2JY8A

Nmr structure of the ubiquitin associated (uba) domain of p62 (sqstm1) in complex with ubiquitin. rdc refined
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
52
structure length
52
Chain Sequence
b'GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-binding protein p62
publication title Ubiquitin Recognition by the Ubiquitin-associated Domain of p62 Involves a Novel Conformational Switch
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 4
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy8A00
1VDLA 4DBGB 2RRUA 3K9PA 1XB2B 1SG9A 1V92A 2JY5A 2LBCA 2JP7A 1UFZA 1TR8A 1WGNA 2DENA 2JZ1A 1T6OA 1C7YA 2JZ0A 3E21A 1QZEA 2CP8A 1DV0A 1G3IA 1HT2E 3B89A 1DO2A 2L2DA 3GLGE 1ZMVA 2OOAA 2DHYA 4GEWA 1IXSA 2EJSA 2KNVA 1OQYA 2LVAA 3LCVB 2CWBA 4WP2A 1NV8A 2MR9A 1R4GA 2EKFA 2KNZA 2O25A 2MGWA 3BBZA 1P3QQ 1YLAA 2DI0A 2ZTCA 2HWJA 2JUJA 1WHCA 5JI2E 3GLHE 1OTRA 1Y8GA 2DAKA 2QNJA 1ZMWA 1VEGA 1GO5A 2DZLA 1KYIA 2ZTDA 3F92A 1Q02A 1A5TA 3LCUA 1IFYA 1F4IA 2DAIA 2LVPC 1ZMUA 2BWBA 2LVQD 2DAEA 1VEKA 2LTUA 1VEJA 2OOBA 2QSFX 1HQYE 2DAGA 2OO9A 1XXHE 1DO0A 2EKKA 2B3TA 3FRIA 2DKLA 1VQ1A 4UN2B 1JR3E 1ZV1A 2G3QA 2MROB 1OKSA 3E46A 2DAMA 2R0IA 3FRHA 1WGLA 2JY8A 2LVNC 3GLFE 2WZJA 1IM2A 2MJ5B 2K0BX 2KNAA 3FE3A 1HT1E 5DFLA 1G4AE 2K9DA 2QHOB 1EFUB 4F1IA 4G3OA 2L4EA 2JNHA 2LVOC 1T43A 1MN3A 2KHHA 1BVSA 3GLIE 3K9OA 1TTEA 1E94E 1WIVA 3MMPA 4HEOA 1AIPC 2HAKA 2L4FA 1NV9A 4Q7JA 2H5XA 2BWEA 4R71A 1WR1B 3IHPA 2JY7A 1VG5A 3T6PA 2JY6B 1CUKA 2DNAA 3H4JA 1PGYA 1OAIA 4F2LA 1WJ7A 1HJPA 1G41A 3IECA
chains in the Genus database with same CATH superfamily
4Z8XA 2X4AA 4PT5A 1N36M 3RGPA 1PJTA 5LMNM 4B3SM 1UFZA 2DENA 2FOIC 2Z4RA 3I04M 3FD9A 3T1HM 2CHGA 2BJVA 2WSFF 2H1RA 2GNOA 1GJTA 1IN4A 4M9XA 1EE8A 4AQYM 4IBEA 1JQJC 4MGZE 3UZUA 4CHTB 3U6LA 1NVMA 4G4NA 1HNZM 1Z6TA 3GPPA 4GEWA 1SXJA 3FUUA 2EJSA 3U60A 2XZFA 1OQYA 1UM8A 2LVAA 3UJNA 5FTMA 5ITUA 1NV8A 2QBYA 3KP1E 3K1JA 1R4GA 1IXRC 1D2NA 2EKFA 1Q39A 3FTCA 5E26A 3L26A 2XH9A 3KOWE 4OU7A 3DZDA 1FJGM 4P17A 2R6FA 3HJSA 3M0EA 3T1YM 3JR4A 2FE8A 3AJIB 4W5WA 3L2AA 2DI0A 1LV7A 2HWJA 2O5RA 4LGYA 1V33A 4LF6M 1OTRA 2UUAM 3FYCA 4IBBA 4CISA 3ZCBB 3W68A 3NBXX 2UU9M 4LF4M 5EP2A 5KPRA 2G5GX 3OTOM 4MGIE 3RGSA 1VEGA 1R6BX 2QCUA 2KZUA 1KYIA 4B7HA 1K82A 4JI4M 1J7KA 4DV4M 1Z5BA 2F5PA 4D81A 2ZM6M 3LMMA 1YE9A 3DOAA 1PJSA 1A5TA 1OIPA 1TDZA 2KRUA 3KXEC 2VF8A 2CV0A 1NNUC 1F4IA 1L2DA 3SARA 3CF6E 1N32M 5BPVA 2LVPC 1ZMUA 2BWBA 2KW0A 1LTMA 2DAEA 2LVQD 1VEKA 2YR0A 3A45A 3FUTA 4PDIA 2QSFX 1HQYE 1NJFA 5EJCA 2V1CA 3TWMA 4Y28F 2DAGA 1JR3D 3VLFB 1XHBA 4NSOB 1XXHB 3U6MA 4FW9A 5KO3A 3I01M 3GQ4A 4LF5M 3HX3A 4R7GA 1GJSA 2DAMA 2R0IA 3H4MA 3PVSA 4G4OA 1N77A 3HGIA 