1GABA

Structure of an albumin-binding domain, nmr, 20 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN PAB
publication title Solution structure of the albumin-binding GA module: a versatile bacterial protein domain.
pubmed doi rcsb
source organism Finegoldia magna atcc 29328
molecule tags Albumin-binding protein
total genus 10
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1996-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gabA00
2JWSA 1GJTA 1GABA 2MH8A 1GJSA 2FS1A 2KDLA 1PRBA 2LHGA 1TF0B 2LHCA 2J5YA 2VDBB 2N35A
chains in the Genus database with same CATH superfamily
2XSZD 3T38A 2WSCF 1TH3A 3DFZA 3A98B 4MM3B 4DV7M 2VIIA 1FNNA 3L29A 2FE8A 4BB9A 1YE9A 1K3WA 4BBAA 1NJFA 3HGIA 2BJWA 3C9PA 2I7PA 1QYRA 2A5YB 8CATA 2DWZB 2DAMA 4LG2A 4B08A 5IT9S 4MGKE 2OQ4A 1FJGM 1IM2A 3RGSA 5EXPA 4PDIA 3CF0A 3UGJA 1AUAA 1NNJA 4DV1M 4I5SA 3VFDA 1YLAA 1K82A 1QAMA 3UZUA 1V33A 4II7A 2R6FA 3HJQA 4L4UA 1LV7A 5EP3A 4IBBA 4G4OA 1XXHA 1XC8A 4JV5M 2CWBA 2C99A 3L26A 4B7HA 1HNWM 2MGWA 1PJTA 4IBDA 4GH9A 2L7HA 1KFVA 2CFOA 4W5WA 5JI3E 3DA1A 2M5ZA 5EQTA 3KSJA 3T6PA 4LF9M 4PT5A 1SXJC 1L1TA 4GEWA 3EIEA 2CHGA 4JI1M 1ZMVA 1Z5CA 1HQYE 1J09A 1Z5BA 3HZJA 3M7GA 4IBIA 4RF0A 1F4IA 2Z4SA 3TWLA 1RU3A 3D8BA 1K3XA 1UM8A 2AHMA 2L6OA 2LBCA 4DV4M 3T1HM 4DR4M 1N32M 2LVQD 1VEGA 4WURA 4FWHA 1NHGC 1OIZA 1HNZM 4GC5A 2CV2A 2CP8A 4MB7A 2XH9A 4FCWA 2YR0A 4JI4M 4LF4M 1XHBA 2XFTA 3JR5A 3SBJA 1DGHA 3AFHA 2CUZA 4PD2A 3BOSA 3U5ZB 2DHRA 1D0MA 2B3TA 1XMOM 1ZMWA 2ZTDA 3L27A 1NY6A 4I81A 4JI7M 1GO5A 5KQDA 3VKGA 4AG6A 5DYGA 3U6SA 3SAWA 4NRVA 4QNMA 4B7FA 3QYEA 3FYCA 3B7NA 2VF8A 2HHHM 3IHPA 4LFCM 3GLGA 2UXDM 1H6UA 4L8RC 1MN3A 3VK7A 4DR5M 2Y21A 3C3DA 4AKIA 5FTJA 1TH4A 4WP2A 2JA2A 2BWBA 4GC9A 1XWIA 2L4FA 3AOEC 2Y0TA 2Q2EB 2W82A 2QP9X 1HR0M 3FUUA 3T1YM 5IZ7D 4R71A 2EJSA 1WIVA 1XNQM 1WHCA 2Z8YM 2KNZA 1TDZA 1OQYA 2N35A 4L78A 3L2AA 1PJIA 4KODA 2L7IA 4IBEA 4IJFA 3RE8A 4D82A 4CGYB 2R4JA 3B9PA 3ZQJA 4FD2A 2P5TA 1Z6TA 3W0FA 1KYIA 1NSFA 3KW6A 4LF8M 2O5RA 4F1IA 4JYAM 3CF6E 1IQPA 1IY2A 2R65A 4G3OA 3FTDA 1Z59A 2QHOB 1QAQA 1ZQ9A 1QQWA 5JI2E 2Y20A 