1GABA

Structure of an albumin-binding domain, nmr, 20 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN PAB
publication title Solution structure of the albumin-binding GA module: a versatile bacterial protein domain.
pubmed doi rcsb
source organism Finegoldia magna atcc 29328
molecule tags Albumin-binding protein
total genus 10
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1996-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gabA00
1TF0B 1PRBA 2KDLA 2FS1A 2JWSA 2N35A 1GABA 2LHCA 2J5YA 1GJSA 2VDBB 2LHGA 2MH8A 1GJTA
chains in the Genus database with same CATH superfamily
4NC6A 3MHVC 4HLQA 4CJ6A 3GLHA 1IBKM 2CE7A 1G3IA 1J5EM 4B7HA 2R18A 4NL4H 3HHYA 3R9XB 3KSXA 1PJQA 4OVZB 2LXEA 1HJPA 2DENA 4FCTA 3RE8A 1VEJA 3GRYA 1QAQA 1VDLA 2F5OA 5DYIA 4JI5M 2X4AA 2JZ1A 2Z4RA 1TH3A 3GLIE 3AV0A 4AG5A 2X8AA 3J81S 1WGNA 4G4NA 2W82A 1XWIA 2DAKA 1KFVA 3HJSA 4LFBM 3BXWA 1L2CA 3FRHA 3GLHE 1IN7A 3K9OA 4MGHA 4D81A 4LF4M 2MJ5B 3K8ZA 1E9RA 1LTMA 4F2LA 2H1RA 1QANA 4GC5A 1Q3CA 1QDTA 2KNAA 4GMQA 1GLNA 3HZJA 5EP2A 3GLGB 1D2NA 1CUKA 3GLFA 3D8BA 1TGUA 2KDLA 4MH0E 4DV2M 3TPZA 2LVOC 3L2AA 2C98A 4JN6A 4GH9A 4LJ5A 1AUAA 1Z5CA 3GLIB 1I94M 2FE8A 3SASA 1TF0B 2HAKA 2Y21A 3L29A 1ZAEA 3MMPA 3C3DA 3T38A 2JUJA 5FSWA 3PNYA 1GL7A 3WHLA 5LMNM 2L2DA 2XGNA 1XMQM 2GNOA 4LY6A 2CEAA 4GC9A 1IY1A 3GLHB 4D82A 2XZFA 2CHQA 3I01M 2YQZA 1MN3A 3E46A 2Z7JA 5FTKA 2DAGA 4XBOA 3KP0E 3SMSA 2O01F 3DZDA 1P3QQ 3NWLA 5E6JA 1NV9A 3U61B 4GHAA 1QUTA 2K47A 1W5SA 4PCZA 2BWEA 2R4JA 3KOYE 4LFAM 3FTFA 1QYRA 2OOAA 1PJTA 4M0WA 1W5TA 3DOAA 1DGGA 2KXEA 4LRSA 4LFCM 2C96A 4IBBA 1Q39A 3MJ5A 1DGHA 1UM8A 2RKOA 2UUCM 2DAEA 2DNAA 4MGKE 4OW0A 2A5YB 1R4GA 1R6BX 1SG9A 4L6V6 1IN5A 1DO2A 5IZ7D 3VDPA 3AJIB 4R71A 3HHZA 4L16A 2OO9A 1A5TA 3KS4A 1IXSB 1N75A 1YSYA 4LJ6A 3PVSA 3FTDA 4QNRA 2LHGA 3QYEA 2KHHA 4X65M 2L6OA 2WSCF 3U6LA 4LZJA 1OAIA 4M9SA 3UZUA 4DR1M 2L4FA 2K0BX 1N78A 1NHWC 3J80S 5F3WA 3GQ3A 2CWBA 5A2QS 3C58A 3UJNA 3F92A 7CATA 4P16A 5EP1A 4JI8M 3GP1A 2FH0A 1FNNA 4DV4M 2EKFA 3T15A 1GL6A 2QQ8A 2WSFF 1HQYE 2JY7A 3CF0A 3KXEC 4M0DA 1C1KA 2JXNA 4IBEA 1K82A 