1GABA

Structure of an albumin-binding domain, nmr, 20 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
TIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Albumin-binding protein
molecule keywords PROTEIN PAB
publication title Solution structure of the albumin-binding GA module: a versatile bacterial protein domain.
pubmed doi rcsb
source organism Finegoldia magna atcc 29328
total genus 10
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 1996-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.40 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Albumin-binding domain 1gabA00
1GABA 2VDBB 2N35A 2LHGA 1GJTA 2JWSA 1PRBA 2J5YA 1TF0B 1GJSA 2LHCA 2FS1A 2KDLA 2MH8A
chains in the Genus database with same CATH superfamily
3FTDA 4LJ7A 4IBDA 3MK6A 3GRUA 3PVSA 1R2ZA 2DWZB 1J7KA 3E9SA 3J2PB 1GL7A 4AW4A 3KDSE 2DNAA 2Z7JA 2GQFA 3GLGE 3R9XB 5FLXS 1ZMWA 2CEAA 3FD9A 4L15A 3GQ4A 2C96A 2JZ0A 2CV0A 5IT9S 3SASA 5EP1A 1GVNA 2WSFF 1FNNA 2RGHA 4LJ9A 3SYLA 4GKJM 2R65A 1UM8A 4Z8XA 2D7GA 3GRRA 4X66M 3SBJA 2DENA 5FTNA 1ZMVA 4LGMA 4I4LA 5FTKA 1ZQ9A 1G3IA 3AFHA 1V92A 4RKUF 2KHHA 2ZAMA 1C7YA 1XB2B 1P3QQ 2DKLA 4LJ8A 3V76A 4LCBA 5JI3E 2UXBM 4YHHM 4DUYM 1TTEA 1Q02A 1SXJC 2EJSA 3GLHE 4UN2B 2OQ4A 1N77A 3SMSA 2QBYB 4RF1A 1WJ7A 3D8LA 4NL4H 4Y28F 3U6MA 3FUTA 2B3TA 4IBKA 4WURA 4A3VB 4LJ5A 3K9OA 5KPZA 5ITTA 3GLIE 4B3MM 3PNYA 3TE6A 1YUBA 4D81A 3ILKA 4HL4A 4QHSA 3HX3A 5A2QS 4FD2A 1WHCA 2CFOA 3FTFA 4WP2A 5IWAM 3GLGB 3CGWA 4JXJA 2NQ8C 3RFWA 4LG2A 3NWLA 2QQ8A 1Z5CA 2UUBM 2HHHM 4M9SA 3VLFB 1PJTA 1HQCA 2CHQA 3B7QA 2JNHA 4BBAA 1NVMA 2C9OA 4MGYE 3ZQJA 1IXSB 2LVPC 2X49A 1MU5A 1KYIA 4DR6M 4HEOA 4CJ6A 1QAMA 3DA1A 4QNRA 1VEGA 1N34M 3LQRA 5DNYA 1NY6A 1VDDA 2DHRA 1D0MA 2C5RA 2FFJA 2JUJA 1IBLM 2MGWA 3AV0A 3DOAA 3EIEA 3MMPA 1EFUB 3GLHB 4NOOB 4Q7JA 4GHLA 3DFZA 2R4EA 4R71A 3HY5A 2JY8A 1TH2A 3C58A 2RRUA 2K47A 2H1RA 2H5XA 3T38A 4M0DA 2K0BX 1R5LA 3U6CA 4FW9A 4GIPA 2YQZA 1EIJA 1OFHA 2Y21A 3CTWB 2QZ4A 3HU2A 3E46A 4B08A 5DFLA 1XNQM 4M0WA 1S3SA 4PDGA 3U5ZA 5EXPA 3SATA 1CUKA 4LRTA 1VDLA 2ERCA 4OVZA 3JR4A 2JY6B 1K3XA 2QNJA 3FRHA 4NRVA 1HNXM 5ITXA 