1PJQA 1PRBA 1VQ1A 2KZSA 4GKJM 4ITQA 2UUBM 3MHVC 3PXGA 2C9OA 1ZV1A 3HX3A 3I04M 1XXHB 1NV9A 4LJAA 3NWLA 1MX0A 1Q3CA 1DO2A 3FYDA 1UFZA 2VQFM 1WXQA 3J80S 4HLQA 4DR7M 1QDRA 5EP4A 4FW9A 2LVPC 4DR1M 1N75A 1IN4A 4CIZA 5FTLA 2R46A 3HY5A 1DO0A 5IREB 1XMQM 1IN5A 4CISA 4TUWA 3FTCA 3GPUA 2G8LA 3GLFA 4DR6M 1VEJA 3TWMA 2LWXA 3E46A 2KEBA 1JR3A 2G3QA 3FUXA 4X62M 4I4LA 4NRWA 3HJSA 2XEPA 1J5EM 2L09A 2XZUA 3FKEA 1QUTA 4AQYM 1SXJA 2KW0A 3I01M 4M9SA 3M0EA 4P16A 2V6ZM 4ZPXA 2X8AA 3LQQA 3U6OA 4IBCA 2DZNB 3U60A 2DXIA 1TTEA 2RGOA 3HHZA 2KNAA 1R7RA 1R5LA 3LQRA 5ITXE 4G4QA 1AIPC 1OTRA 3H4JA 4DV3M 4KO8A 3ZH9B 5DYIA 1DGHB 1D2NA 1WR1B 5DFLA 1PM5A 4FWDA 3HU1A 3ILKA 5LMNM 1GL6A 2MH8A 2VF7A 3U6QA 3GQ5A 3Q8XA 3AV0A 3J27B 3K8ZA 4Q7JA 3C58A 1WJ7A 4JI6M 1E9RA 2UU9M 4RNAA 2Z4RA 4Z6YA 3U6DA 1L2CA 2QSFX 4ANRA 3UK6A 1QAOA 3FUVA 3W67A 5C18A 1ORYB 1D0LA 1HT2E 4EIWA 3GLGB 1L2BA 1IFYA 4LCBA 1T3TA 2BNKA 2KA6B 1L2DA 3SHFA 4M0DA 1QVRA 3TE6A 2JY7A 4OU7A 2WSEF 1XNRM 2F5OA 4NXMM 4P17A 1VDLA 4IBFA 5ITUA 1LTMA 4IBKA 4LF7M 1JB0F 1EFUB 2MR9A 2RKOA 3LCVB 1MU5A 3SATA 2DWLA 4NL4H 3GP1A 5A2QS 2HL7A 3AOEA 3AJIB 2QPAA 5E26A 3B7ZA 4GHAA 1NV8A 1SG9A 3IG5A 2XLJA 3SYLA 1MJGM 4CHTB 3M6AA 1QANA 4PCZA 5L8RF 3KXEC 3HHYA 1A5TA 1NO1A 4GKKM 1N33M 4DBGB 2APLA 4QOSA 4LJ5A 2ZM6M 2V1UA 3CGWA 2FS1A 3KP1E 2D7EA 2DAEA 4JI3M 3L28A 3VKHA 1IBKM 1TF0B 2MJ5B 2QCUA 3TL4X 3W68A 2LVNC 4MGIE 5EXXA 2EKFA 4R3DA 1NJGA 1PGYA 2OOAA 5EJCA 5EP2A 3RGPA 3U6LA 5ITRA 3R9XB 1G4AE 4OVZA 1V34A 2J7OA 1L8QA 5F3WA 1GJTA 3VLFB 3QAUA 1IN7A 4F2LA 4GITA 2R4EA 4JN6A 3R8FA 4AKGA 3A42A 2J7NA 3GQ3A 2XZFA 1QZEA 2QNJA 4GHLA 1GVNA 1Q39A 2H1RA 3F92A 1G59A 3MJ5A 3GLIB 4K0KM 5KPZA 3GLFB 4FCVA 3B89A 2MROB 3K92A 2BJVA 3PVSA 1S3SA 3GPPA 3HU3A 1E9SA 3OTOM 4LJ4A 2DNAA 2CRUA 3B7QA 3HU2A 4AZFA 3W0LB 1L1ZA 2ZANA 1N34M 4RF1A 3SMSA 1SXJB 2LVOC 3A45A 3PFIA 4OX9M 1IY0A 3THGA 2I7NA 3KFUG 5LMUM 1XB2B 2Y0QA 3BXWA 2K9DA 2FFJA 3U60B 1HT1E 2ZTCA 5EP1A 1OAIA 3FRHA 1BVSA 4GMQA 2ZAOA 3BBZA 3J7BA 2QQ8A 4I8OA 3GO8A 3UMMA 3FE3A 1GJSA 4DV6M 3KVWA 4CJ6A 3HHWA 2UUCM 1IN8A 2DAKA 4MGZE 3SAUA 4LY6A 3JR4A 4B7GA 3I4VA 3FUWA 