1GABA

Structure of an albumin-binding domain, nmr, 20 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the albumin-binding GA module: a versatile bacterial protein domain.
pubmed doi rcsb
source organism Finegoldia magna atcc 29328
molecule tags Albumin-binding protein
molecule keywords PROTEIN PAB
total genus 10
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1996-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gabA00
1GJTA 1PRBA 2FS1A 2J5YA 2N35A 2VDBB 2JWSA 1GJSA 2MH8A 2LHCA 1GABA 2KDLA 1TF0B 2LHGA
chains in the Genus database with same CATH superfamily
3TQSA 3SAWA 2NQ8C 4A3VB 2K9DA 4PDGA 3KW6A 3MK6A 4X65M 1G3IA 3C9PA 2MJ5B 2Y20A 2EKFA 3HHYA 5FLXS 2QHOB 1NY5A 1MX0A 4IBGA 4JYAM 5EP4A 3HX3A 2R62A 4CJ6A 3I51A 3RFWA 2CHVA 2WSCF 3D8LA 4IJEA 3H4MA 1EE8A 5LMUM 3HWSA 4AW4A 2OOAA 1GLNA 1C7YA 3GLIE 3K92A 3GLGB 3I4VA 5EXXA 1OAIA 4LJ7A 3GQ3A 1OFHA 3PFIA 1ZMWA 1TDHA 1GL7A 2KNZA 2P5TA 3SMPA 4DV1M 3FUUA 4HL4A 4FW9A 1HR0M 3E21A 2N35A 2OPFA 1DO0A 4DV0M 2DVWB 3QAUA 4GC9A 3FD9A 2FOIC 3HGIA 1QQWA 4B3TM 1SG9A 2R0IA 1QYRA 2VF8A 3HU3A 1NHWC 4M0DA 3VDPA 3R9XB 1IN4A 3GQ4A 4IJFA 4M9XA 3OTOM 1F4IA 2I7PA 4M9ZA 4GITA 1GO5A 3WHLA 4II7A 1XXHA 1DGHA 1T6OA 1YLAA 4XBOA 1PJJA 4LF4M 2F4VM 4NSRA 2Y0TA 4G6ZA 3L28A 4AKGA 1IBLM 2KW0A 3TPZA 1XC8A 2KDLA 2KXEA 3L27A 1PJTA 2J7OA 1E9SA 4RKUF 2K6BA 2QBYA 3CTWB 4ZPXA 1N33M 3U6CA 2CUZA 2WSEF 3B7QA 1NSFA 1Z59A 2FE8A 3HHZA 4GMQA 3TWMA 1K3XA 2DWLA 3PNVA 3U6EA 1QDTA 3GLHE 3PXGA 2VQFM 2UUCM 1XB2B 1IN6A 2C99A 2KNVA 3Q8GA 3L26A 4MH0E 1MU5A 2UXBM 2O01F 1GKIA 3JR5A 2LHGA 4BBAA 4HLQA 1XMQM 3VK7A 2LVPC 7CATA 3GPPA 1GVNA 4GHLA 1R6BX 3HJ8A 4R7GA 3J81S 5F3WA 1UFZA 3AJIB 4IBIA 1EIJA 2DWMA 1PJIA 4K0KM 1IN8A 4DV7M 1Q3BA 1WGNA 2DZOB 2JNHA 3HHWA 1T3TA 4LY6A 2Z3XA 1V92A 1TDZA 2DNAA 4FD2A 2R6FA 3T38A 2F5OA 1J7KA 4FWHA 4BLCA 4IBEA 1DO2A 1L1ZA 2R4JA 2W82A 3FYCA 1ZQ9A 5E6JA 1G71A 3CF2A 1Q3CA 3J80S 2ERCA 3W67A 4LF7M 4B08A 3M7GA 2JY8A 3T6PA 1T43A 4LJ8A 3E4RA 1PGYA 4I4LA 2GNOA 4G3OA 2LVOC 1IY1A 1VEJA 2QP9X 2XFSA 3KXEC 4FVMA 3VDUA 1NY6A 3THGA 2MH8A 2K47A 1UM8A 3L25A 3KP1E 2XGNA 