2F5NA 1WGNA 3FYDA 4GH9A 3SAUA 2R46A 3A98B 1D2NA 4GC5A 1DGHA 2EKKA 2WSCF 1GL6A 2LVAA 4OX9M 1L2CA 3U60A 3K2LA 3UGJA 1OJLA 3HZJA 4RNAA 2M60A 4PD2A 2FE8A 4YY3M 3KW6A 3AJIB 4B3SM 2ZAOA 2LNHC 3B74A 4FCWA 5ITRA 1TDZA 5ITUA 4PT5A 2XF3A 1IY2A 1IFYA 1NSFA 2EKFA 2Z8YM 2Z3XA 4B7HA 3MHVC 3GPUA 2MR9A 1UFZA 1E9SA 2KEBA 5BPVA 2WSEF 3ZH9B 2X8AA 4GRIA 3TWMA 1JB0F 1QVRA 1QAQA 2CHGA 1T6OA 2DHYA 4DV4M 2ZANA 1GJSA 3GRYA 1IN5A 3W0LB 3I4VA 1RU3A 3LMMA 3F92A 2HAKA 2LXEA 2QCUA 1LTMA 2DAGA 2C98A 1PGYA 3KS8A 1HQYE 1SG9A 3J80S 5EP3A 1G41A 3D8BA 1IBMM 1OQYA 2Z4RA 4NRWA 2WZJA 3HJ8A 2XLJA 4OW0A 2DWMA 1N78A 3U6LA 1IY1A 4JI5M 2KZUA 2VDBB 2ZTCA 3HKPA 1E94E 4BLCA 3GPPA 2VIIA 2ZTDA 4I5SA 3SC3A 3B7NA 3SYKA 4B7GA 2DI0A 4D82A 3FTEA 4REZA 3U61A 2XSZA 3TPZA 2CUZA 3MJ5A 4DV0M 2XEPA 2XSZD 3KOZE 2L6OA 1A5TA 2P5TA 1JR3A 1DO2A 2DZNB 2KRUA 1OAIA 3E21A 1R4GA 4JI8M 2BWBA 1OTRA 3KP0E 3KSXA 2V6ZM 2XZFA 4IBFA 3LW5F 3GQ5A 3LCVB 1J5EM 2R45A 2LVOC 2J7NA 1TH3A 1D0LA 3IHPA 3GLFB 2JP7A 4RF0A 2KXEA 2F5OA 1L8QA 1QDRA 2L2DA 1H6UA 2CP8A 5KPRA 1C1KA 4DR2M 1WXQA 4LY6A 4B7FA 3UJNA 4DR3M 1Q3CA 3C3DA 2DWNA 4M9ZA 1IXSA 2BNKA 7CATA 3U6SA 1YSYA 3FE3A 3PFIA 4W5WA 2O5RA 3TQSA 3VK8A 5EP2A 2FNAA 4FVMA 2OOBA 4CHTB 2RGOA 2JY7A 4MH0E 3RGPA 4M9XA 1QZMA 4FCTA 2LH0A 3Q8XA 1QUTA 2C99A 4XBOA 4LZZA 1WIVA 2HL7A 5E26A 2KNAA 5FTJA 2FOIC 1W5TA 1W5SA 1Z5BA 3ZCBB 3FRIA 5C18A 3J81S 2L09A 3WHLA 2MH8A 4LJAA 3GLHA 4AKIA 2KW0A 3SMPA 2LBCA 1LV7A 4MGZE 4II7A 4AG5A 5FSWA 2YFQA 3GQ3A 2EA0A 3T1YM 4R7GA 2XZUA 1G59A 1E9RA 1WR1B 3I01M 2R6FA 4GHAA 2O01F 1G8PA 1I94M 4OU7A 1YE9A 3AOEA 4IBEA 1GABA 4XGIA 2L7HA 3L26A 2K9DA 3JAMS 1HJPA 1V34A 2DZOB 3KXEC 2G3QA 3HJQA 3IG8A 3M6AA 4GMQA 1NHWC 4B3TM 5BR8M 3SHGB 2JZ1A 4XK8F 1GO5A 2UXCM 3L2AA 2G8LA 4IJEA 1G4AE 2C9CA 1IM2A 3GRVA 3B89A 2V1CA 4LFCM 4DR5M 4KLNA 4NSRA 1L1TA 2DAEA 5EXTA 4DBGB 1XXHA 5DYIA 2VF7A 5FTMA 3W67A 1NV9A 3GLIB 1L2BA 3H4JA 4NXNM 4IJFA 5IZ7D 1QZEA 3SAVA 1NHGC 3KOWE 4L8RC 4FCVA 2UUAM 4QHTA 1K82A 1Z59A 4EIWA 4ANRA 2F4VM 4F2LA 4PDIA 1DGGA 4JI1M 1IXRC 4DV5M 3A45A 5L8RF 2R44A 2LHGA 3A42A 3RE8A 3HHZA 1XNRM 2DAKA 3FUUA 3I51A 5ITXE 2CV1A 4LF6M 1HT1E 