2JY8A

Nmr structure of the ubiquitin associated (uba) domain of p62 (sqstm1) in complex with ubiquitin. rdc refined
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-binding protein p62
publication title Ubiquitin Recognition by the Ubiquitin-associated Domain of p62 Involves a Novel Conformational Switch
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 4
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy8A00
1VEJA 1G4AE 2QNJA 3H4JA 4F2LA 1G3IA 2JY8A 2O25A 1HQYE 2ZTDA 2OOBA 1GO5A 4Q7JA 2R0IA 2K9DA 2EKKA 1ZMVA 1DO2A 2EJSA 2DAMA 2HWJA 2JNHA 3LCVB 1WHCA 2MR9A 1IM2A 1R4GA 3GLHE 4WP2A 5DFLA 2DHYA 1HJPA 1HT1E 2JP7A 1OQYA 3B89A 3GLIE 2HAKA 2DENA 1Q02A 1QZEA 2JZ1A 2KNVA 4UN2B 2LVAA 2CP8A 3FE3A 1AIPC 2G3QA 3FRHA 2LVNC 2LVPC 2OO9A 3FRIA 3IECA 4R71A 1PGYA 1WR1B 1DO0A 1YLAA 3K9OA 2KNZA 2K0BX 2LVQD 1WGLA 4HEOA 1ZMUA 2QHOB 2MJ5B 2DZLA 1VEKA 1ZMWA 1A5TA 1WGNA 1XXHE 2JY7A 1E94E 2DKLA 1P3QQ 2EKFA 3IHPA 1MN3A 1T43A 4G3OA 4GEWA 1OAIA 2DAIA 2JZ0A 1UFZA 1TR8A 2L4EA 2WZJA 1NV9A 5JI2E 1KYIA 1V92A 1SG9A 1OTRA 2QSFX 1NV8A 2KNAA 1F4IA 3GLGE 2DI0A 2JY5A 3BBZA 2MGWA 2LBCA 2L4FA 1CUKA 4DBGB 2JY6B 2L2DA 1VQ1A 1HT2E 1JR3E 1WIVA 1VDLA 2CWBA 4F1IA 1OKSA 2JUJA 1VG5A 2LVOC 3T6PA 1TTEA 2OOAA 2MROB 1EFUB 1IFYA 2BWBA 1Y8GA 1BVSA 1ZV1A 2RRUA 3LCUA 3GLFE 1VEGA 3K9PA 1WJ7A 3E46A 2DAKA 2ZTCA 1T6OA 2DAGA 2DNAA 1IXSA 1DV0A 1C7YA 2DAEA 2H5XA 1G41A 3E21A 2BWEA 3MMPA 2LTUA 2B3TA 2KHHA 3F92A 1XB2B
chains in the Genus database with same CATH superfamily
5FTJA 1PJJA 1D0MA 2QNJA 1IY2A 3KSXA 3H4JA 4F2LA 4ANRA 2WSCF 4JN6A 4NC6A 3QAUA 4IBGA 2HKJA 3SYKA 2NQ8C 2O25A 4PT5A 3DFZA 2ZTDA 3B7QA 1SXJC 1GO5A 1KSFX 5IZ7D 3FUUA 3TE6A 5EP4A 4AW4A 2C96A 1FJGM 3MHVC 2HWJA 4LRTA 4NRVA 3TWMA 1SXJD 4YHHM 2Z4SA 4FVMA 3KDSE 1SXJB 3HX3A 2UXDM 1OAOC 1HJPA 1TDZA 3KOWE 1HT1E 2OQ4A 4K0KM 2JP7A 4B3TM 2M60A 3TL4X 4PCZA 3B89A 4NXNM 8CATA 2HAKA 1KFVA 1IBKM 1QZEA 4UN2B 2CP8A 2GNOA 1XMQM 2Q2EB 2CHQA 4IJFA 4D82A 2LVNC 3AV0A 4D81A 4L78A 2F5OA 3LQQA 2VQEM 2W82A 4IJEA 1DO0A 1JB0F 2CV1A 1SXJA 3FD9A 1WGLA 3HU2A 2Y0QA 3GPYA 3FTEA 4HEOA 1ZMUA 2QHOB 2CHGA 2CV2A 2FS1A 5EP1A 4II7A 4L15A 2DZNB 4LF6M 1NY6A 2JY7A 4MGZE 3HHYA 5EJCA 1EE8A 1E94E 2DKLA 2AHMA 3LMMA 4FCWA 4QNMA 4LFAM 4B3MM 1T43A 5E26A 4G3OA 3AJIB 4NSOB 4DV6M 5LMNM 2UUCM 2YR0A 2XEPA 3VDPA 2L4EA 4BB9A 1QYRA 2FH0A 4JV5M 5JI2E 3BXWA 1V92A 1IXZA 2XZUA 3V76A 5L8RF 4MM3B 1NHGC 1NV8A 4LGYA 3PXGA 5ITQA 2XZFA 3ZQJA 1OIZA 3VLFB 2G5GX 5FTMA 2RKOA 2JY5A 1IN8A 3BBZA 3K92A 3K2LA 4AG6A 5JI3E 2ZBKB 4JI2M 2JY6B 2DWLA 3UMMA 2QZ4A 4L6V6 5KPRA 3T15A 5KQ8A 1OKSA 2JUJA 3SMPA 2R62A 4LY6A 3T38A 4GHAA 2DVWB 4JI5M 5EXSA 2MROB 1HR0M 2KDLA 4A3VB 1PJQA 4Y28F 