1GABA

Structure of an albumin-binding domain, nmr, 20 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
b'TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN PAB
publication title Solution structure of the albumin-binding GA module: a versatile bacterial protein domain.
pubmed doi rcsb
source organism Finegoldia magna atcc 29328
molecule tags Albumin-binding protein
total genus 10
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1996-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gabA00
2JWSA 2LHGA 2FS1A 1TF0B 1GJSA 1GABA 2VDBB 2J5YA 1PRBA 2MH8A 2LHCA 2N35A 1GJTA 2KDLA
chains in the Genus database with same CATH superfamily
3J27B 2RGHA 1GL6A 1TDHA 1Z5CA 3KOZE 4FWDA 1PRBA 1TH4A 3F92A 1RU3A 5FTLA 1XWIA 1G3IA 3UMMA 2OPFA 1IBKM 4BB9A 4CJ6A 2BJWA 3HX3A 4MM3B 3ZH9B 1R6BX 4QNMA 4WW0A 5DYGA 3J80S 4B3TM 3AL0C 2DAGA 3FKEA 1C1KA 2ZTDA 1IBMM 3L2AA 3GLIE 2APLA 2R0IA 4DR5M 2H5XA 3LQRA 2DVWB 4ITQA 4NOOB 1D0KA 1JQJC 1Q02A 2BWEA 4IBFA 1ZV1A 2D7HA 1NVMA 4GIPA 4JI3M 2GQFA 1H6UA 2UUAM 3FYCA 3L26A 2VF8A 4DV4M 1HNWM 2C5RA 3M0EA 4G3OA 5KPTA 5LMUM 5ITTA 8CATA 3Q8GA 1HT2E 2DAKA 1IY2A 4AG5A 4G4RA 2DWNA 3D8BA 3GQ3A 3OTOM 4LRSA 4G4NA 4A3VB 2EKKA 3LMMA 3T6PA 3J81S 4G4QA 5ITQA 2QQ8A 3RE8A 1K82A 3T38A 2DZNB 1YLAA 1YUBA 1NSFA 2WSFF 2EJSA 2XFSA 3H4JA 1OFHA 5ITUA 1NY5A 1QAQA 2RRUA 2VF7A 1GKIA 2XEPA 2HHHM 2JXNA 3TPZA 4JI2M 1V34A 1VQ1A 1D0LA 1G71A 1MU5A 2JY6B 2LHCA 3E4RA 2ERCA 3PFIA 4GKJM 3L27A 3VKGA 1SXJB 1QUTA 4PCZA 2QBYA 4KHPM 3B7NA 1KSFX 2M5ZA 3K9OA 3FTCA 2C96A 1PJQA 1Z5BA 1NO1A 4AW4A 3EIHA 3WHLA 1ZQ9A 2R18A 3TWMA 3GRYA 1K3WA 2J5YA 1XMQM 2X4AA 4LF9M 4NC6A 4JI8M 4R3DA 3NBXX 1PM5A 3DZDA 2BNKA 3HHZA 2Z3XA 2E5LM 2FOIC 3D8LA 1XXHA 1PJJA 1SXJC 4F2LA 2R44A 3AOEA 1XNRM 4X64M 3I04M 1ZAEA 1PJSA 2XH9A 2Z4SA 5EXSA 1DGFA 4IBCA 4PDIA 3HU3A 4JV5M 3SHFA 1A5TA 1IY1A 4FWGA 1NJGA 2L7IA 5ITXA 3K9PA 2LNHC 3T15A 5EJCA 3RFWA 1WXQA 4PT5A 2I7PA 3FUUA 3SARA 1XNQM 4B3RM 1IN8A 1IXSB 2LHGA 3HHXA 1IN7A 4I5SA 3B89A 2C98A 2YNMD 2YFQA 3FTDA 4LZZA 3JAMS 4LFCM 1IFYA 2KRKA 1NHGC 4B7FA 5JI2E 3SASA 2DI0A 3A42A 3E9SA 2QPAA 2CV0A 1R2YA 