1HNZM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hnzM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hnzM02
4DR2M 3U6SA 4DV4M 3GQ3A 4DUZM 4PDIA 4DV1M 1XMQM 3T1HM 3U6OA 4JYAM 3U6PA 4B3SM 2ZBKB 1L1TA 4DV6M 4K0KM 3TWMA 4JI7M 2F5QA 2UUCM 2UUBM 4YY3M 1IBLM 4DV0M 2F5NA 2HHHM 4PCZA 3JAMS 1KFVA 2F5OA 4DV2M 3SBJA 2XZUA 4G4NA 4DV5M 4DR1M 1R2ZA 5BR8M 1N32M 1TDHA 3GQ5A 5IT9S 4LF6M 4LFCM 1FJGM 4ITQA 1PM5A 1PJJA 1XNQM 3GQ4A 1XC8A 2UXCM 3J80S 5LMNM 2OQ4A 2HKJA 4G4QA 3GPYA 2OPFA 1N34M 3U6LA 1I94M 5ITUA 3TWKA 4JI1M 2UXBM 4G4OA 1Z5BA 3A42A 2F5SA 4JI6M 1NNJA 4DUYM 2XZFA 5ITYA 3J7AS 2Q2EB 5ITRA 2UUAM 3U6CA 4B3RM 5IWAM 5LMUM 3U6QA 1IBMM 4JI8M 4B3MM 4LF4M 1PJIA 3TWLA 3T1YM 4CISA 5ITQA 3OTOM 1HNXM 4GKKM 1HNZM 3DOAA 4NXMM 2UXDM 3A45A 1N36M 3VK8A 4LFBM 4DV7M 4YHHM 5ITTA 3SAUA 3SASA 3GPXA 4PD2A 3GO8A 1Q3BA 4X66M 4LF7M 4B3TM 4LF9M 4NXNM 3SAVA 1TDZA 3U6DA 1J5EM 4LF5M 3SATA 4X64M 2ZM6M 4JI2M 4DV3M 4DR6M 1IBKM 1HR0M 1Z5CA 4KHPM 4NRWA 4DR5M 3SARA 2F4VM 1MX0A 1N33M 1Q3CA 3U6EA 1L2CA 4JI4M 1Q39A 2VQEM 5FLXS 1K3XA 4DR3M 1L1ZA 2F5PA 4DR4M 3GPUA 5ITXA 4JI5M 1MU5A 4JI0M 4X62M 4X65M 3GPPA 1HNWM 3J81S 1XNRM 3C58A 1EE8A 4G4RA 4DR7M 3SAWA 4JI3M 1XMOM 4LFAM 3VK7A 4GKJM 2UU9M 3U6MA 1L2BA 4MB7A 2E5LM 4LF8M 4OX9M 4PDGA 3GP1A 5ITXE 1R2YA 1K82A 3JR5A 4AQYM 4JV5M 2VQFM 2EA0A 1K3WA 1Z59A 1Z5AA 1L2DA 3JR4A 3A46A 3W0FA 4NRVA 5A2QS
chains in the Genus database with same CATH superfamily
1V92A 4MGZE 3U60A 1XB2B 1OKSA 5IREB 3TL4X 1KYIA 3PNYA 3L27A 4DUZM 3L25A 3U6OA 2J7NA 3T38A 2HWJA 4TUWA 1XXHB 2YR0A 3A98B 3E4RA 2KRUA 1JR3A 4QNRA 2L6OA 1PJSA 4DV6M 4FWGA 4JI7M 5L8RF 1TR8A 4FD2A 2F5QA 2M5ZA 3GLIB 3LQRA 2ZAOA 2DXIA 5EXSA 2K9DA 4AG5A 4YY3M 4DV0M 2ZTDA 2HHHM 1EIJA 1QYRA 2DWZB 3WHKA 1OIZA 3MJ5A 2C98A 3MK6A 2F5OA 4G6ZA 3VKHA 3SBJA 4LJ9A 3TPZA 4G4NA 4DV5M 2CFOA 1IN4A 3AOEC 2H5XA 3GLFE 3Q8XA 4LF6M 1YE9A 2YNMD 3HU1A 2D7HA 4NL4H 1PM5A 1LV7A 2N35A 4CHTB 4BB9A 2OQ4A 3H4JA 2HKJA 3D8BA 3H4MA 4L4UA 4QHTA 2CHQA 4EIWA 3U6LA 3K9OA 3SC3A 5ITUA 2QNJA 4D80A 4XBOA 2JWSA 5KPTA 2DHRA 5DNYA 4P17A 1Z5BA 4ANRA 4JI6M 1NNJA 4DUYM 5DYGA 2R44A 2R65A 2H1RA 5ITRA 3SMSA 4LRSA 2L2DA 3U6QA 2R0IA 3U60B 3SYLA 1H6UA 4IBCA 4LG2A 1IBMM 2JZ1A 3T1YM 2DAIA 1EFUB 3BXWA 3DA1A 4QNMA 1HNXM 3HGIA 1XHBA 1Y8GA 1N36M 2KZSA 4DV7M 1TF0B 1VDDA 3GRVA 5ITTA 3SAUA 3K9PA 3GPXA 4IJEA 3GO8A 3VDUA 2Y21A 4X66M 4LF7M 3KOWE 4LF9M 4PT5A 2I7PA 2C5RA 5KQ8A 5KO3A 4LF5M 1MN3A 4IBJA 2G5GX 4DV3M 1KSFX 1IY2A 2GNOA 4IBIA 4JXJA 1IXSA 5FTJA 1R5LA 4AKGA 3KSJA 4B08A 3L28A 2F4VM 4M9XA 4Z8XA 3C3DA 3U6EA 1NJFA 1L2CA 3AL0C 5FLXS 1L1ZA 2LWXA 3UMMA 4DR4M 4L16A 3IG8A 3FTDA 3WHLA 1G4AE 2ZANA 1WIVA 3J81S 4NSRA 1WR1B 1T6OA 4G4RA 2QBYA 2KZUA 1WHCA 1XMOM 3HHZA 3I51A 3ILKA 2FOIC 2E5LM 1IY1A 1D2NA 1S3SA 2CWBA 2KDLA 3GLHE 3QYEA 4PDGA 1VG5A 2CUZA 4AQYM 2Y0QA 4JV5M 1Z5AA 1W5TA 2JY5A 3FE3A 3UK6A 2G8LA 4R71A 3UGJA 1SXJC 5EP1A 2JZ0A 2QCUA 2HCBA 4BLCA 1C1KA 2DAEA 4IIWA 3RGSA 1AIPC 2BJVA 3FRHA 3VDPA 4DV4M 2CE7A 3E9SA 3DFZA 3FTEA 1XMQM 2DENA 2QSFX 3T1HM 3NBIA 3U6PA 3GLGE 3LVWA 1N77A 1QVRA 1G3IA 1R4GA 2DWMA 5H37D 1HT2E 3TWMA 1NNUC 1IXSB 2XF3A 1IBLM 2F5NA 2WZJA 3KW6A 5EP2A 3DZDA 1DGFA 1YUBA 1YLAA 2B3TA 2KNZA 4L15A 4KO8A 2DI0A 4DBGB 2APLA 2JUJA 2XZUA 3FD9A 3EIEA 2HL7A 4DR1M 4NC6A 1N32M 1SXJD 1R7RA 5GKNA 2XFSA 1DO0A 5IT9S 1NO1A 2XSZD 1FJGM 1PJJA 2QBYB 1AUAA 3KOYE 1XNQM 3GQ4A 3ZC7B 2UXCM 2ERCA 3KS8A 4HL4A 4LJ7A 4AKIA 3MHVC 1WGLA 2C96A 3QYBA 4G4QA 3TQSA 3FTCA 3HJ8A 1G59A 5EP4A 5FTKA 2D7GA 3HU2A 4I4LA 5IZ7D 4P16A 3W0LB 4I5SA 1GO5A 4G4OA 4FCWA 4CIZA 3IECA 8CATA 4IBEA 1IN5A 1E9RA 4FVMA 4KLNA 2Q2EB 1N75A 4Y28F 2LTUA 4GIPA 1PJQA 3ZH9B 2KNVA 3I4VA 3KOXE 1OTRA 1HQCA 4B3MM 1D0MA 1E94E 2BWBA 4MM3B 1IXZA 1QAOA 2DZNB 3GLHA 2LVOC 1ZMWA 2R4JA 4NXMM 2UXDM 2VF8A 2R62A 3VK8A 2DNAA 3NWLA 1QZEA 2D7EA 2LVQD 2LNHC 4PD2A 1Q3BA 3VKGA 3K8ZA 4D81A 1J7KA 5F3WA 3F92A 4RF1A 1J09A 2DZOB 5EP3A 1UM8A 2MR9A 2P5TA 