2JY8A

Nmr structure of the ubiquitin associated (uba) domain of p62 (sqstm1) in complex with ubiquitin. rdc refined
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ubiquitin Recognition by the Ubiquitin-associated Domain of p62 Involves a Novel Conformational Switch
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin-binding protein p62
total genus 4
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy8A00
2DAIA 4HEOA 1WR1B 2RRUA 3GLIE 1Q02A 2DAEA 2HAKA 2JY5A 4F2LA 2ZTCA 3GLHE 3E46A 4G3OA 2DZLA 5JI2E 3IECA 1OTRA 2DAGA 1PGYA 4UN2B 2JZ1A 2JZ0A 2DI0A 1F4IA 1WIVA 3LCVB 2KNAA 1WHCA 2MJ5B 2DENA 1AIPC 3K9OA 2DKLA 1Y8GA 1SG9A 2K9DA 2CP8A 1OKSA 2JY6B 2L4EA 3BBZA 2JNHA 3GLFE 1ZMWA 1CUKA 2L2DA 1DO2A 1HT2E 1YLAA 1G4AE 4Q7JA 1TTEA 2MR9A 2DAKA 2JP7A 1G41A 2MROB 1VEJA 1HJPA 2MGWA 2OOAA 1IFYA 2L4FA 3E21A 2EJSA 2EKKA 1GO5A 1QZEA 2QSFX 3B89A 4GEWA 1IM2A 2G3QA 1HQYE 4F1IA 1NV9A 1MN3A 2LVAA 3H4JA 2LVNC 1A5TA 1NV8A 1JR3E 2LVQD 2OO9A 4WP2A 3F92A 2DHYA 1VG5A 2HWJA 2LTUA 1IXSA 2DAMA 1ZMVA 3IHPA 3GLGE 3FE3A 3FRIA 2R0IA 1ZV1A 2JUJA 1OQYA 1UFZA 2QNJA 1XXHE 1ZMUA 2B3TA 1WGLA 2EKFA 1EFUB 2BWEA 1G3IA 1XB2B 2KNVA 1C7YA 2KNZA 1WGNA 1P3QQ 1V92A 2BWBA 2LBCA 1E94E 1TR8A 2KHHA 2ZTDA 2H5XA 2JY7A 1DO0A 1WJ7A 1R4GA 3LCUA 2WZJA 3MMPA 3K9PA 2LVPC 2LVOC 5DFLA 2JY8A 4R71A 1VQ1A 3FRHA 1T43A 2QHOB 1KYIA 1VEGA 2DNAA 2CWBA 2OOBA 4DBGB 3T6PA 1HT1E 1OAIA 1T6OA 2K0BX 1VEKA 2O25A 1DV0A 1BVSA 1VDLA
chains in the Genus database with same CATH superfamily
3FTFA 3SBJA 3HHWA 5IZ7D 4DV3M 3AFHA 4G4QA 5LMUM 2DAIA 4HEOA 4QHTA 2RRUA 3GLIE 4B7GA 5FTNA 1N34M 2QENA 2DAEA 5EP1A 4CJ6A 4D81A 2JY5A 2G5GX 4XK8F 2LHCA 3GRYA 4DR4M 2ZTCA 4ITQA 4GC5A 4DR6M 4MGYE 3E46A 4DV5M 1XNRM 3HX3A 2LWXA 4JI3M 3U6CA 1TGUA 3RFWA 2QP9X 3KFUG 3SHFA 1R5LA 1C1KA 3L28A 2D7EA 3WHLA 2RGHA 2ZAOA 4LF7M 4LJ4A 5C1BA 4LF6M 2Y0TA 2XZUA 1ORYB 4GC9A 2EA0A 4L8RC 1F4IA 3NBXX 3FUWA 4IBIA 4NSRA 3J80S 3A98B 4LJAA 1Q39A 2KNAA 5KQ8A 4LJ6A 5H37D 4KLNA 2YR0A 2OQ4A 1YUBA 4QHSA 3LQQA 4AG5A 4K0KM 4IBDA 1IXRC 2BJWA 3FTCA 3K9OA 1TDHA 4G4RA 3VK8A 2K9DA 4MGHA 3LW5F 3U6SA 3QYEA 4IJEA 2F5NA 4LG2A 3BBZA 3K2LA 3GLFE 2HCBA 1PM5A 2KRKA 1ZMWA 2UU9M 3CF2A 1TH3A 3KS4A 4B3MM 2CE7A 3U6LA 4DV7M 2K47A 2F5SA 2DVWB 2Z4SA 1N77A 1DGHA 3SARA 4L6V6 1G4AE 4FD2A 3A42A 4LJ7A 5BPVA 4ANRA 3VK7A 1GABA 2N35A 1MX0A 3VKGA 3AOGA 3WHKA 5EP3A 4IBKA 3GLHA 2QBYA 1G41A 4LGMA 3TQSA 2AHMA 2DZOB 2HL7A 2O01F 3U6QA 1Z5BA 2L4FA 3L2AA 1XNQM 1QZEA 4NXNM 1GO5A 3B89A 4LRSA 1HQYE 3PNYA 3TPZA 2CV2A 3PVSA 4L15A 3RGPA 2LVNC 2XSZD 1TDZA 1HR0M 1E9RA 4L78A 4LRTA 4WP2A 3J81S 3FKEA 2I7PA 2HWJA 4I5SA 5LMNM 1QANA 3HZJA 3U61B 2EUCA 3FUUA 3U6OA 3IHPA 4GIPA 2R0IA 3HKPA 