3J7BA 3L28A 1NO1A 3SASA 1G71A 2LVNC 2OPFA 3U6DA 2NQ8C 1IM2A 3KW6A 3HWSA 3QAUA 1W5SA 4L6V6 4X62M 3I4VA 3LVWA 1J5EM 4QOZC 1SXJC 3KP0E 3KOZE 2VQFM 3D8LA 5C18A 1L2BA 4DR3M 3GO8A 4F1IA 1EFUB 2CFOA 8CATA 2Y0QA 2CV2A 4LFCM 3SYKA 2L4EA 2JNHA 3SHGB 3HZJA 5DYIA 1MX0A 3GRYA 3GLIE 3K9OA 1QDTA 1TTEA 1KSFX 3CGWA 3ZH9B 3CF2A 4BBAA 3SBJA 4JI0M 2L4FA 4ZPXA 2XFTA 1GL7A 3J7AS 5ITRA 2FH0A 1Z59A 2H5XA 2K6BA 4GMQA 1L1ZA 2QPAA 3J27B 4R71A 1IBMM 2JY7A 1I4WA 2BNKA 2VIIA 4GRIA 4DV2M 1CUKA 2R62A 4HL4A 1WJ7A 1WXQA 4MGYE 1G41A 3LQQA 5JI3E 3V76A 1ZQ9A 4NXMM 1VDLA 3SHFA 1T3TA 3GRVA 1IXZA 2MH8A 1NJGA 4QHSA 1IBLM 2RRUA 3K9PA 4FWHA 1XB2B 2R4JA 1DGHA 5LMUM 3HJ8A 3JAMS 3SAVA 5ITYA 2JXNA 2Z7JA 1T6OA 3BXWA 3KSXA 2DWLA 1TDHA 2XF3A 2L09A 3EIEA 4L16A 3E21A 1PJJA 3GLIB 4AI6A 3HU2A 1GL6A 1DV0A 1HT2E 3SMPA 3L25A 4LCBA 5C1BA 3QYEA 2OOAA 4D80A 3GLGB 3IG8A 3GP1A 3B74A 1IXSA 4B08A 3B7QA 4RKUF 5EP1A 2CWBA 3FKEA 5FTLA 3L29A 1XNRM 3FTFA 1C1KA 4RF0A 2C96A 1L8QA 5L8RF 2CEAA 4JI1M 1P3QQ 1E32A 2QZ4A 5ITTA 4LJ6A 2K47A 1IQPA 3T38A 3HHZA 3IG5A 4QNRA 4AW4A 2LHCA 4B7FA 4X64M 4DUZM 2DAKA 2N35A 3FUVA 3GPYA 4IBFA 4QHTA 1MU5A 4IBIA 2DZLA 3A46A 1GABA 3UK6A 4OVZA 4AG6A 2ZTDA 3KDSE 3SC3A 4DV0M 3HY5A 2DWZB 3U5ZB 3R8FA 3KSJA 4AG5A 4DR6M 3J80S 4GHLA 1EIJA 2Z8YM 3E4RA 4DV6M 4OVZB 1OFHA 4NC6A 1PM5A 4PDGA 4IBGA 5A2QS 3GQ5A 2LTUA 1NNJA 1VEJA 1XXHE 2EKKA 2B3TA 3A42A 2DZNB 2DKLA 2C9OA 2ZAMA 4A3VB 3L27A 2ZANA 3FRHA 1D0KA 1E9RA 5FLXS 1N33M 2CHVA 5EXPA 7CATA 3GPXA 1XC8A 3DFZA 2ZAOA 4D82A 2WSEF 2M5ZA 1IN8A 3GLFB 2KNAA 4X65M 3JR5A 5IZ7D 3I4YA 3FE3A 3M6AA 1HR0M 4I81A 3U61B 4NRWA 1G4AE 3LVVA 4JI7M 4G3OA 5FTJA 2EUCA 3EIHA 4DUYM 4NXNM 2LXEA 1IBKM 2Q2EB 2LVOC 2UUCM 1XXHA 4OW0A 2KHHA 1BVSA 1G8PA 4CGYB 3W0LB 3VKGA 1QVRA 3K92A 1E94E 3SYLA 3UMMA 2VF7A 4FD2A 2Z3XA 3UGJA 4L78A 1QUTA 1NV9A 3KVWA 3C3EA 3FUXA 2XGNA 4MM3B 4Q7JA 5KQ8A 2XLJA 2F5QA 2V1UA 2V6ZM 2F4VM 2YQZA 2JY6B 2QENA 4JN6A 4F2LA 2Y21A 5KPTA 1N34M 3D8BA 3VFDA 4GKJM 5EXTA 1XMOM 3IECA 1QYRA 4JYAM 2ERCA 4DBGB 5IWAM 2DZOB 3C3DA 4FVMA 4PD2A 2LBCA 5BR8M 1OFIA 2ZBKB 4LJ5A 3C9PA 2M60A 1TR8A 2JZ1A 2A5YB 2HCBA 1IY0A 3ILKA 4AKGA 1IN7A 1Q3CA 5IREB 1GKIA 2C99A 1C7YA 2JZ0A 3VK8A 5FTKA 4MB7A 1XWIA 2CP8A 4ITQA 1PJIA 1DO2A 2P5TA 3GLGE 1ZMVA 4FWGA 1Q3BA 2DHYA 2XSZA 3MJ5A 1SXJD 3HHWA 1L2CA 4LFBM 3I51A 5EQTA 2VDBB 2LHGA 3J81S 3W0FA 3LCVB 3HHYA 1OAOC 4FCTA 1QAMA 3AKZA 2DWMA 2E5LM 2MR9A 2KNZA 2FNAA 3VK7A 2C5RA 2W82A 2MGWA 2XEPA 2KEBA 4RF1A 5IT9S 4K0KM 3K2LA 3PNYA 2HHHM 1YLAA 5FTNA 2XFSA 3GLIA 3GRRA 4XBOA 2JUJA 1WHCA 3TPZA 2J7NA 1HNXM 1QQWA 4B3MM 3GLHE 3GLGA 1Z5CA 2D7EA 4GITA 4DV7M 4X66M 3U6OA 4NRVA 3LQRA 4LRSA 2EA0A 3HHXA 3TQSA 4L4UA 4DV1M 4LJ8A 3HU3A 3MHVC 4JI8M 1GO5A 3RFWA 