1HR0M

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hr0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hr0M02
1Q3CA 4JI6M 4DV1M 1XNRM 3JAMS 2F5OA 1XC8A 4JI1M 4YHHM 4DR1M 1K3XA 1IBLM 4LFAM 3A42A 4LFCM 5LMUM 1IBMM 2UUBM 4JI0M 3C58A 4LF4M 4DR4M 3J80S 1XMQM 3U6LA 4X65M 5LMNM 1K3WA 4DR3M 3U6CA 1Z5CA 1L2DA 5A2QS 4LF9M 1IBKM 4B3TM 4AQYM 4DR6M 1Q39A 1FJGM 1R2ZA 1MX0A 5ITYA 5FLXS 1NNJA 1KFVA 3U6QA 3GP1A 1N36M 3GPYA 4GKJM 1I94M 3U6EA 4ITQA 3U6OA 3SATA 4DUYM 3W0FA 4G4NA 4JI5M 5BR8M 5IWAM 2VQEM 5ITUA 5ITXA 4PD2A 5IT9S 5ITTA 2OQ4A 4JI4M 4PCZA 3SAUA 1Z5AA 2UUAM 3GPUA 4B3MM 2Q2EB 3U6DA 1J5EM 1Z5BA 2EA0A 4X62M 1HNZM 1L1TA 2UU9M 2XZFA 1HNWM 1MU5A 3U6PA 3A45A 1Q3BA 4DV6M 4DR5M 1TDHA 3GPXA 3GQ4A 4LF6M 2UUCM 4CISA 3TWKA 3T1YM 2UXDM 1XNQM 4GKKM 3GPPA 4PDIA 4DV0M 2HKJA 2VQFM 2E5LM 4LFBM 1HR0M 1K82A 3J7AS 4NRVA 2HHHM 4DUZM 4DR7M 1L1ZA 4DV3M 3JR5A 4MB7A 4DV7M 4JV5M 2XZUA 3GQ5A 5ITXE 1PM5A 4G4QA 4LF8M 3TWLA 4LF5M 3SASA 4NXNM 1XMOM 3U6SA 5ITRA 4YY3M 4X66M 4NXMM 4K0KM 3JR4A 4X64M 4DV5M 4G4OA 3GO8A 2F5NA 3J81S 2OPFA 3TWMA 2F5QA 2F4VM 1N33M 2F5PA 4KHPM 3SAWA 2UXCM 3SARA 1PJIA 4G4RA 2ZM6M 4NRWA 2F5SA 5ITQA 3VK8A 3A46A 4OX9M 2ZBKB 3GQ3A 4DV2M 1HNXM 4LF7M 1L2CA 1R2YA 1EE8A 4JI7M 1L2BA 4JI2M 4PDGA 3SBJA 1N32M 1Z59A 4DV4M 1PJJA 4B3SM 3OTOM 4B3RM 1TDZA 3VK7A 4JYAM 3DOAA 3SAVA 1N34M 3U6MA 2UXBM 3T1HM 4DR2M 4JI8M 4JI3M
chains in the Genus database with same CATH superfamily
4IBCA 3C3DA 3K1JA 2CP8A 4JI6M 3CF2A 5EP2A 4REZA 4YHHM 3GRRA 1WXQA 5EP1A 3THGA 4LFAM 1NHWC 1IBLM 2DWMA 2Z4RA 1TR8A 2XH9A 4PT5A 5LMUM 3GLIE 5FSWA 2QSFX 5EXSA 4EIWA 3IECA 1R5LA 2JY5A 3J80S 1GVNA 3HU2A 3U6LA 3W68A 2V1CA 2Y20A 4FWHA 3ZC7B 1WHCA 2R6FA 1QAQA 3KP1E 3U61A 3HHXA 2LVOC 1Z5CA 1L2DA 4LF9M 2JXNA 1DGBA 1IM2A 2JY8A 4OW0A 2WZJA 2CHQA 4OU7A 2KHHA 3DFZA 2QQ8A 3GLIA 2V1UA 1NNJA 4B7FA 4IBKA 5DFLA 3M7GA 4P17A 1NJFA 3RGPA 1N36M 5KPTA 3M6AA 1VG5A 3PVSA 4ITQA 2R62A 3V76A 1XWIA 4D80A 1E32A 2LHCA 2DAKA 4IBJA 1HQCA 4D82A 2K47A 1L8QA 2DWZB 3HJ8A 1T6OA 1QZMA 3A98B 2DENA 1QUTA 1V34A 3E46A 2OQ4A 4JI4M 3SAUA 2R18A 2DI0A 4B3MM 3HKPA 3U6DA 1J5EM 4GHLA 2DWNA 2O25A 4KT0F 1HNWM 2CV2A 1YLAA 5EXPA 1Q3BA 4DR5M 2LVQD 4NSOB 3B7ZA 4LJ8A 2DHYA 2QHOB 3E9SA 1G8PA 1PGYA 4JXJA 1T43A 3GPXA 1VEKA 4LRTA 2JUJA 3GQ4A 1HT2E 1AIPC 1TTEA 3BBZA 3BXWA 5EP3A 2ZAOA 2XEPA 1D0MA 1JQJC 1QDRA 5DYIA 2UXDM 1SXJA 1YUBA 3AOGA 4DV0M 5EQTA 1ZV1A 1DGGA 2I7PA 4G6ZA 1PJQA 4LFBM 4OVZA 1HR0M 4F2LA 2MR9A 4NRVA 3L26A 4Y28F 4DUZM 1VEGA 2LBCA 2KNZA 3ILKA 1GL7A 3B9PA 1TH3A 4WP2A 4MB7A 1OJLA 4FVMA 1DO2A 2XZUA 1PM5A 4G4QA 2R0IA 3TWLA 4R3DA 1WR1B 3LQQA 5EJCA 1XMOM 1G4AE 5KQDA 1SXJE 2M60A 4X66M 3ZH9B 3U5ZB 4NXMM 1QDTA 1S3SA 1Y8GA 5IREB 2Z3XA 4K0KM 5BPVA 4X64M 1R7RA 3HZJA 4G4OA 3H4JA 3KS4A 3D8BA 3EIHA 2WSEF 1OFHA 4QOSA 3GO8A 4L15A 4I8OA 1J09A 4LY6A 2F5QA 3KXEC 5C18A 4AI6A 2MGWA 2A5YB 2G3QA 2ZTCA 3LQRA 2UXCM 4NRWA 5EXXA 2ZM6M 3UGJA 3A46A 1HNXM 3M0EA 1FNNA 1MN3A 4CGYB 3HWSA 4AKIA 3VLFB 3Q8GA 1Z59A 2CUZA 2FE8A 4DV4M 3GLGA 3RFWA 3OTOM 3VK7A 1XXHE 4ANRA 3PXGA 3I51A 2UXBM 4GITA 3CF0A 2CHVA 2KXEA 2J7OA 4S12A 3KOZE 4QNRA 4JI8M 3BOSA 4JI3M 4W5WA 3U60B 2F5OA 4M0WA 3FTCA 3W0LB 3HHYA 3FUVA 1XB2B 1MJGM 3ZQJA 2XF3A 4QHSA 3A42A 4LFCM 2CV1A 1WGLA 1IBMM 1R4GA 2UUBM 2CFOA 3UMMA 3FUXA 7CATA 1NNUC 4LZZA 4IBEA 4AG6A 5DNYA 3KW6A 4LF4M 3L25A 4UN2B 3LMMA 3ZCBB 4X65M 2EKKA 1NSFA 5LMNM 3PNYA 2HL7A 4AG5A 1OKSA 3AFHA 2I7NA 4B3TM 2LVAA 3WHLA 4RF0A 4AZFA 4II7A 1DGFA 2DNAA 4B7GA 1FJGM 1R6BX 4Z8XA 1QQWA 3FUTA 1EFUB 1IY1A 2C5RA 3U6QA 4ZPXA 1IXSB 1C7YA 4GKJM 2YNMD 2QP9X 2QPAA 3SATA 2EO2A 4LRSA 4DUYM 3FE3A 4L16A 4JI5M 1G41A 5H37D 5KPZA 5IWAM 1H6UA 5BR8M 2VQEM 3L29A 3KS8A 5ITXA 4PD2A 2V6ZM 3VKGA 2O01F 2L4FA 1N77A 2VIIA 3KOWE 1E94E 2VF8A 4RNAA 2VDBB 1IN8A 1HQYE 2YQZA 1TH2A 4KO8A 1SXJB 2JP7A 4LJAA 3GPUA 4LCBA 4GMQA 1HNZM 3FTDA 1F4IA 2UU9M 3KFUG 3U6PA 2DKLA 2HAKA 2Y21A 3A45A 4DV6M 1KYIA 3IG5A 3I04M 