4KO8A 2NQ8C 1XXHA 2CV2A 2UU9M 2Y0QA 2CP8A 1J09A 1DGFA 3ZC7B 3J7AS 2ZBKB 2BWBA 4PDIA 2XZUA 3IG5A 1R2ZA 1G71A 4KHPM 1VEKA 1DGBA 2XSZA 1V34A 5DNYA 3U60A 4UN2B 2DWLA 4GRIA 4MB7A 2JY6B 5EXXA 1XNQM 3KW6A 1HNZM 2J5YA 3VKGA 2XLJA 1HT1E 3M6AA 5EXTA 1NHGC 4BB9A 2VQEM 1PM5A 4DR7M 1SXJD 2WSEF 4AZFA 4LRTA 1D0MA 3V76A 3K2LA 2F5NA 3IHPA 1XXHE 1DV0A 4OU7A 1JR3D 2HKJA 4HL4A 1GKIA 2BJVA 2QP9X 5EQTA 5IT9S 3QWLA 3HJ8A 4GEWA 4JI4M 1QQWA 4LZZA 4JI3M 4DV3M 2VIIA 1C7YA 1Q3BA 3J27B 1I4WA 1E32A 1JB0F 1KYIA 2DAMA 1TH2A 2QENA 4XK8F 1WGLA 5DFLA 4DR4M 1GO5A 3A42A 3GQ5A 3ILKA 4F1IA 3AOEC 4IBGA 4LGYA 3PXGA 3SMPA 1QVRA 2ZM6M 2DI0A 3LQQA 4JI2M 4JXJA 2H5XA 1D0KA 1N33M 4DUZM 1QAMA 4B7GA 1XXHB 2JNHA 3VLFB 4B3RM 4DR3M 2KEBA 1N36M 1G59A 2DAIA 4AG6A 4NSRA 4TUWA 1OTRA 2O5RA 2QNJA 4I4LA 4L8RC 2K9DA 2VF8A 4LF8M 1Z6TA 2OPFA 1GVNA 4JI6M 4NRVA 3GQ4A 3SATA 4GITA 2XF3A 2EO2A 3FUXA 4MGYE 2CFOA 4IBKA 1L2DA 3VKHA 1TR8A 3VK7A 1L2BA 4G6ZA 4GHLA 2DZOB 2LNHC 4CISA 1XNRM 2LVAA 1T6OA 1VQ1A 1WHCA 2G5GX 2Z4SA 3ZQJA 3HU2A 1IFYA 3HHWA 1WR1B 4LG2A 2KZUA 3PNVA 4NOOB 2CUZA 4G4OA 1R2YA 1SXJA 2BNKA 4AW4A 3TWMA 2F4VM 4B3TM 2FNAA 4B3MM 2CHVA 3A45A 4I5SA 5KQDA 3HU3A 4A3VB 4GKKM 4DR6M 1JR3A 2YR0A 3FYDA 1XMOM 1OQYA 1J7KA 3T1YM 1OIZA 2DXIA 3B7NA 2V1UA 1WJ7A 3RFWA 3U6EA 5IWAM 1PJSA 3I04M 1QUSA 1IN6A 2FS1A 4R3DA 3FE3A 2C9OA 2LWXA 4LF5M 3FTCA 4CHTB 2DZLA 3FYCA 4II7A 3TQSA 4ANRA 1LV7A 1OFIA 3GLFE 3B9PA 2P5TA 5GKNA 3T6PA 2KNZA 4DR2M 3I51A 1IBLM 1IBMM 1HT2E 1GJSA 2VDBB 1D0LA 2HWJA 3THGA 1HNXM 1R5LA 2DKLA 1PGYA 3TWLA 5ITRA 2DWNA 3PFIA 3HY5A 4MM3B 3FUVA 3KOWE 2R0IA 4FW9A 3SHFA 3JR4A 1JR3E 3L28A 4FCVA 3CF2A 3B74A 4DV6M 3KOZE 4LF7M 2LVQD 1Q02A 2D7HA 4R7GA 4DV0M 3GRUA 4L4UA 4CGYB 3E4RA 2Y20A 5DYGA 4B3SM 3TE6A 1L1TA 1YUBA 2DWMA 3H4MA 1GJTA 2X49A 4L15A 2QZ4A 4LCBA 1IY2A 2Q2EB 5KO3A 3EIEA 4QHTA 4QOZC 1G4AE 3KVWA 5ITXA 4AQYM 3SFZA 1NNUC 3GLFB 2CRUA 4KODA 4WURA 2JWSA 3SAUA 1WIVA 5EP3A 2KZSA 4PT5A 1HQCA 2D7EA 2Y0TA 2LTUA 2F5QA 1QDRA 2M60A 3UK6A 3MK6A 4IBCA 4X62M 2B3TA 3QAUA 4BLCA 5KPZA 4M9XA 1VEGA 2LBCA 1IY0A 4CIZA 3KOXE 3SBJA 3GPXA 2R65A 3KSJA 4WP2A 4DBGB 3BBZA 