1NNUC 2R0IA 4LJ9A 1DV0A 4LRTA 4LGYA 2FH0A 2DHYA 3D8LA 2O25A 3RFWA 3AKZA 2L4EA 3LCUA 4DV0M 2DI0A 3HHXA 4L15A 1T43A 4JI2M 3H4MA 3FUTA 2CEAA 4FWGA 4KHPM 5IWAM 2CV1A 1JR3D 2JY8A 4G6ZA 1X37A 5BPVA 3ZCBB 1J7KA 4QHTA 4D80A 1YUBA 2DKLA 2GNOA 1SXJD 1Q02A 2Z3XA 3IG8A 4KT0F 4XGIA 1IXSA 5KO3A 4DUZM 2F5SA 1EIJA 4NC6A 1R2YA 2QZ4A 1QZMA 1VDDA 3TQSA 2LHCA 2VQEM 2K0BX 3FTEA 3B74A 2KNVA 1W5TA 4AKHA 1I4WA 3UJNA 2JY6B 1NHWC 2EA0A 1P3QQ 3KS4A 4Y28F 1QDTA 3SYKA 2X4AA 2JUJA 3I51A 1W5SA 4Z8XA 2EUCA 1N78A 2FNAA 1TH2A 2H5XA 2JZ1A 1TDHA 3WHLA 3SMPA 2X49A 3SFZA 3I4YA 3WHKA 5FTKA 4AW4A 1Y8GA 2CHVA 4R7GA 2D7HA 1DGBA 3KOYE 4JI0M 4X64M 2OPFA 4B3MM 4OVZB 1OFIA 1TR8A 1PJJA 2VDBB 4GIPA 3VDUA 4REZA 2KHHA 2LTUA 4LJ7A 3FRIA 5KQ8A 1IBLM 2HCBA 1NVMA 2F5PA 1QUSA 3KS8A 2UXBM 3GLHE 3HKPA 3LVVA 7CATA 1HJPA 1N36M 3GRUA 4L16A 4IIWA 1ZAEA 4NSOB 4LZZA 2CHQA 4LZJA 2DZOB 2M60A 1I94M 1GL7A 1GLNA 2O01F 4HEOA 4LGMA 1G71A 3QWLA 2F5QA 5GKNA 3GPYA 2DAGA 3U6PA 4B3TM 2QENA 5BR8M 2XSZA 4UN2B 1VEKA 2HKJA 4M0WA 4DR3M 2JNHA 3VK8A 1T6OA 2WZJA 2YQZA 3EIHA 1IBMM 2JP7A 4MGHA 2LXEA 4X66M 5KPTA 2LHGA 3CTWB 2FOIC 4NXNM 3LMMA 4KLNA 3GLGE 3U6EA 2JY5A 4OW0A 3KOWE 5FLXS 3Q8GA 1G8PA 4NOOB 3GPXA 1PJSA 3J81S 4DUYM 2UXCM 1IY1A 3NBIA 2JZ0A 2KDLA 3K9PA 1WGNA 4L6V6 3U61A 3SARA 1GKIA 5ITXA 3LW5F 1ZMUA 3GRRA 3KDSE 2JWSA 2G5GX 4WW0A 3SASA 4GRIA 2ZBKB 4LF5M 5ITQA 2LVAA 2DENA 4B3RM 2CE7A 4LJ6A 4MH0E 1OJLA 1YSYA 4MGYE 3K2LA 3GLHA 4LFAM 2KRUA 5ITYA 2QBYA 1OKSA 2HWJA 1D0KA 1IXRC 1R2ZA 2ZAMA 5ITTA 3IECA 4QOZC 4AI6A 2Z7JA 2R44A 4IBJA 1IXSB 1OFHA 3JAMS 5KPRA 3SC3A 1Q3BA 4X65M 1OIPA 3FD9A 4IBGA 4A3VB 2ERCA 4DV2M 4AG5A 3CF2A 1C1KA 4LJ8A 2F4VM 3E21A 1E94E 2C98A 2KRKA 3E4RA 3GRVA 4HL4A 4LF6M 3DOAA 3NBXX 2HAKA 1R4GA 2K47A 2DWMA 5FTNA 3SHGB 5H37D 3V76A 2LNHC 4RKUF 4D81A 4G4RA 3ZC7B 2BWEA 2EO2A 3TPZA 3QYBA 1N77A 2YNMD 5E6JA 2L2DA 5C1BA 2E5LM 2F5NA 3HWSA 4DR2M 3GLIE 3U6CA 5EXTA 3GLFE 3KOXE 1IN6A 3PNVA 5FSWA 4DV5M 1JR3E 2EKKA 4YY3M 3KP0E 3VDPA 1DGFA 3L25A 2R62A 1SXJE 2YFQA 4XK8F 2K6BA 2J5YA 2UUAM 1IXZA 4S12A 2R45A 1HQCA 1TGUA 3A46A 2C5RA 4LFBM 3PNYA 4G4NA 3J7AS 1E32A 1GABA 