1HR0M

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hr0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hr0M02
4LF6M 1I94M 4KHPM 3U6DA 4DR3M 2UUBM 4DV3M 4PD2A 3U6QA 2OQ4A 2UXBM 1PJIA 4ITQA 2UXDM 2OPFA 4K0KM 1XMOM 1FJGM 1K3WA 2F5SA 5ITQA 4JI6M 2HKJA 4JI4M 4DR5M 1N34M 4OX9M 5A2QS 4JV5M 4NXNM 4JI5M 4DV7M 4CISA 4YHHM 1EE8A 4DV1M 3SAUA 4DV5M 3GO8A 4G4NA 1NNJA 5ITXA 4B3RM 2UXCM 1L2DA 5IWAM 5FLXS 4DR1M 3T1YM 1L1ZA 1J5EM 3OTOM 3GPUA 3T1HM 2UUAM 1XNRM 4PDGA 2ZM6M 3JR5A 4DV4M 4DR2M 4DR7M 3U6EA 3A46A 1N33M 4LFAM 4GKKM 4LF5M 4JI0M 3C58A 4LFBM 3TWLA 4X66M 3U6CA 2F5PA 3U6MA 3DOAA 1TDZA 2Q2EB 4X64M 4AQYM 1Z59A 2F5NA 3U6SA 3SARA 3TWKA 2EA0A 3GPXA 3GPYA 5IT9S 1IBMM 4MB7A 4LF8M 1IBKM 4DUYM 2VQFM 4NRVA 4LFCM 1HNXM 3SAWA 1HNWM 2F5QA 1Z5BA 1PM5A 1MX0A 3U6PA 1N32M 1K82A 1HNZM 4NRWA 1MU5A 1IBLM 2UUCM 1PJJA 4JI3M 1K3XA 1XC8A 2HHHM 5ITRA 3SBJA 3J80S 3GQ3A 2F5OA 4X62M 4DV0M 2XZFA 1N36M 4GKJM 4DV6M 1HR0M 3SASA 1XNQM 4NXMM 5ITUA 3J81S 3A42A 4B3TM 3VK8A 4DV2M 3SATA 3U6LA 4G4RA 4JI8M 3JAMS 5ITTA 4LF9M 5ITXE 4B3MM 3TWMA 4G4OA 4X65M 3W0FA 4PCZA 3JR4A 4G4QA 2F4VM 1Z5AA 3J7AS 5BR8M 2UU9M 5LMNM 2ZBKB 1L1TA 4B3SM 4LF4M 4DR6M 1Z5CA 4LF7M 3VK7A 4JI7M 4PDIA 5ITYA 2XZUA 1R2ZA 4JI2M 1R2YA 1Q3CA 3SAVA 1Q39A 1KFVA 2E5LM 3GP1A 4JI1M 3GQ4A 1L2BA 3A45A 5LMUM 3GPPA 1TDHA 2VQEM 1XMQM 3GQ5A 1Q3BA 4JYAM 4DUZM 4YY3M 1L2CA 4DR4M 3U6OA
chains in the Genus database with same CATH superfamily
1I94M 5DYGA 2QZ4A 3PNVA 2KZUA 2UXBM 3B89A 5EP1A 3DA1A 4EIWA 2QSFX 3GLHB 1NHWC 4GRIA 3LQRA 1N34M 2FS1A 3GRVA 3HZJA 1G8PA 4DV1M 2DHYA 4B3RM 5ITXA 2UXCM 4ZPXA 4L16A 1W5TA 5FTNA 4DR1M 2C98A 2DWZB 1YUBA 2H1RA 3OTOM 1XNRM 2DWLA 2O5RA 4DR2M 2YQZA 4LJ5A 4DBGB 3A46A 4GH9A 1OKSA 2C96A 2DZNB 1A5TA 3MK6A 3TWLA 5EP3A 3U6CA 1TH4A 1GL6A 2ZTCA 1G3IA 1DV0A 4M9XA 1TH2A 1TDZA 2BJWA 2Q2EB 3EIHA 3VFDA 1X37A 1T43A 4X64M 1QQWA 4AKGA 7CATA 1Z59A 2DZLA 3AV0A 3SYKA 1HJPA 3HHZA 2G5GX 5IREB 2F5NA 3TWKA 3SARA 2QNJA 4GHAA 5IT9S 1KSFX 1ZMWA 4QHSA 2LH0A 1LV7A 2KZSA 1SXJE 3SMPA 1IN8A 5KPZA 1MN3A 4LJ4A 4HEOA 3VKHA 1HNWM 1P3QQ 2LBCA 1D0KA 1NY5A 2G8LA 3D8BA 1WGNA 3CF6E 1K82A 2L2DA 2DAGA 4NRWA 1IBLM 2DHRA 2R46A 4KLNA 1N78A 2C9OA 2C5RA 2QBYB 1NNUC 3HU1A 4FCTA 1K3XA 1NVMA 1R6BX 1WXQA 2J5YA 4I5SA 5ITRA 2HHHM 4X62M 2Y0QA 1SG9A 2X8AA 1XHBA 1N36M 3GRYA 5IZ7D 5L8RF 2R44A 4MGHA 2JY5A 1J09A 4DV6M 1HR0M 3C9PA 2CP8A 1YE9A 2KA6B 3B9PA 2L7IA 3K2LA 2XLJA 3FD9A 3RGSA 1DGHA 2MROB 3I51A 2O01F 3I4YA 3VDUA 1IY0A 2JY7A 2APLA 4CGYB 3HJ8A 5ITTA 5ITXE 3U60B 1DGFA 3TWMA 4X65M 3FTDA 3L2AA 4PCZA 4A3VB 2RGHA 3JR4A 2LVNC 1VQ1A 4IBCA 2CFOA 2LTUA 5GKNA 2M60A 5EXPA 2KEBA 1PJTA 2DI0A 2JWSA 2VF7A 5DYIA 4R71A 2LHCA 4DR6M 2JZ1A 3FE3A 1IXRC 2R65A 1AIPC 3GLIB 3KVWA 3RFWA 2JZ0A 3W0LB 3ZCBB 4GC5A 4Z6YA 1D0MA 3DZDA 1Y8GA 3AOEC 1T6OA 3BOSA 3QWLA 4LJ9A 1KFVA 1ZMUA 4JN6A 2XEPA 3J2PB 5LMUM 3CF0A 3FYCA 1YSYA 3AJIB 3KSJA 4FD2A 4KODA 3GPPA 2CV1A 3MMPA 2O25A 2R62A 1JR3E 3B7ZA 1BVSA 3A98B 4BBAA 3GQ5A 4D80A 3FUWA 4YY3M 3HGIA 2DNAA 4B08A 1L2CA 2B3TA 1XXHB 4OVZB 1NV9A 1EIJA 4DV3M 3WHKA 3UJNA 4LJ7A 5EP4A 3U6QA 3ILKA 1WJ7A 2ZANA 4L15A 4ITQA 3HHWA 4II7A 2UXDM 1DGBA 2D7GA 2OPFA 5JI3E 3SYLA 1K3WA 3K1JA 4NSRA 1FJGM 1NV8A 5ITQA 3QYBA 1IXZA 4OX9M 5A2QS 4JV5M 1PJQA 4LJ6A 2RGOA 3D8LA 3E21A 1SXJA 1ZAEA 4FCWA 2J7OA 4MH0E 4CIZA 3GO8A 4CISA 4D81A 1HT2E 1GKIA 2DVWB 3THGA 2HL7A 3GRUA 4QOSA 4FWDA 1L1ZA 2UUAM 2R6FA 3E4RA 2BJVA 2K0BX 4IJFA 2ZM6M 4DV4M 3J7BA 2JP7A 3U6EA 4UN2B 1N33M 3PVSA 1NJFA 4LF5M 3EIEA 3C58A 1R5LA 2DAIA 1FNNA 2MR9A 3C3EA 3HJSA 4S12A 4LFBM 3Q8GA 2XGNA 2HWJA 4L78A 4GITA 1OIPA 3CF2A 2KXEA 2CV0A 5FTLA 1QZMA 2DAEA 4IBJA 4AI6A 3U6SA 3KP0E 3WHLA 2JUJA 1E9RA 2LNHC 3IG5A 3TE6A 4BB9A 4MB7A 3VDPA 5KPTA 3ZC7B 5EXXA 2VQFM 1N75A 4NRVA 2JXNA 5BPVA 2QQ8A 5H37D 1HNXM 3HX3A 3SAWA 3KP1E 5EXTA 3ZH9B 2CWBA 1WIVA 3HWSA 1OTRA 3IECA 2BWEA 2FH0A 2JNHA 4Y28F 3I4VA 2LVQD 1PJJA 2DKLA 2QP9X 3R9XB 2KNZA 2R45A 