4RNAA 5EP4A 1E9SA 4LJ8A 3UGJA 5ITXE 2OOBA 1HR0M 4OVZA 3GRRA 4JI0M 2I7NA 1IM2A 1NY5A 2ZAMA 5JI3E 2HCBA 1FJGM 4IIWA 4DR5M 4I8OA 5JI2E 1N32M 2OQ4A 2KRKA 2G3QA 5LMUM 2LH0A 3RGSA 3M7GA 2KW0A 2UXDM 3I4YA 1DGHB 3IG8A 1KSFX 3HJQA 4M9ZA 1QZMA 1MU5A 3K1JA 3JAMS 2YNMD 2Z3XA 3A46A 1QAOA 3K9PA 5E26A 5EJCA 1L1ZA 4REZA 4JV5M 3LVVA 5IREB 2G8LA 3FKEA 3ZCBB 5C18A 2APLA 3IECA 2CHGA 2RGHA 1T43A 2L4EA 2E5LM 2V1CA 4W5WA 1UFZA 2O25A 3HKPA 1YLAA 2L09A 2XFTA 3GRVA 3W0FA 4B08A 4Y28F 3T1HM 5EXPA 1ORYB 1E94E 2J7NA 3KDSE 4RF1A 3GLGA 4AI6A 2UUBM 1MJGM 3FUUA 1IN8A 4FWHA 4IBFA 2ZAOA 8CATA 1K3XA 2XFSA 3B7ZA 4KT0F 4YY3M 5BR8M 3TL4X 4ITQA 3GLIA 2EUCA 4Z8XA 4FWGA 2F5SA 5FLXS 2QHOB 3HHXA 4AKGA 1L8QA 3W67A 2VQFM 3U6SA 3R8FA 3OTOM 4B7FA 1XB2B 4DUYM 1TTEA 2CV0A 1IXZA 1BVSA 2UXBM 3LMMA 3B89A 2XH9A 3U6QA 1N77A 1V92A 4IBJA 5ITYA 2ZANA 3GPPA 1QZEA 1PRBA 2BJWA 3J7BA 4DV5M 2KNVA 3AKZA 3SAVA 3U61A 1GABA 2C9CA 2EJSA 3GLGE 3LQRA 3W0LB 4OX9M 3U60B 3EIHA 2MR9A 3D8LA 4LF6M 2LVNC 1VG5A 3E21A 1YE9A 3KFUG 1EIJA 3RGPA 3KP1E 4NRWA 2EKKA 2R6FA 1T3TA 2QBYA 5KPTA 2D7GA 2HHHM 3C9PA 3U5ZA 1H6UA 4LJ9A 3NBXX 3DA1A 3SHGB 2F5PA 5FTLA 1NJFA 3GPYA 4LJ4A 4Z6YA 3W68A 3ZH9B 1NNJA 3SYKA 3WHKA 3U6PA 4L78A 2LVPC 1EE8A 1IXSA 2C99A 2ZTCA 1TH4A 2DHRA 1R7RA 4NSOB 1V33A 3CTWB 2MROB 2R46A 1NSFA 1S3SA 4FD2A 1OIPA 2JA2A 3Q8XA 2FFJA 1PJIA 2DVWB 4AKIA 1NY6A 1PJJA 1NV8A 2L7IA 2V6ZM 4PDGA 4JI1M 3NBIA 4MGIE 4ZPXA 4JI7M 3H4JA 5L8RF 1VDDA 1SXJE 4GIPA 4YHHM 3BOSA 1N34M 5C1BA 4LF9M 3I4VA 2CV1A 2RGOA 1IN4A 3M0EA 4EIWA 4RF0A 1OAOC 1DO0A 4IBDA 1ZMUA 4LGMA 1IQPA 1TDHA 3L27A 3HU1A 3A98B 4LJAA 2M5ZA 1NO1A 1OJLA 2GQFA 4BBAA 4G4QA 4I81A 2FOIC 2R45A 3HGIA 4G3OA 5FTNA 1OFHA 2UXCM 1F4IA 2XSZD 1WXQA 2DHYA 2QPAA 1RU3A 4RKUF 4MGZE 2QSFX 3SARA 3L26A 2YFQA 3J2PB 3KS8A 4GKJM 2QBYB 1Z5BA 3SAWA 1AIPC 4HEOA 3U6CA 2ERCA 1NVMA 2R62A 3AOEA 5BPVA 3U5ZB 2C5RA 1ZMWA 3LW5F 2JZ0A 1XC8A 3SC3A 3LCVB 4X64M 1SXJB 1G41A 1Z5AA 2ZTDA 3AFHA 3FTEA 3LCUA 4P17A 1TDZA 1HNWM 2Z8YM 3HX3A 2XEPA 3K92A 5ITQA 3E9SA 3VFDA 2KRUA 3B7QA 1ZV1A 3GO8A 3C3EA 1EFUB 2N35A 3FUWA 3UMMA 2HL7A 2L7HA 2EA0A 4FCWA 4DV7M 2K6BA 