2XZFA 4LGYA 1OQYA 1XHBA 2QNJA 4QOZC 1T3TA 2FOIC 4KODA 3ZH9B 3GLIB 2QBYB 2GNOA 1PRBA 2JXNA 2B3TA 1HNXM 1N78A 1EFUB 2BWEA 1G3IA 2C9CA 4JI4M 2KNZA 1L2CA 2BNKA 4GHAA 1IBLM 1QDRA 4CISA 3GO8A 1V92A 2R4JA 4M0WA 1E94E 1L2BA 1E9SA 2LXEA 4NSOB 2H5XA 2C5RA 3GRRA 1WJ7A 2DWNA 1IY0A 3ILKA 4L4UA 1ZQ9A 5KPZA 2LVPC 2LVOC 1N33M 1Z59A 3L27A 5FTKA 3FRHA 4LY6A 3DOAA 3I4YA 2DZNB 1KSFX 2Z8YM 1IQPA 2KW0A 2D7GA 4GITA 4M9SA 4PT5A 4DV2M 2UUAM 2JA2A 2Y0QA 3AL0C 2QCUA 3QYBA 2CRUA 1L1TA 4DBGB 5IT9S 4JI6M 1PJTA 1T6OA 4IIWA 2F5QA 1Q3CA 1VDLA 1OIPA 4JXJA 3DFZA 3L26A 3U6DA 3U5ZB 3MHVC 5ITQA 1WR1B 4X62M 2VF8A 4WURA 3SYKA 2YQZA 1WXQA 2HAKA 1Z5CA 3KSXA 4F2LA 4PCZA 1I94M 2V1UA 4R3DA 3AV0A 3M7GA 5FLXS 1PJQA 3TWLA 2DZLA 5JI2E 4D80A 2KA6B 2DAGA 3K92A 1PGYA 4JYAM 2VQFM 3W0LB 3J27B 4DR2M 4DR3M 2RGOA 2R6FA 2Z7JA 3KOZE 4LF5M 2DI0A 2CEAA 5E26A 4IBBA 1S3SA 3JR4A 5ITXE 1EIJA 3U61A 4DV6M 4PD2A 3UGJA 4NOOB 2CHGA 1K82A 4G6ZA 4JI0M 2KEBA 4NC6A 4OVZB 3BXWA 3VDUA 3U5ZA 3TL4X 1NJFA 4LFAM 3SASA 1NY6A 1Y8GA 1GVNA 3CTWB 4YY3M 3EIEA 1OKSA 3GLHB 2DXIA 2L4EA 5DYIA 1J5EM 1G71A 2JNHA 2VF7A 3SFZA 3W0FA 4LF8M 4B7FA 1YLAA 4I4LA 1EE8A 2OPFA 4M9ZA 3R8FA 2FE8A 1LV7A 4Y28F 2DAKA 3UMMA 5DYGA 4LFCM 2MROB 2Q2EB 3GPPA 1XC8A 3I4VA 3SMPA 2QZ4A 3E4RA 2UUCM 4IBFA 2EJSA 2EKKA 4BLCA 2L6OA 2XLJA 3T15A 4LF9M 2GQFA 1IM2A 3SHGB 2Y20A 4F1IA 2VQEM 1MN3A 2C96A 3NWLA 3H4JA 3U6EA 4AKGA 1NVMA 2LHGA 2OO9A 1Q3BA 2LVQD 2R45A 1D2NA 2WSEF 5E6JA 2JWSA 1DGBA 3IG8A 1ZMVA 3GQ4A 1QQWA 3FRIA 2WSFF 3J7AS 3UK6A 5L8RF 1UFZA 2KDLA 2F5PA 3HWSA 2KZSA 5IREB 3KS8A 3D8LA 4FVMA 4G4NA 1SXJD 1UM8A 3L25A 3ZCBB 4ZPXA 1OJLA 3SATA 1QAMA 1N36M 3R9XB 3HY5A 4NRVA 1P3QQ 3KP1E 1PJSA 4MGKE 2R18A 4Z6YA 1R7RA 2C98A 2LBCA 1IY1A 1TR8A 2KHHA 3FUVA 8CATA 1E32A 7CATA 1QAOA 2WSCF 2JY7A 1DO0A 3VKHA 5EXSA 1R4GA 3KDSE 4DR7M 5FSWA 2LNHC 3D8BA 3U6MA 2K6BA 1NHWC 4RKUF 2JY8A 1VQ1A 2QQ8A 4OU7A 4II7A 2Y21A 2LH0A 4X66M 3U60A 3LMMA 2E5LM 3KOWE 4D82A 5KPTA 1GL6A 2CWBA 2XSZA 3VDPA 3GLIA 4DV4M 3AOEA 2R46A 4JI8M 3UZUA 2J5YA 1FJGM 1IY2A 5GKNA 2K0BX 1OAIA 1H6UA 4R7GA 2CV1A 4KO8A 4RF1A 1VEKA 2V6ZM 4LJ5A 3SYLA 3U6PA 3VLFB 3K8ZA 2UXBM 4KT0F 1QYRA 1D0MA 1W5SA 1L2DA 4P17A 4LZJA 2KRUA 5JI3E 1NNJA 2C99A 4LFBM 1N32M 5ITTA 4CGYB 3UJNA 4AW4A 3C3EA 5C18A 4IBJA 5IWAM 2L09A 2XFTA 3FTDA 3IECA 1HNWM 4OVZA 2V1CA 3B9PA 2JZ1A 2BJVA 4YHHM 3U60B 1IBMM 3L29A 3FUXA 4PDIA 1D0KA 3MK6A 1IN7A 2Z4RA 4JN6A 2P5TA 4BBAA 2KZUA 3I04M 3LCVB 1G59A 3J7BA 2MJ5B 3SAVA 4GRIA 1OIZA 2DENA 5FTLA 3GLGA 5EJCA 2F4VM 2L7IA 4REZA 2X8AA 4GHLA 1AIPC 2DKLA 1XXHA 2L7HA 3RGSA 2JY6B 4FWHA 4XGIA 1L1ZA 3PFIA 2KXEA 2DHRA 4KHPM 1SXJE 1CUKA 3AOEC 4FCWA 2L2DA 1DO2A 3A46A 3SAWA 3C58A 4NXMM 4AG6A 1GJSA 5EXXA 1TTEA 