3GQ3A 4B3TM 3WHLA 3ZC7B 4JI5M 4MGHA 4DR7M 4FCVA 1N75A 2LH0A 3QWLA 2I7NA 4XK8F 4YY3M 1TH2A 1Z5AA 3SAWA 1YSYA 1XMQM 2F5NA 1XNQM 2DAIA 4KO8A 4GIPA 4IBDA 2RKOA 3U6QA 5H37D 1TH3A 2OOBA 3BOSA 4LY6A 4KLNA 4KT0F 2OO9A 3KOXE 4LRTA 1IN5A 1VQ1A 3HKPA 3RE8A 2KA6B 1V34A 2C9CA 1OKSA 2G3QA 2G8LA 3GLHB 3E46A 4FCWA 4QNMA 1QAQA 1D0MA 4R3DA 4IJEA 1D0LA 4EIWA 4REZA 4LG2A 1DGGA 2JY8A 2UUBM 3U5ZA 4NL4H 4M9ZA 4M0DA 3GLFE 2WZJA 2FS1A 4G4RA 2MJ5B 2K0BX 3U6PA 4AKHA 5KQDA 2X8AA 3LW5F 5EXSA 2JWSA 1HT1E 3HU1A 5DFLA 1PRBA 2K9DA 4LJ9A 3SATA 3FTEA 4LF8M 4JXJA 4WURA 4OX9M 3GPUA 2CE7A 1NSFA 1QAOA 1T43A 1MN3A 1E9SA 2QP9X 4IBKA 4CIZA 4Z6YA 3KOYE 1AUAA 1IN6A 2L7IA 4YHHM 3FTDA 1H6UA 2LWXA 1G59A 4IBCA 2I7PA 1HQCA 1YUBA 5ITXE 3PNVA 4TUWA 2BWEA 3DA1A 2XSZD 4RNAA 4BLCA 1WR1B 4DR5M 3VKHA 4G6ZA 3GLFA 3QYBA 4LF7M 3AOEA 1NHGC 3H4JA 3SFZA 4DV5M 3TL4X 4HLQA 4L15A 3U61A 1IY1A 1NHWC 1HJPA 1SXJB 2R44A 2YFQA 2R46A 4LZZA 5KPZA 4MGKE 3U60B 4JI2M 4AKIA 2QQ8A 4LJ4A 2D7HA 2JY5A 1SG9A 1V92A 1GVNA 3U6SA 2QBYB 2JP7A 1GLNA 1WGNA 2JA2A 4ANRA 2UXCM 1R7RA 3TWLA 4DR1M 5EXXA 1QZMA 1OJLA 3VDUA 2HL7A 4B7GA 2GQFA 5EP4A 2KXEA 1K3WA 3W67A 1QZEA 3AOGA 5ITXA 1G3IA 3B89A 2EO2A 2L2DA 4DR4M 1S3SA 3AV0A 3TE6A 3CF0A 2KNVA 3AFHA 1IY2A 4IJFA 1TH4A 3Q8GA 4WP2A 2L6OA 3MK6A 2Y0TA 5E6JA 1QUSA 4JI6M 2WSCF 3K8ZA 2O25A 4AZFA 3B9PA 4KHPM 2FFJA 1HNWM 2XZUA 3BBZA 4LJAA 1L1TA 4S12A 3PXGA 4GC9A 5FSWA 2KDLA 4I4LA 2ZTCA 2RGHA 3FYDA 4M0WA 2R45A 4IBJA 3ZQJA 1QANA 5JI2E 4MH0E 2R65A 3KFUG 1Y8GA 5F3WA 3FUWA 1JB0F 3GRUA 4II7A 3A98B 5DYGA 2QNJA 1ZMWA 4CJ6A 2J7OA 4GHAA 2D7GA 4NOOB 1OIZA 4KODA 1QDRA 2Y20A 3SAUA 3M7GA 3THGA 2R18A 1PJQA 2CV1A 3F92A 1Q02A 3LCUA 2RGOA 1FNNA 1IFYA 3AOEC 4I8OA 5DNYA 1DGBA 1TGUA 3WHKA 3KS4A 3AL0C 2KZSA 4P16A 3B7ZA 4XGIA 2O01F 1R2ZA 1J09A 1R2YA 3B7NA 3HJQA 1DO0A 3CTWB 1RU3A 2C98A 3FRIA 5GKNA 4DV3M 2Z4SA 3C58A 2J5YA 2DVWB 4QOSA 1X37A 4UN2B 2DWNA 3R9XB 1JR3E 1ORYB 1ZV1A 2MROB 3U6EA 2DXIA 1K3XA 4PCZA 3E9SA 2X49A 4L8RC 2OQ4A 1WGLA 1VDDA 4GC5A 4LZJA 4LFAM 1DGFA 4JI3M 3U6CA 1I94M 4B3RM 2DHRA 1TF0B 4GH9A 4JV5M 4WW0A 3T15A 3KS8A 2CHQA 2BJWA 2YNMD 4DR2M 5ITQA 2R4EA 3PFIA 2UXBM 2HKJA 4M9SA 4I5SA 2LNHC 2QHOB 2F5OA 4NSRA 1R5LA 1KFVA 1ZAEA 2CUZA 3VDPA 4IIWA 1DGHB 3GLHA 5EP3A 4BB9A 3Q8XA 1JR3A 4LF9M 1WIVA 3MMPA 4LJ7A 4FWDA 3TWKA 4HEOA 1AIPC 2HAKA 1NY6A 2L7HA 1NY5A 3IHPA 2AHMA 4GKKM 1VG5A 3SMSA 3J2PB 3T6PA 2F5SA 2DNAA 2VQEM 1PGYA 1SXJE 3NWLA 4LGMA 1OAIA 1N78A 3NBIA 1W5TA 2CRUA 2UXDM 2APLA 1IXSB 2KRKA 1MJGM 4G4QA
chains in the Genus database with same CATH topology