4DV1M 3HWSA 1VG5A 2LWXA 3J7BA 5JI3E 2KNVA 2ZANA 1QAMA 4Z8XA 2V1UA 2QP9X 4XK8F 3U5ZA 3RGSA 5EQTA 1R2ZA 3M6AA 3ZC7B 4BLCA 4DR6M 2WSEF 1WGNA 1MN3A 4LGMA 3HHYA 2XSZA 2DAMA 3IG8A 2ZTCA 4LF6M 3FE3A 4NSOB 3VK8A 2EKFA 3AFHA 4CGYB 4DR7M 3GLGE 3PNVA 4HL4A 4LG2A 2J7OA 1T3TA 2R62A 3B74A 4FCTA 3UZUA 3T1YM 3U6CA 3GP1A 2JY8A 2OQ4A 4QOSA 5GKNA 3BBZA 4L6V6 3GPYA 5ITYA 4LZJA 4R7GA 1QQWA 2YR0A 4REZA 1G4AE 3SAVA 3C9PA 3L29A 2F5QA 5DFLA 5EXTA 1IXSA 2QENA 5FSWA 2KA6B 2R4EA 2CUZA 2L4FA 3QYBA 1N33M 3FTEA 2Q2EB 3GLIB 5C18A 5F3WA 1L2BA 2CV1A 1OKSA 1NV9A 3AOGA 2F4VM 3RGPA 3IHPA 4GC5A 4I4LA 2R4JA 2WZJA 3MHVC 1LV7A 2HAKA 1E9SA 2RKOA 4LJ4A 4B7HA 1N32M 2R45A 4LF7M 5E26A 3LQQA 2LTUA 1AIPC 2C9OA 3C58A 5FTJA 1ZMWA 2AHMA 2DZOB 2JWSA 3SYLA 3W67A 1K3XA 1FNNA 3EIEA 3SMSA 3CF2A 2P5TA 2UUBM 3VDPA 2CE7A 2QSFX 4LRTA 3DA1A 4JI4M 3IECA 2L4EA 4WURA 3I4VA 4G6ZA 2CHGA 2CHQA 1QUSA 4M9SA 5EP1A 1GVNA 2BWBA 2UXDM 1IN6A 1DO2A 1TH3A 3KFUG 4IBBA 1T6OA 1L1TA 5EXXA 5FLXS 4DR1M 4JYAM 3GQ4A 2C9CA 5EP3A 2I7NA 2F5SA 5IT9S 1T43A 4AKGA 5DYIA 5ITRA 2QCUA 4I81A 1NNUC 1I94M 3Q8XA 1N78A 3GLHA 3NWLA 4JI6M 2KW0A 3HU1A 3AJIB 4MGZE 4M0DA 1X37A 2NQ8C 1KFVA 1SXJD 4IJFA 1OAOC 5KPRA 2ZM6M 1NNJA 2CV2A 1Z6TA 2CRUA 2LVPC 4IJEA 1QDRA 3FUXA 1IY0A 3KS4A 1KYIA 1QVRA 3W0LB 2XZUA 2BJVA 1ORYB 2GNOA 2XSZD 5DNYA 3B9PA 2A5YB 2KXEA 2OOAA 2XLJA 4KO8A 1VDDA 2JNHA 3PNYA 2LVAA 1Z59A 5L8RF 4GHAA 4LY6A 4L8RC 4LCBA 1E9RA 3HHWA 1WGLA 3U6OA 1QDTA 4GC9A 2FNAA 3HJSA 4GHLA 3FUVA 1TGUA 1XB2B 1XXHE 1OIZA 1W5SA 4M9XA 3B7QA 5BR8M 3ILKA 1IBLM 3U6QA 4LF5M 4PDGA 1XC8A 2DZLA 1F4IA 2MH8A 2CEAA 3W68A 4XGIA 3QAUA 1IN4A 2V6ZM 4G4OA 1R5LA 2V1CA 4Q7JA 4IBGA 1L2DA 4IIWA 4FCVA 3U6PA 4II7A 2X8AA 2HCBA 5EP4A 2FH0A 1OIPA 2O5RA 1S3SA 3C3EA 3I01M 1HQYE 2UXBM 2F5OA 1VEGA 2Y0TA 1TR8A 3HY5A 1DV0A 4GKKM 1JB0F 3GQ5A 4LJ6A 5C1BA 3VLFB 4GMQA 4B7GA 2C99A 2MR9A 1EFUB 2VIIA 3DOAA 2EO2A 3B7ZA 2DAEA 4LJAA 3GLGB 4DR2M 5H37D 4L15A 2ZAMA 3GRUA 1SXJA 4GH9A 1HT1E 1DGBA 1E94E 1VEJA 1PJIA 3V76A 5IWAM 1IQPA 1PJTA 3FUTA 3K2LA 4OX9M 2FE8A 3MK6A 3FYDA 3KOXE 3I4YA 2G3QA 4JI1M 4OW0A 3JR5A 3KS8A 2RGOA 1GJSA 2CP8A 1NV8A 4DUZM 