4B3RM 1R2YA 1DGGA 4GKKM 3GRVA 3GLFA 1VDDA 2JP7A 2X4AA 1K3XA 4JI1M 1VEJA 1XWIA 1Z5AA 5FTJA 3THGA 2OOAA 3CF6E 1PJJA 1IFYA 3E21A 4DUZM 4DUYM 4LF4M 2QSFX 4IBGA 2Z3XA 1JR3D 2G3QA 1V33A 4QNRA 3HHZA 3B7QA 2CHQA 4P16A 3OTOM 1A5TA 1NV8A 1W5TA 1JR3E 1G8PA 1QAQA 2G8LA 3HU3A 2DHYA 2J7OA 4PDGA 1VG5A 2C9OA 1IN5A 2LTUA 1NNUC 1IXSA 2CFOA 1MU5A 3T1HM 1K3WA 3GLGE 3FE3A 1ZV1A 4JV5M 3LVWA 2JUJA 3MJ5A 3HHXA 1IXZA 3HJQA 3GQ5A 1XXHE 3Q8XA 3PXGA 4EIWA 1J7KA 3GQ3A 2VDBB 3W68A 3AKZA 2R65A 3B7ZA 1QDTA 1NY5A 1ZMUA 3LVVA 3J2PB 1SXJA 1OFIA 4RF0A 3QWLA 1C7YA 3K1JA 4MH0E 1L8QA 5ITUA 2J7NA 3M6AA 3JR5A 1IBKM 3SMSA 1R6BX 2ZTDA 1TH2A 3V76A 3LCUA 3RE8A 3GPXA 5KQDA 3GP1A 2R62A 2R4EA 1JB0F 3MMPA 4AKHA 3K9PA 4OX9M 4R71A 1ZAEA 1J09A 3FYCA 5EP2A 2HKJA 4G4OA 4QNMA 3GLGB 1KYIA 1GLNA 3TE6A 3GPYA 3CGWA 2CV0A 2DWMA 4S12A 1NO1A 3HHYA 1QVRA 2OOBA 2XF3A 3T6PA 3DA1A 4JI7M 1HT1E 2UXCM 2X49A 1YSYA 2O5RA 1DV0A 1OAOC 2UUBM 4FWDA 3KOXE 4A3VB 4NRWA 2ZM6M 2CUZA 1I4WA 4CIZA 3EIHA 1IN8A 2XH9A 3NBIA 4MGZE 5KO3A 1XMOM 2A5YB 1TF0B 2YNMD 4LCBA 4MM3B 4CHTB 4B08A 1PJIA 1GKIA 1Q02A 3HGIA 1YE9A 1QZMA 3AJIB 3GLHE 5EQTA 3SC3A 3SAUA 3VFDA 3GPUA 5DNYA 4G3OA 1DGHB 1OTRA 2QPAA 3ZQJA 4UN2B 2JZ0A 2ZAMA 4B7HA 3FD9A 1IN6A 1XXHB 3LQRA 4I8OA 1HNZM 4OW0A 1X37A 4AI6A 2XFSA 1WIVA 4IJFA 2W82A 4HL4A 4AKIA 1WHCA 1NJGA 5EXPA 1XMQM 2FH0A 3ZC7B 2I7NA 4AZFA 1KFVA 2HHHM 1TH4A 2YFQA 3FTEA 4LJ9A 1IN4A 3DZDA 2MH8A 3GLFB 1SG9A 2EO2A 2CP8A 2ZBKB 5KPRA 4JI5M 4IBCA 3H4MA 4JI2M 5ITYA 2F5OA 3PNVA 4M0DA 1SXJB 5BR8M 2XEPA 3FUTA 3GRUA 3A45A 1HT2E 4W5WA 3TWMA 5F3WA 3CF0A 4Q7JA 1MJGM 3HJSA 2MR9A 3C3DA 2ZANA 3T38A 2M60A 3KSJA 1IXSB 1Z6TA 1HJPA 2MGWA 3KP0E 1GL7A 4X64M 1D0LA 4GEWA 4DR5M 2RKOA 4GMQA 4X65M 1NV9A 5EP4A 2LVAA 4NL4H 1R2ZA 3T1YM 3F92A 4FCVA 4HLQA 3W67A 1QUTA 4L16A 1SXJC 2DAMA 3KOYE 1NSFA 4GH9A 3I51A 2FNAA 4TUWA 4FCTA 1N75A 1GJTA 3E9SA 5FTMA 4RNAA 4XBOA 1OFHA 2H1RA 4DV0M 2FS1A 4B3SM 5ITRA 1NHGC 3TWKA 1HQCA 1RU3A 4M9XA 1WGLA 2EKFA 1XB2B 2M5ZA 2KNVA 4I81A 1WGNA 2VIIA 1QUSA 4LJ8A 3IG5A 3HU2A 3HU1A 2FFJA 1AUAA 1DGFA 4BB9A 2BWBA 4DR1M 3KW6A 4FW9A 1JQJC 1LTMA 2WZJA 2ERCA 3M0EA 2DWZB 2CHVA 2APLA 4QOSA 5A2QS 5ITXA 5DFLA 2UXDM 2D7HA 3I01M 2R44A 4IBEA 4WW0A 1T43A 2QHOB 4B3TM 1VEGA 4MB7A 1JR3A 3JAMS 2NQ8C 3KVWA 5EXTA 3HJ8A 2DNAA 3B74A 3C9PA 1V34A 4MGIE 2XGNA 2DWLA 1FNNA 3FYDA 3BOSA 3B7NA 4AQYM 2O25A 4LZZA 1BVSA 4DV1M 3Q8GA 4GKJM 3QAUA 4Z8XA 4FWGA 3KXEC
chains in the Genus database with same CATH topology