1XC8A 3SBJA 4G6ZA 2F5OA 2XH9A 2VDBB 3M6AA 4GEWA 4M9SA 2FFJA 1C1KA 3SASA 2CHGA 1IY2A 1G4AE 4NXMM 3AL0C 4XK8F 1PJSA 2WSFF 4LG2A 4MGIE 3SHFA 1IN4A 2CHVA 4DV2M 1GJTA 1JR3A 1VEKA 3J27B 3U61A 4NL4H 4LF9M 2CEAA 2HAKA 2EKFA 3W0FA 2F4VM 2V1UA 1Z5AA 1G71A 3RGPA 2L4EA 4IIWA 1JQJC 5BR8M 3H4MA 5LMNM 2CE7A 2QCUA 5DNYA 3LMMA 1DGHB 4L8RC 4LF4M 1Z5CA 5FTKA 5KPRA 3PNYA 2C99A 1IXSA 1HQCA 1CUKA 1XWIA 3T38A 2R0IA 4PDIA 2FOIC 3NBXX 2L6OA 4LRTA 4LJAA 4P17A 1IN6A 2WSEF 2J7NA 2GQFA 4W5WA 2DAMA 2D7HA 1QVRA 2Z8YM 1UFZA 3A45A 4WW0A 4XBOA 1IFYA 2RRUA 4AKHA 3Q8XA 4L6V6 1XMQM 5EQTA 4JYAM 1WGLA 2L09A 1MX0A 2LHGA 4DUZM 4RF0A 4GKJM 4DR4M 4KHPM 2OO9A 3DFZA 3U6DA 4DR3M 2A5YB 2UUBM 2FE8A 3KW6A 1NJGA 1PGYA 3SC3A 2OQ4A 2KDLA 2MGWA 2JY6B 3UK6A 3GLFE 3AOGA 1PJIA 1QAQA 1EFUB 3KS8A 1XMOM 1NY6A 2F5SA 2W82A 1DGGA 1R7RA 2R18A 2HKJA 4DR5M 5EXSA 3MHVC 2D7EA 5C1BA 1KYIA 4NXNM 2FNAA 4G3OA 4YHHM 1EE8A 3CTWB 4LCBA 2XSZA 4FVMA 2R4EA 3E46A 8CATA 3VKGA 4LZJA 1V92A 3TPZA 3I04M 1L2DA 4WURA 3T1YM 1QDRA 2DENA 2BWBA 4D82A 1D0LA 1HT1E 3FTCA 3JR5A 4DR7M 4B7HA 2NQ8C 1C7YA 4LFAM 1QUTA 3QYEA 3NBIA 1SXJB 4JI0M 3KOWE 4FW9A 3V76A 1VEJA 2OOBA 2F5PA 1OIZA 3DOAA 4P16A 4Q7JA 1NO1A 3MJ5A 3E9SA 4XGIA 2Z3XA 2DWMA 4M0WA 3HU3A 1OQYA 4RNAA 3FUXA 4AQYM 1QDTA 4NC6A 2ERCA 4MM3B 2GNOA 4TUWA 3GPXA 4IBGA 2R4JA 3U5ZA 2V1CA 2Z4RA 1IBKM 4LF8M 4M0DA 4DUYM 2LWXA 5EJCA 4PT5A 3I01M 4LFCM 4OW0A 3LCUA 3FUTA 1OJLA 2ZTDA 1TF0B 2F5QA 3LVWA 1YLAA 2K6BA 1GJSA 3AFHA 4RKUF 1SXJC 3KXEC 1QAOA 4BLCA 1HNZM 4CHTB 2M5ZA 4FWGA 5JI2E 2UUCM 1VEGA 1ZV1A 4I4LA 1VG5A 2I7PA 2CRUA 4DV0M 1JB0F 2DAKA 2VIIA 2VF8A 1QANA 2YNMD 2P5TA 2ZAOA 3HHYA 3M0EA 3UZUA 3A42A 3J81S 4B3TM 4L4UA 1J7KA 3QAUA 2X49A 3RE8A 3AKZA 3KOXE 4I81A 2MH8A 4KT0F 3U6LA 1SXJD 3B7QA 4IJEA 3JAMS 4Z8XA 3LQQA 4B3MM 4G4OA 3GRRA 3LVVA 3UMMA 4G4QA 2KHHA 3GLFA 3J7AS 5KQDA 3HHXA 4B3SM 4QNMA 2LVOC 1GVNA 4LF7M 1Q02A 2OOAA 3VK7A 3U61B 4FWHA 1TGUA 5ITYA 1S3SA 1R2ZA 2YFQA 3IG8A 3FRIA 1R2YA 1I4WA 5C18A 1Q3CA 2L4FA 1QAMA 2JA2A 2KRKA 2V6ZM 4QHTA 4QNRA 3GLGE 3SAVA 2E5LM 1WR1B 2KW0A 3BBZA 3L27A 3GP1A 4JI1M 3K92A 3GQ4A 1L2BA 2CHQA 3KSXA 5E26A 4AG5A 2VQEM 1IXSB 3GLHA 3KS4A 3B7NA 4LGMA 1Q3BA 2QPAA 1VDDA 3M7GA 1PRBA 2EKKA 2QENA 3FUVA 3GLIE 2K9DA 3U6OA 5FTJA 1OFIA 1J5EM 4LF6M 4AW4A 1ZMVA 4PD2A 1G41A 2DZOB 3LCVB 1H6UA 5E6JA 2H5XA 3ZQJA 1RU3A 3FYDA 4IBBA 3IHPA 3L26A 3SFZA 4K0KM 1E9SA 2Z4SA 3SHGB 2QHOB 2DWNA 4JI6M 3PXGA 4JI4M 4HLQA 4GIPA 3BXWA 1QZEA 4JI5M 4MGZE 5DFLA 4DV7M 5F3WA 1XXHE 2KNAA 2C9CA 3K9PA 3L28A 4LY6A 4DV5M 3SAUA 3H4JA 1DO2A 4G4NA 1N77A 1NNJA 3K8ZA 1MJGM 5IWAM 2I7NA 2Z7JA 2KRUA 5FLXS 4AG6A 2JY8A 2KNVA 2CUZA 2ZAMA 2WZJA 4NSOB 3GPUA 3T1HM 1WHCA 4PDGA 2Y21A 3HU2A 2LVAA 3FTEA 1TH3A 1JR3D 1IN5A 1GO5A 3C3DA 1TTEA 2K47A 4GKKM 3UGJA 2WSCF 4B7FA 4GHLA 4X66M 3HKPA 1HQYE 5FTMA 3U6MA 3TQSA 3FUUA 4MGYE 1L8QA 1GABA 3R8FA 4R3DA 2XFSA 1XB2B 2EA0A 3GPYA 2QBYA 1IN7A 3KDSE 1IBMM 1F4IA 3F92A 2EUCA 2RKOA 4F2LA 4NOOB 1LTMA 2DXIA 3L25A 1TR8A 3SMSA 4IBIA 3PFIA 2EJSA 2XF3A 1DO0A 3W68A 3W67A 2LXEA 4LRSA 1Z5BA 3FRHA 4IBFA 3GLGB 1PM5A 4QOZC 4FCVA 3GLHE 1AUAA 3U6PA 1NHGC 2CV2A 3TL4X 1N32M 4MGKE 1MU5A 1NSFA 4GC9A 4IBDA 4OU7A 1E94E 3AOEA 3U5ZB 1GLNA 4JI3M 4LZZA 4REZA 3J80S 3GQ3A 3NWLA 4WP2A 1QYRA 2EO2A 2Y20A 3HJQA 3U60A 2XZFA 3KOYE 3GLGA 4F1IA 2XFTA 5FSWA 2MJ5B 1XNQM 1IQPA 1ZQ9A 1ORYB 4LJ8A 5ITUA 4KO8A 5EP2A 1OAIA 4HL4A 1T3TA 2X4AA 1IY1A 2YR0A 3K9OA 3VK8A 3SATA 2BNKA 4G4RA 3L29A 4JI8M 4R7GA 2XSZD 3GLIA 1G59A 5KQ8A 4AKIA 1GL7A 1QUSA 5KO3A 2L7HA 3LW5F 2UU9M 1L1TA 2ZBKB 1V33A 3KFUG 1UM8A 2HCBA 4RF1A 2LVPC 1IM2A 3FTFA 4AZFA 1OAOC 4JI7M 4M9ZA 3HY5A 1OFHA 3CGWA 3FKEA 2XZUA 4JI2M 1E32A 4IBKA 1XXHA 4OVZA 4I8OA 1Q39A 4GMQA 4B7GA 3GLFB 3KOZE 1R4GA 1W5SA 3B74A 2Y0TA 4CJ6A 1V34A 2AHMA 1D2NA 4JXJA 2G3QA 3T6PA 4IBEA 1TDHA 2N35A 4LGYA 4ANRA 1VDLA 3T15A 3VLFB 1Z6TA
chains in the Genus database with same CATH topology