1G71A 4AI6A 3ZC7B 3KP1E 4IBGA 2ZM6M 2X4AA 3C3EA 4QNMA 1SXJA 1VG5A 3K9PA 1SXJD 1WGLA 2L4FA 3VKHA 1IQPA 2I7PA 1J09A 1HT2E 4L6V6 1DV0A 4JI6M 4S12A 1GKIA 3AKZA 2Z4SA 4KODA 4NC6A 3EIHA 2KNZA 3U6PA 2CV2A 2DZLA 1Y8GA 4L16A 3L27A 3H4MA 3T6PA 1QDTA 4DUZM 3M7GA 4LFAM 4PCZA 1L2DA 1PM5A 1QANA 3CF6E 1X37A 4FWGA 3KVWA 4F1IA 1HNWM 3AL0C 4WW0A 1IBKM 2CRUA 3HHWA 1I4WA 1KFVA 3U5ZB 3T15A 1ZMUA 3B7ZA 2QENA 1DGFA 1GJTA 1OIZA 4OVZB 3HWSA 5E6JA 1QUSA 4LF5M 1EE8A 1TH4A 3K8ZA 3W68A 3L25A 2A5YB 1DGBA 2Q2EB 2XH9A 4MGIE 3GLFA 1VQ1A 3SFZA 5F3WA 5EJCA 3TWKA 5KO3A 2UUCM 1YLAA 4GITA 5KPTA 4CGYB 3PXGA 2VQFM 2QBYA 4AG6A 2M5ZA 3HGIA 3U6QA 2R18A 4JN6A 2OOAA 1JR3D 4G4NA 5EP4A 1PJSA 1QQWA 2YR0A 3K1JA 1OIPA 3KOYE 1TF0B 1PJIA 3WHKA 1N33M 2VQEM 3U6DA 1D0KA 3K92A 2OPFA 3LQQA 3Q8GA 2I7NA 2DAIA 2OO9A 3M0EA 2HWJA 3C9PA 1XHBA 5C1BA 3GLGA 4DR4M 4DV1M 1NNUC 2BWEA 4X62M 3PNVA 5H37D 3LVWA 2KZSA 2MROB 4IBCA 2JY5A 3FKEA 3L28A 2D7HA 1TR8A 2JXNA 5JI2E 4I81A 3OTOM 3HJSA 3QYBA 3SARA 2BJVA 3R8FA 1TDHA 4MB7A 2UXDM 1OFIA 1MJGM 1R6BX 5LMNM 2KA6B 2L7IA 5DYGA 4K0KM 4LZJA 2GNOA 3SHFA 4X64M 4LF9M 3KFUG 3KSJA 2L4EA 2LHCA 5KQDA 1NJGA 1T43A 2DVWB 2HKJA 2QPAA 3J7AS 3U61B 2F5QA 4LGYA 3TL4X 1MN3A 3UMMA 1XWIA 2MJ5B 3W0FA 2EO2A 4DR1M 3NBXX 3HHYA 3TWLA 3FYCA 3GLIA 2F5PA 4AKHA 4LJ4A 3DZDA 4AZFA 1V33A 3E4RA 3J7BA 4JI2M 4HLQA 1IXZA 1MX0A 1Q39A 2APLA 1OAOC 3CF0A 4P17A 3L29A 4G4QA 4NSOB 3VFDA 4I8OA 4G4RA 1IN7A 1BVSA 4LJ6A 2Y0QA 4D80A 1R7RA 4G6ZA 4L4UA 1KSFX 2QP9X 2RKOA 4G3OA 4IBJA 1HR0M 4AQYM 3VDPA 4JV5M 4IBBA 1L1ZA 2CHVA 3GO8A 2QSFX 2R0IA 3HU3A 3RGSA 4DV3M 4GEWA 2XGNA 4X65M 3A46A 3FTCA 5IREB 1NNJA 1XXHE 2LWXA 2XFSA 3I04M 3VDUA 3U6EA 4CISA 3KOXE 4NXMM 4JI0M 1OKSA 2FH0A 1GLNA 4G4OA 5EXXA 1IN8A 4MGHA 1Q3BA 1VEKA 2EUCA 4LRSA 1IN6A 5EXSA 3HU1A 1VEJA 3QWLA 2R4JA 2FS1A 3LCUA 4MGKE 2JA2A 3THGA 3UZUA 3GPYA 1DO0A 4ITQA 2BJWA 1AUAA 4GC9A 2N35A 3NBIA 4MM3B 3U6OA 3FUXA 4LF8M 2V1UA 4R3DA 4P16A 4FWHA 4JYAM 4KO8A 3B9PA 1XMOM 1SXJE 1QAOA 2HCBA 2F5SA 4JI4M 2O25A 4KHPM 1QYRA 2K6BA 1N75A 2VF8A 2D7EA 5KQ8A 4DV2M 3AOGA 4QOZC 2R62A 1ORYB 3BXWA 1N36M 5LMUM 2LVQD 3BOSA 1HNZM 1JQJC 5GKNA 4KT0F 