2DAIA 4HEOA 1WR1B 2RRUA 3GLIE 1Q02A 2DAEA 2HAKA 2JY5A 4F2LA 2ZTCA 3GLHE 3E46A 4G3OA 2DZLA 5JI2E 3IECA 1OTRA 2DAGA 1PGYA 4UN2B 2JZ1A 2JZ0A 2DI0A 1F4IA 1WIVA 3LCVB 2KNAA 1WHCA 2MJ5B 2DENA 1AIPC 3K9OA 2DKLA 1Y8GA 1SG9A 2K9DA 2CP8A 1OKSA 2JY6B 2L4EA 3BBZA 2JNHA 3GLFE 1ZMWA 1CUKA 2L2DA 1DO2A 1HT2E 1YLAA 1G4AE 4Q7JA 1TTEA 2MR9A 2DAKA 2JP7A 1G41A 2MROB 1VEJA 1HJPA 2MGWA 2OOAA 1IFYA 2L4FA 3E21A 2EJSA 2EKKA 1GO5A 1QZEA 2QSFX 3B89A 4GEWA 1IM2A 2G3QA 1HQYE 4F1IA 1NV9A 1MN3A 2LVAA 3H4JA 2LVNC 1A5TA 1NV8A 1JR3E 2LVQD 2OO9A 4WP2A 3F92A 2DHYA 1VG5A 2HWJA 2LTUA 1IXSA 2DAMA 1ZMVA 3IHPA 3GLGE 3FE3A 3FRIA 2R0IA 1ZV1A 2JUJA 1OQYA 1UFZA 2QNJA 1XXHE 1ZMUA 2B3TA 1WGLA 2EKFA 1EFUB 2BWEA 1G3IA 1XB2B 2KNVA 1C7YA 2KNZA 1WGNA 1P3QQ 1V92A 2BWBA 2LBCA 1E94E 1TR8A 2KHHA 2ZTDA 2H5XA 2JY7A 1DO0A 1WJ7A 1R4GA 3LCUA 2WZJA 3MMPA 3K9PA 2LVPC 2LVOC 5DFLA 2JY8A 4R71A 1VQ1A 3FRHA 1T43A 2QHOB 1KYIA 1VEGA 2DNAA 2CWBA 2OOBA 4DBGB 3T6PA 1HT1E 1OAIA 1T6OA 2K0BX 1VEKA 2O25A 1DV0A 1BVSA 1VDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DAI A;  4HEO A;  1WR1 B;  2RRU A;  3GLI E;  1Q02 A;  2DAE A;  2HAK A;  2JY5 A;  4F2L A;  2ZTC A;  3GLH E;  3E46 A;  4G3O A;  2DZL A;  5JI2 E;  3IEC A;  1OTR A;  2DAG A;  1PGY A;  4UN2 B;  2JZ1 A;  2JZ0 A;  2DI0 A;  1F4I A;  1WIV A;  3LCV B;  2KNA A;  1WHC A;  2MJ5 B;  2DEN A;  1AIP C;  3K9O A;  2DKL A;  1Y8G A;  1SG9 A;  2K9D A;  2CP8 A;  1OKS A;  2JY6 B;  2L4E A;  3BBZ A;  2JNH A;  3GLF E;  1ZMW A;  1CUK A;  2L2D A;  1DO2 A;  1HT2 E;  1YLA A;  1G4A E;  4Q7J A;  1TTE A;  2MR9 A;  2DAK A;  2JP7 A;  1G41 A;  2MRO B;  1VEJ A;  1HJP A;  2MGW A;  2OOA A;  1IFY A;  2L4F A;  3E21 A;  2EJS A;  2EKK A;  1GO5 A;  1QZE A;  2QSF X;  3B89 A;  4GEW A;  1IM2 A;  2G3Q A;  1HQY E;  4F1I A;  1NV9 A;  1MN3 A;  2LVA A;  3H4J A;  2LVN C;  1A5T A;  1NV8 A;  1JR3 E;  2LVQ D;  2OO9 A;  4WP2 A;  3F92 A;  2DHY A;  1VG5 A;  2HWJ A;  2LTU A;  1IXS A;  2DAM A;  1ZMV A;  3IHP A;  3GLG E;  3FE3 A;  3FRI A;  2R0I A;  1ZV1 A;  2JUJ A;  1OQY A;  1UFZ A;  2QNJ A;  1XXH E;  1ZMU A;  2B3T A;  1WGL A;  2EKF A;  1EFU B;  2BWE A;  1G3I A;  1XB2 B;  2KNV A;  1C7Y A;  2KNZ A;  1WGN A;  1P3Q Q;  1V92 A;  2BWB A;  2LBC A;  1E94 E;  1TR8 A;  2KHH A;  2ZTD A;  2H5X A;  2JY7 A;  1DO0 A;  1WJ7 A;  1R4G A;  3LCU A;  2WZJ A;  3MMP A;  3K9P A;  2LVP C;  2LVO C;  5DFL A;  2JY8 A;  4R71 A;  1VQ1 A;  3FRH A;  1T43 A;  2QHO B;  1KYI A;  1VEG A;  2DNA A;  2CWB A;  2OOB A;  4DBG B;  3T6P A;  1HT1 E;  1OAI A;  1T6O A;  2K0B X;  1VEK A;  2O25 A;  1DV0 A;  1BVS A;  1VDL A; 
#chains in the Genus database with same CATH topology