2VF7A 2DWZB 2MGWA 2QCUA 3AOGA 3FUTA 2KA6B 4WW0A 5EXSA 4FWDA 5FTJA 3U6OA 2JP7A 2DZNB 4NXNM 3Q8GA 5ITUA 2R4EA 1K3WA 4LJ7A 3CF6E 3FD9A 5KPRA 4AKHA 2JY5A 4D80A 1SXJC 1MX0A 3DFZA 1ZMVA 2LHCA 2R44A 1OKSA 4DV1M 2AHMA 2RRUA 5KQ8A 4NXMM 4IJFA 4QHSA 4Q7JA 3SYLA 4X66M 3JR5A 5FTMA 1JQJC 4S12A 3HWSA 1IXRC 4XGIA 3AL0C 3LVWA 3VDUA 4K0KM 4IJEA 2WZJA 1G8PA 3U6MA 1X37A 4QNMA 2JY8A 3U6DA 1XHBA 3QYBA 5H37D 4JYAM 4G4RA 4IBIA 1ZQ9A 1Z59A 3FRIA 1Y8GA 4QOSA 2UUAM 5ITTA 3GPUA 4KLNA 3CGWA 4PD2A 3TWKA 3L25A 3VK8A 1NJGA 2I7PA 2J7OA 2MH8A 4FVMA
chains in the Genus database with same CATH topology
1TF0B 1PRBA 2KDLA 2FS1A 2JWSA 2N35A 1GABA 2LHCA 2J5YA 1GJSA 2VDBB 2LHGA 2MH8A 1GJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TF0 B;  1PRB A;  2KDL A;  2FS1 A;  2JWS A;  2N35 A;  1GAB A;  2LHC A;  2J5Y A;  1GJS A;  2VDB B;  2LHG A;  2MH8 A;  1GJT A; 
#chains in the Genus database with same CATH topology
 4NC6 A;  3MHV C;  4HLQ A;  4CJ6 A;  3GLH A;  1IBK M;  2CE7 A;  1G3I A;  1J5E M;  4B7H A;  2R18 A;  4NL4 H;  3HHY A;  3R9X B;  3KSX A;  1PJQ A;  4OVZ B;  2LXE A;  1HJP A;  2DEN A;  4FCT A;  3RE8 A;  1VEJ A;  3GRY A;  1QAQ A;  1VDL A;  2F5O A;  5DYI A;  4JI5 M;  2X4A A;  2JZ1 A;  2Z4R A;  1TH3 A;  3GLI E;  3AV0 A;  4AG5 A;  2X8A A;  3J81 S;  1WGN A;  4G4N A;  2W82 A;  1XWI A;  2DAK A;  1KFV A;  3HJS A;  4LFB M;  3BXW A;  1L2C A;  3FRH A;  3GLH E;  1IN7 A;  3K9O A;  4MGH A;  4D81 A;  4LF4 M;  2MJ5 B;  3K8Z A;  1E9R A;  1LTM A;  4F2L A;  2H1R A;  1QAN A;  4GC5 A;  1Q3C A;  1QDT A;  2KNA A;  4GMQ A;  1GLN A;  3HZJ A;  5EP2 A;  3GLG B;  1D2N A;  1CUK A;  3GLF A;  3D8B A;  1TGU A;  2KDL A;  4MH0 E;  4DV2 M;  3TPZ A;  2LVO C;  3L2A A;  2C98 A;  4JN6 A;  4GH9 A;  4LJ5 A;  1AUA A;  1Z5C A;  3GLI B;  1I94 M;  2FE8 A;  3SAS A;  1TF0 B;  2HAK A;  2Y21 A;  3L29 A;  1ZAE A;  3MMP A;  3C3D A;  3T38 A;  2JUJ A;  5FSW A;  3PNY A;  1GL7 A;  3WHL A;  5LMN M;  2L2D A;  2XGN A;  1XMQ M;  2GNO A;  4LY6 A;  2CEA A;  4GC9 A;  1IY1 A;  3GLH B;  4D82 A;  2XZF A;  2CHQ A;  3I01 M;  2YQZ A;  1MN3 A;  3E46 A;  2Z7J A;  5FTK A;  2DAG A;  