1YSYA 4NOOB 2BWBA 2G8LA 4AZFA 1MX0A 3PNVA 3M0EA 4PD2A 1NJFA 2Z8YM 3KOYE 2BNKA 3E46A 5KO3A 2FNAA 2DAKA 2ZTCA 3DOAA 2DWNA 2QBYB 4DR5M 1HNWM 1IXSA 2XSZA 3SC3A 4X62M 3ZH9B 1IN6A 3MJ5A 2DAEA 1N77A 2BWEA 4GKKM 2Y0TA 3U6QA 3QYEA 3OTOM 2N35A 3UJNA 5EP2A 2QPAA 2XFSA 4RF1A 2B3TA 4MB7A 4TUWA 4DUYM 2KHHA 2K6BA 3D8LA 3I04M 1DGFA 4OW0A 2CV0A 1DGGA 4X65M 4FD2A 1N75A 1G4AE 2D7GA 1NVMA 2QBYA 2C99A 4L8RC 3J27B 2VF7A 1G3IA 1R6BX 1SXJE 3DA1A 4B7FA 2JA2A 1NJGA 5EP3A 3C3DA 1QANA 4Q7JA 1GJTA 1LV7A 1XWIA 4QOZC 3CGWA 2EJSA 1OJLA 2JNHA 1PJIA 1NNJA 1IM2A 1GVNA 1R4GA 3HJ8A 3B9PA 4L16A 5DYIA 5DFLA 4JI3M 3KFUG 4LG2A 3KSJA 2KW0A 3AKZA 1OQYA 4I4LA 2KRUA 3UGJA 4ITQA 2VIIA 1XHBA 3FE3A 2EUCA 2LHGA 2R4JA 3FRHA 1N33M 2OO9A 3KOXE 3ZC7B 4G4NA 1WXQA 2DZOB 1WR1B 4DV4M 2DWMA 1OFIA 1PRBA 2CHVA 4EIWA 4AKGA 5F3WA 4NRWA 1QDTA 4DR1M 1Q3BA 3CF2A 2MJ5B 3HY5A 4I8OA 1VEKA 2DZLA 1WGNA 2KZSA 1QAOA 2E5LM 4I5SA 1MU5A 3FTFA 2O5RA 4GHLA 3IHPA 1L8QA 1L1TA 3U6OA 5GKNA 2XGNA 4JI4M 1T3TA 3FKEA 2WSEF 5A2QS 3R8FA 1R2ZA 4GKJM 4GH9A 1QUSA 1UFZA 2P5TA 2F4VM 2L6OA 1GL7A 1NHWC 4LJ5A 1NV9A 3AFHA 3I51A 2QP9X 3B74A 3NBXX 3FTDA 2Z3XA 4Z6YA 3LVWA 1MJGM 4CJ6A 3TWKA 4G4RA 2XH9A 2OPFA 2A5YB 2DHRA 3SFZA 2R46A 1NSFA 4G4OA 3JAMS 2MGWA 2LBCA 1GABA 3KS4A 3GPPA 2L4FA 2FFJA 1CUKA 3L2AA 1R7RA 2KXEA 1Z5AA 4QHSA 5FTNA 4HL4A 1V33A 4LZZA 1AUAA 3U6MA 2R6FA 5FLXS 3GRRA 3T6PA 2CFOA 3L26A 3U61B 3I4YA 3Q8XA 4GITA 4IIWA 4PDGA 3Q8GA 1K3WA 4GC9A 2RGHA 2O01F 4GMQA 2DXIA 3K8ZA 4DR4M 1GKIA 1IFYA 3KVWA 4DR6M 2WSFF 1HNXM 2FE8A 1EIJA 1ZV1A 4NSRA 4DV7M 2XLJA 4P17A 2D7HA 3TQSA 4P16A 2BJWA 1VEGA 5ITYA 3CF6E 1WJ7A 2DWZB 1IN4A 2I7NA 3KP1E 4IBIA 4PDIA 1K3XA 1GL6A 5DYGA 1DGHA 2ZAMA 3U61A 2UUAM 4FWDA 2ZANA 4XBOA 4R3DA 2KEBA 3U6CA 1IXSB 1NNUC 5E6JA 4LJ9A 4ZPXA 5EQTA 3L25A 1D2NA 2I7PA 1FNNA 2D7EA 1OIPA 3FYDA 4KHPM 2JY8A 2L7HA 3HHWA 4WURA 5C18A 1HQYE 3SHFA 4D80A 5IWAM 3KP0E 2VDBB 2K9DA 2EKKA 3C58A 4LJ8A 1RU3A 4LF4M 3K1JA 2DAMA 1TH4A 4IBBA 4DV2M 1WHCA 2MR9A 3RGPA 4B08A 2L09A 1W5SA 2Z4RA 2R44A 4IBDA 1Q3CA 1QQWA 2CE7A 1S3SA 3PVSA 4B3RM 1Q02A 2JZ1A 2LH0A 2QQ8A 2YNMD 3HKPA 3L27A 2LVAA 3RGSA 4IBEA 4LF7M 1UM8A 4WW0A 3J7BA 2C9CA 4CIZA 2MH8A 3FRIA 2LVPC 3GPUA 3CF0A 3IECA 1IXRC 1Z5BA 1IQPA 3BOSA 5EXTA 4R71A 3JR4A 1N34M 1N78A 4QOSA 4YY3M 4X64M 4LF8M 2F5PA 1YUBA 4M9XA 2K0BX 4LCBA 3GQ4A 1NO1A 3W68A 3UZUA 4LGMA 4DV3M 4LJAA 1ZMWA 1A5TA 1XXHE 3A42A 1J7KA 5EXXA 4AKIA 4JI7M 3GO8A 2X8AA 1G71A 1GLNA 2V1CA 4BLCA 1R5LA 2ZM6M 1I4WA 4JYAM 5FSWA 3SBJA 4LF5M 1MN3A 1TH2A 3I4VA 1L1ZA 1TGUA 4XGIA 5C1BA 2UU9M 2V1UA 1OAIA 3U5ZB 2JZ0A 3GP1A 5BR8M 3SASA 1R2YA 2EO2A 3M6AA 4X66M 3FYCA 1JQJC 3TPZA 3PNYA 3J81S 3SAUA 1SG9A 1OTRA 4G4QA 1Z5CA 2QSFX 4LJ7A 2YQZA 