1J5EM 3SATA 4X64M 1IFYA 2EJSA 3PNVA 4GITA 2DVWB 2L4EA 3QWLA 2V6ZM 3PVSA 4QOSA 2LHGA 1Z5CA 3W67A 2MROB 2YQZA 2RGHA 3HKPA 5KPZA 1WGNA 3B9PA 3V76A 1QAMA 4R7GA 4F1IA 1OIPA 1IN7A 5FTLA 1NHGC 3PFIA 1Q3CA 4JI4M 4ZPXA 2QHOB 2C99A 4OU7A 5E26A 3GRRA 4XK8F 5ITXA 4FWHA 3IG5A 3GPPA 3GLIE 4MH0E 3T15A 1C7YA 3C58A 3K92A 2QQ8A 4AKHA 1DV0A 2EO2A 2CV1A 2MJ5B 1V33A 1JB0F 2CRUA 2JY6B 4IBBA 2OO9A 2OOAA 1DGHA 2VDBB 4II7A 3EIHA 4MGIE 3M6AA 4MB7A 4R3DA 4OX9M 4CJ6A 2DWNA 1IN8A 3B7NA 3C3EA 3BOSA 3CF6E 3Q8GA 5DFLA 2FNAA 2EA0A 3GLHB 3UJNA 2DAMA 1DO2A 3KVWA 2AHMA 1E32A 3A46A 1IQPA 1Z6TA 3W0FA 2I7NA 2ZTCA 2CP8A 3C9PA 3I4YA 4MGHA 5C1BA 1A5TA 1W5SA 4LJ6A 2LBCA 1SXJE 1QDTA 4DV1M 3FUUA 3LCVB 4JYAM 4M0WA 4FWDA 4B3SM 2QZ4A 1LTMA 1QUSA 2ZBKB 4RNAA 4K0KM 2DKLA 2UUCM 3K2LA 4IBFA 3GLFA 1NV9A 3AJIB 3HJQA 4AZFA 5FSWA 5EXXA 3JAMS 4XGIA 4LRTA 3U5ZA 2V1CA 3LVVA 1R2ZA 1NY5A 4BBAA 5BR8M 2L09A 3J2PB 1TDHA 3GQ5A 3FYDA 4ITQA 1OQYA 4LCBA 3AKZA 4IBKA 1GL7A 4MGYE 3IHPA 1XC8A 1ZMVA 5LMNM 2JNHA 1DGHB 3AOGA 3GRUA 1TTEA 1NJGA 3GPYA 1VEKA 1G8PA 4LZJA 3HHXA 2YFQA 1I94M 4AI6A 1N78A 3LCUA 4JI1M 2UXBM 4KT0F 3KP1E 3SMPA 1UFZA 4AW4A 2KA6B 3J7AS 7CATA 1TH3A 3HZJA 2KXEA 3HY5A 3B74A 2UUAM 1VQ1A 4B3RM 4GMQA 5IWAM 5LMUM 2CV2A 2BNKA 1V34A 2XLJA 3FUWA 1PJIA 2DAGA 2VIIA 3T6PA 3TWLA 4F2LA 2Z3XA 4CISA 3KOZE 3DOAA 2O5RA 3A45A 4LFBM 1ZV1A 2Z4SA 3SHFA 1DGGA 4WURA 3KXEC 4YHHM 4LJAA 3GLFB 4LJ5A 1RU3A 4LGMA 2K0BX 4B3TM 3CGWA 3B89A 4IBGA 2JXNA 4QOZC 2Z4RA 4NXNM 1CUKA 3SAVA 3U5ZB 2FS1A 2W82A 1SXJA 3W68A 2CHVA 3FTFA 2FE8A 1WXQA 3MMPA 4RKUF 2MGWA 2XSZA 4L6V6 1BVSA 1QANA 1JR3D 1DGBA 3ZQJA 5KPRA 1IBKM 1L8QA 4DR6M 3FUVA 4NRWA 2LHCA 4I8OA 1WJ7A 2Z7JA 1PGYA 1QUTA 2RGOA 2XGNA 3RE8A 4DR5M 3HU3A 1T43A 3FYCA 5JI3E 1MX0A 4GC5A 1N33M 2FFJA 1Q39A 1Q02A 4I81A 1NSFA 4FCVA 1YSYA 1K3XA 4Q7JA 5DYIA 2CV0A 5EJCA 2CEAA 1R6BX 2KW0A 3GRYA 4NSOB 4KODA 1MU5A 1G71A 4X62M 1HNWM 4REZA 3SFZA 1EE8A 2JP7A 3SAWA 1OJLA 4JI3M 4LJ4A 3L2AA 3HJSA 3LQQA 3D8LA 2UU9M 3U6MA 2RKOA 1L2BA 4L8RC 4OVZB 4LF8M 1R2YA 3L29A 3JR5A 2V1UA 2C9OA 2WSFF 1VEGA 5EXPA 2GQFA 1K3WA 1OAIA 4G3OA 3GLGA 3FKEA 3JR4A 3BBZA 1IN6A 4GEWA 3UZUA 3VLFB 4W5WA 4NRVA 2KEBA 1OAOC 2R4EA 1ORYB 1IY0A 4DR2M 3SHGB 1MJGM 2EKFA 1XXHE 4LGYA 4M9SA 3U6SA 2OOBA 3GQ3A 1T3TA 4PDIA 3I01M 2FH0A 1G41A 1GJTA 2QENA 4Z6YA 3U61B 2X8AA 1SXJB 1TH4A 2NQ8C 2XEPA 1L1TA 4B7FA 3TE6A 1D0LA 1HQYE 2UUBM 3E21A 2L7IA 4QHSA 1TGUA 3QAUA 3HHWA 3AOEA 3B7ZA 4RF0A 2WSCF 1GABA 4PCZA 2KNAA 3J27B 2XH9A 1NHWC 1QDRA 4DV2M 1KFVA 3RGPA 2JY8A 2K6BA 4D82A 2R18A 1JQJC 2O01F 2X49A 1QQWA 4JN6A 4LFCM 1P3QQ 2A5YB 5E6JA 1QZMA 3I04M 1X37A 1GLNA 3J80S 1D0KA 2Y0TA 4GC9A 1FNNA 2OPFA 1N34M 2RRUA 4OW0A 2J5YA 3TWKA 1NV8A 5FTNA 3GLGB 4CGYB 3A42A 2F5SA 1VEJA 3LW5F 2O25A 3HX3A 3L26A 2XZFA 2LXEA 5ITYA 1TH2A 3LMMA 2DZLA 3U6CA 1GL6A 2Z8YM 1NVMA 1XWIA 2KHHA 3FUTA 3KP0E 1GVNA 4UN2B 1GKIA 3CF2A 3SYKA 3VFDA 1JR3E 2L7HA 4JI8M 3ZCBB 4LF4M 4WP2A 4S12A 2G3QA 5ITQA 3OTOM 4NOOB 1E9SA 4IBDA 4GKKM 1QAQA 4FW9A 1HNZM 5C18A 4HLQA 4B7HA 1PRBA 2JY7A 2QP9X 4GH9A 4GHLA 3KDSE 2MH8A 3SASA 2ZAMA 5EXTA 1OFHA 3KFUG 4L78A 4FCTA 4GRIA 2R6FA 4M0DA 1HJPA 2VF7A 3FUXA 1I4WA 3B7QA 1OFIA 4LJ8A 2HAKA 1TDZA 3U6DA 2LVPC 1XXHA 1ZQ9A 2DHYA 4MGKE 5FTMA 2ZM6M 2EUCA 4JI2M 1VDLA 3NBXX 3THGA 1HR0M 3GLIA 4KHPM 2R45A 3K1JA 3KSXA 2C9CA 3AFHA 3SARA 1GJSA 4LZZA 2EKKA 4OVZA 4A3VB 5JI2E 1SG9A 2VQEM 4HEOA 3PXGA 5BPVA 4DR3M 2F5PA 2DWLA 3GPUA 2XFTA 4B7GA 2X4AA 2KRKA 4JI5M 3M7GA 3J7BA 2M60A 1F4IA 4JI0M 4X65M 1XNRM 2L4FA 2J7OA 4LY6A 4DR7M 2K47A 3CTWB 3HWSA 2CHGA 2LVNC 3KS4A 4AG6A 3AV0A 2BWEA 4LFAM 4WW0A 5KQDA 2QPAA 2R46A 3VK7A 3R8FA 3HHYA 3R9XB 4GKJM 3U61A 1PJTA 1NY6A 3CF0A 1K82A 3GP1A 5ITXE 2BJWA 3FRIA 1ZAEA 4M9ZA 1IM2A 3M0EA 2DAKA 1ZMUA 4IJFA 2JA2A 2VQFM 5EQTA 1L2DA 1Z59A 3E46A 2LVAA 1HT1E 1IXRC 3RFWA 2LH0A 4GHAA 2WSEF 2Y20A 5A2QS
chains in the Genus database with same CATH topology