5EQTA 4LFBM 2Y0TA 3HHXA 1NJFA 1TGUA 4L78A 4JI7M 4ZPXA 1XC8A 1N32M 1ZV1A 2LVNC 4AKGA 1F4IA 4DV7M 4TUWA 3QYEA 4BB9A 1NV8A 1XXHB 2Y20A 5FTLA 3QAUA 3BBZA 3CF2A 4CIZA 2W82A 1Z5AA 2KRKA 3SAWA 1K3WA 2KDLA 2KNVA 4DV6M 2DAMA 4FWDA 3VK7A 4IIWA 3GP1A 3VKGA 5ITYA 3J27B 2JWSA 2J5YA 1E32A 2QHOB 4LF7M 5ITQA 2DXIA 3T1HM 3IECA 4IBIA 4GKKM 4Z6YA 4B3RM 2AHMA 3KS4A 1PJQA 3FUVA 1AIPC 3JR5A 2LTUA 3GLFE 1DGHB 1PJJA 3I4YA 2E5LM 3AOEC 3U60B 1SXJB 1XMQM 1PRBA 2UU9M 2DWLA 2XFTA 2ZBKB 4DR7M 1Z6TA 3FUWA 4JI3M 2CE7A 3UK6A 1NY5A 1R2YA 3GPXA 8CATA 1FJGM 1T3TA 1ZAEA 1IN4A 1JR3E 3LVVA 4QOSA 3IG5A 1IY0A 2G5GX 2YNMD 2J7OA 1NO1A 4LF4M 2CWBA
chains in the Genus database with same CATH topology
1GABA 2VDBB 2N35A 2LHGA 1GJTA 2JWSA 1PRBA 2J5YA 1TF0B 1GJSA 2LHCA 2FS1A 2KDLA 2MH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GAB A;  2VDB B;  2N35 A;  2LHG A;  1GJT A;  2JWS A;  1PRB A;  2J5Y A;  1TF0 B;  1GJS A;  2LHC A;  2FS1 A;  2KDL A;  2MH8 A; 
#chains in the Genus database with same CATH topology
 3FTD A;  4LJ7 A;  4IBD A;  3MK6 A;  3GRU A;  3PVS A;  1R2Z A;  2DWZ B;  1J7K A;  3E9S A;  3J2P B;  1GL7 A;  4AW4 A;  3KDS E;  2DNA A;  2Z7J A;  2GQF A;  3GLG E;  3R9X B;  5FLX S;  1ZMW A;  2CEA A;  3FD9 A;  4L15 A;  3GQ4 A;  2C96 A;  2JZ0 A;  2CV0 A;  5IT9 S;  3SAS A;  5EP1 A;  1GVN A;  2WSF F;  1FNN A;  2RGH A;  4LJ9 A;  3SYL A;  4GKJ M;  2R65 A;  1UM8 A;  4Z8X A;  2D7G A;  3GRR A;  4X66 M;  3SBJ A;  2DEN A;  5FTN A;  1ZMV A;  4LGM A;  4I4L A;  5FTK A;  1ZQ9 A;  1G3I A;  3AFH A;  1V92 A;  4RKU F;  2KHH A;  2ZAM A;  1C7Y A;  1XB2 B;  1P3Q Q;  2DKL A;  4LJ8 A;  3V76 A;  4LCB A;  5JI3 E;  2UXB M;  4YHH M;  4DUY M;  1TTE A;  1Q02 A;  1SXJ C;  2EJS A;  3GLH E;  4UN2 B;  2OQ4 A;  1N77 A;  3SMS A;  2QBY B;  4RF1 A;  1WJ7 A;  3D8L A;  4NL4 H;  4Y28 F;  3U6M A;  3FUT A;  2B3T A;  4IBK A;  4WUR A;  4A3V B;  4LJ5 A;  3K9O A;  5KPZ A;  5ITT A;  3GLI E;  4B3M M;  3PNY A;  3TE6 A;  1YUB A;  4D81 A;  3ILK A;  4HL4 A;  4QHS A;  3HX3 A;  5A2Q S;  4FD2 A;  1WHC A;  2CFO A;  3FTF A;  4WP2 A;  5IWA M;  3GLG B;  3CGW A;  4JXJ A;  2NQ8 C;  3RFW A;  4LG2 