1HR0M

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hr0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hr0M02
3U6DA 3OTOM 4LF4M 4DV2M 3J7AS 3JR5A 3C58A 5IWAM 1K82A 3GPXA 2OQ4A 4DR6M 4PDIA 3U6QA 3U6OA 1Z5AA 1MU5A 3T1HM 3TWMA 1IBKM 1N36M 3JR4A 1K3WA 1KFVA 4X66M 3J81S 2F5OA 2HHHM 2UUAM 2VQEM 3T1YM 4JI6M 2F5SA 4ITQA 1R2ZA 4G4OA 4G4QA 4PD2A 4DV0M 4NXMM 4DV6M 4DR3M 2UU9M 4DV5M 1Q3BA 2UUCM 1IBMM 1R2YA 3U6SA 4LFCM 3SAWA 1HNZM 4JI5M 4MB7A 4JI1M 2UUBM 4DR7M 4LF5M 1L1ZA 4JI2M 5ITUA 5LMUM 3VK7A 2OPFA 4LF6M 5ITTA 4JI4M 1EE8A 1Q3CA 3U6CA 4JI7M 2E5LM 3GP1A 5ITXA 4B3TM 3GQ3A 4JI0M 3SAVA 1L1TA 1IBLM 4OX9M 3A42A 2F5NA 4DUZM 4NRWA 3J80S 4G4RA 1XNQM 4AQYM 1PJIA 2XZUA 1MX0A 3TWLA 1XMOM 4PDGA 4K0KM 3U6EA 4DR5M 1Q39A 3GQ4A 4X65M 2EA0A 4JYAM 4B3RM 3U6LA 1XNRM 4GKKM 3GQ5A 4KHPM 1L2CA 4B3SM 4X62M 2UXBM 3W0FA 5FLXS 5LMNM 1XC8A 4DV1M 2F5QA 2VQFM 4DV3M 1N33M 1I94M 4DR1M 4LF8M 1K3XA 3SAUA 3VK8A 4CISA 3DOAA 1XMQM 4JI3M 4NXNM 5ITXE 1HNWM 4GKJM 3SATA 4X64M 3A46A 1HNXM 1J5EM 4YY3M 1PJJA 5ITRA 4LFBM 2HKJA 5ITYA 1N34M 2F5PA 4B3MM 4YHHM 1Z59A 4JV5M 4DV4M 4LF9M 1PM5A 2ZM6M 3GO8A 2Q2EB 4NRVA 2XZFA 4JI8M 1FJGM 1Z5CA 3JAMS 2F4VM 1TDZA 1Z5BA 1N32M 1L2DA 1NNJA 4G4NA 5ITQA 5BR8M 1L2BA 4PCZA 4DR4M 1TDHA 3SARA 3A45A 3GPPA 4DV7M 3U6MA 4LFAM 3SBJA 2UXCM 4DUYM 5A2QS 4LF7M 3SASA 2ZBKB 1HR0M 2UXDM 5IT9S 3GPUA 3U6PA 3TWKA 4DR2M 3GPYA
chains in the Genus database with same CATH superfamily
3U6DA 1XB2B 4LJ7A 3J7AS 2O01F 2HCBA 1G59A 1WJ7A 4PDIA 3THGA 4IBEA 2FE8A 2MJ5B 4HEOA 3GRYA 1LV7A 3R8FA 1IN8A 1N36M 2BWBA 2ZAMA 3QYEA 2F5OA 2UUAM 1GO5A 1FNNA 1IQPA 3FE3A 2VQEM 3T1YM 4JI6M 1TH3A 4AW4A 4TUWA 3L25A 3AOEA 3TL4X 1IXSA 1C1KA 4G4QA 4NXMM 5JI2E 1EFUB 3L2AA 1QYRA 2Z8YM 3T15A 3SAWA 3KP1E 3UMMA 2XSZD 2DAMA 4DR7M 4LF5M 2LH0A 1DO0A 4F1IA 4GIPA 4M9ZA 4MGZE 5ITUA 2OPFA 3VK7A 2DZNB 2CE7A 3GLHA 2KZUA 1PRBA 4AI6A 3E4RA 1VEKA 2LVNC 1ZMUA 4AZFA 3GQ3A 3BOSA 1SXJA 1UM8A 1QZMA 4JXJA 3W67A 1QDTA 4AKIA 3GLHE 2F5NA 4DUZM 3ZC7B 4NRWA 2KEBA 5KPTA 1IN6A 4AQYM 2QP9X 1SXJE 2CWBA 2X4AA 4RF1A 3C3DA 5E6JA 1MX0A 1TR8A 3QAUA 3KP0E 1XMOM 4LGMA 4K0KM 1QANA 1PGYA 3TPZA 4QOSA 3KS8A 3B89A 2EA0A 4B3RM 3AOGA 2AHMA 1F4IA 4LRTA 1H6UA 3CTWB 3BBZA 4GC5A 2UXBM 2L7IA 1WXQA 2I7NA 5GKNA 2F5QA 3KDSE 1GABA 3PFIA 1G8PA 4FCVA 4CIZA 1NY5A 2ZTDA 4DV3M 4L8RC 1I94M 1IXSB 4OU7A 4DR1M 4I81A 3FUUA 3SAUA 4CGYB 4LF8M 3VK8A 1SXJD 3K9PA 1GVNA 4LRSA 4R3DA 4JI3M 1HNWM 2DNAA 4GRIA 2C9CA 2FOIC 3RGPA 2APLA 2LNHC 1CUKA 3WHKA 1G71A 3E46A 1I4WA 1Z6TA 3A46A 4NSOB 3KXEC 2DAIA 3SC3A 4D81A 3GLIA 1IY1A 1XWIA 1Y8GA 2HKJA 1PJJA 4LFBM 1XXHB 5ITYA 1D0MA 3GLHB 1D2NA 1Q02A 3D8LA 2V1UA 3LVVA 4LF9M 2LHGA 2ZM6M 3GO8A 2JNHA 1SXJB 2XZFA 1OQYA 4JI8M 2BWEA 3SMPA 1Z5CA 3NWLA 1TDZA 3DA1A 1Z5BA 4Z8XA 1L2DA 3B7QA 4IBJA 1NNJA 4G4NA 1HT1E 2DHRA 5ITQA 3T38A 1IN7A 1PJQA 4LJ6A 3AFHA 4DR4M 1NY6A 2OO9A 3FRHA 3HKPA 3DFZA 3A45A 2R62A 4NL4H 1IXZA 4DV7M 4KODA 1IN5A 3HHXA 3B9PA 3HHZA 2DZOB 4LY6A 2DAKA 3VFDA 2DXIA 1HR0M 2Z7JA 2ZANA 3K92A 2G8LA 2D7GA 2Y0TA 1D0LA 3CF6E 5IWAM 3GPXA 4DBGB 2JWSA 2LVAA 2P5TA 2JY8A 2QQ8A 3HX3A 3U6OA 1MU5A 5F3WA 3HJSA 3HWSA 2BNKA 2JUJA 5E26A 3W68A 3JR4A 1KFVA 3CF0A 3VDPA 3FTEA 1DGGA 1V33A 1OIZA 4ITQA 4RKUF 3GLIB 4G4OA 1X37A 3HU3A 2VDBB 4KO8A 5C18A 2UU9M 3FUTA 1TGUA 2UUCM 4GH9A 4BB9A 1R2YA 3HU1A 2MR9A 4ZPXA 3U6SA 1HNZM 5DYGA 3PNVA 5L8RF 2ZTCA 3VLFB 3SYLA 5JI3E 2UUBM 4LCBA 1L1ZA 2EUCA 2WSCF 4LJAA 4Y28F 1QUTA 1EE8A 2NQ8C 1Q3CA 2CHVA 2Z4SA 2FS1A 2Z4RA 2L6OA 2E5LM 5ITXA 2VIIA 4JI0M 3SAVA 2A5YB 2X8AA 3J27B 3L28A 1RU3A 3AOEC 3ZQJA 3HZJA 1WR1B 3NBIA 2KW0A 1OFHA 2Y0QA 2Y20A 4RF0A 4IBGA 2L4EA 4PDGA 1HT2E 5KPZA 4MGYE 4GITA 1Q39A 2JZ0A 4B08A 2C98A 4ANRA 5KPRA 4X65M 5EP1A 5IZ7D 3U6LA 2WSEF 1XNRM 4FW9A 3GLGA 4IJEA 1D0KA 4X62M 1NHWC 1DV0A 1XXHA 1QQWA 3W0FA 2LVQD 3GLGE 2LTUA 2VQFM 2DI0A 1N33M 1SXJC 5EXXA 3PNYA 5EP3A 3QWLA 2DWLA 3UZUA 1K3XA 3I4VA 1XXHE 3KOWE 4W5WA 4CJ6A 2C5RA 