4DR3M 3AOGA 4CHTB 2X49A 1VDDA 4LF9M 2KNAA 2ZAOA 1J5EM 4FCVA 1F4IA 3SHGB 3GLGE 2JWSA 4Z8XA 2DI0A 3WHLA 2J5YA 4I81A 2VQFM 3U5ZA 3VKGA 4KT0F 1PM5A 3MK6A 4DV5M 1C1KA 5FTKA 4DBGB 2GQFA 1Q39A 2L2DA 3IG5A 4S12A 5IT9S 4IBCA 1QAQA 1VQ1A 3GRVA 4L4UA 2F5SA 1JR3E 3U6DA 1XNQM 1XC8A 3SATA 2CWBA 2FOIC 4F1IA 4FWGA 2R65A 4AG5A 1V34A 3VKHA 2K47A 1TTEA 2BJVA 1YE9A 2XFTA 3VDUA 3L29A 3UK6A 2LXEA 1EFUB 1XXHB 2UXCM 3U6PA 1Y8GA 1G8PA 1XNRM 1BVSA 2V6ZM 4QHTA 3U6SA 3GLFE 4RNAA 4B3SM 3RE8A 1G59A 3AOEC 1QZMA 3IG8A 3K9PA 4FCTA 2Y21A 4NXMM 3FUTA 1C7YA 2KA6B 3HGIA 5EXPA 2H5XA 4JI0M 1G41A 5ITUA 1L2BA 3E4RA 1XXHA 4JI8M 3KXEC 2LTUA 4RKUF 3KW6A 4KODA 2R45A 5KQDA 4MGYE 4DR2M 1W5TA 3F92A 5H37D 3NWLA 3GLGB 3H4MA 1XB2B 3W67A 1DGHB 2QENA 1VEJA 4QNRA 1PJTA 3U6EA 2HCBA 3I01M 3KS8A 3L28A 4CISA 2M5ZA 2JXNA 4DV1M 5LMUM 2KZUA 3J80S 4MH0E 1JR3D 2OOBA 4LFCM 4B7GA 4CGYB 4RF0A 1X37A 4AI6A 2R0IA 3EIEA 1ZMVA 4IBKA 1QUTA 3HHXA 3E9SA 2CUZA 1DO2A 3M7GA 4LFBM 3FUXA 3AOEA 3LCVB 4LZJA 4MGIE 2CEAA 3GRYA 3GLHE 1Z59A 3J2PB 3LVVA 4OVZB 4WP2A 3GLGA 2L7IA 1N32M 2DHYA 1K82A 3HJQA 3GQ5A 3C9PA 1IN5A 1ORYB 4MGHA 1QAMA 3FTCA 3GLIE 2DENA 3GLFB 1NY5A 2KNVA 4NL4H 3T1HM 2LWXA 3QWLA 1AIPC 2C9OA 3U60B 1JR3A 2G3QA 2LHCA 5ITXE 3VK7A 3A98B 3HU1A 3FUWA 1Z6TA 2HHHM 4XK8F 1J09A 5BPVA 2YFQA 1PGYA 3SYLA 3FUVA 3TWLA 3D8BA 4OVZA 1YLAA 3K9OA 2KNZA 2LVQD 3A45A 3T1YM 4GC5A 3HJSA 4OX9M 4JXJA 1I94M 1TF0B 1LTMA 4JI6M 4KLNA 4DV0M 2CRUA 5DNYA 3GLFA 1E32A 2UUBM 2J7OA 3JR5A 2EKFA 1P3QQ 1PJSA 3U60A 3A46A 2ERCA 1ZQ9A 2XSZD 1DGBA 3GPXA 2C5RA 3CTWB 4GEWA 1HQCA 1L2DA 2QCUA 3LQRA 1OFHA 2DAIA 4OU7A 4AQYM 1H6UA 3SMSA 4M9ZA 4B7HA 1TR8A 4M0WA 4G6ZA 3W0FA 2WZJA 4LRSA 2H1RA 4DR7M 1KYIA 4GRIA 4R7GA 3GLHB 2APLA 3WHKA 2R4EA 1E9RA 3THGA 2EA0A 5ITRA 3J7AS 3DZDA 3RFWA 1IY0A 3AL0C 2Z7JA 3HHZA 4LJ6A 1E9SA 3GLIB 1IBMM 3VFDA 3HU3A 3LW5F 1D0KA 1TDHA 3SAVA 2XF3A 1L2CA 2F5NA 1IN7A 3GRUA 4IBJA 1HT2E 1IBLM 3B7ZA 4W5WA 4M9SA 4JI1M 1WIVA 1VDLA 3GLHA 4FWHA 1VG5A 4LJ4A 2X4AA 3C3EA 2LVOC 3PFIA 4FW9A 3VK8A 2OOAA 4HLQA 2F5QA 4REZA 3B7NA 1QDRA 5KPTA 3GQ3A 1XMOM 1HNZM 2J7NA 3GLIA 3SARA 3ZCBB 5ITTA 1GJSA 5FTLA 1D0LA 5IREB 3SAWA 2RRUA 4KO8A 3LCUA 3QYBA 5ITXA 4MGKE 7CATA 2Y20A 3KOZE 2UXBM 4DUZM 3EIHA 4AKHA 1T6OA 2DAGA 2DNAA 2KRKA 2LNHC 3HWSA 1DV0A 4IBFA 3R9XB 3ILKA 1ZAEA 3E21A 4GIPA 3HZJA 5KPZA 1N36M 3MMPA 1IY1A 4BBAA 1QVRA 2HL7A 3W0LB 2RGOA 2VF8A 3U6LA 3NBIA 2C98A 4M0DA 1TH3A 2R18A
chains in the Genus database with same CATH topology
