1HR0M

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hr0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hr0M02
1R2ZA 4JI5M 3SATA 4NXNM 4MB7A 2UUAM 4JI6M 1EE8A 4AQYM 1HNXM 1K82A 4PD2A 1N36M 4DV6M 4YHHM 2EA0A 3J7AS 4JI4M 1XNRM 2VQEM 4OX9M 4DV5M 4PDIA 4GKJM 1XC8A 1Z59A 4JI1M 3J80S 3U6QA 3U6SA 1L1TA 4B3MM 3GQ3A 3TWLA 4DR1M 1Q39A 1Z5BA 3VK8A 5ITYA 3GPYA 4B3RM 3VK7A 4JI8M 1XNQM 3DOAA 3U6MA 1IBKM 5LMNM 5IT9S 3A46A 4G4NA 3SARA 1XMOM 5ITRA 4G4QA 3SAVA 3U6PA 4JV5M 2F5NA 2Q2EB 2ZBKB 4DR2M 1MU5A 4LFBM 5IWAM 5LMUM 3TWKA 4LF9M 3U6OA 3GPPA 4X66M 1IBLM 5ITTA 4DUZM 2UU9M 3GQ4A 3GQ5A 2UXDM 4DV7M 4JI2M 4PCZA 2OQ4A 4LF5M 3GPUA 2F4VM 4X65M 1HR0M 1K3WA 2F5PA 2UXCM 2VQFM 4X64M 4GKKM 4DV1M 4LFCM 1Q3CA 4KHPM 4NRWA 4DR4M 2HHHM 3JR4A 4ITQA 4DV4M 1R2YA 3W0FA 5A2QS 4K0KM 1MX0A 1XMQM 3SASA 1N33M 1NNJA 4DR6M 4B3SM 2HKJA 1HNZM 4JI3M 4DR3M 4DV0M 1HNWM 3SAWA 4DUYM 3U6CA 2E5LM 1N32M 3TWMA 2UXBM 3J81S 1L2CA 3T1YM 2F5OA 2F5QA 4LF6M 4LF4M 4YY3M 1L2BA 2UUCM 1PM5A 1TDZA 4X62M 3A45A 3SBJA 3GPXA 3U6EA 2XZUA 2ZM6M 3C58A 1N34M 5ITUA 4NRVA 3OTOM 3GP1A 1Z5AA 3SAUA 3U6LA 3T1HM 1PJJA 1FJGM 4JI0M 5BR8M 3U6DA 3JAMS 4CISA 1K3XA 4NXMM 4LF8M 3JR5A 4DV2M 1TDHA 5ITQA 4DR5M 1Z5CA 2F5SA 1PJIA 5ITXA 2XZFA 4DV3M 4G4RA 1Q3BA 1J5EM 3A42A 2OPFA 1I94M 4JI7M 5FLXS 4DR7M 1IBMM 3GO8A 1L2DA 4B3TM 4PDGA 4LF7M 4LFAM 1L1ZA 2UUBM 4JYAM 5ITXE 1KFVA 4G4OA
chains in the Genus database with same CATH superfamily
2KW0A 5KPTA 2J7OA 4NXNM 2X8AA 1IN5A 2RGHA 3SATA 2G5GX 3AV0A 3IECA 2DXIA 7CATA 1HQCA 4IBJA 4MGHA 3ZQJA 2DENA 2LHGA 2ZANA 2JY5A 2R0IA 4YHHM 2EA0A 5IREB 2YFQA 3J7AS 3KP1E 4JI4M 2R45A 3K2LA 3BXWA 4JXJA 3B7ZA 2NQ8C 3B89A 2DZLA 3LQRA 4LY6A 3KSJA 3SHGB 4M0DA 2EJSA 4D82A 4DV5M 4GKJM 1TR8A 1XC8A 1AUAA 1OKSA 1Z59A 2HL7A 2ZTDA 2XFSA 1HQYE 4DR1M 1Q39A 1Z5BA 1F4IA 3VK8A 1I4WA 3E4RA 4KO8A 5C18A 3HJSA 3SMSA 2JUJA 1NJFA 3W68A 5KPRA 3KSXA 2WSCF 5LMNM 3D8BA 2DWNA 3A46A 4REZA 3SARA 3VDPA 4G4QA 2JA2A 1G3IA 3U6PA 3SAVA 1DGGA 2C5RA 3EIEA 3J27B 1MU5A 2DHYA 2R4EA 3TWKA 4LF9M 2L6OA 4IBIA 3GRUA 1G41A 2Z3XA 1PRBA 3RE8A 1EFUB 2CHQA 2K0BX 3LCUA 4HLQA 3RGPA 3L2AA 3K9OA 1X37A 4KODA 2JY7A 3GQ5A 2UXDM 2XH9A 3SFZA 3TPZA 1NV9A 2KA6B 2LBCA 4PCZA 4JI2M 4LF5M 4AG6A 5IZ7D 1HR0M 1G8PA 2DI0A 1ZAEA 2FOIC 1VEJA 2JNHA 2O01F 4R7GA 3GLIA 1T3TA 1YUBA 4WP2A 3U61A 2F5PA 1GJTA 4RF1A 2LVOC 3VLFB 4B08A 1MJGM 4DV1M 4XBOA 4XK8F 1E32A 3M7GA 4LFCM 2GQFA 4B7HA 1S3SA 4LJ4A 5FSWA 2HHHM 1ZV1A 4MGKE 4GH9A 2APLA 2QSFX 2D7GA 5FTLA 4IBBA 1R6BX 2KRKA 4KT0F 4M9ZA 1IQPA 3A98B 1YE9A 2C9OA 3DFZA 2BJVA 2MH8A 3B7NA 4M9SA 3I4VA 1XB2B 3GLFB 5EXPA 3I4YA 4IBEA 1QUTA 1BVSA 3T15A 1NJGA 4GEWA 3GLGE 4AKIA 3BOSA 5GKNA 1IXSA 3ZCBB 2OOBA 4AW4A 3HX3A 4Z8XA 2ZAMA 4LF6M 2EKKA 2XEPA 1L2BA 2K47A 1PM5A 2C98A 4X62M 3J2PB 2DAKA 4AZFA 2C96A 3GPXA 2EUCA 5L8RF 2QNJA 3W67A 2FFJA 2X49A 4G6ZA 1Z5AA 3HHZA 3QAUA 4FWGA 3FUWA 1R7RA 3T1HM 2JY6B 1GL6A 2DAMA 4HEOA 1DO2A 3C3DA 3AJIB 4MH0E 4NXMM 4GRIA 3NBXX 1TDHA 1DGFA 4L16A 2F5SA 2D7HA 3L29A 5ITXA 2VIIA 4L78A 2VF7A 3GRVA 4G4RA 2FE8A 1IN7A 2BNKA 3PNVA 1IBMM 3BBZA 4FVMA 4II7A 4AI6A 2YR0A 1TF0B 4ZPXA 2DAIA 2RRUA 4G4OA 1G71A 4GMQA 4A3VB 1DO0A 2DAGA 4L15A 1IN4A 2VF8A 4LZJA 2LVQD 3HU2A 3DA1A 4QHTA 4AQYM 1HNXM 1K82A 1XXHB 2HWJA 3L28A 3PXGA 3QYBA 1N75A 3Q8GA 2D7EA 5H37D 2Y0TA 3HJQA 3HHWA 5KQDA 5KQ8A 2LH0A 2OOAA 3B74A 3MMPA 1YLAA 5EP2A 4PDIA 2EO2A 5DYIA 1UFZA 3MJ5A 3J80S 3U6SA 4B3MM 3GQ3A 4CGYB 4D81A 4FCWA 3GPYA 2GNOA 1IXRC 4FW9A 2L09A 1R4GA 3FTCA 3KOZE 5E6JA 3U60B 4GC5A 2I7NA 1QUSA 3FUUA 3KOXE 3V76A 2QBYB 1CUKA 2CHGA 4IBKA 4G4NA 3MHVC 3GLGA 5IT9S 1SXJB 2XSZD 1JQJC 3GLFE 2F5NA 2Q2EB 4WURA 4DR2M 5IWAM 1PJTA 3HY5A 1VG5A 1OJLA 5DYGA 3D8LA 4X66M 1E9SA 2QCUA 4DUZM 3LVVA 5EXTA 4AG5A 1W5TA 2UU9M 3FD9A 4NOOB 3GQ4A 2DWMA 1LTMA 3H4JA 4DV7M 3KS4A 4I8OA 4LJ6A 2OQ4A 2V1CA 2XGNA 1OTRA 3E46A 3I51A 4LRTA 3TQSA 2F4VM 4X65M 5E26A 1KYIA 1K3WA 3H4MA 1D0LA 3QYEA 4FCTA 3THGA 