4DBGB 3LCUA 2R45A 5KPZA 1W5TA 4L15A 5A2QS 1JB0F 2R4EA 2V6ZM 3AOEA 4I5SA 2UUAM 2UU9M 4LG2A 3K1JA 4AI6A 2O25A 2Z4SA 2KRUA 2L09A 1HQCA 1VDDA 4R3DA 2ZM6M 3SMSA 3GLIB 4GEWA 2KZUA 1HNWM 4JI7M 1TH2A 3DA1A 1FNNA 2LNHC 4LCBA 1P3QQ 3PNYA 5ITYA 5ITTA 3KOXE 2RGOA 2ZANA 4I81A 2BWEA 2D7HA 2J7NA 3AOEC 2YNMD 4HEOA 3ZH9B 4LJ4A 5ITUA 3GQ5A 1PJQA 3VK8A 3V76A 1I94M 2XEPA 5LMNM 2VF7A 3L29A 2CWBA 2GQFA 5DFLA 2EUCA 3AFHA 1N32M 1G4AE 1IXZA 2V1UA 4GH9A 4LZJA 3TL4X 1NJGA 3U60B 2L2DA 3GRYA 1AUAA 4IBJA 5BR8M 2R44A 1QVRA 3BBZA 1SXJB 3FTDA 4MB7A 3U60A 1IY2A 4CIZA 1TGUA 2UUBM 3TWLA 4DV5M 3U6MA 5EXTA 2HL7A 4B7GA 1C1KA 2XZUA 1KYIA 3TE6A 2ZAOA 3CF6E 4IBBA 2C5RA 4W5WA 1IXRC 2FH0A 5KPRA 4DV4M 2F5SA 4LF8M 4TUWA 3SYKA 4FCVA 4RNAA 4QOZC 3VLFB 1NJFA 4P17A 1IBMM 1PM5A 1OTRA 2L4FA 2F5PA 5JI3E 1GJSA 3QWLA 4JI3M 2LVQD 3SARA 3FTEA 4AZFA 4OVZA 2R18A 4D80A 2LH0A 2BJWA 1IXSB 2DAMA 2ZTCA 4S12A 3W68A 2DHYA 4L8RC 1W5SA 1A5TA 3K9PA 4G4QA 1NO1A 3NWLA 4PT5A 3FUWA 4QOSA 3K9OA 1NHGC 5FTMA 2RGHA 2C96A 2JY5A 4XK8F 2BWBA 4M0WA 3H4JA 1LTMA 3T1YM 2LWXA 4GC5A 4LGMA 2OQ4A 1K3WA 1SXJA 2UXDM 1ZMUA 4NL4H 4B7FA 3UJNA 2L6OA 2Y0QA 3ZCBB 1PRBA 2MROB 2DWZB 1D0MA 3Q8XA 2L7IA 4FCWA 1IN7A 3SHGB 5C18A 3AKZA 4JI5M 1V34A 1E9RA 1QANA 4OU7A 4FWDA 4DR5M 1DGFA 5IT9S 1TH3A 2JZ0A 2XH9A 3GLHB 4BB9A 1BVSA 1R7RA 3SYLA 3L2AA 3GLFE 1WIVA 3KOWE 3KOZE 4G4RA 4QNMA 5EP1A 3U6SA 3SC3A 2FS1A 1VEGA 2O5RA 4DR2M 1N78A 3DFZA 3LVVA 3LMMA 1MN3A 3HZJA 4DV2M 2JA2A 1MJGM 3VFDA 4F1IA 3GLIA 4G4NA 4XGIA 2EO2A 2XSZD 3BOSA 3CF0A 3FRIA 4P16A 5E26A 3TWKA 4F2LA 4DR3M 2VQEM 1PJSA 1SXJD 1JQJC 1NNJA 4AG5A 2M60A 3B7NA 2A5YB 4LJ6A 3UK6A 4LRSA 3IHPA 3LW5F 3U6QA 2RKOA 2UXCM 1XXHB 2DKLA 5ITXA 3KS4A 2CV2A 1FJGM 3GLGA 1ZMVA 4KHPM 1Z6TA 1XMOM 3PVSA 3M6AA 4ANRA 4JI6M 1QAQA 3KS8A 2X49A 3FKEA 1R2YA 2DWNA 1Z5AA 2MGWA 4MGHA 5EQTA 2C9OA 4NC6A 5DYGA 3FRHA 5EP3A 3U6DA 1JR3D 3UZUA 1E32A 1L8QA 4X62M 2FFJA 3GPXA 1ORYB 4LRTA 3DZDA 2EJSA 4PD2A 2LTUA 1Q39A 1L2BA 4I8OA 1R2ZA 3RGPA 3U5ZB 1OIZA 2R65A 1KFVA 1J09A 5IZ7D 2QNJA 2YFQA 1WGLA 1XXHE 2G3QA 3GRUA 1TTEA 2CHQA 3J7BA 3KP0E 2CHGA 4KODA 5ITXE 2CE7A 3GO8A 4JV5M 