3VDUA 2R4JA 3DOAA 4CHTB 4FWGA 1W5SA 3EIEA 3ILKA 3E9SA 2HAKA 4NSRA 1IY0A 3AL0C 2K0BX 1Z59A 3HJQA 4L15A 3ZCBB 1QUSA 1PM5A 3IG5A 2Q2EB 3RE8A 2WZJA 2WSFF 4B7HA 3Q8GA 3J7BA 2LVOC 1N78A 1GL6A 3TQSA 4D80A 2F4VM 3JAMS 1DGBA 3H4JA 4AG5A 2RGHA 3AV0A 4IBIA 5FSWA 3H4MA 3K1JA 3W0LB 1PJTA 1W5TA 3PVSA 1OIPA 2OOBA 1TDHA 4GHAA 2VF8A 5DYIA 1QAQA 2XEPA 3C3EA 2DWZB 7CATA 2H5XA 1GKIA 1ORYB 4B7FA 1VQ1A 2EKKA 4OW0A 3GLGB 2CP8A 2R46A 4IIWA 2RKOA 4L78A 3UGJA 3GPUA 2UXDM 5IT9S 1AUAA 4LJ5A 4IBKA 4R7GA 4DR2M 2R6FA 3GPYA 1E9SA 2J7NA 4FWDA 1IY2A 2RRUA 3LQQA 1DO2A 3IECA 3JR5A 3HY5A 2XGNA 2EKFA 3FUWA 1HQYE 1DGHB 1IXRC 2Y21A 4I4LA 1KYIA 2HWJA 3GLIE 2DWNA 4LZZA 2CEAA 3KW6A 1JQJC 1R4GA 3M0EA 1IN4A 5EXSA 3KFUG 3LW5F 3R9XB 4G3OA 4EIWA 1IBKM 1NVMA 3M7GA 1R2ZA 2L4FA 3A98B 4WURA 3VKGA 4DV6M 3KOZE 1Q3BA 2J5YA 2QCUA 3HHYA 1IBMM 5C1BA 1TH2A 3IG8A 2XLJA 4LFCM 1DGFA 2R65A 1MJGM 4MB7A 4JI1M 2X49A 1QZEA 4QHSA 3UK6A 4LJ4A 3GLFB 5LMUM 4MGKE 4LF6M 5ITTA 4JI4M 4L6V6 2JA2A 3U6CA 4M9XA 2L09A 4JI7M 5EJCA 3DZDA 4B3TM 5EP2A 3SHFA 1IBLM 4OX9M 2FFJA 2K9DA 3J80S 1YSYA 4HLQA 4P16A 1XNQM 3FTCA 2ERCA 4MGHA 4MM3B 1C7YA 3KOXE 3K2LA 2W82A 2QPAA 3I4YA 4KT0F 3U6EA 3GQ4A 4GKKM 3U60A 2O25A 4XGIA 3FD9A 2QSFX 4OVZB 4P17A 3IHPA 5EXTA 3HGIA 1L2CA 4KHPM 2QBYB 5FLXS 5LMNM 2L2DA 1XC8A 4DV1M 1NSFA 4Z6YA 2CV1A 2FNAA 1J7KA 1G3IA 2LVPC 2YFQA 4GMQA 3UJNA 2KNAA 1HJPA 2OOAA 2M60A 3L27A 2JZ1A 4II7A 4CISA 4WP2A 4NXNM 5ITXE 3MJ5A 4AG6A 2CFOA 3B7ZA 1GLNA 2YR0A 2CV2A 4X64M 3K8ZA 1HNXM 3KSJA 4YY3M 1G4AE 5ITRA 3FTDA 2KRKA 5H37D 2QHOB 1A5TA 4YHHM 3FTFA 4LG2A 2VF7A 3B74A 2KNVA 4NC6A 2I7PA 1PJSA 4D82A 1R7RA 1VG5A 4FCTA 2CV0A 2ZAOA 2DWMA 2GQFA 4IBCA 1VEJA 3MK6A 1E32A 1FJGM 3FUXA 4L16A 5FTMA 1WHCA 4F2LA 4LJ9A 8CATA 2KRUA 3K9OA 4IBBA 1WGNA 1DGHA 2JY6B 2R45A 2D7EA 3J2PB 5KQ8A 4JN6A 4UN2B 5BR8M 1OJLA 3LCUA 1QAMA 3FRIA 2DAEA 4R71A 4PCZA 5EQTA 2QNJA 4QHTA 1NJGA 3LVWA 1XHBA 3GRRA 3SARA 2DKLA 3SYKA 3U6MA 1GL7A 4LFAM 4S12A 1IM2A 2XF3A 4A3VB 2H1RA 4DUYM 3SBJA 5A2QS 3U60B 3SASA 2ZBKB 4LF7M 2R0IA 2YQZA 4NOOB 1BVSA 3U6PA 3TWKA 3AKZA 3MMPA 3FYCA 3E21A 2G3QA 3OTOM 4LF4M 4DV2M 4REZA 1OAIA 1ZAEA 3HU2A 3C58A 1K82A 3KS4A 2OQ4A 4GC9A 4DR6M 4LJ8A 2D7HA 4AKGA 3U6QA 2O5RA 2MROB 1Z5AA 2C99A 3B7NA 3TWMA 3T1HM 3NBXX 3GLFA 3MHVC 1K3WA 2HHHM 3F92A 3T6PA 4X66M 2JY5A 1SG9A 1VDLA 2K47A 2KNZA 3J81S 3U5ZA 2FH0A 2HL7A 3BXWA 4BLCA 4L4UA 5BPVA 3HJ8A 2JP7A 4MH0E 4RNAA 2F5SA 4QOZC 2KDLA 4QNRA 1KSFX 3GLFE 4PD2A 4DV0M 2XH9A 4DR3M 4GHLA 5EXPA 4DV5M 3V76A 4IJFA 3PXGA 3I51A 4AKHA 2R4EA 4LGYA 1TH4A 3D8BA 4JI5M 2BJVA 1NV8A 1OAOC 1P3QQ 3I01M 4XK8F 1ZMVA 4JI2M 3FKEA 1R6BX 1N75A 2XFSA 5FTKA 4PT5A 2EJSA 2C9OA 5KQDA 3U61A 4Q7JA 1L8QA 1T3TA 4FCWA 4FVMA 1ZQ9A 1R5LA 2YNMD 2KZSA 3CF2A 1ZMWA 3GRVA 3GP1A 4G6ZA 4LZJA 4OVZA 1AIPC 4BBAA 1NV9A 3Q8XA 2CHGA 1L1TA 3A42A 5IREB 3ZH9B 2QBYA 3SMSA 4G4RA 2MGWA 2LBCA 3CGWA 4FWHA 4B7GA 4XBOA 1PJIA 2XZUA 3QYBA 1E94E 2LWXA 2QENA 3C9PA 3TWLA 1MN3A 5FTLA 1YLAA 4DR5M 2LHCA 2RGOA 3I04M 1GJSA 4JYAM 1NJFA 2L7HA 1NO1A 2MH8A 3GQ5A 1T43A 1TTEA 4B3SM 1JR3A 2G5GX 2R18A 5DNYA 2QZ4A 2GNOA 4KLNA 3EIHA 1QAOA 1V92A 3U5ZB 3RGSA 1S3SA 1JR3E 2CRUA 3AJIB 4QNMA 1V34A 3LMMA 2R44A 2JY7A 2KXEA 3L26A 5FTNA 1T6OA 2DHYA 3GRUA 1XMQM 1VEGA 2EO2A 4MGIE 1QVRA 4GKJM 3SATA 1HQCA 2DVWB 2DAGA 1JB0F 1GJTA 5EP4A 5DFLA 2BJWA 3LCVB 1J5EM 1J09A 1N77A 3VKHA 1IFYA 1LTMA 3LQRA 3U61B 1YE9A 4M0DA 1N34M 1WIVA 3SFZA 2F5PA 1WGLA 2M5ZA 4M9SA 2CUZA 4DV4M 4B3MM 1OTRA 4GEWA 4JV5M 1EIJA 2Z3XA 1UFZA 2V6ZM 3HHWA 1NNUC 4I8OA 4NRVA 2K6BA 1TF0B 2LXEA 1VDDA 5FTJA 1JR3D 3KOYE 1N32M 2J7OA 1QDRA 3FYDA 2KHHA 5KO3A 2XFTA 1OKSA 1ZV1A 1L2BA 3RFWA 1G41A 1E9RA 1OFIA 2JXNA 2KA6B 3GPPA 2N35A 1YUBA 3FUVA 3KSXA 2DZLA 2V1CA 3KVWA 4FD2A 4HL4A 1NHGC 2XSZA 4IBDA 4WW0A 2UXCM 2B3TA 3M6AA 3SHGB 3WHLA 3TE6A 3L29A 4IBFA 2C96A 2DENA 2CHQA 4M0WA 4I5SA
chains in the Genus database with same CATH topology