4MGZE 3U60A 5IREB 3TL4X 1KYIA 3PNYA 3L27A 4DUZM 3L25A 3U6OA 2J7NA 3T38A 4TUWA 1XXHB 2YR0A 3A98B 3E4RA 2KRUA 1JR3A 4QNRA 2L6OA 4DV6M 4FWGA 4JI7M 2F5QA 4FD2A 2M5ZA 3GLIB 3LQRA 2ZAOA 2DXIA 5EXSA 4YY3M 4AG5A 4DV0M 2HHHM 1QYRA 2DWZB 3WHKA 3MJ5A 2C98A 3MK6A 2F5OA 4G6ZA 3VKHA 3SBJA 4LJ9A 3TPZA 4G4NA 4DV5M 2CFOA 1IN4A 3AOEC 3Q8XA 4LF6M 1YE9A 2YNMD 3HU1A 2D7HA 4NL4H 1PM5A 1LV7A 4CHTB 4BB9A 2OQ4A 2HKJA 3D8BA 3H4MA 4L4UA 4QHTA 2CHQA 4EIWA 3U6LA 3SC3A 5ITUA 4D80A 4XBOA 5KPTA 2DHRA 5DNYA 1Z5BA 4JI6M 1NNJA 4DUYM 5DYGA 2R65A 2H1RA 5ITRA 3SMSA 4LRSA 3U6QA 3U60B 3SYLA 1H6UA 4IBCA 4LG2A 1IBMM 3T1YM 3DA1A 4QNMA 1HNXM 3HGIA 1XHBA 1N36M 2KZSA 4DV7M 1VDDA 3GRVA 5ITTA 3SAUA 3GPXA 4IJEA 3GO8A 3VDUA 2Y21A 4X66M 4LF7M 3KOWE 4LF9M 4PT5A 2I7PA 2C5RA 5KQ8A 5KO3A 4LF5M 4IBJA 2G5GX 4DV3M 1KSFX 1IY2A 4IBIA 4JXJA 5FTJA 4AKGA 3KSJA 4B08A 3L28A 2F4VM 4M9XA 4Z8XA 3U6EA 1NJFA 1L2CA 3AL0C 5FLXS 1L1ZA 2LWXA 3UMMA 4DR4M 4L16A 3IG8A 3FTDA 3WHLA 1G4AE 2ZANA 3J81S 4NSRA 4G4RA 2QBYA 2KZUA 1XMOM 3HHZA 3I51A 3ILKA 2FOIC 2E5LM 1IY1A 1D2NA 1S3SA 4PDGA 2CUZA 4AQYM 2Y0QA 4JV5M 1Z5AA 1W5TA 3UK6A 2G8LA 3UGJA 1SXJC 5EP1A 2QCUA 2HCBA 4BLCA 1C1KA 4IIWA 3RGSA 2BJVA 3VDPA 4DV4M 2CE7A 3E9SA 3DFZA 3FTEA 1XMQM 3T1HM 3NBIA 3U6PA 3LVWA 1N77A 1QVRA 1G3IA 2DWMA 5H37D 1HT2E 3TWMA 1NNUC 1IXSB 2XF3A 1IBLM 2F5NA 3KW6A 5EP2A 3DZDA 1DGFA 1YUBA 4L15A 4KO8A 2XZUA 3FD9A 3EIEA 2HL7A 4DR1M 1N32M 1SXJD 1R7RA 5GKNA 2XFSA 1DO0A 5IT9S 2XSZD 1FJGM 1PJJA 2QBYB 3KOYE 1XNQM 3GQ4A 3ZC7B 2UXCM 2ERCA 3KS8A 4HL4A 4LJ7A 4AKIA 3MHVC 2C96A 4G4QA 3TQSA 3FTCA 3HJ8A 1G59A 5EP4A 5FTKA 2D7GA 3HU2A 4I4LA 5IZ7D 4P16A 3W0LB 4I5SA 4G4OA 4FCWA 8CATA 4IBEA 1IN5A 1E9RA 4FVMA 4KLNA 2Q2EB 1N75A 4GIPA 3ZH9B 3I4VA 3KOXE 1HQCA 4B3MM 1E94E 4MM3B 1IXZA 1QAOA 2DZNB 3GLHA 2R4JA 4NXMM 2UXDM 2R62A 3VK8A 3NWLA 2D7EA 2LNHC 4PD2A 1Q3BA 3VKGA 3K8ZA 4D81A 1J7KA 5F3WA 4RF1A 1J09A 2DZOB 5EP3A 1UM8A 1J5EM 2P5TA 3SATA 4X64M 3PNVA 4GITA 2DVWB 3QWLA 4QOSA 2V6ZM 3PVSA 1Z5CA 2YQZA 2RGHA 3HKPA 5KPZA 3B9PA 1QAMA 4R7GA 1IN7A 5FTLA 1NHGC 3PFIA 1Q3CA 4JI4M 4ZPXA 2C99A 4OU7A 5E26A 3GRRA 5ITXA 4FWHA 3IG5A 3GPPA 4MH0E 3T15A 3C58A 3K92A 4AKHA 2EO2A 2CV1A 4IBBA 4II7A 1DGHA 3EIHA 4MGIE 3M6AA 4MB7A 4R3DA 4OX9M 2DWNA 1IN8A 3BOSA 3CF6E 2FNAA 2EA0A 3GLHB 3UJNA 3KVWA 1DO2A 2AHMA 1E32A 3A46A 1IQPA 1Z6TA 3W0FA 2I7NA 3I4YA 4MGHA 5C1BA 1W5SA 4LJ6A 1SXJE 4DV1M 3FUUA 4JYAM 4M0WA 4FWDA 4B3SM 2QZ4A 2ZBKB 4RNAA 4K0KM 2UUCM 3K2LA 4IBFA 3GLFA 3AJIB 3HJQA 4AZFA 5FSWA 5EXXA 3JAMS 4XGIA 4LRTA 3U5ZA 2V1CA 3LVVA 1R2ZA 1NY5A 4BBAA 5BR8M 2L09A 3J2PB 1TDHA 3GQ5A 3FYDA 4ITQA 4LCBA 3AKZA 1XC8A 4IBKA 1GL7A 4MGYE 5LMNM 1DGHB 3AOGA 3GRUA 1NJGA 3GPYA 4LZJA 1G8PA 3HHXA 2YFQA 1I94M 4AI6A 1N78A 4JI1M 2UXBM 3SMPA 3KP1E 4AW4A 2KA6B 3J7AS 7CATA 1TH3A 2UUAM 2KXEA 4B3RM 4GMQA 5IWAM 5LMUM 2CV2A 2BNKA 2XLJA 3FUWA 1PJIA 2VIIA 3TWLA 2Z3XA 4CISA 3KOZE 3DOAA 2O5RA 3A45A 4LFBM 2Z4SA 3SHFA 1DGGA 4WURA 3KXEC 4YHHM 4LJAA 3GLFB 4LJ5A 4LGMA 4B3TM 4IBGA 4QOZC 2Z4RA 4NXNM 3SAVA 3U5ZB 2W82A 1SXJA 2CHVA 3FTFA 2FE8A 1WXQA 2XSZA 4DR6M 1QANA 1JR3D 1DGBA 5KPRA 1IBKM 1L8QA 3FUVA 4NRWA 4I8OA 2Z7JA 2XGNA 2RGOA 4DR5M 3RE8A 3HU3A 3FYCA 5JI3E 1MX0A 4GC5A 1N33M 2FFJA 1Q39A 4I81A 1NSFA 4FCVA 1YSYA 1K3XA 5DYIA 2CV0A 5EJCA 2CEAA 1R6BX 2KW0A 3GRYA 4NSOB 4KODA 1MU5A 4X62M 1HNWM 4REZA 3SFZA 1EE8A 3SAWA 1OJLA 4JI3M 4LJ4A 3L2AA 3HJSA 3LQQA 3D8LA 2UU9M 3U6MA 2RKOA 1L2BA 4L8RC 4OVZB 4LF8M 1R2YA 3L29A 3JR5A 2V1UA 2C9OA 5EXPA 1K3WA 3GLGA 3FKEA 3JR4A 1IN6A 3UZUA 3VLFB 4W5WA 4NRVA 2KEBA 2R4EA 1ORYB 1IY0A 4DR2M 3SHGB 4LGYA 4M9SA 3U6SA 3GQ3A 1T3TA 4PDIA 1G41A 2QENA 4Z6YA 3U61B 2X8AA 1SXJB 1TH4A 2NQ8C 2XEPA 1L1TA 4B7FA 3TE6A 1HQYE 2UUBM 4QHSA 2L7IA 1TGUA 3QAUA 3HHWA 3AOEA 4RF0A 4PCZA 3J27B 1KFVA 2XH9A 1NHWC 4DV2M 3RGPA 4D82A 2R18A 1JQJC 2X49A 1QQWA 4JN6A 4LFCM 2A5YB 5E6JA 1QZMA 1X37A 1GLNA 3J80S 2Y0TA 4GC9A 1FNNA 2OPFA 1N34M 4OW0A 3TWKA 5FTNA 3GLGB 4CGYB 3A42A 2F5SA 2XZFA 3L26A 2LXEA 