1VEJA 1G4AE 2QNJA 3H4JA 4F2LA 1G3IA 2JY8A 2O25A 1HQYE 2ZTDA 2OOBA 1GO5A 4Q7JA 2R0IA 2K9DA 2EKKA 1ZMVA 1DO2A 2EJSA 2DAMA 2HWJA 2JNHA 3LCVB 1WHCA 2MR9A 1IM2A 1R4GA 3GLHE 4WP2A 5DFLA 2DHYA 1HJPA 1HT1E 2JP7A 1OQYA 3B89A 3GLIE 2HAKA 2DENA 1Q02A 1QZEA 2JZ1A 2KNVA 4UN2B 2LVAA 2CP8A 3FE3A 1AIPC 2G3QA 3FRHA 2LVNC 2LVPC 2OO9A 3FRIA 3IECA 4R71A 1PGYA 1WR1B 1DO0A 1YLAA 3K9OA 2KNZA 2K0BX 2LVQD 1WGLA 4HEOA 1ZMUA 2QHOB 2MJ5B 2DZLA 1VEKA 1ZMWA 1A5TA 1WGNA 1XXHE 2JY7A 1E94E 2DKLA 1P3QQ 2EKFA 3IHPA 1MN3A 1T43A 4G3OA 4GEWA 1OAIA 2DAIA 2JZ0A 1UFZA 1TR8A 2L4EA 2WZJA 1NV9A 5JI2E 1KYIA 1V92A 1SG9A 1OTRA 2QSFX 1NV8A 2KNAA 1F4IA 3GLGE 2DI0A 2JY5A 3BBZA 2MGWA 2LBCA 2L4FA 1CUKA 4DBGB 2JY6B 2L2DA 1VQ1A 1HT2E 1JR3E 1WIVA 1VDLA 2CWBA 4F1IA 1OKSA 2JUJA 1VG5A 2LVOC 3T6PA 1TTEA 2OOAA 2MROB 1EFUB 1IFYA 2BWBA 1Y8GA 1BVSA 1ZV1A 2RRUA 3LCUA 3GLFE 1VEGA 3K9PA 1WJ7A 3E46A 2DAKA 2ZTCA 1T6OA 2DAGA 2DNAA 1IXSA 1DV0A 1C7YA 2DAEA 2H5XA 1G41A 3E21A 2BWEA 3MMPA 2LTUA 2B3TA 2KHHA 3F92A 1XB2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEJ A;  1G4A E;  2QNJ A;  3H4J A;  4F2L A;  1G3I A;  2JY8 A;  2O25 A;  1HQY E;  2ZTD A;  2OOB A;  1GO5 A;  4Q7J A;  2R0I A;  2K9D A;  2EKK A;  1ZMV A;  1DO2 A;  2EJS A;  2DAM A;  2HWJ A;  2JNH A;  3LCV B;  1WHC A;  2MR9 A;  1IM2 A;  1R4G A;  3GLH E;  4WP2 A;  5DFL A;  2DHY A;  1HJP A;  1HT1 E;  2JP7 A;  1OQY A;  3B89 A;  3GLI E;  2HAK A;  2DEN A;  1Q02 A;  1QZE A;  2JZ1 A;  2KNV A;  4UN2 B;  2LVA A;  2CP8 A;  3FE3 A;  1AIP C;  2G3Q A;  3FRH A;  2LVN C;  2LVP C;  2OO9 A;  3FRI A;  3IEC A;  4R71 A;  1PGY A;  1WR1 B;  1DO0 A;  1YLA A;  3K9O A;  2KNZ A;  2K0B X;  2LVQ D;  1WGL A;  4HEO A;  1ZMU A;  2QHO B;  2MJ5 B;  2DZL A;  1VEK A;  1ZMW A;  1A5T A;  1WGN A;  1XXH E;  2JY7 A;  1E94 E;  2DKL A;  1P3Q Q;  2EKF A;  3IHP A;  1MN3 A;  1T43 A;  4G3O A;  4GEW A;  1OAI A;  2DAI A;  2JZ0 A;  1UFZ A;  1TR8 A;  2L4E A;  2WZJ A;  1NV9 A;  5JI2 E;  1KYI A;  1V92 A;  1SG9 A;  1OTR A;  2QSF X;  1NV8 A;  2KNA A;  1F4I A;  3GLG E;  2DI0 A;  2JY5 A;  3BBZ A;  2MGW A;  2LBC A;  2L4F A;  1CUK A;  4DBG B;  2JY6 B;  2L2D A;  1VQ1 A;  1HT2 E;  1JR3 E;  1WIV A;  1VDL A;  2CWB A;  4F1I A;  1OKS A;  2JUJ A;  1VG5 A;  2LVO C;  3T6P A;  1TTE A;  2OOA A;  2MRO B;  1EFU B;  1IFY A;  2BWB A;  1Y8G A;  1BVS A;  1ZV1 A;  2RRU A;  3LCU A;  3GLF E;  1VEG A;  3K9P A;  1WJ7 A;  3E46 A;  2DAK A;  2ZTC A;  1T6O A;  2DAG A;  2DNA A;  1IXS A;  1DV0 A;  1C7Y A;  2DAE A;  2H5X A;  1G41 A;  3E21 A;  2BWE A;  3MMP A;  2LTU A;  2B3T A;  2KHH A;  3F92 A;  1XB2 B; 
#chains in the Genus database with same CATH topology