4L8RC 3RFWA 3LW5F 2JP7A 2LNHC 2Z8YM 3FE3A 1J7KA 3K1JA 3K92A 1SXJC 2JZ0A 3FTFA 4KHPM 1Q02A 1DV0A 1E9RA 1WGLA 3ILKA 4IBDA 1JR3E 4RNAA 2QQ8A 3VKHA 1EIJA 2MGWA 3GLHA 1R2YA 1QYRA 1GKIA 5A2QS 1HT2E 3WHKA 2R4JA 3CF6E 1MX0A 3CGWA 1N33M 3HKPA 1NNJA 2V6ZM 1OFIA 2HKJA 2C9CA 4JI3M 3KDSE 4R71A 2YQZA 8CATA 1JR3D 3SAWA 3U5ZA 5EXXA 3U6CA 3J81S 4RF0A 2KHHA 4M0WA 1GL7A 1TGUA 5C1BA 3A45A 3SBJA 2XFTA 4FWDA 1OQYA 2DNAA 3GRYA 3WHLA 3E9SA 3LMMA 2DHRA 4B7FA 2LVNC 4BLCA 1HJPA 4NRVA 5ITUA 1OIZA 3SAUA 1V92A 4LZZA 3U6LA 5F3WA 2FS1A 2EKFA 5BR8M 1MN3A 2KEBA 3M6AA 4P16A 1V33A 2KZSA 1IY0A 1UM8A 1VDLA 3AOEA 3DZDA 3UZUA 3GLIB 3U61B 1IFYA 4I4LA 3K8ZA 4RKUF 1DGHA 3FRHA 1IM2A 1QVRA 4OVZA 4MGIE 2YNMD 2XF3A 1RU3A 2H5XA 2QHOB 3T6PA 2OPFA 1J5EM 3Q8XA 4LCBA 3LCVB 1PJQA 4GHAA 4OU7A 2QENA 1ORYB 2CV0A 1PJSA 3HU1A 1QQWA 4IJEA 2DZOB 1L1ZA 2DWZB 4GITA 3HHYA 1SXJE 3UGJA 1D0KA 4XGIA 4LJ9A 3C3EA 2LVPC 4ANRA 1PGYA 4JI5M 5FTJA 2LXEA 3CF0A 2UUAM 1EE8A 4UN2B 1IXSB 2CE7A 3PNYA 5EP1A 4AKGA 2R62A 2Z4SA 1XHBA 2BJWA 4LRSA 5EJCA 1NSFA 4QHSA 4DBGB 4Z6YA 4PD2A 4GIPA 3L25A 4CJ6A 2CP8A 1T43A 2L2DA 1SXJD 2OO9A 1NV8A 1Z6TA 1E94E 4HL4A 3NWLA 3L26A 4OX9M 4GHLA 3GRRA 3FYCA 2DWLA 4JI1M 3U6QA 1JR3A 1L1TA 3TWLA 2L7IA 3I04M 1TH3A 1WHCA 2HAKA 2R44A 3HHXA 3NBIA 4QNRA 4P17A 4JI8M 1XNQM 3DOAA 3KFUG 3PVSA 3KXEC 3U6MA 2QZ4A 5DFLA 2KNZA 3IG8A 4IBCA 2J7NA 2VDBB 2CV2A 3FUTA 4LFBM 2FNAA 3R9XB 5EQTA 5EXSA 1H6UA 3TE6A 3ZH9B 5DNYA 1NNUC 3HU3A 2M60A 4LJ7A 1IBLM 1KSFX 1C1KA 2Z4RA 2KNAA 3FTDA 5FTKA 4F1IA 4EIWA 4QOZC 1A5TA 3QWLA 3W0LB 3T38A 2LTUA 4L6V6 3GPUA 1OAOC 3FUVA 4FD2A 4FCVA 4M9XA 1NY5A 3KVWA 1NO1A 1ZQ9A 3UMMA 2UXCM 2A5YB 4CHTB 4X64M 4GKKM 2M5ZA 2R6FA 5JI2E 1Q3CA 4NRWA 3UJNA 4NSOB 5BPVA 1WXQA 2Y20A 4ITQA 1N77A 5FTMA 1QZMA 3W0FA 2DKLA 3SYKA 2BWBA 4K0KM 1XMQM 3VFDA 4IBFA 4IBGA 1IN8A 3VKGA 2KDLA 2HCBA 4DV0M 4DR3M 1Y8GA 1HNWM 1YSYA 2CRUA 5JI3E 1N32M 3HZJA 2UXBM 1L2CA 3T1YM 2F5OA 1QZEA 3FTEA 4LF4M 3M0EA 2AHMA 1TDZA 2MJ5B 2G8LA 3L27A 3I01M 2C99A 1XWIA 1V34A 2JWSA 4W5WA 4NC6A 2H1RA 2XLJA 3U6EA 1N34M 1QAQA 1D0MA 1LV7A 4LJ8A 3GP1A 5KPZA 1PJJA 4JI0M 1TH4A 3CTWB 4GC9A 3U6DA 2O5RA 1K3XA 2L4FA 4I81A 1VEKA 3AKZA 3B9PA 3JR5A 3C9PA 1NHGC 2QP9X 1GO5A 1NVMA 1Z5CA 2WSFF 4IJFA 3PFIA 4R3DA 3K9PA 2XZFA 4NL4H 1Q3BA 1WGNA 1OAIA 1VEGA 2ERCA 5FLXS 3KP0E 4Y28F 2ZTCA 1G59A 3GLHB 4JN6A 3GO8A 2CFOA 3EIHA 4PDGA 4LF7M 5ITXE 1KFVA 4Q7JA 4TUWA 1QAMA 1R2ZA 4NSRA 4MB7A 1XXHE 2MROB 4JI6M 2B3TA 3U5ZB 4LG2A 1TTEA 2DZNB 1N36M 1T6OA 4WW0A 4DV6M 1IY1A 2XSZA 2Y0QA 1QDRA 4BB9A 4G3OA 1QANA 1ZMWA 1XNRM 2K6BA 1QAOA 2VQEM 1G4AE 4F2LA 1HT1E 3CF2A 3E21A 3RGSA 4L4UA 1ZMUA 2LWXA 5EP4A 1AIPC 2KNVA 2N35A 5ITYA 3GLFA 4B3RM 3VK7A 1L8QA 1GLNA 2R65A 3SC3A 1DGHB 3F92A 1IBKM 1FNNA 4LGMA 2CV1A 1D2NA 4OVZB 3HWSA 3IHPA 4QNMA 3AOGA 5ITRA 1XMOM 3LQQA 4JV5M 2DAEA 3VDUA 2ZBKB 5LMUM 1TH2A 2WSEF 3U6OA 3GPPA 3UK6A 1NY6A 2Y21A 3HGIA 4IIWA 4OW0A 5ITTA 4I5SA 3SYLA 2P5TA 2Z7JA 2MR9A 1OFHA 1DGBA 3R8FA 2I7PA 2ZAOA 3AOEC 1OIPA 1GVNA 2RGOA 1IXZA 5FTNA 2WZJA 2VQFM 2KZUA 2R46A 4LGYA 5EP3A 2V1UA 5KO3A 1QDTA 2X4AA 3HJ8A 4S12A 1N78A 4CIZA 2CEAA 2FH0A 4DR4M 2L7HA 3FYDA 3JR4A 4AKHA 1GJSA 3FRIA 3LVWA 2DVWB 4DV4M 4BBAA 1J09A 1VQ1A 1W5SA 4LJ5A 4QOSA 3SASA 3FUXA 3SMPA 2JY8A 2LVAA 2KXEA 4DR6M 4B3SM 1IY2A 3AL0C 2BWEA 1HNZM 2CHVA 4MGZE 2JXNA 2LHCA 2QPAA 1R5LA 3AFHA 3FKEA 3GLHE 4DUYM 2E5LM 2J5YA 3TWMA 1XXHA 3IG5A 2F5QA 4YY3M 2UUCM 1ZMVA 1NHWC 3J7BA 4MM3B 4B7GA 1VDDA 2JZ1A 3KOYE 2ZM6M 2XZUA 3C58A 1P3QQ 3KOWE 3OTOM 3MK6A 1SG9A 1FJGM 3KS8A 3GLIE 2K9DA 3JAMS 4CISA 1C7YA 4KLNA 1IN6A 4LF8M 4DV2M 1GABA 1WJ7A 4PT5A 5ITQA 3U60A 4DR5M 2O25A 2QBYA 3B7QA 2L4EA 1PJIA 3KW6A 2CUZA 1SXJA 4LJAA 2W82A 4D80A 4DV3M 1I94M 3A42A 4FWHA 4JI7M 2G3QA 2CWBA 3GLGB 4DR7M 2KRUA 1WR1B 3ZC7B 3SHFA 3TL4X 1L2DA 1JB0F 1WIVA 4B3TM 4LFAM 2UUBM 4JYAM 2R18A 4MGYE 2RKOA
chains in the Genus database with same CATH topology