1T3TA 1I4WA 3SHFA 4GHAA 1V92A 2O5RA 4L4UA 1OFIA 2H5XA 3SMPA 4LF6M 2UUCM 3VDPA 3TWKA 3K2LA 2QBYA 3HU1A 3UJNA 3U60A 2C99A 2DAEA 4FD2A 2R4JA 2XGNA 3CGWA 2P5TA 2DXIA 3J7AS 1V33A 3RGSA 4DR7M 1SXJC 3HJSA 3WHKA 4R71A 5KO3A 3FYDA 2BWEA 2W82A 3QAUA 3B89A 3FRIA 4MGZE 2MH8A 3IHPA 2JA2A 3GQ5A 2J5YA 4LF5M 2BNKA 3GRUA 3SASA 5ITRA 2L7HA 4IJEA 1XHBA 1NY6A 2JZ0A 3L27A 3TPZA 1JB0F 1E9RA 1J7KA 2FFJA 2KW0A 1OTRA 4GEWA 4M9XA 1VEJA 1N75A 2OPFA 3TWMA 1IN5A 4GRIA 3SYLA 3SYKA 1G71A 2F5PA 1N33M 2B3TA 1JR3A 3J7BA 3SHGB 3GQ3A 4LJ5A 3E21A 1W5TA 3TE6A 1L2CA 1EE8A 1NV9A 2JWSA 2Y0TA 4MM3B 4JI7M 2ZAMA 3SBJA 5KPRA 4TUWA 1GL6A 3B74A 2KEBA 1PJJA 3FRHA 4B3RM 1TDZA 2LVNC 3HGIA 3DOAA 2EKFA 3SAVA 4LJ7A 1GABA 5FTNA 4CJ6A 2HWJA 1D0LA 3B7QA 2D7GA 2OOAA 3AKZA 2DAGA 2FS1A 3FKEA 3JAMS 2QNJA 1VDDA 5EP4A 4F1IA 4WW0A 1XC8A 4Z6YA 3GLHB 3MK6A 4DR1M 2BJWA 1K3XA 1BVSA 3FTEA 4B08A 1ZQ9A 3FYCA 4KODA 4M9SA 2GQFA 2WSFF 2FOIC 3LCUA 2BWBA 3DZDA 4CHTB 1IN6A 4CIZA 1WIVA 3C58A 2ERCA 2M5ZA 4OVZB 3FTFA 2MROB 3KVWA 4IIWA 1K3WA 4NOOB 4HL4A 1ZMWA 4FW9A 3T6PA 2L09A 5A2QS 2DWLA 2Z7JA 1IBKM 4DR6M 1Q39A 3EIEA 4HLQA 3AJIB 1MX0A 2R44A 3FD9A 5ITYA 1QVRA 4FWGA 4GH9A 5FLXS 3E4RA 4LJ9A 2KNAA 2RKOA 3GPYA 1XXHB 1I94M 3U6EA 2LTUA 3PNVA 3W0FA 1ZMVA 4P16A 3NBXX 3R9XB 3HHWA 1OQYA 1G3IA 2XFSA 5ITUA 1ORYB 2WSCF 4LG2A 5IT9S 5ITTA 3GLFE 2C9CA 2C96A 4PCZA 3B7NA 1Z5AA 4LJ4A 4QNMA 1VDLA 5F3WA 3IG8A 1IXZA 2EA0A 4X62M 5FTLA 2DZLA 1L1TA 3J27B 2X4AA 1MU5A 1KSFX 3T38A 1E9SA 1OIPA 2KNVA 1TDHA 3HY5A 1OIZA 3AL0C 1VQ1A 1NJGA 4LJ6A 2FH0A 1IFYA 2X8AA 3I01M 4L8RC 3L2AA 3HX3A 2K0BX 2L2DA 5C1BA 3MMPA 1W5SA 2EJSA 4RF1A 3I4VA 3T1YM 5EXTA 2KDLA 2OO9A 1DGHB 3TL4X 3GPPA 2BJVA 1P3QQ 2HKJA 4IBGA 3NBIA 3KSJA 2CV0A 5FTJA 2VQFM 2E5LM 1HT1E 1OAOC 2LXEA 2R45A 2JY7A 1K82A 1GJTA 4Q7JA 3LVVA 4GC9A 4DV3M 1G59A 4IBIA 1IY0A 5ITXE 3K9OA 4LF8M 1WGNA 4L78A 3LW5F 3SFZA 4NXNM 4YY3M 3FUUA 2QCUA 2Z4SA 2Y0QA 4MGIE 1TH4A 4XGIA 3MJ5A 1Z6TA 1GJSA 1NV8A 2KA6B 3GLGE 4IBDA 2CEAA 4DBGB 2F5NA 2D7HA 4I81A 3NWLA 4KHPM 1LTMA 3UK6A 2G5GX 2C98A 3CTWB 3AOEA 3HHZA 2CE7A 4G4RA 1PJIA 2F5SA 4I4LA 3VK8A 3FUWA 4OX9M 3QYEA 4KLNA 1QANA 4NL4H 4DV2M 3KOXE 1R2YA 4IJFA 4BLCA 4GC5A 2CWBA 1L2BA 3LCVB 2XLJA 1N32M 2DZOB 4FWDA 4B3SM 3GRYA 5KQ8A 2L4EA 1GLNA 1A5TA 3VDUA 1N34M 5E6JA 1PRBA 5FTMA 3GLFA 3U6MA 4DR2M 1YE9A 1D2NA 1Q3CA 1ZMUA 4DV1M 1XNRM 2R4EA 4IBBA 4MGKE 3GLFB 2LVPC 3GRVA 4QHTA 4JI1M 4GIPA 1OAIA 3C3EA 1X37A 1SXJD 3F92A 3K92A 1XXHA 4G3OA 2LNHC 1QAMA 1QUSA 2JNHA 4NSRA 4BB9A 4JI0M 1ZAEA 2RGHA 4LGYA 2HCBA 4DR4M 1XMQM 4FCWA 3GLIB 2EUCA 5L8RF 1QAOA 2K9DA 4DR3M 1GKIA 2JY6B 4WURA 3U6CA 2QBYB 4LGMA 4B7HA 2XSZA 5IZ7D 4AQYM 2QZ4A 1D0KA 5E26A 1TF0B 4L6V6 1R2ZA 2GNOA 8CATA 2OOBA 1UM8A 2XFTA 4I5SA 2D7EA 4MGYE 1SG9A 1KFVA 3GP1A 3K8ZA 3KDSE 5DYGA 1QYRA 3T15A 2ZTDA 1DO0A 3GLHE 3U6OA 3MHVC 3VKHA 4G4NA 2APLA 2K6BA 1IY2A 1GO5A 3KOYE 3Q8XA 1RU3A 2CHGA 2JZ1A 4LZJA 3AOEC 2DHRA 5JI3E 2UUAM 1DGHA 2DAMA 2AHMA 2H1RA 2Q2EB 2LH0A 2R46A 1Z5BA 4A3VB 2DVWB 2XZFA 2QENA 4M0DA 4FCVA 4XK8F 3I4YA 2X49A 1WJ7A 1UFZA 1IXSA 4MGHA 2MJ5B 4AKGA 3D8LA 3SC3A 2LWXA 2L6OA 2N35A 4HEOA 3TQSA 3J2PB 4CISA 3HJQA 2KRUA 2R65A 3UZUA 1HJPA 1XNQM 2XSZD 3L28A 4NC6A 4GKKM 4R7GA 4PDIA 1AUAA 3HU3A 3KSXA 1IXRC 2HHHM 5GKNA 1L1ZA 1PJSA 3CF6E 3SMSA 2LHGA 3JR5A 3DA1A 4DV7M 3K9PA 4IBFA 4JV5M 1JR3E 3W67A 1CUKA 3KP0E 1YSYA 2RGOA 2C9OA 2CRUA 3H4MA 3QWLA 1NVMA 3C9PA 3U6SA 4D81A 4AW4A 3JR4A 4DV5M 1QZEA 5FTKA 3LVWA 1TGUA 3R8FA 2FNAA 3J81S 4M9ZA 2ZANA 2DZNB 2F4VM 4RKUF 4XBOA 3U61B 1EIJA 4QOZC 3GLGB 1NO1A 2YFQA 3SAWA 3VFDA 3SARA 5JI2E 3PFIA 3AV0A 2KZUA 5ITQA 3QYBA 4JN6A 3U5ZA 1LV7A 1NHGC 2DAIA 2ZBKB 4LF7M 2VF7A 1Q02A 2Z8YM 1C1KA 4JI2M 4PDGA 4FCTA 2G8LA 1IQPA 2YR0A 4MH0E 4BBAA 2NQ8C 1PJTA 1N78A 1DV0A 3GLHA 4JYAM 1IN7A 4AKHA 1NY5A 1JR3D 2RRUA 3T1HM 1IN4A 2KRKA 2KZSA 2L7IA 2J7NA 3RE8A
chains in the Genus database with same CATH topology