4JI8M 3MK6A 2NQ8C 2WSFF 5FTMA 3KSXA 2D7GA 1CUKA 2DAIA 1NY5A 1EE8A 3FTFA 4M9ZA 2C96A 2JXNA 1G41A 4XBOA 5EXSA 3T15A 3U5ZA 4NSRA 2LH0A 3HJ8A 1HNXM 3E9SA 3GRYA 3K9OA 1XXHE 2KZUA 4JXJA 2RGHA 4QHSA 1OAOC 1DGGA 2XFSA 4YHHM 3KOZE 3C3EA 2C9CA 4QNRA 3K1JA 4B3SM 2OOBA 3DZDA 2XGNA 2KXEA 1WGLA 1Z5AA 2V1CA 3MMPA 4LRSA 4M9XA 1JQJC 2RRUA 3GQ4A 3U6MA 3U61B 4JI5M 2DVWB 4FCTA 3GLIA 3AOGA 1R6BX 1C7YA 3J2PB 3TWKA 2DWNA 3LVWA 1V92A 1KSFX 2DZLA 2XF3A 2CV0A 1G3IA 4FVMA 4PDGA 3SAVA 2GQFA 2R18A 4IJEA 3AL0C 5DNYA 3GLHB 2QBYB 4BLCA 1VG5A 2OO9A
chains in the Genus database with same CATH topology
2JWSA 1GJTA 1GABA 2MH8A 1GJSA 2FS1A 2KDLA 1PRBA 2LHGA 1TF0B 2LHCA 2J5YA 2VDBB 2N35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWS A;  1GJT A;  1GAB A;  2MH8 A;  1GJS A;  2FS1 A;  2KDL A;  1PRB A;  2LHG A;  1TF0 B;  2LHC A;  2J5Y A;  2VDB B;  2N35 A; 
#chains in the Genus database with same CATH topology
 2XSZ D;  3T38 A;  2WSC F;  1TH3 A;  3DFZ A;  3A98 B;  4MM3 B;  4DV7 M;  2VII A;  1FNN A;  3L29 A;  2FE8 A;  4BB9 A;  1YE9 A;  1K3W A;  4BBA A;  1NJF A;  3HGI A;  2BJW A;  3C9P A;  2I7P A;  1QYR A;  2A5Y B;  8CAT A;  2DWZ B;  2DAM A;  4LG2 A;  4B08 A;  5IT9 S;  4MGK E;  2OQ4 A;  1FJG M;  1IM2 A;  3RGS A;  5EXP A;  4PDI A;  3CF0 A;  3UGJ A;  1AUA A;  1NNJ A;  4DV1 M;  4I5S A;  3VFD A;  1YLA A;  1K82 A;  1QAM A;  3UZU A;  1V33 A;  4II7 A;  2R6F A;  3HJQ A;  4L4U A;  1LV7 A;  5EP3 A;  4IBB A;  4G4O A;  1XXH A;  1XC8 A;  4JV5 M;  2CWB A;  2C99 A;  3L26 A;  4B7H A;  1HNW M;  2MGW A;  1PJT A;  4IBD A;  4GH9 A;  2L7H A;  1KFV A;  2CFO A;  4W5W A;  5JI3 E;  3DA1 A;  2M5Z A;  5EQT A;  3KSJ A;  3T6P A;  4LF9 M;  4PT5 A;  1SXJ C;  1L1T A;  4GEW A;  3EIE A;  2CHG A;  4JI1 M;  1ZMV A;  1Z5C A;  1HQY E;  1J09 A;  1Z5B A;  3HZJ A;  3M7G A;  4IBI A;  4RF0 A;  1F4I A;  2Z4S A;  3TWL A;  1RU3 A;  3D8B A;  1K3X A;  1UM8 A;  2AHM A;  2L6O A;  2LBC A;  4DV4 M;  3T1H M;  4DR4 M;  1N32 M;  2LVQ D;  1VEG A;  4WUR A;  4FWH A;  1NHG C;  1OIZ A;  1HNZ M;  4GC5 A;  2CV2 A;  2CP8 A;  4MB7 A;  2XH9 A;  4FCW A;  2YR0 A;  4JI4 M;  4LF4 M;  