2JY8A

Nmr structure of the ubiquitin associated (uba) domain of p62 (sqstm1) in complex with ubiquitin. rdc refined
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin-binding protein p62
publication title Ubiquitin Recognition by the Ubiquitin-associated Domain of p62 Involves a Novel Conformational Switch
pubmed doi rcsb
source organism Homo sapiens
total genus 4
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy8A00
2QHOB 4UN2B 2DAMA 1UFZA 1NV8A 1XB2B 1ZMUA 2LVQD 2L2DA 4DBGB 3MMPA 1G41A 1Y8GA 1BVSA 3F92A 2LVOC 1VEKA 1HT1E 2HWJA 2DAGA 1JR3E 1EFUB 1TR8A 1VDLA 2WZJA 1T6OA 2ZTCA 3GLIE 2EKKA 2BWEA 3IECA 3IHPA 1CUKA 3K9OA 4HEOA 2OOBA 4F1IA 2G3QA 1OAIA 1G3IA 2DZLA 1GO5A 2B3TA 2JY8A 2DENA 1VG5A 3K9PA 2QNJA 1ZMVA 1R4GA 2LVNC 4Q7JA 1OTRA 2MROB 1DO0A 5JI2E 1OQYA 2JY5A 2JP7A 1DV0A 2EKFA 2BWBA 3E46A 2KNVA 1WR1B 1ZV1A 2JZ0A 1VQ1A 2CP8A 4R71A 1IFYA 3FE3A 2K0BX 4WP2A 2MGWA 2MJ5B 2LVAA 2ZTDA 1Q02A 1QZEA 1T43A 2OOAA 1G4AE 3E21A 2L4FA 1WIVA 1NV9A 1ZMWA 2KHHA 2LBCA 2DAKA 2H5XA 1VEJA 1WGLA 2JNHA 2L4EA 3FRIA 1V92A 2QSFX 2KNAA 2MR9A 2R0IA 1F4IA 2CWBA 2JY7A 1KYIA 1OKSA 4G3OA 1PGYA 2O25A 3FRHA 1C7YA 1DO2A 3GLHE 1HJPA 3B89A 1YLAA 1A5TA 1P3QQ 1E94E 2DAIA 2K9DA 3LCVB 4GEWA 1WJ7A 1IM2A 1VEGA 2JZ1A 1IXSA 3H4JA 1HQYE 2RRUA 2JUJA 1AIPC 2DNAA 4F2LA 2DI0A 1XXHE 3T6PA 1TTEA 2KNZA 3BBZA 2DKLA 2HAKA 1WGNA 3GLGE 1SG9A 1MN3A 5DFLA 3LCUA 2DAEA 2DHYA 3GLFE 2JY6B 2LVPC 1HT2E 2LTUA 2EJSA 2OO9A 1WHCA
chains in the Genus database with same CATH superfamily
4I4LA 4CIZA 4IBBA 5DNYA 4AW4A 3EIHA 3LQQA 1UFZA 4B3RM 4OX9M 1IXZA 2CE7A 1N75A 3C3EA 3HU3A 3MMPA 1XNQM 2C98A 1Y8GA 1BVSA 3HU1A 3F92A 3GLHB 3IG8A 2E5LM 2D7GA 3SARA 2R65A 2KXEA 5FTLA 3HZJA 1QVRA 1R7RA 3GRYA 3U6LA 1IN8A 4RNAA 4D80A 2R45A 1CUKA 3K9OA 4FCVA 3UGJA 2QPAA 1V33A 1GJTA 2XZFA 4LZZA 4EIWA 2OOBA 4R3DA 5LMNM 3B9PA 2G3QA 3HHWA 5FLXS 3VLFB 4NRWA 2R44A 1J09A 3AFHA 4FWHA 3FTFA 4IBKA 5EQTA 2V6ZM 5FTNA 4KLNA 2B3TA 4LFBM 2HCBA 1VG5A 4LFCM 3GPXA 2DZOB 2C99A 1R4GA 2KRUA 3HHXA 3JR4A 2LWXA 4KHPM 4Q7JA 1N78A 1GABA 3U5ZB 1DO0A 4DUYM 5FTJA 3T1HM 3A46A 2ZAMA 1K82A 4LF4M 3SASA 4GC5A 3RGSA 2C9OA 2EKFA 1FNNA 2KW0A 4MM3B 4BBAA 1MJGM 2W82A 3E46A 3J7BA 2A5YB 1E9RA 1QUTA 2L09A 4GRIA 2UUBM 2UU9M 2LHGA 4WW0A 4DR7M 2WSCF 1VQ1A 1GL7A 2VF8A 1IFYA 4YY3M 2KZUA 4OVZB 4WP2A 1N33M 3LMMA 2KEBA 3D8LA 1YE9A 1GJSA 2ZTDA 3KOWE 1TDZA 4DV7M 1Q02A 1KFVA 2OOAA 3PNYA 1PJSA 3B74A 2DWMA 3J27B 4OW0A 3THGA 1XC8A 3DA1A 1QZMA 3J7AS 4NRVA 2XFTA 3Q8XA 2VIIA 4LRTA 4LY6A 4AZFA 3GLFB 3PFIA 3SAUA 1NY6A 2MR9A 2XF3A 5EXXA 1R2ZA 2CV0A 2JY7A 3KSJA 3GQ4A 1ZAEA 3Q8GA 3GQ5A 3TWLA 2FH0A 2O25A 3CGWA 3IG5A 3GLHE 3PXGA 2N35A 3GPYA 3CF0A 1KSFX 2OPFA 1NO1A 