4IBCA 3K1JA 4JI6M 3CF2A 5EP2A 4REZA 4YHHM 3GRRA 1WXQA 5EP1A 3THGA 4LFAM 1NHWC 1IBLM 2DWMA 2Z4RA 2XH9A 4PT5A 5LMUM 5FSWA 5EXSA 4EIWA 3J80S 1GVNA 3HU2A 3U6LA 2V1CA 2Y20A 4FWHA 3ZC7B 3KP1E 1QAQA 3U61A 3HHXA 1Z5CA 1L2DA 4LF9M 1DGBA 1IM2A 4OW0A 2CHQA 4OU7A 3DFZA 3GLIA 2V1UA 1NNJA 4B7FA 4IBKA 3RGPA 3M7GA 1NJFA 1N36M 5KPTA 3M6AA 3PVSA 4ITQA 2R62A 1XWIA 4D80A 1E32A 4IBJA 1HQCA 4D82A 2K47A 1L8QA 2DWZB 3HJ8A 3A98B 1QZMA 2OQ4A 4JI4M 3SAUA 2R18A 4B3MM 3HKPA 3U6DA 1J5EM 4GHLA 2DWNA 1HNWM 2CV2A 5EXPA 1Q3BA 4DR5M 4NSOB 4LJ8A 3E9SA 1G8PA 4JXJA 3GPXA 4LRTA 3GQ4A 1HT2E 5EP3A 2ZAOA 2XEPA 1JQJC 5DYIA 2UXDM 1SXJA 1YUBA 3AOGA 4DV0M 5EQTA 1DGGA 2I7PA 4G6ZA 4LFBM 4OVZA 1HR0M 4NRVA 3L26A 4DUZM 3ILKA 1GL7A 3B9PA 1TH3A 4MB7A 1OJLA 4FVMA 1DO2A 2XZUA 1PM5A 4G4QA 3TWLA 4R3DA 3LQQA 5EJCA 1XMOM 1G4AE 5KQDA 1SXJE 2M60A 4X66M 3ZH9B 3U5ZB 4NXMM 1S3SA 5IREB 2Z3XA 4K0KM 5BPVA 4X64M 1R7RA 4G4OA 3KS4A 4QOSA 3D8BA 3EIHA 3GO8A 1OFHA 4L15A 4I8OA 1J09A 4LY6A 2F5QA 3KXEC 5C18A 4AI6A 2A5YB 3LQRA 2UXCM 4NRWA 5EXXA 2ZM6M 3UGJA 3A46A 1HNXM 3M0EA 1FNNA 4CGYB 3HWSA 4AKIA 3VLFB 1Z59A 2CUZA 2FE8A 4DV4M 3GLGA 3RFWA 3OTOM 3VK7A 3PXGA 3I51A 2UXBM 4GITA 3CF0A 2CHVA 2KXEA 2J7OA 4S12A 3KOZE 4QNRA 4JI8M 3BOSA 4JI3M 4W5WA 3U60B 2F5OA 4M0WA 3FTCA 3W0LB 3HHYA 3FUVA 2XF3A 4QHSA 3A42A 4LFCM 2CV1A 1IBMM 2UUBM 2CFOA 3UMMA 3FUXA 7CATA 1NNUC 4LZZA 4IBEA 4AG6A 5DNYA 3KW6A 4LF4M 3L25A 3LMMA 3ZCBB 4X65M 1NSFA 5LMNM 3PNYA 2HL7A 4AG5A 3AFHA 2I7NA 4B3TM 3WHLA 4RF0A 4AZFA 4II7A 1DGFA 1FJGM 4B7GA 1R6BX 4Z8XA 1QQWA 3FUTA 1IY1A 2C5RA 3U6QA 4ZPXA 1IXSB 4GKJM 2YNMD 2QP9X 2QPAA 3SATA 2EO2A 4LRSA 4DUYM 4L16A 4JI5M 1G41A 5H37D 5KPZA 5IWAM 1H6UA 5BR8M 2VQEM 3L29A 3KS8A 5ITXA 4PD2A 2V6ZM 3VKGA 1N77A 2VIIA 3KOWE 1E94E 4RNAA 1IN8A 1HQYE 2YQZA 1TH2A 4KO8A 1SXJB 4LJAA 3GPUA 4LCBA 4GMQA 1HNZM 3FTDA 2UU9M 3KFUG 3U6PA 2Y21A 3A45A 4DV6M 1KYIA 3IG5A 1T3TA 1I4WA 3SHFA 4GHAA 2O5RA 4L4UA 1OFIA 3SMPA 4LF6M 2UUCM 3VDPA 3TWKA 3K2LA 2QBYA 3HU1A 3UJNA 3U60A 2C99A 4FD2A 2R4JA 2XGNA 2P5TA 2DXIA 3J7AS 3RGSA 4DR7M 1SXJC 3HJSA 3WHKA 5KO3A 3FYDA 2W82A 3QAUA 4MGZE 3GQ5A 2JA2A 4LF5M 2BNKA 3GRUA 3SASA 5ITRA 2L7HA 4IJEA 1XHBA 1NY6A 3L27A 3TPZA 1E9RA 1J7KA 2FFJA 2KW0A 4M9XA 2OPFA 1N75A 3TWMA 1IN5A 4GRIA 3SYLA 3SYKA 2F5PA 1N33M 1JR3A 3J7BA 3SHGB 3GQ3A 4LJ5A 3TE6A 1W5TA 1L2CA 1EE8A 2Y0TA 4MM3B 4JI7M 2ZAMA 3SBJA 5KPRA 4TUWA 1GL6A 2KEBA 1PJJA 4B3RM 1TDZA 3HGIA 3DOAA 3SAVA 4LJ7A 5FTNA 2D7GA 3AKZA 3FKEA 3JAMS 5EP4A 1VDDA 4WW0A 1XC8A 4Z6YA 3GLHB 3MK6A 4DR1M 2BJWA 1K3XA 3FTEA 4B08A 1ZQ9A 3FYCA 4KODA 4M9SA 2FOIC 3DZDA 4CHTB 3C58A 1IN6A 2ERCA 2M5ZA 4OVZB 3FTFA 3KVWA 4IIWA 1K3WA 4NOOB 4HL4A 4FW9A 2L09A 5A2QS 2DWLA 2Z7JA 1IBKM 4DR6M 1Q39A 3EIEA 4HLQA 3AJIB 1MX0A 3FD9A 5ITYA 1QVRA 4FWGA 4GH9A 5FLXS 3E4RA 4LJ9A 2RKOA 3GPYA 1XXHB 1I94M 3U6EA 3PNVA 3W0FA 4P16A 3R9XB 3HHWA 2XFSA 1G3IA 5ITUA 1ORYB 4LG2A 5IT9S 5ITTA 2C9CA 2C96A 4PCZA 1Z5AA 4LJ4A 4QNMA 5F3WA 3IG8A 1IXZA 2EA0A 4X62M 5FTLA 1L1TA 3J27B 2X4AA 1MU5A 1KSFX 3T38A 1E9SA 3AL0C 1TDHA 1NJGA 4LJ6A 2X8AA 4L8RC 3L2AA 5C1BA 1W5SA 4RF1A 3I4VA 3T1YM 5EXTA 1DGHB 3TL4X 3GPPA 2BJVA 4IBGA 2HKJA 3NBIA 3KSJA 2CV0A 5FTJA 2VQFM 2E5LM 1HT1E 1K82A 2LXEA 2R45A 3LVVA 4GC9A 4DV3M 1G59A 4IBIA 1IY0A 5ITXE 4LF8M 4L78A 3SFZA 4NXNM 4YY3M 3FUUA 2QCUA 2Z4SA 2Y0QA 4MGIE 1TH4A 4XGIA 3MJ5A 1Z6TA 2KA6B 4IBDA 2CEAA 2F5NA 2D7HA 4I81A 3NWLA 4KHPM 3UK6A 2G5GX 2C98A 3CTWB 3AOEA 3HHZA 2CE7A 4G4RA 1PJIA 2F5SA 4I4LA 3VK8A 3FUWA 4OX9M 4KLNA 1QANA 4NL4H 4DV2M 3KOXE 1R2YA 4IJFA 4BLCA 4GC5A 1L2BA 2XLJA 1N32M 2DZOB 4FWDA 4B3SM 3GRYA 5KQ8A 1GLNA 3VDUA 1N34M 5E6JA 5FTMA 3GLFA 3U6MA 4DR2M 1YE9A 1D2NA 1Q3CA 1XNRM 4DV1M 2R4EA 4IBBA 4MGKE 3GLFB 3GRVA 4QHTA 4JI1M 4GIPA 1X37A 1SXJD 3K92A 1XXHA 2LNHC 1QAMA 4NSRA 4BB9A 4JI0M 1ZAEA 2RGHA 4LGYA 2HCBA 4DR4M 1XMQM 4FCWA 3GLIB 2EUCA 1QAOA 4DR3M 1GKIA 4WURA 3U6CA 2QBYB 4LGMA 4B7HA 2XSZA 5IZ7D 4AQYM 2QZ4A 5E26A 1R2ZA 8CATA 2XFTA 1UM8A 4I5SA 4MGYE 2D7EA 