2KW0A 5KPTA 2J7OA 4NXNM 2X8AA 1IN5A 2RGHA 3SATA 2G5GX 3AV0A 2DXIA 7CATA 1HQCA 4IBJA 4MGHA 2ZANA 4YHHM 2EA0A 5IREB 2YFQA 3J7AS 3KP1E 4JI4M 2R45A 3K2LA 4JXJA 4LY6A 2NQ8C 3LQRA 3KSJA 3SHGB 4M0DA 4D82A 4DV5M 4GKJM 1XC8A 2HL7A 1Z59A 2XFSA 1HQYE 4DR1M 1Q39A 1Z5BA 3VK8A 1I4WA 3E4RA 4KO8A 5C18A 3HJSA 3SMSA 1NJFA 5KPRA 3KSXA 5LMNM 3D8BA 2DWNA 3A46A 4REZA 3SARA 3VDPA 4G4QA 2JA2A 1G3IA 3U6PA 3SAVA 1DGGA 2C5RA 3EIEA 3J27B 1MU5A 2R4EA 3TWKA 4LF9M 2L6OA 4IBIA 3GRUA 1G41A 2Z3XA 3RE8A 2CHQA 4HLQA 3RGPA 3L2AA 1X37A 4KODA 3GQ5A 2UXDM 2XH9A 3SFZA 3TPZA 2KA6B 4JI2M 4PCZA 4LF5M 4AG6A 5IZ7D 1HR0M 1G8PA 4R7GA 1ZAEA 2FOIC 3GLIA 3U61A 1T3TA 1YUBA 2F5PA 4RF1A 3VLFB 4B08A 4DV1M 4LFCM 4XBOA 1E32A 3M7GA 4B7HA 1S3SA 4LJ4A 5FSWA 2HHHM 4MGKE 4GH9A 2D7GA 5FTLA 4IBBA 1R6BX 2KRKA 4M9ZA 1IQPA 3A98B 1YE9A 2C9OA 3DFZA 2BJVA 4M9SA 3I4VA 3GLFB 5EXPA 3I4YA 4IBEA 3T15A 1NJGA 4AKIA 3BOSA 5GKNA 3ZCBB 4AW4A 4Z8XA 2ZAMA 4LF6M 2XEPA 1L2BA 2K47A 1PM5A 2C98A 4X62M 3J2PB 4AZFA 2C96A 3GPXA 2EUCA 2FFJA 2X49A 4G6ZA 1Z5AA 3HHZA 3QAUA 4FWGA 3FUWA 1R7RA 3T1HM 1GL6A 1DO2A 3AJIB 4MH0E 4NXMM 4GRIA 1TDHA 1DGFA 4L16A 2F5SA 2D7HA 3L29A 5ITXA 2VIIA 4L78A 3GRVA 4G4RA 2FE8A 1IN7A 2BNKA 3PNVA 1IBMM 4FVMA 4II7A 4AI6A 2YR0A 4ZPXA 4G4OA 4GMQA 4A3VB 1DO0A 4L15A 1IN4A 4LZJA 3HU2A 3DA1A 4QHTA 4AQYM 1HNXM 1K82A 1XXHB 3L28A 3PXGA 1N75A 2D7EA 5H37D 2Y0TA 3HJQA 3HHWA 5KQDA 5KQ8A 2LH0A 5EP2A 4PDIA 2EO2A 5DYIA 3MJ5A 3J80S 3U6SA 4B3MM 3GQ3A 4CGYB 4D81A 4FCWA 3GPYA 1IXRC 4FW9A 2L09A 5E6JA 3FTCA 3KOZE 3U60B 4GC5A 2I7NA 2QBYB 3FUUA 3KOXE 2CHGA 4IBKA 4G4NA 3MHVC 3GLGA 5IT9S 1SXJB 2XSZD 1JQJC 2F5NA 2Q2EB 4WURA 4DR2M 5IWAM 5DYGA 1OJLA 3D8LA 4X66M 1E9SA 2QCUA 4DUZM 3LVVA 5EXTA 4AG5A 1W5TA 2UU9M 3FD9A 4NOOB 3GQ4A 2DWMA 4DV7M 3KS4A 4I8OA 4LJ6A 2OQ4A 2V1CA 2XGNA 4LRTA 3I51A 3TQSA 2F4VM 4X65M 5E26A 1KYIA 1K3WA 3H4MA 4L8RC 4FCTA 3THGA 3RFWA 3K92A 2LNHC 3K1JA 1J7KA 1SXJC 3FTFA 4KHPM 1E9RA 3ILKA 4IBDA 4RNAA 3VKHA 3GLHA 1R2YA 1QYRA 1GKIA 5A2QS 1HT2E 3WHKA 2R4JA 3CF6E 1MX0A 1N33M 3HKPA 1NNJA 2V6ZM 1OFIA 2HKJA 2C9CA 4JI3M 3KDSE 2YQZA 8CATA 1JR3D 3SAWA 3U5ZA 5EXXA 3U6CA 3J81S 4RF0A 4M0WA 1GL7A 1TGUA 5C1BA 3A45A 3SBJA 2XFTA 4FWDA 3GRYA 3WHLA 3E9SA 3LMMA 2DHRA 4B7FA 4BLCA 5ITUA 4NRVA 3SAUA 5F3WA 4LZZA 3U6LA 5BR8M 2KEBA 3M6AA 4P16A 2KZSA 1IY0A 1UM8A 3DZDA 3AOEA 3GLIB 3UZUA 3U61B 4I4LA 3K8ZA 1DGHA 1IM2A 1QVRA 4OVZA 4MGIE 2YNMD 2XF3A 1J5EM 2OPFA 3Q8XA 4LCBA 4GHAA 4OU7A 2QENA 1ORYB 2CV0A 3HU1A 1QQWA 4IJEA 2DZOB 1L1ZA 2DWZB 4GITA 3HHYA 1SXJE 3UGJA 4XGIA 4LJ9A 4JI5M 5FTJA 2LXEA 3CF0A 2UUAM 1EE8A 1IXSB 2CE7A 3PNYA 5EP1A 4AKGA 2R62A 2Z4SA 1XHBA 2BJWA 4LRSA 5EJCA 1NSFA 4QHSA 4Z6YA 4PD2A 3L25A 4GIPA 1SXJD 1Z6TA 1E94E 4HL4A 3NWLA 3L26A 4OX9M 4GHLA 3GRRA 3FYCA 2DWLA 4JI1M 3U6QA 1JR3A 1L1TA 3TWLA 2L7IA 1TH3A 3HHXA 3NBIA 4QNRA 4JI8M 1XNQM 3DOAA 3KFUG 3PVSA 3KXEC 3U6MA 2QZ4A 3IG8A 4IBCA 2J7NA 2CV2A 3FUTA 4LFBM 2FNAA 3R9XB 5EQTA 5EXSA 1H6UA 3TE6A 3ZH9B 5DNYA 1NNUC 3HU3A 2M60A 4LJ7A 1IBLM 1KSFX 1C1KA 2Z4RA 3FTDA 5FTKA 4EIWA 4QOZC 3QWLA 3W0LB 3T38A 3GPUA 3FUVA 4FD2A 4FCVA 4M9XA 1NY5A 3KVWA 1ZQ9A 3UMMA 2UXCM 2A5YB 4CHTB 4X64M 4GKKM 2M5ZA 5JI2E 1Q3CA 4NRWA 3UJNA 4NSOB 5BPVA 1WXQA 2Y20A 4ITQA 1N77A 5FTMA 1QZMA 3W0FA 3SYKA 4K0KM 1XMQM 3VFDA 4IBFA 4IBGA 1IN8A 3VKGA 4DR3M 2HCBA 4DV0M 1HNWM 1YSYA 5JI3E 1N32M 2UXBM 1L2CA 3T1YM 2F5OA 3FTEA 4LF4M 3M0EA 2AHMA 1TDZA 2G8LA 3L27A 2C99A 1XWIA 4W5WA 2XLJA 3U6EA 2H1RA 1N34M 1QAQA 1LV7A 4LJ8A 3GP1A 5KPZA 1PJJA 4JI0M 1TH4A 3CTWB 4GC9A 3U6DA 2O5RA 1K3XA 4I81A 3AKZA 3B9PA 3JR5A 1NHGC 2QP9X 1NVMA 1Z5CA 4IJFA 4R3DA 3PFIA 2XZFA 4NL4H 1Q3BA 2ERCA 5FLXS 3KP0E 1G59A 3GLHB 4JN6A 3GO8A 2CFOA 3EIHA 4PDGA 4LF7M 5ITXE 1KFVA 4TUWA 1QAMA 1R2ZA 4NSRA 4MB7A 4JI6M 4LG2A 3U5ZB 2DZNB 1N36M 4WW0A 4DV6M 1IY1A 2XSZA 2Y0QA 4BB9A 1QANA 1XNRM 1QAOA 2VQEM 1G4AE 1HT1E 3CF2A 3RGSA 4L4UA 2LWXA 5EP4A 5ITYA 3GLFA 4B3RM 3VK7A 1L8QA 1GLNA 2R65A 3SC3A 1DGHB 1IBKM 1FNNA 4LGMA 2CV1A 1D2NA 