1XHBA 4FD2A 5BPVA 4AZFA 4DV7M 4RF0A 2DHRA 4X65M 4NXMM 3MJ5A 2LVQD 3SC3A 1JR3A 1DGGA 4MGKE 4LFAM 1N34M 3HGIA 2K6BA 2KZSA 2L7HA 1L1ZA 4HEOA 2F5NA 4KODA 4DV2M 3TE6A 4JI5M 2HWJA 3GLFE 4RKUF 2EA0A 4S12A 2Z7JA 7CATA 4OU7A 1IN5A 4HLQA 1GJTA 2DKLA 3T1HM 2QHOB 1EIJA 1CUKA 1W5TA 3TQSA 3U6LA 2B3TA 4L4UA 4P17A 2DENA 3I51A 3LW5F 1N77A 2XFTA 2KHHA 1ZMVA 2KZUA 4CISA 2LH0A 2VQFM 4QHSA 5KQDA 4IBIA 4IBEA 5LMNM 5E6JA 4DV3M 4LFBM 1QYRA 4GRIA 4QNRA 3UK6A 1V33A 1IXRC 3E21A 4CIZA 4KT0F 3U6DA 4ZPXA 2LVNC 4MH0E 5FTNA 4DV0M 4DV5M 1G41A 4L16A 2R46A 1IXZA 1QZMA 1Q3CA 3FD9A 1D0MA 3PXGA 3U6MA 2KEBA 3W0FA 3HZJA 3KVWA 3ZCBB 4X62M 1HR0M 3GPXA 3KSXA 5IREB 3GLHE 2XF3A 3LVWA 5A2QS 4FWHA 2HL7A 3GO8A 2DAIA 1AUAA 4NRVA 5KPZA 3VDUA 2XGNA 1G8PA 1NY6A 1WIVA 4D82A 4YHHM 2QBYB 2VDBB 3FRHA 3SFZA 1WJ7A 3HU2A 2D7EA 4LJ9A 4OVZB 1LTMA 3THGA 4Z6YA 3J7AS 4AKHA 5KO3A 1YE9A 1VEKA 1YSYA 1UM8A 4M0WA 4D81A 4AG6A 3U60B 2UXCM 4TUWA 3GPPA 3H4MA 3U6SA 4LJ5A 2CHVA 4B08A 3A46A 3LCVB 2L09A 1XXHB 3A45A 4MGHA 2YQZA 1PGYA 2WSCF 3CGWA 3QYEA 4XBOA 1DGHB 4DUYM 2ZBKB 1HNZM 3GLIA 1HNXM 2EUCA 5EXPA 2JY5A 4FW9A 4IBDA 5IZ7D 3GPUA 2ZAOA 1EE8A 3HJ8A 1JR3D 2K47A 3VFDA 3NBIA 4DR3M 2DWLA 2FS1A 4YY3M 5EP2A 4DV6M 3CTWB 2LVOC 1NJFA 3LVVA 4Y28F 1UFZA 3AOEC 1N75A 1L2CA 3UJNA 2L6OA 2Z8YM 1WHCA 1FJGM 5ITXE 4MGYE 4F1IA 3TWLA 3KP0E 3ZQJA 4LF4M 2G8LA 2JUJA 1TTEA 1NHWC 4QOZC 4K0KM 2Y20A 1OQYA 3U5ZB 3R9XB 2UUCM 4D80A 3JR4A 5FTMA 4JN6A 2DNAA 4M9ZA 4OVZA 3FRIA 2JZ0A 1QZEA 3FUWA 4FCWA 3PVSA 3U60A 3AKZA 2HKJA 3KP1E 4B3MM 2W82A 4IBJA 4DBGB 3M7GA 3SBJA 1SXJE 1Z5AA 2JZ1A 2OOBA 3AV0A 3BOSA 3E46A 4JI0M 4AQYM 4RNAA 4NXNM 3SMPA 1GL7A 2Z4RA 4R71A 1DGHA 3UGJA 2MGWA 2K0BX 1VDLA 4GITA 3K1JA 4B3SM 3LCUA 2JP7A 2CWBA 3FTFA 3CF6E 1J09A 3SATA 2MROB 3R8FA 1GLNA 2O01F 4DR4M 2X49A 2Y0QA 2DXIA 1TF0B 2KNAA 4RF1A 3C3DA 2KRUA 1BVSA 1JR3E 2Y21A 3L28A 3U61B 1J7KA 3CF0A 3MMPA 4LJ8A 3WHKA 1R4GA 1Q3BA 2LBCA 4IBKA 4FVMA 3J2PB 3SHGB 4EIWA 3GLFB 3KOWE 2UU9M 1OFIA 3GRRA 1I4WA 1SG9A 3KSJA 4QHTA 2J7NA 3HJQA 4CHTB 4MGIE 4X66M 2QZ4A 2F5PA 4NRWA 4KLNA 1IM2A 4P16A 1TDZA 2OO9A 3K8ZA 3TL4X 3SYKA 4ANRA 1MJGM 2CFOA 