5ITYA 1TH2A 3LMMA 3U6CA 1GL6A 1NVMA 1XWIA 3FUTA 3KP0E 1GVNA 3SYKA 1GKIA 3CF2A 3VFDA 4JI8M 2L7HA 4LF4M 3ZCBB 4S12A 5ITQA 3OTOM 4NOOB 1E9SA 4IBDA 4GKKM 1QAQA 4FW9A 1HNZM 5C18A 4HLQA 4B7HA 4GH9A 2QP9X 4GHLA 3KDSE 3SASA 2ZAMA 5EXTA 1OFHA 3KFUG 4L78A 4FCTA 4GRIA 4M0DA 3FUXA 1I4WA 1OFIA 4LJ8A 1TDZA 3U6DA 1XXHA 1ZQ9A 4MGKE 5FTMA 2ZM6M 2EUCA 4JI2M 3THGA 1HR0M 3GLIA 4KHPM 2R45A 3K1JA 3KSXA 2C9CA 3AFHA 3SARA 4LZZA 4OVZA 4A3VB 5JI2E 2VQEM 3PXGA 5BPVA 4DR3M 2F5PA 2DWLA 3GPUA 2XFTA 4B7GA 2X4AA 2KRKA 4JI5M 3M7GA 3J7BA 2M60A 4JI0M 4X65M 1XNRM 2J7OA 4LY6A 4DR7M 2K47A 3CTWB 3HWSA 2CHGA 3KS4A 4AG6A 3AV0A 4LFAM 4WW0A 5KQDA 2QPAA 2R46A 3VK7A 3R8FA 3HHYA 3R9XB 4GKJM 3U61A 1NY6A 3CF0A 1K82A 3GP1A 5ITXE 2BJWA 1ZAEA 4M9ZA 1IM2A 3M0EA 4IJFA 2JA2A 2VQFM 5EQTA 1L2DA 1Z59A 1HT1E 1IXRC 3RFWA 2LH0A 4GHAA 2Y20A 5A2QS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 M;  3U6S A;  4DV4 M;  3GQ3 A;  4DUZ M;  4PDI A;  4DV1 M;  1XMQ M;  3T1H M;  3U6O A;  4JYA M;  3U6P A;  4B3S M;  2ZBK B;  1L1T A;  4DV6 M;  4K0K M;  3TWM A;  4JI7 M;  2F5Q A;  2UUC M;  2UUB M;  4YY3 M;  1IBL M;  4DV0 M;  2F5N A;  2HHH M;  4PCZ A;  3JAM S;  1KFV A;  2F5O A;  4DV2 M;  3SBJ A;  2XZU A;  4G4N A;  4DV5 M;  4DR1 M;  1R2Z A;  5BR8 M;  1N32 M;  1TDH A;  3GQ5 A;  5IT9 S;  4LF6 M;  4LFC M;  1FJG M;  4ITQ A;  1PM5 A;  1PJJ A;  1XNQ M;  3GQ4 A;  1XC8 A;  2UXC M;  3J80 S;  5LMN M;  2OQ4 A;  2HKJ A;  4G4Q A;  3GPY A;  2OPF A;  1N34 M;  3U6L A;  1I94 M;  5ITU A;  3TWK A;  4JI1 M;  2UXB M;  4G4O A;  1Z5B A;  3A42 A;  2F5S A;  4JI6 M;  1NNJ A;  4DUY M;  2XZF A;  5ITY A;  3J7A S;  2Q2E B;  5ITR A;  2UUA M;  3U6C A;  4B3R M;  5IWA M;  5LMU M;  3U6Q A;  1IBM M;  4JI8 M;  4B3M M;  4LF4 M;  1PJI A;  3TWL A;  3T1Y M;  4CIS A;  5ITQ A;  3OTO M;  1HNX M;  4GKK M;  1HNZ M;  3DOA A;  4NXM M;  2UXD M;  3A45 A;  1N36 M;  3VK8 A;  4LFB M;  4DV7 M;  4YHH M;  5ITT A;  3SAU A;  3SAS A;  3GPX A;  4PD2 A;  3GO8 A;  1Q3B A;  4X66 M;  4LF7 M;  4B3T M;  4LF9 M;  4NXN M;  3SAV A;  1TDZ A;  3U6D A;  1J5E M;  4LF5 M;  3SAT A;  4X64 M;  2ZM6 M;  4JI2 M;  4DV3 M;  4DR6 M;  1IBK M;  1HR0 M;  1Z5C A;  4KHP M;  4NRW A;  4DR5 M;  3SAR A;  2F4V M;  1MX0 A;  1N33 M;  1Q3C A;  3U6E A;  1L2C A;  4JI4 M;  1Q39 A;  2VQE M;  5FLX S;  1K3X A;  4DR3 M;  1L1Z A;  2F5P A;  4DR4 M;  3GPU A;  5ITX A;  4JI5 M;  1MU5 A;  4JI0 M;  4X62 M;  4X65 M;  3GPP A;  1HNW M;  3J81 S;  1XNR M;  3C58 A;  1EE8 A;  4G4R A;  4DR7 M;  3SAW A;  4JI3 M;  1XMO M;  4LFA M;  3VK7 A;  4GKJ M;  2UU9 M;  3U6M A;  1L2B A;  4MB7 A;  2E5L M;  4LF8 M;  4OX9 M;  4PDG A;  3GP1 A;  5ITX E;  1R2Y A;  1K82 A;  3JR5 A;  4AQY M;  4JV5 M;  2VQF M;  2EA0 A;  1K3W A;  1Z59 A;  1Z5A A;  1L2D A;  3JR4 A;  3A46 A;  3W0F A;  4NRV A;  5A2Q S; 
#chains in the Genus database with same CATH topology
 1V92 A;  4MGZ E;  3U60 A;  1XB2 B;  1OKS A;  5IRE B;  3TL4 X;  1KYI A;  3PNY A;  3L27 A;  4DUZ M;  3L25 A;  3U6O A;  2J7N A;  3T38 A;  2HWJ A;  4TUW A;  1XXH B;  2YR0 A;  3A98 B;  3E4R A;  2KRU A;  1JR3 A;  4QNR A;  2L6O A;  1PJS A;  4DV6 M;  4FWG A;  4JI7 M;  5L8R F;  1TR8 A;  4FD2 A;  2F5Q A;  2M5Z A;  3GLI B;  3LQR A;  2ZAO A;  2DXI A;  5EXS A;  2K9D A;  4AG5 A;  4YY3 M;  4DV0 M;  2ZTD A;  2HHH M;  1EIJ A;  1QYR A;  2DWZ B;  3WHK A;  1OIZ A;  3MJ5 A;  2C98 A;  3MK6 A;  2F5O A;  4G6Z A;  3VKH A;  3SBJ A;  4LJ9 A;  3TPZ A;  4G4N A;  4DV5 M;  2CFO A;  1IN4 A;  3AOE C;  2H5X A;  3GLF E;  3Q8X A;  4LF6 M;  1YE9 A;  2YNM D;  3HU1 A;  2D7H A;  4NL4 H;  1PM5 A;  1LV7 A;  2N35 A;  4CHT B;  4BB9 A;  2OQ4 A;  3H4J A;  2HKJ A;  3D8B A;  3H4M A;  4L4U A;  4QHT A;  2CHQ A;  4EIW A;  3U6L A;  3K9O A;  3SC3 A;  5ITU A;  2QNJ A;  4D80 A;  4XBO A;  2JWS A;  5KPT A;  2DHR A;  5DNY A;  4P17 A;  1Z5B A;  4ANR A;  4JI6 M;  1NNJ A;  4DUY M;  5DYG A;  2R44 A;  2R65 A;  2H1R A;  5ITR A;  3SMS A;  4LRS A;  2L2D A;  3U6Q A;  