJNA 3W0LB 2ERCA 3L29A 2XFTA 3I51A 1SXJB 3M7GA 1W5SA 1OJLA 3HHZA 2XH9A 3VLFB 2DWMA 1N78A 2M60A 3FTCA 3RGPA 4RF0A 3U60B 5IT9S 3U6MA 1W5TA 4JI5M 3LMMA 4B7HA 2Z3XA 3SYLA 3GLIB 4MH0E 4L15A 2KEBA 2ZANA 4II7A 4MB7A 3DZDA 4FWHA 2D7EA 2KA6B 2C96A 1ZQ9A 4GKJM 3PNYA 4X65M 3KSXA 1NVMA 4HL4A 3CF6E 3MJ5A 2DWNA 1NJFA 3U6OA 3KS4A 4WW0A 4IBJA 3J81S 4DR4M 2C5RA 4A3VB 2XFSA 4W5WA 2QPAA 3GLHB 2C9OA 1R7RA 4IBCA 3PXGA 3K8ZA 4G4RA 1L1TA 3TWLA 3U5ZA 4FVMA 1MU5A 1SXJC 4B7GA 4KODA 2FE8A 3GLGB 4QOSA 3GPPA 1IXSB 4WURA 1TH3A 1IY1A 4JI6M 5BPVA 5A2QS 2QZ4A 1N75A 4LY6A 1I4WA 1DGFA 3HU1A 5KPRA 3U6PA 5EJCA 2DWLA 2Y0TA 4NRWA 3KP0E 2C98A 1QAOA 1KFVA 4MGIE 2UU9M 1Q3CA 3T1YM 4NSRA 3LVVA 5EXTA 4Z8XA 4AZFA 2HKJA 3HHYA 3HHXA 4CHTB 5ITRA 2P5TA 2LH0A 4JI4M 2R45A 4CGYB 1Q3BA 1K3WA 1QVRA 1G59A 1R2ZA 2V1UA 4XGIA 2ZAOA 3AV0A 3D8BA 3KOZE 1I94M 3GRRA 1NJGA 4JI3M 3RE8A 3TWMA 3KS8A 1XWIA 2CE7A 2XGNA 2R4JA 1E94E 4AI6A 1GLNA 4NRVA 3GRVA 1SXJD 4HLQA 1Z59A 3KSJA 4B08A 3DA1A 1NHWC 4RF1A 2UUCM 4GHAA 1Z5BA 2CUZA 1T3TA 3T38A 4FWGA 2V1CA 1GKIA 3D8LA 1LV7A 4LFAM 1IN5A 1L8QA 2D7GA 3HJ8A 4OU7A 4BB9A 1IQPA 3FUVA 1GL6A 2F5SA 5BR8M 1XXHA 2FFJA 2Z4SA 3SAVA 2XF3A 1EE8A 1KYIA 2LNHC 3U5ZB 3Q8XA 1TH2A 3GLGA 4LJ4A 4YHHM 5ITXA 1UM8A 3SYKA 1Z6TA 3M6AA 4MM3B 3KDSE 4IJFA 2Z7JA 1NY6A 3SAUA 2L7IA 3JAMS 4L16A 1N32M 5EP4A 5GKNA 4GHLA 2JA2A 3ZC7B 4JN6A 3L26A 2HL7A 4LCBA 5KQ8A 3FTFA 3J7AS 4DV0M 2EUCA 1WXQA 2X49A 4LF9M 4MGZE 4X62M 2EO2A 3FYDA 5E26A 3HU3A 3E9SA 3GRYA 4FCVA 3FD9A 4R7GA 4Z6YA 4GRIA 1HQYE 3SAWA 3MHVC 3HJSA 3C58A 4ZPXA 3GO8A 1J7KA 4M0DA 3GPXA 4NXMM 3A42A 5C1BA 5EXSA 1DGHB 3U6LA 4AKIA 4JI1M 1IXZA 1FJGM 5IZ7D 5FSWA 5ITQA 2ZAMA 5JI2E 1HNXM 2QBYA 1C1KA 5DNYA 3U60A 3EIEA 1XNRM 4DV3M 4LFBM 4PDIA 1PJIA 3U6QA 2UXBM 3U6EA 2LXEA 2DVWB 4FCTA 2CEAA 7CATA 2M5ZA 4TUWA 4D82A 5EXPA 2O5RA 3AFHA 1NHGC 3HU2A 3KOYE 3A45A 3SBJA 3VDPA 4M9ZA 4XBOA 4LJ6A 4LJ7A 1HNZM 5EP1A 4FWDA 2CV2A 2VIIA 2Z4RA 2CV1A 2Y21A 3FKEA 4L4UA 1IXRC 4NSOB 1L1ZA 2DZOB 4DV2M 3DFZA 3ILKA 3FUUA 4KHPM 2EA0A 4LF7M 5KPTA 3LQRA 1IBMM 4DR3M 1TDHA 1IBLM 3AOEC 2F4VM 3GP1A 1MX0A 4P16A 3TPZA 2DZNB 1HT1E 1IN6A 3FTDA 3H4MA 4GC9A 4LGYA 3SHFA 1YSYA 3TE6A 5EXXA 3K2LA 4LRTA 2AHMA 5DYGA 2XLJA 1XMQM 4X66M 5FTLA 1XHBA 4I5SA 4DR2M 5FTKA 1N77A 3AJIB 4BLCA 4G4NA 2NQ8C 5JI3E 2L09A 5IWAM 3T15A 3UMMA 5ITUA 3K92A 3TWKA 3GLHA 2ZBKB 5EP3A 3VFDA 2LWXA 3AOEA 1DGHA 3U61A 3ZH9B 3VKGA 2XSZD 4OVZA 1E32A 3M0EA 2KRUA 4PT5A 4DR6M 3J27B 4IBBA 3GQ4A 1OFHA 1G41A 4QHSA 3J80S 2XZFA 4M0WA 3WHLA 3TQSA 3L2AA 1XNQM 1JQJC 4IBKA 2BJWA 3HWSA 4GKKM 5KQDA 4LF8M 2VQEM 2XZUA 4DV5M 2R4EA 2L6OA 4LG2A 1FNNA 3AL0C 1NSFA 2R65A 2I7NA 4AG5A 5H37D 3FYCA 1QAMA 3IG5A 4I8OA 1IN4A 1NNJA 4LJ9A 2C9CA 4IBIA 1YUBA 3HJQA 