3KDSE 1QANA 3SAWA 1ZMUA 4L78A 4LGYA 1XMOM 4NSRA 3HKPA 3K92A 2XZFA 2DWMA 2L2DA 1HQCA 2R65A 3A98B 3VK7A 1GABA 1DO0A 1OAIA 4NL4H 3TWKA 2MJ5B 2G5GX 2N35A 2KNZA 4UN2B 5FTKA 1C7YA 2O25A 2M60A 4JI7M 4LJ7A 2H1RA 3BXWA 1HJPA 2K9DA 4JXJA 1J5EM 3L25A 3KW6A 1GO5A 2JA2A 2JY7A 2QNJA 2R6FA 1MX0A 3U6EA 4AI6A 4GEWA 2D7GA 4PD2A 3GLGA 3GLHB 1L8QA 2FFJA 3VKHA 4LF8M 1E32A 3KXEC 4W5WA 3QWLA 1V92A 1WR1B 4I8OA 4AKIA 1OJLA 1N36M 3SAUA 3U61A 2LXEA 1OTRA 1TH2A 2DWZB 1D2NA 2KDLA 1Q39A 3GLFA 5KQ8A 4WP2A 4BBAA 3IG5A 3GRVA 3KOYE 2VQEM 1G59A 1R7RA 1QAOA 1P3QQ 1Y8GA 3DFZA 4MB7A 2DHYA
chains in the Genus database with same CATH topology
2JWSA 2LHGA 2FS1A 1TF0B 1GJSA 1GABA 2VDBB 2J5YA 1PRBA 2MH8A 2LHCA 2N35A 1GJTA 2KDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWS A;  2LHG A;  2FS1 A;  1TF0 B;  1GJS A;  1GAB A;  2VDB B;  2J5Y A;  1PRB A;  2MH8 A;  2LHC A;  2N35 A;  1GJT A;  2KDL A; 
#chains in the Genus database with same CATH topology
 3J27 B;  2RGH A;  1GL6 A;  1TDH A;  1Z5C A;  3KOZ E;  4FWD A;  1PRB A;  1TH4 A;  3F92 A;  1RU3 A;  5FTL A;  1XWI A;  1G3I A;  3UMM A;  2OPF A;  1IBK M;  4BB9 A;  4CJ6 A;  2BJW A;  3HX3 A;  4MM3 B;  3ZH9 B;  1R6B X;  4QNM A;  4WW0 A;  5DYG A;  3J80 S;  4B3T M;  3AL0 C;  2DAG A;  3FKE A;  1C1K A;  2ZTD A;  1IBM M;  3L2A A;  3GLI E;  2APL A;  2R0I A;  4DR5 M;  2H5X A;  3LQR A;  2DVW B;  4ITQ A;  4NOO B;  1D0K A;  1JQJ C;  1Q02 A;  2BWE A;  4IBF A;  1ZV1 A;  2D7H A;  1NVM A;  4GIP A;  4JI3 M;  2GQF A;  1H6U A;  2UUA M;  3FYC A;  3L26 A;  2VF8 A;  4DV4 M;  1HNW M;  2C5R A;  3M0E A;  4G3O A;  5KPT A;  5LMU M;  5ITT A;  8CAT A;  3Q8G A;  1HT2 E;  2DAK A;  1IY2 A;  4AG5 A;  4G4R A;  2DWN A;  3D8B A;  3GQ3 A;  3OTO M;  4LRS A;  4G4N A;  4A3V B;  2EKK A;  3LMM A;  3T6P A;  3J81 S;  4G4Q A;  5ITQ A;  2QQ8 A;  3RE8 A;  1K82 A;  3T38 A;  2DZN B;  1YLA A;  1YUB A;  1NSF A;  2WSF F;  2EJS A;  2XFS A;  3H4J A;  1OFH A;  5ITU A;  1NY5 A;  1QAQ A;  2RRU A;  2VF7 A;  1GKI A;  2XEP A;  2HHH M;  2JXN A;  3TPZ A;  4JI2 M;  1V34 A;  1VQ1 A;  1D0L A;  1G71 A;  1MU5 A;  2JY6 B;  2LHC A;  3E4R A;  2ERC A;  