4OVZB 3HWSA 4QNMA 3AOGA 5ITRA 1XMOM 3LQQA 4JV5M 3VDUA 2ZBKB 5LMUM 1TH2A 3U6OA 3GPPA 3UK6A 1NY6A 2Y21A 3HGIA 4IIWA 4OW0A 5ITTA 4I5SA 3SYLA 2P5TA 2Z7JA 1OFHA 1DGBA 3R8FA 2I7PA 2ZAOA 3AOEC 1GVNA 2RGOA 1IXZA 5FTNA 2VQFM 2KZUA 2R46A 4LGYA 5EP3A 2V1UA 5KO3A 2X4AA 3HJ8A 4S12A 1N78A 4DR4M 2CEAA 2L7HA 3FYDA 3JR4A 4AKHA 3LVWA 2DVWB 4DV4M 4BBAA 1J09A 1W5SA 4LJ5A 4QOSA 3SASA 3FUXA 3SMPA 2KXEA 4DR6M 4B3SM 1IY2A 3AL0C 1HNZM 2CHVA 4MGZE 2QPAA 3AFHA 3FKEA 4DUYM 2E5LM 3TWMA 1XXHA 3IG5A 2F5QA 4YY3M 2UUCM 1NHWC 3J7BA 4MM3B 4B7GA 1VDDA 3KOYE 2XZUA 2ZM6M 3C58A 3KOWE 3OTOM 3MK6A 1FJGM 3KS8A 3JAMS 4CISA 4KLNA 1IN6A 4LF8M 4DV2M 4PT5A 5ITQA 3U60A 4DR5M 2QBYA 1PJIA 3KW6A 2CUZA 1SXJA 4LJAA 2W82A 4D80A 4DV3M 1I94M 3A42A 4FWHA 4JI7M 3GLGB 4DR7M 2KRUA 3ZC7B 3SHFA 3TL4X 1L2DA 4B3TM 4LFAM 2UUBM 4JYAM 2R18A 4MGYE 2RKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R2Z A;  4JI5 M;  3SAT A;  4NXN M;  4MB7 A;  2UUA M;  4JI6 M;  1EE8 A;  4AQY M;  1HNX M;  1K82 A;  4PD2 A;  1N36 M;  4DV6 M;  4YHH M;  2EA0 A;  3J7A S;  4JI4 M;  1XNR M;  2VQE M;  4OX9 M;  4DV5 M;  4PDI A;  4GKJ M;  1XC8 A;  1Z59 A;  4JI1 M;  3J80 S;  3U6Q A;  3U6S A;  1L1T A;  4B3M M;  3GQ3 A;  3TWL A;  4DR1 M;  1Q39 A;  1Z5B A;  3VK8 A;  5ITY A;  3GPY A;  4B3R M;  3VK7 A;  4JI8 M;  1XNQ M;  3DOA A;  3U6M A;  1IBK M;  5LMN M;  5IT9 S;  3A46 A;  4G4N A;  3SAR A;  1XMO M;  5ITR A;  4G4Q A;  3SAV A;  3U6P A;  4JV5 M;  2F5N A;  2Q2E B;  2ZBK B;  4DR2 M;  1MU5 A;  4LFB M;  5IWA M;  5LMU M;  3TWK A;  4LF9 M;  3U6O A;  3GPP A;  4X66 M;  1IBL M;  5ITT A;  4DUZ M;  2UU9 M;  3GQ4 A;  3GQ5 A;  2UXD M;  4DV7 M;  4JI2 M;  4PCZ A;  2OQ4 A;  4LF5 M;  3GPU A;  2F4V M;  4X65 M;  1HR0 M;  1K3W A;  2F5P A;  2UXC M;  2VQF M;  4X64 M;  4GKK M;  4DV1 M;  4LFC M;  1Q3C A;  4KHP M;  4NRW A;  4DR4 M;  2HHH M;  3JR4 A;  4ITQ A;  4DV4 M;  1R2Y A;  3W0F A;  5A2Q S;  4K0K M;  1MX0 A;  1XMQ M;  3SAS A;  1N33 M;  1NNJ A;  4DR6 M;  4B3S M;  2HKJ A;  1HNZ M;  4JI3 M;  4DR3 M;  4DV0 M;  1HNW M;  3SAW A;  4DUY M;  3U6C A;  2E5L M;  1N32 M;  3TWM A;  2UXB M;  3J81 S;  1L2C A;  3T1Y M;  2F5O A;  2F5Q A;  4LF6 M;  4LF4 M;  4YY3 M;  1L2B A;  2UUC M;  1PM5 A;  1TDZ A;  4X62 M;  3A45 A;  3SBJ A;  3GPX A;  3U6E A;  2XZU A;  2ZM6 M;  3C58 A;  1N34 M;  5ITU A;  4NRV A;  3OTO M;  3GP1 A;  1Z5A A;  3SAU A;  3U6L A;  3T1H M;  1PJJ A;  1FJG M;  4JI0 M;  5BR8 M;  3U6D A;  3JAM S;  4CIS A;  1K3X A;  4NXM M;  4LF8 M;  3JR5 A;  4DV2 M;  1TDH A;  5ITQ A;  4DR5 M;  1Z5C A;  2F5S A;  1PJI A;  5ITX A;  2XZF A;  4DV3 M;  4G4R A;  1Q3B A;  1J5E M;  3A42 A;  2OPF A;  1I94 M;  4JI7 M;  5FLX S;  4DR7 M;  1IBM M;  3GO8 A;  1L2D A;  4B3T M;  4PDG A;  4LF7 M;  4LFA M;  1L1Z A;  2UUB M;  4JYA M;  5ITX E;  1KFV A;  4G4O A; 
#chains in the Genus database with same CATH topology
 2KW0 A;  5KPT A;  2J7O A;  4NXN M;  2X8A A;  1IN5 A;  2RGH A;  3SAT A;  2G5G X;  3AV0 A;  3IEC A;  2DXI A;  7CAT A;  1HQC A;  4IBJ A;  4MGH A;  3ZQJ A;  2DEN A;  2LHG A;  2ZAN A;  2JY5 A;  2R0I A;  4YHH M;  2EA0 A;  5IRE B;  2YFQ A;  3J7A S;  3KP1 E;  4JI4 M;  2R45 A;  3K2L A;  3BXW A;  4JXJ A;  3B7Z A;  2NQ8 C;  3B89 A;  2DZL A;  3LQR A;  4LY6 A;  3KSJ A;  3SHG B;  4M0D A;  2EJS A;  4D82 A;  4DV5 M;  4GKJ M;  1TR8 A;  1XC8 A;  1AUA A;  1OKS A;  1Z59 A;  2HL7 A;  2ZTD A;  2XFS A;  1HQY E;  4DR1 M;  1Q39 A;  1Z5B A;  1F4I A;  3VK8 A;  1I4W A;  3E4R A;  4KO8 A;  5C18 A;  3HJS A;  3SMS A;  2JUJ A;  1NJF A;  3W68 A;  5KPR A;  3KSX A;  2WSC F;  5LMN M;  3D8B A;  2DWN A;  3A46 A;  4REZ A;  3SAR A;  3VDP A;  4G4Q A;  2JA2 A;  1G3I A;  3U6P A;  3SAV A;  1DGG A;  2C5R A;  3EIE A;  3J27 B;  1MU5 A;  2DHY A;  2R4E A;  3TWK A;  4LF9 M;  2L6O A;  4IBI A;  3GRU A;  1G41 A;  2Z3X A;  1PRB A;  3RE8 A;  1EFU B;  2CHQ A;  2K0B X;  3LCU A;  4HLQ A;  3RGP A;  3L2A A;  3K9O A;  1X37 A;  4KOD A;  2JY7 A;  3GQ5 A;  2UXD M;  