5E6JA 1L2BA 4L6V6 4GHAA 1D2NA 1WJ7A 2DZNB 1SXJB 3PVSA 2JZ1A 1HQYE 1IN6A 2RRUA 1PJJA 4HL4A 1RU3A 4F2LA 1HQCA 5ITUA 2YFQA 4LJ8A 4LFAM 3I01M 5KO3A 2CV1A 3MJ5A 2F5NA 1Z59A 4XGIA 2QCUA 3GLIA 3TWKA 3DZDA 3U6QA 4JI4M 2XEPA 3GLGE 4MGYE 3AV0A 5KPRA 4ANRA 4LF7M 3D8BA 3LCUA 2DAEA 2Y20A 5E26A 3T1YM 1OIZA 4II7A 3HJQA 1HT2E 5DYGA 2EJSA 4IJFA 3NBIA 3KP0E 2CFOA 4Y28F 5KQDA 2X8AA 3AOEC 3EIEA 4UN2B 5LMUM 2LVQD 3GRVA 3A45A 1PJTA 2X49A 2LHCA 2L7HA 3GPUA 5C1BA 4JI8M 4IBFA 4B7FA 1JR3E 1TR8A 5EXPA 3IECA 3IHPA 4GITA 2CHVA 2KRKA 3HKPA 4L16A 1OIPA 2QP9X 3T38A 1N36M 1G71A 1K3WA 8CATA 4DR1M 3C58A 2DZLA 4IBIA 2J7OA 5IREB 4L15A 5FTKA 1V34A 2UUAM 4PDGA 4L8RC 3ZQJA 1DGHA 4ZPXA 2Q2EB 5H37D 4LF8M 3SAVA 1DGFA 2C5RA 3FD9A 4JI0M 1N77A 2Z8YM 1NHGC 3U60A 3U61B 1OTRA 5F3WA 1NHWC 5JI2E 2D7HA 2ZAOA 1Z5CA 1OQYA 2JY5A 3VKHA 1HNXM 3FYCA 2R6FA 3K1JA 4KO8A 1DV0A 1IXSB 2C9CA 1SXJE 1WR1B 4NSRA 1ZV1A 3B7NA 5GKNA 4IBJA 4P16A 4BB9A 1LV7A 3DOAA 1PM5A 4D81A 3FE3A 3K8ZA 2YR0A 3U5ZA 4B08A 3L25A 2L7IA 4B3TM 4FCWA 3CF6E 3KOYE 2CHQA 2LVAA 2WSFF 4LJAA 4DV6M 2F4VM 4LF9M 3LQRA 2Z3XA 1T43A 2I7NA 1G4AE 4S12A 3GPPA 4M9XA 1TH4A 1DGGA 3UK6A 1ZMWA 5IWAM 3WHKA 3GLGB 2CHGA 2KHHA 2RKOA 3FUUA 1TGUA 3GQ3A 4FCTA 4JI5M 3HHYA 3GP1A 4JYAM 2NQ8C 4NXMM 2QSFX 2O01F 2R0IA 4OVZA 1KYIA 2WSEF 1XXHA 4K0KM 3A42A 5EXSA 2R4JA 5ITXA 3NWLA 3L28A 1IY2A 5C18A 1Z5BA 1GLNA 3KS4A 3BOSA 4CJ6A 1AUAA 5ITYA 3B89A 3BXWA 3E9SA 2DHRA 4LJ5A 1SXJC 3GLFA 4LJ7A 1GKIA 4GMQA 2J7NA 3KSXA 1IM2A 4LGYA 3M7GA 1VEGA 3WHLA 5JI3E 4PD2A 1XHBA 2GQFA 4X62M 2XLJA 3AJIB 4JI3M 1AIPC 1MX0A 1W5SA 3SC3A 2DI0A 3I4YA 1TDHA 3LW5F 1QUSA 1C1KA 1TTEA 1QAQA 5EP2A 5ITRA 2QBYA 4REZA 4JV5M 3VK8A 4M9SA 4PCZA 3JAMS 2ERCA 2HAKA 1QYRA 1WGNA 4FW9A 1SG9A 2BJVA 2MH8A 3J2PB 4NL4H 5DFLA 3U6OA 4IBDA 3FUVA 2DWZB 2DWNA 2OO9A 1PJQA 4AKIA 4W5WA 2VF7A 2Y0QA 2F5SA 4GKKM 4I5SA 2QHOB 4DR4M 1NV8A 2G5GX 3NBXX 2F5PA 1G41A 1NJFA 4DR3M 3VFDA 4B3MM 3C3DA 2YQZA 1IY1A 1VEKA 1HT1E 3T15A 3U6CA 2HWJA 1IBMM 4JN6A 4MB7A 2RGHA 3W68A 3FUXA 1EFUB 4DR2M 2WZJA 1T6OA 3ILKA 1J7KA 3RE8A 4BLCA 1JR3D 1XWIA 2O5RA 3J80S 4HEOA 4X65M 2XSZD 4YHHM 1NNJA 3E4RA 1IY0A 5IZ7D 1L1ZA 4LF5M 4CGYB 4RF1A 4F1IA 3SMSA 3B7QA 4LF6M 1OAIA 3K2LA 1G3IA 2F5QA 4ITQA 1GO5A 1QAMA 4WURA 4AQYM 2G8LA 2EO2A 4NC6A 4DV0M 1H6UA 2R18A 3M6AA 3U6DA 2HL7A 4AKHA 4DV2M 1JB0F 3B7ZA 2FNAA 4XK8F 2V1UA 4IIWA 1ZMVA 2AHMA 2CEAA 1XMOM 2XH9A 3TL4X 1NVMA 1X37A 2MROB 1WXQA 4AG6A 5EP4A 2CUZA 3QYBA 1R5LA 1N34M 2JP7A 2R62A 3MHVC 1HNZM 1IBLM 1OFIA 4LJ6A 3AOGA 4JXJA 2OQ4A 2BWBA 3HJ8A 1W5TA 2UUCM 2KNVA 1L2DA 3V76A 2BJWA 3CTWB 3L29A 1L8QA 1SXJD 3TWMA 3AOEA 2CP8A 3A98B 4R71A 4MGKE 3SATA 2QENA 1E9SA 4G4OA 3SYLA 3GLHA 1S3SA 2APLA 3RGPA 4HLQA 