1HNZM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hnzM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hnzM02
4JI0M 1HNZM 1MU5A 1N34M 2F4VM 4JV5M 1KFVA 3SAWA 2EA0A 3U6SA 4DR1M 3U6CA 4G4QA 3DOAA 1PJJA 4NRVA 4NXMM 1Q39A 4X65M 4DR7M 2ZBKB 1TDHA 1I94M 4X62M 1N36M 4DUZM 3SAVA 1TDZA 5IWAM 3U6EA 1FJGM 4DR5M 3VK8A 2F5PA 2UUAM 1J5EM 4JI8M 3JAMS 4DR3M 1K82A 3GPPA 1L1ZA 4JI4M 1EE8A 4YY3M 3SATA 4JI6M 4DV0M 4NRWA 3TWKA 2VQEM 4DV7M 3GQ5A 3T1YM 3SARA 1NNJA 2OQ4A 2VQFM 3J7AS 5ITYA 3T1HM 5A2QS 1L2DA 2F5SA 4LF7M 4G4RA 2UXBM 3A42A 3OTOM 3J80S 1IBMM 4LF5M 3SASA 2XZUA 1XMOM 3TWLA 4G4OA 4GKJM 2OPFA 4B3TM 5ITTA 3GQ3A 4AQYM 4YHHM 4B3RM 4KHPM 1Z5AA 4G4NA 4MB7A 5LMNM 4GKKM 4JYAM 3GQ4A 2F5NA 4LF4M 1K3XA 2UXDM 1IBLM 4DV6M 3VK7A 4JI5M 2UUCM 5ITRA 1HNXM 4PDIA 5FLXS 2Q2EB 2ZM6M 1XNRM 4LF9M 4X64M 4ITQA 3GO8A 3U6DA 5ITXE 2F5OA 3GPYA 2F5QA 4DR6M 3GPUA 4PD2A 4LF6M 2E5LM 1Z5BA 1R2ZA 3SBJA 2HKJA 1N33M 1Q3CA 4DV3M 4B3SM 5IT9S 4X66M 2UUBM 4NXNM 3U6OA 1L2BA 1PJIA 1HNWM 3J81S 1L2CA 4JI2M 4CISA 4LFCM 3JR5A 4LFAM 4DUYM 1XNQM 1Q3BA 1XMQM 4DR2M 1Z5CA 3A45A 3GP1A 3A46A 3GPXA 1L1TA 1HR0M 1Z59A 4OX9M 3TWMA 3SAUA 4PDGA 2HHHM 2XZFA 3C58A 1XC8A 4LF8M 1R2YA 2UXCM 3JR4A 1MX0A 3W0FA 5ITXA 4DV4M 4JI3M 3U6MA 3U6PA 2UU9M 3U6LA 4DR4M 1K3WA 4PCZA 5ITUA 5BR8M 5LMUM 1IBKM 4JI7M 4JI1M 4K0KM 5ITQA 4B3MM 4LFBM 4DV5M 4DV2M 3U6QA 1PM5A 1N32M 4DV1M
chains in the Genus database with same CATH superfamily
1IN7A 4OVZA 3IECA 4WP2A 2QP9X 3TE6A 2EA0A 3U6SA 2KHHA 3ZC7B 3WHKA 3DOAA 3FTCA 2DAKA 3I04M 1N75A 2EUCA 4RNAA 3FUTA 1GVNA 1XXHB 2CWBA 4DR7M 1GL7A 4OW0A 4XGIA 2XSZD 4FCWA 4JN6A 4MM3B 5H37D 4FCVA 2CFOA 2LVQD 4AG6A 2JY8A 2F5PA 2GQFA 1J5EM 2OOBA 3SMSA 2QPAA 4M9XA 4CHTB 1QQWA 2LVPC 3KSXA 5EXSA 3I01M 3V76A 1NO1A 3BOSA 1NJGA 4L4UA 3GRVA 4NSOB 1NHWC 3PNYA 4Y28F 2DWNA 3U60A 3SARA 1IN5A 2QNJA 1IXSA 2L7HA 5L8RF 2VQFM 2KEBA 3T1HM 1VDLA 5EXTA 3HX3A 1HJPA 3KW6A 1IFYA 4D82A 3AFHA 1OJLA 4LF7M 3DZDA 2LH0A 3KOXE 1PJTA 5FTLA 3MK6A 2RKOA 1W5TA 3RGPA 2UXBM 3L27A 3J80S 4CGYB 1VEJA 2CEAA 2KZUA 2XSZA 3SASA 1UFZA 2LVNC 1DO0A 1A5TA 2CHGA 3E4RA 1XMOM 1TH2A 4F1IA 4G4OA 3FUVA 2B3TA 4LJ8A 5E6JA 3KOYE 5ITTA 1DGHB 3W67A 1JB0F 1ZMUA 2LXEA 4D80A 3LQRA 3UGJA 4AQYM 3PFIA 4G4NA 1MJGM 2WSFF 3VDPA 5LMNM 1NSFA 4GKKM 4JYAM 4HLQA 1YUBA 3U60B 1IBLM 2H1RA 1OTRA 1IXSB 1XHBA 4RKUF 2X49A 4GC5A 2DXIA 1G71A 2VF8A 4NOOB 4JI5M 2L4EA 3I51A 5FLXS 2CRUA 3NBXX 3HWSA 2MR9A 4X64M 1FNNA 3ILKA 4L15A 4EIWA 2JY5A 4M0DA 1Z6TA 3GO8A 2DAEA 3THGA 3J27B 3GPUA 2E5LM 1TH4A 1NV8A 1Z5BA 3K2LA 1EIJA 1QUSA 3HHZA 2CUZA 2HKJA 1N33M 3DA1A 4FCTA 3T6PA 4DV3M 3NWLA 2XLJA 4NXNM 5E26A 1L2BA 3HU3A 3J81S 2KNVA 3UJNA 2L4FA 4LFCM 4DUYM 4LFAM 4II7A 3H4JA 3M0EA 4FVMA 1NV9A 1EFUB 4P16A 4QNMA 1HQCA 3Q8XA 1XMQM 1SG9A 3LMMA 2Y0QA 2XEPA 1R6BX 1GJTA 1HT1E 4B7FA 3GLFB 2JNHA 2VIIA 1QAMA 2R6FA 5EP4A 3KFUG 2R46A 2M60A 4GHLA 2DWZB 2DAGA 1Z59A 3GLHA 5JI2E 3C58A 4QNRA 2R4JA 2EKKA 3SHFA 1MX0A 3BBZA 2K9DA 2EKFA 4XK8F 1NY6A 2FNAA 3TQSA 2HL7A 3EIEA 2J5YA 2Z4SA 1WXQA 3FRHA 4LJAA 4MH0E 1AIPC 3MJ5A 4JI3M 3KXEC 1QAOA 5LMUM 1HT2E 2JUJA 2VDBB 4JI1M 1JR3E 4L16A 4B3MM 1N77A 1SXJB 3U6QA 3RE8A 3NBIA 5DNYA 2AHMA 3KOWE 2O5RA 4BBAA 4DV1M 4LJ9A 2R44A 1VDDA 1HNZM 4LRSA 2RGHA 3KS4A 1N34M 3R8FA 2BNKA 1DGBA 2J7NA 5GKNA 2C5RA 1KFVA 1E9SA 1VG5A 7CATA 3U6CA 4G4QA 3FD9A 1Q39A 1ZQ9A 3LQQA 3A98B 2LHCA 2V1CA 1TDHA 2KA6B 4QHTA 3R9XB 1N36M 4AZFA 5EQTA 2FE8A 3J7BA 4DUZM 2Z4RA 5FTMA 3SAVA 1TDZA 1FJGM 3QWLA 4DR5M 3GRYA 3EIHA 4JI8M 3HHYA 3HKPA 2BJVA 5EJCA 4DR3M 2DI0A 3E9SA 1ZAEA 1N78A 2JY7A 3GPPA 3FTDA 4DV0M 2R45A 4I5SA 2VQEM 2APLA 1Q02A 3E21A 5IZ7D 1DV0A 1OAOC 1IN4A 2ZAMA 4GEWA 5FSWA 1NNJA 1QANA 5IREB 2KW0A 1R4GA 1QAQA 1Y8GA 3HZJA 1NVMA 3KVWA 2HAKA 4G4RA 3A42A 3QYBA 2QCUA 2VF7A 3OTOM 2D7EA 4QOSA 1IBMM 1BVSA 3K92A 4ANRA 1R7RA 5EXPA 4FWGA 1TTEA 3B7ZA 4G3OA 3M7GA 3TWLA 4GKJM 1TGUA 3W68A 2OPFA 3U5ZA 3W0LB 1KYIA 1VEKA 4Q7JA 3GQ3A 