2DZLA 2JY6B 4WW0A 5JI2E 1OAOC 1YUBA 2DZNB 3I01M 2VIIA 4LFAM 2D7GA 3ZC7B 4LJ5A 2DAKA 3U61A 4LJ9A 1DGHB 1YE9A 2YR0A 1N36M 3AL0C 4JI4M 1ZAEA 4B3RM 3VKHA 3HKPA 4GHAA 4PDIA 2I7NA 1SXJC 3KSJA 2J5YA 3DOAA 4OVZB 2CV1A 1QZMA 2KHHA 3GP1A 5FSWA 5H37D 4JI8M 2XF3A 4JXJA 1HQYE 1RU3A 1ZV1A 2LXEA 2M5ZA 3ILKA 2JXNA 3SHFA 1G41A 4L78A 4CGYB 2B3TA 4LZZA 3K8ZA 1AIPC 3SATA 1DGGA 4QHSA 3MJ5A 1QUSA 3NBIA 3MHVC 5L8RF 2QBYB 1DV0A 1HT2E 3GRVA 3W0LB 1D2NA 1JR3E 4NOOB 4NRWA 1QAOA 3A42A 2HKJA 4KLNA 1R4GA 1L2DA 3GLHA 1VEKA 3E46A 3C58A 1SXJE 3QYBA 4KO8A 1X37A 1HNXM 1QAMA 1CUKA 2QENA 3F92A 4NXNM 5KQ8A 1WJ7A 3RE8A 1R5LA 1D0LA 2OOBA 1NNUC 3AV0A 3VKGA 5FTJA 3T15A 3KSXA 3FUXA 3SBJA 5FTKA 1WXQA 1Z5CA 3JAMS 3GLGE 1OIPA 3KOYE 3HJQA 4IBDA 4MGYE 4YHHM 2CRUA 1Z5BA 2KNAA 4QNRA 3A46A 1IBKM 4PCZA 2F5QA 1OQYA 3ZQJA 5IWAM 2BNKA 1L1TA 4DUYM 3SAVA 2E5LM 1IQPA 4X64M 2DENA 4IIWA 2R46A 2V1CA 2ZBKB 5KPTA 3HHXA 1OKSA 3FTFA 1K82A 3C3EA 3UGJA 4DR4M 3GPYA 3JR4A 1S3SA 2CFOA 1TR8A 2KZSA 1XHBA 2RRUA 1V33A 5ITQA 2HAKA 2JZ1A 1D0KA 4NSOB 3IG8A 2JY7A 2KRKA 4GRIA 2XFTA 3LVWA 4JI2M 5EXPA 3U5ZA 3HY5A 2BJVA 2WSFF 2CEAA 4DV3M 3J27B 1LV7A 2G8LA 2YQZA 3AOGA 1WHCA 2DAIA 4X66M 3U6LA 1L2CA 2D7EA 3U6PA 5GKNA 4JN6A 2OO9A 3E9SA 2L4EA 3LQQA 2Q2EB 2X4AA 4L16A 5IREB 2X8AA 4REZA 3B74A 4Y28F 5EXSA 3B7ZA 1J5EM 3T1HM 3WHKA 4B7HA 3NBXX 3SFZA 2DHRA 4OW0A 4Z6YA 1NVMA 4D81A 8CATA 4KT0F 2DXIA 4YY3M 3EIEA 2K0BX 1N34M 3I04M 4MGZE 2WZJA 4LGYA 2MR9A 2FNAA 2QCUA 4GIPA 3J2PB 3UMMA 2HWJA 3KVWA 5DNYA 1HNZM 2LVNC 3FUTA 5KO3A 2AHMA 4LF6M 2C9CA 1G8PA 1XWIA 2LBCA 1EFUB 1HJPA 1NV9A 1Q02A 4G4OA 4AKIA 3FUVA 3D8BA 4NRVA 1XNRM 2VDBB 1I4WA 2KEBA 2JWSA 3QYEA 3MMPA 3A45A 5FTNA 3U6OA 1GABA 4RF0A 4IBFA 1JR3A 3B89A 4MM3B 1HT1E 4MGKE 5EP2A 4CHTB 4D82A 4B3SM 4DR1M 3A98B 4AKHA 4LFCM 1G59A 3GLFA 1QDRA 4NXMM 2DAGA 4DR6M 1KSFX 1IFYA 1IY0A 2Z8YM 1TH4A 1E94E 3U61B 3SASA 4IBKA 1IM2A 5ITRA 2DI0A 3IECA 4LJAA 1NV8A 4EIWA 4JI1M 1OFIA 2QZ4A 4FWGA 3HU2A 4LFBM 1H6UA 3C3DA 4FCTA 4Q7JA 4IBCA 2APLA 2CP8A 1GJTA 3FE3A 1IN5A 2JUJA 3KDSE 4L4UA 4JI0M 1GL6A 2G5GX 4DUZM 4DV6M 4LF5M 4OX9M 2L7HA 2H5XA 1OJLA 3GRRA 