 5FTJ A;  1PJJ A;  1D0M A;  2QNJ A;  1IY2 A;  3KSX A;  3H4J A;  4F2L A;  4ANR A;  2WSC F;  4JN6 A;  4NC6 A;  3QAU A;  4IBG A;  2HKJ A;  3SYK A;  2NQ8 C;  2O25 A;  4PT5 A;  3DFZ A;  2ZTD A;  3B7Q A;  1SXJ C;  1GO5 A;  1KSF X;  5IZ7 D;  3FUU A;  3TE6 A;  5EP4 A;  4AW4 A;  2C96 A;  1FJG M;  3MHV C;  2HWJ A;  4LRT A;  4NRV A;  3TWM A;  1SXJ D;  4YHH M;  2Z4S A;  4FVM A;  3KDS E;  1SXJ B;  3HX3 A;  2UXD M;  1OAO C;  1HJP A;  1TDZ A;  3KOW E;  1HT1 E;  2OQ4 A;  4K0K M;  2JP7 A;  4B3T M;  2M60 A;  3TL4 X;  4PCZ A;  3B89 A;  4NXN M;  8CAT A;  2HAK A;  1KFV A;  1IBK M;  1QZE A;  4UN2 B;  2CP8 A;  2GNO A;  1XMQ M;  2Q2E B;  2CHQ A;  4IJF A;  4D82 A;  2LVN C;  3AV0 A;  4D81 A;  4L78 A;  2F5O A;  3LQQ A;  2VQE M;  2W82 A;  4IJE A;  1DO0 A;  1JB0 F;  2CV1 A;  1SXJ A;  3FD9 A;  1WGL A;  3HU2 A;  2Y0Q A;  3GPY A;  3FTE A;  4HEO A;  1ZMU A;  2QHO B;  2CHG A;  2CV2 A;  2FS1 A;  5EP1 A;  4II7 A;  4L15 A;  2DZN B;  4LF6 M;  1NY6 A;  2JY7 A;  4MGZ E;  3HHY A;  5EJC A;  1EE8 A;  1E94 E;  2DKL A;  2AHM A;  3LMM A;  4FCW A;  4QNM A;  4LFA M;  4B3M M;  1T43 A;  5E26 A;  4G3O A;  3AJI B;  4NSO B;  4DV6 M;  5LMN M;  2UUC M;  2YR0 A;  2XEP A;  3VDP A;  2L4E A;  4BB9 A;  1QYR A;  2FH0 A;  4JV5 M;  5JI2 E;  3BXW A;  1V92 A;  1IXZ A;  2XZU A;  3V76 A;  5L8R F;  4MM3 B;  1NHG C;  1NV8 A;  4LGY A;  3PXG A;  5ITQ A;  2XZF A;  3ZQJ A;  1OIZ A;  3VLF B;  2G5G X;  5FTM A;  2RKO A;  2JY5 A;  1IN8 A;  3BBZ A;  3K92 A;  3K2L A;  4AG6 A;  5JI3 E;  2ZBK B;  4JI2 M;  2JY6 B;  2DWL A;  3UMM A;  2QZ4 A;  4L6V 6;  5KPR A;  3T15 A;  5KQ8 A;  1OKS A;  2JUJ A;  3SMP A;  2R62 A;  4LY6 A;  3T38 A;  4GHA A;  2DVW B;  4JI5 M;  5EXS A;  2MRO B;  1HR0 M;  2KDL A;  4A3V B;  1PJQ A;  4Y28 F;  1YSY A;  4NOO B;  2BWB A;  2G8L A;  4AZF A;  1MX0 A;  3PNV A;  3M0E A;  4PD2 A;  1NJF A;  2Z8Y M;  3KOY E;  2BNK A;  3E46 A;  5KO3 A;  2FNA A;  2DAK A;  2ZTC A;  3DOA A;  2DWN A;  2QBY B;  4DR5 M;  1HNW M;  1IXS A;  2XSZ A;  3SC3 A;  4X62 M;  3ZH9 B;  1IN6 A;  3MJ5 A;  2DAE A;  1N77 A;  2BWE A;  4GKK M;  2Y0T A;  3U6Q A;  3QYE A;  3OTO M;  2N35 A;  3UJN A;  5EP2 A;  2QPA A;  2XFS A;  4RF1 A;  2B3T A;  4MB7 A;  4TUW A;  4DUY M;  2KHH A;  2K6B A;  3D8L A;  3I04 M;  1DGF A;  4OW0 A;  2CV0 A;  1DGG A;  4X65 M;  4FD2 A;  1N75 A;  1G4A E;  2D7G A;  1NVM A;  2QBY A;  2C99 A;  4L8R C;  3J27 B;  2VF7 A;  1G3I A;  1R6B X;  1SXJ E;  3DA1 A;  4B7F A;  2JA2 A;  1NJG A;  5EP3 A;  3C3D A;  1QAN A;  4Q7J A;  1GJT A;  1LV7 A;  1XWI A;  4QOZ C;  3CGW A;  2EJS A;  1OJL A;  2JNH A;  1PJI A;  1NNJ A;  1IM2 A;  1GVN A;  1R4G A;  3HJ8 A;  3B9P A;  4L16 A;  5DYI A;  5DFL A;  4JI3 M;  3KFU G;  4LG2 A;  3KSJ A;  2KW0 A;  3AKZ A;  1OQY A;  4I4L A;  2KRU A;  3UGJ A;  4ITQ A;  2VII A;  1XHB A;  3FE3 A;  2EUC A;  2LHG A;  2R4J A;  3FRH A;  1N33 M;  2OO9 A;  3KOX E;  3ZC7 B;  4G4N A;  1WXQ A;  2DZO B;  1WR1 B;  4DV4 M;  2DWM A;  1OFI A;  1PRB A;  2CHV A;  4EIW A;  