3HU1A 4LGMA 2O25A 4KHPM 2DNAA 2I7NA 2O01F 4TUWA 2ZANA 4MB7A 4UN2B 4FWHA 2JP7A 1PJSA 4FD2A 3LVVA 2UXDM 3CGWA 2Z3XA 2EO2A 1XXHE 2DWLA 1LV7A 4M0WA 2KZSA 3VK7A 4OVZB 3AOEC 3J2PB 1XNRM 2P5TA 2K0BX 1OIZA 2R4EA 2DKLA 3CF2A 2KNAA 4LY6A 1G59A 3HU2A 1NY5A 3FYDA 3Q8GA 2F5OA 3GPYA 4DR6M 4LF6M 1E9RA 3PXGA 3K8ZA 1ZV1A 2DENA 2W82A 2R18A 2Z7JA 1E94E 1W5SA 2L2DA 4L78A 3U6OA 2N35A 3U5ZB 1H6UA 1PJIA 5FTNA 1L2CA 4JI2M 4CISA 3VKHA 4L6V6 2DAIA 2FOIC 2ZTCA 3AL0C 1Q3BA 3WHLA 4GH9A 1OIPA 4MGIE 4GMQA 4DR2M 2CV1A 3A45A 3FE3A 4IJEA 3HHWA 2XGNA 1T43A 5KPZA 2QZ4A 3MHVC 1E32A 1L1TA 2D7GA 2C9CA 2M5ZA 2HWJA 4LJ5A 3TWMA 2QENA 1WIVA 4KODA 2FFJA 1D0KA 2DZOB 2A5YB 2MJ5B 3SMPA 3CF0A 3B7QA 4CIZA 3L26A 1WJ7A 4DV4M 3U6MA 2V6ZM 2UU9M 3U6LA 3GLGA 1K3WA 4M9SA 3SYKA 4NL4H 5BR8M 2RGOA 4WURA 1PM5A 4IBCA 2C99A 2JA2A 3B74A 3IHPA 1DO2A 4ZPXA 5DYGA 3K9OA 2JY6B 1JR3A 4MGYE 2LTUA 2F4VM 3GLIE 3K9PA 1MN3A 3VDUA 2BWBA 3L29A 3E46A 4NRVA 3VKGA 4NXMM 1QVRA 4WW0A 1V34A 4FWDA 2ZBKB 1QUTA 3U61A 4X62M 1PJQA 3KP1E 2BJWA 3U6EA 4IBDA 2CHQA 3TL4X 2UUAM 1HQYE 4R7GA 1OFHA 2LVAA 1ZMVA 3I4YA 2CE7A 1G3IA 3GLGB 4LJ7A 2QBYA 3FUUA 1SXJC 3B7NA 4A3VB 3PNVA 4LJ4A 3GLFE 1IY1A 3SATA 4JI6M 4LG2A 2Y20A 3GQ5A 3T1YM 2FS1A 1D0MA 2OQ4A 3FTFA 1P3QQ 3FUWA 2H5XA 4HL4A 5ITYA 2CV2A 1XB2B 1L2DA 4P17A 4IBBA 4I8OA 4MGZE 2FH0A 2CHVA 3GLHB 1IXZA 3U61B 2XZUA 2CV0A 3B89A 3BXWA 1IN6A 1SXJE 3HJ8A 3KSJA 2MROB 1IQPA 3ZCBB 4B3RM 4IBIA 2HCBA 2QBYB 2DWMA 3KDSE 4IBEA 4XBOA 2KXEA 1IY0A 5EXXA 1G4AE 2C98A 2JZ1A 4KLNA 4OU7A 3FTEA 2F5NA 3L28A 2WZJA 3CTWB 1K3XA 4LF4M 1G41A 2EJSA 4DV6M 4BB9A 1DGFA 1IN8A 1TF0B 1NHGC 1XWIA 2UUCM 4KO8A 3LCUA 3IG8A 4PDIA 2Q2EB 2MH8A 3C3DA 5DYIA 4LF9M 5KPTA 3AOGA 3KP0E 1PRBA 2QHOB 3TPZA 1V92A 3U6DA 5ITXE 1F4IA 1PGYA 3SFZA 2LWXA 5EP1A 4AW4A 3SBJA 4IBFA 1Q3CA 2K47A 2Y0TA 4GITA 4X66M 3ZQJA 2UUBM 1QZEA 2NQ8C 5FTKA 3K1JA 1L8QA 3GRUA 4AI6A 1J7KA 5ITXA 3UK6A 1XNQM 4JXJA 3HGIA 5EP2A 1WHCA 5F3WA 1IXRC 3FRIA 2BWEA 2JXNA 1WGLA 1TH3A 3AOEA 5KPRA 3A46A 3IG5A 1VQ1A 2YQZA 2GNOA 5FTJA 2XZFA 3F92A 1ORYB 4G6ZA 1OQYA 3DFZA 4LF8M 1R2YA 2UXCM 3JR4A 2YNMD 2DHYA 3HJSA 3MMPA 1YSYA 3W0FA 1CUKA 1DGHA 3HJQA 4IBJA 4W5WA 2KRKA 4CJ6A 4B7HA 3U6PA 2KDLA 1UM8A 1T3TA 5BPVA 4DR4M 4K0KM 4AKIA 4LFBM 1OFIA 2LBCA 3SHGB 4DV5M 4DV2M 2XFTA 2KNZA 4KT0F 4M9ZA 2G3QA 3KOZE 1N32M 3T15A 4B7GA 4JI0M 3VLFB 1JR3D 1MU5A 3T38A 4JV5M 2QQ8A 1QDRA 4RF1A 4MGHA 4HEOA 2OOAA 3SAWA 4DR1M 2DAMA 5KQ8A 1PJJA 1C1KA 2YR0A 2WSCF 4X65M 4BLCA 3RFWA 1I94M 3RGSA 3SC3A 4GIPA 3AJIB 3L25A 4D81A 1T6OA 5IWAM 1GLNA 2ERCA 3VK8A 2C96A 2YFQA 2MGWA 3JAMS 4AG5A 1K82A 4LRTA 1JQJC 1SXJD 2KRUA 1L1ZA 4GHAA 2XFSA 1EE8A 4YY3M 4JI4M 1QDTA 3GLIA 1KSFX 2LVOC 4NRWA 3TWKA 2JZ0A 4L8RC 5EP3A 4DV7M 3C9PA 3LW5F 8CATA 2ZAOA 1ZMWA 3PVSA 3GLFA 1RU3A 4GC9A 1YLAA 3J7AS 2R62A 5A2QS 4LJ6A 4Z8XA 2X8AA 2RRUA 2F5SA 5C1BA 4PT5A 4R71A 1NNUC 2L6OA 4I81A 1X37A 4NC6A 3GRRA 1V33A 4LF5M 5C18A 3D8BA 3I4VA 4QHSA 3QYEA 3QAUA 2DZLA 2G8LA 4B3TM 4YHHM 1LTMA 1SXJA 1R5LA 3FYCA 4IBGA 3LCVB 3SYLA 1Z5AA 2OO9A 1GJSA 4S12A 3GLIB 1S3SA 1J09A 2DZNB 2XF3A 3CF6E 3GQ4A 3LVWA 4I4LA 2DVWB 3M6AA 3UMMA 5JI3E 1OAIA 2DHRA 1TR8A 3L2AA 2J7OA 3B9PA 1GKIA 5ITRA 3FKEA 1D2NA 4LZJA 2ZM6M 1G8PA 1GL6A 3H4MA 1HNXM 2V1UA 2CP8A 2G5GX 2K6BA 4ITQA 1YE9A 2D7HA 2F5QA 4B08A 2LNHC 4LZZA 4PD2A 3GLGE 3FUXA 3VFDA 1R2ZA 4LGYA 4IJFA 1GABA 1QYRA 2I7PA 4B3SM 4FW9A 4DBGB 5IT9S 1NJFA 3AV0A 1HNWM 4IBKA 1IM2A 2JWSA 4GRIA 3JR5A 1D0LA 1C7YA 4F2LA 4REZA 3KS8A 1VEGA 4IIWA 2C9OA 2XH9A 1Z5CA 1GO5A 2R0IA 2WSEF 4RF0A 1QZMA 3GP1A 3GLHE 2X4AA 2L7IA 5KQDA 3GPXA 1HR0M 2Y21A 3HHXA 4OX9M 4NSRA 5DFLA 4Z6YA 1I4WA 1WGNA 1XXHA 3C3EA 4PDGA 3SAUA 2HHHM 2ZTDA 4R3DA 1XC8A 1WR1B 3D8LA 5KO3A 1AUAA 2LHGA 3HY5A 3AKZA 4QOZC 4MGKE 1OKSA 2R65A 3UZUA 4PCZA 4LCBA 2QSFX 3ZH9B 5ITUA 1IY2A 1IBKM 2L09A 4JI7M 4AKGA 5ITQA 4AKHA 1DGGA 2Z8YM
chains in the Genus database with same CATH topology
