1HR0M

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hr0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hr0M02
1L2DA 3U6PA 1Z5AA 3SBJA 1XMQM 5A2QS 1IBKM 4K0KM 4DR6M 4NXNM 1Z59A 3GP1A 4MB7A 1KFVA 3TWLA 3JR4A 3SAUA 4JI2M 1XMOM 4G4NA 4G4OA 2EA0A 4DV1M 3SAWA 5ITYA 1L2CA 1EE8A 1XNQM 2UUBM 2UU9M 1L1ZA 5ITUA 4DR7M 3JR5A 2F5SA 4B3SM 2UUCM 4JI3M 4DR5M 1Q3CA 3A46A 3VK8A 3U6SA 4DR1M 4OX9M 4DV4M 4JI0M 2F5OA 4NRWA 3GPUA 2UUAM 1PJJA 4LF4M 2HHHM 4B3TM 1XNRM 4X65M 1NNJA 5LMNM 1HNXM 1K3WA 4AQYM 2ZBKB 1HR0M 3J7AS 3GPPA 4LF5M 4NXMM 2F5PA 4PDIA 4DUZM 4B3MM 3GPYA 4G4RA 2F5NA 3U6DA 4JI8M 2OQ4A 4X66M 1XC8A 4JI4M 1FJGM 4GKJM 1Q3BA 5ITXE 3U6LA 4PDGA 3SASA 5IWAM 4LF8M 2XZUA 4B3RM 4JV5M 4PCZA 1I94M 1HNZM 1N34M 3A42A 4DUYM 4JI5M 4YY3M 4JI1M 3T1HM 3GPXA 1PM5A 4DV6M 4LF6M 2OPFA 4LFBM 4DV2M 4DV5M 3U6MA 3A45A 1L1TA 5FLXS 1N33M 3SARA 4LF7M 4JYAM 5ITRA 2F4VM 4PD2A 3SAVA 4LFAM 1Z5CA 2UXCM 4YHHM 3DOAA 5IT9S 3GO8A 3GQ3A 5ITQA 2VQFM 1IBMM 4DV7M 5ITTA 4JI6M 3TWMA 1MX0A 4DV3M 3SATA 4X62M 2ZM6M 2XZFA 2UXDM 3U6CA 1L2BA 3J80S 1IBLM 4DR3M 4CISA 1N36M 1PJIA 5ITXA 2VQEM 3U6EA 4DR4M 1TDHA 4NRVA 3T1YM 3VK7A 4G4QA 4JI7M 1HNWM 4DV0M 5BR8M 1TDZA 4ITQA 1MU5A 4GKKM 3OTOM 2HKJA 2Q2EB 3U6OA 1J5EM 4KHPM 1R2YA 4LFCM 3U6QA 1N32M 4DR2M 2F5QA 3TWKA 1K82A 3GQ5A 2E5LM 1R2ZA 1Q39A 4X64M 1Z5BA 3J81S 3GQ4A 2UXBM 4LF9M 3W0FA 5LMUM 1K3XA 3JAMS 3C58A
chains in the Genus database with same CATH superfamily
2ZAOA 4L16A 1KSFX 1L2DA 4IBFA 5IZ7D 3PXGA 2G8LA 1G41A 4IBIA 3I4VA 1NY6A 2QSFX 3RGSA 3QAUA 4NXNM 4MB7A 1A5TA 2BNKA 4LJAA 3KOXE 4BBAA 2R4EA 2G3QA 4M0WA 1SG9A 2JZ0A 2BJVA 2Y0QA 4P17A 2EA0A 3K9PA 1EE8A 1D0MA 4DR7M 3D8BA 1DGHA 2UUCM 1LTMA 2JWSA 2DNAA 3A46A 3C9PA 5FTJA 2I7NA 4OX9M 1EIJA 3GRVA 3GPUA 2UUAM 3KOYE 4HLQA 1XNRM 4Z6YA 2DWZB 1JQJC 4X65M 1NNJA 3AL0C 5LMNM 2EO2A 1HNXM 1VG5A 3KOZE 3GLIB 2LWXA 2X4AA 4LG2A 2KDLA 3W0LB 1IN7A 4NXMM 2J7NA 4GEWA 4TUWA 2CEAA 2HL7A 2LVQD 4DUZM 1GVNA 4IBKA 5EXSA 1X37A 2N35A 5FTKA 3U60A 1R5LA 1G4AE 4REZA 1G3IA 3LMMA 3M6AA 3EIEA 5FTNA 4JI8M 4LJ4A 3RE8A 3NBXX 4LRSA 1NV9A 1Q3BA 1Y8GA 4I8OA 4IBEA 3IECA 4WP2A 2LVNC 4PDGA 3SASA 3LQRA 1GJTA 4B3RM 2O5RA 3K9OA 4OW0A 2XZUA 4JV5M 2XGNA 3GRYA 4PCZA 1IY1A 2JY5A 1HNZM 4KLNA 2M60A 3A42A 3I51A 3LVVA 4DUYM 2P5TA 4JI1M 1QQWA 1IQPA 5FSWA 3T1HM 3GLGE 1PM5A 1QAOA 4IBJA 4DV6M 2CV0A 4L8RC 4LJ9A 2CV2A 3GLFB 4LZZA 2C5RA 3U6MA 3LCVB 2JP7A 4RF1A 2G5GX 3HKPA 4IBDA 5EP3A 2OOBA 3UMMA 3SARA 4D82A 2WSCF 1NNUC 2D7GA 2F4VM 4JYAM 3GLGA 2UXCM 3T38A 3CF2A 4AI6A 4LGMA 1PJQA 1WGNA 1HT1E 3GQ3A 1IBMM 4BLCA 3HHZA 1TH2A 1PRBA 4JI6M 2LVAA 3GLIE 3U5ZB 2XZFA 5EP1A 2UXDM 2CUZA 4IJFA 3U6CA 1IN6A 4IBGA 4MGKE 2C99A 4FWDA 1XWIA 4CIZA 1BVSA 2LTUA 3R8FA 1D2NA 1QUSA 2L7HA 2X8AA 3FUXA 2JY7A 4NRVA 1ZAEA 4DV0M 3GLHA 4EIWA 5BR8M 3MJ5A 1TDZA 2MR9A 1MU5A 1TR8A 4GKKM 3U6OA 2KW0A 3CF6E 1J5EM 4RF0A 4LFCM 3D8LA 3L25A 2EKKA 3B7NA 2FFJA 1P3QQ 1TF0B 2UXBM 3FTCA 3UZUA 3FRIA 4QNRA 3A98B 2OOAA 3FRHA 2DAIA 2FS1A 2A5YB 2BJWA 4UN2B 2DHYA 1FNNA 3FTDA 5EP4A 3U6PA 1Z5AA 1G71A 3L29A 3Q8XA 1XMQM 3KW6A 4IBBA 5A2QS 4GHAA 1WHCA 1T43A 2JA2A 3GP1A 3TWLA 2JXNA 3KOWE 1V33A 3PFIA 5EXPA 3THGA 3FTFA 4G4NA 2QENA 1SXJB 1WR1B 2Z7JA 2UUBM 1L1ZA 2JNHA 1S3SA 3JR5A 2F5SA 4DR5M 4B3SM 3FYDA 4XBOA 3C3DA 4B08A 4JI0M 4NRWA 2EKFA 3E46A 3HJ8A 3IHPA 1IXSB 1F4IA 4LF4M 2VDBB 3KS8A 1E32A 3HHXA 1OIPA 3F92A 3AOEA 4LRTA 1PJTA 4P16A 2ERCA 5EJCA 3ZQJA 1HR0M 3J7AS 1NJGA 1YUBA 2F5PA 4HL4A 3DA1A 1QUTA 3QYBA 1YSYA 4G4RA 1SXJC 2R44A 3U6DA 2APLA 2DHRA 1OKSA 2CHVA 1YE9A 2XSZD 4X66M 1XC8A 4FWHA 5ITXE 3MK6A 2JUJA 2WZJA 7CATA 5KPZA 1YLAA 4OVZB 2WSFF 2J7OA 1IN4A 3PNVA 4GC5A 1I94M 1N34M 4JI5M 1V92A 1OTRA 4R7GA 4B7FA 1H6UA 3HWSA 2FH0A 2QHOB 2KRUA 3HU2A 3Q8GA 2C9OA 2EJSA 4KO8A 3GPXA 2K6BA 2ZTCA 1VQ1A 3SMSA 2OPFA 4DV2M 1HQCA 3KS4A 3U61A 2DKLA 5FLXS 1N33M 3K2LA 4ANRA 2H1RA 2R65A 1IN5A 4FWGA 3VFDA 4FCVA 4I4LA 3GO8A 5BPVA 4NSOB 1CUKA 1UM8A 3KP1E 