3U6DA 4LJ7A 3J7AS 2HCBA 1G59A 4PDIA 3THGA 4IBEA 2FE8A 3GRYA 1LV7A 3R8FA 1IN8A 1N36M 2ZAMA 2F5OA 2UUAM 1FNNA 1IQPA 2VQEM 3T1YM 4JI6M 1TH3A 4AW4A 4TUWA 3L25A 3AOEA 3TL4X 1C1KA 4G4QA 4NXMM 5JI2E 3L2AA 1QYRA 3T15A 3SAWA 3KP1E 3UMMA 2XSZD 4DR7M 4LF5M 2LH0A 1DO0A 4GIPA 4M9ZA 4MGZE 5ITUA 2OPFA 3VK7A 2DZNB 3GLHA 2CE7A 2KZUA 4AI6A 3E4RA 4AZFA 3GQ3A 3BOSA 1SXJA 1UM8A 1QZMA 4JXJA 4AKIA 2F5NA 4DUZM 3ZC7B 4NRWA 2KEBA 5KPTA 1IN6A 4AQYM 2QP9X 1SXJE 2X4AA 4RF1A 5E6JA 1MX0A 3QAUA 3KP0E 1XMOM 4LGMA 4K0KM 1QANA 3TPZA 4QOSA 3KS8A 2EA0A 4B3RM 3AOGA 2AHMA 4LRTA 1H6UA 3CTWB 4GC5A 2UXBM 2L7IA 1WXQA 2I7NA 5GKNA 2F5QA 3KDSE 3PFIA 1G8PA 4FCVA 1NY5A 4DV3M 4L8RC 1I94M 1IXSB 4OU7A 4DR1M 4I81A 3FUUA 3SAUA 4CGYB 4LF8M 3VK8A 1SXJD 1GVNA 4LRSA 4R3DA 4JI3M 1HNWM 4GRIA 2C9CA 2FOIC 3RGPA 2LNHC 3WHKA 1I4WA 1Z6TA 3A46A 4NSOB 3KXEC 3SC3A 4D81A 3GLIA 1PJJA 1IY1A 1XWIA 4LFBM 2HKJA 1XXHB 5ITYA 3GLHB 1D2NA 3D8LA 2V1UA 4LF9M 3LVVA 2ZM6M 3GO8A 1SXJB 2XZFA 4JI8M 3SMPA 1Z5CA 3NWLA 1TDZA 3DA1A 1Z5BA 4Z8XA 1L2DA 4IBJA 1NNJA 4G4NA 1HT1E 2DHRA 5ITQA 3T38A 1IN7A 4LJ6A 3AFHA 4DR4M 1NY6A 3HKPA 3DFZA 3A45A 2R62A 4NL4H 1IXZA 4DV7M 4KODA 3HHXA 1IN5A 3B9PA 3HHZA 2DZOB 4LY6A 3VFDA 2DXIA 1HR0M 2Z7JA 3K92A 2ZANA 2G8LA 2D7GA 2Y0TA 3CF6E 5IWAM 3GPXA 2P5TA 3U6OA 1MU5A 5F3WA 3HJSA 3HWSA 2BNKA 5E26A 3JR4A 1KFVA 3CF0A 3VDPA 3FTEA 1DGGA 4ITQA 3GLIB 4G4OA 1X37A 3HU3A 5C18A 4KO8A 2UU9M 3FUTA 1TGUA 2UUCM 4GH9A 4BB9A 1R2YA 3HU1A 4ZPXA 3U6SA 1HNZM 5DYGA 3PNVA 3VLFB 3SYLA 5JI3E 2UUBM 4LCBA 1L1ZA 2EUCA 4LJAA 1EE8A 2NQ8C 1Q3CA 2CHVA 2Z4SA 2Z4RA 2L6OA 2E5LM 5ITXA 2VIIA 4JI0M 3SAVA 2A5YB 2X8AA 3J27B 3L28A 3AOEC 3NBIA 2KW0A 1OFHA 2Y0QA 2Y20A 4RF0A 4IBGA 4PDGA 1HT2E 5KPZA 4MGYE 4GITA 1Q39A 4B08A 2C98A 4X65M 5KPRA 5EP1A 5IZ7D 3U6LA 1XNRM 4FW9A 3GLGA 4IJEA 4X62M 1NHWC 1XXHA 1QQWA 3W0FA 2VQFM 1N33M 1SXJC 5EXXA 3PNYA 5EP3A 3QWLA 2DWLA 3UZUA 1K3XA 3I4VA 3KOWE 4W5WA 2C5RA 3VDUA 2R4JA 3DOAA 4CHTB 4FWGA 1W5SA 3EIEA 3ILKA 3E9SA 4NSRA 1IY0A 3AL0C 1Z59A 3HJQA 4L15A 3ZCBB 1PM5A 3IG5A 2Q2EB 3RE8A 4B7HA 3J7BA 1N78A 1GL6A 3TQSA 4D80A 2F4VM 3JAMS 1DGBA 4AG5A 2RGHA 3AV0A 4IBIA 5FSWA 3H4MA 3K1JA 3W0LB 1W5TA 3PVSA 4GHAA 1TDHA 5DYIA 1QAQA 2XEPA 2DWZB 7CATA 1GKIA 1ORYB 4B7FA 3GLGB 4OW0A 2R46A 4IIWA 2RKOA 4L78A 3UGJA 3GPUA 2UXDM 5IT9S 4LJ5A 4IBKA 4R7GA 4DR2M 3GPYA 1E9SA 2J7NA 4FWDA 1IY2A 3LQQA 1DO2A 3JR5A 2XGNA 3FUWA 1HQYE 1DGHB 1IXRC 2Y21A 4I4LA 1KYIA 2DWNA 4LZZA 2CEAA 3KW6A 1JQJC 3M0EA 1IN4A 5EXSA 3KFUG 3R9XB 4EIWA 1IBKM 1NVMA 3M7GA 1R2ZA 3A98B 4WURA 3VKGA 4DV6M 3KOZE 1Q3BA 2QCUA 3HHYA 1IBMM 5C1BA 1TH2A 3IG8A 2XLJA 4LFCM 1DGFA 2R65A 4MB7A 4JI1M 2X49A 4QHSA 3UK6A 4LJ4A 3GLFB 5LMUM 4MGKE 4LF6M 5ITTA 4JI4M 2JA2A 3U6CA 4M9XA 2L09A 4JI7M 5EJCA 3DZDA 4B3TM 5EP2A 3SHFA 1IBLM 4OX9M 2FFJA 3J80S 1YSYA 4HLQA 4P16A 1XNQM 3FTCA 2ERCA 4MGHA 3KOXE 3K2LA 2W82A 2QPAA 3I4YA 3U6EA 3GQ4A 4GKKM 3U60A 4XGIA 3FD9A 4OVZB 5EXTA 1L2CA 4KHPM 3HGIA 2QBYB 5FLXS 5LMNM 1XC8A 4DV1M 1NSFA 4Z6YA 2CV1A 2FNAA 1J7KA 1G3IA 2YFQA 4GMQA 3UJNA 2M60A 3L27A 4II7A 4CISA 4NXNM 5ITXE 3MJ5A 4AG6A 2CFOA 1GLNA 2YR0A 2CV2A 4X64M 3K8ZA 1HNXM 3KSJA 4YY3M 1G4AE 5ITRA 3FTDA 2KRKA 5H37D 4YHHM 3FTFA 4LG2A 2I7PA 4D82A 1R7RA 4FCTA 2CV0A 2ZAOA 2DWMA 4IBCA 1FJGM 3MK6A 1E32A 3FUXA 4L16A 5FTMA 4LJ9A 8CATA 2KRUA 4IBBA 1DGHA 2R45A 3J2PB 2D7EA 5KQ8A 4JN6A 5BR8M 1OJLA 1QAMA 4PCZA 5EQTA 4QHTA 1NJGA 3LVWA 1XHBA 3GRRA 3SARA 3SYKA 3U6MA 1GL7A 4LFAM 4S12A 1IM2A 2XF3A 4A3VB 2H1RA 4DUYM 3SBJA 5A2QS 3U60B 3SASA 2ZBKB 4LF7M 2YQZA 4NOOB 3U6PA 3TWKA 3AKZA 3FYCA 3OTOM 4LF4M 4DV2M 4REZA 1ZAEA 3HU2A 3C58A 1K82A 3KS4A 2OQ4A 4GC9A 4DR6M 4LJ8A 2D7HA 4AKGA 3U6QA 2O5RA 1Z5AA 2C99A 3T1HM 3TWMA 3GLFA 3MHVC 1K3WA 2HHHM 4X66M 3J81S 2K47A 3U5ZA 4BLCA 2HL7A 4L4UA 5BPVA 3HJ8A 4MH0E 4RNAA 2F5SA 4QOZC 4QNRA 1KSFX 4PD2A 4DV0M 2XH9A 4DR3M 4GHLA 5EXPA 4DV5M 4IJFA 3PXGA 3I51A 4AKHA 2R4EA 4LGYA 1TH4A 3D8BA 4JI5M 2BJVA 4JI2M 3FKEA 1R6BX 1N75A 2XFSA 5FTKA 4PT5A 2C9OA 