2XH9 A;  3SFZ A;  3TPZ A;  1NV9 A;  2KA6 B;  2LBC A;  4PCZ A;  4JI2 M;  4LF5 M;  4AG6 A;  5IZ7 D;  1HR0 M;  1G8P A;  2DI0 A;  1ZAE A;  2FOI C;  1VEJ A;  2JNH A;  2O01 F;  4R7G A;  3GLI A;  1T3T A;  1YUB A;  4WP2 A;  3U61 A;  2F5P A;  1GJT A;  4RF1 A;  2LVO C;  3VLF B;  4B08 A;  1MJG M;  4DV1 M;  4XBO A;  4XK8 F;  1E32 A;  3M7G A;  4LFC M;  2GQF A;  4B7H A;  1S3S A;  4LJ4 A;  5FSW A;  2HHH M;  1ZV1 A;  4MGK E;  4GH9 A;  2APL A;  2QSF X;  2D7G A;  5FTL A;  4IBB A;  1R6B X;  2KRK A;  4KT0 F;  4M9Z A;  1IQP A;  3A98 B;  1YE9 A;  2C9O A;  3DFZ A;  2BJV A;  2MH8 A;  3B7N A;  4M9S A;  3I4V A;  1XB2 B;  3GLF B;  5EXP A;  3I4Y A;  4IBE A;  1QUT A;  1BVS A;  3T15 A;  1NJG A;  4GEW A;  3GLG E;  4AKI A;  3BOS A;  5GKN A;  1IXS A;  3ZCB B;  2OOB A;  4AW4 A;  3HX3 A;  4Z8X A;  2ZAM A;  4LF6 M;  2EKK A;  2XEP A;  1L2B A;  2K47 A;  1PM5 A;  2C98 A;  4X62 M;  3J2P B;  2DAK A;  4AZF A;  2C96 A;  3GPX A;  2EUC A;  5L8R F;  2QNJ A;  3W67 A;  2FFJ A;  2X49 A;  4G6Z A;  1Z5A A;  3HHZ A;  3QAU A;  4FWG A;  3FUW A;  1R7R A;  3T1H M;  2JY6 B;  1GL6 A;  2DAM A;  4HEO A;  1DO2 A;  3C3D A;  3AJI B;  4MH0 E;  4NXM M;  4GRI A;  3NBX X;  1TDH A;  1DGF A;  4L16 A;  2F5S A;  2D7H A;  3L29 A;  5ITX A;  2VII A;  4L78 A;  2VF7 A;  3GRV A;  4G4R A;  2FE8 A;  1IN7 A;  2BNK A;  3PNV A;  1IBM M;  3BBZ A;  4FVM A;  4II7 A;  4AI6 A;  2YR0 A;  1TF0 B;  4ZPX A;  2DAI A;  2RRU A;  4G4O A;  1G71 A;  4GMQ A;  4A3V B;  1DO0 A;  2DAG A;  4L15 A;  1IN4 A;  2VF8 A;  4LZJ A;  2LVQ D;  3HU2 A;  3DA1 A;  4QHT A;  4AQY M;  1HNX M;  1K82 A;  1XXH B;  2HWJ A;  3L28 A;  3PXG A;  3QYB A;  1N75 A;  3Q8G A;  2D7E A;  5H37 D;  2Y0T A;  3HJQ A;  3HHW A;  5KQD A;  5KQ8 A;  2LH0 A;  2OOA A;  3B74 A;  3MMP A;  1YLA A;  5EP2 A;  4PDI A;  2EO2 A;  5DYI A;  1UFZ A;  3MJ5 A;  3J80 S;  3U6S A;  4B3M M;  3GQ3 A;  4CGY B;  4D81 A;  4FCW A;  3GPY A;  2GNO A;  1IXR C;  4FW9 A;  2L09 A;  1R4G A;  3FTC A;  3KOZ E;  5E6J A;  3U60 B;  4GC5 A;  2I7N A;  1QUS A;  3FUU A;  3KOX E;  3V76 A;  2QBY B;  1CUK A;  2CHG A;  4IBK A;  4G4N A;  3MHV C;  3GLG A;  5IT9 S;  1SXJ B;  2XSZ D;  1JQJ C;  3GLF E;  2F5N A;  2Q2E B;  4WUR A;  4DR2 M;  5IWA M;  1PJT A;  3HY5 A;  1VG5 A;  1OJL A;  5DYG A;  3D8L A;  4X66 M;  1E9S A;  2QCU A;  4DUZ M;  3LVV A;  5EXT A;  4AG5 A;  1W5T A;  2UU9 M;  3FD9 A;  4NOO B;  3GQ4 A;  2DWM A;  1LTM A;  3H4J A;  4DV7 M;  3KS4 A;  4I8O A;  4LJ6 A;  2OQ4 A;  2V1C A;  2XGN A;  1OTR A;  3E46 A;  3I51 A;  4LRT A;  3TQS A;  2F4V M;  4X65 M;  5E26 A;  1KYI A;  1K3W A;  3H4M A;  1D0L A;  3QYE A;  4FCT A;  3THG A;  4L8R C;  3RFW A;  3LW5 F;  2JP7 A;  2LNH C;  2Z8Y M;  3FE3 A;  1J7K A;  3K1J A;  3K92 A;  1SXJ C;  2JZ0 A;  3FTF A;  4KHP M;  1Q02 A;  1DV0 A;  1E9R A;  1WGL A;  3ILK A;  4IBD A;  1JR3 E;  4RNA A;  2QQ8 A;  3VKH A;  1EIJ A;  2MGW A;  3GLH A;  1R2Y A;  1QYR A;  1GKI A;  5A2Q S;  1HT2 E;  3WHK A;  2R4J A;  3CF6 E;  1MX0 A;  3CGW A;  1N33 M;  3HKP A;  1NNJ A;  2V6Z M;  1OFI A;  2HKJ A;  2C9C A;  4JI3 M;  3KDS E;  4R71 A;  2YQZ A;  8CAT A;  1JR3 D;  3SAW A;  3U5Z A;  5EXX A;  3U6C A;  3J81 S;  4RF0 A;  2KHH A;  4M0W A;  1GL7 A;  1TGU A;  5C1B A;  3A45 A;  3SBJ A;  2XFT A;  4FWD A;  1OQY A;  2DNA A;  3GRY A;  3WHL A;  3E9S A;  3LMM A;  2DHR A;  4B7F A;  2LVN C;  4BLC A;  1HJP A;  4NRV A;  5ITU A;  1OIZ A;  3SAU A;  1V92 A;  4LZZ A;  3U6L A;  5F3W A;  2FS1 A;  2EKF A;  5BR8 M;  1MN3 A;  2KEB A;  3M6A A;  4P16 A;  1V33 A;  2KZS A;  1IY0 A;  1UM8 A;  1VDL A;  3AOE A;  3DZD A;  3UZU A;  3GLI B;  3U61 B;  1IFY A;  4I4L A;  3K8Z A;  4RKU F;  1DGH A;  3FRH A;  1IM2 A;  1QVR A;  4OVZ A;  4MGI E;  2YNM D;  2XF3 A;  1RU3 A;  2H5X A;  2QHO B;  3T6P A;  2OPF A;  1J5E M;  3Q8X A;  4LCB A;  3LCV B;  1PJQ A;  4GHA A;  4OU7 A;  2QEN A;  1ORY B;  2CV0 A;  1PJS A;  3HU1 A;  1QQW A;  4IJE A;  2DZO B;  1L1Z A;  2DWZ B;  4GIT A;  