1XHB A;  2XFT A;  3JR5 A;  3SBJ A;  1DGH A;  3AFH A;  2CUZ A;  4PD2 A;  3BOS A;  3U5Z B;  2DHR A;  1D0M A;  2B3T A;  1XMO M;  1ZMW A;  2ZTD A;  3L27 A;  1NY6 A;  4I81 A;  4JI7 M;  1GO5 A;  5KQD A;  3VKG A;  4AG6 A;  5DYG A;  3U6S A;  3SAW A;  4NRV A;  4QNM A;  4B7F A;  3QYE A;  3FYC A;  3B7N A;  2VF8 A;  2HHH M;  3IHP A;  4LFC M;  3GLG A;  2UXD M;  1H6U A;  4L8R C;  1MN3 A;  3VK7 A;  4DR5 M;  2Y21 A;  3C3D A;  4AKI A;  5FTJ A;  1TH4 A;  4WP2 A;  2JA2 A;  2BWB A;  4GC9 A;  1XWI A;  2L4F A;  3AOE C;  2Y0T A;  2Q2E B;  2W82 A;  2QP9 X;  1HR0 M;  3FUU A;  3T1Y M;  5IZ7 D;  4R71 A;  2EJS A;  1WIV A;  1XNQ M;  1WHC A;  2Z8Y M;  2KNZ A;  1TDZ A;  1OQY A;  2N35 A;  4L78 A;  3L2A A;  1PJI A;  4KOD A;  2L7I A;  4IBE A;  4IJF A;  3RE8 A;  4D82 A;  4CGY B;  2R4J A;  3B9P A;  3ZQJ A;  4FD2 A;  2P5T A;  1Z6T A;  3W0F A;  1KYI A;  1NSF A;  3KW6 A;  4LF8 M;  2O5R A;  4F1I A;  4JYA M;  3CF6 E;  1IQP A;  1IY2 A;  2R65 A;  4G3O A;  3FTD A;  1Z59 A;  2QHO B;  1QAQ A;  1ZQ9 A;  1QQW A;  5JI2 E;  2Y20 A;  1PJQ A;  1PRB A;  1VQ1 A;  2KZS A;  4GKJ M;  4ITQ A;  2UUB M;  3MHV C;  3PXG A;  2C9O A;  1ZV1 A;  3HX3 A;  3I04 M;  1XXH B;  1NV9 A;  4LJA A;  3NWL A;  1MX0 A;  1Q3C A;  1DO2 A;  3FYD A;  1UFZ A;  2VQF M;  1WXQ A;  3J80 S;  4HLQ A;  4DR7 M;  1QDR A;  5EP4 A;  4FW9 A;  2LVP C;  4DR1 M;  1N75 A;  1IN4 A;  4CIZ A;  5FTL A;  2R46 A;  3HY5 A;  1DO0 A;  5IRE B;  1XMQ M;  1IN5 A;  4CIS A;  4TUW A;  3FTC A;  3GPU A;  2G8L A;  3GLF A;  4DR6 M;  1VEJ A;  3TWM A;  2LWX A;  3E46 A;  2KEB A;  1JR3 A;  2G3Q A;  3FUX A;  4X62 M;  4I4L A;  4NRW A;  3HJS A;  2XEP A;  1J5E M;  2L09 A;  2XZU A;  3FKE A;  1QUT A;  4AQY M;  1SXJ A;  2KW0 A;  3I01 M;  4M9S A;  3M0E A;  4P16 A;  2V6Z M;  4ZPX A;  2X8A A;  3LQQ A;  3U6O A;  4IBC A;  2DZN B;  3U60 A;  2DXI A;  1TTE A;  2RGO A;  3HHZ A;  2KNA A;  1R7R A;  1R5L A;  3LQR A;  5ITX E;  4G4Q A;  1AIP C;  1OTR A;  3H4J A;  4DV3 M;  4KO8 A;  3ZH9 B;  5DYI A;  1DGH B;  1D2N A;  1WR1 B;  5DFL A;  1PM5 A;  4FWD A;  3HU1 A;  3ILK A;  5LMN M;  1GL6 A;  2MH8 A;  2VF7 A;  3U6Q A;  3GQ5 