3PFI A;  4GKJ M;  3L27 A;  3VKG A;  1SXJ B;  1QUT A;  4PCZ A;  2QBY A;  4KHP M;  3B7N A;  1KSF X;  2M5Z A;  3K9O A;  3FTC A;  2C96 A;  1PJQ A;  1Z5B A;  1NO1 A;  4AW4 A;  3EIH A;  3WHL A;  1ZQ9 A;  2R18 A;  3TWM A;  3GRY A;  1K3W A;  2J5Y A;  1XMQ M;  2X4A A;  4LF9 M;  4NC6 A;  4JI8 M;  4R3D A;  3NBX X;  1PM5 A;  3DZD A;  2BNK A;  3HHZ A;  2Z3X A;  2E5L M;  2FOI C;  3D8L A;  1XXH A;  1PJJ A;  1SXJ C;  4F2L A;  2R44 A;  3AOE A;  1XNR M;  4X64 M;  3I04 M;  1ZAE A;  1PJS A;  2XH9 A;  2Z4S A;  5EXS A;  1DGF A;  4IBC A;  4PDI A;  3HU3 A;  4JV5 M;  3SHF A;  1A5T A;  1IY1 A;  4FWG A;  1NJG A;  2L7I A;  5ITX A;  3K9P A;  2LNH C;  3T15 A;  5EJC A;  3RFW A;  1WXQ A;  4PT5 A;  2I7P A;  3FUU A;  3SAR A;  1XNQ M;  4B3R M;  1IN8 A;  1IXS B;  2LHG A;  3HHX A;  1IN7 A;  4I5S A;  3B89 A;  2C98 A;  2YNM D;  2YFQ A;  3FTD A;  4LZZ A;  3JAM S;  4LFC M;  1IFY A;  2KRK A;  1NHG C;  4B7F A;  5JI2 E;  3SAS A;  2DI0 A;  3A42 A;  3E9S A;  2QPA A;  2CV0 A;  1R2Y A;  4DV1 M;  3HWS A;  1VG5 A;  2LWX A;  3J7B A;  5JI3 E;  2KNV A;  2ZAN A;  1QAM A;  4Z8X A;  2V1U A;  2QP9 X;  4XK8 F;  3U5Z A;  3RGS A;  5EQT A;  1R2Z A;  3M6A A;  3ZC7 B;  4BLC A;  4DR6 M;  2WSE F;  1WGN A;  1MN3 A;  4LGM A;  3HHY A;  2XSZ A;  2DAM A;  3IG8 A;  2ZTC A;  4LF6 M;  3FE3 A;  4NSO B;  3VK8 A;  2EKF A;  3AFH A;  4CGY B;  4DR7 M;  3GLG E;  3PNV A;  4HL4 A;  4LG2 A;  2J7O A;  1T3T A;  2R62 A;  3B74 A;  4FCT A;  3UZU A;  3T1Y M;  3U6C A;  3GP1 A;  2JY8 A;  2OQ4 A;  4QOS A;  5GKN A;  3BBZ A;  4L6V 6;  3GPY A;  5ITY A;  4LZJ A;  4R7G A;  1QQW A;  2YR0 A;  4REZ A;  1G4A E;  3SAV A;  3C9P A;  3L29 A;  2F5Q A;  5DFL A;  5EXT A;  1IXS A;  2QEN A;  5FSW A;  2KA6 B;  2R4E A;  2CUZ A;  2L4F A;  3QYB A;  1N33 M;  3FTE A;  2Q2E B;  3GLI B;  5C18 A;  5F3W A;  1L2B A;  2CV1 A;  1OKS A;  1NV9 A;  3AOG A;  2F4V M;  3RGP A;  3IHP A;  4GC5 A;  4I4L A;  2R4J A;  2WZJ A;  3MHV C;  1LV7 A;  2HAK A;  1E9S A;  2RKO A;  4LJ4 A;  4B7H A;  1N32 M;  2R45 A;  4LF7 M;  5E26 A;  3LQQ A;  2LTU A;  1AIP C;  2C9O A;  3C58 A;  5FTJ A;  1ZMW A;  2AHM A;  2DZO B;  2JWS A;  