4XBO A;  3KP0 E;  3SMS A;  2O01 F;  3DZD A;  1P3Q Q;  3NWL A;  5E6J A;  1NV9 A;  3U61 B;  4GHA A;  1QUT A;  2K47 A;  1W5S A;  4PCZ A;  2BWE A;  2R4J A;  3KOY E;  4LFA M;  3FTF A;  1QYR A;  2OOA A;  1PJT A;  4M0W A;  1W5T A;  3DOA A;  1DGG A;  2KXE A;  4LRS A;  4LFC M;  2C96 A;  4IBB A;  1Q39 A;  3MJ5 A;  1DGH A;  1UM8 A;  2RKO A;  2UUC M;  2DAE A;  2DNA A;  4MGK E;  4OW0 A;  2A5Y B;  1R4G A;  1R6B X;  1SG9 A;  4L6V 6;  1IN5 A;  1DO2 A;  5IZ7 D;  3VDP A;  3AJI B;  4R71 A;  3HHZ A;  4L16 A;  2OO9 A;  1A5T A;  3KS4 A;  1IXS B;  1N75 A;  1YSY A;  4LJ6 A;  3PVS A;  3FTD A;  4QNR A;  2LHG A;  3QYE A;  2KHH A;  4X65 M;  2L6O A;  2WSC F;  3U6L A;  4LZJ A;  1OAI A;  4M9S A;  3UZU A;  4DR1 M;  2L4F A;  2K0B X;  1N78 A;  1NHW C;  3J80 S;  5F3W A;  3GQ3 A;  2CWB A;  5A2Q S;  3C58 A;  3UJN A;  3F92 A;  7CAT A;  4P16 A;  5EP1 A;  4JI8 M;  3GP1 A;  2FH0 A;  1FNN A;  4DV4 M;  2EKF A;  3T15 A;  1GL6 A;  2QQ8 A;  2WSF F;  1HQY E;  2JY7 A;  3CF0 A;  3KXE C;  4M0D A;  1C1K A;  2JXN A;  4IBE A;  1K82 A;  4KO8 A;  2NQ8 C;  1XXH A;  2CV2 A;  2UU9 M;  2Y0Q A;  2CP8 A;  1J09 A;  1DGF A;  3ZC7 B;  3J7A S;  2ZBK B;  2BWB A;  4PDI A;  2XZU A;  3IG5 A;  1R2Z A;  1G71 A;  4KHP M;  1VEK A;  1DGB A;  2XSZ A;  1V34 A;  5DNY A;  3U60 A;  4UN2 B;  2DWL A;  4GRI A;  4MB7 A;  2JY6 B;  5EXX A;  1XNQ M;  3KW6 A;  1HNZ M;  2J5Y A;  3VKG A;  2XLJ A;  1HT1 E;  3M6A A;  5EXT A;  1NHG C;  4BB9 A;  2VQE M;  1PM5 A;  4DR7 M;  1SXJ D;  2WSE F;  4AZF A;  4LRT A;  1D0M A;  3V76 A;  3K2L A;  2F5N A;  3IHP A;  1XXH E;  1DV0 A;  4OU7 A;  1JR3 D;  2HKJ A;  4HL4 A;  1GKI A;  2BJV A;  2QP9 X;  5EQT A;  5IT9 S;  3QWL A;  3HJ8 A;  4GEW A;  4JI4 M;  1QQW A;  4LZZ A;  4JI3 M;  4DV3 M;  2VII A;  1C7Y A;  1Q3B A;  3J27 B;  1I4W A;  1E32 A;  1JB0 F;  1KYI A;  2DAM A;  1TH2 A;  2QEN A;  4XK8 F;  1WGL A;  5DFL A;  4DR4 M;  1GO5 A;  3A42 A;  3GQ5 A;  3ILK A;  4F1I A;  3AOE C;  4IBG A;  4LGY A;  3PXG A;  3SMP A;  1QVR A;  2ZM6 M;  2DI0 A;  3LQQ A;  4JI2 M;  4JXJ A;  2H5X A;  1D0K A;  1N33 M;  4DUZ M;  1QAM A;  4B7G A;  1XXH B;  2JNH A;  3VLF