1I94M 5DYGA 2QZ4A 3PNVA 2KZUA 2UXBM 5EP1A 3DA1A 4EIWA 3GLHB 1NHWC 4GRIA 3LQRA 1N34M 3GRVA 1G8PA 4DV1M 4B3RM 5ITXA 2UXCM 4ZPXA 4L16A 1W5TA 5FTNA 4DR1M 2C98A 2DWZB 1YUBA 2H1RA 3OTOM 1XNRM 2DWLA 2O5RA 4DR2M 2YQZA 4LJ5A 3A46A 4GH9A 2C96A 2DZNB 3MK6A 3TWLA 5EP3A 3U6CA 1TH4A 1GL6A 1G3IA 4M9XA 1TH2A 1TDZA 2BJWA 2Q2EB 3EIHA 3VFDA 1X37A 4X64M 1QQWA 4AKGA 7CATA 1Z59A 3AV0A 3SYKA 3HHZA 2F5NA 3SARA 2G5GX 5IREB 3TWKA 4GHAA 5IT9S 1KSFX 4QHSA 2LH0A 1LV7A 2KZSA 1SXJE 3SMPA 1IN8A 5KPZA 4LJ4A 3VKHA 1HNWM 1NY5A 2G8LA 3D8BA 3R9XB 3CF6E 1K82A 4NRWA 1IBLM 2DHRA 2R46A 4KLNA 1N78A 2C9OA 2C5RA 2QBYB 1NNUC 3HU1A 4FCTA 1K3XA 1NVMA 1R6BX 1WXQA 4I5SA 5ITRA 2HHHM 4X62M 2Y0QA 2X8AA 1XHBA 1N36M 3GRYA 5IZ7D 4DV6M 4MGHA 1HR0M 1J09A 1YE9A 2KA6B 3B9PA 2L7IA 3K2LA 2XLJA 3FD9A 3RGSA 1DGHA 3I51A 3I4YA 3VDUA 1IY0A 4CGYB 3HJ8A 5ITTA 5ITXE 3U60B 1DGFA 3TWMA 4X65M 3FTDA 3L2AA 4PCZA 4A3VB 2RGHA 3JR4A 4IBCA 2CFOA 5GKNA 2M60A 5EXPA 2KEBA 5DYIA 4DR6M 1IXRC 2R65A 3GLIB 3KVWA 3RFWA 3W0LB 3ZCBB 4GC5A 4Z6YA 3DZDA 3AOEC 3QWLA 3BOSA 4LJ9A 1KFVA 4JN6A 2XEPA 3J2PB 5LMUM 3CF0A 3FYCA 1YSYA 3AJIB 3KSJA 4FD2A 4KODA 3GPPA 2CV1A 2R62A 4BBAA 3GQ5A 3A98B 4D80A 3FUWA 4YY3M 3HGIA 4B08A 1L2CA 1XXHB 4OVZB 4DV3M 3WHKA 3UJNA 4LJ7A 5EP4A 3U6QA 3ILKA 2ZANA 4L15A 4ITQA 3HHWA 4II7A 2UXDM 1DGBA 2D7GA 2OPFA 5JI3E 3SYLA 1K3WA 3K1JA 4NSRA 1FJGM 5ITQA 1IXZA 4OX9M 5A2QS 4JV5M 4LJ6A 2RGOA 3D8LA 4CISA 1SXJA 1ZAEA 4FCWA 2J7OA 4MH0E 3GO8A 4D81A 1HT2E 1GKIA 2DVWB 3THGA 2HL7A 3GRUA 4QOSA 4FWDA 1L1ZA 2UUAM 3E4RA 2BJVA 4IJFA 2ZM6M 4DV4M 3J7BA 3U6EA 1N33M 3PVSA 1NJFA 4LF5M 3EIEA 3C58A 4LFBM 3HJSA 1FNNA 4S12A 2XGNA 4L78A 4GITA 3CF2A 2KXEA 2CV0A 5FTLA 1QZMA 4IBJA 4AI6A 3U6SA 3KP0E 3WHLA 1E9RA 2LNHC 3IG5A 3TE6A 4BB9A 4MB7A 3VDPA 5KPTA 3ZC7B 5EXXA 2VQFM 1N75A 4NRVA 5BPVA 5H37D 1HNXM 3SAWA 3KP1E 5EXTA 3ZH9B 3HWSA 3I4VA 1PJJA 2QP9X 2R45A 1XC8A 3SBJA 4G6ZA 2F5OA 2XH9A 3M6AA 4M9SA 1C1KA 2FFJA 3SASA 2CHGA 1IY2A 1G4AE 4NXMM 3AL0C 4LG2A 4MGIE 3SHFA 1IN4A 2CHVA 4DV2M 1JR3A 3U61A 3J27B 4NL4H 4LF9M 2CEAA 3W0FA 2F4VM 2V1UA 1Z5AA 3RGPA 4IIWA 1JQJC 5BR8M 3H4MA 5LMNM 2CE7A 2QCUA 5DNYA 3LMMA 1DGHB 4L8RC 4LF4M 1Z5CA 5FTKA 5KPRA 3PNYA 2C99A 1HQCA 1XWIA 3T38A 4PDIA 2FOIC 2L6OA 4LRTA 4LJAA 1IN6A 2J7NA 4W5WA 2D7HA 1QVRA 3A45A 4WW0A 4XBOA 4AKHA 3Q8XA 1XMQM 5EQTA 4JYAM 2L09A 1MX0A 4DUZM 4GKJM 4RF0A 4DR4M 4KHPM 3DFZA 3U6DA 4DR3M 2A5YB 2UUBM 2FE8A 3KW6A 1NJGA 3SC3A 2OQ4A 3UK6A 1PJIA 3AOGA 1QAQA 3KS8A 1XMOM 1NY6A 2F5SA 2W82A 1DGGA 1R7RA 2R18A 2HKJA 4DR5M 5EXSA 3MHVC 2D7EA 5C1BA 1KYIA 4NXNM 2FNAA 4YHHM 1EE8A 3CTWB 4LCBA 2XSZA 4FVMA 2R4EA 8CATA 3VKGA 4LZJA 3TPZA 1L2DA 4WURA 3T1YM 4D82A 1HT1E 3FTCA 3JR5A 4DR7M 4B7HA 2NQ8C 4LFAM 3NBIA 1SXJB 4JI0M 3KOWE 4FW9A 2F5PA 3DOAA 4P16A 2DWMA 3MJ5A 3E9SA 4XGIA 2Z3XA 4M0WA 3HU3A 4RNAA 3FUXA 4AQYM 2ERCA 4MM3B 4TUWA 3GPXA 4IBGA 2R4JA 3U5ZA 2V1CA 2Z4RA 1IBKM 4LF8M 4M0DA 4DUYM 2LWXA 5EJCA 4PT5A 4LFCM 4OW0A 3FUTA 1OJLA 2F5QA 3LVWA 3AFHA 1SXJC 3KXEC 1QAOA 4BLCA 1HNZM 4CHTB 2M5ZA 4FWGA 5JI2E 2UUCM 4I4LA 2I7PA 4DV0M 2VIIA 1QANA 2YNMD 2P5TA 2ZAOA 3HHYA 3M0EA 3UZUA 3A42A 3J81S 4B3TM 4L4UA 1J7KA 3QAUA 2X49A 3RE8A 3AKZA 3KOXE 4I81A 3U6LA 1SXJD 4IJEA 3JAMS 4Z8XA 3LQQA 4B3MM 4G4OA 3GRRA 3LVVA 3UMMA 4G4QA 3GLFA 3J7AS 5KQDA 3HHXA 4B3SM 4QNMA 1GVNA 4LF7M 3VK7A 3U61B 4FWHA 1TGUA 5ITYA 1S3SA 1R2ZA 2YFQA 3IG8A 1R2YA 1I4WA 5C18A 1Q3CA 4QHTA 1QAMA 2JA2A 2KRKA 2V6ZM 4QNRA 3SAVA 2E5LM 3L27A 2KW0A 3GP1A 4JI1M 3K92A 3GQ4A 1L2BA 2CHQA 3KSXA 5E26A 4AG5A 2VQEM 1IXSB 3GLHA 3KS4A 4LGMA 1Q3BA 2QPAA 1VDDA 3M7GA 3FUVA 2QENA 3U6OA 1J5EM 4LF6M 5FTJA 1OFIA 4AW4A 4PD2A 1G41A 2DZOB 1H6UA 5E6JA 3FYDA 4IBBA 3L26A 3SFZA 4K0KM 1E9SA 2Z4SA 3SHGB 2DWNA 4JI6M 3PXGA 4JI4M 4HLQA 4GIPA 4JI5M 4MGZE 4DV7M 5F3WA 2C9CA 3L28A 4LY6A 4DV5M 3SAUA 1DO2A 4G4NA 1N77A 1NNJA 3K8ZA 5IWAM 2I7NA 2Z7JA 2KRUA 5FLXS 4AG6A 2CUZA 2ZAMA 4NSOB 3GPUA 3T1HM 4PDGA 2Y21A 3HU2A 3FTEA 1TH3A 1JR3D 1IN5A 2K47A 4GKKM 3UGJA 4B7FA 