3IG5A 4DR7M 3HU1A 3R8FA 4Z8XA 2ZAMA 3LQRA 4GKKM 1Y8GA 3EIHA 2Z7JA 4R71A 5BPVA 5KQDA 3GPUA 3CGWA 4RF1A 1QZEA 1VDLA 3LCVB 2HCBA 2C98A 5DYIA 2ZTDA 4MGIE 1VQ1A 3I4YA 3BXWA 4B3MM 2XSZA 3RGSA 3W0FA 4WURA 4QHTA 1TF0B 2QPAA 3FYDA 4AG6A 1N77A 1XNQM 2EA0A 4AQYM 2DAEA 3J7AS 2EKKA 2QSFX 2XZFA 2LHCA 3K2LA 2F5NA 1N75A 2Y21A 5EJCA 2XLJA 4L6V6 4GKJM 1QUTA 2CV0A 2KA6B 4ITQA 5FTLA 2HHHM 3GLFB 2QQ8A 3SAUA 5C1BA 4LF9M 2H1RA 2JP7A 2LVAA 4WP2A 1VG5A 1YSYA 2Z4RA 4UN2B 1WR1B 3M0EA 1DGBA 4CISA 1IXSA 3FTCA 4M9SA 3HJSA 3B9PA 3KFUG
chains in the Genus database with same CATH topology
1GJTA 1PRBA 2FS1A 2J5YA 2N35A 2VDBB 2JWSA 1GJSA 2MH8A 2LHCA 1GABA 2KDLA 1TF0B 2LHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GJT A;  1PRB A;  2FS1 A;  2J5Y A;  2N35 A;  2VDB B;  2JWS A;  1GJS A;  2MH8 A;  2LHC A;  1GAB A;  2KDL A;  1TF0 B;  2LHG A; 
#chains in the Genus database with same CATH topology
 3TQS A;  3SAW A;  2NQ8 C;  4A3V B;  2K9D A;  4PDG A;  3KW6 A;  3MK6 A;  4X65 M;  1G3I A;  3C9P A;  2MJ5 B;  2Y20 A;  2EKF A;  3HHY A;  5FLX S;  2QHO B;  1NY5 A;  1MX0 A;  4IBG A;  4JYA M;  5EP4 A;  3HX3 A;  2R62 A;  4CJ6 A;  3I51 A;  3RFW A;  2CHV A;  2WSC F;  3D8L A;  4IJE A;  3H4M A;  1EE8 A;  5LMU M;  3HWS A;  4AW4 A;  2OOA A;  1GLN A;  1C7Y A;  3GLI E;  3K92 A;  3GLG B;  3I4V A;  5EXX A;  1OAI A;  4LJ7 A;  3GQ3 A;  1OFH A;  3PFI A;  1ZMW A;  1TDH A;  1GL7 A;  2KNZ A;  2P5T A;  3SMP A;  4DV1 M;  3FUU A;  4HL4 A;  4FW9 A;  1HR0 M;  3E21 A;  2N35 A;  2OPF A;  1DO0 A;  4DV0 M;  2DVW B;  3QAU A;  4GC9 A;  3FD9 A;  2FOI C;  3HGI A;  1QQW A;  4B3T M;  1SG9 A;  2R0I A;  1QYR A;  2VF8 A;  3HU3 A;  1NHW C;  4M0D A;  3VDP A;  3R9X B;  1IN4 A;  3GQ4 A;  4IJF A;  4M9X A;  3OTO M;  1F4I A;  2I7P A;  4M9Z A;  4GIT A;  1GO5 A;  3WHL A;  4II7 A;  1XXH A;  1DGH A;  1T6O A;  1YLA A;  4XBO A;  1PJJ A;  4LF4 M;  2F4V M;  4NSR A;  2Y0T A;  4G6Z A;  3L28 A;  4AKG A;  1IBL M;  2KW0 A;  3TPZ A;  1XC8 A;  2KDL A;  2KXE A;  3L27 A;  1PJT A;  2J7O A;  1E9S A;  4RKU F;  2K6B A;  2QBY A;  3CTW B;  4ZPX A;  1N33 M;  3U6C A;  2CUZ A;  2WSE F;  