1XNRM 1HNWM 2MGWA 1D0MA 2H1RA 4TUWA 3KP1E 5DYIA 1TF0B 4GH9A 1QZEA 1GL6A 2GNOA 2ZM6M 5ITTA 2L4FA 1WIVA 2LNHC 1NV9A 1TH2A 4QHTA 1QQWA 4GKJM 3PNVA 4LGMA 2DAKA 1D0LA 2H5XA 1VEJA 1WGLA 2Y0TA 2L4EA 4MGZE 1V92A 3OTOM 1EIJA 3FUTA 2KNAA 4GIPA 2M60A 2R4EA 1F4IA 3JR5A 4X66M 4DR5M 3TQSA 4DUZM 1OKSA 2ZBKB 2P5TA 4G3OA 2XFSA 5EXTA 5BPVA 4PDIA 2UXBM 1Z6TA 5BR8M 4DV5M 2DVWB 4LJ9A 2VQEM 2V1CA 3SYKA 1C7YA 2DWLA 1HJPA 1MU5A 2Y21A 2Z4RA 4LZJA 3GLGA 1YLAA 2DAIA 1G8PA 3LCVB 2JA2A 2KZSA 3QYEA 4RF0A 3U6PA 1Q3CA 1QANA 1L1TA 3H4JA 4L78A 2FOIC 2JUJA 2YNMD 4GC9A 3ZC7B 4MGIE 4JI2M 4NXNM 3SBJA 1DGHB 3W0FA 1G59A 3ZCBB 4FVMA 3HJSA 3AKZA 3W67A 2VQFM 1Z5AA 4CISA 4DV1M 1JR3A 5KPTA 5EJCA 3U60B 2J5YA 3BBZA 4CHTB 3KVWA 2XSZA 3W0LB 3ZH9B 1MN3A 3SMPA 3FKEA 2KDLA 4DV4M 2Z7JA 2R46A 2LVPC 1J5EM 2LTUA 3K92A 3QAUA 4JI1M 4LJ4A 1WHCA 1Q39A 1NSFA 5EP3A 2XGNA 2DAMA 1XB2B 4I8OA 3HX3A 4IJEA 1ZMUA 3UMMA 2KA6B 5FSWA 2L2DA 4DBGB 2BNKA 3KOZE 4LRSA 1YUBA 3L27A 5L8RF 2LVOC 3VDPA 2QQ8A 7CATA 5FTMA 1N32M 2DAGA 1FJGM 3R8FA 5KPZA 2ZANA 1VDLA 2ZTCA 3I51A 3GLIE 4FWGA 4DV3M 2EKKA 2JXNA 4X64M 2BWEA 5EP1A 3FYDA 2X4AA 4QNRA 1LTMA 3HHZA 3TPZA 2DXIA 3MK6A 4JI6M 4FD2A 1SXJA 2I7PA 4XBOA 2K6BA 1I94M 1UM8A 1HR0M 4G4QA 3SAWA 1XXHB 3HGIA 2JY8A 2DENA 3K9PA 3HWSA 1Q3BA 1YSYA 2QNJA 3UZUA 4IBGA 4QHSA 4R7GA 3FTDA 2LVNC 3LVVA 1XMQM 2M5ZA 5KQ8A 2EUCA 2LXEA 5IT9S 3U6MA 1GVNA 2LH0A 4QOSA 3DFZA 3SHGB 4DR6M 2RGOA 1IN4A 3I4VA 2CV2A 4L4UA 1NY5A 3H4MA 4MGHA 2VDBB 4AKGA 3HU2A 2Z4SA 2JZ0A 4RKUF 1IN7A 3VDUA 3J81S 4G6ZA 4LG2A 1PJIA 1QDTA 1R6BX 4KODA 1QDRA 1L2CA 2K0BX 1R2YA 4IBCA 2QBYB 2UXCM 3VK7A 1OAOC 2FS1A 2MJ5B 4OU7A 4B7HA 3E21A 3LVWA 4M9ZA 4Z8XA 1E32A 3KFUG 2LBCA 3QWLA 4NSOB 4JI7M 2JNHA 3FRIA 1I4WA 3KDSE 3KXEC 3L26A 1PRBA 2CWBA 1QAOA 3C9PA 3FTEA 4AG5A 2C96A 3TE6A 2HHHM 3KOXE 4NOOB 3GRUA 2EA0A 1PGYA 3FRHA 1NNUC 1DO2A 4G4RA 1ZQ9A 1ORYB 2D7EA 3GO8A 1DGBA 3U61A 1JQJC 1A5TA 1OFHA 1E94E 1P3QQ 2L6OA 2UXDM 3GLIB 4AI6A 2K9DA 4FWDA 1IQPA 4GEWA 3VKGA 1TH3A 3SFZA 4B3SM 1VDDA 3U6SA 2HKJA 2QZ4A 3CF2A 3RFWA 3KS8A 3KW6A 3U6EA 1NJGA 1IXSA 3L2AA 2CRUA 4PT5A 4IBEA 3AL0C 4LCBA 1EE8A 3M0EA 2DNAA 2F5OA 3I04M 2XZUA 1IXRC 1XXHE 4Z6YA 2K47A 5ITXE 3T6PA 2FE8A 2KNZA 3R9XB 4B7GA 2DKLA 3HY5A 4D82A 3SHFA 4M0DA 4QOZC 3FUWA 5A2QS 1K3XA 1IBKM 4QNMA 1T3TA 3GRRA 4A3VB 4P17A 1IN5A 2DHYA 1OJLA 2FFJA 4I81A 4MH0E 1D0KA 5ITQA 2JWSA 2JY6B 3UJNA 3GLFE 4GHLA 3FTCA 4M0WA 4KT0F 4G4NA
chains in the Genus database with same CATH topology