1VDLA 4DBGB 2RRUA 3K9PA 1XB2B 1SG9A 1V92A 2JY5A 2LBCA 2JP7A 1UFZA 1TR8A 1WGNA 2DENA 2JZ1A 1T6OA 1C7YA 2JZ0A 3E21A 1QZEA 2CP8A 1DV0A 1G3IA 1HT2E 3B89A 1DO2A 2L2DA 3GLGE 1ZMVA 2OOAA 2DHYA 4GEWA 1IXSA 2EJSA 2KNVA 1OQYA 2LVAA 3LCVB 2CWBA 4WP2A 1NV8A 2MR9A 1R4GA 2EKFA 2KNZA 2O25A 2MGWA 3BBZA 1P3QQ 1YLAA 2DI0A 2ZTCA 2HWJA 2JUJA 1WHCA 5JI2E 3GLHE 1OTRA 1Y8GA 2DAKA 2QNJA 1ZMWA 1VEGA 1GO5A 2DZLA 1KYIA 2ZTDA 3F92A 1Q02A 1A5TA 3LCUA 1IFYA 1F4IA 2DAIA 2LVPC 1ZMUA 2BWBA 2LVQD 2DAEA 1VEKA 2LTUA 1VEJA 2OOBA 2QSFX 1HQYE 2DAGA 2OO9A 1XXHE 1DO0A 2EKKA 2B3TA 3FRIA 2DKLA 1VQ1A 4UN2B 1JR3E 1ZV1A 2G3QA 2MROB 1OKSA 3E46A 2DAMA 2R0IA 3FRHA 1WGLA 2JY8A 2LVNC 3GLFE 2WZJA 1IM2A 2MJ5B 2K0BX 2KNAA 3FE3A 1HT1E 5DFLA 1G4AE 2K9DA 2QHOB 1EFUB 4F1IA 4G3OA 2L4EA 2JNHA 2LVOC 1T43A 1MN3A 2KHHA 1BVSA 3GLIE 3K9OA 1TTEA 1E94E 1WIVA 3MMPA 4HEOA 1AIPC 2HAKA 2L4FA 1NV9A 4Q7JA 2H5XA 2BWEA 4R71A 1WR1B 3IHPA 2JY7A 1VG5A 3T6PA 2JY6B 1CUKA 2DNAA 3H4JA 1PGYA 1OAIA 4F2LA 1WJ7A 1HJPA 1G41A 3IECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDL A;  4DBG B;  2RRU A;  3K9P A;  1XB2 B;  1SG9 A;  1V92 A;  2JY5 A;  2LBC A;  2JP7 A;  1UFZ A;  1TR8 A;  1WGN A;  2DEN A;  2JZ1 A;  1T6O A;  1C7Y A;  2JZ0 A;  3E21 A;  1QZE A;  2CP8 A;  1DV0 A;  1G3I A;  1HT2 E;  3B89 A;  1DO2 A;  2L2D A;  3GLG E;  1ZMV A;  2OOA A;  2DHY A;  4GEW A;  1IXS A;  2EJS A;  2KNV A;  1OQY A;  2LVA A;  3LCV B;  2CWB A;  4WP2 A;  1NV8 A;  2MR9 A;  1R4G A;  2EKF A;  2KNZ A;  2O25 A;  2MGW A;  3BBZ A;  1P3Q Q;  1YLA A;  2DI0 A;  2ZTC A;  2HWJ A;  2JUJ A;  1WHC A;  5JI2 E;  3GLH E;  1OTR A;  1Y8G A;  2DAK A;  2QNJ A;  1ZMW A;  1VEG A;  1GO5 A;  2DZL A;  1KYI A;  2ZTD A;  3F92 A;  1Q02 A;  1A5T A;  3LCU A;  1IFY A;  1F4I A;  2DAI A;  2LVP C;  1ZMU A;  2BWB A;  2LVQ D;  2DAE A;  1VEK A;  2LTU A;  1VEJ A;  2OOB A;  2QSF X;  1HQY E;  2DAG A;  2OO9 A;  1XXH E;  1DO0 A;  2EKK A;  2B3T A;  3FRI A;  2DKL A;  1VQ1 A;  4UN2 B;  1JR3 E;  1ZV1 A;  2G3Q A;  2MRO B;  1OKS A;  3E46 A;  2DAM A;  2R0I A;  3FRH A;  1WGL A;  2JY8 A;  2LVN C;  3GLF E;  2WZJ A;  1IM2 A;  2MJ5 B;  2K0B X;  2KNA A;  3FE3 A;  1HT1 E;  5DFL A;  1G4A E;  2K9D A;  2QHO B;  1EFU B;  4F1I A;  4G3O A;  2L4E A;  2JNH A;  2LVO C;  1T43 A;  1MN3 A;  2KHH A;  1BVS A;  3GLI E;  3K9O A;  1TTE A;  1E94 E;  1WIV A;  3MMP A;  4HEO A;  1AIP C;  2HAK A;  2L4F A;  1NV9 A;  4Q7J A;  2H5X A;  2BWE A;  4R71 A;  1WR1 B;  3IHP A;  2JY7 A;  1VG5 A;  3T6P A;  2JY6 B;  1CUK A;  2DNA A;  3H4J A;  1PGY A;  1OAI A;  4F2L A;  1WJ7 A;  1HJP A;  1G41 A;  3IEC A; 
#chains in the Genus database with same CATH topology