B;  4B3R M;  4DR3 M;  2KEB A;  1N36 M;  1G59 A;  2DAI A;  4AG6 A;  4NSR A;  4TUW A;  1OTR A;  2O5R A;  2QNJ A;  4I4L A;  4L8R C;  2K9D A;  2VF8 A;  4LF8 M;  1Z6T A;  2OPF A;  1GVN A;  4JI6 M;  4NRV A;  3GQ4 A;  3SAT A;  4GIT A;  2XF3 A;  2EO2 A;  3FUX A;  4MGY E;  2CFO A;  4IBK A;  1L2D A;  3VKH A;  1TR8 A;  3VK7 A;  1L2B A;  4G6Z A;  4GHL A;  2DZO B;  2LNH C;  4CIS A;  1XNR M;  2LVA A;  1T6O A;  1VQ1 A;  1WHC A;  2G5G X;  2Z4S A;  3ZQJ A;  3HU2 A;  1IFY A;  3HHW A;  1WR1 B;  4LG2 A;  2KZU A;  3PNV A;  4NOO B;  2CUZ A;  4G4O A;  1R2Y A;  1SXJ A;  2BNK A;  4AW4 A;  3TWM A;  2F4V M;  4B3T M;  2FNA A;  4B3M M;  2CHV A;  3A45 A;  4I5S A;  5KQD A;  3HU3 A;  4A3V B;  4GKK M;  4DR6 M;  1JR3 A;  2YR0 A;  3FYD A;  1XMO M;  1OQY A;  1J7K A;  3T1Y M;  1OIZ A;  2DXI A;  3B7N A;  2V1U A;  1WJ7 A;  3RFW A;  3U6E A;  5IWA M;  1PJS A;  3I04 M;  1QUS A;  1IN6 A;  2FS1 A;  4R3D A;  3FE3 A;  2C9O A;  2LWX A;  4LF5 M;  3FTC A;  4CHT B;  2DZL A;  3FYC A;  4II7 A;  3TQS A;  4ANR A;  1LV7 A;  1OFI A;  3GLF E;  3B9P A;  2P5T A;  5GKN A;  3T6P A;  2KNZ A;  4DR2 M;  3I51 A;  1IBL M;  1IBM M;  1HT2 E;  1GJS A;  2VDB B;  1D0L A;  2HWJ A;  3THG A;  1HNX M;  1R5L A;  2DKL A;  1PGY A;  3TWL A;  5ITR A;  2DWN A;  3PFI A;  3HY5 A;  4MM3 B;  3FUV A;  3KOW E;  2R0I A;  4FW9 A;  3SHF A;  3JR4 A;  1JR3 E;  3L28 A;  4FCV A;  3CF2 A;  3B74 A;  4DV6 M;  3KOZ E;  4LF7 M;  2LVQ D;  1Q02 A;  2D7H A;  4R7G A;  4DV0 M;  3GRU A;  4L4U A;  4CGY B;  3E4R A;  2Y20 A;  5DYG A;  4B3S M;  3TE6 A;  1L1T A;  1YUB A;  2DWM A;  3H4M A;  1GJT A;  2X49 A;  4L15 A;  2QZ4 A;  4LCB A;  1IY2 A;  2Q2E B;  5KO3 A;  3EIE A;  4QHT A;  4QOZ C;  1G4A E;  3KVW A;  5ITX A;  4AQY M;  3SFZ A;  1NNU C;  3GLF B;  2CRU A;  4KOD A;  4WUR A;  2JWS A;  3SAU A;  1WIV A;  5EP3 A;  2KZS A;  4PT5 A;  1HQC A;  2D7E A;  2Y0T A;  2LTU A;  2F5Q A;  1QDR A;  2M60 A;  3UK6 A;  3MK6 A;  4IBC A;  4X62 M;  2B3T A;  3QAU A;  4BLC A;  5KPZ A;  4M9X A;  1VEG A;  2LBC A;  1IY0 A;  4CIZ A;  3KOX E;  3SBJ A;  3GPX A;  2R65 A;  3KSJ A;  4WP2 A;  4DBG B;  3BBZ A;  4RNA A;  