5KQDA 3U61A 1L8QA 1T3TA 4FCWA 4FVMA 1ZQ9A 2YNMD 2KZSA 3CF2A 3GRVA 3GP1A 4G6ZA 4LZJA 4OVZA 4BBAA 3Q8XA 1L1TA 2CHGA 3A42A 5IREB 3ZH9B 2QBYA 3SMSA 4G4RA 4FWHA 4B7GA 4XBOA 1PJIA 2XZUA 1E94E 2LWXA 2QENA 3TWLA 5FTLA 4DR5M 2RGOA 4JYAM 1NJFA 2L7HA 3GQ5A 4B3SM 1JR3A 2G5GX 2R18A 5DNYA 2QZ4A 4KLNA 3EIHA 1QAOA 3U5ZB 3RGSA 1S3SA 3AJIB 4QNMA 3LMMA 2KXEA 3L26A 5FTNA 3GRUA 1XMQM 2EO2A 4MGIE 1QVRA 4GKJM 3SATA 1HQCA 2DVWB 5EP4A 2BJWA 1J5EM 1J09A 1N77A 3VKHA 3LQRA 3U61B 1YE9A 4M0DA 1N34M 3SFZA 2F5PA 4B3MM 2M5ZA 4JV5M 4M9SA 2CUZA 4DV4M 2Z3XA 2V6ZM 3HHWA 1NNUC 4I8OA 4NRVA 2LXEA 1VDDA 5FTJA 1JR3D 3KOYE 1N32M 2J7OA 3FYDA 5KO3A 2XFTA 1L2BA 3RFWA 1G41A 1E9RA 1OFIA 2KA6B 3GPPA 1YUBA 3KVWA 3KSXA 3FUVA 2V1CA 4FD2A 4HL4A 4IBDA 1NHGC 2XSZA 4WW0A 2UXCM 3M6AA 3WHLA 3SHGB 3TE6A 3L29A 4IBFA 2C96A 4MM3B 2CHQA 4M0WA 4I5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6D A;  3OTO M;  4LF4 M;  4DV2 M;  3J7A S;  3JR5 A;  3C58 A;  5IWA M;  1K82 A;  3GPX A;  2OQ4 A;  4DR6 M;  4PDI A;  3U6Q A;  3U6O A;  1Z5A A;  1MU5 A;  3T1H M;  3TWM A;  1IBK M;  1N36 M;  3JR4 A;  1K3W A;  1KFV A;  4X66 M;  3J81 S;  2F5O A;  2HHH M;  2UUA M;  2VQE M;  3T1Y M;  4JI6 M;  2F5S A;  4ITQ A;  1R2Z A;  4G4O A;  4G4Q A;  4PD2 A;  4DV0 M;  4NXM M;  4DV6 M;  4DR3 M;  2UU9 M;  4DV5 M;  1Q3B A;  2UUC M;  1IBM M;  1R2Y A;  3U6S A;  4LFC M;  3SAW A;  1HNZ M;  4JI5 M;  4MB7 A;  4JI1 M;  2UUB M;  4DR7 M;  4LF5 M;  1L1Z A;  4JI2 M;  5ITU A;  5LMU M;  3VK7 A;  2OPF A;  4LF6 M;  5ITT A;  4JI4 M;  1EE8 A;  1Q3C A;  3U6C A;  4JI7 M;  2E5L M;  3GP1 A;  5ITX A;  4B3T M;  3GQ3 A;  4JI0 M;  3SAV A;  1L1T A;  1IBL M;  4OX9 M;  3A42 A;  2F5N A;  4DUZ M;  4NRW A;  3J80 S;  4G4R A;  1XNQ M;  4AQY M;  1PJI A;  2XZU A;  1MX0 A;  3TWL A;  1XMO M;  4PDG A;  4K0K M;  3U6E A;  4DR5 M;  1Q39 A;  3GQ4 A;  4X65 M;  2EA0 A;  4JYA M;  4B3R M;  3U6L A;  1XNR M;  4GKK M;  3GQ5 A;  4KHP M;  1L2C A;  4B3S M;  4X62 M;  2UXB M;  3W0F A;  5FLX S;  5LMN M;  1XC8 A;  4DV1 M;  2F5Q A;  2VQF M;  4DV3 M;  1N33 M;  1I94 M;  4DR1 M;  4LF8 M;  1K3X A;  3SAU A;  3VK8 A;  4CIS A;  3DOA A;  1XMQ M;  4JI3 M;  4NXN M;  5ITX E;  1HNW M;  4GKJ M;  3SAT A;  4X64 M;  3A46 A;  1HNX M;  1J5E M;  4YY3 M;  1PJJ A;  5ITR A;  4LFB M;  2HKJ A;  5ITY A;  1N34 M;  2F5P A;  4B3M M;  4YHH M;  1Z59 A;  4JV5 M;  4DV4 M;  4LF9 M;  1PM5 A;  2ZM6 M;  3GO8 A;  2Q2E B;  4NRV A;  2XZF A;  4JI8 M;  1FJG M;  1Z5C A;  3JAM S;  2F4V M;  1TDZ A;  1Z5B A;  1N32 M;  1L2D A;  1NNJ A;  4G4N A;  5ITQ A;  5BR8 M;  1L2B A;  4PCZ A;  4DR4 M;  1TDH A;  3SAR A;  3A45 A;  3GPP A;  4DV7 M;  3U6M A;  4LFA M;  3SBJ A;  2UXC M;  4DUY M;  5A2Q S;  4LF7 M;  3SAS A;  2ZBK B;  1HR0 M;  2UXD M;  5IT9 S;  3GPU A;  3U6P A;  3TWK A;  4DR2 M;  3GPY A; 
#chains in the Genus database with same CATH topology
 3U6D A;  1XB2 B;  4LJ7 A;  3J7A S;  2O01 F;  2HCB A;  1G59 A;  1WJ7 A;  4PDI A;  3THG A;  4IBE A;  2FE8 A;  2MJ5 B;  4HEO A;  3GRY A;  1LV7 A;  3R8F A;  1IN8 A;  1N36 M;  2BWB A;  2ZAM A;  3QYE A;  2F5O A;  2UUA M;  1GO5 A;  1FNN A;  1IQP A;  3FE3 A;  2VQE M;  3T1Y M;  4JI6 M;  1TH3 A;  4AW4 A;  4TUW A;  3L25 A;  3AOE A;  3TL4 X;  1IXS A;  1C1K A;  4G4Q A;  4NXM M;  5JI2 E;  1EFU B;  3L2A A;  1QYR A;  2Z8Y M;  3T15 A;  3SAW A;  3KP1 E;  3UMM A;  2XSZ D;  2DAM A;  4DR7 M;  4LF5 M;  2LH0 A;  1DO0 A;  4F1I A;  4GIP A;  4M9Z A;  4MGZ E;  5ITU A;  2OPF A;  3VK7 A;  2DZN B;  2CE7 A;  3GLH A;  2KZU A;  1PRB A;  4AI6 A;  3E4R A;  1VEK A;  2LVN C;  1ZMU A;  4AZF A;  3GQ3 A;  3BOS A;  1SXJ A;  1UM8 A;  1QZM A;  4JXJ A;  3W67 A;  1QDT A;  4AKI A;  3GLH E;  2F5N A;  4DUZ M;  3ZC7 B;  4NRW A;  2KEB A;  5KPT A;  1IN6 A;  4AQY M;  2QP9 X;  1SXJ E;  2CWB A;  2X4A A;  4RF1 A;  3C3D A;  5E6J A;  1MX0 A;  1TR8 A;  3QAU A;  3KP0 E;  1XMO M;  4LGM A;  4K0K M;  1QAN A;  1PGY A;  3TPZ A;  4QOS A;  3KS8 A;  3B89 A;  2EA0 A;  