2QHOB 4UN2B 2DAMA 1UFZA 1NV8A 1XB2B 1ZMUA 2LVQD 2L2DA 4DBGB 3MMPA 1G41A 1Y8GA 1BVSA 3F92A 2LVOC 1VEKA 1HT1E 2HWJA 2DAGA 1JR3E 1EFUB 1TR8A 1VDLA 2WZJA 1T6OA 2ZTCA 3GLIE 2EKKA 2BWEA 3IECA 3IHPA 1CUKA 3K9OA 4HEOA 2OOBA 4F1IA 2G3QA 1OAIA 1G3IA 2DZLA 1GO5A 2B3TA 2JY8A 2DENA 1VG5A 3K9PA 2QNJA 1ZMVA 1R4GA 2LVNC 4Q7JA 1OTRA 2MROB 1DO0A 5JI2E 1OQYA 2JY5A 2JP7A 1DV0A 2EKFA 2BWBA 3E46A 2KNVA 1WR1B 1ZV1A 2JZ0A 1VQ1A 2CP8A 4R71A 1IFYA 3FE3A 2K0BX 4WP2A 2MGWA 2MJ5B 2LVAA 2ZTDA 1Q02A 1QZEA 1T43A 2OOAA 1G4AE 3E21A 2L4FA 1WIVA 1NV9A 1ZMWA 2KHHA 2LBCA 2DAKA 2H5XA 1VEJA 1WGLA 2JNHA 2L4EA 3FRIA 1V92A 2QSFX 2KNAA 2MR9A 2R0IA 1F4IA 2CWBA 2JY7A 1KYIA 1OKSA 4G3OA 1PGYA 2O25A 3FRHA 1C7YA 1DO2A 3GLHE 1HJPA 3B89A 1YLAA 1A5TA 1P3QQ 1E94E 2DAIA 2K9DA 3LCVB 4GEWA 1WJ7A 1IM2A 1VEGA 2JZ1A 1IXSA 3H4JA 1HQYE 2RRUA 2JUJA 1AIPC 2DNAA 4F2LA 2DI0A 1XXHE 3T6PA 1TTEA 2KNZA 3BBZA 2DKLA 2HAKA 1WGNA 3GLGE 1SG9A 1MN3A 5DFLA 3LCUA 2DAEA 2DHYA 3GLFE 2JY6B 2LVPC 1HT2E 2LTUA 2EJSA 2OO9A 1WHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QHO B;  4UN2 B;  2DAM A;  1UFZ A;  1NV8 A;  1XB2 B;  1ZMU A;  2LVQ D;  2L2D A;  4DBG B;  3MMP A;  1G41 A;  1Y8G A;  1BVS A;  3F92 A;  2LVO C;  1VEK A;  1HT1 E;  2HWJ A;  2DAG A;  1JR3 E;  1EFU B;  1TR8 A;  1VDL A;  2WZJ A;  1T6O A;  2ZTC A;  3GLI E;  2EKK A;  2BWE A;  3IEC A;  3IHP A;  1CUK A;  3K9O A;  4HEO A;  2OOB A;  4F1I A;  2G3Q A;  1OAI A;  1G3I A;  2DZL A;  1GO5 A;  2B3T A;  2JY8 A;  2DEN A;  1VG5 A;  3K9P A;  2QNJ A;  1ZMV A;  1R4G A;  2LVN C;  4Q7J A;  1OTR A;  2MRO B;  1DO0 A;  5JI2 E;  1OQY A;  2JY5 A;  2JP7 A;  1DV0 A;  2EKF A;  2BWB A;  3E46 A;  2KNV A;  1WR1 B;  1ZV1 A;  2JZ0 A;  1VQ1 A;  2CP8 A;  4R71 A;  1IFY A;  3FE3 A;  2K0B X;  4WP2 A;  2MGW A;  2MJ5 B;  2LVA A;  2ZTD A;  1Q02 A;  1QZE A;  1T43 A;  2OOA A;  1G4A E;  3E21 A;  2L4F A;  1WIV A;  1NV9 A;  1ZMW A;  2KHH A;  2LBC A;  2DAK A;  2H5X A;  1VEJ A;  1WGL A;  2JNH A;  2L4E A;  3FRI A;  1V92 A;  2QSF X;  2KNA A;  2MR9 A;  2R0I A;  1F4I A;  2CWB A;  2JY7 A;  1KYI A;  1OKS A;  4G3O A;  1PGY A;  2O25 A;  3FRH A;  1C7Y A;  1DO2 A;  3GLH E;  1HJP A;  3B89 A;  1YLA A;  1A5T A;  1P3Q Q;  1E94 E;  2DAI A;  2K9D A;  3LCV B;  4GEW A;  1WJ7 A;  1IM2 A;  1VEG A;  2JZ1 A;  1IXS A;  3H4J A;  1HQY E;  2RRU A;  2JUJ A;  1AIP C;  2DNA A;  4F2L A;  2DI0 A;  1XXH E;  3T6P A;  1TTE A;  2KNZ A;  3BBZ A;  2DKL A;  2HAK A;  1WGN A;  3GLG E;  1SG9 A;  1MN3 A;  5DFL A;  3LCU A;  2DAE A;  2DHY A;  3GLF E;  2JY6 B;  2LVP C;  1HT2 E;  2LTU A;  2EJS A;  2OO9 A;  1WHC A; 
#chains in the Genus database with same CATH topology