3HHY A;  1SXJ E;  3UGJ A;  1D0K A;  4XGI A;  4LJ9 A;  3C3E A;  2LVP C;  4ANR A;  1PGY A;  4JI5 M;  5FTJ A;  2LXE A;  3CF0 A;  2UUA M;  1EE8 A;  4UN2 B;  1IXS B;  2CE7 A;  3PNY A;  5EP1 A;  4AKG A;  2R62 A;  2Z4S A;  1XHB A;  2BJW A;  4LRS A;  5EJC A;  1NSF A;  4QHS A;  4DBG B;  4Z6Y A;  4PD2 A;  4GIP A;  3L25 A;  4CJ6 A;  2CP8 A;  1T43 A;  2L2D A;  1SXJ D;  2OO9 A;  1NV8 A;  1Z6T A;  1E94 E;  4HL4 A;  3NWL A;  3L26 A;  4OX9 M;  4GHL A;  3GRR A;  3FYC A;  2DWL A;  4JI1 M;  3U6Q A;  1JR3 A;  1L1T A;  3TWL A;  2L7I A;  3I04 M;  1TH3 A;  1WHC A;  2HAK A;  2R44 A;  3HHX A;  3NBI A;  4QNR A;  4P17 A;  4JI8 M;  1XNQ M;  3DOA A;  3KFU G;  3PVS A;  3KXE C;  3U6M A;  2QZ4 A;  5DFL A;  2KNZ A;  3IG8 A;  4IBC A;  2J7N A;  2VDB B;  2CV2 A;  3FUT A;  4LFB M;  2FNA A;  3R9X B;  5EQT A;  5EXS A;  1H6U A;  3TE6 A;  3ZH9 B;  5DNY A;  1NNU C;  3HU3 A;  2M60 A;  4LJ7 A;  1IBL M;  1KSF X;  1C1K A;  2Z4R A;  2KNA A;  3FTD A;  5FTK A;  4F1I A;  4EIW A;  4QOZ C;  1A5T A;  3QWL A;  3W0L B;  3T38 A;  2LTU A;  4L6V 6;  3GPU A;  1OAO C;  3FUV A;  4FD2 A;  4FCV A;  4M9X A;  1NY5 A;  3KVW A;  1NO1 A;  1ZQ9 A;  3UMM A;  2UXC M;  2A5Y B;  4CHT B;  4X64 M;  4GKK M;  2M5Z A;  2R6F A;  5JI2 E;  1Q3C A;  4NRW A;  3UJN A;  4NSO B;  5BPV A;  1WXQ A;  2Y20 A;  4ITQ A;  1N77 A;  5FTM A;  1QZM A;  3W0F A;  2DKL A;  3SYK A;  2BWB A;  4K0K M;  1XMQ M;  3VFD A;  4IBF A;  4IBG A;  1IN8 A;  3VKG A;  2KDL A;  2HCB A;  4DV0 M;  4DR3 M;  1Y8G A;  1HNW M;  1YSY A;  2CRU A;  5JI3 E;  1N32 M;  3HZJ A;  2UXB M;  1L2C A;  3T1Y M;  2F5O A;  1QZE A;  3FTE A;  4LF4 M;  3M0E A;  2AHM A;  1TDZ A;  2MJ5 B;  2G8L A;  3L27 A;  3I01 M;  2C99 A;  1XWI A;  1V34 A;  2JWS A;  4W5W A;  4NC6 A;  2H1R A;  2XLJ A;  3U6E A;  1N34 M;  1QAQ A;  1D0M A;  1LV7 A;  4LJ8 A;  3GP1 A;  5KPZ A;  1PJJ A;  4JI0 M;  1TH4 A;  3CTW B;  4GC9 A;  3U6D A;  2O5R A;  1K3X A;  2L4F A;  4I81 A;  1VEK A;  3AKZ A;  3B9P A;  3JR5 A;  3C9P A;  1NHG C;  2QP9 X;  1GO5 A;  1NVM A;  1Z5C A;  2WSF F;  4IJF A;  3PFI A;  4R3D A;  3K9P A;  2XZF A;  4NL4 H;  1Q3B A;  1WGN A;  1OAI A;  1VEG A;  2ERC A;  5FLX S;  3KP0 E;  4Y28 F;  2ZTC A;  1G59 A;  3GLH B;  4JN6 A;  3GO8 A;  2CFO A;  3EIH A;  4PDG A;  4LF7 M;  5ITX E;  1KFV A;  4Q7J A;  4TUW A;  1QAM A;  1R2Z A;  4NSR A;  4MB7 A;  1XXH E;  2MRO B;  4JI6 M;  2B3T A;  3U5Z B;  4LG2 A;  1TTE A;  2DZN B;  1N36 M;  1T6O A;  4WW0 A;  4DV6 M;  1IY1 A;  2XSZ A;  2Y0Q A;  1QDR A;  4BB9 A;  4G3O A;  1QAN A;  1ZMW A;  1XNR M;  2K6B A;  1QAO A;  2VQE M;  1G4A E;  4F2L A;  1HT1 E;  3CF2 A;  3E21 A;  3RGS A;  4L4U A;  1ZMU A;  2LWX A;  5EP4 A;  1AIP C;  2KNV A;  2N35 A;  5ITY A;  3GLF A;  4B3R M;  3VK7 A;  1L8Q A;  1GLN A;  2R65 A;  3SC3 A;  1DGH B;  3F92 A;  1IBK M;  1FNN A;  4LGM A;  2CV1 A;  1D2N A;  4OVZ B;  3HWS A;  3IHP A;  4QNM A;  3AOG A;  5ITR A;  1XMO M;  3LQQ A;  4JV5 M;  2DAE A;  3VDU A;  2ZBK B;  5LMU M;  1TH2 A;  2WSE F;  3U6O A;  3GPP A;  3UK6 A;  1NY6 A;  2Y21 A;  3HGI A;  4IIW A;  4OW0 A;  5ITT A;  4I5S A;  3SYL A;  2P5T A;  2Z7J A;  2MR9 A;  1OFH A;  1DGB A;  3R8F A;  2I7P A;  2ZAO A;  3AOE C;  1OIP A;  1GVN A;  2RGO A;  1IXZ A;  5FTN A;  2WZJ A;  2VQF M;  2KZU A;  2R46 A;  4LGY A;  5EP3 A;  2V1U A;  5KO3 A;  1QDT A;  2X4A A;  3HJ8 A;  4S12 A;  1N78 A;  4CIZ A;  2CEA A;  2FH0 A;  4DR4 M;  2L7H A;  3FYD A;  3JR4 A;  4AKH A;  1GJS A;  3FRI A;  3LVW A;  2DVW B;  4DV4 M;  4BBA A;  1J09 A;  1VQ1 A;  1W5S A;  4LJ5 A;  4QOS A;  3SAS A;  3FUX A;  3SMP A;  2JY8 A;  2LVA A;  2KXE A;  4DR6 M;  4B3S M;  1IY2 A;  3AL0 C;  2BWE A;  1HNZ M;  2CHV A;  4MGZ E;  2JXN A;  2LHC A;  2QPA A;  1R5L A;  3AFH A;  3FKE A;  3GLH E;  4DUY M;  2E5L M;  2J5Y A;  3TWM A;  1XXH A;  3IG5 A;  2F5Q A;  4YY3 M;  2UUC M;  1ZMV A;  1NHW C;  3J7B A;  4MM3 B;  4B7G A;  1VDD A;  2JZ1 A;  3KOY E;  2ZM6 M;  2XZU A;  3C58 A;  1P3Q Q;  3KOW E;  3OTO M;  3MK6 A;  1SG9 A;  1FJG M;  3KS8 A;  3GLI E;  2K9D A;  3JAM S;  4CIS A;  1C7Y A;  4KLN A;  1IN6 A;  4LF8 M;  4DV2 M;  1GAB A;  1WJ7 A;  4PT5 A;  5ITQ A;  3U60 A;  4DR5 M;  2O25 A;  2QBY A;  3B7Q A;  2L4E A;  1PJI A;  3KW6 A;  2CUZ A;  1SXJ A;  4LJA A;  2W82 A;  4D80 A;  4DV3 M;  1I94 M;  3A42 A;  4FWH A;  4JI7 M;  2G3Q A;  2CWB A;  3GLG B;  4DR7 M;  2KRU A;  1WR1 B;  3ZC7 B;  3SHF A;  3TL4 X;  1L2D A;  1JB0 F;  1WIV A;  4B3T M;  4LFA M;  2UUB M;  4JYA M;  2R18 A;  4MGY E;  2RKO A; 