1IN7A 4OVZA 2QP9X 3TE6A 2EA0A 3U6SA 3ZC7B 3WHKA 3DOAA 3FTCA 1N75A 2EUCA 4RNAA 3FUTA 1GVNA 1XXHB 4DR7M 1GL7A 4OW0A 4XGIA 2XSZD 4FCWA 4JN6A 4MM3B 5H37D 4FCVA 2CFOA 4AG6A 2F5PA 1J5EM 3SMSA 2QPAA 4M9XA 4CHTB 1QQWA 3KSXA 5EXSA 3BOSA 1NJGA 4L4UA 3GRVA 4NSOB 1NHWC 3PNYA 2DWNA 3U60A 3SARA 1IN5A 2L7HA 2VQFM 2KEBA 3T1HM 5EXTA 3KW6A 4D82A 3AFHA 1OJLA 4LF7M 3DZDA 2LH0A 3KOXE 5FTLA 2UXBM 3MK6A 2RKOA 1W5TA 3RGPA 3L27A 3J80S 4CGYB 2CEAA 2KZUA 2XSZA 3SASA 1DO0A 2CHGA 3E4RA 1XMOM 1TH2A 4G4OA 3FUVA 4LJ8A 5E6JA 3KOYE 5ITTA 1DGHB 2LXEA 4D80A 4AQYM 3LQRA 3UGJA 3PFIA 4G4NA 3VDPA 5LMNM 1NSFA 4GKKM 4JYAM 4HLQA 1YUBA 3U60B 1IBLM 2H1RA 1IXSB 1XHBA 2X49A 4GC5A 2DXIA 4NOOB 4JI5M 3I51A 5FLXS 3HWSA 4X64M 1FNNA 3ILKA 4L15A 4EIWA 4M0DA 3GO8A 1Z6TA 3THGA 3J27B 3GPUA 2E5LM 1TH4A 1Z5BA 3K2LA 3HHZA 2CUZA 2HKJA 1N33M 3DA1A 4FCTA 4DV3M 3NWLA 2XLJA 4NXNM 5E26A 1L2BA 3HU3A 3J81S 3UJNA 4LFCM 4DUYM 4LFAM 4II7A 3M0EA 4FVMA 4P16A 4QNMA 1HQCA 3Q8XA 1XMQM 3LMMA 2Y0QA 2XEPA 1R6BX 1HT1E 4B7FA 3GLFB 3KFUG 2VIIA 1QAMA 5EP4A 4GHLA 2R46A 2M60A 2DWZB 1Z59A 3GLHA 5JI2E 3C58A 4QNRA 2R4JA 3SHFA 1MX0A 1NY6A 2FNAA 3TQSA 2HL7A 3EIEA 2Z4SA 4LJAA 1WXQA 4JI3M 4MH0E 5ITXA 3MJ5A 3KXEC 1QAOA 5LMUM 1HT2E 4JI1M 4L16A 4B3MM 1N77A 1SXJB 3U6QA 3RE8A 3NBIA 5DNYA 2AHMA 3KOWE 2O5RA 4BBAA 4DV1M 4LJ9A 1VDDA 1HNZM 4LRSA 2RGHA 3KS4A 1N34M 3R8FA 2BNKA 1DGBA 2J7NA 5GKNA 2C5RA 1KFVA 1E9SA 7CATA 3U6CA 4G4QA 3FD9A 1Q39A 1ZQ9A 3LQQA 3A98B 2V1CA 1TDHA 2KA6B 4QHTA 3R9XB 1N36M 4AZFA 5EQTA 2FE8A 3J7BA 4DUZM 2Z4RA 5FTMA 3SAVA 1TDZA 1FJGM 3QWLA 4DR5M 3GRYA 3EIHA 4JI8M 3HHYA 3HKPA 2BJVA 5EJCA 4DR3M 3E9SA 1ZAEA 1N78A 3GPPA 3FTDA 4DV0M 2R45A 4I5SA 2VQEM 5IZ7D 2ZAMA 1IN4A 5FSWA 1NNJA 1QANA 5IREB 2KW0A 1QAQA 1NVMA 3KVWA 4G4RA 3A42A 2QCUA 3OTOM 2D7EA 4QOSA 1IBMM 3K92A 1R7RA 5EXPA 4FWGA 3M7GA 3TWLA 4GKJM 1TGUA 2OPFA 3U5ZA 3W0LB 1KYIA 3GQ3A 3HU1A 4LGMA 4KHPM 2I7NA 4TUWA 2ZANA 4MB7A 4FWHA 4FD2A 3LVVA 2UXDM 2Z3XA 2EO2A 2DWLA 1LV7A 4M0WA 2KZSA 3VK7A 4OVZB 3AOEC 3J2PB 1XNRM 2P5TA 2R4EA 3CF2A 4LY6A 1G59A 3HU2A 1NY5A 3FYDA 2F5OA 3GPYA 4DR6M 4LF6M 1E9RA 3PXGA 3K8ZA 2W82A 2R18A 2Z7JA 1E94E 1W5SA 4L78A 3U6OA 1PJIA 3U5ZB 1H6UA 5FTNA 1L2CA 4JI2M 4CISA 3VKHA 2FOIC 3AL0C 1Q3BA 3WHLA 4GH9A 4MGIE 4GMQA 4DR2M 2CV1A 3A45A 4IJEA 3HHWA 2XGNA 5KPZA 2QZ4A 3MHVC 1E32A 1L1TA 2D7GA 2C9CA 2M5ZA 4LJ5A 3TWMA 2QENA 4KODA 2FFJA 2DZOB 2A5YB 3SMPA 3CF0A 3L26A 4DV4M 3U6MA 2V6ZM 2UU9M 3U6LA 3GLGA 1K3WA 4M9SA 3SYKA 4NL4H 5BR8M 2RGOA 4WURA 1PM5A 4IBCA 2C99A 2JA2A 1DO2A 4ZPXA 5DYGA 1JR3A 4MGYE 2F4VM 3VDUA 3L29A 4NRVA 3VKGA 4NXMM 1QVRA 4WW0A 4FWDA 2ZBKB 3U61A 4X62M 3KP1E 2BJWA 3U6EA 4IBDA 2CHQA 3TL4X 2UUAM 1HQYE 4R7GA 1OFHA 3I4YA 2CE7A 1G3IA 3GLGB 4LJ7A 2QBYA 3FUUA 1SXJC 4A3VB 3SATA 3PNVA 4LJ4A 4JI6M 1IY1A 4LG2A 2Y20A 3GQ5A 3T1YM 3FTFA 2OQ4A 3FUWA 4HL4A 5ITYA 2CV2A 1L2DA 4IBBA 4I8OA 4MGZE 2CHVA 3GLHB 1IXZA 3U61B 2XZUA 2CV0A 1IN6A 1SXJE 3HJ8A 3KSJA 1IQPA 3ZCBB 4B3RM 4IBIA 2HCBA 2QBYB 2DWMA 3KDSE 4IBEA 4XBOA 2KXEA 1IY0A 5EXXA 1G4AE 2C98A 4KLNA 4OU7A 3FTEA 2F5NA 3L28A 4LF4M 3CTWB 1K3XA 1G41A 4DV6M 4BB9A 1DGFA 1IN8A 1NHGC 1XWIA 2UUCM 4KO8A 3IG8A 4PDIA 2Q2EB 5DYIA 4LF9M 5KPTA 3AOGA 3KP0E 3TPZA 3U6DA 5ITXE 3SFZA 2LWXA 5EP1A 4AW4A 3SBJA 4IBFA 1Q3CA 2K47A 2Y0TA 4GITA 4X66M 2UUBM 5FTKA 2NQ8C 3K1JA 1L8QA 3GRUA 4AI6A 1J7KA 3UK6A 1XNQM 4JXJA 3HGIA 5EP2A 5F3WA 1IXRC 1TH3A 3AOEA 5KPRA 3A46A 3IG5A 2YQZA 5FTJA 2XZFA 1ORYB 4G6ZA 4LF8M 3DFZA 1R2YA 2UXCM 3JR4A 2YNMD 3HJSA 1YSYA 3W0FA 1DGHA 3HJQA 4IBJA 4W5WA 2KRKA 4B7HA 3U6PA 1UM8A 1T3TA 5BPVA 4DR4M 4K0KM 4AKIA 4LFBM 1OFIA 3SHGB 4DV5M 4DV2M 2XFTA 4M9ZA 3KOZE 1N32M 3T15A 4B7GA 4JI0M 3VLFB 1JR3D 1MU5A 3T38A 4JV5M 4RF1A 4MGHA 3SAWA 4DR1M 5KQ8A 1PJJA 1C1KA 2YR0A 4X65M 4BLCA 3RFWA 1I94M 3RGSA 3SC3A 4GIPA 3AJIB 3L25A 4D81A 5IWAM 1GLNA 2ERCA 3VK8A 2C96A 2YFQA 3JAMS 4AG5A 1K82A 4LRTA 1JQJC 1SXJD 2KRUA 1L1ZA 4GHAA 2XFSA 1EE8A 4YY3M 4JI4M 3GLIA 1KSFX 4NRWA 3TWKA 4L8RC 5EP3A 4DV7M 