3HKPA 4GMQA 4REZA 2KW0A 1XMOM 2BNKA 4IBGA 3OTOM 5IREB 4ITQA 4M9XA 4JV5M 4DV4M 3L27A 2CHVA 2L7HA 3FUTA 2OQ4A 1QYRA 4GH9A 1Z5CA 4R3DA 2KZSA 2R18A 3CTWB 5FTNA 3SC3A 3B9PA 5LMUM 4G4OA 3VK8A 1DGGA 1QAQA 3VKHA 1N33M 3A98B 4OW0A 2J7NA 2ZM6M 4JI0M 3VK7A 4YY3M 2CHGA 5FTJA 2C99A 2YFQA 2Q2EB 3HGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 M;  1KFV A;  3GPU A;  4JI8 M;  3DOA A;  2UU9 M;  4PD2 A;  1J5E M;  1Q3C A;  3T1Y M;  3A45 A;  4X64 M;  4DV7 M;  3U6C A;  3SBJ A;  2HKJ A;  4JYA M;  1HNZ M;  5ITR A;  4B3M M;  4JI4 M;  5FLX S;  1K3W A;  1Q3B A;  4B3T M;  1R2Z A;  2UXC M;  1HNW M;  3SAT A;  4LF6 M;  4LFC M;  1XC8 A;  3T1H M;  1L1Z A;  4DV2 M;  1K82 A;  4G4Q A;  1N36 M;  2UXD M;  4LF4 M;  4KHP M;  1I94 M;  2EA0 A;  4LF7 M;  1IBM M;  4DR3 M;  4JI3 M;  1TDH A;  1IBL M;  1R2Y A;  3TWM A;  2F4V M;  3GP1 A;  1MX0 A;  1L2B A;  5LMN M;  2F5O A;  4JI2 M;  3GPY A;  4NRV A;  5ITY A;  1Q39 A;  1Z59 A;  1L2C A;  4B3R M;  5ITT A;  4DR1 M;  1TDZ A;  2UUB M;  4LF5 M;  1XMQ M;  4X66 M;  4K0K M;  2UUC M;  2F5P A;  4DR2 M;  1Z5B A;  5ITX E;  4G4N A;  4LFA M;  4DUY M;  4JI7 M;  5IWA M;  3SAR A;  3W0F A;  3GQ3 A;  2OPF A;  5ITU A;  3TWK A;  1IBK M;  2F5S A;  5BR8 M;  2ZBK B;  4OX9 M;  4PCZ A;  3SAV A;  1EE8 A;  3SAS A;  2VQF M;  4YHH M;  5ITX A;  4AQY M;  3U6S A;  4DR6 M;  5IT9 S;  1Z5A A;  3GQ4 A;  3J80 S;  3U6M A;  2XZF A;  3A46 A;  3SAU A;  4JI5 M;  2F5N A;  3JAM S;  4DV6 M;  1N32 M;  3JR5 A;  1XNQ M;  2UUA M;  4DV1 M;  4GKK M;  4LF8 M;  4MB7 A;  2VQE M;  2XZU A;  1PJJ A;  3JR4 A;  4DV5 M;  4GKJ M;  3J7A S;  4DV0 M;  4X65 M;  4LF9 M;  4X62 M;  3U6D A;  4DR5 M;  4NXN M;  2F5Q A;  1NNJ A;  3U6O A;  3J81 S;  4DR4 M;  3SAW A;  1PM5 A;  2E5L M;  3GQ5 A;  4DR7 M;  3C58 A;  1XMO M;  3GO8 A;  1K3X A;  3GPX A;  4NXM M;  3A42 A;  3OTO M;  4G4R A;  3U6L A;  1L1T A;  3TWL A;  4CIS A;  4JI1 M;  1MU5 A;  4ITQ A;  4JV5 M;  4PDG A;  4DV4 M;  1FJG M;  2OQ4 A;  3GPP A;  1Z5C A;  5ITQ A;  3VK8 A;  1N34 M;  4B3S M;  4G4O A;  5LMU M;  1HNX M;  4JI6 M;  1L2D A;  5A2Q S;  1N33 M;  1XNR M;  4DV3 M;  2HHH M;  3U6P A;  4LFB M;  4NRW A;  4PDI A;  2ZM6 M;  4DUZ M;  4JI0 M;  3U6Q A;  1PJI A;  2UXB M;  3U6E A;  3VK7 A;  4YY3 M;  2Q2E B; 
#chains in the Genus database with same CATH topology
 1H6U A;  2QBY B;  2KXE A;  3DOA A;  1J5E M;  3SMP A;  2K0B X;  1PRB A;  4IJE A;  3U6C A;  4X64 M;  1V33 A;  2FNA A;  4LGM A;  4G6Z A;  2R6F A;  3CF0 A;  3QAU A;  4LJ5 A;  5FLX S;  1OFI A;  1JR3 A;  2X4A A;  1HNW M;  3SAT A;  2LVO C;  4LF6 M;  4LFC M;  2L4F A;  3T1H M;  3AKZ A;  1K82 A;  4G4Q A;  2UXD M;  1OQY A;  4RNA A;  3SFZ A;  4QOZ C;  1BVS A;  4AKH A;  4KO8 A;  5EP2 A;  1IXS A;  1G8P