3SFZA 1UFZA 3FKEA 1IXZA 3TWMA 2RKOA 4LY6A 2DAEA 3ILKA 4X62M 2VF7A 2MROB 3J80S 1VEJA 4FD2A 4DR3M 3AJIB 4MGYE 2CWBA 2FOIC 4CISA 1QYRA 4GH9A 3KSXA 1MN3A 1NHWC 3KP0E 5JI2E 2Z4RA 2KNVA 3B89A 1DGFA 1JB0F 2LXEA 2XF3A 1C1KA 4L6V6 3T1YM 1HNWM 3PVSA 2R18A 2H5XA 1ZV1A 4ITQA 2MJ5B 4W5WA 3OTOM 2Q2EB 2QNJA 3T15A 4CGYB 2O25A 1N32M 5KPTA 4ZPXA 1SXJD 5DFLA 3CGWA 3TE6A 4G6ZA 3VLFB 1GABA 2E5LM 3J81S 4LGYA 3HU1A 3W0FA 3ZC7B 1K3XA 3FE3A 2DAMA 3JAMS 1NVMA 1QZMA 4DBGB 1VDLA 2Z3XA 2R45A 1NO1A 3BOSA 4PT5A 2RGOA 3I01M 4AG6A 3PNYA 1WJ7A 1ZMUA 2DXIA 2ZANA 3AOGA 1OFIA 2V1CA 3DFZA 3SBJA 3GLIA 3UK6A 3W68A 3L28A 2L2DA 1N77A 1JR3E 1Z59A 1L8QA 1E9SA 2C9CA 3FUWA 3ZCBB 1DGBA 3AKZA 4RKUF 3FUVA 3SYKA 4JI2M 1XMOM 2JY8A 4XGIA 1LV7A 2CRUA 3SHGB 2Y20A 5H37D 4G4OA 3UJNA 1DV0A 4DV1M 4R71A 5KO3A 3H4JA 4B7HA 3E21A 1L2CA 2UU9M 4FVMA 1XNQM 4IIWA 4F2LA 1VEKA 4JI3M 4M0DA 1XXHB 3GRRA 3FUUA 5DYIA 3GLFE 4DR1M 4DV4M 1ORYB 4MGIE 1GLNA 2QBYB 2F5OA 3I4YA 1AUAA 4OU7A 1XB2B 4I81A 1PJJA 4L78A 4AKGA 5JI3E 4WW0A 3W67A 2BWEA 2DZNB 3GLFA 2GQFA 4QOZC 4FCTA 4MH0E 4NL4H 3GPPA 4LF5M 1D0LA 1TH4A 3BXWA 5EQTA 4PDIA 1QAMA 1QDTA 2Z8YM 3WHLA 2F5NA 1KYIA 1C7YA 2XLJA 2QZ4A 2ZTDA 2OQ4A 2XSZA 4GKJM 5EXXA 1FJGM 1JR3D 1OAIA 2DWLA 3U6LA 1DGHB 3U5ZA 1QANA 4M9SA 3WHKA 1GL7A 1EFUB 4LJ8A 3MHVC 2Y0TA 3RFWA 3TQSA 2LVPC 3SC3A 5GKNA 3R9XB 3AOEC 1N75A 1AIPC 4YY3M 3NWLA 4LFBM 3LW5F 3HY5A 2CV1A 1W5TA 3EIHA 3L2AA 1XXHE 2DAGA 3M7GA 3J7BA 4LF7M 1Q02A 2XEPA 5KPRA 1XHBA 3FUTA 1QVRA 3L27A 4LFAM 4D81A 4YHHM 3DOAA 3SAVA 2DZLA 4HEOA 2MH8A 3M0EA 2D7EA 2CFOA 2QP9X 2VQFM 2NQ8C 4BB9A 2L4EA 5ITTA 2EUCA 1XXHA 2JY6B 2DWMA 2R4JA 3SATA 2KZUA 4NC6A 1L2BA 1NJFA 1IBLM 2KNZA 2X49A 2LNHC 5DYGA 2J5YA 1VDDA 3B7ZA 5C1BA 3K1JA 2LHCA 1VEGA 2GNOA 4G3OA 2FNAA 1OAOC 1TGUA 2YFQA 3HJQA 5ITXA 2VQEM 4LZJA 4DR4M 1SXJE 1TDHA 3HX3A 4AG5A 4G4QA 2KA6B 4QNMA 3LQQA 2CP8A 2C98A 3VDPA 2Y21A 2HKJA 1GKIA 4KHPM 3GLGB 1R2YA 2YQZA 3U6QA 4AZFA 4IJEA 4DR2M 3TWKA 4IBCA 4B7GA 1SXJA 3AFHA 4KT0F 1WIVA 2HCBA 2DVWB 2KXEA 1PGYA 2M5ZA 1Q39A 4X64M 3GQ4A 4NSRA 1R2ZA 4L4UA 2K0BX 4LF9M 1HT2E 3V76A 4LJ7A 5DNYA 5LMUM 3ZH9B 4FW9A 3LVWA 3QWLA 4AW4A 2CE7A 2DI0A 1IXSA 3T6PA 2K47A 3TPZA 1OQYA 3C58A 5EP2A 1E9RA 1IXRC 3KSJA 1R7RA 5E6JA 5EXTA 3B74A 4M9ZA 1IBKM 2L6OA 4K0KM 4DR6M 1NHGC 2DZOB 4JXJA 5FTMA 3GLHB 5IREB 4A3VB 4MGZE 3UGJA 1HQYE 2ZAMA 1KFVA 2VF8A 4QOSA 3JR4A 3SAUA 2FE8A 2HAKA 1I4WA 3HHWA 2KRKA 3KDSE 3QYEA 1V34A 3TL4X 3SAWA 4WURA 5ITYA 3SMPA 1QDRA 5ITUA 3FTEA 4Z8XA 1Q3CA 4OVZA 1IY0A 3VK8A 3VKGA 1OFHA 2DAKA 4MM3B 3U6SA 4QHSA 4GHLA 3FYCA 1GJSA 1DO0A 2R0IA 4II7A 4Q7JA 1G59A 2HHHM 4CJ6A 4B3TM 3KXEC 2W82A 4JN6A 1K3WA 2LHGA 4FCWA 3SYLA 1RU3A 4AQYM 2ZBKB 1R6BX 1TTEA 4GC9A 4LJ5A 2V1UA 3E4RA 3VDUA 4M9XA 2KNAA 4D80A 2L4FA 2L09A 4MGHA 4B3MM 2B3TA 4GITA 3CTWB 3GPYA 2CHGA 4R3DA 3L26A 5F3WA 3MMPA 2D7HA 4JI4M 2Z4SA 5KQ8A 1NV8A 2OO9A 1JR3A 3IG5A 1WGLA 5IWAM 1DO2A 3H4MA 4LF8M 1ZQ9A 2AHMA 2RGHA 3GLHE 3KFUG 3LCUA 1T3TA 1E94E 2XFTA 1T6OA 2V6ZM 1Z6TA 4Y28F 1OIZA 3C3EA 2DWNA 2O01F 3AV0A 3HZJA 3HGIA 1MJGM 3IG8A 4L15A 4LF6M 4AKHA 3J27B 1G8PA 3GRUA 3K8ZA 1J7KA 3HHYA 4DV5M 3A45A 1L1TA 2R46A 2VIIA 3BBZA 2BWBA 1NSFA 4F1IA 5C18A 5ITRA 1GL6A 4CHTB 3E9SA 3K92A 1HJPA 4PD2A 1IFYA 1Z5CA 2LBCA 5IT9S 1WXQA 4LCBA 3HU3A 5ITQA 1PJSA 4DV7M 2QCUA 1IY2A 2HWJA 2LVOC 1MX0A 4DV3M 2XFSA 4KODA 4GIPA 3RGPA 3SHFA 2ZM6M 1J09A 4AKIA 1ZMVA 2KHHA 5L8RF 4I5SA 4NOOB 2LH0A 2I7PA 1GO5A 2R62A 3U60B 1IM2A 2RRUA 1N36M 5FTLA 2L7IA 2KZSA 3J2PB 5KQDA 1PJIA 1TH3A 2QPAA 3CF0A 2CHQA 4RNAA 5E26A 3U6EA 2DENA 2QQ8A 4JI7M 4QHTA 3VK7A 3B7QA 3U61B 1DGGA 1QAQA 1IN8A 2MGWA 3NBIA 4XK8F 2K9DA 3KVWA 2C96A 1OJLA 4GRIA 2YR0A 2F5QA 3HJSA 3DZDA 3B9PA 3I04M 4LJ6A 1K82A 3GQ5A 2WSEF 8CATA 1ZMWA 2XH9A 3FD9A 1Z5BA 3VKHA 1D0KA 2YNMD 1NY5A 4GMQA 2QBYA 2JZ1A 2R6FA 1R4GA 1QZEA 1W5SA 2KEBA 4S12A 1N78A
chains in the Genus database with same CATH topology