8CATA 2ZAOA 3GLFA 3PVSA 4GC9A 3J7AS 2R62A 5A2QS 4LJ6A 4Z8XA 2X8AA 2F5SA 5C1BA 4PT5A 1NNUC 2L6OA 4I81A 1X37A 3GRRA 4LF5M 5C18A 3D8BA 3I4VA 4QHSA 3QAUA 2G8LA 4B3TM 4YHHM 1SXJA 3FYCA 4IBGA 3SYLA 1Z5AA 4S12A 3GLIB 1S3SA 1J09A 2DZNB 2XF3A 3CF6E 3GQ4A 3LVWA 4I4LA 2DVWB 3M6AA 3UMMA 5JI3E 2DHRA 3L2AA 2J7OA 3B9PA 1GKIA 5ITRA 3FKEA 1D2NA 4LZJA 2ZM6M 1G8PA 1GL6A 3H4MA 1HNXM 2V1UA 2G5GX 4ITQA 1YE9A 2D7HA 2F5QA 4B08A 2LNHC 4LZZA 4PD2A 3FUXA 3VFDA 1R2ZA 4LGYA 4IJFA 1QYRA 2I7PA 4B3SM 4FW9A 5IT9S 1NJFA 3AV0A 1HNWM 4IBKA 1IM2A 4GRIA 3JR5A 4REZA 3KS8A 4IIWA 2C9OA 2XH9A 1Z5CA 4RF0A 1QZMA 3GP1A 2X4AA 2L7IA 5KQDA 3GPXA 1HR0M 2Y21A 3HHXA 4OX9M 4NSRA 4Z6YA 1I4WA 1XXHA 4PDGA 3SAUA 2HHHM 4R3DA 1XC8A 5KO3A 3D8LA 3AKZA 4QOZC 4MGKE 2R65A 3UZUA 4PCZA 4LCBA 3ZH9B 5ITUA 1IY2A 1IBKM 2L09A 4JI7M 4AKGA 5ITQA 4AKHA 1DGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 M;  1HNZ M;  1MU5 A;  1N34 M;  2F4V M;  4JV5 M;  1KFV A;  3SAW A;  2EA0 A;  3U6S A;  4DR1 M;  3U6C A;  4G4Q A;  3DOA A;  1PJJ A;  4NRV A;  4NXM M;  1Q39 A;  4X65 M;  4DR7 M;  2ZBK B;  1TDH A;  1I94 M;  4X62 M;  1N36 M;  4DUZ M;  3SAV A;  1TDZ A;  5IWA M;  3U6E A;  1FJG M;  4DR5 M;  3VK8 A;  2F5P A;  2UUA M;  1J5E M;  4JI8 M;  3JAM S;  4DR3 M;  1K82 A;  3GPP A;  1L1Z A;  4JI4 M;  1EE8 A;  4YY3 M;  3SAT A;  4JI6 M;  4DV0 M;  4NRW A;  3TWK A;  2VQE M;  4DV7 M;  3GQ5 A;  3T1Y M;  3SAR A;  1NNJ A;  2OQ4 A;  2VQF M;  3J7A S;  5ITY A;  3T1H M;  5A2Q S;  1L2D A;  2F5S A;  4LF7 M;  4G4R A;  2UXB M;  3A42 A;  3OTO M;  3J80 S;  1IBM M;  4LF5 M;  3SAS A;  2XZU A;  1XMO M;  3TWL A;  4G4O A;  4GKJ M;  2OPF A;  4B3T M;  5ITT A;  3GQ3 A;  4AQY M;  4YHH M;  4B3R M;  4KHP M;  1Z5A A;  4G4N A;  4MB7 A;  5LMN M;  4GKK M;  4JYA M;  3GQ4 A;  2F5N A;  4LF4 M;  1K3X A;  2UXD M;  1IBL M;  4DV6 M;  3VK7 A;  4JI5 M;  2UUC M;  5ITR A;  1HNX M;  4PDI A;  5FLX S;  2Q2E B;  2ZM6 M;  1XNR M;  4LF9 M;  4X64 M;  4ITQ A;  3GO8 A;  3U6D A;  5ITX E;  2F5O A;  3GPY A;  2F5Q A;  4DR6 M;  3GPU A;  4PD2 A;  4LF6 M;  2E5L M;  1Z5B A;  1R2Z A;  3SBJ A;  2HKJ A;  1N33 M;  1Q3C A;  4DV3 M;  4B3S M;  5IT9 S;  4X66 M;  2UUB M;  4NXN M;  3U6O A;  1L2B A;  1PJI A;  1HNW M;  3J81 S;  1L2C A;  4JI2 M;  4CIS A;  4LFC M;  3JR5 A;  4LFA M;  4DUY M;  1XNQ M;  1Q3B A;  1XMQ M;  4DR2 M;  1Z5C A;  3A45 A;  3GP1 A;  3A46 A;  3GPX A;  1L1T A;  1HR0 M;  1Z59 A;  4OX9 M;  3TWM A;  3SAU A;  4PDG A;  2HHH M;  2XZF A;  3C58 A;  1XC8 A;  4LF8 M;  1R2Y A;  2UXC M;  3JR4 A;  1MX0 A;  3W0F A;  5ITX A;  4DV4 M;  4JI3 M;  3U6M A;  3U6P A;  2UU9 M;  3U6L A;  4DR4 M;  1K3W A;  4PCZ A;  5ITU A;  5BR8 M;  5LMU M;  1IBK M;  4JI7 M;  4JI1 M;  4K0K M;  5ITQ A;  4B3M M;  4LFB M;  4DV5 M;  4DV2 M;  3U6Q A;  1PM5 A;  1N32 M;  4DV1 M; 
#chains in the Genus database with same CATH topology
 1IN7 A;  4OVZ A;  3IEC A;  4WP2 A;  2QP9 X;  3TE6 A;  2EA0 A;  3U6S A;  2KHH A;  3ZC7 B;  3WHK A;  3DOA A;  3FTC A;  2DAK A;  3I04 M;  1N75 A;  2EUC A;  4RNA A;  3FUT A;  1GVN A;  1XXH B;  2CWB A;  4DR7 M;  1GL7 A;  4OW0 A;  4XGI A;  2XSZ D;  4FCW A;  4JN6 A;  4MM3 B;  5H37 D;  4FCV A;  2CFO A;  2LVQ D;  4AG6 A;  2JY8 A;  2F5P A;  2GQF A;  1J5E M;  2OOB A;  3SMS A;  2QPA A;  4M9X A;  4CHT B;  1QQW A;  2LVP C;  3KSX A;  5EXS A;  3I01 M;  3V76 A;  1NO1 A;  3BOS A;  1NJG A;  4L4U A;  3GRV A;  4NSO B;  1NHW C;  3PNY A;  4Y28 F;  2DWN A;  3U60 A;  3SAR A;  1IN5 A;  2QNJ A;  1IXS A;  2L7H A;  5L8R F;  2VQF M;  2KEB A;  3T1H M;  1VDL A;  5EXT A;  3HX3 A;  1HJP A;  3KW6 A;  1IFY A;  4D82 A;  3AFH A;  1OJL A;  4LF7 M;  3DZD A;  2LH0 A;  3KOX E;  1PJT A;  5FTL A;  3MK6 A;  2RKO A;  1W5T A;  3RGP A;  2UXB M;  3L27 A;  3J80 S;  4CGY B;  1VEJ A;  2CEA A;  2KZU A;  2XSZ A;  3SAS A;  1UFZ A;  2LVN C;  1DO0 A;  1A5T A;  2CHG A;  3E4R A;  1XMO M;  1TH2 A;  4F1I A;  4G4O A;  3FUV A;  2B3T A;  4LJ8 A;  5E6J A;  3KOY E;  