 3FTF A;  3SBJ A;  3HHW A;  5IZ7 D;  4DV3 M;  3AFH A;  4G4Q A;  5LMU M;  2DAI A;  4HEO A;  4QHT A;  2RRU A;  3GLI E;  4B7G A;  5FTN A;  1N34 M;  2QEN A;  2DAE A;  5EP1 A;  4CJ6 A;  4D81 A;  2JY5 A;  2G5G X;  4XK8 F;  2LHC A;  3GRY A;  4DR4 M;  2ZTC A;  4ITQ A;  4GC5 A;  4DR6 M;  4MGY E;  3E46 A;  4DV5 M;  1XNR M;  3HX3 A;  2LWX A;  4JI3 M;  3U6C A;  1TGU A;  3RFW A;  2QP9 X;  3KFU G;  3SHF A;  1R5L A;  1C1K A;  3L28 A;  2D7E A;  3WHL A;  2RGH A;  2ZAO A;  4LF7 M;  4LJ4 A;  5C1B A;  4LF6 M;  2Y0T A;  2XZU A;  1ORY B;  4GC9 A;  2EA0 A;  4L8R C;  1F4I A;  3NBX X;  3FUW A;  4IBI A;  4NSR A;  3J80 S;  3A98 B;  4LJA A;  1Q39 A;  2KNA A;  5KQ8 A;  4LJ6 A;  5H37 D;  4KLN A;  2YR0 A;  2OQ4 A;  1YUB A;  4QHS A;  3LQQ A;  4AG5 A;  4K0K M;  4IBD A;  1IXR C;  2BJW A;  3FTC A;  3K9O A;  1TDH A;  4G4R A;  3VK8 A;  2K9D A;  4MGH A;  3LW5 F;  3U6S A;  3QYE A;  4IJE A;  2F5N A;  4LG2 A;  3BBZ A;  3K2L A;  3GLF E;  2HCB A;  1PM5 A;  2KRK A;  1ZMW A;  2UU9 M;  3CF2 A;  1TH3 A;  3KS4 A;  4B3M M;  2CE7 A;  3U6L A;  4DV7 M;  2K47 A;  2F5S A;  2DVW B;  2Z4S A;  1N77 A;  1DGH A;  3SAR A;  4L6V 6;  1G4A E;  4FD2 A;  3A42 A;  4LJ7 A;  5BPV A;  4ANR A;  3VK7 A;  1GAB A;  2N35 A;  1MX0 A;  3VKG A;  3AOG A;  3WHK A;  5EP3 A;  4IBK A;  3GLH A;  2QBY A;  1G41 A;  4LGM A;  3TQS A;  2AHM A;  2DZO B;  2HL7 A;  2O01 F;  3U6Q A;  1Z5B A;  2L4F A;  3L2A A;  1XNQ M;  1QZE A;  4NXN M;  1GO5 A;  3B89 A;  4LRS A;  1HQY E;  3PNY A;  3TPZ A;  2CV2 A;  3PVS A;  4L15 A;  3RGP A;  2LVN C;  2XSZ D;  1TDZ A;  1HR0 M;  1E9R A;  4L78 A;  4LRT A;  4WP2 A;  3J81 S;  3FKE A;  2I7P A;  2HWJ A;  4I5S A;  5LMN M;  1QAN A;  3HZJ A;  3U61 B;  2EUC A;  3FUU A;  3U6O A;  3IHP A;  4GIP A;  2R0I A;  3HKP A;  2XZF A;  4LGY A;  1OQY A;  1XHB A;  2QNJ A;  4QOZ C;  1T3T A;  2FOI C;  4KOD A;  3ZH9 B;  3GLI B;  2QBY B;  2GNO A;  1PRB A;  2JXN A;  2B3T A;  1HNX M;  1N78 A;  1EFU B;  2BWE A;  1G3I A;  2C9C A;  4JI4 M;  2KNZ A;  1L2C A;  2BNK A;  4GHA A;  1IBL M;  1QDR A;  4CIS A;  3GO8 A;  1V92 A;  2R4J A;  4M0W A;  1E94 E;  1L2B A;  1E9S A;  2LXE A;  4NSO B;  2H5X A;  2C5R A;  3GRR A;  1WJ7 A;  2DWN A;  1IY0 A;  3ILK A;  4L4U A;  1ZQ9 A;  5KPZ A;  2LVP C;  2LVO C;  1N33 M;  1Z59 A;  3L27 A;  5FTK A;  3FRH A;  4LY6 A;  3DOA A;  3I4Y A;  2DZN B;  1KSF X;  2Z8Y M;  1IQP A;  2KW0 A;  2D7G A;  4GIT A;  4M9S A;  4PT5 A;  4DV2 M;  2UUA M;  2JA2 A;  2Y0Q A;  3AL0 C;  2QCU A;  3QYB A;  2CRU A;  1L1T A;  4DBG B;  5IT9 S;  4JI6 M;  1PJT A;  1T6O A;  4IIW A;  2F5Q A;  1Q3C A;  1VDL A;  1OIP A;  4JXJ A;  3DFZ A;  3L26 A;  3U6D A;  3U5Z B;  3MHV C;  5ITQ A;  1WR1 B;  4X62 M;  2VF8 A;  4WUR A;  3SYK A;  2YQZ A;  1WXQ A;  2HAK A;  1Z5C A;  3KSX A;  4F2L A;  4PCZ A;  1I94 M;  2V1U A;  4R3D A;  3AV0 A;  3M7G A;  5FLX S;  1PJQ A;  3TWL A;  2DZL A;  5JI2 E;  4D80 A;  2KA6 B;  2DAG A;  3K92 A;  1PGY A;  4JYA M;  2VQF M;  3W0L B;  3J27 B;  4DR2 M;  4DR3 M;  