A;  4I4L A;  8CAT A;  1IN7 A;  2D7H A;  1R2Y A;  4AW4 A;  4B7F A;  2DWL A;  1R6B X;  1L2B A;  5LMN M;  2WSE F;  3PVS A;  3KFU G;  2F5O A;  4JI2 M;  2JY6 B;  3FRI A;  2CFO A;  1G4A E;  4KLN A;  4BBA A;  1MJG M;  1G3I A;  3AOG A;  2CHQ A;  5ITY A;  3K9O A;  3PNV A;  4GIP A;  5ITT A;  4DR1 M;  3KW6 A;  3PFI A;  3RFW A;  5DYI A;  3J2P B;  4JI8 M;  2F5P A;  1ZMW A;  3B74 A;  1X37 A;  1HT2 E;  3E21 A;  3GLF B;  4S12 A;  4DUY M;  4JI7 M;  2DEN A;  3QWL A;  1Q02 A;  3NBI A;  3UZU A;  3K1J A;  2DHR A;  3L25 A;  4OVZ B;  2G5G X;  2EKF A;  3W0F A;  2OPF A;  3UK6 A;  4LJA A;  1IBK M;  2O25 A;  2YNM D;  3W67 A;  4OX9 M;  4PCZ A;  4JXJ A;  4M9S A;  3ZCB B;  3SAS A;  3B7Q A;  4IIW A;  2VQF M;  2K47 A;  2KZU A;  1DO2 A;  4AQY M;  1J09 A;  1GL7 A;  2JP7 A;  4Y28 F;  3U6S A;  1WJ7 A;  2I7P A;  3GRU A;  3J7B A;  3LCU A;  3HHW A;  3KVW A;  3BOS A;  1Z5A A;  4QNR A;  3A46 A;  1IY0 A;  2DAE A;  2F5N A;  4DV6 M;  3CF2 A;  4FW9 A;  1IM2 A;  3JR5 A;  1IY2 A;  2UUA M;  1ZMV A;  4DV1 M;  2L4E A;  1G71 A;  3KP1 E;  3NWL A;  3R8F A;  1IN8 A;  1SXJ E;  4LJ8 A;  2XEP A;  3L28 A;  4NOO B;  4AG6 A;  4GIT A;  3JR4 A;  1PJJ A;  2RGH A;  2A5Y B;  2CRU A;  3SHG B;  3U6D A;  3GLF A;  2XSZ A;  4I81 A;  1WHC A;  4D81 A;  1ORY B;  4GEW A;  4DR5 M;  4NXN M;  2F5Q A;  4L8R C;  3FUW A;  3LVW A;  2QP9 X;  1PM5 A;  1QAN A;  2OOB A;  2G3Q A;  2E5L M;  3GQ5 A;  1HQC A;  5FTM A;  4DR7 M;  4F1I A;  1XXH B;  4FD2 A;  1K3X A;  3KXE C;  3I4Y A;  1D2N A;  1SXJ A;  4IBD A;  2FOI C;  4L78 A;  4MGY E;  4KT0 F;  2R44 A;  2R46 A;  3U61 B;  4CIS A;  4PDG A;  2QEN A;  5KPZ A;  2DXI A;  3FTE A;  2YQZ A;  1YLA A;  2JWS A;  2FS1 A;  2CV0 A;  1QQW A;  4MGH A;  4B3S M;  1N34 M;  4MGK E;  3MK6 A;  1R5L A;  2KDL A;  4LZZ A;  3E4R A;  1L2D A;  5C18 A;  2DAK A;  2RGO A;  2HHH M;  1GAB A;  1LTM A;  4DUZ M;  1E9S A;  1NNU C;  2QCU A;  3GLI A;  1QUT A;  3FUX A;  4CJ6 A;  5E6J A;  2J7O A;  1HR0 M;  3THG A;  3GPU A;  2X8A A;  2KRK A;  2VF8 A;  3EIH A;  3SMS A;  3KOW E;  2W82 A;  4PD2 A;  3VK8 A;  2HCB A;  1JB0 F;  1TGU A;  4DV7 M;  1TH4 A;  2HAK A;  4JYA M;  1QZM A;  4B3M M;  4FCW A;  3HY5 A;  3IHP A;  1HJP A;  4B3T M;  2UXC M;  1XC8 A;  3W68 A;  2V6Z M;  1N36 M;  1DGB A;  5F3W A;  1WIV A;  4LF4 M;  1NY5 A;  4D80 A;  1KSF X;  1PGY A;  2JZ1 A;  1DO0 A;  4QHT A;  4GC5 A;  4NL4 H;  5EQT A;  4LZJ A;  2JY7 A;  3R9X B;  3TL4 X;  2G8L A;  2YR0 A;  2DWZ B;  4AKG A;  2Y20 A;  3UGJ A;  3GPY A;  1YE9 A;  2BJV A;  2R62 A;  2RKO A;  1Q39 A;  1ZAE A;  3WHK A;  1L2C A;  1QZE A;  4B3R M;  1OAO C;  1TDZ A;  3LQQ A;  3VDU A;  2UUB M;  4LF5 M;  4K0K M;  2DAI A;  1VDD A;  3RGS A;  1JR3 E;  3I4V A;  5ITX E;  1S3S A;  1JR3 D;  