4B3R M;  3AOG A;  2AHM A;  1F4I A;  4LRT A;  1H6U A;  3CTW B;  3BBZ A;  4GC5 A;  2UXB M;  2L7I A;  1WXQ A;  2I7N A;  5GKN A;  2F5Q A;  3KDS E;  1GAB A;  3PFI A;  1G8P A;  4FCV A;  4CIZ A;  1NY5 A;  2ZTD A;  4DV3 M;  4L8R C;  1I94 M;  1IXS B;  4OU7 A;  4DR1 M;  4I81 A;  3FUU A;  3SAU A;  4CGY B;  4LF8 M;  3VK8 A;  1SXJ D;  3K9P A;  1GVN A;  4LRS A;  4R3D A;  4JI3 M;  1HNW M;  2DNA A;  4GRI A;  2C9C A;  2FOI C;  3RGP A;  2APL A;  2LNH C;  1CUK A;  3WHK A;  1G71 A;  3E46 A;  1I4W A;  1Z6T A;  3A46 A;  4NSO B;  3KXE C;  2DAI A;  3SC3 A;  4D81 A;  3GLI A;  1IY1 A;  1XWI A;  1Y8G A;  2HKJ A;  1PJJ A;  4LFB M;  1XXH B;  5ITY A;  1D0M A;  3GLH B;  1D2N A;  1Q02 A;  3D8L A;  2V1U A;  3LVV A;  4LF9 M;  2LHG A;  2ZM6 M;  3GO8 A;  2JNH A;  1SXJ B;  2XZF A;  1OQY A;  4JI8 M;  2BWE A;  3SMP A;  1Z5C A;  3NWL A;  1TDZ A;  3DA1 A;  1Z5B A;  4Z8X A;  1L2D A;  3B7Q A;  4IBJ A;  1NNJ A;  4G4N A;  1HT1 E;  2DHR A;  5ITQ A;  3T38 A;  1IN7 A;  1PJQ A;  4LJ6 A;  3AFH A;  4DR4 M;  1NY6 A;  2OO9 A;  3FRH A;  3HKP A;  3DFZ A;  3A45 A;  2R62 A;  4NL4 H;  1IXZ A;  4DV7 M;  4KOD A;  1IN5 A;  3HHX A;  3B9P A;  3HHZ A;  2DZO B;  4LY6 A;  2DAK A;  3VFD A;  2DXI A;  1HR0 M;  2Z7J A;  2ZAN A;  3K92 A;  2G8L A;  2D7G A;  2Y0T A;  1D0L A;  3CF6 E;  5IWA M;  3GPX A;  4DBG B;  2JWS A;  2LVA A;  2P5T A;  2JY8 A;  2QQ8 A;  3HX3 A;  3U6O A;  1MU5 A;  5F3W A;  3HJS A;  3HWS A;  2BNK A;  2JUJ A;  5E26 A;  3W68 A;  3JR4 A;  1KFV A;  3CF0 A;  3VDP A;  3FTE A;  1DGG A;  1V33 A;  1OIZ A;  4ITQ A;  4RKU F;  3GLI B;  4G4O A;  1X37 A;  3HU3 A;  2VDB B;  4KO8 A;  5C18 A;  2UU9 M;  3FUT A;  1TGU A;  2UUC M;  4GH9 A;  4BB9 A;  1R2Y A;  3HU1 A;  2MR9 A;  4ZPX A;  3U6S A;  1HNZ M;  5DYG A;  3PNV A;  5L8R F;  2ZTC A;  3VLF B;  3SYL A;  5JI3 E;  2UUB M;  4LCB A;  1L1Z A;  2EUC A;  2WSC F;  4LJA A;  4Y28 F;  1QUT A;  1EE8 A;  2NQ8 C;  1Q3C A;  2CHV A;  2Z4S A;  2FS1 A;  2Z4R A;  2L6O A;  2E5L M;  5ITX A;  2VII A;  4JI0 M;  3SAV A;  2A5Y B;  2X8A A;  3J27 B;  3L28 A;  1RU3 A;  3AOE C;  3ZQJ A;  3HZJ A;  1WR1 B;  3NBI A;  2KW0 A;  1OFH A;  2Y0Q A;  2Y20 A;  4RF0 A;  4IBG A;  2L4E A;  4PDG A;  1HT2 E;  5KPZ A;  4MGY E;  4GIT A;  1Q39 A;  2JZ0 A;  4B08 A;  2C98 A;  4ANR A;  5KPR A;  4X65 M;  5EP1 A;  5IZ7 D;  3U6L A;  2WSE F;  1XNR M;  4FW9 A;  3GLG A;  4IJE A;  1D0K A;  4X62 M;  1NHW C;  1DV0 A;  1XXH A;  1QQW A;  3W0F A;  2LVQ D;  3GLG E;  2LTU A;  2VQF M;  2DI0 A;  1N33 M;  1SXJ C;  5EXX A;  3PNY A;  5EP3 A;  3QWL A;  2DWL A;  3UZU A;  1K3X A;  3I4V A;  1XXH E;  3KOW E;  4W5W A;  4CJ6 A;  2C5R A;  3VDU A;  2R4J A;  3DOA A;  4CHT B;  4FWG A;  1W5S A;  3EIE A;  3ILK A;  3E9S A;  2HAK A;  4NSR A;  1IY0 A;  3AL0 C;  2K0B X;  1Z59 A;  3HJQ A;  4L15 A;  3ZCB B;  1QUS A;  1PM5 A;  3IG5 A;  2Q2E B;  3RE8 A;  2WZJ A;  2WSF F;  4B7H A;  3Q8G A;  3J7B A;  2LVO C;  1N78 A;  1GL6 A;  3TQS A;  4D80 A;  2F4V M;  3JAM S;  1DGB A;  3H4J A;  4AG5 A;  2RGH A;  3AV0 A;  4IBI A;  5FSW A;  3H4M A;  3K1J A;  3W0L B;  1PJT A;  1W5T A;  3PVS A;  1OIP A;  2OOB A;  1TDH A;  4GHA A;  2VF8 A;  5DYI A;  1QAQ A;  2XEP A;  3C3E A;  2DWZ B;  7CAT A;  2H5X A;  1GKI A;  1ORY B;  4B7F A;  1VQ1 A;  2EKK A;  4OW0 A;  3GLG B;  2CP8 A;  2R46 A;  4IIW A;  2RKO A;  4L78 A;  3UGJ A;  3GPU A;  2UXD M;  5IT9 S;  1AUA A;  4LJ5 A;  4IBK A;  4R7G A;  4DR2 M;  2R6F A;  3GPY A;  1E9S A;  2J7N A;  4FWD A;  1IY2 A;  2RRU A;  3LQQ A;  1DO2 A;  3IEC A;  3JR5 A;  3HY5 A;  2XGN A;  2EKF A;  3FUW A;  1HQY E;  1DGH B;  1IXR C;  2Y21 A;  4I4L A;  1KYI A;  2HWJ A;  3GLI E;  2DWN A;  4LZZ A;  2CEA A;  3KW6 A;  1JQJ C;  1R4G A;  3M0E A;  1IN4 A;  5EXS A;  3KFU G;  3LW5 F;  3R9X B;  4G3O A;  4EIW A;  1IBK M;  1NVM A;  3M7G A;  1R2Z A;  2L4F A;  3A98 B;  4WUR A;  3VKG A;  4DV6 M;  3KOZ E;  1Q3B A;  2J5Y A;  2QCU A;  3HHY A;  1IBM M;  5C1B A;  1TH2 A;  3IG8 A;  