 4I4L A;  4CIZ A;  4IBB A;  5DNY A;  4AW4 A;  3EIH A;  3LQQ A;  1UFZ A;  4B3R M;  4OX9 M;  1IXZ A;  2CE7 A;  1N75 A;  3C3E A;  3HU3 A;  3MMP A;  1XNQ M;  2C98 A;  1Y8G A;  1BVS A;  3HU1 A;  3F92 A;  3GLH B;  3IG8 A;  2E5L M;  2D7G A;  3SAR A;  2R65 A;  2KXE A;  5FTL A;  3HZJ A;  1QVR A;  1R7R A;  3GRY A;  3U6L A;  1IN8 A;  4RNA A;  4D80 A;  2R45 A;  1CUK A;  3K9O A;  4FCV A;  3UGJ A;  2QPA A;  1V33 A;  1GJT A;  2XZF A;  4LZZ A;  4EIW A;  2OOB A;  4R3D A;  5LMN M;  3B9P A;  2G3Q A;  3HHW A;  5FLX S;  3VLF B;  4NRW A;  2R44 A;  1J09 A;  3AFH A;  4FWH A;  3FTF A;  4IBK A;  5EQT A;  2V6Z M;  5FTN A;  4KLN A;  2B3T A;  4LFB M;  2HCB A;  1VG5 A;  4LFC M;  3GPX A;  2DZO B;  2C99 A;  1R4G A;  2KRU A;  3HHX A;  3JR4 A;  2LWX A;  4KHP M;  4Q7J A;  1N78 A;  1GAB A;  3U5Z B;  1DO0 A;  4DUY M;  5FTJ A;  3T1H M;  3A46 A;  2ZAM A;  1K82 A;  4LF4 M;  3SAS A;  4GC5 A;  3RGS A;  2C9O A;  2EKF A;  1FNN A;  2KW0 A;  4MM3 B;  4BBA A;  1MJG M;  2W82 A;  3E46 A;  3J7B A;  2A5Y B;  1E9R A;  1QUT A;  2L09 A;  4GRI A;  2UUB M;  2UU9 M;  2LHG A;  4WW0 A;  4DR7 M;  2WSC F;  1VQ1 A;  1GL7 A;  2VF8 A;  1IFY A;  4YY3 M;  2KZU A;  4OVZ B;  4WP2 A;  1N33 M;  3LMM A;  2KEB A;  3D8L A;  1YE9 A;  1GJS A;  2ZTD A;  3KOW E;  1TDZ A;  4DV7 M;  1Q02 A;  1KFV A;  2OOA A;  3PNY A;  1PJS A;  3B74 A;  2DWM A;  3J27 B;  4OW0 A;  3THG A;  1XC8 A;  3DA1 A;  1QZM A;  3J7A S;  4NRV A;  2XFT A;  3Q8X A;  2VII A;  4LRT A;  4LY6 A;  4AZF A;  3GLF B;  3PFI A;  3SAU A;  1NY6 A;  2MR9 A;  2XF3 A;  5EXX A;  1R2Z A;  2CV0 A;  2JY7 A;  3KSJ A;  3GQ4 A;  1ZAE A;  3Q8G A;  3GQ5 A;  3TWL A;  2FH0 A;  2O25 A;  3CGW A;  3IG5 A;  3GLH E;  3PXG A;  2N35 A;  3GPY A;  3CF0 A;  1KSF X;  2OPF A;  1NO1 A;  5E6J A;  1L2B A;  4L6V 6;  4GHA A;  1D2N A;  1WJ7 A;  2DZN B;  1SXJ B;  3PVS A;  2JZ1 A;  1HQY E;  1IN6 A;  2RRU A;  1PJJ A;  4HL4 A;  1RU3 A;  4F2L A;  1HQC A;  5ITU A;  2YFQ A;  4LJ8 A;  4LFA M;  3I01 M;  5KO3 A;  2CV1 A;  3MJ5 A;  2F5N A;  1Z59 A;  4XGI A;  2QCU A;  3GLI A;  3TWK A;  3DZD A;  3U6Q A;  4JI4 M;  2XEP A;  3GLG E;  4MGY E;  3AV0 A;  5KPR A;  4ANR A;  4LF7 M;  3D8B A;  3LCU A;  2DAE A;  2Y20 A;  5E26 A;  3T1Y M;  1OIZ A;  4II7 A;  3HJQ A;  1HT2 E;  5DYG A;  2EJS A;  4IJF A;  3NBI A;  3KP0 E;  2CFO A;  4Y28 F;  5KQD A;  2X8A A;  3AOE C;  3EIE A;  4UN2 B;  5LMU M;  2LVQ D;  3GRV A;  3A45 A;  1PJT A;  2X49 A;  2LHC A;  2L7H A;  3GPU A;  5C1B A;  4JI8 M;  4IBF A;  4B7F A;  1JR3 E;  1TR8 A;  5EXP A;  3IEC A;  3IHP A;  4GIT A;  2CHV A;  2KRK A;  3HKP A;  4L16 A;  1OIP A;  2QP9 X;  3T38 A;  1N36 M;  1G71 A;  1K3W A;  8CAT A;  4DR1 M;  3C58 A;  2DZL A;  4IBI A;  2J7O A;  5IRE B;  4L15 A;  5FTK A;  1V34 A;  2UUA M;  4PDG A;  4L8R C;  3ZQJ A;  1DGH A;  4ZPX A;  2Q2E B;  5H37 D;  4LF8 M;  3SAV A;  1DGF A;  2C5R A;  3FD9 A;  4JI0 M;  1N77 A;  2Z8Y M;  1NHG C;  3U60 A;  3U61 B;  1OTR A;  5F3W A;  1NHW C;  5JI2 E;  2D7H A;  2ZAO A;  