4GHLA 4X66M 3HKPA 1HQYE 5FTMA 3U6MA 3TQSA 3FUUA 4MGYE 1L8QA 3R8FA 4R3DA 2XFSA 2EA0A 3GPYA 2QBYA 1IN7A 3KDSE 1IBMM 2EUCA 2RKOA 2DXIA 4NOOB 3L25A 3SMSA 4IBIA 3PFIA 2XF3A 1DO0A 2LXEA 4LRSA 1Z5BA 4IBFA 3GLGB 1PM5A 4QOZC 4FCVA 3U6PA 2CV2A 1NHGC 3TL4X 1N32M 4MGKE 1MU5A 1NSFA 4GC9A 4IBDA 4OU7A 1E94E 3AOEA 3U5ZB 1GLNA 4JI3M 4LZZA 4REZA 3J80S 3GQ3A 3NWLA 1QYRA 2EO2A 2Y20A 3HJQA 3U60A 2XZFA 3KOYE 3GLGA 2XFTA 5FSWA 1XNQM 1IQPA 1ZQ9A 1ORYB 4LJ8A 5ITUA 4KO8A 5EP2A 4HL4A 1T3TA 2X4AA 1IY1A 2YR0A 3VK8A 3SATA 2BNKA 4G4RA 3L29A 4JI8M 4R7GA 2XSZD 3GLIA 1G59A 5KQ8A 4AKIA 1GL7A 5KO3A 2L7HA 2UU9M 1L1TA 2ZBKB 3KFUG 1UM8A 2HCBA 4RF1A 1IM2A 3FTFA 4AZFA 4JI7M 4M9ZA 1OFHA 3FKEA 2XZUA 4JI2M 1E32A 4IBKA 1XXHA 4OVZA 4I8OA 1Q39A 4GMQA 4B7GA 3GLFB 3KOZE 1W5SA 2Y0TA 2AHMA 1D2NA 4JXJA 4IBEA 1TDHA 4LGYA 3T15A 3VLFB 1Z6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 M;  1I94 M;  4KHP M;  3U6D A;  4DR3 M;  2UUB M;  4DV3 M;  4PD2 A;  3U6Q A;  2OQ4 A;  2UXB M;  1PJI A;  4ITQ A;  2UXD M;  2OPF A;  4K0K M;  1XMO M;  1FJG M;  1K3W A;  2F5S A;  5ITQ A;  4JI6 M;  2HKJ A;  4JI4 M;  4DR5 M;  1N34 M;  4OX9 M;  5A2Q S;  4JV5 M;  4NXN M;  4JI5 M;  4DV7 M;  4CIS A;  4YHH M;  1EE8 A;  4DV1 M;  3SAU A;  4DV5 M;  3GO8 A;  4G4N A;  1NNJ A;  5ITX A;  4B3R M;  2UXC M;  1L2D A;  5IWA M;  5FLX S;  4DR1 M;  3T1Y M;  1L1Z A;  1J5E M;  3OTO M;  3GPU A;  3T1H M;  2UUA M;  1XNR M;  4PDG A;  2ZM6 M;  3JR5 A;  4DV4 M;  4DR2 M;  4DR7 M;  3U6E A;  3A46 A;  1N33 M;  4LFA M;  4GKK M;  4LF5 M;  4JI0 M;  3C58 A;  4LFB M;  3TWL A;  4X66 M;  3U6C A;  2F5P A;  3U6M A;  3DOA A;  1TDZ A;  2Q2E B;  4X64 M;  4AQY M;  1Z59 A;  2F5N A;  3U6S A;  3SAR A;  3TWK A;  2EA0 A;  3GPX A;  3GPY A;  5IT9 S;  1IBM M;  4MB7 A;  4LF8 M;  1IBK M;  4DUY M;  2VQF M;  4NRV A;  4LFC M;  1HNX M;  3SAW A;  1HNW M;  2F5Q A;  1Z5B A;  1PM5 A;  1MX0 A;  3U6P A;  1N32 M;  1K82 A;  1HNZ M;  4NRW A;  1MU5 A;  1IBL M;  2UUC M;  1PJJ A;  4JI3 M;  1K3X A;  1XC8 A;  2HHH M;  5ITR A;  3SBJ A;  3J80 S;  3GQ3 A;  2F5O A;  4X62 M;  4DV0 M;  2XZF A;  1N36 M;  4GKJ M;  4DV6 M;  1HR0 M;  3SAS A;  1XNQ M;  4NXM M;  5ITU A;  3J81 S;  3A42 A;  4B3T M;  3VK8 A;  4DV2 M;  3SAT A;  3U6L A;  4G4R A;  4JI8 M;  3JAM S;  5ITT A;  4LF9 M;  5ITX E;  4B3M M;  3TWM A;  4G4O A;  4X65 M;  3W0F A;  4PCZ A;  3JR4 A;  4G4Q A;  2F4V M;  1Z5A A;  3J7A S;  5BR8 M;  2UU9 M;  5LMN M;  2ZBK B;  1L1T A;  4B3S M;  4LF4 M;  4DR6 M;  1Z5C A;  4LF7 M;  3VK7 A;  4JI7 M;  4PDI A;  5ITY A;  2XZU A;  1R2Z A;  4JI2 M;  1R2Y A;  1Q3C A;  3SAV A;  1Q39 A;  1KFV A;  2E5L M;  3GP1 A;  4JI1 M;  3GQ4 A;  1L2B A;  3A45 A;  5LMU M;  3GPP A;  1TDH A;  2VQE M;  1XMQ M;  3GQ5 A;  1Q3B A;  4JYA M;  4DUZ M;  4YY3 M;  1L2C A;  4DR4 M;  3U6O A; 
#chains in the Genus database with same CATH topology
 1I94 M;  5DYG A;  2QZ4 A;  3PNV A;  2KZU A;  2UXB M;  3B89 A;  5EP1 A;  3DA1 A;  4EIW A;  2QSF X;  3GLH B;  1NHW C;  4GRI A;  3LQR A;  1N34 M;  2FS1 A;  3GRV A;  3HZJ A;  1G8P A;  4DV1 M;  2DHY A;  4B3R M;  5ITX A;  2UXC M;  4ZPX A;  4L16 A;  1W5T A;  5FTN A;  4DR1 M;  2C98 A;  2DWZ B;  1YUB A;  2H1R A;  3OTO M;  1XNR M;  2DWL A;  2O5R A;  4DR2 M;  2YQZ A;  4LJ5 A;  4DBG B;  3A46 A;  4GH9 A;  1OKS A;  2C96 A;  2DZN B;  1A5T A;  3MK6 A;  3TWL A;  5EP3 A;  3U6C A;  1TH4 A;  1GL6 A;  2ZTC A;  1G3I A;  1DV0 A;  4M9X A;  1TH2 A;  1TDZ A;  2BJW A;  2Q2E B;  3EIH A;  3VFD A;  1X37 A;  1T43 A;  4X64 M;  1QQW A;  4AKG A;  7CAT A;  1Z59 A;  2DZL A;  3AV0 A;  3SYK A;  1HJP A;  3HHZ A;  2G5G X;  5IRE B;  2F5N A;  3TWK A;  3SAR A;  2QNJ A;  4GHA A;  5IT9 S;  1KSF X;  1ZMW A;  4QHS A;  2LH0 A;  1LV7 A;  2KZS A;  1SXJ E;  3SMP A;  1IN8 A;  5KPZ A;  1MN3 A;  4LJ4 A;  4HEO A;  3VKH A;  1HNW M;  1P3Q Q;  2LBC A;  1D0K A;  1NY5 A;  2G8L A;  3D8B A;  1WGN A;  3CF6 E;  1K82 A;  2L2D A;  2DAG A;  4NRW A;  1IBL M;  2DHR A;  