2QSF X;  1E9R A;  3ZQJ A;  3IG8 A;  1GVN A;  1RU3 A;  2H1R A;  2Y0Q A;  4EIW A;  3GLI E;  1PJQ A;  1XXH E;  2LVP C;  4IBE A;  3KOX E;  4LRS A;  3SAR A;  4IBF A;  3GQ3 A;  4QNM A;  5KO3 A;  3UJN A;  3W0L B;  2ERC A;  2J5Y A;  3L29 A;  2XFT A;  3I51 A;  1SXJ B;  3M7G A;  1W5S A;  1OJL A;  2KNA A;  3HHZ A;  1TF0 B;  2XH9 A;  3VLF B;  2DWM A;  1N78 A;  2M60 A;  4HEO A;  2MRO B;  3FTC A;  3RGP A;  4RF0 A;  3U60 B;  5IT9 S;  1GJS A;  1VDL A;  3U6M A;  1W5T A;  4JI5 M;  2JY5 A;  3LMM A;  4B7H A;  2Z3X A;  3SYL A;  1EIJ A;  3GLI B;  4XK8 F;  4MH0 E;  4L15 A;  1V92 A;  1OIZ A;  1TR8 A;  2KEB A;  2ZAN A;  2LHG A;  4II7 A;  4MB7 A;  3DZD A;  2D7E A;  4FWH A;  1D0L A;  2KA6 B;  1AUA A;  2C96 A;  1ZQ9 A;  4GKJ M;  3PNY A;  4X65 M;  3KSX A;  1NVM A;  4HL4 A;  3CF6 E;  3MJ5 A;  2DWN A;  1OKS A;  1NJF A;  1ZMU A;  2GQF A;  2WSC F;  3U6O A;  3KS4 A;  4WW0 A;  3HZJ A;  4IBJ A;  3J81 S;  4DR4 M;  2C5R A;  4A3V B;  2XFS A;  4W5W A;  2QPA A;  3GLH B;  2JUJ A;  2C9O A;  2LTU A;  1R7R A;  4IBC A;  3BBZ A;  3PXG A;  3K8Z A;  4G4R A;  1L1T A;  2FH0 A;  3TWL A;  3U5Z A;  4FVM A;  1MU5 A;  4UN2 B;  1SXJ C;  4B7G A;  4KOD A;  2FE8 A;  3GLG B;  4QOS A;  3GPP A;  1T6O A;  1IXS B;  3LW5 F;  2MGW A;  4WUR A;  1TH3 A;  1IY1 A;  4JI6 M;  1QDT A;  5BPV A;  5A2Q S;  2KNZ A;  1N75 A;  2QZ4 A;  1I4W A;  1DGF A;  3HU1 A;  3IEC A;  4LY6 A;  5EJC A;  5KPR A;  2Y0T A;  2APL A;  2OO9 A;  2CWB A;  3U6P A;  3KP0 E;  4NRW A;  2DAM A;  2C98 A;  4F2L A;  1QAO A;  1VEJ A;  1KFV A;  3K9P A;  4MGI E;  3GLH E;  2UU9 M;  1Q3C A;  4WP2 A;  3T1Y M;  4NSR A;  3LVV A;  5EXT A;  4Z8X A;  4AZF A;  2HKJ A;  3HHY A;  3C9P A;  3HHX A;  4CHT B;  5ITR A;  2P5T A;  2LH0 A;  2RRU A;  4JI4 M;  2R45 A;  4CGY B;  1Q3B A;  2L2D A;  1QVR A;  1K3W A;  1R2Z A;  1G59 A;  1QDR A;  2V1U A;  4XGI A;  2ZAO A;  3AV0 A;  3D8B A;  3KOZ E;  2QNJ A;  1I94 M;  3GRR A;  2MJ5 B;  1NJG A;  4JI3 M;  3RE8 A;  3TWM A;  3KS8 A;  1XWI A;  2CE7 A;  2XGN A;  1SG9 A;  2R4J A;  1E94 E;  3CGW A;  4AI6 A;  1P3Q Q;  1GLN A;  4NRV A;  3GRV A;  1SXJ D;  4HLQ A;  1Z59 A;  3KSJ A;  4B08 A;  3E46 A;  2EKK A;  1UFZ A;  1NO1 A;  1V34 A;  3DA1 A;  4DBG B;  1NHW C;  4RF1 A;  2UUC M;  1Y8G A;  1Z5B A;  2CUZ A;  1CUK A;  1OAI A;  1T3T A;  1QUS A;  1ZV1 A;  2DKL A;  4GHA A;  1VQ1 A;  3T38 A;  4FWG A;  2V1C A;  1GKI A;  3D8L A;  1LV7 A;  4G3O A;  4LFA M;  1IN5 A;  1C7Y A;  1L8Q A;  2D7G A;  3HJ8 A;  3QYB A;  4OU7 A;  4BB9 A;  1IQP A;  3FUV A;  1GL6 A;  2F5S A;  3C3E A;  5BR8 M;  2Z8Y M;  1XXH A;  2FFJ A;  2Z4S A;  3SAV A;  2XF3 A;  1EE8 A;  1KYI A;  2LNH C;  3U5Z B;  3Q8X A;  1TH2 A;  3GLG A;  4LJ4 A;  4YHH M;  5ITX A;  1UM8 A;  3SYK A;  