 4Z8X A;  2X4A A;  4PT5 A;  1N36 M;  3RGP A;  1PJT A;  5LMN M;  4B3S M;  1UFZ A;  2DEN A;  2FOI C;  2Z4R A;  3I04 M;  3FD9 A;  3T1H M;  2CHG A;  2BJV A;  2WSF F;  2H1R A;  2GNO A;  1GJT A;  1IN4 A;  4M9X A;  1EE8 A;  4AQY M;  4IBE A;  1JQJ C;  4MGZ E;  3UZU A;  4CHT B;  3U6L A;  1NVM A;  4G4N A;  1HNZ M;  1Z6T A;  3GPP A;  4GEW A;  1SXJ A;  3FUU A;  2EJS A;  3U60 A;  2XZF A;  1OQY A;  1UM8 A;  2LVA A;  3UJN A;  5FTM A;  5ITU A;  1NV8 A;  2QBY A;  3KP1 E;  3K1J A;  1R4G A;  1IXR C;  1D2N A;  2EKF A;  1Q39 A;  3FTC A;  5E26 A;  3L26 A;  2XH9 A;  3KOW E;  4OU7 A;  3DZD A;  1FJG M;  4P17 A;  2R6F A;  3HJS A;  3M0E A;  3T1Y M;  3JR4 A;  2FE8 A;  3AJI B;  4W5W A;  3L2A A;  2DI0 A;  1LV7 A;  2HWJ A;  2O5R A;  4LGY A;  1V33 A;  4LF6 M;  1OTR A;  2UUA M;  3FYC A;  4IBB A;  4CIS A;  3ZCB B;  3W68 A;  3NBX X;  2UU9 M;  4LF4 M;  5EP2 A;  5KPR A;  2G5G X;  3OTO M;  4MGI E;  3RGS A;  1VEG A;  1R6B X;  2QCU A;  2KZU A;  1KYI A;  4B7H A;  1K82 A;  4JI4 M;  1J7K A;  4DV4 M;  1Z5B A;  2F5P A;  4D81 A;  2ZM6 M;  3LMM A;  1YE9 A;  3DOA A;  1PJS A;  1A5T A;  1OIP A;  1TDZ A;  2KRU A;  3KXE C;  2VF8 A;  2CV0 A;  1NNU C;  1F4I A;  1L2D A;  3SAR A;  3CF6 E;  1N32 M;  5BPV A;  2LVP C;  1ZMU A;  2BWB A;  2KW0 A;  1LTM A;  2DAE A;  2LVQ D;  1VEK A;  2YR0 A;  3A45 A;  3FUT A;  4PDI A;  2QSF X;  1HQY E;  1NJF A;  5EJC A;  2V1C A;  3TWM A;  4Y28 F;  2DAG A;  1JR3 D;  3VLF B;  1XHB A;  4NSO B;  1XXH B;  3U6M A;  4FW9 A;  5KO3 A;  3I01 M;  3GQ4 A;  4LF5 M;  3HX3 A;  4R7G A;  1GJS A;  2DAM A;  2R0I A;  3H4M A;  3PVS A;  4G4O A;  1N77 A;  3HGI A;  3J7B A;  3L28 A;  1NO1 A;  3SAS A;  1G71 A;  2LVN C;  2OPF A;  3U6D A;  2NQ8 C;  1IM2 A;  3KW6 A;  3HWS A;  3QAU A;  1W5S A;  4L6V 6;  4X62 M;  3I4V A;  3LVW A;  1J5E M;  4QOZ C;  1SXJ C;  3KP0 E;  3KOZ E;  2VQF M;  3D8L A;  5C18 A;  1L2B A;  4DR3 M;  3GO8 A;  4F1I A;  1EFU B;  2CFO A;  8CAT A;  2Y0Q A;  2CV2 A;  4LFC M;  3SYK A;  2L4E A;  2JNH A;  3SHG B;  3HZJ A;  5DYI A;  1MX0 A;  3GRY A;  3GLI E;  3K9O A;  1QDT A;  1TTE A;  1KSF X;  3CGW A;  3ZH9 B;  3CF2 A;  4BBA A;  3SBJ A;  4JI0 M;  2L4F A;  4ZPX A;  2XFT A;  1GL7 A;  3J7A S;  5ITR A;  2FH0 A;  1Z59 A;  2H5X A;  2K6B A;  4GMQ A;  1L1Z A;  2QPA A;  3J27 B;  4R71 A;  1IBM M;  2JY7 A;  1I4W A;  2BNK A;  2VII A;  4GRI A;  4DV2 M;  1CUK A;  2R62 A;  4HL4 A;  1WJ7 A;  1WXQ A;  4MGY E;  1G41 A;  3LQQ A;  5JI3 E;  3V76 A;  1ZQ9 A;  4NXM M;  1VDL A;  3SHF A;  1T3T A;  3GRV A;  1IXZ A;  2MH8 A;  1NJG A;  4QHS A;  1IBL M;  2RRU A;  3K9P A;  4FWH A;  1XB2 B;  2R4J A;  1DGH A;  5LMU M;  3HJ8 A;  3JAM S;  3SAV A;  5ITY A;  2JXN A;  2Z7J A;  1T6O A;  3BXW A;  3KSX A;  2DWL A;  1TDH A;  2XF3 A;  2L09 A;  3EIE A;  4L16 A;  3E21 A;  1PJJ A;  3GLI B;  4AI6 A;  3HU2 A;  1GL6 A;  1DV0 A;  1HT2 E;  3SMP A;  3L25 A;  4LCB A;  5C1B A;  3QYE A;  2OOA A;  4D80 A;  3GLG B;  3IG8 A;  3GP1 A;  