5ITT A;  1DGH B;  3W67 A;  1JB0 F;  1ZMU A;  2LXE A;  4D80 A;  3LQR A;  3UGJ A;  4AQY M;  3PFI A;  4G4N A;  1MJG M;  2WSF F;  3VDP A;  5LMN M;  1NSF A;  4GKK M;  4JYA M;  4HLQ A;  1YUB A;  3U60 B;  1IBL M;  2H1R A;  1OTR A;  1IXS B;  1XHB A;  4RKU F;  2X49 A;  4GC5 A;  2DXI A;  1G71 A;  2VF8 A;  4NOO B;  4JI5 M;  2L4E A;  3I51 A;  5FLX S;  2CRU A;  3NBX X;  3HWS A;  2MR9 A;  4X64 M;  1FNN A;  3ILK A;  4L15 A;  4EIW A;  2JY5 A;  4M0D A;  1Z6T A;  3GO8 A;  2DAE A;  3THG A;  3J27 B;  3GPU A;  2E5L M;  1TH4 A;  1NV8 A;  1Z5B A;  3K2L A;  1EIJ A;  1QUS A;  3HHZ A;  2CUZ A;  2HKJ A;  1N33 M;  3DA1 A;  4FCT A;  3T6P A;  4DV3 M;  3NWL A;  2XLJ A;  4NXN M;  5E26 A;  1L2B A;  3HU3 A;  3J81 S;  2KNV A;  3UJN A;  2L4F A;  4LFC M;  4DUY M;  4LFA M;  4II7 A;  3H4J A;  3M0E A;  4FVM A;  1NV9 A;  1EFU B;  4P16 A;  4QNM A;  1HQC A;  3Q8X A;  1XMQ M;  1SG9 A;  3LMM A;  2Y0Q A;  2XEP A;  1R6B X;  1GJT A;  1HT1 E;  4B7F A;  3GLF B;  2JNH A;  2VII A;  1QAM A;  2R6F A;  5EP4 A;  3KFU G;  2R46 A;  2M60 A;  4GHL A;  2DWZ B;  2DAG A;  1Z59 A;  3GLH A;  5JI2 E;  3C58 A;  4QNR A;  2R4J A;  2EKK A;  3SHF A;  1MX0 A;  3BBZ A;  2K9D A;  2EKF A;  4XK8 F;  1NY6 A;  2FNA A;  3TQS A;  2HL7 A;  3EIE A;  2J5Y A;  2Z4S A;  1WXQ A;  3FRH A;  4LJA A;  4MH0 E;  1AIP C;  3MJ5 A;  4JI3 M;  3KXE C;  1QAO A;  5LMU M;  1HT2 E;  2JUJ A;  2VDB B;  4JI1 M;  1JR3 E;  4L16 A;  4B3M M;  1N77 A;  1SXJ B;  3U6Q A;  3RE8 A;  3NBI A;  5DNY A;  2AHM A;  3KOW E;  2O5R A;  4BBA A;  4DV1 M;  4LJ9 A;  2R44 A;  1VDD A;  1HNZ M;  4LRS A;  2RGH A;  3KS4 A;  1N34 M;  3R8F A;  2BNK A;  1DGB A;  2J7N A;  5GKN A;  2C5R A;  1KFV A;  1E9S A;  1VG5 A;  7CAT A;  3U6C A;  4G4Q A;  3FD9 A;  1Q39 A;  1ZQ9 A;  3LQQ A;  3A98 B;  2LHC A;  2V1C A;  1TDH A;  2KA6 B;  4QHT A;  3R9X B;  1N36 M;  4AZF A;  5EQT A;  2FE8 A;  3J7B A;  4DUZ M;  2Z4R A;  5FTM A;  3SAV A;  1TDZ A;  1FJG M;  3QWL A;  4DR5 M;  3GRY A;  3EIH A;  4JI8 M;  3HHY A;  3HKP A;  2BJV A;  5EJC A;  4DR3 M;  2DI0 A;  3E9S A;  1ZAE A;  1N78 A;  2JY7 A;  3GPP A;  3FTD A;  4DV0 M;  2R45 A;  4I5S A;  2VQE M;  2APL A;  1Q02 A;  3E21 A;  5IZ7 D;  1DV0 A;  1OAO C;  1IN4 A;  2ZAM A;  4GEW A;  5FSW A;  1NNJ A;  1QAN A;  5IRE B;  2KW0 A;  1R4G A;  1QAQ A;  1Y8G A;  3HZJ A;  1NVM A;  3KVW A;  2HAK A;  4G4R A;  3A42 A;  3QYB A;  2QCU A;  2VF7 A;  3OTO M;  2D7E A;  4QOS A;  1IBM M;  1BVS A;  3K92 A;  4ANR A;  1R7R A;  5EXP A;  4FWG A;  1TTE A;  3B7Z A;  4G3O A;  3M7G A;  3TWL A;  4GKJ M;  1TGU A;  3W68 A;  2OPF A;  3U5Z A;  3W0L B;  1KYI A;  1VEK A;  4Q7J A;  3GQ3 A;  3HU1 A;  4LGM A;  2O25 A;  4KHP M;  2DNA A;  2I7N A;  2O01 F;  4TUW A;  2ZAN A;  4MB7 A;  4UN2 B;  4FWH A;  2JP7 A;  1PJS A;  4FD2 A;  3LVV A;  2UXD M;  3CGW A;  2Z3X A;  2EO2 A;  1XXH E;  2DWL A;  1LV7 A;  4M0W A;  2KZS A;  3VK7 A;  4OVZ B;  3AOE C;  3J2P B;  1XNR M;  2P5T A;  2K0B X;  1OIZ A;  2R4E A;  2DKL A;  3CF2 A;  2KNA A;  4LY6 A;  1G59 A;  3HU2 A;  1NY5 A;  3FYD A;  3Q8G A;  2F5O A;  3GPY A;  4DR6 M;  4LF6 M;  1E9R A;  3PXG A;  3K8Z A;  1ZV1 A;  2DEN A;  2W82 A;  2R18 A;  2Z7J A;  1E94 E;  1W5S A;  2L2D A;  4L78 A;  3U6O A;  2N35 A;  3U5Z B;  1H6U A;  1PJI A;  5FTN A;  1L2C A;  4JI2 M;  4CIS A;  3VKH A;  4L6V 6;  2DAI A;  2FOI C;  2ZTC A;  3AL0 C;  1Q3B A;  3WHL A;  4GH9 A;  1OIP A;  4MGI E;  4GMQ A;  4DR2 M;  2CV1 A;  3A45 A;  3FE3 A;  4IJE A;  3HHW A;  2XGN A;  1T43 A;  5KPZ A;  2QZ4 A;  3MHV C;  1E32 A;  1L1T A;  2D7G A;  2C9C A;  2M5Z A;  2HWJ A;  4LJ5 A;  3TWM A;  2QEN A;  1WIV A;  4KOD A;  2FFJ A;  1D0K A;  2DZO B;  2A5Y B;  2MJ5 B;  3SMP A;  3CF0 A;  3B7Q A;  4CIZ A;  3L26 A;  1WJ7 A;  4DV4 M;  3U6M A;  2V6Z M;  2UU9 M;  3U6L A;  3GLG A;  1K3W A;  4M9S A;  3SYK A;  4NL4 H;  5BR8 M;  2RGO A;  4WUR A;  1PM5 A;  4IBC A;  2C99 A;  2JA2 A;  3B74 A;  3IHP A;  1DO2 A;  4ZPX A;  5DYG A;  3K9O A;  