1Z6T A;  1NV8 A;  2DZL A;  3M6A A;  3MMP A;  4MM3 B;  3KDS E;  4IJF A;  2Z7J A;  1NY6 A;  3SAU A;  2KHH A;  4RKU F;  1D0M A;  2JY8 A;  2L7I A;  3JAM S;  1WGN A;  4L16 A;  4ANR A;  1N32 M;  3GLG E;  2ZTD A;  5EP4 A;  5GKN A;  4GHL A;  1PJT A;  2JA2 A;  3ZC7 B;  4JN6 A;  3L26 A;  2HL7 A;  4LCB A;  5KQ8 A;  3FTF A;  1EFU B;  3T6P A;  3J7A S;  4DV0 M;  2EUC A;  1WXQ A;  2X49 A;  4LF9 M;  4MGZ E;  3B7Z A;  4X62 M;  2EO2 A;  3FYD A;  5E26 A;  3HU3 A;  3E9S A;  3GRY A;  4FCV A;  2LVN C;  2DHY A;  3FD9 A;  2LHC A;  2EJS A;  1HQY E;  4GRI A;  4R7G A;  4Z6Y A;  3SAW A;  3MHV C;  3HJS A;  3C58 A;  4ZPX A;  2B3T A;  1DV0 A;  3GO8 A;  1J7K A;  4M0D A;  3GPX A;  4NXM M;  3A42 A;  5C1B A;  5EXS A;  1DGH B;  3U6L A;  4AKI A;  4JI1 M;  1IXZ A;  2HWJ A;  5IZ7 D;  1FJG M;  5FSW A;  1VEK A;  3C3D A;  5ITQ A;  2ZAM A;  2QHO B;  5JI2 E;  1HNX M;  2QBY A;  3H4J A;  1C1K A;  2QQ8 A;  2KNV A;  5DNY A;  3U60 A;  3EIE A;  1XNR M;  2K6B A;  4DV3 M;  4LFB M;  4PDI A;  1PJI A;  2H5X A;  3U6Q A;  2UXB M;  3QYE A;  3U6E A;  2DAG A;  2LXE A;  2DVW B;  4FCT A;  2CEA A;  7CAT A;  2M5Z A;  4TUW A;  4D82 A;  3I04 M;  2CP8 A;  5EXP A;  2O5R A;  3AFH A;  1NHG C;  3B89 A;  3BXW A;  2ZTC A;  3HU2 A;  3A45 A;  3KOY E;  3SBJ A;  3VDP A;  4M9Z A;  4XBO A;  4LJ6 A;  4LJ7 A;  1HNZ M;  5EP1 A;  4FWD A;  2CV2 A;  2VII A;  2Z4R A;  2CV1 A;  2Y21 A;  3FKE A;  4L4U A;  1IXR C;  1WGL A;  4NSO B;  1L1Z A;  2DZO B;  4Q7J A;  4DV2 M;  2O01 F;  3DFZ A;  3ILK A;  3FUU A;  2DNA A;  3GLF E;  4KHP M;  2EA0 A;  4LF7 M;  5KPT A;  3LQR A;  1WR1 B;  2LVQ D;  4DR3 M;  1IBM M;  1A5T A;  1TDH A;  1IBL M;  3AOE C;  3FRH A;  2F4V M;  3GP1 A;  1MX0 A;  5L8R F;  2JNH A;  4P16 A;  2MR9 A;  2WZJ A;  4NC6 A;  3TPZ A;  2DZN B;  1HT1 E;  1IN6 A;  3FTD A;  3H4M A;  4GC9 A;  4LGY A;  2JZ0 A;  3SHF A;  2BWE A;  1XB2 B;  1YSY A;  3TE6 A;  5EXX A;  3K2L A;  4LRT A;  2AHM A;  5DYG A;  2XLJ A;  1XMQ M;  4X66 M;  5FTL A;  1XHB A;  4I5S A;  4DR2 M;  5FTK A;  1N77 A;  3AJI B;  4BLC A;  4G4N A;  2NQ8 C;  1VG5 A;  5JI3 E;  2L09 A;  5IWA M;  3T15 A;  2LVA A;  3UMM A;  1MN3 A;  1VEG A;  5ITU A;  3K92 A;  3TWK A;  2BWB A;  3GLH A;  1TTE A;  2ZBK B;  1F4I A;  5EP3 A;  3VFD A;  2LWX A;  3AOE A;  3V76 A;  1DGH A;  2LBC A;  5DFL A;  4R71 A;  3U61 A;  3ZH9 B;  1IFY A;  3VKG A;  2XSZ D;  3B7N A;  2MH8 A;  4OVZ A;  3HX3 A;  3F92 A;  1E32 A;  3M0E A;  2KRU A;  4PT5 A;  2WSF F;  4DR6 M;  1AIP C;  3J27 B;  4IBB A;  3GQ4 A;  1OFH A;  1G41 A;  2N35 A;  3FE3 A;  4QHS A;  3J80 S;  2XZF A;  4M0W A;  3WHL A;  3TQS A;  3L2A A;  1R4G A;  1XNQ M;  1JQJ C;  4IBK A;  1OTR A;  2BJW A;  3HWS A;  4GKK M;  5KQD A;  4LF8 M;  2VQE M;  2XZU A;  