3SYL A;  3W67 A;  1K3X A;  1FNN A;  3EIE A;  3SMS A;  3CF2 A;  2P5T A;  2UUB M;  3VDP A;  2CE7 A;  2QSF X;  4LRT A;  3DA1 A;  4JI4 M;  3IEC A;  2L4E A;  4WUR A;  3I4V A;  4G6Z A;  2CHG A;  2CHQ A;  1QUS A;  4M9S A;  5EP1 A;  1GVN A;  2BWB A;  2UXD M;  1IN6 A;  1DO2 A;  1TH3 A;  3KFU G;  4IBB A;  1T6O A;  1L1T A;  5EXX A;  5FLX S;  4DR1 M;  4JYA M;  3GQ4 A;  2C9C A;  5EP3 A;  2I7N A;  2F5S A;  5IT9 S;  1T43 A;  4AKG A;  5DYI A;  5ITR A;  2QCU A;  4I81 A;  1NNU C;  1I94 M;  3Q8X A;  1N78 A;  3GLH A;  3NWL A;  4JI6 M;  2KW0 A;  3HU1 A;  3AJI B;  4MGZ E;  4M0D A;  1X37 A;  2NQ8 C;  1KFV A;  1SXJ D;  4IJF A;  1OAO C;  5KPR A;  2ZM6 M;  1NNJ A;  2CV2 A;  1Z6T A;  2CRU A;  2LVP C;  4IJE A;  1QDR A;  3FUX A;  1IY0 A;  3KS4 A;  1KYI A;  1QVR A;  3W0L B;  2XZU A;  2BJV A;  1ORY B;  2GNO A;  2XSZ D;  5DNY A;  3B9P A;  2A5Y B;  2KXE A;  2OOA A;  2XLJ A;  4KO8 A;  1VDD A;  2JNH A;  3PNY A;  2LVA A;  1Z59 A;  5L8R F;  4GHA A;  4LY6 A;  4L8R C;  4LCB A;  1E9R A;  3HHW A;  1WGL A;  3U6O A;  1QDT A;  4GC9 A;  2FNA A;  3HJS A;  4GHL A;  3FUV A;  1TGU A;  1XB2 B;  1XXH E;  1OIZ A;  1W5S A;  4M9X A;  3B7Q A;  5BR8 M;  3ILK A;  1IBL M;  3U6Q A;  4LF5 M;  4PDG A;  1XC8 A;  2DZL A;  1F4I A;  2MH8 A;  2CEA A;  3W68 A;  4XGI A;  3QAU A;  1IN4 A;  2V6Z M;  4G4O A;  1R5L A;  2V1C A;  4Q7J A;  4IBG A;  1L2D A;  4IIW A;  4FCV A;  3U6P A;  4II7 A;  2X8A A;  2HCB A;  5EP4 A;  2FH0 A;  1OIP A;  2O5R A;  1S3S A;  3C3E A;  3I01 M;  1HQY E;  2UXB M;  2F5O A;  1VEG A;  2Y0T A;  1TR8 A;  3HY5 A;  1DV0 A;  4GKK M;  1JB0 F;  3GQ5 A;  4LJ6 A;  5C1B A;  3VLF B;  4GMQ A;  4B7G A;  2C99 A;  2MR9 A;  1EFU B;  2VII A;  3DOA A;  2EO2 A;  3B7Z A;  2DAE A;  4LJA A;  3GLG B;  4DR2 M;  5H37 D;  4L15 A;  2ZAM A;  3GRU A;  1SXJ A;  4GH9 A;  1HT1 E;  1DGB A;  1E94 E;  1VEJ A;  1PJI A;  3V76 A;  5IWA M;  1IQP A;  1PJT A;  3FUT A;  3K2L A;  4OX9 M;  2FE8 A;  3MK6 A;  3FYD A;  3KOX E;  3I4Y A;  2G3Q A;  4JI1 M;  4OW0 A;  3JR5 A;  3KS8 A;  2RGO A;  1GJS A;  2CP8 A;  1NV8 A;  4DUZ M;  1XHB A;  4FD2 A;  5BPV A;  4AZF A;  4DV7 M;  4RF0 A;  