A;  3Q8X A;  3AV0 A;  3J27 B;  3K8Z A;  4Q7J A;  3C58 A;  1WJ7 A;  4JI6 M;  1E9R A;  2UU9 M;  4RNA A;  2Z4R A;  4Z6Y A;  3U6D A;  1L2C A;  2QSF X;  4ANR A;  3UK6 A;  1QAO A;  3FUV A;  3W67 A;  5C18 A;  1ORY B;  1D0L A;  1HT2 E;  4EIW A;  3GLG B;  1L2B A;  1IFY A;  4LCB A;  1T3T A;  2BNK A;  2KA6 B;  1L2D A;  3SHF A;  4M0D A;  1QVR A;  3TE6 A;  2JY7 A;  4OU7 A;  2WSE F;  1XNR M;  2F5O A;  4NXM M;  4P17 A;  1VDL A;  4IBF A;  5ITU A;  1LTM A;  4IBK A;  4LF7 M;  1JB0 F;  1EFU B;  2MR9 A;  2RKO A;  3LCV B;  1MU5 A;  3SAT A;  2DWL A;  4NL4 H;  3GP1 A;  5A2Q S;  2HL7 A;  3AOE A;  3AJI B;  2QPA A;  5E26 A;  3B7Z A;  4GHA A;  1NV8 A;  1SG9 A;  3IG5 A;  2XLJ A;  3SYL A;  1MJG M;  4CHT B;  3M6A A;  1QAN A;  4PCZ A;  5L8R F;  3KXE C;  3HHY A;  1A5T A;  1NO1 A;  4GKK M;  1N33 M;  4DBG B;  2APL A;  4QOS A;  4LJ5 A;  2ZM6 M;  2V1U A;  3CGW A;  2FS1 A;  3KP1 E;  2D7E A;  2DAE A;  4JI3 M;  3L28 A;  3VKH A;  1IBK M;  1TF0 B;  2MJ5 B;  2QCU A;  3TL4 X;  3W68 A;  2LVN C;  4MGI E;  5EXX A;  2EKF A;  4R3D A;  1NJG A;  1PGY A;  2OOA A;  5EJC A;  5EP2 A;  3RGP A;  3U6L A;  5ITR A;  3R9X B;  1G4A E;  4OVZ A;  1V34 A;  2J7O A;  1L8Q A;  5F3W A;  1GJT A;  3VLF B;  3QAU A;  1IN7 A;  4F2L A;  4GIT A;  2R4E A;  4JN6 A;  3R8F A;  4AKG A;  3A42 A;  2J7N A;  3GQ3 A;  2XZF A;  1QZE A;  2QNJ A;  4GHL A;  1GVN A;  1Q39 A;  2H1R A;  3F92 A;  1G59 A;  3MJ5 A;  3GLI B;  4K0K M;  5KPZ A;  3GLF B;  4FCV A;  3B89 A;  2MRO B;  3K92 A;  2BJV A;  3PVS A;  1S3S A;  3GPP A;  3HU3 A;  1E9S A;  3OTO M;  4LJ4 A;  2DNA A;  2CRU A;  3B7Q A;  3HU2 A;  4AZF A;  3W0L B;  1L1Z A;  2ZAN A;  1N34 M;  4RF1 A;  3SMS A;  1SXJ B;  2LVO C;  3A45 A;  3PFI A;  4OX9 M;  1IY0 A;  3THG A;  2I7N A;  3KFU G;  5LMU M;  1XB2 B;  2Y0Q A;  3BXW A;  2K9D A;  2FFJ A;  3U60 B;  1HT1 E;  2ZTC A;  5EP1 A;  1OAI A;  3FRH A;  1BVS A;  4GMQ A;  2ZAO A;  3BBZ A;  3J7B A;  2QQ8 A;  4I8O A;  3GO8 A;  3UMM A;  3FE3 A;  1GJS A;  4DV6 M;  3KVW A;  4CJ6 A;  3HHW A;  2UUC M;  1IN8 A;  2DAK A;  4MGZ E;  3SAU A;  4LY6 A;  3JR4 A;  4B7G A;  3I4V A;  3FUW A;  1NNU C;  