2ZAOA 4L16A 1KSFX 1L2DA 4IBFA 5IZ7D 3PXGA 2G8LA 1G41A 4IBIA 3I4VA 1NY6A 3RGSA 3QAUA 4NXNM 4MB7A 2BNKA 4LJAA 3KOXE 4BBAA 2R4EA 4M0WA 2Y0QA 2BJVA 2EA0A 1EE8A 4DR7M 3D8BA 1DGHA 2UUCM 3A46A 5FTJA 2I7NA 4OX9M 3GRVA 3GPUA 2UUAM 3KOYE 4HLQA 1XNRM 4Z6YA 2DWZB 1JQJC 4X65M 1NNJA 3AL0C 5LMNM 2EO2A 1HNXM 3KOZE 3GLIB 2LWXA 2X4AA 4LG2A 3W0LB 1IN7A 4NXMM 2J7NA 4TUWA 2CEAA 2HL7A 4DUZM 1GVNA 4IBKA 5EXSA 1X37A 5FTKA 3U60A 1G4AE 4REZA 1G3IA 3LMMA 3M6AA 3EIEA 5FTNA 4JI8M 4LJ4A 3RE8A 4LRSA 1Q3BA 4I8OA 4IBEA 4PDGA 3SASA 3LQRA 4B3RM 2O5RA 2XZUA 4OW0A 4JV5M 2XGNA 3GRYA 4PCZA 1IY1A 1HNZM 4KLNA 2M60A 3A42A 3I51A 3LVVA 4DUYM 2P5TA 4JI1M 1QQWA 1IQPA 5FSWA 3T1HM 1PM5A 1QAOA 4IBJA 4DV6M 2CV0A 4L8RC 4LJ9A 2CV2A 3GLFB 4LZZA 2C5RA 3U6MA 3UMMA 5EP3A 4RF1A 2G5GX 3HKPA 4IBDA 3SARA 4JYAM 4D82A 2F4VM 1NNUC 2D7GA 3GLGA 2UXCM 3T38A 3CF2A 4AI6A 4LGMA 1HT1E 3GQ3A 1IBMM 4BLCA 4JI6M 1TH2A 3U5ZB 2XZFA 5EP1A 2UXDM 2CUZA 4IJFA 3U6CA 1IN6A 4IBGA 4MGKE 2C99A 4FWDA 1XWIA 3R8FA 1D2NA 2L7HA 2X8AA 3FUXA 4NRVA 1ZAEA 4DV0M 3GLHA 4EIWA 5BR8M 3MJ5A 1TDZA 1MU5A 4GKKM 3U6OA 2KW0A 3CF6E 1J5EM 4RF0A 4LFCM 3D8LA 3L25A 2FFJA 2UXBM 3FTCA 3UZUA 4QNRA 3A98B 2A5YB 2BJWA 1FNNA 3FTDA 5EP4A 3U6PA 1Z5AA 3L29A 3Q8XA 1XMQM 3KW6A 4IBBA 5A2QS 4GHAA 2JA2A 3GP1A 3TWLA 3KOWE 3PFIA 5EXPA 3THGA 3FTFA 4G4NA 2QENA 1SXJB 2Z7JA 2UUBM 1L1ZA 3JR5A 1S3SA 2F5SA 4B3SM 4DR5M 3FYDA 4XBOA 4B08A 4JI0M 4NRWA 3HJ8A 1IXSB 4LF4M 3KS8A 1E32A 3HHXA 3AOEA 4LRTA 5EJCA 4P16A 2ERCA 1HR0M 3J7AS 1NJGA 1YUBA 2F5PA 4HL4A 3DA1A 1YSYA 4G4RA 1SXJC 3U6DA 2DHRA 2XSZD 2CHVA 1YE9A 4X66M 1XC8A 4FWHA 5ITXE 3MK6A 7CATA 5KPZA 4OVZB 2J7OA 1IN4A 3PNVA 4GC5A 1I94M 1N34M 4JI5M 4R7GA 4B7FA 4YY3M 1H6UA 3HWSA 3HU2A 3HHZA 2KRUA 4KO8A 2C9OA 3GPXA 3SMSA 2OPFA 4DV2M 1HQCA 3KS4A 3U61A 1N33M 5FLXS 3K2LA 2H1RA 2R65A 1IN5A 4FWGA 3VFDA 4FCVA 4I4LA 3GO8A 5BPVA 4NSOB 1UM8A 3KP1E 3SFZA 3FKEA 1IXZA 3TWMA 2RKOA 4LY6A 3ILKA 4X62M 3J80S 4FD2A 4DR3M 3AJIB 4MGYE 2FOIC 4CISA 1QYRA 4GH9A 3KSXA 1NHWC 3KP0E 5JI2E 2Z4RA 1DGFA 2LXEA 2XF3A 1C1KA 3T1YM 1HNWM 3PVSA 2R18A 4ITQA 4W5WA 3OTOM 2Q2EB 3T15A 4CGYB 1N32M 5KPTA 4ZPXA 1SXJD 3TE6A 4G6ZA 3VLFB 2E5LM 3J81S 4LGYA 3HU1A 3W0FA 3ZC7B 1K3XA 3JAMS 1NVMA 1QZMA 2Z3XA 3BOSA 2R45A 4PT5A 4AG6A 2RGOA 2DXIA 3PNYA 2ZANA 3AOGA 1OFIA 2V1CA 3DFZA 3SBJA 3GLIA 3UK6A 3L28A 1N77A 1Z59A 1L8QA 1E9SA 2C9CA 3FUWA 3ZCBB 1DGBA 3AKZA 3FUVA 3SYKA 4JI2M 1XMOM 4XGIA 1LV7A 3SHGB 2Y20A 5H37D 4G4OA 3UJNA 4DV1M 5KO3A 4B7HA 1L2CA 1XNQM 2UU9M 4FVMA 4IIWA 4JI3M 4M0DA 1XXHB 3GRRA 3FUUA 5DYIA 4DR1M 4DV4M 1ORYB 4MGIE 1GLNA 2QBYB 2F5OA 3I4YA 4OU7A 4I81A 1PJJA 4L78A 4AKGA 5JI3E 4WW0A 2DZNB 3GLFA 4QOZC 4FCTA 4MH0E 4NL4H 3GPPA 4LF5M 1TH4A 5EQTA 4PDIA 1QAMA 3WHLA 2F5NA 1KYIA 2XLJA 2QZ4A 2OQ4A 2XSZA 4GKJM 5EXXA 1FJGM 1JR3D 2DWLA 3U6LA 1DGHB 3U5ZA 1QANA 4M9SA 3WHKA 1GL7A 4LJ8A 3MHVC 2Y0TA 3RFWA 3TQSA 3SC3A 5GKNA 3R9XB 3AOEC 1N75A 3NWLA 4LFBM 2CV1A 1W5TA 3EIHA 3L2AA 4LF7M 3M7GA 3J7BA 2XEPA 5KPRA 3SAVA 1XHBA 3FUTA 1QVRA 3L27A 4LFAM 4D81A 4YHHM 3DOAA 3U60B 3M0EA 2D7EA 2CFOA 2QP9X 2VQFM 2NQ8C 4BB9A 5ITTA 2EUCA 1XXHA 2DWMA 2R4JA 3SATA 2KZUA 1L2BA 1NJFA 1IBLM 2X49A 2LNHC 5DYGA 1VDDA 5C1BA 3K1JA 5ITXA 2FNAA 1TGUA 2YFQA 3HJQA 2VQEM 4LZJA 4DR4M 1SXJE 1TDHA 4AG5A 4G4QA 2KA6B 4QNMA 3LQQA 3VDPA 2C98A 2Y21A 2HKJA 1GKIA 4KHPM 3GLGB 1R2YA 2YQZA 3U6QA 4AZFA 4IJEA 4DR2M 3TWKA 4IBCA 4B7GA 1SXJA 3AFHA 2HCBA 2DVWB 2KXEA 2M5ZA 1R2ZA 1Q39A 4X64M 3GQ4A 4NSRA 4L4UA 4LF9M 1HT2E 4LJ7A 5DNYA 5LMUM 3ZH9B 4FW9A 3LVWA 3QWLA 4AW4A 2CE7A 3C58A 3TPZA 2K47A 5EP2A 1E9RA 1IXRC 3KSJA 1R7RA 5E6JA 5EXTA 4M9ZA 1IBKM 2L6OA 4K0KM 4DR6M 1NHGC 2DZOB 4JXJA 5FTMA 3GLHB 5IREB 4A3VB 4MGZE 3UGJA 1HQYE 2ZAMA 1KFVA 3JR4A 4QOSA 3SAUA 2FE8A 1I4WA 3HHWA 2KRKA 3KDSE 3TL4X 3SAWA 4WURA 5ITYA 3SMPA 5ITUA 3FTEA 4Z8XA 1Q3CA 4OVZA 1IY0A 3VK8A 3VKGA 1OFHA 4MM3B 3U6SA 4QHSA 4GHLA 3FYCA 1DO0A 4II7A 1G59A 2HHHM 4B3TM 3KXEC 2W82A 4JN6A 1K3WA 4FCWA 3SYLA 4AQYM 2ZBKB 1R6BX 4GC9A 