3B7Q A;  1NSF A;  1Z59 A;  2FE8 A;  3HHZ A;  4GMQ A;  3TWM A;  1K3X A;  2DWL A;  3PNV A;  3U6E A;  1QDT A;  3GLH E;  3PXG A;  2VQF M;  2UUC M;  1XB2 B;  1IN6 A;  2C99 A;  2KNV A;  3Q8G A;  3L26 A;  4MH0 E;  1MU5 A;  2UXB M;  2O01 F;  1GKI A;  3JR5 A;  2LHG A;  4BBA A;  4HLQ A;  1XMQ M;  3VK7 A;  2LVP C;  7CAT A;  3GPP A;  1GVN A;  4GHL A;  1R6B X;  3HJ8 A;  4R7G A;  3J81 S;  5F3W A;  1UFZ A;  3AJI B;  4IBI A;  1EIJ A;  2DWM A;  1PJI A;  4K0K M;  1IN8 A;  4DV7 M;  1Q3B A;  1WGN A;  2DZO B;  2JNH A;  3HHW A;  1T3T A;  4LY6 A;  2Z3X A;  1V92 A;  1TDZ A;  2DNA A;  4FD2 A;  2R6F A;  3T38 A;  2F5O A;  1J7K A;  4FWH A;  4BLC A;  4IBE A;  1DO2 A;  1L1Z A;  2R4J A;  2W82 A;  3FYC A;  1ZQ9 A;  5E6J A;  1G71 A;  3CF2 A;  1Q3C A;  3J80 S;  2ERC A;  3W67 A;  4LF7 M;  4B08 A;  3M7G A;  2JY8 A;  3T6P A;  1T43 A;  4LJ8 A;  3E4R A;  1PGY A;  4I4L A;  2GNO A;  4G3O A;  2LVO C;  1IY1 A;  1VEJ A;  2QP9 X;  2XFS A;  3KXE C;  4FVM A;  3VDU A;  1NY6 A;  3THG A;  2MH8 A;  2K47 A;  1UM8 A;  3L25 A;  3KP1 E;  2XGN A;  4DBG B;  3LCU A;  2R45 A;  5KPZ A;  1W5T A;  4L15 A;  5A2Q S;  1JB0 F;  2R4E A;  2V6Z M;  3AOE A;  4I5S A;  2UUA M;  2UU9 M;  4LG2 A;  3K1J A;  4AI6 A;  2O25 A;  2Z4S A;  2KRU A;  2L09 A;  1HQC A;  1VDD A;  4R3D A;  2ZM6 M;  3SMS A;  3GLI B;  4GEW A;  2KZU A;  1HNW M;  4JI7 M;  1TH2 A;  3DA1 A;  1FNN A;  2LNH C;  4LCB A;  1P3Q Q;  3PNY A;  5ITY A;  5ITT A;  3KOX E;  2RGO A;  2ZAN A;  4I81 A;  2BWE A;  2D7H A;  2J7N A;  3AOE C;  2YNM D;  4HEO A;  3ZH9 B;  4LJ4 A;  5ITU A;  3GQ5 A;  1PJQ A;  3VK8 A;  3V76 A;  1I94 M;  2XEP A;  5LMN M;  2VF7 A;  3L29 A;  2CWB A;  2GQF A;  5DFL A;  2EUC A;  3AFH A;  1N32 M;  1G4A E;  1IXZ A;  2V1U A;  4GH9 A;  4LZJ A;  3TL4 X;  1NJG A;  3U60 B;  2L2D A;  3GRY A;  1AUA A;  4IBJ A;  5BR8 M;  2R44 A;  1QVR A;  3BBZ A;  1SXJ B;  3FTD A;  4MB7 A;  3U60 A;  1IY2 A;  4CIZ A;  1TGU A;  2UUB M;  3TWL A;  4DV5 M;  3U6M A;  5EXT A;  2HL7 A;  4B7G A;  1C1K A;  2XZU A;  1KYI A;  3TE6 A;  2ZAO A;  3CF6 E;  4IBB A;  2C5R A;  4W5W A;  1IXR C;  2FH0 A;  5KPR A;  4DV4 M;  