2XLJ A;  4LFC M;  1DGF A;  2R65 A;  1MJG M;  4MB7 A;  4JI1 M;  2X49 A;  1QZE A;  4QHS A;  3UK6 A;  4LJ4 A;  3GLF B;  5LMU M;  4MGK E;  4LF6 M;  5ITT A;  4JI4 M;  4L6V 6;  2JA2 A;  3U6C A;  4M9X A;  2L09 A;  4JI7 M;  5EJC A;  3DZD A;  4B3T M;  5EP2 A;  3SHF A;  1IBL M;  4OX9 M;  2FFJ A;  2K9D A;  3J80 S;  1YSY A;  4HLQ A;  4P16 A;  1XNQ M;  3FTC A;  2ERC A;  4MGH A;  4MM3 B;  1C7Y A;  3KOX E;  3K2L A;  2W82 A;  2QPA A;  3I4Y A;  4KT0 F;  3U6E A;  3GQ4 A;  4GKK M;  3U60 A;  2O25 A;  4XGI A;  3FD9 A;  2QSF X;  4OVZ B;  4P17 A;  3IHP A;  5EXT A;  3HGI A;  1L2C A;  4KHP M;  2QBY B;  5FLX S;  5LMN M;  2L2D A;  1XC8 A;  4DV1 M;  1NSF A;  4Z6Y A;  2CV1 A;  2FNA A;  1J7K A;  1G3I A;  2LVP C;  2YFQ A;  4GMQ A;  3UJN A;  2KNA A;  1HJP A;  2OOA A;  2M60 A;  3L27 A;  2JZ1 A;  4II7 A;  4CIS A;  4WP2 A;  4NXN M;  5ITX E;  3MJ5 A;  4AG6 A;  2CFO A;  3B7Z A;  1GLN A;  2YR0 A;  2CV2 A;  4X64 M;  3K8Z A;  1HNX M;  3KSJ A;  4YY3 M;  1G4A E;  5ITR A;  3FTD A;  2KRK A;  5H37 D;  2QHO B;  1A5T A;  4YHH M;  3FTF A;  4LG2 A;  2VF7 A;  3B74 A;  2KNV A;  4NC6 A;  2I7P A;  1PJS A;  4D82 A;  1R7R A;  1VG5 A;  4FCT A;  2CV0 A;  2ZAO A;  2DWM A;  2GQF A;  4IBC A;  1VEJ A;  3MK6 A;  1E32 A;  1FJG M;  3FUX A;  4L16 A;  5FTM A;  1WHC A;  4F2L A;  4LJ9 A;  8CAT A;  2KRU A;  3K9O A;  4IBB A;  1WGN A;  1DGH A;  2JY6 B;  2R45 A;  2D7E A;  3J2P B;  5KQ8 A;  4JN6 A;  4UN2 B;  5BR8 M;  1OJL A;  3LCU A;  1QAM A;  3FRI A;  2DAE A;  4R71 A;  4PCZ A;  5EQT A;  2QNJ A;  4QHT A;  1NJG A;  3LVW A;  1XHB A;  3GRR A;  3SAR A;  2DKL A;  3SYK A;  3U6M A;  1GL7 A;  4LFA M;  4S12 A;  1IM2 A;  2XF3 A;  4A3V B;  2H1R A;  4DUY M;  3SBJ A;  5A2Q S;  3U60 B;  3SAS A;  2ZBK B;  4LF7 M;  2R0I A;  2YQZ A;  4NOO B;  1BVS A;  3U6P A;  3TWK A;  3AKZ A;  3MMP A;  3FYC A;  3E21 A;  2G3Q A;  3OTO M;  4LF4 M;  4DV2 M;  4REZ A;  1OAI A;  1ZAE A;  3HU2 A;  3C58 A;  1K82 A;  3KS4 A;  2OQ4 A;  4GC9 A;  4DR6 M;  4LJ8 A;  2D7H A;  4AKG A;  3U6Q A;  2O5R A;  2MRO B;  1Z5A A;  2C99 A;  3B7N A;  3TWM A;  3T1H M;  3NBX X;  3GLF A;  3MHV C;  1K3W A;  2HHH M;  3F92 A;  3T6P A;  4X66 M;  2JY5 A;  1SG9 A;  1VDL A;  2K47 A;  2KNZ A;  3J81 S;  3U5Z A;  2FH0 A;  2HL7 A;  3BXW A;  4BLC A;  4L4U A;  5BPV A;  3HJ8 A;  2JP7 A;  4MH0 E;  4RNA A;  2F5S A;  4QOZ C;  2KDL A;  4QNR A;  1KSF X;  3GLF E;  4PD2 A;  4DV0 M;  2XH9 A;  4DR3 M;  4GHL A;  5EXP A;  4DV5 M;  3V76 A;  4IJF A;  3PXG A;  3I51 A;  4AKH A;  2R4E A;  4LGY A;  1TH4 A;  3D8B A;  4JI5 M;  2BJV A;  1NV8 A;  1OAO C;  1P3Q Q;  3I01 M;  4XK8 F;  1ZMV A;  4JI2 M;  3FKE A;  1R6B X;  1N75 A;  2XFS A;  5FTK A;  4PT5 A;  2EJS A;  2C9O A;  5KQD A;  3U61 A;  4Q7J A;  1L8Q A;  1T3T A;  4FCW A;  4FVM A;  1ZQ9 A;  1R5L A;  2YNM D;  2KZS A;  3CF2 A;  1ZMW A;  3GRV A;  3GP1 A;  4G6Z A;  4LZJ A;  4OVZ A;  1AIP C;  4BBA A;  1NV9 A;  3Q8X A;  2CHG A;  1L1T A;  3A42 A;  5IRE B;  3ZH9 B;  2QBY A;  3SMS A;  4G4R A;  2MGW A;  2LBC A;  3CGW A;  4FWH A;  4B7G A;  4XBO A;  1PJI A;  2XZU A;  3QYB A;  1E94 E;  2LWX A;  2QEN A;  3C9P A;  3TWL A;  1MN3 A;  5FTL A;  1YLA A;  4DR5 M;  2LHC A;  2RGO A;  3I04 M;  1GJS A;  4JYA M;  1NJF A;  2L7H A;  1NO1 A;  2MH8 A;  3GQ5 A;  1T43 A;  1TTE A;  4B3S M;  1JR3 A;  2G5G X;  2R18 A;  5DNY A;  2QZ4 A;  2GNO A;  4KLN A;  3EIH A;  1QAO A;  1V92 A;  3U5Z B;  3RGS A;  1S3S A;  1JR3 E;  2CRU A;  3AJI B;  4QNM A;  1V34 A;  3LMM A;  2R44 A;  2JY7 A;  2KXE A;  3L26 A;  5FTN A;  1T6O A;  2DHY A;  3GRU A;  1XMQ M;  1VEG A;  2EO2 A;  4MGI E;  1QVR A;  4GKJ M;  3SAT A;  1HQC A;  2DVW B;  2DAG A;  1JB0 F;  1GJT A;  5EP4 A;  5DFL A;  2BJW A;  3LCV B;  1J5E M;  1J09 A;  1N77 A;  3VKH A;  1IFY A;  1LTM A;  3LQR A;  3U61 B;  1YE9 A;  4M0D A;  1N34 M;  1WIV A;  3SFZ A;  2F5P A;  1WGL A;  2M5Z A;  4M9S A;  2CUZ A;  4DV4 M;  4B3M M;  1OTR A;  4GEW A;  4JV5 M;  1EIJ A;  2Z3X A;  1UFZ A;  2V6Z M;  3HHW A;  1NNU C;  4I8O A;  4NRV A;  2K6B A;  1TF0 B;  2LXE A;  1VDD A;  5FTJ A;  1JR3 D;  3KOY E;  1N32 M;  2J7O A;  1QDR A;  3FYD A;  2KHH A;  5KO3 A;  2XFT A;  1OKS A;  1ZV1 A;  1L2B A;  3RFW A;  1G41 A;  1E9R A;  1OFI A;  2JXN A;  2KA6 B;  3GPP A;  2N35 A;  1YUB A;  3FUV A;  3KSX A;  2DZL A;  2V1C A;  3KVW A;  4FD2 A;  4HL4 A;  1NHG C;  2XSZ A;  4IBD A;  4WW0 A;  2UXC M;  2B3T A;  3M6A A;  3SHG B;  3WHL A;  3TE6 A;  3L29 A;  4IBF A;  2C96 A;  2DEN A;  2CHQ A;  4M0W A;  4I5S A; 