A;  3NWL A;  2QQ8 A;  1Z5C A;  2UUB M;  2HHH M;  4M9S A;  3VLF B;  1PJT A;  1HQC A;  2CHQ A;  3B7Q A;  2JNH A;  4BBA A;  1NVM A;  2C9O A;  4MGY E;  3ZQJ A;  1IXS B;  2LVP C;  2X49 A;  1MU5 A;  1KYI A;  4DR6 M;  4HEO A;  4CJ6 A;  1QAM A;  3DA1 A;  4QNR A;  1VEG A;  1N34 M;  3LQR A;  5DNY A;  1NY6 A;  1VDD A;  2DHR A;  1D0M A;  2C5R A;  2FFJ A;  2JUJ A;  1IBL M;  2MGW A;  3AV0 A;  3DOA A;  3EIE A;  3MMP A;  1EFU B;  3GLH B;  4NOO B;  4Q7J A;  4GHL A;  3DFZ A;  2R4E A;  4R71 A;  3HY5 A;  2JY8 A;  1TH2 A;  3C58 A;  2RRU A;  2K47 A;  2H1R A;  2H5X A;  3T38 A;  4M0D A;  2K0B X;  1R5L A;  3U6C A;  4FW9 A;  4GIP A;  2YQZ A;  1EIJ A;  1OFH A;  2Y21 A;  3CTW B;  2QZ4 A;  3HU2 A;  3E46 A;  4B08 A;  5DFL A;  1XNQ M;  4M0W A;  1S3S A;  4PDG A;  3U5Z A;  5EXP A;  3SAT A;  1CUK A;  4LRT A;  1VDL A;  2ERC A;  4OVZ A;  3JR4 A;  2JY6 B;  1K3X A;  2QNJ A;  3FRH A;  4NRV A;  1HNX M;  5ITX A;  2F5N A;  1WGN A;  3FYD A;  4GH9 A;  3SAU A;  2R46 A;  3A98 B;  1D2N A;  4GC5 A;  1DGH A;  2EKK A;  2WSC F;  1GL6 A;  2LVA A;  4OX9 M;  1L2C A;  3U60 A;  3K2L A;  3UGJ A;  1OJL A;  3HZJ A;  4RNA A;  2M60 A;  4PD2 A;  2FE8 A;  4YY3 M;  3KW6 A;  3AJI B;  4B3S M;  2ZAO A;  2LNH C;  3B74 A;  4FCW A;  5ITR A;  1TDZ A;  5ITU A;  4PT5 A;  2XF3 A;  1IY2 A;  1IFY A;  1NSF A;  2EKF A;  2Z8Y M;  2Z3X A;  4B7H A;  3MHV C;  3GPU A;  2MR9 A;  1UFZ A;  1E9S A;  2KEB A;  5BPV A;  2WSE F;  3ZH9 B;  2X8A A;  4GRI A;  3TWM A;  1JB0 F;  1QVR A;  1QAQ A;  2CHG A;  1T6O A;  2DHY A;  4DV4 M;  2ZAN A;  1GJS A;  3GRY A;  1IN5 A;  3W0L B;  3I4V A;  1RU3 A;  3LMM A;  3F92 A;  2HAK A;  2LXE A;  2QCU A;  1LTM A;  2DAG A;  2C98 A;  1PGY A;  3KS8 A;  1HQY E;  1SG9 A;  3J80 S;  5EP3 A;  1G41 A;  3D8B A;  1IBM M;  1OQY A;  2Z4R A;  4NRW A;  2WZJ A;  3HJ8 A;  2XLJ A;  4OW0 A;  2DWM A;  1N78 A;  3U6L A;  1IY1 A;  4JI5 M;  2KZU A;  2VDB B;  2ZTC A;  3HKP A;  1E94 E;  4BLC A;  3GPP A;  2VII A;  2ZTD A;  4I5S A;  3SC3 A;  3B7N A;  3SYK A;  4B7G A;  2DI0 A;  4D82 A;  3FTE A;  4REZ A;  3U61 A;  2XSZ A;  3TPZ A;  2CUZ A;  3MJ5 A;  4DV0 M;  2XEP A;  2XSZ D;  3KOZ E;  