2F5S A;  4LF8 M;  4TUW A;  3SYK A;  4FCV A;  4RNA A;  4QOZ C;  3VLF B;  1NJF A;  4P17 A;  1IBM M;  1PM5 A;  1OTR A;  2L4F A;  2F5P A;  5JI3 E;  1GJS A;  3QWL A;  4JI3 M;  2LVQ D;  3SAR A;  3FTE A;  4AZF A;  4OVZ A;  2R18 A;  4D80 A;  2LH0 A;  2BJW A;  1IXS B;  2DAM A;  2ZTC A;  4S12 A;  3W68 A;  2DHY A;  4L8R C;  1W5S A;  1A5T A;  3K9P A;  4G4Q A;  1NO1 A;  3NWL A;  4PT5 A;  3FUW A;  4QOS A;  3K9O A;  1NHG C;  5FTM A;  2RGH A;  2C96 A;  2JY5 A;  4XK8 F;  2BWB A;  4M0W A;  3H4J A;  1LTM A;  3T1Y M;  2LWX A;  4GC5 A;  4LGM A;  2OQ4 A;  1K3W A;  1SXJ A;  2UXD M;  1ZMU A;  4NL4 H;  4B7F A;  3UJN A;  2L6O A;  2Y0Q A;  3ZCB B;  1PRB A;  2MRO B;  2DWZ B;  1D0M A;  3Q8X A;  2L7I A;  4FCW A;  1IN7 A;  3SHG B;  5C18 A;  3AKZ A;  4JI5 M;  1V34 A;  1E9R A;  1QAN A;  4OU7 A;  4FWD A;  4DR5 M;  1DGF A;  5IT9 S;  1TH3 A;  2JZ0 A;  2XH9 A;  3GLH B;  4BB9 A;  1BVS A;  1R7R A;  3SYL A;  3L2A A;  3GLF E;  1WIV A;  3KOW E;  3KOZ E;  4G4R A;  4QNM A;  5EP1 A;  3U6S A;  3SC3 A;  2FS1 A;  1VEG A;  2O5R A;  4DR2 M;  1N78 A;  3DFZ A;  3LVV A;  3LMM A;  1MN3 A;  3HZJ A;  4DV2 M;  2JA2 A;  1MJG M;  3VFD A;  4F1I A;  3GLI A;  4G4N A;  4XGI A;  2EO2 A;  2XSZ D;  3BOS A;  3CF0 A;  3FRI A;  4P16 A;  5E26 A;  3TWK A;  4F2L A;  4DR3 M;  2VQE M;  1PJS A;  1SXJ D;  1JQJ C;  1NNJ A;  4AG5 A;  2M60 A;  3B7N A;  2A5Y B;  4LJ6 A;  3UK6 A;  4LRS A;  3IHP A;  3LW5 F;  3U6Q A;  2RKO A;  2UXC M;  1XXH B;  2DKL A;  5ITX A;  3KS4 A;  2CV2 A;  1FJG M;  3GLG A;  1ZMV A;  4KHP M;  1Z6T A;  1XMO M;  3PVS A;  3M6A A;  4ANR A;  4JI6 M;  1QAQ A;  3KS8 A;  2X49 A;  3FKE A;  1R2Y A;  2DWN A;  1Z5A A;  2MGW A;  4MGH A;  5EQT A;  2C9O A;  4NC6 A;  5DYG A;  3FRH A;  5EP3 A;  3U6D A;  1JR3 D;  3UZU A;  1E32 A;  1L8Q A;  4X62 M;  2FFJ A;  3GPX A;  1ORY B;  4LRT A;  3DZD A;  2EJS A;  4PD2 A;  2LTU A;  1Q39 A;  1L2B A;  4I8O A;  1R2Z A;  3RGP A;  3U5Z B;  1OIZ A;  2R65 A;  1KFV A;  1J09 A;  5IZ7 D;  2QNJ A;  2YFQ A;  1WGL A;  1XXH E;  2G3Q A;  3GRU A;  1TTE A;  2CHQ A;  3J7B A;  3KP0 E;  2CHG A;  4KOD A;  5ITX E;  2CE7 A;  3GO8 A;  