2JY6 B;  1JR3 A;  4MGY E;  2LTU A;  2F4V M;  3GLI E;  3K9P A;  1MN3 A;  3VDU A;  2BWB A;  3L29 A;  3E46 A;  4NRV A;  3VKG A;  4NXM M;  1QVR A;  4WW0 A;  1V34 A;  4FWD A;  2ZBK B;  1QUT A;  3U61 A;  4X62 M;  1PJQ A;  3KP1 E;  2BJW A;  3U6E A;  4IBD A;  2CHQ A;  3TL4 X;  2UUA M;  1HQY E;  4R7G A;  1OFH A;  2LVA A;  1ZMV A;  3I4Y A;  2CE7 A;  1G3I A;  3GLG B;  4LJ7 A;  2QBY A;  3FUU A;  1SXJ C;  3B7N A;  4A3V B;  3PNV A;  4LJ4 A;  3GLF E;  1IY1 A;  3SAT A;  4JI6 M;  4LG2 A;  2Y20 A;  3GQ5 A;  3T1Y M;  2FS1 A;  1D0M A;  2OQ4 A;  3FTF A;  1P3Q Q;  3FUW A;  2H5X A;  4HL4 A;  5ITY A;  2CV2 A;  1XB2 B;  1L2D A;  4P17 A;  4IBB A;  4I8O A;  4MGZ E;  2FH0 A;  2CHV A;  3GLH B;  1IXZ A;  3U61 B;  2XZU A;  2CV0 A;  3B89 A;  3BXW A;  1IN6 A;  1SXJ E;  3HJ8 A;  3KSJ A;  2MRO B;  1IQP A;  3ZCB B;  4B3R M;  4IBI A;  2HCB A;  2QBY B;  2DWM A;  3KDS E;  4IBE A;  4XBO A;  2KXE A;  1IY0 A;  5EXX A;  1G4A E;  2C98 A;  2JZ1 A;  4KLN A;  4OU7 A;  3FTE A;  2F5N A;  3L28 A;  2WZJ A;  3CTW B;  1K3X A;  4LF4 M;  1G41 A;  2EJS A;  4DV6 M;  4BB9 A;  1DGF A;  1IN8 A;  1TF0 B;  1NHG C;  1XWI A;  2UUC M;  4KO8 A;  3LCU A;  3IG8 A;  4PDI A;  2Q2E B;  2MH8 A;  3C3D A;  5DYI A;  4LF9 M;  5KPT A;  3AOG A;  3KP0 E;  1PRB A;  2QHO B;  3TPZ A;  1V92 A;  3U6D A;  5ITX E;  1F4I A;  1PGY A;  3SFZ A;  2LWX A;  5EP1 A;  4AW4 A;  3SBJ A;  4IBF A;  1Q3C A;  2K47 A;  2Y0T A;  4GIT A;  4X66 M;  3ZQJ A;  2UUB M;  1QZE A;  2NQ8 C;  5FTK A;  3K1J A;  1L8Q A;  3GRU A;  4AI6 A;  1J7K A;  5ITX A;  3UK6 A;  1XNQ M;  4JXJ A;  3HGI A;  5EP2 A;  1WHC A;  5F3W A;  1IXR C;  3FRI A;  2BWE A;  2JXN A;  1WGL A;  1TH3 A;  3AOE A;  5KPR A;  3A46 A;  3IG5 A;  1VQ1 A;  2YQZ A;  2GNO A;  5FTJ A;  2XZF A;  3F92 A;  1ORY B;  4G6Z A;  1OQY A;  3DFZ A;  4LF8 M;  1R2Y A;  2UXC M;  3JR4 A;  2YNM D;  2DHY A;  3HJS A;  3MMP A;  1YSY A;  3W0F A;  1CUK A;  1DGH A;  3HJQ A;  4IBJ A;  4W5W A;  2KRK A;  4CJ6 A;  4B7H A;  3U6P A;  2KDL A;  1UM8 A;  1T3T A;  5BPV A;  4DR4 M;  4K0K M;  4AKI A;  4LFB M;  1OFI A;  2LBC A;  3SHG B;  4DV5 M;  4DV2 M;  2XFT A;  2KNZ A;  4KT0 F;  4M9Z A;  2G3Q A;  3KOZ E;  1N32 M;  3T15 A;  4B7G A;  4JI0 M;  3VLF B;  1JR3 D;  1MU5 A;  3T38 A;  4JV5 M;  2QQ8 A;  1QDR A;  4RF1 A;  4MGH A;  4HEO A;  2OOA A;  3SAW A;  4DR1 M;  2DAM A;  5KQ8 A;  1PJJ A;  1C1K A;  2YR0 A;  2WSC F;  4X65 M;  4BLC A;  3RFW A;  1I94 M;  3RGS A;  3SC3 A;  4GIP A;  3AJI B;  3L25 A;  4D81 A;  1T6O A;  5IWA M;  1GLN A;  2ERC A;  3VK8 A;  2C96 A;  2YFQ A;  2MGW A;  3JAM S;  4AG5 A;  1K82 A;  4LRT A;  1JQJ C;  1SXJ D;  2KRU A;  1L1Z A;  4GHA A;  2XFS A;  1EE8 A;  4YY3 M;  4JI4 M;  1QDT A;  3GLI A;  1KSF X;  2LVO C;  4NRW A;  3TWK A;  2JZ0 A;  4L8R C;  5EP3 A;  4DV7 M;  3C9P A;  3LW5 F;  8CAT A;  2ZAO A;  1ZMW A;  3PVS A;  3GLF A;  1RU3 A;  4GC9 A;  1YLA A;  3J7A S;  2R62 A;  5A2Q S;  4LJ6 A;  4Z8X A;  2X8A A;  2RRU A;  2F5S A;  5C1B A;  4PT5 A;  4R71 A;  1NNU C;  2L6O A;  4I81 A;  1X37 A;  4NC6 A;  3GRR A;  1V33 A;  4LF5 M;  5C18 A;  3D8B A;  3I4V A;  4QHS A;  3QYE A;  3QAU A;  2DZL A;  2G8L A;  4B3T M;  4YHH M;  1LTM A;  1SXJ A;  1R5L A;  3FYC A;  4IBG A;  3LCV B;  3SYL A;  1Z5A A;  2OO9 A;  1GJS A;  4S12 A;  3GLI B;  1S3S A;  1J09 A;  2DZN B;  2XF3 A;  3CF6 E;  3GQ4 A;  3LVW A;  4I4L A;  2DVW B;  3M6A A;  3UMM A;  5JI3 E;  1OAI A;  2DHR A;  1TR8 A;  3L2A A;  2J7O A;  3B9P A;  1GKI A;  5ITR A;  3FKE A;  1D2N A;  4LZJ A;  2ZM6 M;  1G8P A;  1GL6 A;  3H4M A;  1HNX M;  2V1U A;  2CP8 A;  2G5G X;  2K6B A;  4ITQ A;  1YE9 A;  2D7H A;  2F5Q A;  4B08 A;  2LNH C;  4LZZ A;  4PD2 A;  3GLG E;  3FUX A;  3VFD A;  1R2Z A;  4LGY A;  4IJF A;  1GAB A;  1QYR A;  2I7P A;  4B3S M;  4FW9 A;  4DBG B;  5IT9 S;  1NJF A;  3AV0 A;  1HNW M;  4IBK A;  1IM2 A;  2JWS A;  4GRI A;  3JR5 A;  1D0L A;  1C7Y A;  4F2L A;  4REZ A;  3KS8 A;  1VEG A;  4IIW A;  2C9O A;  2XH9 A;  1Z5C A;  1GO5 A;  2R0I A;  2WSE F;  4RF0 A;  1QZM A;  3GP1 A;  3GLH E;  2X4A A;  2L7I A;  5KQD A;  3GPX A;  1HR0 M;  2Y21 A;  3HHX A;  4OX9 M;  4NSR A;  5DFL A;  4Z6Y A;  1I4W A;  1WGN A;  1XXH A;  3C3E A;  4PDG A;  3SAU A;  2HHH M;  2ZTD A;  4R3D A;  1XC8 A;  1WR1 B;  3D8L A;  5KO3 A;  1AUA A;  2LHG A;  3HY5 A;  3AKZ A;  4QOZ C;  4MGK E;  1OKS A;  2R65 A;  3UZU A;  4PCZ A;  4LCB A;  2QSF X;  3ZH9 B;  5ITU A;  1IY2 A;  1IBK M;  2L09 A;  4JI7 M;  4AKG A;  5ITQ A;  4AKH A;  1DGG A;  2Z8Y M; 