2L6O A;  1A5T A;  2P5T A;  1JR3 A;  1DO2 A;  2DZN B;  2KRU A;  1OAI A;  3E21 A;  1R4G A;  4JI8 M;  2BWB A;  1OTR A;  3KP0 E;  3KSX A;  2V6Z M;  2XZF A;  4IBF A;  3LW5 F;  3GQ5 A;  3LCV B;  1J5E M;  2R45 A;  2LVO C;  2J7N A;  1TH3 A;  1D0L A;  3IHP A;  3GLF B;  2JP7 A;  4RF0 A;  2KXE A;  2F5O A;  1L8Q A;  1QDR A;  2L2D A;  1H6U A;  2CP8 A;  5KPR A;  1C1K A;  4DR2 M;  1WXQ A;  4LY6 A;  4B7F A;  3UJN A;  4DR3 M;  1Q3C A;  3C3D A;  2DWN A;  4M9Z A;  1IXS A;  2BNK A;  7CAT A;  3U6S A;  1YSY A;  3FE3 A;  3PFI A;  4W5W A;  2O5R A;  3TQS A;  3VK8 A;  5EP2 A;  2FNA A;  4FVM A;  2OOB A;  4CHT B;  2RGO A;  2JY7 A;  4MH0 E;  3RGP A;  4M9X A;  1QZM A;  4FCT A;  2LH0 A;  3Q8X A;  1QUT A;  2C99 A;  4XBO A;  4LZZ A;  1WIV A;  2HL7 A;  5E26 A;  2KNA A;  5FTJ A;  2FOI C;  1W5T A;  1W5S A;  1Z5B A;  3ZCB B;  3FRI A;  5C18 A;  3J81 S;  2L09 A;  3WHL A;  2MH8 A;  4LJA A;  3GLH A;  4AKI A;  2KW0 A;  3SMP A;  2LBC A;  1LV7 A;  4MGZ E;  4II7 A;  4AG5 A;  5FSW A;  2YFQ A;  3GQ3 A;  2EA0 A;  3T1Y M;  4R7G A;  2XZU A;  1G59 A;  1E9R A;  1WR1 B;  3I01 M;  2R6F A;  4GHA A;  2O01 F;  1G8P A;  1I94 M;  4OU7 A;  1YE9 A;  3AOE A;  4IBE A;  1GAB A;  4XGI A;  2L7H A;  3L26 A;  2K9D A;  3JAM S;  1HJP A;  1V34 A;  2DZO B;  3KXE C;  2G3Q A;  3HJQ A;  3IG8 A;  3M6A A;  4GMQ A;  1NHW C;  4B3T M;  5BR8 M;  3SHG B;  2JZ1 A;  4XK8 F;  1GO5 A;  2UXC M;  3L2A A;  2G8L A;  4IJE A;  1G4A E;  2C9C A;  1IM2 A;  3GRV A;  3B89 A;  2V1C A;  4LFC M;  4DR5 M;  4KLN A;  4NSR A;  1L1T A;  2DAE A;  5EXT A;  4DBG B;  1XXH A;  5DYI A;  2VF7 A;  5FTM A;  3W67 A;  1NV9 A;  3GLI B;  1L2B A;  3H4J A;  4NXN M;  4IJF A;  5IZ7 D;  1QZE A;  3SAV A;  1NHG C;  3KOW E;  4L8R C;  4FCV A;  2UUA M;  4QHT A;  1K82 A;  1Z59 A;  4EIW A;  4ANR A;  2F4V M;  4F2L A;  4PDI A;  1DGG A;  4JI1 M;  1IXR C;  4DV5 M;  3A45 A;  5L8R F;  2R44 A;  2LHG A;  3A42 A;  3RE8 A;  3HHZ A;  1XNR M;  2DAK A;  3FUU A;  3I51 A;  5ITX E;  2CV1 A;  4LF6 M;  1HT1 E;  1G71 A;  4AI6 A;  3ZC7 B;  3KP1 E;  4IBG A;  2ZM6 M;  2X4A A;  3C3E A;  4QNM A;  1SXJ A;  1VG5 A;  3K9P A;  1SXJ D;  1WGL A;  2L4F