4JV5 M;  2DZL A;  2JY6 B;  4WW0 A;  5JI2 E;  1OAO C;  1YUB A;  2DZN B;  3I01 M;  2VII A;  4LFA M;  2D7G A;  3ZC7 B;  4LJ5 A;  2DAK A;  3U61 A;  4LJ9 A;  1DGH B;  1YE9 A;  2YR0 A;  1N36 M;  3AL0 C;  4JI4 M;  1ZAE A;  4B3R M;  3VKH A;  3HKP A;  4GHA A;  4PDI A;  2I7N A;  1SXJ C;  3KSJ A;  2J5Y A;  3DOA A;  4OVZ B;  2CV1 A;  1QZM A;  2KHH A;  3GP1 A;  5FSW A;  5H37 D;  4JI8 M;  2XF3 A;  4JXJ A;  1HQY E;  1RU3 A;  1ZV1 A;  2LXE A;  2M5Z A;  3ILK A;  2JXN A;  3SHF A;  1G41 A;  4L78 A;  4CGY B;  2B3T A;  4LZZ A;  3K8Z A;  1AIP C;  3SAT A;  1DGG A;  4QHS A;  3MJ5 A;  1QUS A;  3NBI A;  3MHV C;  5L8R F;  2QBY B;  1DV0 A;  1HT2 E;  3GRV A;  3W0L B;  1D2N A;  1JR3 E;  4NOO B;  4NRW A;  1QAO A;  3A42 A;  2HKJ A;  4KLN A;  1R4G A;  1L2D A;  3GLH A;  1VEK A;  3E46 A;  3C58 A;  1SXJ E;  3QYB A;  4KO8 A;  1X37 A;  1HNX M;  1QAM A;  1CUK A;  2QEN A;  3F92 A;  4NXN M;  5KQ8 A;  1WJ7 A;  3RE8 A;  1R5L A;  1D0L A;  2OOB A;  1NNU C;  3AV0 A;  3VKG A;  5FTJ A;  3T15 A;  3KSX A;  3FUX A;  3SBJ A;  5FTK A;  1WXQ A;  1Z5C A;  3JAM S;  3GLG E;  1OIP A;  3KOY E;  3HJQ A;  4IBD A;  4MGY E;  4YHH M;  2CRU A;  1Z5B A;  2KNA A;  4QNR A;  3A46 A;  1IBK M;  4PCZ A;  2F5Q A;  1OQY A;  3ZQJ A;  5IWA M;  2BNK A;  1L1T A;  4DUY M;  3SAV A;  2E5L M;  1IQP A;  4X64 M;  2DEN A;  4IIW A;  2R46 A;  2V1C A;  2ZBK B;  5KPT A;  3HHX A;  1OKS A;  3FTF A;  1K82 A;  3C3E A;  3UGJ A;  4DR4 M;  3GPY A;  3JR4 A;  1S3S A;  2CFO A;  1TR8 A;  2KZS A;  1XHB A;  2RRU A;  1V33 A;  5ITQ A;  2HAK A;  2JZ1 A;  1D0K A;  4NSO B;  3IG8 A;  2JY7 A;  2KRK A;  4GRI A;  2XFT A;  3LVW A;  4JI2 M;  5EXP A;  3U5Z A;  3HY5 A;  2BJV A;  2WSF F;  2CEA A;  4DV3 M;  3J27 B;  1LV7 A;  2G8L A;  2YQZ A;  3AOG A;  1WHC A;  2DAI A;  4X66 M;  3U6L A;  1L2C A;  2D7E A;  3U6P A;  5GKN A;  4JN6 A;  2OO9 A;  3E9S A;  2L4E A;  3LQQ A;  2Q2E B;  2X4A A;  4L16 A;  5IRE B;  2X8A A;  4REZ A;  3B74 A;  4Y28 F;  5EXS A;  3B7Z A;  1J5E M;  3T1H M;  3WHK A;  4B7H A;  3NBX X;  3SFZ A;  2DHR A;  4OW0 A;  4Z6Y A;  1NVM A;  4D81 A;  8CAT A;  4KT0 F;  2DXI A;  4YY3 M;  3EIE