2R0I A;  4LJ9 A;  1DV0 A;  4LRT A;  4LGY A;  2FH0 A;  2DHY A;  3D8L A;  2O25 A;  3RFW A;  3AKZ A;  2L4E A;  3LCU A;  4DV0 M;  2DI0 A;  3HHX A;  4L15 A;  1T43 A;  4JI2 M;  3H4M A;  3FUT A;  2CEA A;  4FWG A;  4KHP M;  5IWA M;  2CV1 A;  1JR3 D;  2JY8 A;  4G6Z A;  1X37 A;  5BPV A;  3ZCB B;  1J7K A;  4QHT A;  4D80 A;  1YUB A;  2DKL A;  2GNO A;  1SXJ D;  1Q02 A;  2Z3X A;  3IG8 A;  4KT0 F;  4XGI A;  1IXS A;  5KO3 A;  4DUZ M;  2F5S A;  1EIJ A;  4NC6 A;  1R2Y A;  2QZ4 A;  1QZM A;  1VDD A;  3TQS A;  2LHC A;  2VQE M;  2K0B X;  3FTE A;  3B74 A;  2KNV A;  1W5T A;  4AKH A;  1I4W A;  3UJN A;  2JY6 B;  1NHW C;  2EA0 A;  1P3Q Q;  3KS4 A;  4Y28 F;  1QDT A;  3SYK A;  2X4A A;  2JUJ A;  3I51 A;  1W5S A;  4Z8X A;  2EUC A;  1N78 A;  2FNA A;  1TH2 A;  2H5X A;  2JZ1 A;  1TDH A;  3WHL A;  3SMP A;  2X49 A;  3SFZ A;  3I4Y A;  3WHK A;  5FTK A;  4AW4 A;  1Y8G A;  2CHV A;  4R7G A;  2D7H A;  1DGB A;  3KOY E;  4JI0 M;  4X64 M;  2OPF A;  4B3M M;  4OVZ B;  1OFI A;  1TR8 A;  1PJJ A;  2VDB B;  4GIP A;  3VDU A;  4REZ A;  2KHH A;  2LTU A;  4LJ7 A;  3FRI A;  5KQ8 A;  1IBL M;  2HCB A;  1NVM A;  2F5P A;  1QUS A;  3KS8 A;  2UXB M;  3GLH E;  3HKP A;  3LVV A;  7CAT A;  1HJP A;  1N36 M;  3GRU A;  4L16 A;  4IIW A;  1ZAE A;  4NSO B;  4LZZ A;  2CHQ A;  4LZJ A;  2DZO B;  2M60 A;  1I94 M;  1GL7 A;  1GLN A;  2O01 F;  4HEO A;  4LGM A;  1G71 A;  3QWL A;  2F5Q A;  5GKN A;  3GPY A;  2DAG A;  3U6P A;  4B3T M;  2QEN A;  5BR8 M;  2XSZ A;  4UN2 B;  1VEK A;  2HKJ A;  4M0W A;  4DR3 M;  2JNH A;  3VK8 A;  1T6O A;  2WZJ A;  2YQZ A;  3EIH A;  1IBM M;  2JP7 A;  4MGH A;  2LXE A;  4X66 M;  5KPT A;  2LHG A;  3CTW B;  2FOI C;  4NXN M;  3LMM A;  4KLN A;  3GLG E;  3U6E A;  2JY5 A;  4OW0 A;  3KOW E;  5FLX S;  3Q8G A;  1G8P A;  4NOO B;  3GPX A;  1PJS A;  3J81 S;  4DUY M;  2UXC M;  1IY1 A;  3NBI A;  2JZ0 A;  2KDL A;  3K9P A;  1WGN A;  4L6V 6;  3U61 A;  3SAR A;  1GKI A;  5ITX A;  3LW5 F;  1ZMU A;  3GRR A;  3KDS E;  2JWS A;  2G5G X;  4WW0 A;  3SAS A;  4GRI A;  2ZBK B;  4LF5 M;  5ITQ A;  2LVA A;  2DEN A;  4B3R M;  2CE7 A;  4LJ6 A;  4MH0 E;  1OJL A;  1YSY