2R46 A;  4KLN A;  1N78 A;  2C9O A;  2C5R A;  2QBY B;  1NNU C;  3HU1 A;  4FCT A;  1K3X A;  1NVM A;  1R6B X;  1WXQ A;  2J5Y A;  4I5S A;  5ITR A;  2HHH M;  4X62 M;  2Y0Q A;  1SG9 A;  2X8A A;  1XHB A;  1N36 M;  3GRY A;  5IZ7 D;  5L8R F;  2R44 A;  4MGH A;  2JY5 A;  1J09 A;  4DV6 M;  1HR0 M;  3C9P A;  2CP8 A;  1YE9 A;  2KA6 B;  3B9P A;  2L7I A;  3K2L A;  2XLJ A;  3FD9 A;  3RGS A;  1DGH A;  2MRO B;  3I51 A;  2O01 F;  3I4Y A;  3VDU A;  1IY0 A;  2JY7 A;  2APL A;  4CGY B;  3HJ8 A;  5ITT A;  5ITX E;  3U60 B;  1DGF A;  3TWM A;  4X65 M;  3FTD A;  3L2A A;  4PCZ A;  4A3V B;  2RGH A;  3JR4 A;  2LVN C;  1VQ1 A;  4IBC A;  2CFO A;  2LTU A;  5GKN A;  2M60 A;  5EXP A;  2KEB A;  1PJT A;  2DI0 A;  2JWS A;  2VF7 A;  5DYI A;  4R71 A;  2LHC A;  4DR6 M;  2JZ1 A;  3FE3 A;  1IXR C;  2R65 A;  1AIP C;  3GLI B;  3KVW A;  3RFW A;  2JZ0 A;  3W0L B;  3ZCB B;  4GC5 A;  4Z6Y A;  1D0M A;  3DZD A;  1Y8G A;  3AOE C;  1T6O A;  3BOS A;  3QWL A;  4LJ9 A;  1KFV A;  1ZMU A;  4JN6 A;  2XEP A;  3J2P B;  5LMU M;  3CF0 A;  3FYC A;  1YSY A;  3AJI B;  3KSJ A;  4FD2 A;  4KOD A;  3GPP A;  2CV1 A;  3MMP A;  2O25 A;  2R62 A;  1JR3 E;  3B7Z A;  1BVS A;  3A98 B;  4BBA A;  3GQ5 A;  4D80 A;  3FUW A;  4YY3 M;  3HGI A;  2DNA A;  4B08 A;  1L2C A;  2B3T A;  1XXH B;  4OVZ B;  1NV9 A;  1EIJ A;  4DV3 M;  3WHK A;  3UJN A;  4LJ7 A;  5EP4 A;  3U6Q A;  3ILK A;  1WJ7 A;  2ZAN A;  4L15 A;  4ITQ A;  3HHW A;  4II7 A;  2UXD M;  1DGB A;  2D7G A;  2OPF A;  5JI3 E;  3SYL A;  1K3W A;  3K1J A;  4NSR A;  1FJG M;  1NV8 A;  5ITQ A;  3QYB A;  1IXZ A;  4OX9 M;  5A2Q S;  4JV5 M;  1PJQ A;  4LJ6 A;  2RGO A;  3D8L A;  3E21 A;  1SXJ A;  1ZAE A;  4FCW A;  2J7O A;  4MH0 E;  4CIZ A;  3GO8 A;  4CIS A;  4D81 A;  1HT2 E;  1GKI A;  2DVW B;  3THG A;  2HL7 A;  3GRU A;  4QOS A;  4FWD A;  1L1Z A;  2UUA M;  2R6F A;  3E4R A;  2BJV A;  2K0B X;  4IJF A;  2ZM6 M;  4DV4 M;  3J7B A;  2JP7 A;  3U6E A;  4UN2 B;  1N33 M;  3PVS A;  1NJF A;  4LF5 M;  3EIE A;  3C58 A;  1R5L A;  2DAI A;  1FNN A;  2MR9 A;  3C3E A;  3HJS A;  4S12 A;  4LFB M;  3Q8G A;  2XGN A;  2HWJ A;  4L78 A;  4GIT A;  1OIP A;  3CF2 A;  2KXE A;  2CV0 A;  5FTL A;  1QZM A;  2DAE A;  4IBJ A;  4AI6 A;  3U6S A;  3KP0 E;  3WHL A;  2JUJ A;  1E9R A;  2LNH C;  3IG5 A;  3TE6 A;  4BB9 A;  4MB7 A;  3VDP A;  5KPT A;  3ZC7 B;  5EXX A;  2VQF M;  1N75 A;  4NRV A;  2JXN A;  5BPV A;  2QQ8 A;  5H37 D;  1HNX M;  3HX3 A;  3SAW A;  3KP1 E;  5EXT A;  3ZH9 B;  2CWB A;  1WIV A;  3HWS A;  1OTR A;  3IEC A;  2BWE A;  2FH0 A;  2JNH A;  4Y28 F;  3I4V A;  2LVQ D;  1PJJ A;  2DKL A;  2QP9 X;  3R9X B;  2KNZ A;  2R45 A;  1XC8 A;  3SBJ A;  4G6Z A;  2F5O A;  2XH9 A;  2VDB B;  3M6A A;  4GEW A;  4M9S A;  2FFJ A;  1C1K A;  3SAS A;  2CHG A;  1IY2 A;  1G4A E;  4NXM M;  3AL0 C;  4XK8 F;  1PJS A;  2WSF F;  4LG2 A;  4MGI E;  3SHF A;  1IN4 A;  2CHV A;  4DV2 M;  1GJT A;  1JR3 A;  1VEK A;  3J27 B;  3U61 A;  4NL4 H;  4LF9 M;  2CEA A;  2HAK A;  2EKF A;  3W0F A;  2F4V M;  2V1U A;  1Z5A A;  1G71 A;  3RGP A;  2L4E A;  4IIW A;  1JQJ C;  5BR8 M;  3H4M A;  5LMN M;  2CE7 A;  2QCU A;  5DNY A;  3LMM A;  1DGH B;  4L8R C;  4LF4 M;  1Z5C A;  5FTK A;  5KPR A;  3PNY A;  2C99 A;  1IXS A;  1HQC A;  1CUK A;  1XWI A;  3T38 A;  2R0I A;  4PDI A;  2FOI C;  3NBX X;  2L6O A;  4LRT A;  4LJA A;  4P17 A;  1IN6 A;  2WSE F;  2J7N A;  2GQF A;  4W5W A;  2DAM A;  2D7H A;  1QVR A;  2Z8Y M;  1UFZ A;  3A45 A;  4WW0 A;  4XBO A;  1IFY A;  2RRU A;  4AKH A;  3Q8X A;  4L6V 6;  1XMQ M;  5EQT A;  4JYA M;  1WGL A;  2L09 A;  1MX0 A;  2LHG A;  4DUZ M;  4RF0 A;  4GKJ M;  4DR4 M;  4KHP M;  2OO9 A;  3DFZ A;  3U6D A;  4DR3 M;  2A5Y B;  2UUB M;  2FE8 A;  3KW6 A;  1NJG A;  1PGY A;  3SC3 A;  2OQ4 A;  2KDL A;  2MGW A;  2JY6 B;  3UK6 A;  3GLF E;  3AOG A;  1PJI A;  1QAQ A;  1EFU B;  3KS8 A;  1XMO M;  1NY6 A;  2F5S A;  2W82 A;  1DGG A;  1R7R A;  2R18 A;  2HKJ A;  4DR5 M;  5EXS A;  3MHV C;  