1KFVA 3GP1A 3K8ZA 3KDSE 5DYGA 1QYRA 3T15A 1DO0A 3U6OA 3MHVC 3VKHA 4G4NA 1IY2A 3KOYE 3Q8XA 2CHGA 4LZJA 3AOEC 2DHRA 5JI3E 2UUAM 1DGHA 2AHMA 2H1RA 2Q2EB 2LH0A 2R46A 1Z5BA 4A3VB 2DVWB 2XZFA 2QENA 4M0DA 4FCVA 3I4YA 2X49A 4MGHA 4AKGA 3D8LA 3SC3A 2LWXA 2L6OA 3TQSA 3J2PB 4CISA 3HJQA 2KRUA 2R65A 3UZUA 1XNQM 2XSZD 3L28A 4GKKM 4R7GA 4PDIA 3HU3A 3KSXA 1IXRC 2HHHM 5GKNA 1L1ZA 3CF6E 3SMSA 3JR5A 3DA1A 4DV7M 4IBFA 4JV5M 3KP0E 1YSYA 2RGOA 2C9OA 3U6SA 3H4MA 3QWLA 1NVMA 4D81A 4AW4A 3JR4A 4DV5M 5FTKA 3LVWA 1TGUA 3R8FA 2FNAA 3J81S 4M9ZA 2ZANA 2DZNB 2F4VM 4XBOA 3U61B 4QOZC 3GLGB 2YFQA 3SAWA 3VFDA 3SARA 5JI2E 3PFIA 3AV0A 2KZUA 5ITQA 3U5ZA 4JN6A 1LV7A 1NHGC 2ZBKB 4LF7M 1C1KA 4JI2M 4PDGA 4FCTA 2G8LA 1IQPA 2YR0A 4MH0E 4BBAA 2NQ8C 1N78A 3GLHA 4JYAM 1IN7A 4AKHA 1NY5A 1JR3D 3T1HM 1IN4A 2KRKA 2KZSA 2L7IA 2J7NA 3RE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3C A;  4JI6 M;  4DV1 M;  1XNR M;  3JAM S;  2F5O A;  1XC8 A;  4JI1 M;  4YHH M;  4DR1 M;  1K3X A;  1IBL M;  4LFA M;  3A42 A;  4LFC M;  5LMU M;  1IBM M;  2UUB M;  4JI0 M;  3C58 A;  4LF4 M;  4DR4 M;  3J80 S;  1XMQ M;  3U6L A;  4X65 M;  5LMN M;  1K3W A;  4DR3 M;  3U6C A;  1Z5C A;  1L2D A;  5A2Q S;  4LF9 M;  1IBK M;  4B3T M;  4AQY M;  4DR6 M;  1Q39 A;  1FJG M;  1R2Z A;  1MX0 A;  5ITY A;  5FLX S;  1NNJ A;  1KFV A;  3U6Q A;  3GP1 A;  1N36 M;  3GPY A;  4GKJ M;  1I94 M;  3U6E A;  4ITQ A;  3U6O A;  3SAT A;  4DUY M;  3W0F A;  4G4N A;  4JI5 M;  5BR8 M;  5IWA M;  2VQE M;  5ITU A;  5ITX A;  4PD2 A;  5IT9 S;  5ITT A;  2OQ4 A;  4JI4 M;  4PCZ A;  3SAU A;  1Z5A A;  2UUA M;  3GPU A;  4B3M M;  2Q2E B;  3U6D A;  1J5E M;  1Z5B A;  2EA0 A;  4X62 M;  1HNZ M;  1L1T A;  2UU9 M;  2XZF A;  1HNW M;  1MU5 A;  3U6P A;  3A45 A;  1Q3B A;  4DV6 M;  4DR5 M;  1TDH A;  3GPX A;  3GQ4 A;  4LF6 M;  2UUC M;  4CIS A;  3TWK A;  3T1Y M;  2UXD M;  1XNQ M;  4GKK M;  3GPP A;  4PDI A;  4DV0 M;  2HKJ A;  2VQF M;  2E5L M;  4LFB M;  1HR0 M;  1K82 A;  3J7A S;  4NRV A;  2HHH M;  4DUZ M;  4DR7 M;  1L1Z A;  4DV3 M;  3JR5 A;  4MB7 A;  4DV7 M;  4JV5 M;  2XZU A;  3GQ5 A;  5ITX E;  1PM5 A;  4G4Q A;  4LF8 M;  3TWL A;  4LF5 M;  3SAS A;  4NXN M;  1XMO M;  3U6S A;  5ITR A;  4YY3 M;  4X66 M;  4NXM M;  4K0K M;  3JR4 A;  4X64 M;  4DV5 M;  4G4O A;  3GO8 A;  2F5N A;  3J81 S;  2OPF A;  3TWM A;  2F5Q A;  2F4V M;  1N33 M;  2F5P A;  4KHP M;  3SAW A;  2UXC M;  3SAR A;  1PJI A;  4G4R A;  2ZM6 M;  4NRW A;  2F5S A;  5ITQ A;  3VK8 A;  3A46 A;  4OX9 M;  2ZBK B;  3GQ3 A;  4DV2 M;  1HNX M;  4LF7 M;  1L2C A;  1R2Y A;  1EE8 A;  4JI7 M;  1L2B A;  4JI2 M;  4PDG A;  3SBJ A;  1N32 M;  1Z59 A;  4DV4 M;  1PJJ A;  4B3S M;  3OTO M;  4B3R M;  1TDZ A;  3VK7 A;  4JYA M;  3DOA A;  3SAV A;  1N34 M;  3U6M A;  2UXB M;  3T1H M;  4DR2 M;  4JI8 M;  4JI3 M; 
#chains in the Genus database with same CATH topology
 4IBC A;  3C3D A;  3K1J A;  2CP8 A;  4JI6 M;  3CF2 A;  5EP2 A;  4REZ A;  4YHH M;  3GRR A;  1WXQ A;  5EP1 A;  3THG A;  4LFA M;  1NHW C;  1IBL M;  2DWM A;  2Z4R A;  1TR8 A;  2XH9 A;  4PT5 A;  5LMU M;  3GLI E;  5FSW A;  2QSF X;  5EXS A;  4EIW A;  3IEC A;  1R5L A;  2JY5 A;  3J80 S;  1GVN A;  3HU2 A;  3U6L A;  3W68 A;  2V1C A;  2Y20 A;  4FWH A;  3ZC7 B;  1WHC A;  2R6F A;  1QAQ A;  3KP1 E;  3U61 A;  3HHX A;  2LVO C;  1Z5C A;  1L2D A;  4LF9 M;  2JXN A;  1DGB A;  1IM2 A;  2JY8 A;  4OW0 A;  2WZJ A;  2CHQ A;  4OU7 A;  2KHH A;  3DFZ A;  2QQ8 A;  3GLI A;  2V1U A;  1NNJ A;  4B7F A;  4IBK A;  5DFL A;  3M7G A;  4P17 A;  1NJF A;  3RGP A;  1N36 M;  5KPT A;  3M6A A;  1VG5 A;  3PVS A;  4ITQ A;  2R62 A;  3V76 A;  1XWI A;  4D80 A;  1E32 A;  2LHC A;  2DAK A;  4IBJ A;  1HQC A;  4D82 A;  2K47 A;  1L8Q A;  2DWZ B;  3HJ8 A;  1T6O A;  1QZM A;  3A98 B;  2DEN A;  1QUT A;  1V34 A;  3E46 A;  2OQ4 A;  4JI4 M;  3SAU A;  2R18 A;  2DI0 A;  4B3M M;  3HKP A;  3U6D A;  1J5E M;  4GHL A;  2DWN A;  2O25 A;  4KT0 F;  1HNW M;  2CV2 A;  1YLA A;  