1D0K A;  4DV5 M;  2R4E A;  2L6O A;  4LG2 A;  1FNN A;  1GO5 A;  2VF7 A;  1NSF A;  2R65 A;  3AL0 C;  2I7N A;  4AG5 A;  5H37 D;  3FYC A;  1PJS A;  1QAM A;  3IG5 A;  3NBX X;  4I8O A;  4CIZ A;  1IN4 A;  1NNJ A;  4LJ9 A;  2C9C A;  2K9D A;  4IBI A;  1YUB A;  3HJQ A;  3HKP A;  4GMQ A;  4REZ A;  2KW0 A;  1XMO M;  2BNK A;  4IBG A;  3Q8G A;  2VDB B;  3OTO M;  5IRE B;  4P17 A;  4ITQ A;  4M9X A;  4JV5 M;  4DV4 M;  2JXN A;  1NV9 A;  2CHV A;  2L7H A;  3FUT A;  3L27 A;  2OQ4 A;  2DI0 A;  1QYR A;  1OIP A;  4GH9 A;  2OOA A;  1Z5C A;  2GNO A;  2KZS A;  2R18 A;  3CTW B;  4R3D A;  3I01 M;  3B9P A;  5FTN A;  3SC3 A;  5LMU M;  1DGG A;  1QAQ A;  4G4O A;  3VKH A;  1N33 M;  3A98 B;  4L6V 6;  4OW0 A;  2J7N A;  3LCV B;  2ZM6 M;  1GJT A;  4JI0 M;  3VK7 A;  1T43 A;  4YY3 M;  2CHG A;  5FTJ A;  2R0I A;  2C99 A;  2YFQ A;  2Q2E B;  3HGI A; 
#chains in the Genus database with same CATH homology
 1H6U A;  2QBY B;  2KXE A;  3DOA A;  1J5E M;  3SMP A;  4IJE A;  3U6C A;  4X64 M;  2FNA A;  4LGM A;  4G6Z A;  3CF0 A;  3QAU A;  4LJ5 A;  5FLX S;  1OFI A;  1JR3 A;  2X4A A;  1HNW M;  3SAT A;  4LF6 M;  4LFC M;  3T1H M;  3AKZ A;  1K82 A;  4G4Q A;  2UXD M;  4RNA A;  3SFZ A;  4QOZ C;  4AKH A;  4KO8 A;  5EP2 A;  1G8P A;  4I4L A;  8CAT A;  1IN7 A;  2D7H A;  1R2Y A;  4AW4 A;  4B7F A;  1R6B X;  1L2B A;  5LMN M;  3PVS A;  3KFU G;  2F5O A;  4JI2 M;  2CFO A;  1G4A E;  4KLN A;  4BBA A;  3AOG A;  1G3I A;  2CHQ A;  5ITY A;  3PNV A;  4GIP A;  5ITT A;  4DR1 M;  3KW6 A;  3PFI A;  3RFW A;  5DYI A;  3J2P B;  2F5P A;  1X37 A;  1HT2 E;  3GLF B;  4S12 A;  4DUY M;  4JI7 M;  3QWL A;  3NBI A;  3UZU A;  3K1J A;  2DHR A;  4OVZ B;  2G5G X;  3W0F A;  2OPF A;  3UK6 A;  4LJA A;  1IBK M;  2YNM D;  4OX9 M;  4PCZ A;  4JXJ A;  4M9S A;  3ZCB B;  3SAS A;  4IIW A;  2VQF M;  2K47 A;  2KZU A;  1DO2 A;  4AQY M;  1J09 A;  1GL7 A;  3U6S A;  3GRU A;  2I7P A;  3J7B A;  3HHW A;  3KVW A;  3BOS A;  1Z5A A;  4QNR A;  3A46 A;  1IY0 A;  2F5N A;  4DV6 M;  3CF2 A;  4FW9 A;  1IM2 A;  3JR5 A;  1IY2 A;  2UUA M;  4DV1 M;  3KP1 E;  3R8F A;  3NWL A;  1IN8 A;  1SXJ E;  4LJ8 A;  2XEP A;  3L28 A;  4NOO B;  4AG6 A;  4GIT A;  3JR4 A;  1PJJ A;  2RGH A;  2A5Y B;  3SHG B;  3U6D A;  3GLF A;  2XSZ A;  4I81 A;  4D81 A;  1ORY B;  4DR5 M;  4NXN M;  2F5Q A;  4L8R C;  3FUW A;  3LVW A;  2QP9 X;  1PM5 A;  1QAN A;  2E5L M;  3GQ5 A;  1HQC A;  5FTM A;  4DR7 M;  1XXH B;  4FD2 A;  1K3X A;  3KXE C;  3I4Y A;  1D2N A;  1SXJ A;  4IBD A;  2FOI C;  4L78 A;  4MGY E;  4CIS A;  2R46 A;  3U61 B;  4PDG A;  2QEN A;  5KPZ A;  2DXI A;  3FTE A;  2YQZ A;  2CV0 A;  1QQW A;  4MGH A;  4B3S M;  1N34 M;  4MGK E;  3MK6 A;  4LZZ A;  3E4R A;  1L2D A;  5C18 A;  2RGO A;  2HHH M;  