#chains in the Genus database with same CATH homology
 2KW0 A;  5KPT A;  2J7O A;  4NXN M;  2X8A A;  1IN5 A;  2RGH A;  3SAT A;  2G5G X;  3AV0 A;  2DXI A;  7CAT A;  1HQC A;  4IBJ A;  4MGH A;  2ZAN A;  4YHH M;  2EA0 A;  5IRE B;  2YFQ A;  3J7A S;  3KP1 E;  4JI4 M;  2R45 A;  3K2L A;  4JXJ A;  4LY6 A;  2NQ8 C;  3LQR A;  3KSJ A;  3SHG B;  4M0D A;  4D82 A;  4DV5 M;  4GKJ M;  1XC8 A;  2HL7 A;  1Z59 A;  2XFS A;  1HQY E;  4DR1 M;  1Q39 A;  1Z5B A;  3VK8 A;  1I4W A;  3E4R A;  4KO8 A;  5C18 A;  3HJS A;  3SMS A;  1NJF A;  5KPR A;  3KSX A;  5LMN M;  3D8B A;  2DWN A;  3A46 A;  4REZ A;  3SAR A;  3VDP A;  4G4Q A;  2JA2 A;  1G3I A;  3U6P A;  3SAV A;  1DGG A;  2C5R A;  3EIE A;  3J27 B;  1MU5 A;  2R4E A;  3TWK A;  4LF9 M;  2L6O A;  4IBI A;  3GRU A;  1G41 A;  2Z3X A;  3RE8 A;  2CHQ A;  4HLQ A;  3RGP A;  3L2A A;  1X37 A;  4KOD A;  3GQ5 A;  2UXD M;  2XH9 A;  3SFZ A;  3TPZ A;  2KA6 B;  4JI2 M;  4PCZ A;  4LF5 M;  4AG6 A;  5IZ7 D;  1HR0 M;  1G8P A;  4R7G A;  1ZAE A;  2FOI C;  3GLI A;  3U61 A;  1T3T A;  1YUB A;  2F5P A;  4RF1 A;  3VLF B;  4B08 A;  4DV1 M;  4LFC M;  4XBO A;  1E32 A;  3M7G A;  4B7H A;  1S3S A;  4LJ4 A;  5FSW A;  2HHH M;  4MGK E;  4GH9 A;  2D7G A;  5FTL A;  4IBB A;  1R6B X;  2KRK A;  4M9Z A;  1IQP A;  3A98 B;  1YE9 A;  2C9O A;  3DFZ A;  2BJV A;  4M9S A;  3I4V A;  3GLF B;  5EXP A;  3I4Y A;  4IBE A;  3T15 A;  1NJG A;  4AKI A;  3BOS A;  5GKN A;  3ZCB B;  4AW4 A;  4Z8X A;  2ZAM A;  4LF6 M;  2XEP A;  1L2B A;  2K47 A;  1PM5 A;  2C98 A;  4X62 M;  3J2P B;  4AZF A;  2C96 A;  3GPX A;  2EUC A;  2FFJ A;  2X49 A;  4G6Z A;  1Z5A A;  3HHZ A;  3QAU A;  4FWG A;  3FUW A;  1R7R A;  3T1H M;  1GL6 A;  1DO2 A;  3AJI B;  4MH0 E;  4NXM M;  4GRI A;  1TDH A;  1DGF A;  4L16 A;  2F5S A;  2D7H A;  3L29 A;  5ITX A;  2VII A;  4L78 A;  3GRV A;  4G4R A;  2FE8 A;  1IN7 A;  2BNK A;  3PNV A;  1IBM M;  4FVM A;  4II7 A;  4AI6 A;  2YR0 A;  4ZPX A;  4G4O A;  4GMQ A;  4A3V B;  1DO0 A;  4L15 A;  1IN4 A;  4LZJ A;  3HU2 A;  3DA1 A;  4QHT A;  4AQY M;  1HNX M;  1K82 A;  1XXH B;  3L28 A;  3PXG A;  1N75 A;  2D7E A;  5H37 D;  2Y0T A;  3HJQ A;  3HHW A;  5KQD A;  5KQ8 A;  2LH0 A;  5EP2 A;  4PDI A;  2EO2 A;  5DYI A;  3MJ5 A;  3J80 S;  3U6S A;  4B3M M;  3GQ3 A;  4CGY B;  4D81 A;  4FCW A;  3GPY A;  1IXR C;  4FW9 A;  2L09 A;  5E6J A;  3FTC A;  3KOZ E;  3U60 B;  4GC5 A;  2I7N A;  2QBY B;  3FUU A;  3KOX E;  2CHG A;  4IBK A;  4G4N A;  3MHV C;  3GLG A;  5IT9 S;  1SXJ B;  2XSZ D;  1JQJ C;  2F5N A;  2Q2E B;  4WUR A;  4DR2 M;  5IWA M;  5DYG A;  1OJL A;  3D8L A;  4X66 M;  1E9S A;  2QCU A;  4DUZ M;  3LVV A;  5EXT A;  4AG5 A;  1W5T A;  2UU9 M;  3FD9 A;  4NOO B;  3GQ4 A;  2DWM A;  4DV7 M;  3KS4 A;  4I8O A;  4LJ6 A;  2OQ4 A;  2V1C A;  2XGN A;  4LRT A;  3I51 A;  3TQS A;  2F4V M;  4X65 M;  5E26 A;  1KYI A;  1K3W A;  3H4M A;  4L8R C;  4FCT A;  3THG A;  3RFW A;  3K92 A;  2LNH C;  3K1J A;  1J7K A;  1SXJ C;  3FTF A;  4KHP M;  1E9R A;  3ILK A;  4IBD A;  4RNA A;  3VKH A;  3GLH A;  1R2Y A;  1QYR A;  1GKI A;  5A2Q S;  1HT2 E;  3WHK A;  2R4J A;  3CF6 E;  1MX0 A;  1N33 M;  3HKP A;  1NNJ A;  2V6Z M;  1OFI A;  2HKJ A;  2C9C A;  4JI3 M;  3KDS E;  2YQZ A;  8CAT A;  1JR3 D;  3SAW A;  3U5Z A;  5EXX A;  3U6C A;  3J81 S;  4RF0 A;  4M0W A;  1GL7 A;  1TGU A;  5C1B A;  3A45 A;  3SBJ A;  2XFT A;  4FWD A;  3GRY A;  3WHL A;  3E9S A;  3LMM A;  2DHR