5EXP A;  1Q3B A;  4DR5 M;  2LVQ D;  4NSO B;  3B7Z A;  4LJ8 A;  2DHY A;  2QHO B;  3E9S A;  1G8P A;  1PGY A;  4JXJ A;  1T43 A;  3GPX A;  1VEK A;  4LRT A;  2JUJ A;  3GQ4 A;  1HT2 E;  1AIP C;  1TTE A;  3BBZ A;  3BXW A;  5EP3 A;  2ZAO A;  2XEP A;  1D0M A;  1JQJ C;  1QDR A;  5DYI A;  2UXD M;  1SXJ A;  1YUB A;  3AOG A;  4DV0 M;  5EQT A;  1ZV1 A;  1DGG A;  2I7P A;  4G6Z A;  1PJQ A;  4LFB M;  4OVZ A;  1HR0 M;  4F2L A;  2MR9 A;  4NRV A;  3L26 A;  4Y28 F;  4DUZ M;  1VEG A;  2LBC A;  2KNZ A;  3ILK A;  1GL7 A;  3B9P A;  1TH3 A;  4WP2 A;  4MB7 A;  1OJL A;  4FVM A;  1DO2 A;  2XZU A;  1PM5 A;  4G4Q A;  2R0I A;  3TWL A;  4R3D A;  1WR1 B;  3LQQ A;  5EJC A;  1XMO M;  1G4A E;  5KQD A;  1SXJ E;  2M60 A;  4X66 M;  3ZH9 B;  3U5Z B;  4NXM M;  1QDT A;  1S3S A;  1Y8G A;  5IRE B;  2Z3X A;  4K0K M;  5BPV A;  4X64 M;  1R7R A;  3HZJ A;  4G4O A;  3H4J A;  3KS4 A;  3D8B A;  3EIH A;  2WSE F;  1OFH A;  4QOS A;  3GO8 A;  4L15 A;  4I8O A;  1J09 A;  4LY6 A;  2F5Q A;  3KXE C;  5C18 A;  4AI6 A;  2MGW A;  2A5Y B;  2G3Q A;  2ZTC A;  3LQR A;  2UXC M;  4NRW A;  5EXX A;  2ZM6 M;  3UGJ A;  3A46 A;  1HNX M;  3M0E A;  1FNN A;  1MN3 A;  4CGY B;  3HWS A;  4AKI A;  3VLF B;  3Q8G A;  1Z59 A;  2CUZ A;  2FE8 A;  4DV4 M;  3GLG A;  3RFW A;  3OTO M;  3VK7 A;  1XXH E;  4ANR A;  3PXG A;  3I51 A;  2UXB M;  4GIT A;  3CF0 A;  2CHV A;  2KXE A;  2J7O A;  4S12 A;  3KOZ E;  4QNR A;  4JI8 M;  3BOS A;  4JI3 M;  4W5W A;  3U60 B;  2F5O A;  4M0W A;  3FTC A;  3W0L B;  3HHY A;  3FUV A;  1XB2 B;  1MJG M;  3ZQJ A;  2XF3 A;  4QHS A;  3A42 A;  4LFC M;  2CV1 A;  1WGL A;  1IBM M;  1R4G A;  2UUB M;  2CFO A;  3UMM A;  3FUX A;  7CAT A;  1NNU C;  4LZZ A;  4IBE A;  4AG6 A;  5DNY A;  3KW6 A;  4LF4 M;  3L25 A;  4UN2 B;  3LMM A;  3ZCB B;  4X65 M;  2EKK A;  1NSF A;  5LMN M;  3PNY A;  2HL7 A;  4AG5 A;  1OKS A;  3AFH A;  2I7N A;  4B3T M;  2LVA A;  3WHL A;  4RF0 A;  4AZF A;  4II7 A;  1DGF A;  2DNA A;  4B7G A;  1FJG M;  1R6B X;  4Z8X A;  1QQW A;  3FUT A;  1EFU B;  1IY1 A;  2C5R A;  3U6Q A;  4ZPX A;  1IXS B;  1C7Y A;  4GKJ M;  2YNM D;  2QP9 X;  2QPA A;  3SAT A;  2EO2 A;  4LRS A;  4DUY M;  3FE3 A;  4L16 A;  4JI5 M;  1G41 A;  5H37 D;  5KPZ A;  5IWA M;  1H6U A;  5BR8 M;  2VQE M;  3L29 A;  3KS8 A;  5ITX A;  4PD2 A;  2V6Z M;  3VKG A;  2O01 F;  2L4F A;  1N77 A;  2VII A;  3KOW E;  1E94 E;  2VF8 A;  4RNA A;  2VDB B;  1IN8 A;  1HQY E;  2YQZ A;  1TH2 A;  4KO8 A;  1SXJ B;  2JP7 A;  4LJA A;  3GPU A;  4LCB A;  4GMQ A;  1HNZ M;  3FTD A;  1F4I A;  2UU9 M;  3KFU G;  3U6P A;  2DKL A;  2HAK A;  2Y21 A;  3A45 A;  4DV6 M;  1KYI A;  3IG5 A;  3I04 M;  1T3T A;  1I4W A;  3SHF A;  4GHA A;  1V92 A;  2O5R A;  4L4U A;  1OFI A;  2H5X A;  3SMP A;  4LF6 M;  2UUC M;  3VDP A;  3TWK A;  3K2L A;  2QBY A;  3HU1 A;  3UJN A;  3U60 A;  2C99 A;  2DAE A;  4FD2 A;  2R4J A;  2XGN A;  3CGW A;  2P5T A;  2DXI A;  3J7A S;  1V33 A;  3RGS A;  4DR7 M;  1SXJ C;  3HJS A;  3WHK A;  4R71 A;  5KO3 A;  3FYD A;  2BWE A;  2W82 A;  3QAU A;  3B89 A;  3FRI A;  4MGZ E;  2MH8 A;  3IHP A;  2JA2 A;  3GQ5 A;  2J5Y A;  4LF5 M;  2BNK A;  3GRU A;  3SAS A;  5ITR A;  2L7H A;  4IJE A;  1XHB A;  1NY6 A;  2JZ0 A;  3L27 A;  3TPZ A;  1JB0 F;  1E9R A;  1J7K A;  2FFJ A;  2KW0 A;  1OTR A;  4GEW A;  4M9X A;  1VEJ A;  1N75 A;  2OPF A;  3TWM A;  1IN5 A;  4GRI A;  3SYL A;  3SYK A;  1G71 A;  2F5P A;  1N33 M;  2B3T A;  1JR3 A;  3J7B A;  3SHG B;  3GQ3 A;  4LJ5 A;  3E21 A;  1W5T A;  3TE6 A;  1L2C A;  1EE8 A;  1NV9 A;  2JWS A;  2Y0T A;  4MM3 B;  4JI7 M;  2ZAM A;  3SBJ A;  5KPR A;  4TUW A;  1GL6 A;  3B74 A;  2KEB A;  1PJJ A;  3FRH A;  4B3R M;  1TDZ A;  2LVN C;  3HGI A;  3DOA A;  2EKF A;  3SAV A;  4LJ7 A;  1GAB A;  5FTN A;  4CJ6 A;  2HWJ A;  1D0L A;  3B7Q A;  2D7G A;  2OOA A;  3AKZ A;  2DAG A;  2FS1 A;  3FKE A;  3JAM S;  2QNJ A;  1VDD A;  5EP4 A;  4F1I A;  4WW0 A;  1XC8 A;  4Z6Y A;  3GLH B;  3MK6 A;  4DR1 M;  2BJW A;  