4DUZ M;  1E9S A;  1NNU C;  2QCU A;  3GLI A;  3FUX A;  5E6J A;  2J7O A;  1HR0 M;  3THG A;  3GPU A;  2X8A A;  2KRK A;  3EIH A;  3SMS A;  4PD2 A;  3KOW E;  2W82 A;  4JI8 M;  2HCB A;  1TGU A;  4DV7 M;  1TH4 A;  4JYA M;  1QZM A;  4B3M M;  4FCW A;  4B3T M;  2UXC M;  1XC8 A;  2V6Z M;  1N36 M;  1DGB A;  5F3W A;  4LF4 M;  1NY5 A;  4D80 A;  1KSF X;  1DO0 A;  4QHT A;  4GC5 A;  4NL4 H;  5EQT A;  4LZJ A;  3R9X B;  3TL4 X;  2G8L A;  2YR0 A;  2DWZ B;  4AKG A;  2Y20 A;  3UGJ A;  3GPY A;  1YE9 A;  2BJV A;  2R62 A;  2RKO A;  1Q39 A;  1ZAE A;  3WHK A;  1L2C A;  4B3R M;  1TDZ A;  3LQQ A;  3VDU A;  2UUB M;  4LF5 M;  4K0K M;  1VDD A;  3RGS A;  3I4V A;  5ITX E;  1S3S A;  1JR3 D;  1E9R A;  3IG8 A;  1GVN A;  2H1R A;  2Y0Q A;  4EIW A;  3L25 A;  4IBE A;  4LRS A;  3SAR A;  3KOX E;  4IBF A;  3GQ3 A;  4QNM A;  5KO3 A;  3UJN A;  3W0L B;  2ERC A;  3L29 A;  2XFT A;  3I51 A;  1SXJ B;  3M7G A;  1W5S A;  1OJL A;  3HHZ A;  2XH9 A;  3VLF B;  2DWM A;  1N78 A;  2M60 A;  3FTC A;  3RGP A;  4RF0 A;  3U60 B;  5IT9 S;  3U6M A;  1W5T A;  4JI5 M;  3LMM A;  4B7H A;  2Z3X A;  3SYL A;  3GLI B;  4MH0 E;  4L15 A;  2KEB A;  2ZAN A;  4II7 A;  4MB7 A;  3DZD A;  4FWH A;  2D7E A;  2KA6 B;  2C96 A;  1ZQ9 A;  4GKJ M;  3PNY A;  4X65 M;  3KSX A;  1NVM A;  4HL4 A;  3CF6 E;  3MJ5 A;  2DWN A;  1NJF A;  3U6O A;  3KS4 A;  4WW0 A;  4IBJ A;  3J81 S;  4DR4 M;  2C5R A;  4A3V B;  2XFS A;  4W5W A;  2QPA A;  3GLH B;  2C9O A;  1R7R A;  4IBC A;  3PXG A;  3K8Z A;  4G4R A;  1L1T A;  3TWL A;  3U5Z A;  4FVM A;  1MU5 A;  1SXJ C;  4B7G A;  4KOD A;  2FE8 A;  3GLG B;  4QOS A;  3GPP A;  1IXS B;  4WUR A;  1TH3 A;  1IY1 A;  4JI6 M;  5BPV A;  5A2Q S;  2QZ4 A;  1N75 A;  4LY6 A;  1I4W A;  1DGF A;  3HU1 A;  5KPR A;  3U6P A;  5EJC A;  2DWL A;  2Y0T A;  4NRW A;  3KP0 E;  2C98 A;  1QAO A;  1KFV A;  4MGI E;  2UU9 M;  1Q3C A;  3T1Y M;  4NSR A;  3LVV A;  5EXT A;  4Z8X A;  4AZF A;  2HKJ A;  3HHY A;  3HHX A;  4CHT B;  5ITR A;  2P5T A;  2LH0 A;  4JI4 M;  2R45 A;  4CGY B;  1Q3B A;  1K3W A;  1QVR A;  1G59 A;  1R2Z A;  2V1U A;  4XGI A;  2ZAO A;  3AV0 A;  3D8B A;  3KOZ E;  1I94 M;  3GRR A;  1NJG A;  4JI3 M;  3RE8 A;  3TWM A;  3KS8 A;  1XWI A;  2CE7 A;  2XGN A;  2R4J A;  1E94 E;  4AI6 A;  1GLN A;  4NRV A;  3GRV A;  1SXJ D;  4HLQ A;  1Z59 A;  3KSJ A;  4B08 A;  3DA1 A;  1NHW C;  4RF1 A;  2UUC M;  4GHA A;  1Z5B A;  2CUZ A;  1T3T A;  3T38 A;  4FWG A;  2V1C A;  1GKI A;  3D8L A;  1LV7 A;  4LFA M;  1IN5 A;  1L8Q A;  2D7G A;  3HJ8 A;  4OU7 A;  4BB9 A;  1IQP A;  3FUV A;  1GL6 A;  2F5S A;  5BR8 M;  1XXH A;  2FFJ A;  2Z4S A;  3SAV A;  2XF3 A;  1EE8 A;  1KYI A;  2LNH C;  3U5Z B;  3Q8X A;  1TH2 A;  3GLG A;  4LJ4 A;  4YHH M;  5ITX A;  1UM8 A;  3SYK