3B74 A;  1IXS A;  4B08 A;  3B7Q A;  4RKU F;  5EP1 A;  2CWB A;  3FKE A;  5FTL A;  3L29 A;  1XNR M;  3FTF A;  1C1K A;  4RF0 A;  2C96 A;  1L8Q A;  5L8R F;  2CEA A;  4JI1 M;  1P3Q Q;  1E32 A;  2QZ4 A;  5ITT A;  4LJ6 A;  2K47 A;  1IQP A;  3T38 A;  3HHZ A;  3IG5 A;  4QNR A;  4AW4 A;  2LHC A;  4B7F A;  4X64 M;  4DUZ M;  2DAK A;  2N35 A;  3FUV A;  3GPY A;  4IBF A;  4QHT A;  1MU5 A;  4IBI A;  2DZL A;  3A46 A;  1GAB A;  3UK6 A;  4OVZ A;  4AG6 A;  2ZTD A;  3KDS E;  3SC3 A;  4DV0 M;  3HY5 A;  2DWZ B;  3U5Z B;  3R8F A;  3KSJ A;  4AG5 A;  4DR6 M;  3J80 S;  4GHL A;  1EIJ A;  2Z8Y M;  3E4R A;  4DV6 M;  4OVZ B;  1OFH A;  4NC6 A;  1PM5 A;  4PDG A;  4IBG A;  5A2Q S;  3GQ5 A;  2LTU A;  1NNJ A;  1VEJ A;  1XXH E;  2EKK A;  2B3T A;  3A42 A;  2DZN B;  2DKL A;  2C9O A;  2ZAM A;  4A3V B;  3L27 A;  2ZAN A;  3FRH A;  1D0K A;  1E9R A;  5FLX S;  1N33 M;  2CHV A;  5EXP A;  7CAT A;  3GPX A;  1XC8 A;  3DFZ A;  2ZAO A;  4D82 A;  2WSE F;  2M5Z A;  1IN8 A;  3GLF B;  2KNA A;  4X65 M;  3JR5 A;  5IZ7 D;  3I4Y A;  3FE3 A;  3M6A A;  1HR0 M;  4I81 A;  3U61 B;  4NRW A;  1G4A E;  3LVV A;  4JI7 M;  4G3O A;  5FTJ A;  2EUC A;  3EIH A;  4DUY M;  4NXN M;  2LXE A;  1IBK M;  2Q2E B;  2LVO C;  2UUC M;  1XXH A;  4OW0 A;  2KHH A;  1BVS A;  1G8P A;  4CGY B;  3W0L B;  3VKG A;  1QVR A;  3K92 A;  1E94 E;  3SYL A;  3UMM A;  2VF7 A;  4FD2 A;  2Z3X A;  3UGJ A;  4L78 A;  1QUT A;  1NV9 A;  3KVW A;  3C3E A;  3FUX A;  2XGN A;  4MM3 B;  4Q7J A;  5KQ8 A;  2XLJ A;  2F5Q A;  2V1U A;  2V6Z M;  2F4V M;  2YQZ A;  2JY6 B;  2QEN A;  4JN6 A;  4F2L A;  2Y21 A;  5KPT A;  1N34 M;  3D8B A;  3VFD A;  4GKJ M;  5EXT A;  1XMO M;  3IEC A;  1QYR A;  4JYA M;  2ERC A;  4DBG B;  5IWA M;  2DZO B;  3C3D A;  4FVM A;  4PD2 A;  2LBC A;  5BR8 M;  1OFI A;  2ZBK B;  4LJ5 A;  3C9P A;  2M60 A;  1TR8 A;  2JZ1 A;  2A5Y B;  2HCB A;  1IY0 A;  3ILK A;  4AKG A;  1IN7 A;  1Q3C A;  5IRE B;  1GKI A;  2C99 A;  1C7Y A;  2JZ0 A;  3VK8 A;  5FTK A;  4MB7 A;  1XWI A;  2CP8 A;  4ITQ A;  1PJI A;  1DO2 A;  2P5T A;  3GLG E;  1ZMV A;  4FWG A;  1Q3B A;  2DHY A;  2XSZ A;  3MJ5 A;  1SXJ D;  3HHW A;  1L2C A;  4LFB M;  3I51 A;  5EQT A;  2VDB B;  2LHG A;  3J81 S;  3W0F A;  3LCV B;  3HHY A;  1OAO C;  4FCT A;  1QAM A;  3AKZ A;  2DWM A;  2E5L M;  2MR9 A;  2KNZ A;  2FNA A;  3VK7 A;  2C5R A;  2W82 A;  2MGW A;  2XEP A;  2KEB A;  4RF1 A;  5IT9 S;  4K0K M;  3K2L A;  3PNY A;  2HHH M;  1YLA A;  5FTN A;  2XFS A;  3GLI A;  3GRR A;  4XBO A;  2JUJ A;  1WHC A;  3TPZ A;  2J7N A;  1HNX M;  1QQW A;  4B3M M;  3GLH E;  3GLG A;  1Z5C A;  2D7E A;  4GIT A;  4DV7 M;  4X66 M;  3U6O A;  4NRV A;  3LQR A;  4LRS A;  2EA0 A;  3HHX A;  3TQS A;  4L4U A;  4DV1 M;  4LJ8 A;  