4LJ5A 2V1UA 3E4RA 3VDUA 4M9XA 4D80A 4MGHA 2L09A 4B3MM 4GITA 3CTWB 3GPYA 2CHGA 4R3DA 3L26A 5F3WA 2D7HA 4JI4M 2Z4SA 5KQ8A 1JR3A 3IG5A 5IWAM 1DO2A 3H4MA 4LF8M 1ZQ9A 2AHMA 2RGHA 3KFUG 1T3TA 1E94E 2XFTA 2V6ZM 1Z6TA 2DWNA 3AV0A 3HGIA 4LF6M 3IG8A 4L15A 4AKHA 3J27B 1G8PA 3GRUA 3K8ZA 1J7KA 3HHYA 4DV5M 3A45A 1L1TA 2R46A 2VIIA 5C18A 1NSFA 5ITRA 1GL6A 4CHTB 3E9SA 3K92A 4PD2A 1Z5CA 5IT9S 1WXQA 4LCBA 3HU3A 5ITQA 4DV7M 2QCUA 1IY2A 1MX0A 4DV3M 2XFSA 4KODA 4GIPA 3RGPA 3SHFA 2ZM6M 1J09A 4AKIA 4I5SA 4NOOB 2LH0A 2I7PA 2R62A 1IM2A 1N36M 5FTLA 2L7IA 2KZSA 3J2PB 5KQDA 1PJIA 1TH3A 2QPAA 3CF0A 2CHQA 4RNAA 5E26A 3U6EA 4JI7M 4QHTA 3VK7A 3U61B 1DGGA 1QAQA 1IN8A 3NBIA 3KVWA 2C96A 1OJLA 4GRIA 2YR0A 2F5QA 3HJSA 3DZDA 3B9PA 4LJ6A 1K82A 3GQ5A 8CATA 2XH9A 3FD9A 1Z5BA 3VKHA 2YNMD 1NY5A 4GMQA 2QBYA 1W5SA 2KEBA 4S12A 1N78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2D A;  3U6P A;  1Z5A A;  3SBJ A;  1XMQ M;  5A2Q S;  1IBK M;  4K0K M;  4DR6 M;  4NXN M;  1Z59 A;  3GP1 A;  4MB7 A;  1KFV A;  3TWL A;  3JR4 A;  3SAU A;  4JI2 M;  1XMO M;  4G4N A;  4G4O A;  2EA0 A;  4DV1 M;  3SAW A;  5ITY A;  1L2C A;  1EE8 A;  1XNQ M;  2UUB M;  2UU9 M;  1L1Z A;  5ITU A;  4DR7 M;  3JR5 A;  2F5S A;  4B3S M;  2UUC M;  4JI3 M;  4DR5 M;  1Q3C A;  3A46 A;  3VK8 A;  3U6S A;  4DR1 M;  4OX9 M;  4DV4 M;  4JI0 M;  2F5O A;  4NRW A;  3GPU A;  2UUA M;  1PJJ A;  4LF4 M;  2HHH M;  4B3T M;  1XNR M;  4X65 M;  1NNJ A;  5LMN M;  1HNX M;  1K3W A;  4AQY M;  2ZBK B;  1HR0 M;  3J7A S;  3GPP A;  4LF5 M;  4NXM M;  2F5P A;  4PDI A;  4DUZ M;  4B3M M;  3GPY A;  4G4R A;  2F5N A;  3U6D A;  4JI8 M;  2OQ4 A;  4X66 M;  1XC8 A;  4JI4 M;  1FJG M;  4GKJ M;  1Q3B A;  5ITX E;  3U6L A;  4PDG A;  3SAS A;  5IWA M;  4LF8 M;  2XZU A;  4B3R M;  4JV5 M;  4PCZ A;  1I94 M;  1HNZ M;  1N34 M;  3A42 A;  4DUY M;  4JI5 M;  4YY3 M;  4JI1 M;  3T1H M;  3GPX A;  1PM5 A;  4DV6 M;  4LF6 M;  2OPF A;  4LFB M;  4DV2 M;  4DV5 M;  3U6M A;  3A45 A;  1L1T A;  5FLX S;  1N33 M;  3SAR A;  4LF7 M;  4JYA M;  5ITR A;  2F4V M;  4PD2 A;  3SAV A;  4LFA M;  1Z5C A;  2UXC M;  4YHH M;  3DOA A;  5IT9 S;  3GO8 A;  3GQ3 A;  5ITQ A;  2VQF M;  1IBM M;  4DV7 M;  5ITT A;  4JI6 M;  3TWM A;  1MX0 A;  4DV3 M;  3SAT A;  4X62 M;  2ZM6 M;  2XZF A;  2UXD M;  3U6C A;  1L2B A;  3J80 S;  1IBL M;  4DR3 M;  4CIS A;  1N36 M;  1PJI A;  5ITX A;  2VQE M;  3U6E A;  4DR4 M;  1TDH A;  4NRV A;  3T1Y M;  3VK7 A;  4G4Q A;  4JI7 M;  1HNW M;  4DV0 M;  5BR8 M;  1TDZ A;  4ITQ A;  1MU5 A;  4GKK M;  3OTO M;  2HKJ A;  2Q2E B;  3U6O A;  1J5E M;  4KHP M;  1R2Y A;  4LFC M;  3U6Q A;  1N32 M;  4DR2 M;  2F5Q A;  3TWK A;  1K82 A;  3GQ5 A;  2E5L M;  1R2Z A;  1Q39 A;  4X64 M;  1Z5B A;  3J81 S;  3GQ4 A;  2UXB M;  4LF9 M;  3W0F A;  5LMU M;  1K3X A;  3JAM S;  3C58 A; 
#chains in the Genus database with same CATH topology
 2ZAO A;  4L16 A;  1KSF X;  1L2D A;  4IBF A;  5IZ7 D;  3PXG A;  2G8L A;  1G41 A;  4IBI A;  3I4V A;  1NY6 A;  2QSF X;  3RGS A;  3QAU A;  4NXN M;  4MB7 A;  1A5T A;  2BNK A;  4LJA A;  3KOX E;  4BBA A;  2R4E A;  2G3Q A;  4M0W A;  1SG9 A;  2JZ0 A;  2BJV A;  2Y0Q A;  4P17 A;  2EA0 A;  3K9P A;  1EE8 A;  1D0M A;  4DR7 M;  3D8B A;  1DGH A;  2UUC M;  1LTM A;  2JWS A;  2DNA A;  3A46 A;  3C9P A;  5FTJ A;  2I7N A;  4OX9 M;  1EIJ A;  3GRV A;  3GPU A;  2UUA M;  3KOY E;  4HLQ A;  1XNR M;  4Z6Y A;  2DWZ B;  1JQJ C;  4X65 M;  1NNJ A;  3AL0 C;  5LMN M;  2EO2 A;  1HNX M;  1VG5 A;  3KOZ E;  3GLI B;  2LWX A;  2X4A A;  4LG2 A;  2KDL A;  3W0L B;  1IN7 A;  4NXM M;  2J7N A;  4GEW A;  4TUW A;  2CEA A;  2HL7 A;  2LVQ D;  4DUZ M;  1GVN A;  4IBK A;  5EXS A;  1X37 A;  2N35 A;  5FTK A;  3U60 A;  1R5L A;  1G4A E;  4REZ A;  1G3I A;  3LMM A;  3M6A A;  3EIE A;  5FTN A;  4JI8 M;  4LJ4 A;  3RE8 A;  3NBX X;  4LRS A;  1NV9 A;  1Q3B A;  1Y8G A;  4I8O A;  4IBE A;  3IEC A;  4WP2 A;  2LVN C;  4PDG A;  3SAS A;  3LQR A;  1GJT A;  4B3R M;  2O5R A;  