#chains in the Genus database with same CATH homology
 3U6D A;  4LJ7 A;  3J7A S;  2HCB A;  1G59 A;  4PDI A;  3THG A;  4IBE A;  2FE8 A;  3GRY A;  1LV7 A;  3R8F A;  1IN8 A;  1N36 M;  2ZAM A;  2F5O A;  2UUA M;  1FNN A;  1IQP A;  2VQE M;  3T1Y M;  4JI6 M;  1TH3 A;  4AW4 A;  4TUW A;  3L25 A;  3AOE A;  3TL4 X;  1C1K A;  4G4Q A;  4NXM M;  5JI2 E;  3L2A A;  1QYR A;  3T15 A;  3SAW A;  3KP1 E;  3UMM A;  2XSZ D;  4DR7 M;  4LF5 M;  2LH0 A;  1DO0 A;  4GIP A;  4M9Z A;  4MGZ E;  5ITU A;  2OPF A;  3VK7 A;  2DZN B;  3GLH A;  2CE7 A;  2KZU A;  4AI6 A;  3E4R A;  4AZF A;  3GQ3 A;  3BOS A;  1SXJ A;  1UM8 A;  1QZM A;  4JXJ A;  4AKI A;  2F5N A;  4DUZ M;  3ZC7 B;  4NRW A;  2KEB A;  5KPT A;  1IN6 A;  4AQY M;  2QP9 X;  1SXJ E;  2X4A A;  4RF1 A;  5E6J A;  1MX0 A;  3QAU A;  3KP0 E;  1XMO M;  4LGM A;  4K0K M;  1QAN A;  3TPZ A;  4QOS A;  3KS8 A;  2EA0 A;  4B3R M;  3AOG A;  2AHM A;  4LRT A;  1H6U A;  3CTW B;  4GC5 A;  2UXB M;  2L7I A;  1WXQ A;  2I7N A;  5GKN A;  2F5Q A;  3KDS E;  3PFI A;  1G8P A;  4FCV A;  1NY5 A;  4DV3 M;  4L8R C;  1I94 M;  1IXS B;  4OU7 A;  4DR1 M;  4I81 A;  3FUU A;  3SAU A;  4CGY B;  4LF8 M;  3VK8 A;  1SXJ D;  1GVN A;  4LRS A;  4R3D A;  4JI3 M;  1HNW M;  4GRI A;  2C9C A;  2FOI C;  3RGP A;  2LNH C;  3WHK A;  1I4W A;  1Z6T A;  3A46 A;  4NSO B;  3KXE C;  3SC3 A;  4D81 A;  3GLI A;  1PJJ A;  1IY1 A;  1XWI A;  4LFB M;  2HKJ A;  1XXH B;  5ITY A;  3GLH B;  1D2N A;  3D8L A;  2V1U A;  4LF9 M;  3LVV A;  2ZM6 M;  3GO8 A;  1SXJ B;  2XZF A;  4JI8 M;  3SMP A;  1Z5C A;  3NWL A;  1TDZ A;  3DA1 A;  1Z5B A;  4Z8X A;  1L2D A;  4IBJ A;  1NNJ A;  4G4N A;  1HT1 E;  2DHR A;  5ITQ A;  3T38 A;  1IN7 A;  4LJ6 A;  3AFH A;  4DR4 M;  1NY6 A;  3HKP A;  3DFZ A;  3A45 A;  2R62 A;  4NL4 H;  1IXZ A;  4DV7 M;  4KOD A;  3HHX A;  1IN5 A;  3B9P A;  3HHZ A;  2DZO B;  4LY6 A;  3VFD A;  2DXI A;  1HR0 M;  2Z7J A;  3K92 A;  2ZAN A;  2G8L A;  2D7G A;  2Y0T A;  3CF6 E;  5IWA M;  3GPX A;  2P5T A;  3U6O A;  1MU5 A;  5F3W A;  3HJS A;  3HWS A;  2BNK A;  5E26 A;  3JR4 A;  1KFV A;  3CF0 A;  3VDP A;  3FTE A;  1DGG A;  4ITQ A;  3GLI B;  4G4O A;  1X37 A;  3HU3 A;  5C18 A;  4KO8 A;  2UU9 M;  3FUT A;  1TGU A;  2UUC M;  4GH9 A;  4BB9 A;  1R2Y A;  3HU1 A;  4ZPX A;  3U6S A;  1HNZ M;  5DYG A;  3PNV A;  3VLF B;  3SYL A;  5JI3 E;  2UUB M;  4LCB A;  1L1Z A;  2EUC A;  4LJA A;  1EE8 A;  2NQ8 C;  1Q3C A;  2CHV A;  2Z4S A;  2Z4R A;  2L6O A;  2E5L M;  5ITX A;  2VII A;  4JI0 M;  3SAV A;  2A5Y B;  2X8A A;  3J27 B;  3L28 A;  3AOE C;  3NBI A;  2KW0 A;  1OFH A;  2Y0Q A;  2Y20 A;  4RF0 A;  4IBG A;  4PDG A;  1HT2 E;  5KPZ A;  4MGY E;  4GIT A;  1Q39 A;  4B08 A;  2C98 A;  4X65 M;  5KPR A;  5EP1 A;  5IZ7 D;  3U6L A;  1XNR M;  4FW9 A;  3GLG A;  4IJE A;  4X62 M;  1NHW C;  1XXH A;  1QQW A;  3W0F A;  2VQF M;  1N33 M;  1SXJ C;  5EXX A;  3PNY A;  5EP3 A;  3QWL A;  2DWL A;  3UZU A;  1K3X A;  3I4V A;  3KOW E;  4W5W A;  2C5R A;  3VDU A;  2R4J A;  3DOA A;  4CHT B;  4FWG A;  1W5S A;  3EIE A;  3ILK A;  3E9S A;  4NSR A;  1IY0 A;  3AL0 C;  1Z59 A;  3HJQ A;  4L15 A;  3ZCB B;  1PM5 A;  3IG5 A;  2Q2E B;  3RE8 A;  4B7H A;  3J7B A;  1N78 A;  1GL6 A;  3TQS A;  4D80 A;  2F4V M;  3JAM S;  1DGB A;  4AG5 A;  2RGH A;  3AV0 A;  4IBI A;  5FSW A;  3H4M A;  3K1J A;  3W0L B;  1W5T A;  3PVS A;  4GHA A;  1TDH A;  5DYI A;  1QAQ A;  2XEP A;  2DWZ B;  7CAT A;  1GKI