1K3X A;  1BVS A;  3FTE A;  4B08 A;  1ZQ9 A;  3FYC A;  4KOD A;  4M9S A;  2GQF A;  2WSF F;  2FOI C;  3LCU A;  2BWB A;  3DZD A;  4CHT B;  1IN6 A;  4CIZ A;  1WIV A;  3C58 A;  2ERC A;  2M5Z A;  4OVZ B;  3FTF A;  2MRO B;  3KVW A;  4IIW A;  1K3W A;  4NOO B;  4HL4 A;  1ZMW A;  4FW9 A;  3T6P A;  2L09 A;  5A2Q S;  2DWL A;  2Z7J A;  1IBK M;  4DR6 M;  1Q39 A;  3EIE A;  4HLQ A;  3AJI B;  1MX0 A;  2R44 A;  3FD9 A;  5ITY A;  1QVR A;  4FWG A;  4GH9 A;  5FLX S;  3E4R A;  4LJ9 A;  2KNA A;  2RKO A;  3GPY A;  1XXH B;  1I94 M;  3U6E A;  2LTU A;  3PNV A;  3W0F A;  1ZMV A;  4P16 A;  3NBX X;  3R9X B;  3HHW A;  1OQY A;  1G3I A;  2XFS A;  5ITU A;  1ORY B;  2WSC F;  4LG2 A;  5IT9 S;  5ITT A;  3GLF E;  2C9C A;  2C96 A;  4PCZ A;  3B7N A;  1Z5A A;  4LJ4 A;  4QNM A;  1VDL A;  5F3W A;  3IG8 A;  1IXZ A;  2EA0 A;  4X62 M;  5FTL A;  2DZL A;  1L1T A;  3J27 B;  2X4A A;  1MU5 A;  1KSF X;  3T38 A;  1E9S A;  1OIP A;  2KNV A;  1TDH A;  3HY5 A;  1OIZ A;  3AL0 C;  1VQ1 A;  1NJG A;  4LJ6 A;  2FH0 A;  1IFY A;  2X8A A;  3I01 M;  4L8R C;  3L2A A;  3HX3 A;  2K0B X;  2L2D A;  5C1B A;  3MMP A;  1W5S A;  2EJS A;  4RF1 A;  3I4V A;  3T1Y M;  5EXT A;  2KDL A;  2OO9 A;  1DGH B;  3TL4 X;  3GPP A;  2BJV A;  1P3Q Q;  2HKJ A;  4IBG A;  3NBI A;  3KSJ A;  2CV0 A;  5FTJ A;  2VQF M;  2E5L M;  1HT1 E;  1OAO C;  2LXE A;  2R45 A;  2JY7 A;  1K82 A;  1GJT A;  4Q7J A;  3LVV A;  4GC9 A;  4DV3 M;  1G59 A;  4IBI A;  1IY0 A;  5ITX E;  3K9O A;  4LF8 M;  1WGN A;  4L78 A;  3LW5 F;  3SFZ A;  4NXN M;  4YY3 M;  3FUU A;  2QCU A;  2Z4S A;  2Y0Q A;  4MGI E;  1TH4 A;  4XGI A;  3MJ5 A;  1Z6T A;  1GJS A;  1NV8 A;  2KA6 B;  3GLG E;  4IBD A;  2CEA A;  4DBG B;  2F5N A;  2D7H A;  4I81 A;  3NWL A;  4KHP M;  1LTM A;  3UK6 A;  2G5G X;  2C98 A;  3CTW B;  3AOE A;  3HHZ A;  2CE7 A;  4G4R A;  1PJI A;  2F5S A;  4I4L A;  3VK8 A;  3FUW A;  4OX9 M;  3QYE A;  4KLN A;  1QAN A;  4NL4 H;  4DV2 M;  3KOX E;  1R2Y A;  4IJF A;  4BLC A;  4GC5 A;  2CWB A;  1L2B A;  3LCV B;  2XLJ A;  1N32 M;  2DZO B;  4FWD A;  4B3S M;  3GRY A;  5KQ8 A;  2L4E A;  1GLN A;  1A5T A;  3VDU A;  1N34 M;  5E6J A;  1PRB A;  5FTM A;  3GLF A;  3U6M A;  4DR2 M;  1YE9 A;  1D2N A;  1Q3C A;  1ZMU A;  4DV1 M;  1XNR M;  2R4E A;  4IBB A;  4MGK E;  3GLF B;  2LVP C;  3GRV A;  4QHT A;  4JI1 M;  4GIP A;  1OAI A;  3C3E A;  1X37 A;  1SXJ D;  3F92 A;  3K92 A;  1XXH A;  4G3O A;  2LNH C;  1QAM A;  1QUS A;  2JNH A;  4NSR A;  4BB9 A;  4JI0 M;  1ZAE A;  2RGH A;  4LGY A;  2HCB A;  4DR4 M;  1XMQ M;  4FCW A;  3GLI B;  2EUC A;  5L8R F;  1QAO A;  2K9D A;  4DR3 M;  1GKI A;  2JY6 B;  4WUR A;  3U6C A;  2QBY B;  4LGM A;  4B7H A;  2XSZ A;  5IZ7 D;  4AQY M;  2QZ4 A;  1D0K A;  5E26 A;  1TF0 B;  4L6V 6;  1R2Z A;  2GNO A;  8CAT A;  2OOB A;  1UM8 A;  2XFT A;  4I5S A;  2D7E A;  4MGY E;  1SG9 A;  1KFV A;  3GP1 A;  3K8Z A;  3KDS E;  5DYG A;  1QYR A;  3T15 A;  2ZTD A;  1DO0 A;  3GLH E;  3U6O A;  3MHV C;  3VKH A;  4G4N A;  2APL A;  2K6B A;  1IY2 A;  1GO5 A;  3KOY E;  3Q8X A;  1RU3 A;  2CHG A;  2JZ1 A;  4LZJ A;  3AOE C;  2DHR A;  5JI3 E;  2UUA M;  1DGH A;  2DAM A;  2AHM A;  2H1R A;  2Q2E B;  2LH0 A;  2R46 A;  1Z5B A;  4A3V B;  2DVW B;  2XZF A;  2QEN A;  4M0D A;  4FCV A;  4XK8 F;  3I4Y A;  2X49 A;  1WJ7 A;  1UFZ A;  1IXS A;  4MGH A;  2MJ5 B;  4AKG A;  3D8L A;  3SC3 A;  2LWX A;  2L6O A;  2N35 A;  4HEO A;  3TQS A;  3J2P B;  4CIS A;  3HJQ A;  2KRU A;  2R65 A;  3UZU A;  1HJP A;  1XNQ M;  2XSZ D;  3L28 A;  4NC6 A;  4GKK M;  4R7G A;  4PDI A;  1AUA A;  3HU3 A;  3KSX A;  1IXR C;  2HHH M;  5GKN A;  1L1Z A;  1PJS A;  3CF6 E;  3SMS A;  2LHG A;  3JR5 A;  3DA1 A;  4DV7 M;  3K9P A;  4IBF A;  4JV5 M;  1JR3 E;  3W67 A;  1CUK A;  3KP0 E;  1YSY A;  2RGO A;  2C9O A;  2CRU A;  3H4M A;  3QWL A;  1NVM A;  3C9P A;  3U6S A;  4D81 A;  4AW4 A;  3JR4 A;  4DV5 M;  1QZE A;  5FTK A;  3LVW A;  1TGU A;  3R8F A;  2FNA A;  3J81 S;  4M9Z A;  2ZAN A;  2DZN B;  2F4V M;  4RKU F;  4XBO A;  3U61 B;  1EIJ A;  4QOZ C;  3GLG B;  1NO1 A;  2YFQ A;  3SAW A;  3VFD A;  3SAR A;  5JI2 E;  3PFI A;  3AV0 A;  2KZU A;  5ITQ A;  3QYB A;  4JN6 A;  3U5Z A;  1LV7 A;  1NHG C;  2DAI A;  2ZBK B;  4LF7 M;  2VF7 A;  1Q02 A;  2Z8Y M;  1C1K A;  4JI2 M;  4PDG A;  4FCT A;  2G8L A;  1IQP A;  2YR0 A;  4MH0 E;  4BBA A;  2NQ8 C;  1PJT A;  1N78 A;  1DV0 A;  3GLH A;  4JYA M;  1IN7 A;  4AKH A;  1NY5 A;  1JR3 D;  2RRU A;  3T1H M;  1IN4 A;  2KRK A;  2KZS A;  2L7I A;  2J7N A;  3RE8 A; 