3K9O A;  4OW0 A;  2XZU A;  4JV5 M;  2XGN A;  3GRY A;  4PCZ A;  1IY1 A;  2JY5 A;  1HNZ M;  4KLN A;  2M60 A;  3A42 A;  3I51 A;  3LVV A;  4DUY M;  2P5T A;  4JI1 M;  1QQW A;  1IQP A;  5FSW A;  3T1H M;  3GLG E;  1PM5 A;  1QAO A;  4IBJ A;  4DV6 M;  2CV0 A;  4L8R C;  4LJ9 A;  2CV2 A;  3GLF B;  4LZZ A;  2C5R A;  3U6M A;  3LCV B;  2JP7 A;  4RF1 A;  2G5G X;  3HKP A;  4IBD A;  5EP3 A;  2OOB A;  3UMM A;  3SAR A;  4D82 A;  2WSC F;  1NNU C;  2D7G A;  2F4V M;  4JYA M;  3GLG A;  2UXC M;  3T38 A;  3CF2 A;  4AI6 A;  4LGM A;  1PJQ A;  1WGN A;  1HT1 E;  3GQ3 A;  1IBM M;  4BLC A;  3HHZ A;  1TH2 A;  1PRB A;  4JI6 M;  2LVA A;  3GLI E;  3U5Z B;  2XZF A;  5EP1 A;  2UXD M;  2CUZ A;  4IJF A;  3U6C A;  1IN6 A;  4IBG A;  4MGK E;  2C99 A;  4FWD A;  1XWI A;  4CIZ A;  1BVS A;  2LTU A;  3R8F A;  1D2N A;  1QUS A;  2L7H A;  2X8A A;  3FUX A;  2JY7 A;  4NRV A;  1ZAE A;  4DV0 M;  3GLH A;  4EIW A;  5BR8 M;  3MJ5 A;  1TDZ A;  2MR9 A;  1MU5 A;  1TR8 A;  4GKK M;  3U6O A;  2KW0 A;  3CF6 E;  1J5E M;  4RF0 A;  4LFC M;  3D8L A;  3L25 A;  2EKK A;  3B7N A;  2FFJ A;  1P3Q Q;  1TF0 B;  2UXB M;  3FTC A;  3UZU A;  3FRI A;  4QNR A;  3A98 B;  2OOA A;  3FRH A;  2DAI A;  2FS1 A;  2A5Y B;  2BJW A;  4UN2 B;  2DHY A;  1FNN A;  3FTD A;  5EP4 A;  3U6P A;  1Z5A A;  1G71 A;  3L29 A;  3Q8X A;  1XMQ M;  3KW6 A;  4IBB A;  5A2Q S;  4GHA A;  1WHC A;  1T43 A;  2JA2 A;  3GP1 A;  3TWL A;  2JXN A;  3KOW E;  1V33 A;  3PFI A;  5EXP A;  3THG A;  3FTF A;  4G4N A;  2QEN A;  1SXJ B;  1WR1 B;  2Z7J A;  2UUB M;  1L1Z A;  2JNH A;  1S3S A;  3JR5 A;  2F5S A;  4DR5 M;  4B3S M;  3FYD A;  4XBO A;  3C3D A;  4B08 A;  4JI0 M;  4NRW A;  2EKF A;  3E46 A;  3HJ8 A;  3IHP A;  1IXS B;  1F4I A;  4LF4 M;  2VDB B;  3KS8 A;  1E32 A;  3HHX A;  1OIP A;  3F92 A;  3AOE A;  4LRT A;  1PJT A;  4P16 A;  2ERC A;  5EJC A;  3ZQJ A;  1HR0 M;  3J7A S;  1NJG A;  1YUB A;  2F5P A;  4HL4 A;  3DA1 A;  1QUT A;  3QYB A;  1YSY A;  4G4R A;  1SXJ C;  2R44 A;  3U6D A;  2APL A;  2DHR A;  1OKS A;  2CHV A;  1YE9 A;  2XSZ D;  4X66 M;  1XC8 A;  4FWH A;  5ITX E;  3MK6 A;  2JUJ A;  2WZJ A;  7CAT A;  5KPZ A;  1YLA A;  4OVZ B;  2WSF F;  2J7O A;  1IN4 A;  3PNV A;  4GC5 A;  1I94 M;  1N34 M;  4JI5 M;  1V92 A;  1OTR A;  4R7G A;  4B7F A;  1H6U A;  3HWS A;  2FH0 A;  2QHO B;  2KRU A;  3HU2 A;  3Q8G A;  2C9O A;  2EJS A;  4KO8 A;  3GPX A;  2K6B A;  2ZTC A;  1VQ1 A;  3SMS A;  2OPF A;  4DV2 M;  1HQC A;  3KS4 A;  3U61 A;  2DKL A;  5FLX S;  1N33 M;  3K2L A;  4ANR A;  2H1R A;  2R65 A;  1IN5 A;  4FWG A;  3VFD A;  4FCV A;  4I4L A;  3GO8 A;  5BPV A;  4NSO B;  1CUK A;  1UM8 A;  3KP1 E;  3SFZ A;  1UFZ A;  3FKE A;  1IXZ A;  3TWM A;  2RKO A;  4LY6 A;  2DAE A;  3ILK A;  4X62 M;  2VF7 A;  2MRO B;  3J80 S;  1VEJ A;  4FD2 A;  4DR3 M;  3AJI B;  4MGY E;  2CWB A;  2FOI C;  4CIS A;  1QYR A;  4GH9 A;  3KSX A;  1MN3 A;  1NHW C;  3KP0 E;  5JI2 E;  2Z4R A;  2KNV A;  3B89 A;  1DGF A;  1JB0 F;  2LXE A;  2XF3 A;  1C1K A;  4L6V 6;  3T1Y M;  1HNW M;  3PVS A;  2R18 A;  2H5X A;  1ZV1 A;  4ITQ A;  2MJ5 B;  4W5W A;  3OTO M;  2Q2E B;  2QNJ A;  3T15 A;  4CGY B;  2O25 A;  1N32 M;  5KPT A;  4ZPX A;  1SXJ D;  5DFL A;  3CGW A;  3TE6 A;  4G6Z A;  3VLF B;  1GAB A;  2E5L M;  3J81 S;  4LGY A;  3HU1 A;  3W0F A;  3ZC7 B;  1K3X A;  3FE3 A;  2DAM A;  3JAM S;  1NVM A;  1QZM A;  4DBG B;  1VDL A;  2Z3X A;  2R45 A;  1NO1 A;  3BOS A;  4PT5 A;  2RGO A;  3I01 M;  4AG6 A;  3PNY A;  1WJ7 A;  1ZMU A;  2DXI A;  2ZAN A;  3AOG A;  1OFI A;  2V1C A;  3DFZ A;  3SBJ A;  3GLI A;  3UK6 A;  3W68 A;  3L28 A;  2L2D A;  1N77 A;  1JR3 E;  1Z59 A;  1L8Q A;  1E9S A;  2C9C A;  3FUW A;  3ZCB B;  1DGB A;  3AKZ A;  4RKU F;  3FUV A;  3SYK A;  4JI2 M;  1XMO M;  2JY8 A;  4XGI A;  1LV7 A;  2CRU A;  3SHG B;  2Y20 A;  5H37 D;  4G4O A;  3UJN A;  1DV0 A;  4DV1 M;  4R71 A;  5KO3 A;  3H4J A;  4B7H A;  3E21 A;  1L2C A;  2UU9 M;  4FVM A;  1XNQ M;  4IIW A;  4F2L A;  