1Z5C A;  1OQY A;  2JY5 A;  3VKH A;  1HNX M;  3FYC A;  2R6F A;  3K1J A;  4KO8 A;  1DV0 A;  1IXS B;  2C9C A;  1SXJ E;  1WR1 B;  4NSR A;  1ZV1 A;  3B7N A;  5GKN A;  4IBJ A;  4P16 A;  4BB9 A;  1LV7 A;  3DOA A;  1PM5 A;  4D81 A;  3FE3 A;  3K8Z A;  2YR0 A;  3U5Z A;  4B08 A;  3L25 A;  2L7I A;  4B3T M;  4FCW A;  3CF6 E;  3KOY E;  2CHQ A;  2LVA A;  2WSF F;  4LJA A;  4DV6 M;  2F4V M;  4LF9 M;  3LQR A;  2Z3X A;  1T43 A;  2I7N A;  1G4A E;  4S12 A;  3GPP A;  4M9X A;  1TH4 A;  1DGG A;  3UK6 A;  1ZMW A;  5IWA M;  3WHK A;  3GLG B;  2CHG A;  2KHH A;  2RKO A;  3FUU A;  1TGU A;  3GQ3 A;  4FCT A;  4JI5 M;  3HHY A;  3GP1 A;  4JYA M;  2NQ8 C;  4NXM M;  2QSF X;  2O01 F;  2R0I A;  4OVZ A;  1KYI A;  2WSE F;  1XXH A;  4K0K M;  3A42 A;  5EXS A;  2R4J A;  5ITX A;  3NWL A;  3L28 A;  1IY2 A;  5C18 A;  1Z5B A;  1GLN A;  3KS4 A;  3BOS A;  4CJ6 A;  1AUA A;  5ITY A;  3B89 A;  3BXW A;  3E9S A;  2DHR A;  4LJ5 A;  1SXJ C;  3GLF A;  4LJ7 A;  1GKI A;  4GMQ A;  2J7N A;  3KSX A;  1IM2 A;  4LGY A;  3M7G A;  1VEG A;  3WHL A;  5JI3 E;  4PD2 A;  1XHB A;  2GQF A;  4X62 M;  2XLJ A;  3AJI B;  4JI3 M;  1AIP C;  1MX0 A;  1W5S A;  3SC3 A;  2DI0 A;  3I4Y A;  1TDH A;  3LW5 F;  1QUS A;  1C1K A;  1TTE A;  1QAQ A;  5EP2 A;  5ITR A;  2QBY A;  4REZ A;  4JV5 M;  3VK8 A;  4M9S A;  4PCZ A;  3JAM S;  2ERC A;  2HAK A;  1QYR A;  1WGN A;  4FW9 A;  1SG9 A;  2BJV A;  2MH8 A;  3J2P B;  4NL4 H;  5DFL A;  3U6O A;  4IBD A;  3FUV A;  2DWZ B;  2DWN A;  2OO9 A;  1PJQ A;  4AKI A;  4W5W A;  2VF7 A;  2Y0Q A;  2F5S A;  4GKK M;  4I5S A;  2QHO B;  4DR4 M;  1NV8 A;  2G5G X;  3NBX X;  2F5P A;  1G41 A;  1NJF A;  4DR3 M;  3VFD A;  4B3M M;  3C3D A;  2YQZ A;  1IY1 A;  1VEK A;  1HT1 E;  3T15 A;  3U6C A;  2HWJ A;  1IBM M;  4JN6 A;  4MB7 A;  2RGH A;  3W68 A;  3FUX A;  1EFU B;  4DR2 M;  2WZJ A;  1T6O A;  3ILK A;  1J7K A;  3RE8 A;  4BLC A;  1JR3 D;  1XWI A;  2O5R A;  3J80 S;  4HEO A;  4X65 M;  2XSZ D;  4YHH M;  1NNJ A;  3E4R A;  1IY0 A;  5IZ7 D;  1L1Z A;  4LF5 M;  4CGY B;  4RF1 A;  4F1I A;  3SMS A;  3B7Q A;  4LF6 M;  1OAI A;  3K2L A;  1G3I A;  2F5Q A;  4ITQ A;  1GO5 A;  1QAM A;  4WUR A;  4AQY M;  2G8L A;  2EO2 A;  4NC6 A;  4DV0 M;  1H6U A;  2R18 A;  3M6A A;  3U6D A;  2HL7 A;  4AKH A;  4DV2 M;  1JB0 F;  3B7Z A;  2FNA A;  4XK8 F;  2V1U A;  4IIW A;  1ZMV A;  2AHM A;  2CEA A;  1XMO M;  2XH9 A;  3TL4 X;  1NVM A;  1X37 A;  2MRO B;  1WXQ A;  4AG6 A;  5EP4 A;  2CUZ A;  3QYB A;  1R5L A;  1N34 M;  2JP7 A;  2R62 A;  3MHV C;  1HNZ M;  1IBL M;  1OFI A;  4LJ6 A;  3AOG A;  4JXJ A;  2OQ4 A;  2BWB A;  3HJ8 A;  1W5T A;  2UUC M;  2KNV A;  1L2D A;  3V76 A;  2BJW A;  3CTW B;  3L29 A;  1L8Q A;  1SXJ D;  3TWM A;  3AOE