4AKG A;  5F3W A;  4NRW A;  1QDT A;  4DR1 M;  1Q3B A;  3CF2 A;  2MJ5 B;  3HY5 A;  4I8O A;  1VEK A;  2DZL A;  1WGN A;  2KZS A;  1QAO A;  2E5L M;  4I5S A;  1MU5 A;  3FTF A;  2O5R A;  4GHL A;  3IHP A;  1L8Q A;  1L1T A;  3U6O A;  5GKN A;  2XGN A;  4JI4 M;  1T3T A;  3FKE A;  2WSE F;  5A2Q S;  3R8F A;  1R2Z A;  4GKJ M;  4GH9 A;  1QUS A;  1UFZ A;  2P5T A;  2F4V M;  2L6O A;  1GL7 A;  1NHW C;  4LJ5 A;  1NV9 A;  3AFH A;  3I51 A;  2QP9 X;  3B74 A;  3NBX X;  3FTD A;  2Z3X A;  4Z6Y A;  3LVW A;  1MJG M;  4CJ6 A;  3TWK A;  4G4R A;  2XH9 A;  2OPF A;  2A5Y B;  2DHR A;  3SFZ A;  2R46 A;  1NSF A;  4G4O A;  3JAM S;  2MGW A;  2LBC A;  1GAB A;  3KS4 A;  3GPP A;  2L4F A;  2FFJ A;  1CUK A;  3L2A A;  1R7R A;  2KXE A;  1Z5A A;  4QHS A;  5FTN A;  4HL4 A;  1V33 A;  4LZZ A;  1AUA A;  3U6M A;  2R6F A;  5FLX S;  3GRR A;  3T6P A;  2CFO A;  3L26 A;  3U61 B;  3I4Y A;  3Q8X A;  4GIT A;  4IIW A;  4PDG A;  3Q8G A;  1K3W A;  4GC9 A;  2RGH A;  2O01 F;  4GMQ A;  2DXI A;  3K8Z A;  4DR4 M;  1GKI A;  1IFY A;  3KVW A;  4DR6 M;  2WSF F;  1HNX M;  2FE8 A;  1EIJ A;  1ZV1 A;  4NSR A;  4DV7 M;  2XLJ A;  4P17 A;  2D7H A;  3TQS A;  4P16 A;  2BJW A;  1VEG A;  5ITY A;  3CF6 E;  1WJ7 A;  2DWZ B;  1IN4 A;  2I7N A;  3KP1 E;  4IBI A;  4PDI A;  1K3X A;  1GL6 A;  5DYG A;  1DGH A;  2ZAM A;  3U61 A;  2UUA M;  4FWD A;  2ZAN A;  4XBO A;  4R3D A;  2KEB A;  3U6C A;  1IXS B;  1NNU C;  5E6J A;  4LJ9 A;  4ZPX A;  5EQT A;  3L25 A;  1D2N A;  2I7P A;  1FNN A;  2D7E A;  1OIP A;  3FYD A;  4KHP M;  2JY8 A;  2L7H A;  3HHW A;  4WUR A;  5C18 A;  1HQY E;  3SHF A;  4D80 A;  5IWA M;  3KP0 E;  2VDB B;  2K9D A;  2EKK A;  3C58 A;  4LJ8 A;  1RU3 A;  4LF4 M;  3K1J A;  2DAM A;  1TH4 A;  4IBB A;  4DV2 M;  1WHC A;  2MR9 A;  3RGP A;  4B08 A;  2L09 A;  1W5S A;  2Z4R A;  2R44 A;  4IBD A;  1Q3C A;  1QQW A;  2CE7 A;  1S3S A;  3PVS A;  4B3R M;  1Q02 A;  2JZ1 A;  2LH0 A;  2QQ8 A;  2YNM D;  3HKP A;  3L27 A;  2LVA A;  3RGS A;  4IBE A;  4LF7 M;  1UM8 A;  4WW0 A;  3J7B A;  2C9C A;  4CIZ A;  2MH8 A;  3FRI A;  2LVP C;  3GPU A;  3CF0 A;  3IEC A;  1IXR C;  1Z5B A;  1IQP A;  3BOS A;  5EXT A;  4R71 A;  3JR4 A;  1N34 M;  1N78 A;  4QOS A;  4YY3 M;  4X64 M;  4LF8 M;  2F5P A;  1YUB A;  4M9X A;  2K0B X;  4LCB A;  3GQ4 A;  1NO1 A;  3W68 A;  3UZU A;  4LGM A;  4DV3 M;  4LJA A;  1ZMW A;  1A5T A;  1XXH E;  3A42 A;  1J7K A;  5EXX A;  4AKI A;  4JI7 M;  3GO8 A;  2X8A A;  1G71 A;  1GLN A;  2V1C A;  4BLC A;  1R5L A;  2ZM6 M;  1I4W A;  4JYA M;  5FSW A;  3SBJ A;  4LF5 M;  1MN3 A;  1TH2 A;  3I4V A;  1L1Z A;  1TGU A;  4XGI A;  5C1B A;  2UU9 M;  2V1U A;  1OAI A;  3U5Z B;  2JZ0 A;  3GP1 A;  5BR8 M;  3SAS A;  1R2Y A;  2EO2 A;  3M6A A;  