2DHR A;  4X65 M;  4NXM M;  3MJ5 A;  2LVQ D;  3SC3 A;  1JR3 A;  1DGG A;  4MGK E;  4LFA M;  1N34 M;  3HGI A;  2K6B A;  2KZS A;  2L7H A;  1L1Z A;  4HEO A;  2F5N A;  4KOD A;  4DV2 M;  3TE6 A;  4JI5 M;  2HWJ A;  3GLF E;  4RKU F;  2EA0 A;  4S12 A;  2Z7J A;  7CAT A;  4OU7 A;  1IN5 A;  4HLQ A;  1GJT A;  2DKL A;  3T1H M;  2QHO B;  1EIJ A;  1CUK A;  1W5T A;  3TQS A;  3U6L A;  2B3T A;  4L4U A;  4P17 A;  2DEN A;  3I51 A;  3LW5 F;  1N77 A;  2XFT A;  2KHH A;  1ZMV A;  2KZU A;  4CIS A;  2LH0 A;  2VQF M;  4QHS A;  5KQD A;  4IBI A;  4IBE A;  5LMN M;  5E6J A;  4DV3 M;  4LFB M;  1QYR A;  4GRI A;  4QNR A;  3UK6 A;  1V33 A;  1IXR C;  3E21 A;  4CIZ A;  4KT0 F;  3U6D A;  4ZPX A;  2LVN C;  4MH0 E;  5FTN A;  4DV0 M;  4DV5 M;  1G41 A;  4L16 A;  2R46 A;  1IXZ A;  1QZM A;  1Q3C A;  3FD9 A;  1D0M A;  3PXG A;  3U6M A;  2KEB A;  3W0F A;  3HZJ A;  3KVW A;  3ZCB B;  4X62 M;  1HR0 M;  3GPX A;  3KSX A;  5IRE B;  3GLH E;  2XF3 A;  3LVW A;  5A2Q S;  4FWH A;  2HL7 A;  3GO8 A;  2DAI A;  1AUA A;  4NRV A;  5KPZ A;  3VDU A;  2XGN A;  1G8P A;  1NY6 A;  1WIV A;  4D82 A;  4YHH M;  2QBY B;  2VDB B;  3FRH A;  3SFZ A;  1WJ7 A;  3HU2 A;  2D7E A;  4LJ9 A;  4OVZ B;  1LTM A;  3THG A;  4Z6Y A;  3J7A S;  4AKH A;  5KO3 A;  1YE9 A;  1VEK A;  1YSY A;  1UM8 A;  4M0W A;  4D81 A;  4AG6 A;  3U60 B;  2UXC M;  4TUW A;  3GPP A;  3H4M A;  3U6S A;  4LJ5 A;  2CHV A;  4B08 A;  3A46 A;  3LCV B;  2L09 A;  1XXH B;  3A45 A;  4MGH A;  2YQZ A;  1PGY A;  2WSC F;  3CGW A;  3QYE A;  4XBO A;  1DGH B;  4DUY M;  2ZBK B;  1HNZ M;  3GLI A;  1HNX M;  2EUC A;  5EXP A;  2JY5 A;  4FW9 A;  4IBD A;  5IZ7 D;  3GPU A;  2ZAO A;  1EE8 A;  3HJ8 A;  1JR3 D;  2K47 A;  3VFD A;  3NBI A;  4DR3 M;  2DWL A;  2FS1 A;  4YY3 M;  5EP2 A;  4DV6 M;  3CTW B;  2LVO C;  1NJF A;  3LVV A;  4Y28 F;  1UFZ A;  3AOE C;  1N75 A;  1L2C A;  3UJN A;  2L6O A;  2Z8Y M;  1WHC A;  1FJG M;  5ITX E;  4MGY E;  4F1I A;  3TWL A;  3KP0 E;  3ZQJ A;  4LF4 M;  2G8L A;  2JUJ A;  1TTE A;  1NHW C;  4QOZ C;  4K0K M;  2Y20 A;  1OQY A;  3U5Z B;  3R9X B;  2UUC M;  4D80 A;  3JR4 A;  5FTM A;  4JN6 A;  2DNA A;  4M9Z A;  4OVZ A;  3FRI A;  2JZ0 A;  1QZE A;  3FUW A;  4FCW A;  3PVS A;  3U60 A;  3AKZ A;  2HKJ A;  3KP1 E;  4B3M M;  2W82 A;  4IBJ A;  4DBG B;  3M7G A;  3SBJ A;  1SXJ E;  1Z5A A;  2JZ1 A;  2OOB A;  3AV0 A;  3BOS A;  3E46 A;  4JI0 M;  4AQY M;  4RNA A;  4NXN M;  3SMP A;  1GL7 A;  2Z4R A;  4R71 A;  1DGH A;  3UGJ A;  2MGW A;  2K0B X;  1VDL A;  4GIT A;  3K1J A;  4B3S M;  3LCU A;  2JP7 A;  2CWB A;  3FTF A;  3CF6 E;  1J09 A;  3SAT A;  2MRO B;  3R8F A;  1GLN A;  2O01 F;  4DR4 M;  2X49 A;  2Y0Q A;  2DXI A;  1TF0 B;  2KNA A;  4RF1 A;  3C3D A;  2KRU A;  1BVS A;  1JR3 E;  2Y21 A;  3L28 A;  3U61 B;  1J7K A;  3CF0 A;  3MMP A;  4LJ8 A;  3WHK A;  1R4G A;  1Q3B A;  2LBC A;  4IBK A;  4FVM A;  3J2P B;  3SHG B;  4EIW A;  3GLF B;  3KOW E;  2UU9 M;  1OFI A;  3GRR A;  1I4W A;  1SG9 A;  3KSJ A;  4QHT A;  2J7N A;  3HJQ A;  4CHT B;  4MGI E;  4X66 M;  2QZ4 A;  2F5P A;  4NRW A;  4KLN A;  1IM2 A;  4P16 A;  1TDZ A;  2OO9 A;  3K8Z A;  3TL4 X;  3SYK A;  4ANR A;  1MJG M;  2CFO A;  3KDS E;  1QAN A;  3SAW A;  1ZMU A;  4L78 A;  4LGY A;  1XMO M;  4NSR A;  3HKP A;  3K92 A;  2XZF A;  2DWM A;  2L2D A;  1HQC A;  2R65 A;  3A98 B;  3VK7 A;  1GAB A;  1DO0 A;  1OAI A;  4NL4 H;  3TWK A;  2MJ5 B;  2G5G X;  2N35 A;  2KNZ A;  4UN2 B;  5FTK A;  1C7Y A;  2O25 A;  2M60 A;  4JI7 M;  4LJ7 A;  2H1R A;  3BXW A;  1HJP A;  2K9D A;  4JXJ A;  1J5E M;  3L25 A;  3KW6 A;  1GO5 A;  2JA2 A;  2JY7 A;  2QNJ A;  2R6F A;  1MX0 A;  3U6E A;  4AI6 A;  4GEW A;  2D7G A;  4PD2 A;  3GLG A;  3GLH B;  1L8Q A;  2FFJ A;  3VKH A;  4LF8 M;  1E32 A;  3KXE C;  4W5W A;  3QWL A;  1V92 A;  1WR1 B;  4I8O A;  4AKI A;  1OJL A;  1N36 M;  3SAU A;  3U61 A;  2LXE A;  1OTR A;  1TH2 A;  2DWZ B;  1D2N A;  2KDL A;  1Q39 A;  3GLF A;  5KQ8 A;  4WP2 A;  4BBA A;  3IG5 A;  3GRV A;  3KOY E;  2VQE M;  1G59 A;  1R7R A;  1QAO A;  1P3Q Q;  1Y8G A;  3DFZ A;  4MB7 A;  2DHY A; 
#chains in the Genus database with same CATH homology
 2JWS A;  2LHG A;  2FS1 A;  1TF0 B;  1GJS A;  1GAB A;  2VDB B;  2J5Y A;  1PRB A;  2MH8 A;  2LHC A;  2N35 A;  1GJT A;  2KDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...