2D7E A;  5C1B A;  1KYI A;  4NXN M;  2FNA A;  4G3O A;  4YHH M;  1EE8 A;  3CTW B;  4LCB A;  2XSZ A;  4FVM A;  2R4E A;  3E46 A;  8CAT A;  3VKG A;  4LZJ A;  1V92 A;  3TPZ A;  3I04 M;  1L2D A;  4WUR A;  3T1Y M;  1QDR A;  2DEN A;  2BWB A;  4D82 A;  1D0L A;  1HT1 E;  3FTC A;  3JR5 A;  4DR7 M;  4B7H A;  2NQ8 C;  1C7Y A;  4LFA M;  1QUT A;  3QYE A;  3NBI A;  1SXJ B;  4JI0 M;  3KOW E;  4FW9 A;  3V76 A;  1VEJ A;  2OOB A;  2F5P A;  1OIZ A;  3DOA A;  4P16 A;  4Q7J A;  1NO1 A;  3MJ5 A;  3E9S A;  4XGI A;  2Z3X A;  2DWM A;  4M0W A;  3HU3 A;  1OQY A;  4RNA A;  3FUX A;  4AQY M;  1QDT A;  4NC6 A;  2ERC A;  4MM3 B;  2GNO A;  4TUW A;  3GPX A;  4IBG A;  2R4J A;  3U5Z A;  2V1C A;  2Z4R A;  1IBK M;  4LF8 M;  4M0D A;  4DUY M;  2LWX A;  5EJC A;  4PT5 A;  3I01 M;  4LFC M;  4OW0 A;  3LCU A;  3FUT A;  1OJL A;  2ZTD A;  1TF0 B;  2F5Q A;  3LVW A;  1YLA A;  2K6B A;  1GJS A;  3AFH A;  4RKU F;  1SXJ C;  3KXE C;  1QAO A;  4BLC A;  1HNZ M;  4CHT B;  2M5Z A;  4FWG A;  5JI2 E;  2UUC M;  1VEG A;  1ZV1 A;  4I4L A;  1VG5 A;  2I7P A;  2CRU A;  4DV0 M;  1JB0 F;  2DAK A;  2VII A;  2VF8 A;  1QAN A;  2YNM D;  2P5T A;  2ZAO A;  3HHY A;  3M0E A;  3UZU A;  3A42 A;  3J81 S;  4B3T M;  4L4U A;  1J7K A;  3QAU A;  2X49 A;  3RE8 A;  3AKZ A;  3KOX E;  4I81 A;  2MH8 A;  4KT0 F;  3U6L A;  1SXJ D;  3B7Q A;  4IJE A;  3JAM S;  4Z8X A;  3LQQ A;  4B3M M;  4G4O A;  3GRR A;  3LVV A;  3UMM A;  4G4Q A;  2KHH A;  3GLF A;  3J7A S;  5KQD A;  3HHX A;  4B3S M;  4QNM A;  2LVO C;  1GVN A;  4LF7 M;  1Q02 A;  2OOA A;  3VK7 A;  3U61 B;  4FWH A;  1TGU A;  5ITY A;  1S3S A;  1R2Z A;  2YFQ A;  3IG8 A;  3FRI A;  1R2Y A;  1I4W A;  5C18 A;  1Q3C A;  2L4F A;  1QAM A;  2JA2 A;  2KRK A;  2V6Z M;  4QHT A;  4QNR A;  3GLG E;  3SAV A;  2E5L M;  1WR1 B;  2KW0 A;  3BBZ A;  3L27 A;  3GP1 A;  4JI1 M;  3K92 A;  3GQ4 A;  1L2B A;  2CHQ A;  3KSX A;  5E26 A;  4AG5 A;  2VQE M;  1IXS B;  3GLH A;  3KS4 A;  3B7N A;  4LGM A;  1Q3B A;  2QPA A;  1VDD A;  3M7G A;  1PRB A;  2EKK A;  2QEN A;  3FUV A;  3GLI E;  2K9D A;  3U6O A;  5FTJ A;  1OFI A;  1J5E M;  4LF6 M;  4AW4 A;  1ZMV A;  4PD2 A;  1G41 A;  2DZO B;  3LCV B;  1H6U A;  5E6J A;  2H5X A;  3ZQJ A;  1RU3 A;  3FYD A;  4IBB A;  3IHP A;  3L26 A;  3SFZ A;  4K0K M;  1E9S A;  2Z4S A;  3SHG B;  2QHO B;  2DWN A;  4JI6 M;  3PXG A;  4JI4 M;  4HLQ A;  4GIP A;  3BXW A;  1QZE A;  4JI5 M;  4MGZ E;  5DFL A;  4DV7 M;  5F3W A;  1XXH E;  2KNA A;  2C9C A;  3K9P A;  3L28 A;  4LY6 A;  4DV5 M;  3SAU A;  3H4J A;  1DO2 A;  4G4N A;  1N77 A;  1NNJ A;  3K8Z A;  1MJG M;  5IWA M;  2I7N A;  2Z7J A;  2KRU A;  5FLX S;  4AG6 A;  2JY8 A;  2KNV A;  2CUZ A;  2ZAM A;  2WZJ A;  4NSO B;  3GPU A;  3T1H M;  1WHC A;  4PDG A;  2Y21 A;  3HU2 A;  2LVA A;  3FTE A;  1TH3 A;  1JR3 D;  1IN5 A;  1GO5 A;  3C3D A;  1TTE A;  2K47 A;  4GKK M;  3UGJ A;  2WSC F;  4B7F A;  4GHL A;  4X66 M;  3HKP A;  1HQY E;  5FTM A;  3U6M A;  3TQS A;  3FUU A;  4MGY E;  1L8Q A;  1GAB A;  3R8F A;  4R3D A;  2XFS A;  1XB2 B;  2EA0 A;  3GPY A;  2QBY A;  1IN7 A;  3KDS E;  1IBM M;  1F4I A;  3F92 A;  2EUC A;  2RKO A;  4F2L A;  4NOO B;  1LTM A;  2DXI A;  3L25 A;  1TR8 A;  3SMS A;  4IBI A;  3PFI A;  2EJS A;  2XF3 A;  1DO0 A;  3W68 A;  3W67 A;  2LXE A;  4LRS A;  1Z5B A;  3FRH A;  4IBF A;  3GLG B;  1PM5 A;  4QOZ C;  4FCV A;  3GLH E;  1AUA A;  3U6P A;  1NHG C;  2CV2 A;  3TL4 X;  1N32 M;  4MGK E;  1MU5 A;  1NSF A;  4GC9 A;  4IBD A;  4OU7 A;  1E94 E;  3AOE A;  3U5Z B;  1GLN A;  4JI3 M;  4LZZ A;  4REZ A;  3J80 S;  3GQ3 A;  3NWL A;  4WP2 A;  1QYR A;  2EO2 A;  2Y20 A;  3HJQ A;  3U60 A;  2XZF A;  3KOY E;  3GLG A;  4F1I A;  2XFT A;  5FSW A;  2MJ5 B;  1XNQ M;  1IQP A;  1ZQ9 A;  1ORY B;  4LJ8 A;  5ITU A;  4KO8 A;  5EP2 A;  1OAI A;  4HL4 A;  1T3T A;  2X4A A;  1IY1 A;  2YR0 A;  3K9O A;  3VK8 A;  3SAT A;  2BNK A;  4G4R A;  3L29 A;  4JI8 M;  4R7G A;  2XSZ D;  3GLI A;  1G59 A;  5KQ8 A;  4AKI A;  1GL7 A;  1QUS A;  5KO3 A;  2L7H A;  3LW5 F;  2UU9 M;  1L1T A;  2ZBK B;  1V33 A;  3KFU G;  1UM8 A;  2HCB A;  4RF1 A;  2LVP C;  1IM2 A;  3FTF A;  4AZF A;  1OAO C;  4JI7 M;  4M9Z A;  3HY5 A;  1OFH A;  3CGW A;  3FKE A;  2XZU A;  4JI2 M;  1E32 A;  4IBK A;  1XXH A;  4OVZ A;  4I8O A;  1Q39 A;  4GMQ A;  4B7G A;  3GLF B;  3KOZ E;  1R4G A;  1W5S A;  3B74 A;  2Y0T A;  4CJ6 A;  1V34 A;  2AHM A;  1D2N A;  4JXJ A;  2G3Q A;  3T6P A;  4IBE A;  1TDH A;  2N35 A;  4LGY A;  4ANR A;  1VDL A;  3T15 A;  3VLF B;  1Z6T A; 
#chains in the Genus database with same CATH homology
 1I94 M;  5DYG A;  2QZ4 A;  3PNV A;  2KZU A;  2UXB M;  5EP1 A;  3DA1 A;  4EIW A;  3GLH B;  1NHW C;  4GRI A;  3LQR A;  1N34 M;  3GRV A;  1G8P A;  4DV1 M;  4B3R M;  5ITX A;  2UXC M;  4ZPX A;  4L16 A;  1W5T A;  5FTN A;  4DR1 M;  2C98 A;  2DWZ B;  1YUB A;  2H1R A;  3OTO M;  1XNR M;  2DWL A;  2O5R A;  4DR2 M;  2YQZ A;  4LJ5 A;  3A46 A;  4GH9 A;  2C96 A;  2DZN B;  3MK6 A;  3TWL A;  5EP3 A;  3U6C A;  1TH4 A;  1GL6 A;  1G3I A;  4M9X A;  1TH2 A;  1TDZ A;  2BJW A;  2Q2E B;  3EIH A;  3VFD A;  1X37 A;  4X64 M;  1QQW A;  4AKG A;  7CAT A;  1Z59 A;  3AV0 A;  3SYK A;  3HHZ A;  2F5N A;  3SAR A;  2G5G X;  5IRE B;  3TWK A;  4GHA A;  5IT9 S;  1KSF X;  4QHS A;  2LH0 A;  1LV7 A;  2KZS A;  1SXJ E;  3SMP A;  1IN8 A;  5KPZ A;  4LJ4 A;  3VKH A;  1HNW M;  1NY5 A;  2G8L A;  3D8B A;  3R9X B;  3CF6 E;  1K82 A;  4NRW A;  1IBL M;  2DHR A;  2R46 A;  4KLN A;  1N78 A;  2C9O A;  2C5R A;  2QBY B;  1NNU C;  3HU1 A;  4FCT A;  1K3X A;  1NVM A;  1R6B X;  1WXQ A;  4I5S A;  5ITR A;  2HHH M;  4X62 M;  2Y0Q A;  2X8A A;  1XHB A;  1N36 M;  3GRY A;  5IZ7 D;  4DV6 M;  4MGH A;  1HR0 M;  1J09 A;  1YE9 A;  2KA6 B;  3B9P A;  2L7I A;  3K2L A;  2XLJ A;  3FD9 A;  3RGS A;  1DGH A;  3I51 A;  3I4Y A;  3VDU A;  1IY0 A;  4CGY B;  3HJ8 A;  5ITT A;  5ITX E;  3U60 B;  1DGF A;  3TWM A;  4X65 M;  3FTD A;  3L2A A;  4PCZ A;  4A3V B;  2RGH A;  3JR4 A;  4IBC A;  2CFO A;  5GKN A;  2M60 A;  5EXP A;  2KEB A;  5DYI A;  4DR6 M;  1IXR C;  2R65 A;  3GLI B;  3KVW A;  3RFW A;  3W0L B;  3ZCB B;  4GC5 A;  4Z6Y A;  3DZD A;  3AOE C;  3QWL A;  3BOS A;  4LJ9 A;  1KFV A;  4JN6 A;  2XEP A;  3J2P B;  5LMU M;  3CF0 A;  3FYC A;  1YSY A;  3AJI B;  3KSJ A;  4FD2 A;  4KOD A;  3GPP A;  2CV1 A;  2R62 A;  4BBA A;  3GQ5 A;  3A98 B;  4D80 A;  3FUW A;  4YY3 M;  3HGI A;  4B08 A;  1L2C A;  1XXH B;  4OVZ B;  4DV3 M;  3WHK A;  3UJN A;  4LJ7 A;  5EP4 A;  3U6Q A;  3ILK A;  2ZAN A;  4L15 A;  4ITQ A;  3HHW A;  4II7 A;  2UXD M;  1DGB A;  2D7G A;  2OPF A;  5JI3 E;  3SYL A;  1K3W A;  3K1J A;  4NSR A;  1FJG M;  5ITQ A;  1IXZ A;  4OX9 M;  5A2Q S;  4JV5 M;  4LJ6 A;  2RGO A;  3D8L A;  4CIS A;  1SXJ A;  1ZAE A;  4FCW A;  2J7O A;  4MH0 E;  3GO8 A;  4D81 A;  1HT2 E;  1GKI A;  2DVW B;  3THG A;  2HL7 A;  3GRU A;  4QOS A;  4FWD A;  1L1Z A;  2UUA M;  3E4R A;  2BJV A;  4IJF A;  2ZM6 M;  4DV4 M;  3J7B A;  3U6E A;  1N33 M;  3PVS A;  1NJF A;  4LF5 M;  3EIE A;  3C58 A;  4LFB M;  3HJS A;  1FNN A;  4S12 A;  2XGN A;  4L78 A;  4GIT A;  3CF2 A;  2KXE A;  2CV0 A;  5FTL A;  1QZM A;  4IBJ A;  4AI6 A;  3U6S A;  3KP0 E;  3WHL A;  1E9R A;  2LNH C;  3IG5 A;  3TE6 A;  4BB9 A;  4MB7 A;  3VDP A;  5KPT A;  3ZC7 B;  5EXX A;  2VQF M;  1N75 A;  4NRV A;  5BPV A;  5H37 D;  1HNX M;  3SAW A;  3KP1 E;  5EXT A;  3ZH9 B;  3HWS A;  3I4V A;  1PJJ A;  2QP9 X;  2R45 A;  1XC8 A;  3SBJ A;  4G6Z A;  2F5O A;  2XH9 A;  3M6A A;  4M9S A;  1C1K A;  2FFJ A;  3SAS A;  2CHG A;  1IY2 A;  1G4A E;  4NXM M;  3AL0 C;  4LG2 A;  4MGI E;  3SHF A;  1IN4 A;  2CHV A;  4DV2 M;  1JR3 A;  3U61 A;  3J27 B;  4NL4 H;  4LF9 M;  2CEA A;  3W0F A;  2F4V M;  2V1U A;  1Z5A A;  3RGP A;  4IIW A;  1JQJ C;  5BR8 M;  3H4M A;  5LMN M;  2CE7 A;  2QCU A;  5DNY A;  3LMM A;  1DGH B;  4L8R C;  4LF4 M;  1Z5C A;  5FTK A;  5KPR A;  3PNY A;  2C99 A;  1HQC A;  1XWI A;  3T38 A;  4PDI A;  2FOI