2R0I A;  3U60 B;  3SYL A;  1H6U A;  4IBC A;  4LG2 A;  1IBM M;  2JZ1 A;  3T1Y M;  2DAI A;  1EFU B;  3BXW A;  3DA1 A;  4QNM A;  1HNX M;  3HGI A;  1XHB A;  1Y8G A;  1N36 M;  2KZS A;  4DV7 M;  1TF0 B;  1VDD A;  3GRV A;  5ITT A;  3SAU A;  3K9P A;  3GPX A;  4IJE A;  3GO8 A;  3VDU A;  2Y21 A;  4X66 M;  4LF7 M;  3KOW E;  4LF9 M;  4PT5 A;  2I7P A;  2C5R A;  5KQ8 A;  5KO3 A;  4LF5 M;  1MN3 A;  4IBJ A;  2G5G X;  4DV3 M;  1KSF X;  1IY2 A;  2GNO A;  4IBI A;  4JXJ A;  1IXS A;  5FTJ A;  1R5L A;  4AKG A;  3KSJ A;  4B08 A;  3L28 A;  2F4V M;  4M9X A;  4Z8X A;  3C3D A;  3U6E A;  1NJF A;  1L2C A;  3AL0 C;  5FLX S;  1L1Z A;  2LWX A;  3UMM A;  4DR4 M;  4L16 A;  3IG8 A;  3FTD A;  3WHL A;  1G4A E;  2ZAN A;  1WIV A;  3J81 S;  4NSR A;  1WR1 B;  1T6O A;  4G4R A;  2QBY A;  2KZU A;  1WHC A;  1XMO M;  3HHZ A;  3I51 A;  3ILK A;  2FOI C;  2E5L M;  1IY1 A;  1D2N A;  1S3S A;  2CWB A;  2KDL A;  3GLH E;  3QYE A;  4PDG A;  1VG5 A;  2CUZ A;  4AQY M;  2Y0Q A;  4JV5 M;  1Z5A A;  1W5T A;  2JY5 A;  3FE3 A;  3UK6 A;  2G8L A;  4R71 A;  3UGJ A;  1SXJ C;  5EP1 A;  2JZ0 A;  2QCU A;  2HCB A;  4BLC A;  1C1K A;  2DAE A;  4IIW A;  3RGS A;  1AIP C;  2BJV A;  3FRH A;  3VDP A;  4DV4 M;  2CE7 A;  3E9S A;  3DFZ A;  3FTE A;  1XMQ M;  2DEN A;  2QSF X;  3T1H M;  3NBI A;  3U6P A;  3GLG E;  3LVW A;  1N77 A;  1QVR A;  1G3I A;  1R4G A;  2DWM A;  5H37 D;  1HT2 E;  3TWM A;  1NNU C;  1IXS B;  2XF3 A;  1IBL M;  2F5N A;  2WZJ A;  3KW6 A;  5EP2 A;  3DZD A;  1DGF A;  1YUB A;  1YLA A;  2B3T A;  2KNZ A;  4L15 A;  4KO8 A;  2DI0 A;  4DBG B;  2APL A;  2JUJ A;  2XZU A;  3FD9 A;  3EIE A;  2HL7 A;  4DR1 M;  4NC6 A;  1N32 M;  1SXJ D;  1R7R A;  5GKN A;  2XFS A;  1DO0 A;  5IT9 S;  1NO1 A;  2XSZ D;  1FJG M;  1PJJ A;  2QBY B;  1AUA A;  3KOY E;  1XNQ M;  3GQ4 A;  3ZC7 B;  2UXC M;  2ERC A;  3KS8 A;  4HL4 A;  4LJ7 A;  4AKI A;  3MHV C;  1WGL A;  2C96 A;  3QYB A;  4G4Q A;  3TQS A;  3FTC A;  3HJ8 A;  1G59 A;  5EP4 A;  5FTK A;  2D7G A;  3HU2 A;  4I4L A;  5IZ7 D;  4P16 A;  3W0L B;  4I5S A;  1GO5 A;  4G4O A;  4FCW A;  4CIZ A;  3IEC A;  8CAT A;  4IBE A;  1IN5 A;  1E9R A;  4FVM A;  4KLN A;  2Q2E B;  1N75 A;  4Y28 F;  2LTU A;  4GIP A;  1PJQ A;  3ZH9 B;  2KNV A;  3I4V A;  3KOX E;  1OTR A;  1HQC A;  4B3M M;  1D0M A;  1E94 E;  2BWB A;  4MM3 B;  1IXZ A;  1QAO A;  2DZN B;  3GLH A;  2LVO C;  1ZMW A;  2R4J A;  4NXM M;  2UXD M;  2VF8 A;  2R62 A;  3VK8 A;  2DNA A;  3NWL A;  1QZE A;  2D7E A;  2LVQ D;  2LNH C;  4PD2 A;  1Q3B A;  3VKG A;  3K8Z A;  4D81 A;  1J7K A;  5F3W A;  3F92 A;  4RF1 A;  1J09 A;  2DZO B;  5EP3 A;  1UM8 A;  2MR9 A;  2P5T A;  1J5E M;  3SAT A;  4X64 M;  1IFY A;  2EJS A;  3PNV A;  4GIT A;  2DVW B;  2L4E A;  3QWL A;  2V6Z M;  3PVS A;  4QOS A;  2LHG A;  1Z5C A;  3W67 A;  2MRO B;  2YQZ A;  2RGH A;  3HKP A;  5KPZ A;  1WGN A;  3B9P A;  3V76 A;  1QAM A;  4R7G A;  4F1I A;  1OIP A;  1IN7 A;  5FTL A;  1NHG C;  3PFI A;  1Q3C A;  4JI4 M;  4ZPX A;  2QHO B;  2C99 A;  4OU7 A;  5E26 A;  3GRR A;  4XK8 F;  5ITX A;  4FWH A;  3IG5 A;  3GPP A;  3GLI E;  4MH0 E;  3T15 A;  1C7Y A;  3C58 A;  3K92 A;  2QQ8 A;  4AKH A;  1DV0 A;  2EO2 A;  2CV1 A;  2MJ5 B;  1V33 A;  1JB0 F;  2CRU A;  2JY6 B;  4IBB A;  2OO9 A;  2OOA A;  1DGH A;  2VDB B;  4II7 A;  3EIH A;  4MGI E;  3M6A A;  4MB7 A;  4R3D A;  4OX9 M;  4CJ6 A;  2DWN A;  1IN8 A;  3B7N A;  3C3E A;  3BOS A;  3CF6 E;  3Q8G A;  5DFL A;  2FNA A;  2EA0 A;  3GLH B;  3UJN A;  2DAM A;  1DO2 A;  3KVW A;  2AHM A;  1E32 A;  3A46 A;  1IQP A;  1Z6T A;  3W0F A;  2I7N A;  2ZTC A;  2CP8 A;  3C9P A;  3I4Y A;  4MGH A;  5C1B A;  1A5T A;  1W5S A;  4LJ6 A;  2LBC A;  1SXJ E;  1QDT A;  4DV1 M;  3FUU A;  3LCV B;  4JYA M;  4M0W A;  4FWD A;  4B3S M;  2QZ4 A;  1LTM A;  1QUS A;  2ZBK B;  4RNA A;  4K0K M;  2DKL A;  2UUC M;  3K2L A;  4IBF A;  3GLF A;  1NV9 A;  3AJI B;  3HJQ A;  4AZF A;  5FSW A;  5EXX A;  3JAM S;  4XGI A;  4LRT A;  3U5Z A;  