2RGO A;  2R6F A;  2Z7J A;  3KOZ E;  4LF5 M;  2DI0 A;  2CEA A;  5E26 A;  4IBB A;  1S3S A;  3JR4 A;  5ITX E;  1EIJ A;  3U61 A;  4DV6 M;  4PD2 A;  3UGJ A;  4NOO B;  2CHG A;  1K82 A;  4G6Z A;  4JI0 M;  2KEB A;  4NC6 A;  4OVZ B;  3BXW A;  3VDU A;  3U5Z A;  3TL4 X;  1NJF A;  4LFA M;  3SAS A;  1NY6 A;  1Y8G A;  1GVN A;  3CTW B;  4YY3 M;  3EIE A;  1OKS A;  3GLH B;  2DXI A;  2L4E A;  5DYI A;  1J5E M;  1G71 A;  2JNH A;  2VF7 A;  3SFZ A;  3W0F A;  4LF8 M;  4B7F A;  1YLA A;  4I4L A;  1EE8 A;  2OPF A;  4M9Z A;  3R8F A;  2FE8 A;  1LV7 A;  4Y28 F;  2DAK A;  3UMM A;  5DYG A;  4LFC M;  2MRO B;  2Q2E B;  3GPP A;  1XC8 A;  3I4V A;  3SMP A;  2QZ4 A;  3E4R A;  2UUC M;  4IBF A;  2EJS A;  2EKK A;  4BLC A;  2L6O A;  2XLJ A;  3T15 A;  4LF9 M;  2GQF A;  1IM2 A;  3SHG B;  2Y20 A;  4F1I A;  2VQE M;  1MN3 A;  2C96 A;  3NWL A;  3H4J A;  3U6E A;  4AKG A;  1NVM A;  2LHG A;  2OO9 A;  1Q3B A;  2LVQ D;  2R45 A;  1D2N A;  2WSE F;  5E6J A;  2JWS A;  1DGB A;  3IG8 A;  1ZMV A;  3GQ4 A;  1QQW A;  3FRI A;  2WSF F;  3J7A S;  3UK6 A;  5L8R F;  1UFZ A;  2KDL A;  2F5P A;  3HWS A;  2KZS A;  5IRE B;  3KS8 A;  3D8L A;  4FVM A;  4G4N A;  1SXJ D;  1UM8 A;  3L25 A;  3ZCB B;  4ZPX A;  1OJL A;  3SAT A;  1QAM A;  1N36 M;  3R9X B;  3HY5 A;  4NRV A;  1P3Q Q;  3KP1 E;  1PJS A;  4MGK E;  2R18 A;  4Z6Y A;  1R7R A;  2C98 A;  2LBC A;  1IY1 A;  1TR8 A;  2KHH A;  3FUV A;  8CAT A;  1E32 A;  7CAT A;  1QAO A;  2WSC F;  2JY7 A;  1DO0 A;  3VKH A;  5EXS A;  1R4G A;  3KDS E;  4DR7 M;  5FSW A;  2LNH C;  3D8B A;  3U6M A;  2K6B A;  1NHW C;  4RKU F;  2JY8 A;  1VQ1 A;  2QQ8 A;  4OU7 A;  4II7 A;  2Y21 A;  2LH0 A;  4X66 M;  3U60 A;  3LMM A;  2E5L M;  3KOW E;  4D82 A;  5KPT A;  1GL6 A;  2CWB A;  2XSZ A;  3VDP A;  3GLI A;  4DV4 M;  3AOE A;  2R46 A;  4JI8 M;  3UZU A;  2J5Y A;  1FJG M;  1IY2 A;  5GKN A;  2K0B X;  1OAI A;  1H6U A;  4R7G A;  2CV1 A;  4KO8 A;  4RF1 A;  1VEK A;  2V6Z M;  4LJ5 A;  3SYL A;  3U6P A;  3VLF B;  3K8Z A;  2UXB M;  4KT0 F;  1QYR A;  1D0M A;  1W5S A;  1L2D A;  4P17 A;  4LZJ A;  2KRU A;  5JI3 E;  1NNJ A;  2C99 A;  4LFB M;  1N32 M;  5ITT A;  4CGY B;  3UJN A;  4AW4 A;  3C3E A;  5C18 A;  4IBJ A;  5IWA M;  2L09 A;  2XFT A;  3FTD A;  3IEC A;  1HNW M;  4OVZ A;  2V1C A;  3B9P A;  2JZ1 A;  2BJV A;  4YHH M;  3U60 B;  1IBM M;  3L29 A;  3FUX A;  4PDI A;  1D0K A;  3MK6 A;  1IN7 A;  2Z4R A;  4JN6 A;  2P5T A;  4BBA A;  2KZU A;  3I04 M;  3LCV B;  1G59 A;  3J7B A;  2MJ5 B;  3SAV A;  4GRI A;  1OIZ A;  2DEN A;  5FTL A;  3GLG A;  5EJC A;  2F4V M;  2L7I A;  4REZ A;  2X8A A;  4GHL A;  1AIP C;  2DKL A;  1XXH A;  2L7H A;  3RGS A;  2JY6 B;  4FWH A;  4XGI A;  1L1Z A;  3PFI A;  2KXE A;  2DHR A;  