A;  2CP8 A;  3A98 B;  4R71 A;  4MGK E;  3SAT A;  2QEN A;  1E9S A;  4G4O A;  3SYL A;  3GLH A;  1S3S A;  2APL A;  3RGP A;  4HLQ A;  1XNR M;  1HNW M;  2MGW A;  1D0M A;  2H1R A;  4TUW A;  3KP1 E;  5DYI A;  1TF0 B;  4GH9 A;  1QZE A;  1GL6 A;  2GNO A;  2ZM6 M;  5ITT A;  2L4F A;  1WIV A;  2LNH C;  1NV9 A;  1TH2 A;  4QHT A;  1QQW A;  4GKJ M;  3PNV A;  4LGM A;  2DAK A;  1D0L A;  2H5X A;  1VEJ A;  1WGL A;  2Y0T A;  2L4E A;  4MGZ E;  1V92 A;  3OTO M;  1EIJ A;  3FUT A;  2KNA A;  4GIP A;  2M60 A;  2R4E A;  1F4I A;  3JR5 A;  4X66 M;  4DR5 M;  3TQS A;  4DUZ M;  1OKS A;  2ZBK B;  2P5T A;  4G3O A;  2XFS A;  5EXT A;  5BPV A;  4PDI A;  2UXB M;  1Z6T A;  5BR8 M;  4DV5 M;  2DVW B;  4LJ9 A;  2VQE M;  2V1C A;  3SYK A;  1C7Y A;  2DWL A;  1HJP A;  1MU5 A;  2Y21 A;  2Z4R A;  4LZJ A;  3GLG A;  1YLA A;  2DAI A;  1G8P A;  3LCV B;  2JA2 A;  2KZS A;  3QYE A;  4RF0 A;  3U6P A;  1Q3C A;  1QAN A;  1L1T A;  3H4J A;  4L78 A;  2FOI C;  2JUJ A;  2YNM D;  4GC9 A;  3ZC7 B;  4MGI E;  4JI2 M;  4NXN M;  3SBJ A;  1DGH B;  3W0F A;  1G59 A;  3ZCB B;  4FVM A;  3HJS A;  3AKZ A;  3W67 A;  2VQF M;  1Z5A A;  4CIS A;  4DV1 M;  1JR3 A;  5KPT A;  5EJC A;  3U60 B;  2J5Y A;  3BBZ A;  4CHT B;  3KVW A;  2XSZ A;  3W0L B;  3ZH9 B;  1MN3 A;  3SMP A;  3FKE A;  2KDL A;  4DV4 M;  2Z7J A;  2R46 A;  2LVP C;  1J5E M;  2LTU A;  3K92 A;  3QAU A;  4JI1 M;  4LJ4 A;  1WHC A;  1Q39 A;  1NSF A;  5EP3 A;  2XGN A;  2DAM A;  1XB2 B;  4I8O A;  3HX3 A;  4IJE A;  1ZMU A;  3UMM A;  2KA6 B;  5FSW A;  2L2D A;  4DBG B;  2BNK A;  3KOZ E;  4LRS A;  1YUB A;  3L27 A;  5L8R F;  2LVO C;  3VDP A;  2QQ8 A;  7CAT A;  5FTM A;  1N32 M;  2DAG A;  1FJG M;  3R8F A;  5KPZ A;  2ZAN A;  1VDL A;  2ZTC A;  3I51 A;  3GLI E;  4FWG A;  4DV3 M;  2EKK A;  2JXN A;  4X64 M;  2BWE A;  5EP1 A;  3FYD A;  2X4A A;  4QNR A;  1LTM A;  3HHZ A;  3TPZ A;  2DXI A;  3MK6 A;  4JI6 M;  4FD2 A;  1SXJ A;  2I7P A;  4XBO A;  2K6B A;  1I94 M;  1UM8 A;  1HR0 M;  4G4Q A;  3SAW A;  1XXH B;  3HGI A;  2JY8 A;  2DEN A;  3K9P A;  3HWS A;  1Q3B A;  1YSY A;  2QNJ A;  3UZU A;  4IBG A;  4QHS A;  4R7G A;  3FTD A;  2LVN C;  3LVV A;  1XMQ M;  2M5Z A;  5KQ8 A;  2EUC A;  2LXE A;  5IT9 S;  3U6M A;  1GVN A;  2LH0 A;  4QOS A;  3DFZ A;  3SHG B;  4DR6 M;  2RGO A;  1IN4 A;  3I4V A;  2CV2 A;  4L4U A;  1NY5 A;  3H4M A;  4MGH A;  2VDB B;  4AKG A;  3HU2 A;  2Z4S A;  2JZ0 A;  4RKU F;  1IN7 A;  3VDU A;  3J81 S;  4G6Z A;  4LG2 A;  1PJI A;  1QDT A;  1R6B X;  4KOD A;  1QDR A;  1L2C A;  2K0B X;  1R2Y A;  4IBC A;  2QBY B;  2UXC M;  3VK7 A;  1OAO C;  2FS1 A;  2MJ5 B;  4OU7 A;  4B7H A;  3E21 A;  3LVW A;  4M9Z A;  4Z8X A;  1E32 A;  3KFU G;  2LBC A;  3QWL A;  4NSO B;  4JI7 