#chains in the Genus database with same CATH homology
 4IBC A;  3K1J A;  4JI6 M;  3CF2 A;  5EP2 A;  4REZ A;  4YHH M;  3GRR A;  1WXQ A;  5EP1 A;  3THG A;  4LFA M;  1NHW C;  1IBL M;  2DWM A;  2Z4R A;  2XH9 A;  4PT5 A;  5LMU M;  5FSW A;  5EXS A;  4EIW A;  3J80 S;  1GVN A;  3HU2 A;  3U6L A;  2V1C A;  2Y20 A;  4FWH A;  3ZC7 B;  3KP1 E;  1QAQ A;  3U61 A;  3HHX A;  1Z5C A;  1L2D A;  4LF9 M;  1DGB A;  1IM2 A;  4OW0 A;  2CHQ A;  4OU7 A;  3DFZ A;  3GLI A;  2V1U A;  1NNJ A;  4B7F A;  4IBK A;  3RGP A;  3M7G A;  1NJF A;  1N36 M;  5KPT A;  3M6A A;  3PVS A;  4ITQ A;  2R62 A;  1XWI A;  4D80 A;  1E32 A;  4IBJ A;  1HQC A;  4D82 A;  2K47 A;  1L8Q A;  2DWZ B;  3HJ8 A;  3A98 B;  1QZM A;  2OQ4 A;  4JI4 M;  3SAU A;  2R18 A;  4B3M M;  3HKP A;  3U6D A;  1J5E M;  4GHL A;  2DWN A;  1HNW M;  2CV2 A;  5EXP A;  1Q3B A;  4DR5 M;  4NSO B;  4LJ8 A;  3E9S A;  1G8P A;  4JXJ A;  3GPX A;  4LRT A;  3GQ4 A;  1HT2 E;  5EP3 A;  2ZAO A;  2XEP A;  1JQJ C;  5DYI A;  2UXD M;  1SXJ A;  1YUB A;  3AOG A;  4DV0 M;  5EQT A;  1DGG A;  2I7P A;  4G6Z A;  4LFB M;  4OVZ A;  1HR0 M;  4NRV A;  3L26 A;  4DUZ M;  3ILK A;  1GL7 A;  3B9P A;  1TH3 A;  4MB7 A;  1OJL A;  4FVM A;  1DO2 A;  2XZU A;  1PM5 A;  4G4Q A;  3TWL A;  4R3D A;  3LQQ A;  5EJC A;  1XMO M;  1G4A E;  5KQD A;  1SXJ E;  2M60 A;  4X66 M;  3ZH9 B;  3U5Z B;  4NXM M;  1S3S A;  5IRE B;  2Z3X A;  4K0K M;  5BPV A;  4X64 M;  1R7R A;  4G4O A;  3KS4 A;  4QOS A;  3D8B A;  3EIH A;  3GO8 A;  1OFH A;  4L15 A;  4I8O A;  1J09 A;  4LY6 A;  2F5Q A;  3KXE C;  5C18 A;  4AI6 A;  2A5Y B;  3LQR A;  2UXC M;  4NRW A;  5EXX A;  2ZM6 M;  3UGJ A;  3A46 A;  1HNX M;  3M0E A;  1FNN A;  4CGY B;  3HWS A;  4AKI A;  3VLF B;  1Z59 A;  2CUZ A;  2FE8 A;  4DV4 M;  3GLG A;  3RFW A;  3OTO M;  3VK7 A;  3PXG A;  3I51 A;  2UXB M;  4GIT A;  3CF0 A;  2CHV A;  2KXE A;  2J7O A;  4S12 A;  3KOZ E;  4QNR A;  4JI8 M;  3BOS A;  4JI3 M;  4W5W A;  3U60 B;  2F5O A;  4M0W A;  3FTC A;  3W0L B;  3HHY A;  3FUV A;  2XF3 A;  4QHS A;  3A42 A;  4LFC M;  2CV1 A;  1IBM M;  2UUB M;  2CFO A;  3UMM A;  3FUX A;  7CAT A;  1NNU C;  4LZZ A;  4IBE A;  4AG6 A;  5DNY A;  3KW6 A;  4LF4 M;  3L25 A;  3LMM A;  3ZCB B;  4X65 M;  1NSF A;  5LMN M;  3PNY A;  2HL7 A;  4AG5 A;  3AFH A;  2I7N A;  4B3T M;  3WHL A;  4RF0 A;  4AZF A;  4II7 A;  1DGF A;  1FJG M;  4B7G A;  1R6B X;  4Z8X A;  1QQW A;  3FUT A;  1IY1 A;  2C5R A;  3U6Q A;  4ZPX A;  1IXS B;  4GKJ M;  2YNM D;  2QP9 X;  2QPA A;  3SAT A;  2EO2 A;  4LRS A;  4DUY M;  4L16 A;  4JI5 M;  1G41 A;  5H37 D;  5KPZ A;  5IWA M;  1H6U A;  5BR8 M;  2VQE M;  3L29 A;  3KS8 A;  5ITX A;  4PD2 A;  2V6Z M;  3VKG A;  1N77 A;  2VII A;  3KOW E;  1E94 E;  4RNA A;  1IN8 A;  1HQY E;  2YQZ A;  1TH2 A;  4KO8 A;  1SXJ B;  4LJA A;  3GPU A;  4LCB A;  4GMQ A;  1HNZ M;  3FTD A;  2UU9 M;  3KFU G;  3U6P A;  2Y21 A;  3A45 A;  4DV6 M;  1KYI A;  3IG5 A;  1T3T A;  1I4W A;  3SHF A;  4GHA A;  2O5R A;  4L4U A;  1OFI A;  3SMP A;  4LF6 M;  2UUC M;  3VDP A;  3TWK A;  3K2L A;  2QBY A;  3HU1 A;  3UJN A;  3U60 A;  2C99 A;  4FD2 A;  2R4J A;  2XGN A;  2P5T A;  2DXI A;  3J7A S;  3RGS A;  4DR7 M;  1SXJ C;  3HJS A;  3WHK A;  5KO3 A;  3FYD A;  2W82 A;  3QAU A;  4MGZ E;  3GQ5 A;  2JA2 A;  4LF5 M;  2BNK A;  3GRU A;  3SAS A;  5ITR A;  2L7H A;  4IJE A;  1XHB A;  1NY6 A;  3L27 A;  3TPZ A;  1E9R A;  1J7K A;  2FFJ A;  2KW0 A;  4M9X