2V1C A;  3LVV A;  1R2Z A;  1NY5 A;  4BBA A;  5BR8 M;  2L09 A;  3J2P B;  1TDH A;  3GQ5 A;  3FYD A;  4ITQ A;  1OQY A;  4LCB A;  3AKZ A;  4IBK A;  1GL7 A;  4MGY E;  3IHP A;  1XC8 A;  1ZMV A;  5LMN M;  2JNH A;  1DGH B;  3AOG A;  3GRU A;  1TTE A;  1NJG A;  3GPY A;  1VEK A;  1G8P A;  4LZJ A;  3HHX A;  2YFQ A;  1I94 M;  4AI6 A;  1N78 A;  3LCU A;  4JI1 M;  2UXB M;  4KT0 F;  3KP1 E;  3SMP A;  1UFZ A;  4AW4 A;  2KA6 B;  3J7A S;  7CAT A;  1TH3 A;  3HZJ A;  2KXE A;  3HY5 A;  3B74 A;  2UUA M;  1VQ1 A;  4B3R M;  4GMQ A;  5IWA M;  5LMU M;  2CV2 A;  2BNK A;  1V34 A;  2XLJ A;  3FUW A;  1PJI A;  2DAG A;  2VII A;  3T6P A;  3TWL A;  4F2L A;  2Z3X A;  4CIS A;  3KOZ E;  3DOA A;  2O5R A;  3A45 A;  4LFB M;  1ZV1 A;  2Z4S A;  3SHF A;  1DGG A;  4WUR A;  3KXE C;  4YHH M;  4LJA A;  3GLF B;  4LJ5 A;  1RU3 A;  4LGM A;  2K0B X;  4B3T M;  3CGW A;  3B89 A;  4IBG A;  2JXN A;  4QOZ C;  2Z4R A;  4NXN M;  1CUK A;  3SAV A;  3U5Z B;  2FS1 A;  2W82 A;  1SXJ A;  3W68 A;  2CHV A;  3FTF A;  2FE8 A;  1WXQ A;  3MMP A;  4RKU F;  2MGW A;  2XSZ A;  4L6V 6;  1BVS A;  1QAN A;  1JR3 D;  1DGB A;  3ZQJ A;  5KPR A;  1IBK M;  1L8Q A;  4DR6 M;  3FUV A;  4NRW A;  2LHC A;  4I8O A;  1WJ7 A;  2Z7J A;  1PGY A;  1QUT A;  2RGO A;  2XGN A;  3RE8 A;  4DR5 M;  3HU3 A;  1T43 A;  3FYC A;  5JI3 E;  1MX0 A;  4GC5 A;  1N33 M;  2FFJ A;  1Q39 A;  1Q02 A;  4I81 A;  1NSF A;  4FCV A;  1YSY A;  1K3X A;  4Q7J A;  5DYI A;  2CV0 A;  5EJC A;  2CEA A;  1R6B X;  2KW0 A;  3GRY A;  4NSO B;  4KOD A;  1MU5 A;  1G71 A;  4X62 M;  1HNW M;  4REZ A;  3SFZ A;  1EE8 A;  2JP7 A;  3SAW A;  1OJL A;  4JI3 M;  4LJ4 A;  3L2A A;  3HJS A;  3LQQ A;  3D8L A;  2UU9 M;  3U6M A;  2RKO A;  1L2B A;  4L8R C;  4OVZ B;  4LF8 M;  1R2Y A;  3L29 A;  3JR5 A;  2V1U A;  2C9O A;  2WSF F;  1VEG A;  5EXP A;  2GQF A;  1K3W A;  1OAI A;  4G3O A;  3GLG A;  3FKE A;  3JR4 A;  3BBZ A;  1IN6 A;  4GEW A;  3UZU A;  3VLF B;  4W5W A;  4NRV A;  2KEB A;  1OAO C;  2R4E A;  1ORY B;  1IY0 A;  4DR2 M;  3SHG B;  1MJG M;  2EKF A;  1XXH E;  4LGY A;  4M9S A;  3U6S A;  2OOB A;  3GQ3 A;  1T3T A;  4PDI A;  3I01 M;  2FH0 A;  1G41 A;  1GJT A;  2QEN A;  4Z6Y A;  3U61 B;  2X8A A;  1SXJ B;  1TH4 A;  2NQ8 C;  2XEP A;  1L1T A;  4B7F A;  3TE6 A;  1D0L A;  1HQY E;  2UUB M;  3E21 A;  2L7I A;  4QHS A;  1TGU A;  3QAU A;  3HHW A;  3AOE A;  3B7Z A;  4RF0 A;  2WSC F;  1GAB A;  4PCZ A;  2KNA A;  3J27 B;  2XH9 A;  1NHW C;  1QDR A;  4DV2 M;  1KFV A;  3RGP A;  2JY8 A;  2K6B A;  4D82 A;  2R18 A;  1JQJ C;  2O01 F;  2X49 A;  1QQW A;  4JN6 A;  4LFC M;  1P3Q Q;  2A5Y B;  5E6J A;  1QZM A;  3I04 M;  1X37 A;  1GLN A;  3J80 S;  1D0K A;  2Y0T A;  4GC9 A;  1FNN A;  2OPF A;  1N34 M;  2RRU A;  4OW0 A;  2J5Y A;  3TWK A;  1NV8 A;  5FTN A;  3GLG B;  4CGY B;  3A42 A;  2F5S A;  1VEJ A;  3LW5 F;  2O25 A;  3HX3 A;  3L26 A;  2XZF A;  2LXE A;  5ITY A;  1TH2 A;  3LMM A;  2DZL A;  3U6C A;  1GL6 A;  2Z8Y M;  1NVM A;  1XWI A;  2KHH A;  3FUT A;  3KP0 E;  1GVN A;  4UN2 B;  1GKI A;  3CF2 A;  3SYK A;  3VFD A;  1JR3 E;  2L7H A;  4JI8 M;  3ZCB B;  4LF4 M;  4WP2 A;  4S12 A;  2G3Q A;  5ITQ A;  3OTO M;  4NOO B;  1E9S A;  4IBD A;  4GKK M;  1QAQ A;  4FW9 A;  1HNZ M;  5C18 A;  4HLQ A;  4B7H A;  1PRB A;  2JY7 A;  2QP9 X;  4GH9 A;  4GHL A;  3KDS E;  2MH8 A;  3SAS A;  2ZAM A;  5EXT A;  1OFH A;  3KFU G;  4L78 A;  4FCT A;  4GRI A;  2R6F A;  4M0D A;  1HJP A;  2VF7 A;  3FUX A;  1I4W A;  3B7Q A;  1OFI A;  4LJ8 A;  2HAK A;  1TDZ A;  3U6D A;  2LVP C;  1XXH A;  1ZQ9 A;  2DHY A;  4MGK E;  5FTM A;  2ZM6 M;  2EUC A;  4JI2 M;  1VDL A;  3NBX X;  3THG A;  1HR0 M;  3GLI A;  4KHP M;  2R45 A;  3K1J A;  3KSX A;  2C9C A;  3AFH A;  3SAR A;  1GJS A;  4LZZ A;  2EKK A;  4OVZ A;  4A3V B;  5JI2 E;  1SG9 A;  2VQE M;  4HEO A;  3PXG A;  5BPV A;  4DR3 M;  2F5P A;  2DWL A;  3GPU A;  2XFT A;  4B7G A;  2X4A A;  2KRK A;  4JI5 M;  3M7G A;  3J7B A;  2M60 A;  1F4I A;  4JI0 M;  4X65 M;  1XNR M;  2L4F A;  2J7O A;  4LY6 A;  4DR7 M;  2K47 A;  3CTW B;  3HWS A;  2CHG A;  2LVN C;  3KS4 A;  4AG6 A;  3AV0 A;  2BWE A;  4LFA M;  4WW0 A;  5KQD A;  2QPA A;  2R46 A;  3VK7 A;  3R8F A;  3HHY A;  3R9X B;  4GKJ M;  3U61 A;  1PJT A;  1NY6 A;  3CF0 A;  1K82 A;  3GP1 A;  5ITX E;  2BJW A;  3FRI A;  1ZAE A;  4M9Z A;  1IM2 A;  3M0E A;  2DAK A;  1ZMU A;  4IJF A;  2JA2 A;  2VQF M;  5EQT A;  1L2D A;  1Z59 A;  3E46 A;  2LVA A;  1HT1 E;  1IXR C;  3RFW A;  2LH0 A;  4GHA A;  2WSE F;  2Y20 A;  5A2Q S; 