4X66 M;  3FYC A;  1JQJ C;  3TPZ A;  3PNY A;  3J81 S;  3SAU A;  1SG9 A;  1OTR A;  4G4Q A;  1Z5C A;  2QSF X;  4LJ7 A;  2YQZ A;  4DR3 M;  3AOG A;  4CHT B;  2X49 A;  1VDD A;  4LF9 M;  2KNA A;  2ZAO A;  1J5E M;  4FCV A;  1F4I A;  3SHG B;  3GLG E;  2JWS A;  4Z8X A;  2DI0 A;  3WHL A;  2J5Y A;  4I81 A;  2VQF M;  3U5Z A;  3VKG A;  4KT0 F;  1PM5 A;  3MK6 A;  4DV5 M;  1C1K A;  5FTK A;  4DBG B;  2GQF A;  1Q39 A;  2L2D A;  3IG5 A;  4S12 A;  5IT9 S;  4IBC A;  1QAQ A;  1VQ1 A;  3GRV A;  4L4U A;  2F5S A;  1JR3 E;  3U6D A;  1XNQ M;  1XC8 A;  3SAT A;  2CWB A;  2FOI C;  4F1I A;  4FWG A;  2R65 A;  4AG5 A;  1V34 A;  3VKH A;  2K47 A;  1TTE A;  2BJV A;  1YE9 A;  2XFT A;  3VDU A;  3L29 A;  3UK6 A;  2LXE A;  1EFU B;  1XXH B;  2UXC M;  3U6P A;  1Y8G A;  1G8P A;  1XNR M;  1BVS A;  2V6Z M;  4QHT A;  3U6S A;  3GLF E;  4RNA A;  4B3S M;  3RE8 A;  1G59 A;  3AOE C;  1QZM A;  3IG8 A;  3K9P A;  4FCT A;  2Y21 A;  4NXM M;  3FUT A;  1C7Y A;  2KA6 B;  3HGI A;  5EXP A;  2H5X A;  4JI0 M;  1G41 A;  5ITU A;  1L2B A;  3E4R A;  1XXH A;  4JI8 M;  3KXE C;  2LTU A;  4RKU F;  3KW6 A;  4KOD A;  2R45 A;  5KQD A;  4MGY E;  4DR2 M;  1W5T A;  3F92 A;  5H37 D;  3NWL A;  3GLG B;  3H4M A;  1XB2 B;  3W67 A;  1DGH B;  2QEN A;  1VEJ A;  4QNR A;  1PJT A;  3U6E A;  2HCB A;  3I01 M;  3KS8 A;  3L28 A;  4CIS A;  2M5Z A;  2JXN A;  4DV1 M;  5LMU M;  2KZU A;  3J80 S;  4MH0 E;  1JR3 D;  2OOB A;  4LFC M;  4B7G A;  4CGY B;  4RF0 A;  1X37 A;  4AI6 A;  2R0I A;  3EIE A;  1ZMV A;  4IBK A;  1QUT A;  3HHX A;  3E9S A;  2CUZ A;  1DO2 A;  3M7G A;  4LFB M;  3FUX A;  3AOE A;  3LCV B;  4LZJ A;  4MGI E;  2CEA A;  3GRY A;  3GLH E;  1Z59 A;  3J2P B;  3LVV A;  4OVZ B;  4WP2 A;  3GLG A;  2L7I A;  1N32 M;  2DHY A;  1K82 A;  3HJQ A;  3GQ5 A;  3C9P A;  1IN5 A;  1ORY B;  4MGH A;  1QAM A;  3FTC A;  3GLI E;  2DEN A;  3GLF B;  1NY5 A;  2KNV A;  4NL4 H;  3T1H M;  2LWX A;  3QWL A;  1AIP C;  2C9O A;  3U60 B;  1JR3 A;  2G3Q A;  2LHC A;  5ITX E;  3VK7 A;  3A98 B;  3HU1 A;  3FUW A;  1Z6T A;  2HHH M;  4XK8 F;  1J09 A;  5BPV A;  2YFQ A;  1PGY A;  3SYL A;  3FUV A;  3TWL A;  3D8B A;  4OVZ A;  1YLA A;  3K9O A;  2KNZ A;  2LVQ D;  3A45 A;  3T1Y M;  4GC5 A;  3HJS A;  4OX9 M;  4JXJ A;  1I94 M;  1TF0 B;  1LTM A;  4JI6 M;  4KLN A;  4DV0 M;  2CRU A;  5DNY A;  3GLF A;  1E32 A;  2UUB M;  2J7O A;  3JR5 A;  2EKF A;  1P3Q Q;  1PJS A;  3U60 A;  3A46 A;  2ERC A;  1ZQ9 A;  2XSZ D;  1DGB A;  3GPX A;  2C5R A;  3CTW B;  4GEW A;  1HQC A;  1L2D A;  2QCU A;  3LQR A;  1OFH A;  2DAI A;  4OU7 A;  4AQY M;  1H6U A;  3SMS A;  4M9Z A;  4B7H A;  1TR8 A;  4M0W A;  4G6Z A;  3W0F A;  2WZJ A;  4LRS A;  2H1R A;  4DR7 M;  1KYI A;  4GRI A;  4R7G A;  