A;  1ORY B;  4B7F A;  3GLG B;  4OW0 A;  2R46 A;  4IIW A;  2RKO A;  4L78 A;  3UGJ A;  3GPU A;  2UXD M;  5IT9 S;  4LJ5 A;  4IBK A;  4R7G A;  4DR2 M;  3GPY A;  1E9S A;  2J7N A;  4FWD A;  1IY2 A;  3LQQ A;  1DO2 A;  3JR5 A;  2XGN A;  3FUW A;  1HQY E;  1DGH B;  1IXR C;  2Y21 A;  4I4L A;  1KYI A;  2DWN A;  4LZZ A;  2CEA A;  3KW6 A;  1JQJ C;  3M0E A;  1IN4 A;  5EXS A;  3KFU G;  3R9X B;  4EIW A;  1IBK M;  1NVM A;  3M7G A;  1R2Z A;  3A98 B;  4WUR A;  3VKG A;  4DV6 M;  3KOZ E;  1Q3B A;  2QCU A;  3HHY A;  1IBM M;  5C1B A;  1TH2 A;  3IG8 A;  2XLJ A;  4LFC M;  1DGF A;  2R65 A;  4MB7 A;  4JI1 M;  2X49 A;  4QHS A;  3UK6 A;  4LJ4 A;  3GLF B;  5LMU M;  4MGK E;  4LF6 M;  5ITT A;  4JI4 M;  2JA2 A;  3U6C A;  4M9X A;  2L09 A;  4JI7 M;  5EJC A;  3DZD A;  4B3T M;  5EP2 A;  3SHF A;  1IBL M;  4OX9 M;  2FFJ A;  3J80 S;  1YSY A;  4HLQ A;  4P16 A;  1XNQ M;  3FTC A;  2ERC A;  4MGH A;  3KOX E;  3K2L A;  2W82 A;  2QPA A;  3I4Y A;  3U6E A;  3GQ4 A;  4GKK M;  3U60 A;  4XGI A;  3FD9 A;  4OVZ B;  5EXT A;  1L2C A;  4KHP M;  3HGI A;  2QBY B;  5FLX S;  5LMN M;  1XC8 A;  4DV1 M;  1NSF A;  4Z6Y A;  2CV1 A;  2FNA A;  1J7K A;  1G3I A;  2YFQ A;  4GMQ A;  3UJN A;  2M60 A;  3L27 A;  4II7 A;  4CIS A;  4NXN M;  5ITX E;  3MJ5 A;  4AG6 A;  2CFO A;  1GLN A;  2YR0 A;  2CV2 A;  4X64 M;  3K8Z A;  1HNX M;  3KSJ A;  4YY3 M;  1G4A E;  5ITR A;  3FTD A;  2KRK A;  5H37 D;  4YHH M;  3FTF A;  4LG2 A;  2I7P A;  4D82 A;  1R7R A;  4FCT A;  2CV0 A;  2ZAO A;  2DWM A;  4IBC A;  1FJG M;  3MK6 A;  1E32 A;  3FUX A;  4L16 A;  5FTM A;  4LJ9 A;  8CAT A;  2KRU A;  4IBB A;  1DGH A;  2R45 A;  3J2P B;  2D7E A;  5KQ8 A;  4JN6 A;  5BR8 M;  1OJL A;  1QAM A;  4PCZ A;  5EQT A;  4QHT A;  1NJG A;  3LVW A;  1XHB A;  3GRR A;  3SAR A;  3SYK A;  3U6M A;  1GL7 A;  4LFA M;  4S12 A;  1IM2 A;  2XF3 A;  4A3V B;  2H1R A;  4DUY M;  3SBJ A;  5A2Q S;  3U60 B;  3SAS A;  2ZBK B;  4LF7 M;  2YQZ A;  4NOO B;  3U6P A;  3TWK A;  3AKZ A;  3FYC A;  3OTO M;  4LF4 M;  4DV2 M;  4REZ A;  1ZAE A;  3HU2 A;  3C58 A;  1K82 A;  3KS4 A;  2OQ4 A;  4GC9 A;  4DR6 M;  4LJ8 A;  2D7H A;  4AKG A;  3U6Q A;  2O5R A;  1Z5A A;  2C99 A;  3T1H M;  3TWM A;  3GLF A;  3MHV C;  1K3W A;  2HHH M;  4X66 M;  3J81 S;  2K47 A;  3U5Z A;  4BLC A;  2HL7 A;  4L4U A;  5BPV A;  3HJ8 A;  4MH0 E;  4RNA A;  2F5S A;  4QOZ C;  4QNR A;  1KSF X;  4PD2 A;  4DV0 M;  2XH9 A;  4DR3 M;  4GHL A;  5EXP A;  4DV5 M;  4IJF A;  3PXG A;  3I51 A;  4AKH A;  2R4E A;  4LGY A;  1TH4 A;  3D8B A;  4JI5 M;  2BJV A;  4JI2 M;  3FKE A;  1R6B X;  1N75 A;  2XFS A;  5FTK A;  4PT5 A;  2C9O A;  5KQD A;  3U61 A;  1L8Q A;  1T3T A;  4FCW A;  4FVM A;  1ZQ9 A;  2YNM D;  2KZS A;  3CF2 A;  3GRV A;  3GP1 A;  4G6Z A;  4LZJ A;  4OVZ A;  4BBA A;  3Q8X A;  1L1T A;  2CHG A;  3A42 A;  5IRE B;  3ZH9 B;  2QBY A;  3SMS A;  4G4R A;  4FWH A;  4B7G A;  4XBO A;  1PJI A;  2XZU A;  1E94 E;  2LWX A;  2QEN A;  3TWL A;  5FTL A;  4DR5 M;  2RGO A;  4JYA M;  1NJF A;  2L7H A;  3GQ5 A;  4B3S M;  1JR3 A;  2G5G X;  2R18 A;  5DNY A;  2QZ4 A;  4KLN A;  3EIH A;  1QAO A;  3U5Z B;  3RGS A;  1S3S A;  3AJI B;  4QNM A;  3LMM A;  2KXE A;  3L26 A;  5FTN A;  3GRU A;  1XMQ M;  2EO2 A;  4MGI E;  1QVR A;  4GKJ M;  3SAT A;  1HQC A;  2DVW B;  5EP4 A;  2BJW A;  1J5E M;  1J09 A;  1N77 A;  3VKH A;  3LQR A;  3U61 B;  1YE9 A;  4M0D A;  1N34 M;  3SFZ A;  2F5P A;  4B3M M;  2M5Z A;  4JV5 M;  4M9S A;  2CUZ A;  4DV4 M;  2Z3X A;  2V6Z M;  3HHW A;  1NNU C;  4I8O A;  4NRV A;  2LXE A;  1VDD A;  5FTJ A;  1JR3 D;  3KOY E;  1N32 M;  2J7O A;  3FYD A;  5KO3 A;  2XFT A;  1L2B A;  3RFW A;  1G41 A;  1E9R A;  1OFI A;  2KA6 B;  3GPP A;  1YUB A;  3KVW A;  3KSX A;  3FUV A;  2V1C A;  4FD2 A;  4HL4 A;  4IBD A;  1NHG C;  2XSZ A;  4WW0 A;  2UXC M;  3M6A A;  3WHL A;  3SHG B;  3TE6 A;  3L29 A;  4IBF A;  2C96 A;  4MM3 B;  2CHQ A;  4M0W A;  4I5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...