3HU3 A;  3MHV C;  4JI8 M;  1GO5 A;  3RFW A;  3GQ3 A;  4B3T M;  3WHL A;  3ZC7 B;  4JI5 M;  4MGH A;  4DR7 M;  4FCV A;  1N75 A;  2LH0 A;  3QWL A;  2I7N A;  4XK8 F;  4YY3 M;  1TH2 A;  1Z5A A;  3SAW A;  1YSY A;  1XMQ M;  2F5N A;  1XNQ M;  2DAI A;  4KO8 A;  4GIP A;  4IBD A;  2RKO A;  3U6Q A;  5H37 D;  1TH3 A;  2OOB A;  3BOS A;  4LY6 A;  4KLN A;  4KT0 F;  2OO9 A;  3KOX E;  4LRT A;  1IN5 A;  1VQ1 A;  3HKP A;  3RE8 A;  2KA6 B;  1V34 A;  2C9C A;  1OKS A;  2G3Q A;  2G8L A;  3GLH B;  3E46 A;  4FCW A;  4QNM A;  1QAQ A;  1D0M A;  4R3D A;  4IJE A;  1D0L A;  4EIW A;  4REZ A;  4LG2 A;  1DGG A;  2JY8 A;  2UUB M;  3U5Z A;  4NL4 H;  4M9Z A;  4M0D A;  3GLF E;  2WZJ A;  2FS1 A;  4G4R A;  2MJ5 B;  2K0B X;  3U6P A;  4AKH A;  5KQD A;  2X8A A;  3LW5 F;  5EXS A;  2JWS A;  1HT1 E;  3HU1 A;  5DFL A;  1PRB A;  2K9D A;  4LJ9 A;  3SAT A;  3FTE A;  4LF8 M;  4JXJ A;  4WUR A;  4OX9 M;  3GPU A;  2CE7 A;  1NSF A;  1QAO A;  1T43 A;  1MN3 A;  1E9S A;  2QP9 X;  4IBK A;  4CIZ A;  4Z6Y A;  3KOY E;  1AUA A;  1IN6 A;  2L7I A;  4YHH M;  3FTD A;  1H6U A;  2LWX A;  1G59 A;  4IBC A;  2I7P A;  1HQC A;  1YUB A;  5ITX E;  3PNV A;  4TUW A;  2BWE A;  3DA1 A;  2XSZ D;  4RNA A;  4BLC A;  1WR1 B;  4DR5 M;  3VKH A;  4G6Z A;  3GLF A;  3QYB A;  4LF7 M;  3AOE A;  1NHG C;  3H4J A;  3SFZ A;  4DV5 M;  3TL4 X;  4HLQ A;  4L15 A;  3U61 A;  1IY1 A;  1NHW C;  1HJP A;  1SXJ B;  2R44 A;  2YFQ A;  2R46 A;  4LZZ A;  5KPZ A;  4MGK E;  3U60 B;  4JI2 M;  4AKI A;  2QQ8 A;  4LJ4 A;  2D7H A;  2JY5 A;  1SG9 A;  1V92 A;  1GVN A;  3U6S A;  2QBY B;  2JP7 A;  1GLN A;  1WGN A;  2JA2 A;  4ANR A;  2UXC M;  1R7R A;  3TWL A;  4DR1 M;  5EXX A;  1QZM A;  1OJL A;  3VDU A;  2HL7 A;  4B7G A;  2GQF A;  5EP4 A;  2KXE A;  1K3W A;  3W67 A;  1QZE A;  3AOG A;  5ITX A;  1G3I A;  3B89 A;  2EO2 A;  2L2D A;  4DR4 M;  1S3S A;  3AV0 A;  3TE6 A;  3CF0 A;  2KNV A;  3AFH A;  1IY2 A;  4IJF A;  1TH4 A;  3Q8G A;  4WP2 A;  2L6O A;  3MK6 A;  2Y0T A;  5E6J A;  1QUS A;  4JI6 M;  2WSC F;  3K8Z A;  2O25 A;  4AZF A;  3B9P A;  4KHP M;  2FFJ A;  1HNW M;  2XZU A;  3BBZ A;  4LJA A;  1L1T A;  4S12 A;  3PXG A;  4GC9 A;  5FSW A;  2KDL A;  4I4L A;  2ZTC A;  2RGH A;  3FYD A;  4M0W A;  2R45 A;  4IBJ A;  3ZQJ A;  1QAN A;  5JI2 E;  4MH0 E;  2R65 A;  3KFU G;  1Y8G A;  5F3W A;  3FUW A;  1JB0 F;  3GRU A;  4II7 A;  3A98 B;  5DYG A;  2QNJ A;  1ZMW A;  4CJ6 A;  2J7O A;  4GHA A;  2D7G A;  4NOO B;  1OIZ A;  4KOD A;  1QDR A;  2Y20 A;  3SAU A;  3M7G A;  3THG A;  2R18 A;  1PJQ A;  2CV1 A;  3F92 A;  1Q02 A;  3LCU A;  2RGO A;  1FNN A;  1IFY A;  3AOE C;  4I8O A;  5DNY A;  1DGB A;  1TGU A;  3WHK A;  3KS4 A;  3AL0 C;  2KZS A;  4P16 A;  3B7Z A;  4XGI A;  2O01 F;  1R2Z