5EP4 A;  1E9S A;  4LJ8 A;  3UGJ A;  5ITX E;  2OOB A;  1HR0 M;  4OVZ A;  3GRR A;  4JI0 M;  2I7N A;  1IM2 A;  1NY5 A;  2ZAM A;  5JI3 E;  2HCB A;  1FJG M;  4IIW A;  4DR5 M;  4I8O A;  5JI2 E;  1N32 M;  2OQ4 A;  2KRK A;  2G3Q A;  5LMU M;  2LH0 A;  3RGS A;  3M7G A;  2KW0 A;  2UXD M;  3I4Y A;  1DGH B;  3IG8 A;  1KSF X;  3HJQ A;  4M9Z A;  1QZM A;  1MU5 A;  3K1J A;  3JAM S;  2YNM D;  2Z3X A;  3A46 A;  1QAO A;  3K9P A;  5E26 A;  5EJC A;  1L1Z A;  4REZ A;  4JV5 M;  3LVV A;  5IRE B;  2G8L A;  3FKE A;  3ZCB B;  5C18 A;  2APL A;  3IEC A;  2CHG A;  2RGH A;  1T43 A;  2L4E A;  2E5L M;  2V1C A;  4W5W A;  1UFZ A;  2O25 A;  3HKP A;  1YLA A;  2L09 A;  2XFT A;  3GRV A;  3W0F A;  4B08 A;  4Y28 F;  3T1H M;  5EXP A;  1ORY B;  1E94 E;  2J7N A;  3KDS E;  4RF1 A;  3GLG A;  4AI6 A;  2UUB M;  1MJG M;  3FUU A;  1IN8 A;  4FWH A;  4IBF A;  2ZAO A;  8CAT A;  1K3X A;  2XFS A;  3B7Z A;  4KT0 F;  4YY3 M;  5BR8 M;  3TL4 X;  4ITQ A;  3GLI A;  2EUC A;  4Z8X A;  4FWG A;  2F5S A;  5FLX S;  2QHO B;  3HHX A;  4AKG A;  1L8Q A;  3W67 A;  2VQF M;  3U6S A;  3R8F A;  3OTO M;  4B7F A;  1XB2 B;  4DUY M;  1TTE A;  2CV0 A;  1IXZ A;  1BVS A;  2UXB M;  3LMM A;  3B89 A;  2XH9 A;  3U6Q A;  1N77 A;  1V92 A;  4IBJ A;  5ITY A;  2ZAN A;  3GPP A;  1QZE A;  1PRB A;  2BJW A;  3J7B A;  4DV5 M;  2KNV A;  3AKZ A;  3SAV A;  3U61 A;  1GAB A;  2C9C A;  2EJS A;  3GLG E;  3LQR A;  3W0L B;  4OX9 M;  3U60 B;  3EIH A;  2MR9 A;  3D8L A;  4LF6 M;  2LVN C;  1VG5 A;  3E21 A;  1YE9 A;  3KFU G;  1EIJ A;  3RGP A;  3KP1 E;  4NRW A;  2EKK A;  2R6F A;  1T3T A;  2QBY A;  5KPT A;  2D7G A;  2HHH M;  3C9P A;  3U5Z A;  1H6U A;  4LJ9 A;  3NBX X;  3DA1 A;  3SHG B;  2F5P A;  5FTL A;  1NJF A;  3GPY A;  4LJ4 A;  4Z6Y A;  3W68 A;  3ZH9 B;  1NNJ A;  3SYK A;  3WHK A;  3U6P A;  4L78 A;  2LVP C;  1EE8 A;  1IXS A;  2C99 A;  2ZTC A;  1TH4 A;  2DHR A;  1R7R A;  4NSO B;  1V33 A;  3CTW B;  2MRO B;  2R46 A;  1NSF A;  1S3S A;  4FD2 A;  1OIP A;  2JA2 A;  3Q8X A;  2FFJ A;  1PJI A;  2DVW B;  4AKI A;  1NY6 A;  1PJJ A;  1NV8 A;  2L7I A;  2V6Z M;  4PDG A;  4JI1 M;  3NBI A;  4MGI E;  