1VEK A;  4JI3 M;  4M0D A;  1XXH B;  3GRR A;  3FUU A;  5DYI A;  3GLF E;  4DR1 M;  4DV4 M;  1ORY B;  4MGI E;  1GLN A;  2QBY B;  2F5O A;  3I4Y A;  1AUA A;  4OU7 A;  1XB2 B;  4I81 A;  1PJJ A;  4L78 A;  4AKG A;  5JI3 E;  4WW0 A;  3W67 A;  2BWE A;  2DZN B;  3GLF A;  2GQF A;  4QOZ C;  4FCT A;  4MH0 E;  4NL4 H;  3GPP A;  4LF5 M;  1D0L A;  1TH4 A;  3BXW A;  5EQT A;  4PDI A;  1QAM A;  1QDT A;  2Z8Y M;  3WHL A;  2F5N A;  1KYI A;  1C7Y A;  2XLJ A;  2QZ4 A;  2ZTD A;  2OQ4 A;  2XSZ A;  4GKJ M;  5EXX A;  1FJG M;  1JR3 D;  1OAI A;  2DWL A;  3U6L A;  1DGH B;  3U5Z A;  1QAN A;  4M9S A;  3WHK A;  1GL7 A;  1EFU B;  4LJ8 A;  3MHV C;  2Y0T A;  3RFW A;  3TQS A;  2LVP C;  3SC3 A;  5GKN A;  3R9X B;  3AOE C;  1N75 A;  1AIP C;  4YY3 M;  3NWL A;  4LFB M;  3LW5 F;  3HY5 A;  2CV1 A;  1W5T A;  3EIH A;  3L2A A;  1XXH E;  2DAG A;  3M7G A;  3J7B A;  4LF7 M;  1Q02 A;  2XEP A;  5KPR A;  1XHB A;  3FUT A;  1QVR A;  3L27 A;  4LFA M;  4D81 A;  4YHH M;  3DOA A;  3SAV A;  2DZL A;  4HEO A;  2MH8 A;  3M0E A;  2D7E A;  2CFO A;  2QP9 X;  2VQF M;  2NQ8 C;  4BB9 A;  2L4E A;  5ITT A;  2EUC A;  1XXH A;  2JY6 B;  2DWM A;  2R4J A;  3SAT A;  2KZU A;  4NC6 A;  1L2B A;  1NJF A;  1IBL M;  2KNZ A;  2X49 A;  2LNH C;  5DYG A;  2J5Y A;  1VDD A;  3B7Z A;  5C1B A;  3K1J A;  2LHC A;  1VEG A;  2GNO A;  4G3O A;  2FNA A;  1OAO C;  1TGU A;  2YFQ A;  3HJQ A;  5ITX A;  2VQE M;  4LZJ A;  4DR4 M;  1SXJ E;  1TDH A;  3HX3 A;  4AG5 A;  4G4Q A;  2KA6 B;  4QNM A;  3LQQ A;  2CP8 A;  2C98 A;  3VDP A;  2Y21 A;  2HKJ A;  1GKI A;  4KHP M;  3GLG B;  1R2Y A;  2YQZ A;  3U6Q A;  4AZF A;  4IJE A;  4DR2 M;  3TWK A;  4IBC A;  4B7G A;  1SXJ A;  3AFH A;  4KT0 F;  1WIV A;  2HCB A;  2DVW B;  2KXE A;  1PGY A;  2M5Z A;  1Q39 A;  4X64 M;  3GQ4 A;  4NSR A;  1R2Z A;  4L4U A;  2K0B X;  4LF9 M;  1HT2 E;  3V76 A;  4LJ7 A;  5DNY A;  5LMU M;  3ZH9 B;  4FW9 A;  3LVW A;  3QWL A;  4AW4 A;  2CE7 A;  2DI0 A;  1IXS A;  3T6P A;  2K47 A;  3TPZ A;  1OQY A;  3C58 A;  5EP2 A;  1E9R A;  1IXR C;  3KSJ A;  1R7R A;  5E6J A;  5EXT A;  3B74 A;  4M9Z A;  1IBK M;  2L6O A;  4K0K M;  4DR6 M;  1NHG C;  2DZO B;  4JXJ A;  5FTM A;  3GLH B;  5IRE B;  4A3V B;  4MGZ E;  3UGJ A;  1HQY E;  2ZAM A;  1KFV A;  2VF8 A;  4QOS A;  3JR4 A;  3SAU A;  2FE8 A;  2HAK A;  1I4W A;  3HHW A;  2KRK A;  3KDS E;  3QYE A;  1V34 A;  3TL4 X;  3SAW A;  4WUR A;  5ITY A;  3SMP A;  1QDR A;  5ITU A;  3FTE A;  4Z8X A;  1Q3C A;  4OVZ A;  1IY0 A;  3VK8 A;  3VKG A;  1OFH A;  2DAK A;  4MM3 B;  3U6S A;  4QHS A;  4GHL A;  3FYC A;  1GJS A;  1DO0 A;  2R0I A;  4II7 A;  4Q7J A;  1G59 A;  2HHH M;  4CJ6 A;  4B3T M;  3KXE C;  2W82 A;  4JN6 A;  1K3W A;  2LHG A;  4FCW A;  3SYL A;  1RU3 A;  4AQY M;  2ZBK B;  1R6B X;  1TTE A;  4GC9 A;  4LJ5 A;  2V1U A;  3E4R A;  3VDU A;  4M9X A;  2KNA A;  4D80 A;  2L4F A;  2L09 A;  4MGH A;  4B3M M;  2B3T A;  4GIT A;  3CTW B;  3GPY A;  2CHG A;  4R3D A;  3L26 A;  5F3W A;  3MMP A;  2D7H A;  4JI4 M;  2Z4S A;  5KQ8 A;  1NV8 A;  2OO9 A;  1JR3 A;  3IG5 A;  1WGL A;  5IWA M;  1DO2 A;  3H4M A;  4LF8 M;  1ZQ9 A;  2AHM A;  2RGH A;  3GLH E;  3KFU G;  3LCU A;  1T3T A;  1E94 E;  2XFT A;  1T6O A;  2V6Z M;  1Z6T A;  4Y28 F;  1OIZ A;  3C3E A;  2DWN A;  2O01 F;  3AV0 A;  3HZJ A;  3HGI A;  1MJG M;  3IG8 A;  4L15 A;  4LF6 M;  4AKH A;  3J27 B;  1G8P A;  3GRU A;  3K8Z A;  1J7K A;  3HHY A;  4DV5 M;  3A45 A;  1L1T A;  2R46 A;  2VII A;  3BBZ A;  2BWB A;  1NSF A;  4F1I A;  5C18 A;  5ITR A;  1GL6 A;  4CHT B;  3E9S A;  3K92 A;  1HJP A;  4PD2 A;  1IFY A;  1Z5C A;  2LBC A;  5IT9 S;  1WXQ A;  4LCB A;  3HU3 A;  5ITQ A;  1PJS A;  4DV7 M;  2QCU A;  1IY2 A;  2HWJ A;  2LVO C;  1MX0 A;  4DV3 M;  2XFS A;  4KOD A;  4GIP A;  3RGP A;  3SHF A;  2ZM6 M;  1J09 A;  4AKI A;  1ZMV A;  2KHH A;  5L8R F;  4I5S A;  4NOO B;  2LH0 A;  2I7P A;  1GO5 A;  2R62 A;  3U60 B;  1IM2 A;  2RRU A;  1N36 M;  5FTL A;  2L7I A;  2KZS A;  3J2P B;  5KQD A;  1PJI A;  1TH3 A;  2QPA A;  3CF0 A;  2CHQ A;  4RNA A;  5E26 A;  3U6E A;  2DEN A;  2QQ8 A;  4JI7 M;  4QHT A;  3VK7 A;  3B7Q A;  3U61 B;  1DGG A;  1QAQ A;  1IN8 A;  2MGW A;  3NBI A;  4XK8 F;  2K9D A;  3KVW A;  2C96 A;  1OJL A;  4GRI A;  2YR0 A;  2F5Q A;  3HJS A;  3DZD A;  3B9P A;  3I04 M;  4LJ6 A;  1K82 A;  3GQ5 A;  2WSE F;  8CAT A;  1ZMW A;  2XH9 A;  3FD9 A;  1Z5B A;  3VKH A;  1D0K A;  2YNM D;  1NY5 A;  4GMQ A;  2QBY A;  2JZ1 A;  2R6F A;  1R4G A;  1QZE A;  1W5S A;  2KEB A;  4S12 A;  1N78 A; 