A;  4MGY E;  3K2L A;  3GLH A;  4LFA M;  2KRU A;  5ITY A;  2QBY A;  1OKS A;  2HWJ A;  1D0K A;  1IXR C;  1R2Z A;  2ZAM A;  5ITT A;  3IEC A;  4QOZ C;  4AI6 A;  2Z7J A;  2R44 A;  4IBJ A;  1IXS B;  1OFH A;  3JAM S;  5KPR A;  3SC3 A;  1Q3B A;  4X65 M;  1OIP A;  3FD9 A;  4IBG A;  4A3V B;  2ERC A;  4DV2 M;  4AG5 A;  3CF2 A;  1C1K A;  4LJ8 A;  2F4V M;  3E21 A;  1E94 E;  2C98 A;  2KRK A;  3E4R A;  3GRV A;  4HL4 A;  4LF6 M;  3DOA A;  3NBX X;  2HAK A;  1R4G A;  2K47 A;  2DWM A;  5FTN A;  3SHG B;  5H37 D;  3V76 A;  2LNH C;  4RKU F;  4D81 A;  4G4R A;  3ZC7 B;  2BWE A;  2EO2 A;  3TPZ A;  3QYB A;  1N77 A;  2YNM D;  5E6J A;  2L2D A;  5C1B A;  2E5L M;  2F5N A;  3HWS A;  4DR2 M;  3GLI E;  3U6C A;  5EXT A;  3GLF E;  3KOX E;  1IN6 A;  3PNV A;  5FSW A;  4DV5 M;  1JR3 E;  2EKK A;  4YY3 M;  3KP0 E;  3VDP A;  1DGF A;  3L25 A;  2R62 A;  1SXJ E;  2YFQ A;  4XK8 F;  2K6B A;  2J5Y A;  2UUA M;  1IXZ A;  4S12 A;  2R45 A;  1HQC A;  1TGU A;  3A46 A;  2C5R A;  4LFB M;  3PNY A;  4G4N A;  3J7A S;  1E32 A;  1GAB A;  4JI8 M;  3MK6 A;  2NQ8 C;  2WSF F;  5FTM A;  3KSX A;  2D7G A;  1CUK A;  2DAI A;  1NY5 A;  1EE8 A;  3FTF A;  4M9Z A;  2C96 A;  2JXN A;  1G41 A;  4XBO A;  5EXS A;  3T15 A;  3U5Z A;  4NSR A;  2LH0 A;  3HJ8 A;  1HNX M;  3E9S A;  3GRY A;  3K9O A;  1XXH E;  2KZU A;  4JXJ A;  2RGH A;  4QHS A;  1OAO C;  1DGG A;  2XFS A;  4YHH M;  3KOZ E;  3C3E A;  2C9C A;  4QNR A;  3K1J A;  4B3S M;  2OOB A;  3DZD A;  2XGN A;  2KXE A;  1WGL A;  1Z5A A;  2V1C A;  3MMP A;  4LRS A;  4M9X A;  1JQJ C;  2RRU A;  3GQ4 A;  3U6M A;  3U61 B;  4JI5 M;  2DVW B;  4FCT A;  3GLI A;  3AOG A;  1R6B X;  1C7Y A;  3J2P B;  3TWK A;  2DWN A;  3LVW A;  1V92 A;  1KSF X;  2DZL A;  2XF3 A;  2CV0 A;  1G3I A;  4FVM A;  4PDG A;  3SAV A;  2GQF A;  2R18 A;  4IJE A;  3AL0 C;  5DNY A;  3GLH B;  2QBY B;  4BLC A;  1VG5 A;  2OO9 A; 
#chains in the Genus database with same CATH homology
 2JWS A;  1GJT A;  1GAB A;  2MH8 A;  1GJS A;  2FS1 A;  2KDL A;  1PRB A;  2LHG A;  1TF0 B;  2LHC A;  2J5Y A;  2VDB B;  2N35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...