4KHP M;  1SXJ E;  1CUK A;  3AOE C;  4FCW A;  2L2D A;  1DO2 A;  3A46 A;  3SAW A;  3C58 A;  4NXM M;  4AG6 A;  1GJS A;  5EXX A;  1TTE A;  4B3R M;  1R2Y A;  1DGG A;  4GKK M;  3GRV A;  3GLF A;  1VDD A;  2JP7 A;  2X4A A;  1K3X A;  4JI1 M;  1VEJ A;  1XWI A;  1Z5A A;  5FTJ A;  3THG A;  2OOA A;  3CF6 E;  1PJJ A;  1IFY A;  3E21 A;  4DUZ M;  4DUY M;  4LF4 M;  2QSF X;  4IBG A;  2Z3X A;  1JR3 D;  2G3Q A;  1V33 A;  4QNR A;  3HHZ A;  3B7Q A;  2CHQ A;  4P16 A;  3OTO M;  1A5T A;  1NV8 A;  1W5T A;  1JR3 E;  1G8P A;  1QAQ A;  2G8L A;  3HU3 A;  2DHY A;  2J7O A;  4PDG A;  1VG5 A;  2C9O A;  1IN5 A;  2LTU A;  1NNU C;  1IXS A;  2CFO A;  1MU5 A;  3T1H M;  1K3W A;  3GLG E;  3FE3 A;  1ZV1 A;  4JV5 M;  3LVW A;  2JUJ A;  3MJ5 A;  3HHX A;  1IXZ A;  3HJQ A;  3GQ5 A;  1XXH E;  3Q8X A;  3PXG A;  4EIW A;  1J7K A;  3GQ3 A;  2VDB B;  3W68 A;  3AKZ A;  2R65 A;  3B7Z A;  1QDT A;  1NY5 A;  1ZMU A;  3LVV A;  3J2P B;  1SXJ A;  1OFI A;  4RF0 A;  3QWL A;  1C7Y A;  3K1J A;  4MH0 E;  1L8Q A;  5ITU A;  2J7N A;  3M6A A;  3JR5 A;  1IBK M;  3SMS A;  1R6B X;  2ZTD A;  1TH2 A;  3V76 A;  3LCU A;  3RE8 A;  3GPX A;  5KQD A;  3GP1 A;  2R62 A;  2R4E A;  1JB0 F;  3MMP A;  4AKH A;  3K9P A;  4OX9 M;  4R71 A;  1ZAE A;  1J09 A;  3FYC A;  5EP2 A;  2HKJ A;  4G4O A;  4QNM A;  3GLG B;  1KYI A;  1GLN A;  3TE6 A;  3GPY A;  3CGW A;  2CV0 A;  2DWM A;  4S12 A;  1NO1 A;  3HHY A;  1QVR A;  2OOB A;  2XF3 A;  3T6P A;  3DA1 A;  4JI7 M;  1HT1 E;  2UXC M;  2X49 A;  1YSY A;  2O5R A;  1DV0 A;  1OAO C;  2UUB M;  4FWD A;  3KOX E;  4A3V B;  4NRW A;  2ZM6 M;  2CUZ A;  1I4W A;  4CIZ A;  3EIH A;  1IN8 A;  2XH9 A;  3NBI A;  4MGZ E;  5KO3 A;  1XMO M;  2A5Y B;  1TF0 B;  2YNM D;  4LCB A;  4MM3 B;  4CHT B;  4B08 A;  1PJI A;  1GKI A;  1Q02 A;  3HGI A;  1YE9 A;  1QZM A;  3AJI B;  3GLH E;  5EQT A;  3SC3 A;  3SAU A;  3VFD A;  3GPU A;  5DNY A;  4G3O A;  1DGH B;  1OTR A;  2QPA A;  3ZQJ A;  4UN2 B;  2JZ0 A;  2ZAM A;  4B7H A;  3FD9 A;  1IN6 A;  1XXH B;  3LQR A;  4I8O A;  1HNZ M;  4OW0 A;  1X37 A;  4AI6 A;  2XFS A;  1WIV A;  4IJF A;  2W82 A;  4HL4 A;  4AKI A;  1WHC A;  1NJG A;  5EXP A;  1XMQ M;  2FH0 A;  3ZC7 B;  2I7N A;  4AZF A;  1KFV A;  2HHH M;  1TH4 A;  2YFQ A;  3FTE A;  4LJ9 A;  1IN4 A;  3DZD A;  2MH8 A;  3GLF B;  1SG9 A;  2EO2 A;  2CP8 A;  2ZBK B;  5KPR A;  4JI5 M;  4IBC A;  3H4M A;  4JI2 M;  5ITY A;  2F5O A;  3PNV A;  4M0D A;  1SXJ B;  5BR8 M;  2XEP A;  3FUT A;  3GRU A;  3A45 A;  1HT2 E;  4W5W A;  3TWM A;  5F3W A;  3CF0 A;  4Q7J A;  1MJG M;  3HJS A;  2MR9 A;  3C3D A;  2ZAN A;  3T38 A;  2M60 A;  3KSJ A;  1IXS B;  1Z6T A;  1HJP A;  2MGW A;  3KP0 E;  1GL7 A;  4X64 M;  1D0L A;  4GEW A;  4DR5 M;  2RKO A;  