A;  2OPF A;  1N75 A;  3TWM A;  1IN5 A;  4GRI A;  3SYL A;  3SYK A;  2F5P A;  1N33 M;  1JR3 A;  3J7B A;  3SHG B;  3GQ3 A;  4LJ5 A;  3TE6 A;  1W5T A;  1L2C A;  1EE8 A;  2Y0T A;  4MM3 B;  4JI7 M;  2ZAM A;  3SBJ A;  5KPR A;  4TUW A;  1GL6 A;  2KEB A;  1PJJ A;  4B3R M;  1TDZ A;  3HGI A;  3DOA A;  3SAV A;  4LJ7 A;  5FTN A;  2D7G A;  3AKZ A;  3FKE A;  3JAM S;  5EP4 A;  1VDD A;  4WW0 A;  1XC8 A;  4Z6Y A;  3GLH B;  3MK6 A;  4DR1 M;  2BJW A;  1K3X A;  3FTE A;  4B08 A;  1ZQ9 A;  3FYC A;  4KOD A;  4M9S A;  2FOI C;  3DZD A;  4CHT B;  3C58 A;  1IN6 A;  2ERC A;  2M5Z A;  4OVZ B;  3FTF A;  3KVW A;  4IIW A;  1K3W A;  4NOO B;  4HL4 A;  4FW9 A;  2L09 A;  5A2Q S;  2DWL A;  2Z7J A;  1IBK M;  4DR6 M;  1Q39 A;  3EIE A;  4HLQ A;  3AJI B;  1MX0 A;  3FD9 A;  5ITY A;  1QVR A;  4FWG A;  4GH9 A;  5FLX S;  3E4R A;  4LJ9 A;  2RKO A;  3GPY A;  1XXH B;  1I94 M;  3U6E A;  3PNV A;  3W0F A;  4P16 A;  3R9X B;  3HHW A;  2XFS A;  1G3I A;  5ITU A;  1ORY B;  4LG2 A;  5IT9 S;  5ITT A;  2C9C A;  2C96 A;  4PCZ A;  1Z5A A;  4LJ4 A;  4QNM A;  5F3W A;  3IG8 A;  1IXZ A;  2EA0 A;  4X62 M;  5FTL A;  1L1T A;  3J27 B;  2X4A A;  1MU5 A;  1KSF X;  3T38 A;  1E9S A;  3AL0 C;  1TDH A;  1NJG A;  4LJ6 A;  2X8A A;  4L8R C;  3L2A A;  5C1B A;  1W5S A;  4RF1 A;  3I4V A;  3T1Y M;  5EXT A;  1DGH B;  3TL4 X;  3GPP A;  2BJV A;  4IBG A;  2HKJ A;  3NBI A;  3KSJ A;  2CV0 A;  5FTJ A;  2VQF M;  2E5L M;  1HT1 E;  1K82 A;  2LXE A;  2R45 A;  3LVV A;  4GC9 A;  4DV3 M;  1G59 A;  4IBI A;  1IY0 A;  5ITX E;  4LF8 M;  4L78 A;  3SFZ A;  4NXN M;  4YY3 M;  3FUU A;  2QCU A;  2Z4S A;  2Y0Q A;  4MGI E;  1TH4 A;  4XGI A;  3MJ5 A;  1Z6T A;  2KA6 B;  4IBD A;  2CEA A;  2F5N A;  2D7H A;  4I81 A;  3NWL A;  4KHP M;  3UK6 A;  2G5G X;  2C98 A;  3CTW B;  3AOE A;  3HHZ A;  2CE7 A;  4G4R A;  1PJI A;  2F5S A;  4I4L A;  3VK8 A;  3FUW A;  4OX9 M;  4KLN A;  1QAN A;  4NL4 H;  4DV2 M;  3KOX E;  1R2Y A;  4IJF A;  4BLC A;  4GC5 A;  1L2B A;  2XLJ A;  1N32 M;  2DZO B;  4FWD A;  4B3S M;  3GRY A;  5KQ8 A;  1GLN A;  3VDU A;  1N34 M;  5E6J A;  5FTM A;  3GLF A;  3U6M A;  4DR2 M;  1YE9 A;  1D2N A;  1Q3C A;  1XNR M;  4DV1 M;  2R4E A;  4IBB A;  4MGK E;  3GLF B;  3GRV A;  4QHT A;  4JI1 M;  4GIP A;  1X37 A;  1SXJ D;  3K92 A;  1XXH A;  2LNH C;  1QAM A;  4NSR A;  4BB9 A;  4JI0 M;  1ZAE A;  2RGH A;  4LGY A;  2HCB A;  4DR4 M;  1XMQ M;  4FCW A;  3GLI B;  2EUC A;  1QAO A;  4DR3 M;  1GKI A;  4WUR A;  3U6C A;  2QBY B;  4LGM A;  4B7H A;  2XSZ A;  5IZ7 D;  4AQY M;  2QZ4 A;  5E26 A;  1R2Z A;  8CAT A;  2XFT A;  1UM8 A;  4I5S A;  4MGY E;  2D7E A;  1KFV A;  3GP1 A;  3K8Z A;  3KDS E;  5DYG A;  1QYR A;  3T15 A;  1DO0 A;  3U6O A;  3MHV C;  3VKH A;  4G4N A;  1IY2 A;  3KOY E;  3Q8X A;  2CHG A;  4LZJ A;  3AOE C;  2DHR A;  5JI3 E;  2UUA M;  1DGH A;  2AHM A;  2H1R A;  2Q2E B;  2LH0 A;  2R46 A;  1Z5B A;  4A3V B;  2DVW B;  2XZF A;  2QEN A;  4M0D A;  4FCV A;  3I4Y A;  2X49 A;  4MGH A;  4AKG A;  3D8L A;  3SC3 A;  2LWX A;  2L6O A;  3TQS A;  3J2P B;  4CIS A;  3HJQ A;  2KRU A;  2R65 A;  3UZU A;  1XNQ M;  2XSZ D;  3L28 A;  4GKK M;  4R7G A;  4PDI A;  3HU3 A;  3KSX A;  1IXR C;  2HHH M;  5GKN A;  1L1Z A;  3CF6 E;  3SMS A;  3JR5 A;  3DA1 A;  4DV7 M;  4IBF A;  4JV5 M;  3KP0 E;  1YSY A;  2RGO A;  2C9O A;  3U6S A;  3H4M A;  3QWL A;  1NVM A;  4D81 A;  4AW4 A;  3JR4 A;  4DV5 M;  5FTK A;  3LVW A;  1TGU A;  3R8F A;  2FNA A;  3J81 S;  4M9Z A;  2ZAN A;  2DZN B;  2F4V M;  4XBO A;  3U61 B;  4QOZ C;  3GLG B;  2YFQ A;  3SAW A;  3VFD A;  3SAR A;  5JI2 E;  3PFI A;  3AV0 A;  2KZU A;  5ITQ A;  3U5Z A;  4JN6 A;  1LV7 A;  1NHG C;  2ZBK B;  4LF7 M;  1C1K A;  4JI2 M;  4PDG A;  4FCT A;  2G8L A;  1IQP A;  2YR0 A;  4MH0 E;  4BBA A;  2NQ8 C;  1N78 A;  3GLH A;  4JYA M;  1IN7 A;  4AKH A;  1NY5 A;  1JR3 D;  3T1H M;  1IN4 A;  2KRK A;  2KZS A;  2L7I A;  2J7N A;  3RE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...