#chains in the Genus database with same CATH homology
 1IN7 A;  4OVZ A;  2QP9 X;  3TE6 A;  2EA0 A;  3U6S A;  3ZC7 B;  3WHK A;  3DOA A;  3FTC A;  1N75 A;  2EUC A;  4RNA A;  3FUT A;  1GVN A;  1XXH B;  4DR7 M;  1GL7 A;  4OW0 A;  4XGI A;  2XSZ D;  4FCW A;  4JN6 A;  4MM3 B;  5H37 D;  4FCV A;  2CFO A;  4AG6 A;  2F5P A;  1J5E M;  3SMS A;  2QPA A;  4M9X A;  4CHT B;  1QQW A;  3KSX A;  5EXS A;  3BOS A;  1NJG A;  4L4U A;  3GRV A;  4NSO B;  1NHW C;  3PNY A;  2DWN A;  3U60 A;  3SAR A;  1IN5 A;  2L7H A;  2VQF M;  2KEB A;  3T1H M;  5EXT A;  3KW6 A;  4D82 A;  3AFH A;  1OJL A;  4LF7 M;  3DZD A;  2LH0 A;  3KOX E;  5FTL A;  2UXB M;  3MK6 A;  2RKO A;  1W5T A;  3RGP A;  3L27 A;  3J80 S;  4CGY B;  2CEA A;  2KZU A;  2XSZ A;  3SAS A;  1DO0 A;  2CHG A;  3E4R A;  1XMO M;  1TH2 A;  4G4O A;  3FUV A;  4LJ8 A;  5E6J A;  3KOY E;  5ITT A;  1DGH B;  2LXE A;  4D80 A;  4AQY M;  3LQR A;  3UGJ A;  3PFI A;  4G4N A;  3VDP A;  5LMN M;  1NSF A;  4GKK M;  4JYA M;  4HLQ A;  1YUB A;  3U60 B;  1IBL M;  2H1R A;  1IXS B;  1XHB A;  2X49 A;  4GC5 A;  2DXI A;  4NOO B;  4JI5 M;  3I51 A;  5FLX S;  3HWS A;  4X64 M;  1FNN A;  3ILK A;  4L15 A;  4EIW A;  4M0D A;  3GO8 A;  1Z6T A;  3THG A;  3J27 B;  3GPU A;  2E5L M;  1TH4 A;  1Z5B A;  3K2L A;  3HHZ A;  2CUZ A;  2HKJ A;  1N33 M;  3DA1 A;  4FCT A;  4DV3 M;  3NWL A;  2XLJ A;  4NXN M;  5E26 A;  1L2B A;  3HU3 A;  3J81 S;  3UJN A;  4LFC M;  4DUY M;  4LFA M;  4II7 A;  3M0E A;  4FVM A;  4P16 A;  4QNM A;  1HQC A;  3Q8X A;  1XMQ M;  3LMM A;  2Y0Q A;  2XEP A;  1R6B X;  1HT1 E;  4B7F A;  3GLF B;  3KFU G;  2VII A;  1QAM A;  5EP4 A;  4GHL A;  2R46 A;  2M60 A;  2DWZ B;  1Z59 A;  3GLH A;  5JI2 E;  3C58 A;  4QNR A;  2R4J A;  3SHF A;  1MX0 A;  1NY6 A;  2FNA A;  3TQS A;  2HL7 A;  3EIE A;  2Z4S A;  4LJA A;  1WXQ A;  4JI3 M;  4MH0 E;  5ITX A;  3MJ5 A;  3KXE C;  1QAO A;  5LMU M;  1HT2 E;  4JI1 M;  4L16 A;  4B3M M;  1N77 A;  1SXJ B;  3U6Q A;  3RE8 A;  3NBI A;  5DNY A;  2AHM A;  3KOW E;  2O5R A;  4BBA A;  4DV1 M;  4LJ9 A;  1VDD A;  1HNZ M;  4LRS A;  2RGH A;  3KS4 A;  1N34 M;  3R8F A;  2BNK A;  1DGB A;  2J7N A;  5GKN A;  2C5R A;  1KFV A;  1E9S A;  7CAT A;  3U6C A;  4G4Q A;  3FD9 A;  1Q39 A;  1ZQ9 A;  3LQQ A;  3A98 B;  2V1C A;  1TDH A;  2KA6 B;  4QHT A;  3R9X B;  1N36 M;  4AZF A;  5EQT A;  2FE8 A;  3J7B A;  4DUZ M;  2Z4R A;  5FTM A;  3SAV A;  1TDZ A;  1FJG M;  3QWL A;  4DR5 M;  3GRY A;  3EIH A;  4JI8 M;  3HHY A;  3HKP A;  2BJV A;  5EJC A;  4DR3 M;  3E9S A;  1ZAE A;  1N78 A;  3GPP A;  3FTD A;  4DV0 M;  2R45 A;  4I5S A;  2VQE M;  5IZ7 D;  2ZAM A;  1IN4 A;  5FSW A;  1NNJ A;  1QAN A;  5IRE B;  2KW0 A;  1QAQ A;  1NVM A;  3KVW A;  4G4R A;  3A42 A;  2QCU A;  3OTO M;  2D7E A;  4QOS A;  1IBM M;  3K92 A;  1R7R A;  5EXP A;  4FWG A;  3M7G A;  3TWL A;  4GKJ M;  1TGU A;  2OPF A;  3U5Z A;  3W0L B;  1KYI A;  3GQ3 A;  3HU1 A;  4LGM A;  4KHP M;  2I7N A;  4TUW A;  2ZAN A;  4MB7 A;  4FWH A;  4FD2 A;  3LVV A;  2UXD M;  2Z3X A;  2EO2 A;  2DWL A;  1LV7 A;  4M0W A;  2KZS A;  3VK7 A;  4OVZ B;  3AOE C;  3J2P B;  1XNR M;  2P5T A;  2R4E A;  3CF2 A;  4LY6 A;  1G59 A;  3HU2 A;  1NY5 A;  3FYD A;  2F5O A;  3GPY A;  4DR6 M;  4LF6 M;  1E9R A;  3PXG A;  3K8Z A;  2W82 A;  2R18 A;  2Z7J A;  1E94 E;  1W5S A;  4L78 A;  3U6O A;  1PJI A;  3U5Z B;  1H6U A;  5FTN A;  1L2C A;  4JI2 M;  4CIS A;  3VKH A;  2FOI C;  3AL0 