#chains in the Genus database with same CATH homology
 2ZAO A;  4L16 A;  1KSF X;  1L2D A;  4IBF A;  5IZ7 D;  3PXG A;  2G8L A;  1G41 A;  4IBI A;  3I4V A;  1NY6 A;  3RGS A;  3QAU A;  4NXN M;  4MB7 A;  2BNK A;  4LJA A;  3KOX E;  4BBA A;  2R4E A;  4M0W A;  2Y0Q A;  2BJV A;  2EA0 A;  1EE8 A;  4DR7 M;  3D8B A;  1DGH A;  2UUC M;  3A46 A;  5FTJ A;  2I7N A;  4OX9 M;  3GRV A;  3GPU A;  2UUA M;  3KOY E;  4HLQ A;  1XNR M;  4Z6Y A;  2DWZ B;  1JQJ C;  4X65 M;  1NNJ A;  3AL0 C;  5LMN M;  2EO2 A;  1HNX M;  3KOZ E;  3GLI B;  2LWX A;  2X4A A;  4LG2 A;  3W0L B;  1IN7 A;  4NXM M;  2J7N A;  4TUW A;  2CEA A;  2HL7 A;  4DUZ M;  1GVN A;  4IBK A;  5EXS A;  1X37 A;  5FTK A;  3U60 A;  1G4A E;  4REZ A;  1G3I A;  3LMM A;  3M6A A;  3EIE A;  5FTN A;  4JI8 M;  4LJ4 A;  3RE8 A;  4LRS A;  1Q3B A;  4I8O A;  4IBE A;  4PDG A;  3SAS A;  3LQR A;  4B3R M;  2O5R A;  2XZU A;  4OW0 A;  4JV5 M;  2XGN A;  3GRY A;  4PCZ A;  1IY1 A;  1HNZ M;  4KLN A;  2M60 A;  3A42 A;  3I51 A;  3LVV A;  4DUY M;  2P5T A;  4JI1 M;  1QQW A;  1IQP A;  5FSW A;  3T1H M;  1PM5 A;  1QAO A;  4IBJ A;  4DV6 M;  2CV0 A;  4L8R C;  4LJ9 A;  2CV2 A;  3GLF B;  4LZZ A;  2C5R A;  3U6M A;  3UMM A;  5EP3 A;  4RF1 A;  2G5G X;  3HKP A;  4IBD A;  3SAR A;  4JYA M;  4D82 A;  2F4V M;  1NNU C;  2D7G A;  3GLG A;  2UXC M;  3T38 A;  3CF2 A;  4AI6 A;  4LGM A;  1HT1 E;  3GQ3 A;  1IBM M;  4BLC A;  4JI6 M;  1TH2 A;  3U5Z B;  2XZF A;  5EP1 A;  2UXD M;  2CUZ A;  4IJF A;  3U6C A;  1IN6 A;  4IBG A;  4MGK E;  2C99 A;  4FWD A;  1XWI A;  3R8F A;  1D2N A;  2L7H A;  2X8A A;  3FUX A;  4NRV A;  1ZAE A;  4DV0 M;  3GLH A;  4EIW A;  5BR8 M;  3MJ5 A;  1TDZ A;  1MU5 A;  4GKK M;  3U6O A;  2KW0 A;  3CF6 E;  1J5E M;  4RF0 A;  4LFC M;  3D8L A;  3L25 A;  2FFJ A;  2UXB M;  3FTC A;  3UZU A;  4QNR A;  3A98 B;  2A5Y B;  2BJW A;  1FNN A;  3FTD A;  5EP4 A;  3U6P A;  1Z5A A;  3L29 A;  3Q8X A;  1XMQ M;  3KW6 A;  4IBB A;  5A2Q S;  4GHA A;  2JA2 A;  3GP1 A;  3TWL A;  3KOW E;  3PFI A;  5EXP A;  3THG A;  3FTF A;  4G4N A;  2QEN A;  1SXJ B;  2Z7J A;  2UUB M;  1L1Z A;  3JR5 A;  1S3S A;  2F5S A;  4B3S M;  4DR5 M;  3FYD A;  4XBO A;  4B08 A;  4JI0 M;  4NRW A;  3HJ8 A;  1IXS B;  4LF4 M;  3KS8 A;  1E32 A;  3HHX A;  3AOE A;  4LRT A;  5EJC A;  4P16 A;  2ERC A;  1HR0 M;  3J7A S;  1NJG A;  1YUB A;  2F5P A;  4HL4 A;  3DA1 A;  1YSY A;  4G4R A;  1SXJ C;  3U6D A;  2DHR A;  2XSZ D;  2CHV A;  1YE9 A;  4X66 M;  1XC8 A;  4FWH A;  5ITX E;  3MK6 A;  7CAT A;  5KPZ A;  4OVZ B;  2J7O A;  1IN4 A;  3PNV A;  4GC5 A;  1I94 M;  1N34 M;  4JI5 M;  4R7G A;  4B7F A;  4YY3 M;  1H6U A;  3HWS A;  3HU2 A;  3HHZ A;  2KRU A;  4KO8 A;  2C9O A;  3GPX A;  3SMS A;  2OPF A;  4DV2 M;  1HQC A;  3KS4 A;  3U61 A;  1N33 M;  5FLX S;  3K2L A;  2H1R A;  2R65 A;  1IN5 A;  4FWG A;  3VFD A;  4FCV A;  4I4L A;  3GO8 A;  5BPV A;  4NSO B;  1UM8 A;  3KP1 E;  3SFZ A;  3FKE A;  1IXZ A;  3TWM A;  2RKO A;  4LY6 A;  3ILK A;  4X62 M;  3J80 S;  4FD2 A;  4DR3 M;  3AJI B;  4MGY E;  2FOI C;  4CIS A;  1QYR A;  4GH9 A;  3KSX A;  1NHW C;  3KP0 E;  5JI2 E;  2Z4R A;  1DGF A;  2LXE A;  2XF3 A;  1C1K A;  3T1Y M;  1HNW M;  3PVS A;  2R18 A;  4ITQ A;  4W5W A;  3OTO M;  2Q2E B;  3T15 A;  4CGY B;  1N32 M;  5KPT A;  4ZPX A;  1SXJ D;  3TE6 A;  4G6Z A;  3VLF B;  2E5L M;  3J81 S;  4LGY A;  3HU1 A;  3W0F A;  3ZC7 B;  1K3X A;  3JAM S;  1NVM A;  1QZM A;  2Z3X