A;  1J09 A;  1R2Y A;  3B7N A;  3HJQ A;  1DO0 A;  3CTW B;  1RU3 A;  2C98 A;  3FRI A;  5GKN A;  4DV3 M;  2Z4S A;  3C58 A;  2J5Y A;  2DVW B;  4QOS A;  1X37 A;  4UN2 B;  2DWN A;  3R9X B;  1JR3 E;  1ORY B;  1ZV1 A;  2MRO B;  3U6E A;  2DXI A;  1K3X A;  4PCZ A;  3E9S A;  2X49 A;  4L8R C;  2OQ4 A;  1WGL A;  1VDD A;  4GC5 A;  4LZJ A;  4LFA M;  1DGF A;  4JI3 M;  3U6C A;  1I94 M;  4B3R M;  2DHR A;  1TF0 B;  4GH9 A;  4JV5 M;  4WW0 A;  3T15 A;  3KS8 A;  2CHQ A;  2BJW A;  2YNM D;  4DR2 M;  5ITQ A;  2R4E A;  3PFI A;  2UXB M;  2HKJ A;  4M9S A;  4I5S A;  2LNH C;  2QHO B;  2F5O A;  4NSR A;  1R5L A;  1KFV A;  1ZAE A;  2CUZ A;  3VDP A;  4IIW A;  1DGH B;  3GLH A;  5EP3 A;  4BB9 A;  3Q8X A;  1JR3 A;  4LF9 M;  1WIV A;  3MMP A;  4LJ7 A;  4FWD A;  3TWK A;  4HEO A;  1AIP C;  2HAK A;  1NY6 A;  2L7H A;  1NY5 A;  3IHP A;  2AHM A;  4GKK M;  1VG5 A;  3SMS A;  3J2P B;  3T6P A;  2F5S A;  2DNA A;  2VQE M;  1PGY A;  1SXJ E;  3NWL A;  4LGM A;  1OAI A;  1N78 A;  3NBI A;  1W5T A;  2CRU A;  2UXD M;  2APL A;  1IXS B;  2KRK A;  1MJG M;  4G4Q A; 
#chains in the Genus database with same CATH homology
 1VDL A;  4DBG B;  2RRU A;  3K9P A;  1XB2 B;  1SG9 A;  1V92 A;  2JY5 A;  2LBC A;  2JP7 A;  1UFZ A;  1TR8 A;  1WGN A;  2DEN A;  2JZ1 A;  1T6O A;  1C7Y A;  2JZ0 A;  3E21 A;  1QZE A;  2CP8 A;  1DV0 A;  1G3I A;  1HT2 E;  3B89 A;  1DO2 A;  2L2D A;  3GLG E;  1ZMV A;  2OOA A;  2DHY A;  4GEW A;  1IXS A;  2EJS A;  2KNV A;  1OQY A;  2LVA A;  3LCV B;  2CWB A;  4WP2 A;  1NV8 A;  2MR9 A;  1R4G A;  2EKF A;  2KNZ A;  2O25 A;  2MGW A;  3BBZ A;  1P3Q Q;  1YLA A;  2DI0 A;  2ZTC A;  2HWJ A;  2JUJ A;  1WHC A;  5JI2 E;  3GLH E;  1OTR A;  1Y8G A;  2DAK A;  2QNJ A;  1ZMW A;  1VEG A;  1GO5 A;  2DZL A;  1KYI A;  2ZTD A;  3F92 A;  1Q02 A;  1A5T A;  3LCU A;  1IFY A;  1F4I A;  2DAI A;  2LVP C;  1ZMU A;  2BWB A;  2LVQ D;  2DAE A;  1VEK A;  2LTU A;  1VEJ A;  2OOB A;  2QSF X;  1HQY E;  2DAG A;  2OO9 A;  1XXH E;  1DO0 A;  2EKK A;  2B3T A;  3FRI A;  2DKL A;  1VQ1 A;  4UN2 B;  1JR3 E;  1ZV1 A;  2G3Q A;  2MRO B;  1OKS A;  3E46 A;  2DAM A;  2R0I A;  3FRH A;  1WGL A;  2JY8 A;  2LVN C;  3GLF E;  2WZJ A;  1IM2 A;  2MJ5 B;  2K0B X;  2KNA A;  3FE3 A;  1HT1 E;  5DFL A;  1G4A E;  2K9D A;  2QHO B;  1EFU B;  4F1I A;  4G3O A;  2L4E A;  2JNH A;  2LVO C;  1T43 A;  1MN3 A;  2KHH A;  1BVS A;  3GLI E;  3K9O A;  1TTE A;  1E94 E;  1WIV A;  3MMP A;  4HEO A;  1AIP C;  2HAK A;  2L4F A;  1NV9 A;  4Q7J A;  2H5X A;  2BWE A;  4R71 A;  1WR1 B;  3IHP A;  2JY7 A;  1VG5 A;  3T6P A;  2JY6 B;  1CUK A;  2DNA A;  3H4J A;  1PGY A;  1OAI A;  4F2L A;  1WJ7 A;  1HJP A;  1G41 A;  3IEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...