#chains in the Genus database with same CATH homology
 4MGZ E;  3U60 A;  5IRE B;  3TL4 X;  1KYI A;  3PNY A;  3L27 A;  4DUZ M;  3L25 A;  3U6O A;  2J7N A;  3T38 A;  4TUW A;  1XXH B;  2YR0 A;  3A98 B;  3E4R A;  2KRU A;  1JR3 A;  4QNR A;  2L6O A;  4DV6 M;  4FWG A;  4JI7 M;  2F5Q A;  4FD2 A;  2M5Z A;  3GLI B;  3LQR A;  2ZAO A;  2DXI A;  5EXS A;  4YY3 M;  4AG5 A;  4DV0 M;  2HHH M;  1QYR A;  2DWZ B;  3WHK A;  3MJ5 A;  2C98 A;  3MK6 A;  2F5O A;  4G6Z A;  3VKH A;  3SBJ A;  4LJ9 A;  3TPZ A;  4G4N A;  4DV5 M;  2CFO A;  1IN4 A;  3AOE C;  3Q8X A;  4LF6 M;  1YE9 A;  2YNM D;  3HU1 A;  2D7H A;  4NL4 H;  1PM5 A;  1LV7 A;  4CHT B;  4BB9 A;  2OQ4 A;  2HKJ A;  3D8B A;  3H4M A;  4L4U A;  4QHT A;  2CHQ A;  4EIW A;  3U6L A;  3SC3 A;  5ITU A;  4D80 A;  4XBO A;  5KPT A;  2DHR A;  5DNY A;  1Z5B A;  4JI6 M;  1NNJ A;  4DUY M;  5DYG A;  2R65 A;  2H1R A;  5ITR A;  3SMS A;  4LRS A;  3U6Q A;  3U60 B;  3SYL A;  1H6U A;  4IBC A;  4LG2 A;  1IBM M;  3T1Y M;  3DA1 A;  4QNM A;  1HNX M;  3HGI A;  1XHB A;  1N36 M;  2KZS A;  4DV7 M;  1VDD A;  3GRV A;  5ITT A;  3SAU A;  3GPX A;  4IJE A;  3GO8 A;  3VDU A;  2Y21 A;  4X66 M;  4LF7 M;  3KOW E;  4LF9 M;  4PT5 A;  2I7P A;  2C5R A;  5KQ8 A;  5KO3 A;  4LF5 M;  4IBJ A;  2G5G X;  4DV3 M;  1KSF X;  1IY2 A;  4IBI A;  4JXJ A;  5FTJ A;  4AKG A;  3KSJ A;  4B08 A;  3L28 A;  2F4V M;  4M9X A;  4Z8X A;  3U6E A;  1NJF A;  1L2C A;  3AL0 C;  5FLX S;  1L1Z A;  2LWX A;  3UMM A;  4DR4 M;  4L16 A;  3IG8 A;  3FTD A;  3WHL A;  1G4A E;  2ZAN A;  3J81 S;  4NSR A;  4G4R A;  2QBY A;  2KZU A;  1XMO M;  3HHZ A;  3I51 A;  3ILK A;  2FOI C;  2E5L M;  1IY1 A;  1D2N A;  1S3S A;  4PDG A;  2CUZ A;  4AQY M;  2Y0Q A;  4JV5 M;  1Z5A A;  1W5T A;  3UK6 A;  2G8L A;  3UGJ A;  1SXJ C;  5EP1 A;  2QCU A;  2HCB A;  4BLC A;  1C1K A;  4IIW A;  3RGS A;  2BJV A;  3VDP A;  4DV4 M;  2CE7 A;  3E9S A;  3DFZ A;  3FTE A;  1XMQ M;  3T1H M;  3NBI A;  3U6P A;  3LVW A;  1N77 A;  1QVR A;  1G3I A;  2DWM A;  5H37 D;  1HT2 E;  3TWM A;  1NNU C;  1IXS B;  2XF3 A;  1IBL M;  2F5N A;  3KW6 A;  5EP2 A;  3DZD A;  1DGF A;  1YUB A;  4L15 A;  4KO8 A;  2XZU A;  3FD9 A;  3EIE A;  2HL7 A;  4DR1 M;  1N32 M;  1SXJ D;  1R7R A;  5GKN A;  2XFS A;  1DO0 A;  5IT9 S;  2XSZ D;  1FJG M;  1PJJ A;  2QBY B;  3KOY E;  1XNQ M;  3GQ4 A;  3ZC7 B;  2UXC M;  2ERC A;  3KS8 A;  4HL4 A;  4LJ7 A;  4AKI A;  3MHV C;  2C96 A;  4G4Q A;  3TQS A;  3FTC A;  3HJ8 A;  1G59 A;  5EP4 A;  5FTK A;  2D7G A;  3HU2 A;  4I4L A;  5IZ7 D;  4P16 A;  3W0L B;  4I5S A;  4G4O A;  4FCW A;  8CAT A;  4IBE A;  1IN5 A;  1E9R A;  4FVM A;  4KLN A;  2Q2E B;  1N75 A;  4GIP A;  3ZH9 B;  3I4V A;  3KOX E;  1HQC A;  4B3M M;  1E94 E;  4MM3 B;  1IXZ A;  1QAO A;  2DZN B;  3GLH A;  2R4J A;  4NXM M;  2UXD M;  2R62 A;  3VK8 A;  3NWL A;  2D7E A;  2LNH C;  4PD2 A;  1Q3B A;  3VKG A;  3K8Z A;  4D81 A;  1J7K A;  5F3W A;  4RF1 A;  1J09 A;  2DZO B;  5EP3 A;  1UM8 A;  1J5E M;  2P5T A;  3SAT A;  4X64 M;  3PNV A;  4GIT A;  2DVW B;  3QWL A;  4QOS A;  2V6Z M;  3PVS A;  1Z5C A;  2YQZ A;  2RGH A;  3HKP A;  5KPZ A;  3B9P A;  1QAM A;  4R7G A;  1IN7 A;  5FTL A;  1NHG C;  3PFI A;  1Q3C A;  4JI4 M;  4ZPX A;  2C99 A;  4OU7 A;  5E26 A;  3GRR A;  5ITX A;  4FWH A;  3IG5 A;  3GPP A;  4MH0 E;  3T15 A;  3C58 A;  3K92 A;  4AKH A;  2EO2 A;  2CV1 A;  4IBB A;  4II7 A;  1DGH A;  3EIH A;  4MGI E;  3M6A A;  4MB7 A;  