A;  3BOS A;  2R45 A;  4PT5 A;  4AG6 A;  2RGO A;  2DXI A;  3PNY A;  2ZAN A;  3AOG A;  1OFI A;  2V1C A;  3DFZ A;  3SBJ A;  3GLI A;  3UK6 A;  3L28 A;  1N77 A;  1Z59 A;  1L8Q A;  1E9S A;  2C9C A;  3FUW A;  3ZCB B;  1DGB A;  3AKZ A;  3FUV A;  3SYK A;  4JI2 M;  1XMO M;  4XGI A;  1LV7 A;  3SHG B;  2Y20 A;  5H37 D;  4G4O A;  3UJN A;  4DV1 M;  5KO3 A;  4B7H A;  1L2C A;  1XNQ M;  2UU9 M;  4FVM A;  4IIW A;  4JI3 M;  4M0D A;  1XXH B;  3GRR A;  3FUU A;  5DYI A;  4DR1 M;  4DV4 M;  1ORY B;  4MGI E;  1GLN A;  2QBY B;  2F5O A;  3I4Y A;  4OU7 A;  4I81 A;  1PJJ A;  4L78 A;  4AKG A;  5JI3 E;  4WW0 A;  2DZN B;  3GLF A;  4QOZ C;  4FCT A;  4MH0 E;  4NL4 H;  3GPP A;  4LF5 M;  1TH4 A;  5EQT A;  4PDI A;  1QAM A;  3WHL A;  2F5N A;  1KYI A;  2XLJ A;  2QZ4 A;  2OQ4 A;  2XSZ A;  4GKJ M;  5EXX A;  1FJG M;  1JR3 D;  2DWL A;  3U6L A;  1DGH B;  3U5Z A;  1QAN A;  4M9S A;  3WHK A;  1GL7 A;  4LJ8 A;  3MHV C;  2Y0T A;  3RFW A;  3TQS A;  3SC3 A;  5GKN A;  3R9X B;  3AOE C;  1N75 A;  3NWL A;  4LFB M;  2CV1 A;  1W5T A;  3EIH A;  3L2A A;  4LF7 M;  3M7G A;  3J7B A;  2XEP A;  5KPR A;  3SAV A;  1XHB A;  3FUT A;  1QVR A;  3L27 A;  4LFA M;  4D81 A;  4YHH M;  3DOA A;  3U60 B;  3M0E A;  2D7E A;  2CFO A;  2QP9 X;  2VQF M;  2NQ8 C;  4BB9 A;  5ITT A;  2EUC A;  1XXH A;  2DWM A;  2R4J A;  3SAT A;  2KZU A;  1L2B A;  1NJF A;  1IBL M;  2X49 A;  2LNH C;  5DYG A;  1VDD A;  5C1B A;  3K1J A;  5ITX A;  2FNA A;  1TGU A;  2YFQ A;  3HJQ A;  2VQE M;  4LZJ A;  4DR4 M;  1SXJ E;  1TDH A;  4AG5 A;  4G4Q A;  2KA6 B;  4QNM A;  3LQQ A;  3VDP A;  2C98 A;  2Y21 A;  2HKJ A;  1GKI A;  4KHP M;  3GLG B;  1R2Y A;  2YQZ A;  3U6Q A;  4AZF A;  4IJE A;  4DR2 M;  3TWK A;  4IBC A;  4B7G A;  1SXJ A;  3AFH A;  2HCB A;  2DVW B;  2KXE A;  2M5Z A;  1R2Z A;  1Q39 A;  4X64 M;  3GQ4 A;  4NSR A;  4L4U A;  4LF9 M;  1HT2 E;  4LJ7 A;  5DNY A;  5LMU M;  3ZH9 B;  4FW9 A;  3LVW A;  3QWL A;  4AW4 A;  2CE7 A;  3C58 A;  3TPZ A;  2K47 A;  5EP2 A;  1E9R A;  1IXR C;  3KSJ A;  1R7R A;  5E6J A;  5EXT A;  4M9Z A;  1IBK M;  2L6O A;  4K0K M;  4DR6 M;  1NHG C;  2DZO B;  4JXJ A;  5FTM A;  3GLH B;  5IRE B;  4A3V B;  4MGZ E;  3UGJ A;  1HQY E;  2ZAM A;  1KFV A;  3JR4 A;  4QOS A;  3SAU A;  2FE8 A;  1I4W A;  3HHW A;  2KRK A;  3KDS E;  3TL4 X;  3SAW A;  4WUR A;  5ITY A;  3SMP A;  5ITU A;  3FTE A;  4Z8X A;  1Q3C A;  4OVZ A;  1IY0 A;  3VK8 A;  3VKG A;  1OFH A;  4MM3 B;  3U6S A;  4QHS A;  4GHL A;  3FYC A;  1DO0 A;  4II7 A;  1G59 A;  2HHH M;  4B3T M;  3KXE C;  2W82 A;  4JN6 A;  1K3W A;  4FCW A;  3SYL A;  4AQY M;  2ZBK B;  1R6B X;  4GC9 A;  4LJ5 A;  2V1U A;  3E4R A;  3VDU A;  4M9X A;  4D80 A;  4MGH A;  2L09 A;  4B3M M;  4GIT A;  3CTW B;  3GPY A;  2CHG A;  4R3D A;  3L26 A;  5F3W A;  2D7H A;  4JI4 M;  2Z4S A;  5KQ8 A;  1JR3 A;  3IG5 A;  5IWA M;  1DO2 A;  3H4M A;  4LF8 M;  1ZQ9 A;  2AHM A;  2RGH A;  3KFU G;  1T3T A;  1E94 E;  2XFT A;  2V6Z M;  1Z6T A;  2DWN A;  3AV0 A;  3HGI A;  4LF6 M;  3IG8 A;  4L15 A;  4AKH A;  3J27 B;  1G8P A;  3GRU A;  3K8Z A;  1J7K A;  3HHY A;  4DV5 M;  3A45 A;  1L1T A;  2R46 A;  2VII A;  5C18 A;  1NSF A;  5ITR A;  1GL6 A;  4CHT B;  3E9S A;  3K92 A;  4PD2 A;  1Z5C A;  5IT9 S;  1WXQ A;  4LCB A;  3HU3 A;  5ITQ A;  4DV7 M;  2QCU A;  1IY2 A;  1MX0 A;  4DV3 M;  2XFS A;  4KOD A;  4GIP A;  3RGP A;  3SHF A;  2ZM6 M;  1J09 A;  4AKI A;  4I5S A;  4NOO B;  2LH0 A;  2I7P A;  2R62 A;  1IM2 A;  1N36 M;  5FTL A;  2L7I A;  2KZS A;  3J2P B;  5KQD A;  1PJI A;  1TH3 A;  2QPA A;  3CF0 A;  2CHQ A;  4RNA A;  5E26 A;  3U6E A;  4JI7 M;  4QHT A;  3VK7 A;  3U61 B;  1DGG A;  1QAQ A;  1IN8 A;  3NBI A;  3KVW A;  2C96 A;  1OJL A;  4GRI A;  2YR0 A;  2F5Q A;  3HJS A;  3DZD A;  3B9P A;  4LJ6 A;  1K82 A;  3GQ5 A;  8CAT A;  2XH9 A;  3FD9 A;  1Z5B A;  3VKH A;  2YNM D;  1NY5 A;  4GMQ A;  2QBY A;  1W5S A;  2KEB A;  4S12 A;  1N78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...