M;  2JNH A;  3FRI A;  1I4W A;  3KDS E;  3KXE C;  3L26 A;  1PRB A;  2CWB A;  1QAO A;  3C9P A;  3FTE A;  4AG5 A;  2C96 A;  3TE6 A;  2HHH M;  3KOX E;  4NOO B;  3GRU A;  2EA0 A;  1PGY A;  3FRH A;  1NNU C;  1DO2 A;  4G4R A;  1ZQ9 A;  1ORY B;  2D7E A;  3GO8 A;  1DGB A;  3U61 A;  1JQJ C;  1A5T A;  1OFH A;  1E94 E;  1P3Q Q;  2L6O A;  2UXD M;  3GLI B;  4AI6 A;  2K9D A;  4FWD A;  1IQP A;  4GEW A;  3VKG A;  1TH3 A;  3SFZ A;  4B3S M;  1VDD A;  3U6S A;  2HKJ A;  2QZ4 A;  3CF2 A;  3RFW A;  3KS8 A;  3KW6 A;  3U6E A;  1NJG A;  1IXS A;  3L2A A;  2CRU A;  4PT5 A;  4IBE A;  3AL0 C;  4LCB A;  1EE8 A;  3M0E A;  2DNA A;  2F5O A;  3I04 M;  2XZU A;  1IXR C;  1XXH E;  4Z6Y A;  2K47 A;  5ITX E;  3T6P A;  2FE8 A;  2KNZ A;  3R9X B;  4B7G A;  2DKL A;  3HY5 A;  4D82 A;  3SHF A;  4M0D A;  4QOZ C;  3FUW A;  5A2Q S;  1K3X A;  1IBK M;  4QNM A;  1T3T A;  3GRR A;  4A3V B;  4P17 A;  1IN5 A;  2DHY A;  1OJL A;  2FFJ A;  4I81 A;  4MH0 E;  1D0K A;  5ITQ A;  2JWS A;  2JY6 B;  3UJN A;  3GLF E;  4GHL A;  3FTC A;  4M0W A;  4KT0 F;  4G4N A; 
#chains in the Genus database with same CATH homology
 2QHO B;  4UN2 B;  2DAM A;  1UFZ A;  1NV8 A;  1XB2 B;  1ZMU A;  2LVQ D;  2L2D A;  4DBG B;  3MMP A;  1G41 A;  1Y8G A;  1BVS A;  3F92 A;  2LVO C;  1VEK A;  1HT1 E;  2HWJ A;  2DAG A;  1JR3 E;  1EFU B;  1TR8 A;  1VDL A;  2WZJ A;  1T6O A;  2ZTC A;  3GLI E;  2EKK A;  2BWE A;  3IEC A;  3IHP A;  1CUK A;  3K9O A;  4HEO A;  2OOB A;  4F1I A;  2G3Q A;  1OAI A;  1G3I A;  2DZL A;  1GO5 A;  2B3T A;  2JY8 A;  2DEN A;  1VG5 A;  3K9P A;  2QNJ A;  1ZMV A;  1R4G A;  2LVN C;  4Q7J A;  1OTR A;  2MRO B;  1DO0 A;  5JI2 E;  1OQY A;  2JY5 A;  2JP7 A;  1DV0 A;  2EKF A;  2BWB A;  3E46 A;  2KNV A;  1WR1 B;  1ZV1 A;  2JZ0 A;  1VQ1 A;  2CP8 A;  4R71 A;  1IFY A;  3FE3 A;  2K0B X;  4WP2 A;  2MGW A;  2MJ5 B;  2LVA A;  2ZTD A;  1Q02 A;  1QZE A;  1T43 A;  2OOA A;  1G4A E;  3E21 A;  2L4F A;  1WIV A;  1NV9 A;  1ZMW A;  2KHH A;  2LBC A;  2DAK A;  2H5X A;  1VEJ A;  1WGL A;  2JNH A;  2L4E A;  3FRI A;  1V92 A;  2QSF X;  2KNA A;  2MR9 A;  2R0I A;  1F4I A;  2CWB A;  2JY7 A;  1KYI A;  1OKS A;  4G3O A;  1PGY A;  2O25 A;  3FRH A;  1C7Y A;  1DO2 A;  3GLH E;  1HJP A;  3B89 A;  1YLA A;  1A5T A;  1P3Q Q;  1E94 E;  2DAI A;  2K9D A;  3LCV B;  4GEW A;  1WJ7 A;  1IM2 A;  1VEG A;  2JZ1 A;  1IXS A;  3H4J A;  1HQY E;  2RRU A;  2JUJ A;  1AIP C;  2DNA A;  4F2L A;  2DI0 A;  1XXH E;  3T6P A;  1TTE A;  2KNZ A;  3BBZ A;  2DKL A;  2HAK A;  1WGN A;  3GLG E;  1SG9 A;  1MN3 A;  5DFL A;  3LCU A;  2DAE A;  2DHY A;  3GLF E;  2JY6 B;  2LVP C;  1HT2 E;  2LTU A;  2EJS A;  2OO9 A;  1WHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...