3GLH B;  2APL A;  3WHK A;  2R4E A;  1E9R A;  3THG A;  2EA0 A;  5ITR A;  3J7A S;  3DZD A;  3RFW A;  1IY0 A;  3AL0 C;  2Z7J A;  3HHZ A;  4LJ6 A;  1E9S A;  3GLI B;  1IBM M;  3VFD A;  3HU3 A;  3LW5 F;  1D0K A;  1TDH A;  3SAV A;  2XF3 A;  1L2C A;  2F5N A;  1IN7 A;  3GRU A;  4IBJ A;  1HT2 E;  1IBL M;  3B7Z A;  4W5W A;  4M9S A;  4JI1 M;  1WIV A;  1VDL A;  3GLH A;  4FWH A;  1VG5 A;  4LJ4 A;  2X4A A;  3C3E A;  2LVO C;  3PFI A;  4FW9 A;  3VK8 A;  2OOA A;  4HLQ A;  2F5Q A;  4REZ A;  3B7N A;  1QDR A;  5KPT A;  3GQ3 A;  1XMO M;  1HNZ M;  2J7N A;  3GLI A;  3SAR A;  3ZCB B;  5ITT A;  1GJS A;  5FTL A;  1D0L A;  5IRE B;  3SAW A;  2RRU A;  4KO8 A;  3LCU A;  3QYB A;  5ITX A;  4MGK E;  7CAT A;  2Y20 A;  3KOZ E;  2UXB M;  4DUZ M;  3EIH A;  4AKH A;  1T6O A;  2DAG A;  2DNA A;  2KRK A;  2LNH C;  3HWS A;  1DV0 A;  4IBF A;  3R9X B;  3ILK A;  1ZAE A;  3E21 A;  4GIP A;  3HZJ A;  5KPZ A;  1N36 M;  3MMP A;  1IY1 A;  4BBA A;  1QVR A;  2HL7 A;  3W0L B;  2RGO A;  2VF8 A;  3U6L A;  3NBI A;  2C98 A;  4M0D A;  1TH3 A;  2R18 A; 
#chains in the Genus database with same CATH homology
 1VEJ A;  1G4A E;  2QNJ A;  3H4J A;  4F2L A;  1G3I A;  2JY8 A;  2O25 A;  1HQY E;  2ZTD A;  2OOB A;  1GO5 A;  4Q7J A;  2R0I A;  2K9D A;  2EKK A;  1ZMV A;  1DO2 A;  2EJS A;  2DAM A;  2HWJ A;  2JNH A;  3LCV B;  1WHC A;  2MR9 A;  1IM2 A;  1R4G A;  3GLH E;  4WP2 A;  5DFL A;  2DHY A;  1HJP A;  1HT1 E;  2JP7 A;  1OQY A;  3B89 A;  3GLI E;  2HAK A;  2DEN A;  1Q02 A;  1QZE A;  2JZ1 A;  2KNV A;  4UN2 B;  2LVA A;  2CP8 A;  3FE3 A;  1AIP C;  2G3Q A;  3FRH A;  2LVN C;  2LVP C;  2OO9 A;  3FRI A;  3IEC A;  4R71 A;  1PGY A;  1WR1 B;  1DO0 A;  1YLA A;  3K9O A;  2KNZ A;  2K0B X;  2LVQ D;  1WGL A;  4HEO A;  1ZMU A;  2QHO B;  2MJ5 B;  2DZL A;  1VEK A;  1ZMW A;  1A5T A;  1WGN A;  1XXH E;  2JY7 A;  1E94 E;  2DKL A;  1P3Q Q;  2EKF A;  3IHP A;  1MN3 A;  1T43 A;  4G3O A;  4GEW A;  1OAI A;  2DAI A;  2JZ0 A;  1UFZ A;  1TR8 A;  2L4E A;  2WZJ A;  1NV9 A;  5JI2 E;  1KYI A;  1V92 A;  1SG9 A;  1OTR A;  2QSF X;  1NV8 A;  2KNA A;  1F4I A;  3GLG E;  2DI0 A;  2JY5 A;  3BBZ A;  2MGW A;  2LBC A;  2L4F A;  1CUK A;  4DBG B;  2JY6 B;  2L2D A;  1VQ1 A;  1HT2 E;  1JR3 E;  1WIV A;  1VDL A;  2CWB A;  4F1I A;  1OKS A;  2JUJ A;  1VG5 A;  2LVO C;  3T6P A;  1TTE A;  2OOA A;  2MRO B;  1EFU B;  1IFY A;  2BWB A;  1Y8G A;  1BVS A;  1ZV1 A;  2RRU A;  3LCU A;  3GLF E;  1VEG A;  3K9P A;  1WJ7 A;  3E46 A;  2DAK A;  2ZTC A;  1T6O A;  2DAG A;  2DNA A;  1IXS A;  1DV0 A;  1C7Y A;  2DAE A;  2H5X A;  1G41 A;  3E21 A;  2BWE A;  3MMP A;  2LTU A;  2B3T A;  2KHH A;  3F92 A;  1XB2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...