C;  1Q3B A;  3WHL A;  4GH9 A;  4MGI E;  4GMQ A;  4DR2 M;  2CV1 A;  3A45 A;  4IJE A;  3HHW A;  2XGN A;  5KPZ A;  2QZ4 A;  3MHV C;  1E32 A;  1L1T A;  2D7G A;  2C9C A;  2M5Z A;  4LJ5 A;  3TWM A;  2QEN A;  4KOD A;  2FFJ A;  2DZO B;  2A5Y B;  3SMP A;  3CF0 A;  3L26 A;  4DV4 M;  3U6M A;  2V6Z M;  2UU9 M;  3U6L A;  3GLG A;  1K3W A;  4M9S A;  3SYK A;  4NL4 H;  5BR8 M;  2RGO A;  4WUR A;  1PM5 A;  4IBC A;  2C99 A;  2JA2 A;  1DO2 A;  4ZPX A;  5DYG A;  1JR3 A;  4MGY E;  2F4V M;  3VDU A;  3L29 A;  4NRV A;  3VKG A;  4NXM M;  1QVR A;  4WW0 A;  4FWD A;  2ZBK B;  3U61 A;  4X62 M;  3KP1 E;  2BJW A;  3U6E A;  4IBD A;  2CHQ A;  3TL4 X;  2UUA M;  1HQY E;  4R7G A;  1OFH A;  3I4Y A;  2CE7 A;  1G3I A;  3GLG B;  4LJ7 A;  2QBY A;  3FUU A;  1SXJ C;  4A3V B;  3SAT A;  3PNV A;  4LJ4 A;  4JI6 M;  1IY1 A;  4LG2 A;  2Y20 A;  3GQ5 A;  3T1Y M;  3FTF A;  2OQ4 A;  3FUW A;  4HL4 A;  5ITY A;  2CV2 A;  1L2D A;  4IBB A;  4I8O A;  4MGZ E;  2CHV A;  3GLH B;  1IXZ A;  3U61 B;  2XZU A;  2CV0 A;  1IN6 A;  1SXJ E;  3HJ8 A;  3KSJ A;  1IQP A;  3ZCB B;  4B3R M;  4IBI A;  2HCB A;  2QBY B;  2DWM A;  3KDS E;  4IBE A;  4XBO A;  2KXE A;  1IY0 A;  5EXX A;  1G4A E;  2C98 A;  4KLN A;  4OU7 A;  3FTE A;  2F5N A;  3L28 A;  4LF4 M;  3CTW B;  1K3X A;  1G41 A;  4DV6 M;  4BB9 A;  1DGF A;  1IN8 A;  1NHG C;  1XWI A;  2UUC M;  4KO8 A;  3IG8 A;  4PDI A;  2Q2E B;  5DYI A;  4LF9 M;  5KPT A;  3AOG A;  3KP0 E;  3TPZ A;  3U6D A;  5ITX E;  3SFZ A;  2LWX A;  5EP1 A;  4AW4 A;  3SBJ A;  4IBF A;  1Q3C A;  2K47 A;  2Y0T A;  4GIT A;  4X66 M;  2UUB M;  5FTK A;  2NQ8 C;  3K1J A;  1L8Q A;  3GRU A;  4AI6 A;  1J7K A;  3UK6 A;  1XNQ M;  4JXJ A;  3HGI A;  5EP2 A;  5F3W A;  1IXR C;  1TH3 A;  3AOE A;  5KPR A;  3A46 A;  3IG5 A;  2YQZ A;  5FTJ A;  2XZF A;  1ORY B;  4G6Z A;  4LF8 M;  3DFZ A;  1R2Y A;  2UXC M;  3JR4 A;  2YNM D;  3HJS A;  1YSY A;  3W0F A;  1DGH A;  3HJQ A;  4IBJ A;  4W5W A;  2KRK A;  4B7H A;  3U6P A;  1UM8 A;  1T3T A;  5BPV A;  4DR4 M;  4K0K M;  4AKI A;  4LFB M;  1OFI A;  3SHG B;  4DV5 M;  4DV2 M;  2XFT A;  4M9Z A;  3KOZ E;  1N32 M;  3T15 A;  4B7G A;  4JI0 M;  3VLF B;  1JR3 D;  1MU5 A;  3T38 A;  4JV5 M;  4RF1 A;  4MGH A;  3SAW A;  4DR1 M;  5KQ8 A;  1PJJ A;  1C1K A;  2YR0 A;  4X65 M;  4BLC A;  3RFW A;  1I94 M;  3RGS A;  3SC3 A;  4GIP A;  3AJI B;  3L25 A;  4D81 A;  5IWA M;  1GLN A;  2ERC A;  3VK8 A;  2C96 A;  2YFQ A;  3JAM S;  4AG5 A;  1K82 A;  4LRT A;  1JQJ C;  1SXJ D;  2KRU A;  1L1Z A;  4GHA A;  2XFS A;  1EE8 A;  4YY3 M;  4JI4 M;  3GLI A;  1KSF X;  4NRW A;  3TWK A;  4L8R C;  5EP3 A;  4DV7 M;  8CAT A;  2ZAO A;  3GLF A;  3PVS A;  4GC9 A;  3J7A S;  2R62 A;  5A2Q S;  4LJ6 A;  4Z8X A;  2X8A A;  2F5S A;  5C1B A;  4PT5 A;  1NNU C;  2L6O A;  4I81 A;  1X37 A;  3GRR A;  4LF5 M;  5C18 A;  3D8B A;  3I4V A;  4QHS A;  3QAU A;  2G8L A;  4B3T M;  4YHH M;  1SXJ A;  3FYC A;  4IBG A;  3SYL A;  1Z5A A;  4S12 A;  3GLI B;  1S3S A;  1J09 A;  2DZN B;  2XF3 A;  3CF6 E;  3GQ4 A;  3LVW A;  4I4L A;  2DVW B;  3M6A A;  3UMM A;  5JI3 E;  2DHR A;  3L2A A;  2J7O A;  3B9P A;  1GKI A;  5ITR A;  3FKE A;  1D2N A;  4LZJ A;  2ZM6 M;  1G8P A;  1GL6 A;  3H4M A;  1HNX M;  2V1U A;  2G5G X;  4ITQ A;  1YE9 A;  2D7H A;  2F5Q A;  4B08 A;  2LNH C;  4LZZ A;  4PD2 A;  3FUX A;  3VFD A;  1R2Z A;  4LGY A;  4IJF A;  1QYR A;  2I7P A;  4B3S M;  4FW9 A;  5IT9 S;  1NJF A;  3AV0 A;  1HNW M;  4IBK A;  1IM2 A;  4GRI A;  3JR5 A;  4REZ A;  3KS8 A;  4IIW A;  2C9O A;  2XH9 A;  1Z5C A;  4RF0 A;  1QZM A;  3GP1 A;  2X4A A;  2L7I A;  5KQD A;  3GPX A;  1HR0 M;  2Y21 A;  3HHX A;  4OX9 M;  4NSR A;  4Z6Y A;  1I4W A;  1XXH A;  4PDG A;  3SAU A;  2HHH M;  4R3D A;  1XC8 A;  5KO3 A;  3D8L A;  3AKZ A;  4QOZ C;  4MGK E;  2R65 A;  3UZU A;  4PCZ A;  4LCB A;  3ZH9 B;  5ITU A;  1IY2 A;  1IBK M;  2L09 A;  4JI7 M;  4AKG A;  5ITQ A;  4AKH A;  1DGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...