A;  3VKH A;  1IQP A;  2I7P A;  1J09 A;  1HT2 E;  4L6V 6;  1DV0 A;  4JI6 M;  4S12 A;  1GKI A;  3AKZ A;  2Z4S A;  4KOD A;  4NC6 A;  3EIH A;  2KNZ A;  3U6P A;  2CV2 A;  2DZL A;  1Y8G A;  4L16 A;  3L27 A;  3H4M A;  3T6P A;  1QDT A;  4DUZ M;  3M7G A;  4LFA M;  4PCZ A;  1L2D A;  1PM5 A;  1QAN A;  3CF6 E;  1X37 A;  4FWG A;  3KVW A;  4F1I A;  1HNW M;  3AL0 C;  4WW0 A;  1IBK M;  2CRU A;  3HHW A;  1I4W A;  1KFV A;  3U5Z B;  3T15 A;  1ZMU A;  3B7Z A;  2QEN A;  1DGF A;  1GJT A;  1OIZ A;  4OVZ B;  3HWS A;  5E6J A;  1QUS A;  4LF5 M;  1EE8 A;  1TH4 A;  3K8Z A;  3W68 A;  3L25 A;  2A5Y B;  1DGB A;  2Q2E B;  2XH9 A;  4MGI E;  3GLF A;  1VQ1 A;  3SFZ A;  5F3W A;  5EJC A;  3TWK A;  5KO3 A;  2UUC M;  1YLA A;  4GIT A;  5KPT A;  4CGY B;  3PXG A;  2VQF M;  2QBY A;  4AG6 A;  2M5Z A;  3HGI A;  3U6Q A;  2R18 A;  4JN6 A;  2OOA A;  1JR3 D;  4G4N A;  5EP4 A;  1PJS A;  1QQW A;  2YR0 A;  3K1J A;  1OIP A;  3KOY E;  1TF0 B;  1PJI A;  3WHK A;  1N33 M;  2VQE M;  3U6D A;  1D0K A;  3K92 A;  2OPF A;  3LQQ A;  3Q8G A;  2I7N A;  2DAI A;  2OO9 A;  3M0E A;  2HWJ A;  3C9P A;  1XHB A;  5C1B A;  3GLG A;  4DR4 M;  4DV1 M;  1NNU C;  2BWE A;  4X62 M;  3PNV A;  5H37 D;  3LVW A;  2KZS A;  2MRO B;  4IBC A;  2JY5 A;  3FKE A;  3L28 A;  2D7H A;  1TR8 A;  2JXN A;  5JI2 E;  4I81 A;  3OTO M;  3HJS A;  3QYB A;  3SAR A;  2BJV A;  3R8F A;  1TDH A;  4MB7 A;  2UXD M;  1OFI A;  1MJG M;  1R6B X;  5LMN M;  2KA6 B;  2L7I A;  5DYG A;  4K0K M;  4LZJ A;  2GNO A;  3SHF A;  4X64 M;  4LF9 M;  3KFU G;  3KSJ A;  2L4E A;  2LHC A;  5KQD A;  1NJG A;  1T43 A;  2DVW B;  2HKJ A;  2QPA A;  3J7A S;  3U61 B;  2F5Q A;  4LGY A;  3TL4 X;  1MN3 A;  3UMM A;  1XWI A;  2MJ5 B;  3W0F A;  2EO2 A;  4DR1 M;  3NBX X;  3HHY A;  3TWL A;  3FYC A;  3GLI A;  2F5P A;  4AKH A;  4LJ4 A;  3DZD A;  4AZF A;  1V33 A;  3E4R A;  3J7B A;  4JI2 M;  4HLQ A;  1IXZ A;  1MX0 A;  1Q39 A;  2APL A;  1OAO C;  3CF0 A;  4P17 A;  3L29 A;  4G4Q A;  4NSO B;  3VFD A;  4I8O A;  4G4R A;  1IN7 A;  1BVS A;  4LJ6 A;  2Y0Q A;  4D80 A;  1R7R A;  4G6Z A;  4L4U A;  1KSF X;  2QP9 X;  2RKO A;  4G3O A;  4IBJ A;  1HR0 M;  4AQY M;  