A;  2K0B X;  1N34 M;  3I04 M;  4MGZ E;  2WZJ A;  4LGY A;  2MR9 A;  2FNA A;  2QCU A;  4GIP A;  3J2P B;  3UMM A;  2HWJ A;  3KVW A;  5DNY A;  1HNZ M;  2LVN C;  3FUT A;  5KO3 A;  2AHM A;  4LF6 M;  2C9C A;  1G8P A;  1XWI A;  2LBC A;  1EFU B;  1HJP A;  1NV9 A;  1Q02 A;  4G4O A;  4AKI A;  3FUV A;  3D8B A;  4NRV A;  1XNR M;  2VDB B;  1I4W A;  2KEB A;  2JWS A;  3QYE A;  3MMP A;  3A45 A;  5FTN A;  3U6O A;  1GAB A;  4RF0 A;  4IBF A;  1JR3 A;  3B89 A;  4MM3 B;  1HT1 E;  4MGK E;  5EP2 A;  4CHT B;  4D82 A;  4B3S M;  4DR1 M;  3A98 B;  4AKH A;  4LFC M;  1G59 A;  3GLF A;  1QDR A;  4NXM M;  2DAG A;  4DR6 M;  1KSF X;  1IFY A;  1IY0 A;  2Z8Y M;  1TH4 A;  1E94 E;  3U61 B;  3SAS A;  4IBK A;  1IM2 A;  5ITR A;  2DI0 A;  3IEC A;  4LJA A;  1NV8 A;  4EIW A;  4JI1 M;  1OFI A;  2QZ4 A;  4FWG A;  3HU2 A;  4LFB M;  1H6U A;  3C3D A;  4FCT A;  4Q7J A;  4IBC A;  2APL A;  2CP8 A;  1GJT A;  3FE3 A;  1IN5 A;  2JUJ A;  3KDS E;  4L4U A;  4JI0 M;  1GL6 A;  2G5G X;  4DUZ M;  4DV6 M;  4LF5 M;  4OX9 M;  2L7H A;  2H5X A;  1OJL A;  3GRR A;  3IG5 A;  4DR7 M;  3HU1 A;  3R8F A;  4Z8X A;  2ZAM A;  3LQR A;  4GKK M;  1Y8G A;  3EIH A;  2Z7J A;  4R71 A;  5BPV A;  5KQD A;  3GPU A;  3CGW A;  4RF1 A;  1QZE A;  1VDL A;  3LCV B;  2HCB A;  2C98 A;  5DYI A;  2ZTD A;  4MGI E;  1VQ1 A;  3I4Y A;  3BXW A;  4B3M M;  2XSZ A;  3RGS A;  3W0F A;  4WUR A;  4QHT A;  1TF0 B;  2QPA A;  3FYD A;  4AG6 A;  1N77 A;  1XNQ M;  2EA0 A;  4AQY M;  2DAE A;  3J7A S;  2EKK A;  2QSF X;  2XZF A;  2LHC A;  3K2L A;  2F5N A;  1N75 A;  2Y21 A;  5EJC A;  2XLJ A;  4L6V 6;  4GKJ M;  1QUT A;  2CV0 A;  2KA6 B;  4ITQ A;  5FTL A;  2HHH M;  3GLF B;  2QQ8 A;  3SAU A;  5C1B A;  4LF9 M;  2H1R A;  2JP7 A;  2LVA A;  4WP2 A;  1VG5 A;  1YSY A;  2Z4R A;  4UN2 B;  1WR1 B;  3M0E A;  1DGB A;  4CIS A;  1IXS A;  3FTC A;  4M9S A;  3HJS A;  3B9P A;  3KFU G; 
#chains in the Genus database with same CATH homology
 1GJT A;  1PRB A;  2FS1 A;  2J5Y A;  2N35 A;  2VDB B;  2JWS A;  1GJS A;  2MH8 A;  2LHC A;  1GAB A;  2KDL A;  1TF0 B;  2LHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...