4GMQ A;  4X65 M;  1NV9 A;  5EP4 A;  2LVA A;  4NL4 H;  1R2Z A;  3T1Y M;  3F92 A;  4FCV A;  4HLQ A;  3W67 A;  1QUT A;  4L16 A;  1SXJ C;  2DAM A;  3KOY E;  1NSF A;  4GH9 A;  3I51 A;  2FNA A;  4TUW A;  4FCT A;  1N75 A;  1GJT A;  3E9S A;  5FTM A;  4RNA A;  4XBO A;  1OFH A;  2H1R A;  4DV0 M;  2FS1 A;  4B3S M;  5ITR A;  1NHG C;  3TWK A;  1HQC A;  1RU3 A;  4M9X A;  1WGL A;  2EKF A;  1XB2 B;  2M5Z A;  2KNV A;  4I81 A;  1WGN A;  2VII A;  1QUS A;  4LJ8 A;  3IG5 A;  3HU2 A;  3HU1 A;  2FFJ A;  1AUA A;  1DGF A;  4BB9 A;  2BWB A;  4DR1 M;  3KW6 A;  4FW9 A;  1JQJ C;  1LTM A;  2WZJ A;  2ERC A;  3M0E A;  2DWZ B;  2CHV A;  2APL A;  4QOS A;  5A2Q S;  5ITX A;  5DFL A;  2UXD M;  2D7H A;  3I01 M;  2R44 A;  4IBE A;  4WW0 A;  1T43 A;  2QHO B;  4B3T M;  1VEG A;  4MB7 A;  1JR3 A;  3JAM S;  2NQ8 C;  3KVW A;  5EXT A;  3HJ8 A;  2DNA A;  3B74 A;  3C9P A;  1V34 A;  4MGI E;  2XGN A;  2DWL A;  1FNN A;  3FYD A;  3BOS A;  3B7N A;  4AQY M;  2O25 A;  4LZZ A;  1BVS A;  4DV1 M;  3Q8G A;  4GKJ M;  3QAU A;  4Z8X A;  4FWG A;  3KXE C; 
#chains in the Genus database with same CATH homology
 2DAI A;  4HEO A;  1WR1 B;  2RRU A;  3GLI E;  1Q02 A;  2DAE A;  2HAK A;  2JY5 A;  4F2L A;  2ZTC A;  3GLH E;  3E46 A;  4G3O A;  2DZL A;  5JI2 E;  3IEC A;  1OTR A;  2DAG A;  1PGY A;  4UN2 B;  2JZ1 A;  2JZ0 A;  2DI0 A;  1F4I A;  1WIV A;  3LCV B;  2KNA A;  1WHC A;  2MJ5 B;  2DEN A;  1AIP C;  3K9O A;  2DKL A;  1Y8G A;  1SG9 A;  2K9D A;  2CP8 A;  1OKS A;  2JY6 B;  2L4E A;  3BBZ A;  2JNH A;  3GLF E;  1ZMW A;  1CUK A;  2L2D A;  1DO2 A;  1HT2 E;  1YLA A;  1G4A E;  4Q7J A;  1TTE A;  2MR9 A;  2DAK A;  2JP7 A;  1G41 A;  2MRO B;  1VEJ A;  1HJP A;  2MGW A;  2OOA A;  1IFY A;  2L4F A;  3E21 A;  2EJS A;  2EKK A;  1GO5 A;  1QZE A;  2QSF X;  3B89 A;  4GEW A;  1IM2 A;  2G3Q A;  1HQY E;  4F1I A;  1NV9 A;  1MN3 A;  2LVA A;  3H4J A;  2LVN C;  1A5T A;  1NV8 A;  1JR3 E;  2LVQ D;  2OO9 A;  4WP2 A;  3F92 A;  2DHY A;  1VG5 A;  2HWJ A;  2LTU A;  1IXS A;  2DAM A;  1ZMV A;  3IHP A;  3GLG E;  3FE3 A;  3FRI A;  2R0I A;  1ZV1 A;  2JUJ A;  1OQY A;  1UFZ A;  2QNJ A;  1XXH E;  1ZMU A;  2B3T A;  1WGL A;  2EKF A;  1EFU B;  2BWE A;  1G3I A;  1XB2 B;  2KNV A;  1C7Y A;  2KNZ A;  1WGN A;  1P3Q Q;  1V92 A;  2BWB A;  2LBC A;  1E94 E;  1TR8 A;  2KHH A;  2ZTD A;  2H5X A;  2JY7 A;  1DO0 A;  1WJ7 A;  1R4G A;  3LCU A;  2WZJ A;  3MMP A;  3K9P A;  2LVP C;  2LVO C;  5DFL A;  2JY8 A;  4R71 A;  1VQ1 A;  3FRH A;  1T43 A;  2QHO B;  1KYI A;  1VEG A;  2DNA A;  2CWB A;  2OOB A;  4DBG B;  3T6P A;  1HT1 E;  1OAI A;  1T6O A;  2K0B X;  1VEK A;  2O25 A;  1DV0 A;  1BVS A;  1VDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...