3VDP A;  4JV5 M;  4IBB A;  1L1Z A;  2CHV A;  3GO8 A;  2QSF X;  2R0I A;  3HU3 A;  3RGS A;  4DV3 M;  4GEW A;  2XGN A;  4X65 M;  3A46 A;  3FTC A;  5IRE B;  1NNJ A;  1XXH E;  2LWX A;  2XFS A;  3I04 M;  3VDU A;  3U6E A;  4CIS A;  3KOX E;  4NXM M;  4JI0 M;  1OKS A;  2FH0 A;  1GLN A;  4G4O A;  5EXX A;  1IN8 A;  4MGH A;  1Q3B A;  1VEK A;  2EUC A;  4LRS A;  1IN6 A;  5EXS A;  3HU1 A;  1VEJ A;  3QWL A;  2R4J A;  2FS1 A;  3LCU A;  4MGK E;  2JA2 A;  3THG A;  3UZU A;  3GPY A;  1DO0 A;  4ITQ A;  2BJW A;  1AUA A;  4GC9 A;  2N35 A;  3NBI A;  4MM3 B;  3U6O A;  3FUX A;  4LF8 M;  2V1U A;  4R3D A;  4P16 A;  4FWH A;  4JYA M;  4KO8 A;  3B9P A;  1XMO M;  1SXJ E;  1QAO A;  2HCB A;  2F5S A;  4JI4 M;  2O25 A;  4KHP M;  1QYR A;  2K6B A;  1N75 A;  2VF8 A;  2D7E A;  5KQ8 A;  4DV2 M;  3AOG A;  4QOZ C;  2R62 A;  1ORY B;  3BXW A;  1N36 M;  5LMU M;  2LVQ D;  3BOS A;  1HNZ M;  1JQJ C;  5GKN A;  4KT0 F;  5EQT A;  4LFB M;  2Y0T A;  3HHX A;  1NJF A;  1TGU A;  4L78 A;  4JI7 M;  4ZPX A;  1XC8 A;  1N32 M;  1ZV1 A;  2LVN C;  4AKG A;  1F4I A;  4DV7 M;  4TUW A;  3QYE A;  4BB9 A;  1NV8 A;  1XXH B;  2Y20 A;  5FTL A;  3QAU A;  3BBZ A;  3CF2 A;  4CIZ A;  2W82 A;  1Z5A A;  2KRK A;  3SAW A;  1K3W A;  2KDL A;  2KNV A;  4DV6 M;  2DAM A;  4FWD A;  3VK7 A;  4IIW A;  3GP1 A;  3VKG A;  5ITY A;  3J27 B;  2JWS A;  2J5Y A;  1E32 A;  2QHO B;  4LF7 M;  5ITQ A;  2DXI A;  3T1H M;  3IEC A;  4IBI A;  4GKK M;  4Z6Y A;  4B3R M;  2AHM A;  3KS4 A;  1PJQ A;  3FUV A;  1AIP C;  3JR5 A;  2LTU A;  3GLF E;  1DGH B;  1PJJ A;  3I4Y A;  2E5L M;  3AOE C;  3U60 B;  1SXJ B;  1XMQ M;  1PRB A;  2UU9 M;  2DWL A;  2XFT A;  2ZBK B;  4DR7 M;  1Z6T A;  3FUW A;  4JI3 M;  2CE7 A;  3UK6 A;  1NY5 A;  1R2Y A;  3GPX A;  8CAT A;  1FJG M;  1T3T A;  1ZAE A;  1IN4 A;  1JR3 E;  3LVV A;  4QOS A;  3IG5 A;  1IY0 A;  2G5G X;  2YNM D;  2J7O A;  1NO1 A;  4LF4 M;  2CWB A; 
#chains in the Genus database with same CATH homology
 1GAB A;  2VDB B;  2N35 A;  2LHG A;  1GJT A;  2JWS A;  1PRB A;  2J5Y A;  1TF0 B;  1GJS A;  2LHC A;  2FS1 A;  2KDL A;  2MH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...