A;  1Z6T A;  3M6A A;  4MM3 B;  3KDS E;  4IJF A;  2Z7J A;  1NY6 A;  3SAU A;  2L7I A;  3JAM S;  4L16 A;  1N32 M;  5EP4 A;  5GKN A;  4GHL A;  2JA2 A;  3ZC7 B;  4JN6 A;  3L26 A;  2HL7 A;  4LCB A;  5KQ8 A;  3FTF A;  3J7A S;  4DV0 M;  2EUC A;  1WXQ A;  2X49 A;  4LF9 M;  4MGZ E;  4X62 M;  2EO2 A;  3FYD A;  5E26 A;  3HU3 A;  3E9S A;  3GRY A;  4FCV A;  3FD9 A;  4R7G A;  4Z6Y A;  4GRI A;  1HQY E;  3SAW A;  3MHV C;  3HJS A;  3C58 A;  4ZPX A;  3GO8 A;  1J7K A;  4M0D A;  3GPX A;  4NXM M;  3A42 A;  5C1B A;  5EXS A;  1DGH B;  3U6L A;  4AKI A;  4JI1 M;  1IXZ A;  1FJG M;  5IZ7 D;  5FSW A;  5ITQ A;  2ZAM A;  5JI2 E;  1HNX M;  2QBY A;  1C1K A;  5DNY A;  3U60 A;  3EIE A;  1XNR M;  4DV3 M;  4LFB M;  4PDI A;  1PJI A;  3U6Q A;  2UXB M;  3U6E A;  2LXE A;  2DVW B;  4FCT A;  2CEA A;  7CAT A;  2M5Z A;  4TUW A;  4D82 A;  5EXP A;  2O5R A;  3AFH A;  1NHG C;  3HU2 A;  3KOY E;  3A45 A;  3SBJ A;  3VDP A;  4M9Z A;  4XBO A;  4LJ6 A;  4LJ7 A;  1HNZ M;  5EP1 A;  4FWD A;  2CV2 A;  2VII A;  2Z4R A;  2CV1 A;  2Y21 A;  3FKE A;  4L4U A;  1IXR C;  4NSO B;  1L1Z A;  2DZO B;  4DV2 M;  3DFZ A;  3ILK A;  3FUU A;  4KHP M;  2EA0 A;  4LF7 M;  5KPT A;  3LQR A;  1IBM M;  4DR3 M;  1TDH A;  1IBL M;  3AOE C;  2F4V M;  3GP1 A;  1MX0 A;  4P16 A;  3TPZ A;  2DZN B;  1HT1 E;  1IN6 A;  3FTD A;  3H4M A;  4GC9 A;  4LGY A;  3SHF A;  1YSY A;  3TE6 A;  5EXX A;  3K2L A;  4LRT A;  2AHM A;  5DYG A;  2XLJ A;  1XMQ M;  4X66 M;  5FTL A;  1XHB A;  4I5S A;  4DR2 M;  5FTK A;  1N77 A;  3AJI B;  4BLC A;  4G4N A;  2NQ8 C;  5JI3 E;  2L09 A;  5IWA M;  3T15 A;  3UMM A;  5ITU A;  3K92 A;  3TWK A;  3GLH A;  2ZBK B;  5EP3 A;  3VFD A;  2LWX A;  3AOE A;  1DGH A;  3U61 A;  3ZH9 B;  3VKG A;  2XSZ D;  4OVZ A;  1E32 A;  3M0E A;  2KRU A;  4PT5 A;  4DR6 M;  3J27 B;  4IBB A;  3GQ4 A;  1OFH A;  1G41 A;  4QHS A;  3J80 S;  2XZF A;  4M0W A;  3WHL A;  3TQS A;  3L2A A;  1XNQ M;  1JQJ C;  4IBK A;  2BJW A;  3HWS A;  4GKK M;  5KQD A;  4LF8 M;  2VQE M;  2XZU A;  4DV5 M;  2R4E A;  2L6O A;  4LG2 A;  1FNN A;  3AL0 C;  1NSF A;  2R65 A;  2I7N A;  4AG5 A;  5H37 D;  3FYC A;  1QAM A;  3IG5 A;  4I8O A;  1IN4 A;  1NNJ A;  4LJ9 A;  2C9C A;  4IBI A;  1YUB A;  3HJQ A;  3HKP A;  4GMQ A;  4REZ A;  2KW0 A;  1XMO M;  2BNK A;  4IBG A;  3OTO M;  5IRE B;  4ITQ A;  4M9X A;  4JV5 M;  4DV4 M;  3L27 A;  2CHV A;  2L7H A;  3FUT A;  2OQ4 A;  1QYR A;  4GH9 A;  1Z5C A;  4R3D A;  2KZS A;  2R18 A;  3CTW B;  5FTN A;  3SC3 A;  3B9P A;  5LMU M;  4G4O A;  3VK8 A;  1DGG A;  1QAQ A;  3VKH A;  1N33 M;  3A98 B;  4OW0 A;  2J7N A;  2ZM6 M;  4JI0 M;  3VK7 A;  4YY3 M;  2CHG A;  5FTJ A;  2C99 A;  2YFQ A;  2Q2E B;  3HGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...