A;  4B7F A;  4BLC A;  5ITU A;  4NRV A;  3SAU A;  5F3W A;  4LZZ A;  3U6L A;  5BR8 M;  2KEB A;  3M6A A;  4P16 A;  2KZS A;  1IY0 A;  1UM8 A;  3DZD A;  3AOE A;  3GLI B;  3UZU A;  3U61 B;  4I4L A;  3K8Z A;  1DGH A;  1IM2 A;  1QVR A;  4OVZ A;  4MGI E;  2YNM D;  2XF3 A;  1J5E M;  2OPF A;  3Q8X A;  4LCB A;  4GHA A;  4OU7 A;  2QEN A;  1ORY B;  2CV0 A;  3HU1 A;  1QQW A;  4IJE A;  2DZO B;  1L1Z A;  2DWZ B;  4GIT A;  3HHY A;  1SXJ E;  3UGJ A;  4XGI A;  4LJ9 A;  4JI5 M;  5FTJ A;  2LXE A;  3CF0 A;  2UUA M;  1EE8 A;  1IXS B;  2CE7 A;  3PNY A;  5EP1 A;  4AKG A;  2R62 A;  2Z4S A;  1XHB A;  2BJW A;  4LRS A;  5EJC A;  1NSF A;  4QHS A;  4Z6Y A;  4PD2 A;  3L25 A;  4GIP A;  1SXJ D;  1Z6T A;  1E94 E;  4HL4 A;  3NWL A;  3L26 A;  4OX9 M;  4GHL A;  3GRR A;  3FYC A;  2DWL A;  4JI1 M;  3U6Q A;  1JR3 A;  1L1T A;  3TWL A;  2L7I A;  1TH3 A;  3HHX A;  3NBI A;  4QNR A;  4JI8 M;  1XNQ M;  3DOA A;  3KFU G;  3PVS A;  3KXE C;  3U6M A;  2QZ4 A;  3IG8 A;  4IBC A;  2J7N A;  2CV2 A;  3FUT A;  4LFB M;  2FNA A;  3R9X B;  5EQT A;  5EXS A;  1H6U A;  3TE6 A;  3ZH9 B;  5DNY A;  1NNU C;  3HU3 A;  2M60 A;  4LJ7 A;  1IBL M;  1KSF X;  1C1K A;  2Z4R A;  3FTD A;  5FTK A;  4EIW A;  4QOZ C;  3QWL A;  3W0L B;  3T38 A;  3GPU A;  3FUV A;  4FD2 A;  4FCV A;  4M9X A;  1NY5 A;  3KVW A;  1ZQ9 A;  3UMM A;  2UXC M;  2A5Y B;  4CHT B;  4X64 M;  4GKK M;  2M5Z A;  5JI2 E;  1Q3C A;  4NRW A;  3UJN A;  4NSO B;  5BPV A;  1WXQ A;  2Y20 A;  4ITQ A;  1N77 A;  5FTM A;  1QZM A;  3W0F A;  3SYK A;  4K0K M;  1XMQ M;  3VFD A;  4IBF A;  4IBG A;  1IN8 A;  3VKG A;  4DR3 M;  2HCB A;  4DV0 M;  1HNW M;  1YSY A;  5JI3 E;  1N32 M;  2UXB M;  1L2C A;  3T1Y M;  2F5O A;  3FTE A;  4LF4 M;  3M0E A;  2AHM A;  1TDZ A;  2G8L A;  3L27 A;  2C99 A;  1XWI A;  4W5W A;  2XLJ A;  3U6E A;  2H1R A;  1N34 M;  1QAQ A;  1LV7 A;  4LJ8 A;  3GP1 A;  5KPZ A;  1PJJ A;  4JI0 M;  1TH4 A;  3CTW B;  4GC9 A;  3U6D A;  2O5R A;  1K3X A;  4I81 A;  3AKZ A;  3B9P A;  3JR5 A;  1NHG C;  2QP9 X;  1NVM A;  1Z5C A;  4IJF A;  4R3D A;  3PFI A;  2XZF A;  4NL4 H;  1Q3B A;  2ERC A;  5FLX S;  3KP0 E;  1G59 A;  3GLH B;  4JN6 A;  3GO8 A;  2CFO A;  3EIH A;  4PDG A;  4LF7 M;  5ITX E;  1KFV A;  4TUW A;  1QAM A;  1R2Z A;  4NSR A;  4MB7 A;  4JI6 M;  4LG2 A;  3U5Z B;  2DZN B;  1N36 M;  4WW0 A;  4DV6 M;  1IY1 A;  2XSZ A;  2Y0Q A;  4BB9 A;  1QAN A;  1XNR M;  1QAO A;  2VQE M;  1G4A E;  1HT1 E;  3CF2 A;  3RGS A;  4L4U A;  2LWX A;  5EP4 A;  5ITY A;  3GLF A;  4B3R M;  3VK7 A;  1L8Q A;  1GLN A;  2R65 A;  3SC3 A;  1DGH B;  1IBK M;  1FNN A;  4LGM A;  2CV1 A;  1D2N A;  4OVZ B;  3HWS A;  4QNM A;  3AOG A;  5ITR A;  1XMO M;  3LQQ A;  4JV5 M;  3VDU A;  2ZBK B;  5LMU M;  1TH2 A;  3U6O A;  3GPP A;  3UK6 A;  1NY6 A;  2Y21 A;  3HGI A;  4IIW A;  4OW0 A;  5ITT A;  4I5S A;  3SYL A;  2P5T A;  2Z7J A;  1OFH A;  1DGB A;  3R8F A;  2I7P A;  2ZAO A;  3AOE C;  1GVN A;  2RGO A;  1IXZ A;  5FTN A;  2VQF M;  2KZU A;  2R46 A;  4LGY A;  5EP3 A;  2V1U A;  5KO3 A;  2X4A A;  3HJ8 A;  4S12 A;  1N78 A;  4DR4 M;  2CEA A;  2L7H A;  3FYD A;  3JR4 A;  4AKH A;  3LVW A;  2DVW B;  4DV4 M;  4BBA A;  1J09 A;  1W5S A;  4LJ5 A;  4QOS A;  3SAS A;  3FUX A;  3SMP A;  2KXE A;  4DR6 M;  4B3S M;  1IY2 A;  3AL0 C;  1HNZ M;  2CHV A;  4MGZ E;  2QPA A;  3AFH A;  3FKE A;  4DUY M;  2E5L M;  3TWM A;  1XXH A;  3IG5 A;  2F5Q A;  4YY3 M;  2UUC M;  1NHW C;  3J7B A;  4MM3 B;  4B7G A;  1VDD A;  3KOY E;  2XZU A;  2ZM6 M;  3C58 A;  3KOW E;  3OTO M;  3MK6 A;  1FJG M;  3KS8 A;  3JAM S;  4CIS A;  4KLN A;  1IN6 A;  4LF8 M;  4DV2 M;  4PT5 A;  5ITQ A;  3U60 A;  4DR5 M;  2QBY A;  1PJI A;  3KW6 A;  2CUZ A;  1SXJ A;  4LJA A;  2W82 A;  4D80 A;  4DV3 M;  1I94 M;  3A42 A;  4FWH A;  4JI7 M;  3GLG B;  4DR7 M;  2KRU A;  3ZC7 B;  3SHF A;  3TL4 X;  1L2D A;  4B3T M;  4LFA M;  2UUB M;  4JYA M;  2R18 A;  4MGY E;  2RKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...