4R3D A;  4OX9 M;  2DWN A;  1IN8 A;  3BOS A;  3CF6 E;  2FNA A;  2EA0 A;  3GLH B;  3UJN A;  3KVW A;  1DO2 A;  2AHM A;  1E32 A;  3A46 A;  1IQP A;  1Z6T A;  3W0F A;  2I7N A;  3I4Y A;  4MGH A;  5C1B A;  1W5S A;  4LJ6 A;  1SXJ E;  4DV1 M;  3FUU A;  4JYA M;  4M0W A;  4FWD A;  4B3S M;  2QZ4 A;  2ZBK B;  4RNA A;  4K0K M;  2UUC M;  3K2L A;  4IBF A;  3GLF A;  3AJI B;  3HJQ A;  4AZF A;  5FSW A;  5EXX A;  3JAM S;  4XGI A;  4LRT A;  3U5Z A;  2V1C A;  3LVV A;  1R2Z A;  1NY5 A;  4BBA A;  5BR8 M;  2L09 A;  3J2P B;  1TDH A;  3GQ5 A;  3FYD A;  4ITQ A;  4LCB A;  3AKZ A;  1XC8 A;  4IBK A;  1GL7 A;  4MGY E;  5LMN M;  1DGH B;  3AOG A;  3GRU A;  1NJG A;  3GPY A;  4LZJ A;  1G8P A;  3HHX A;  2YFQ A;  1I94 M;  4AI6 A;  1N78 A;  4JI1 M;  2UXB M;  3SMP A;  3KP1 E;  4AW4 A;  2KA6 B;  3J7A S;  7CAT A;  1TH3 A;  2UUA M;  2KXE A;  4B3R M;  4GMQ A;  5IWA M;  5LMU M;  2CV2 A;  2BNK A;  2XLJ A;  3FUW A;  1PJI A;  2VII A;  3TWL A;  2Z3X A;  4CIS A;  3KOZ E;  3DOA A;  2O5R A;  3A45 A;  4LFB M;  2Z4S A;  3SHF A;  1DGG A;  4WUR A;  3KXE C;  4YHH M;  4LJA A;  3GLF B;  4LJ5 A;  4LGM A;  4B3T M;  4IBG A;  4QOZ C;  2Z4R A;  4NXN M;  3SAV A;  3U5Z B;  2W82 A;  1SXJ A;  2CHV A;  3FTF A;  2FE8 A;  1WXQ A;  2XSZ A;  4DR6 M;  1QAN A;  1JR3 D;  1DGB A;  5KPR A;  1IBK M;  1L8Q A;  3FUV A;  4NRW A;  4I8O A;  2Z7J A;  2XGN A;  2RGO A;  4DR5 M;  3RE8 A;  3HU3 A;  3FYC A;  5JI3 E;  1MX0 A;  4GC5 A;  1N33 M;  2FFJ A;  1Q39 A;  4I81 A;  1NSF A;  4FCV A;  1YSY A;  1K3X A;  5DYI A;  2CV0 A;  5EJC A;  2CEA A;  1R6B X;  2KW0 A;  3GRY A;  4NSO B;  4KOD A;  1MU5 A;  4X62 M;  1HNW M;  4REZ A;  3SFZ A;  1EE8 A;  3SAW A;  1OJL A;  4JI3 M;  4LJ4 A;  3L2A A;  3HJS A;  3LQQ A;  3D8L A;  2UU9 M;  3U6M A;  2RKO A;  1L2B A;  4L8R C;  4OVZ B;  4LF8 M;  1R2Y A;  3L29 A;  3JR5 A;  2V1U A;  2C9O A;  5EXP A;  1K3W A;  3GLG A;  3FKE A;  3JR4 A;  1IN6 A;  3UZU A;  3VLF B;  4W5W A;  4NRV A;  2KEB A;  2R4E A;  1ORY B;  1IY0 A;  4DR2 M;  3SHG B;  4LGY A;  4M9S A;  3U6S A;  3GQ3 A;  1T3T A;  4PDI A;  1G41 A;  2QEN A;  4Z6Y A;  3U61 B;  2X8A A;  1SXJ B;  1TH4 A;  2NQ8 C;  2XEP A;  1L1T A;  4B7F A;  3TE6 A;  1HQY E;  2UUB M;  4QHS A;  2L7I A;  1TGU A;  3QAU A;  3HHW A;  3AOE A;  4RF0 A;  4PCZ A;  3J27 B;  1KFV A;  2XH9 A;  1NHW C;  4DV2 M;  3RGP A;  4D82 A;  2R18 A;  1JQJ C;  2X49 A;  1QQW A;  4JN6 A;  4LFC M;  2A5Y B;  5E6J A;  1QZM A;  1X37 A;  1GLN A;  3J80 S;  2Y0T A;  4GC9 A;  1FNN A;  2OPF A;  1N34 M;  4OW0 A;  3TWK A;  5FTN A;  3GLG B;  4CGY B;  3A42 A;  2F5S A;  2XZF A;  3L26 A;  2LXE A;  5ITY A;  1TH2 A;  3LMM A;  3U6C A;  1GL6 A;  1NVM A;  1XWI A;  3FUT A;  3KP0 E;  1GVN A;  3SYK A;  1GKI A;  3CF2 A;  3VFD A;  4JI8 M;  2L7H A;  4LF4 M;  3ZCB B;  4S12 A;  5ITQ A;  3OTO M;  4NOO B;  1E9S A;  4IBD A;  4GKK M;  1QAQ A;  4FW9 A;  1HNZ M;  5C18 A;  4HLQ A;  4B7H A;  4GH9 A;  2QP9 X;  4GHL A;  3KDS E;  3SAS A;  2ZAM A;  5EXT A;  1OFH A;  3KFU G;  4L78 A;  4FCT A;  4GRI A;  4M0D A;  3FUX A;  1I4W A;  1OFI A;  4LJ8 A;  1TDZ A;  3U6D A;  1XXH A;  1ZQ9 A;  4MGK E;  5FTM A;  2ZM6 M;  2EUC A;  4JI2 M;  3THG A;  1HR0 M;  3GLI A;  4KHP M;  2R45 A;  3K1J A;  3KSX A;  2C9C A;  3AFH A;  3SAR A;  4LZZ A;  4OVZ A;  4A3V B;  5JI2 E;  2VQE M;  3PXG A;  5BPV A;  4DR3 M;  2F5P A;  2DWL A;  3GPU A;  2XFT A;  4B7G A;  2X4A A;  2KRK A;  4JI5 M;  3M7G A;  3J7B A;  2M60 A;  4JI0 M;  4X65 M;  1XNR M;  2J7O A;  4LY6 A;  4DR7 M;  2K47 A;  3CTW B;  3HWS A;  2CHG A;  3KS4 A;  4AG6 A;  3AV0 A;  4LFA M;  4WW0 A;  5KQD A;  2QPA A;  2R46 A;  3VK7 A;  3R8F A;  3HHY A;  3R9X B;  4GKJ M;  3U61 A;  1NY6 A;  3CF0 A;  1K82 A;  3GP1 A;  5ITX E;  2BJW A;  1ZAE A;  4M9Z A;  1IM2 A;  3M0E A;  4IJF A;  2JA2 A;  2VQF M;  5EQT A;  1L2D A;  1Z59 A;  1HT1 E;  1IXR C;  3RFW A;  2LH0 A;  4GHA A;  2Y20 A;  5A2Q S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...