4ZPX A;  4JI7 M;  3H4J A;  5L8R F;  1VDD A;  1SXJ E;  4GIP A;  4YHH M;  3BOS A;  1N34 M;  5C1B A;  4LF9 M;  3I4V A;  2CV1 A;  2RGO A;  1IN4 A;  3M0E A;  4EIW A;  4RF0 A;  1OAO C;  1DO0 A;  4IBD A;  1ZMU A;  4LGM A;  1IQP A;  1TDH A;  3L27 A;  3HU1 A;  3A98 B;  4LJA A;  2M5Z A;  1NO1 A;  1OJL A;  2GQF A;  4BBA A;  4G4Q A;  4I81 A;  2FOI C;  2R45 A;  3HGI A;  4G3O A;  5FTN A;  1OFH A;  2UXC M;  1F4I A;  2XSZ D;  1WXQ A;  2DHY A;  2QPA A;  1RU3 A;  4RKU F;  4MGZ E;  2QSF X;  3SAR A;  3L26 A;  2YFQ A;  3J2P B;  3KS8 A;  4GKJ M;  2QBY B;  1Z5B A;  3SAW A;  1AIP C;  4HEO A;  3U6C A;  2ERC A;  1NVM A;  2R62 A;  3AOE A;  5BPV A;  3U5Z B;  2C5R A;  1ZMW A;  3LW5 F;  2JZ0 A;  1XC8 A;  3SC3 A;  3LCV B;  4X64 M;  1SXJ B;  1G41 A;  1Z5A A;  2ZTD A;  3AFH A;  3FTE A;  3LCU A;  4P17 A;  1TDZ A;  1HNW M;  2Z8Y M;  3HX3 A;  2XEP A;  3K92 A;  5ITQ A;  3E9S A;  3VFD A;  2KRU A;  3B7Q A;  1ZV1 A;  3GO8 A;  3C3E A;  1EFU B;  2N35 A;  3FUW A;  3UMM A;  2HL7 A;  2L7H A;  2EA0 A;  4FCW A;  4DV7 M;  2K6B A;  2VF7 A;  2DWZ B;  2MGW A;  2QCU A;  3AOG A;  3FUT A;  2KA6 B;  4WW0 A;  5EXS A;  4FWD A;  5FTJ A;  3U6O A;  2JP7 A;  2DZN B;  4NXN M;  3Q8G A;  5ITU A;  2R4E A;  1K3W A;  4LJ7 A;  3CF6 E;  3FD9 A;  5KPR A;  4AKH A;  2JY5 A;  4D80 A;  1SXJ C;  1MX0 A;  3DFZ A;  1ZMV A;  2LHC A;  2R44 A;  1OKS A;  4DV1 M;  2AHM A;  2RRU A;  5KQ8 A;  4NXM M;  4IJF A;  4QHS A;  4Q7J A;  3SYL A;  4X66 M;  3JR5 A;  5FTM A;  1JQJ C;  4S12 A;  3HWS A;  1IXR C;  4XGI A;  3AL0 C;  3LVW A;  3VDU A;  4K0K M;  4IJE A;  2WZJ A;  1G8P A;  3U6M A;  1X37 A;  4QNM A;  2JY8 A;  3U6D A;  1XHB A;  3QYB A;  5H37 D;  4JYA M;  4G4R A;  4IBI A;  1ZQ9 A;  1Z59 A;  3FRI A;  1Y8G A;  4QOS A;  2UUA M;  5ITT A;  3GPU A;  4KLN A;  3CGW A;  4PD2 A;  3TWK A;  3L25 A;  3VK8 A;  1NJG A;  2I7P A;  2J7O A;  2MH8 A;  4FVM A; 
#chains in the Genus database with same CATH homology
 1TF0 B;  1PRB A;  2KDL A;  2FS1 A;  2JWS A;  2N35 A;  1GAB A;  2LHC A;  2J5Y A;  1GJS A;  2VDB B;  2LHG A;  2MH8 A;  1GJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...