C;  2L6O A;  4LRT A;  4LJA A;  1IN6 A;  2J7N A;  4W5W A;  2D7H A;  1QVR A;  3A45 A;  4WW0 A;  4XBO A;  4AKH A;  3Q8X A;  1XMQ M;  5EQT A;  4JYA M;  2L09 A;  1MX0 A;  4DUZ M;  4GKJ M;  4RF0 A;  4DR4 M;  4KHP M;  3DFZ A;  3U6D A;  4DR3 M;  2A5Y B;  2UUB M;  2FE8 A;  3KW6 A;  1NJG A;  3SC3 A;  2OQ4 A;  3UK6 A;  1PJI A;  3AOG A;  1QAQ A;  3KS8 A;  1XMO M;  1NY6 A;  2F5S A;  2W82 A;  1DGG A;  1R7R A;  2R18 A;  2HKJ A;  4DR5 M;  5EXS A;  3MHV C;  2D7E A;  5C1B A;  1KYI A;  4NXN M;  2FNA A;  4YHH M;  1EE8 A;  3CTW B;  4LCB A;  2XSZ A;  4FVM A;  2R4E A;  8CAT A;  3VKG A;  4LZJ A;  3TPZ A;  1L2D A;  4WUR A;  3T1Y M;  4D82 A;  1HT1 E;  3FTC A;  3JR5 A;  4DR7 M;  4B7H A;  2NQ8 C;  4LFA M;  3NBI A;  1SXJ B;  4JI0 M;  3KOW E;  4FW9 A;  2F5P A;  3DOA A;  4P16 A;  2DWM A;  3MJ5 A;  3E9S A;  4XGI A;  2Z3X A;  4M0W A;  3HU3 A;  4RNA A;  3FUX A;  4AQY M;  2ERC A;  4MM3 B;  4TUW A;  3GPX A;  4IBG A;  2R4J A;  3U5Z A;  2V1C A;  2Z4R A;  1IBK M;  4LF8 M;  4M0D A;  4DUY M;  2LWX A;  5EJC A;  4PT5 A;  4LFC M;  4OW0 A;  3FUT A;  1OJL A;  2F5Q A;  3LVW A;  3AFH A;  1SXJ C;  3KXE C;  1QAO A;  4BLC A;  1HNZ M;  4CHT B;  2M5Z A;  4FWG A;  5JI2 E;  2UUC M;  4I4L A;  2I7P A;  4DV0 M;  2VII A;  1QAN A;  2YNM D;  2P5T A;  2ZAO A;  3HHY A;  3M0E A;  3UZU A;  3A42 A;  3J81 S;  4B3T M;  4L4U A;  1J7K A;  3QAU A;  2X49 A;  3RE8 A;  3AKZ A;  3KOX E;  4I81 A;  3U6L A;  1SXJ D;  4IJE A;  3JAM S;  4Z8X A;  3LQQ A;  4B3M M;  4G4O A;  3GRR A;  3LVV A;  3UMM A;  4G4Q A;  3GLF A;  3J7A S;  5KQD A;  3HHX A;  4B3S M;  4QNM A;  1GVN A;  4LF7 M;  3VK7 A;  3U61 B;  4FWH A;  1TGU A;  5ITY A;  1S3S A;  1R2Z A;  2YFQ A;  3IG8 A;  1R2Y A;  1I4W A;  5C18 A;  1Q3C A;  4QHT A;  1QAM A;  2JA2 A;  2KRK A;  2V6Z M;  4QNR A;  3SAV A;  2E5L M;  3L27 A;  2KW0 A;  3GP1 A;  4JI1 M;  3K92 A;  3GQ4 A;  1L2B A;  2CHQ A;  3KSX A;  5E26 A;  4AG5 A;  2VQE M;  1IXS B;  3GLH A;  3KS4 A;  4LGM A;  1Q3B A;  2QPA A;  1VDD A;  3M7G A;  3FUV A;  2QEN A;  3U6O A;  1J5E M;  4LF6 M;  5FTJ A;  1OFI A;  4AW4 A;  4PD2 A;  1G41 A;  2DZO B;  1H6U A;  5E6J A;  3FYD A;  4IBB A;  3L26 A;  3SFZ A;  4K0K M;  1E9S A;  2Z4S A;  3SHG B;  2DWN A;  4JI6 M;  3PXG A;  4JI4 M;  4HLQ A;  4GIP A;  4JI5 M;  4MGZ E;  4DV7 M;  5F3W A;  2C9C A;  3L28 A;  4LY6 A;  4DV5 M;  3SAU A;  1DO2 A;  4G4N A;  1N77 A;  1NNJ A;  3K8Z A;  5IWA M;  2I7N A;  2Z7J A;  2KRU A;  5FLX S;  4AG6 A;  2CUZ A;  2ZAM A;  4NSO B;  3GPU A;  3T1H M;  4PDG A;  2Y21 A;  3HU2 A;  3FTE A;  1TH3 A;  1JR3 D;  1IN5 A;  2K47 A;  4GKK M;  3UGJ A;  4B7F A;  4GHL A;  4X66 M;  3HKP A;  1HQY E;  5FTM A;  3U6M A;  3TQS A;  3FUU A;  4MGY E;  1L8Q A;  3R8F A;  4R3D A;  2XFS A;  2EA0 A;  3GPY A;  2QBY A;  1IN7 A;  3KDS E;  1IBM M;  2EUC A;  2RKO A;  2DXI A;  4NOO B;  3L25 A;  3SMS A;  4IBI A;  3PFI A;  2XF3 A;  1DO0 A;  2LXE A;  4LRS A;  1Z5B A;  4IBF A;  3GLG B;  1PM5 A;  4QOZ C;  4FCV A;  3U6P A;  2CV2 A;  1NHG C;  3TL4 X;  1N32 M;  4MGK E;  1MU5 A;  1NSF A;  4GC9 A;  4IBD A;  4OU7 A;  1E94 E;  3AOE A;  3U5Z B;  1GLN A;  4JI3 M;  4LZZ A;  4REZ A;  3J80 S;  3GQ3 A;  3NWL A;  1QYR A;  2EO2 A;  2Y20 A;  3HJQ A;  3U60 A;  2XZF A;  3KOY E;  3GLG A;  2XFT A;  5FSW A;  1XNQ M;  1IQP A;  1ZQ9 A;  1ORY B;  4LJ8 A;  5ITU A;  4KO8 A;  5EP2 A;  4HL4 A;  1T3T A;  2X4A A;  1IY1 A;  2YR0 A;  3VK8 A;  3SAT A;  2BNK A;  4G4R A;  3L29 A;  4JI8 M;  4R7G A;  2XSZ D;  3GLI A;  1G59 A;  5KQ8 A;  4AKI A;  1GL7 A;  5KO3 A;  2L7H A;  2UU9 M;  1L1T A;  2ZBK B;  3KFU G;  1UM8 A;  2HCB A;  4RF1 A;  1IM2 A;  3FTF A;  4AZF A;  4JI7 M;  4M9Z A;  1OFH A;  3FKE A;  2XZU A;  4JI2 M;  1E32 A;  4IBK A;  1XXH A;  4OVZ A;  4I8O A;  1Q39 A;  4GMQ A;  4B7G A;  3GLF B;  3KOZ E;  1W5S A;  2Y0T A;  2AHM A;  1D2N A;  4JXJ A;  4IBE A;  1TDH A;  4LGY A;  3T15 A;  3VLF B;  1Z6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...