2JY8A

Nmr structure of the ubiquitin associated (uba) domain of p62 (sqstm1) in complex with ubiquitin. rdc refined
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
52
structure length
52
Chain Sequence
GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ubiquitin Recognition by the Ubiquitin-associated Domain of p62 Involves a Novel Conformational Switch
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin-binding protein p62
total genus 4
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2007-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2jy8A00
1ZV1A 2EKFA 1G3IA 4Q7JA 1YLAA 2JNHA 1A5TA 1VEJA 4HEOA 2CP8A 2LVNC 1WJ7A 1IFYA 1DV0A 1HQYE 1MN3A 3GLGE 2DAKA 2OOAA 1OKSA 3FE3A 1KYIA 2LVPC 2ZTCA 1WIVA 3K9OA 1BVSA 2CWBA 2MJ5B 2ZTDA 2DI0A 1IM2A 1IXSA 3IHPA 1XB2B 1R4GA 1Y8GA 1UFZA 2JP7A 2H5XA 4WP2A 2HWJA 1G4AE 2JY6B 3LCVB 1VEKA 1JR3E 2B3TA 1T43A 2DZLA 3LCUA 2DKLA 4F1IA 3GLHE 1AIPC 1C7YA 3E21A 1F4IA 3MMPA 2KNZA 2DNAA 1G41A 1ZMUA 2OO9A 2QNJA 1HT1E 4G3OA 1GO5A 2DENA 2HAKA 5JI2E 2LVAA 3FRHA 2OOBA 1XXHE 3GLIE 1WGNA 1HT2E 1DO0A 3F92A 2LVOC 2MR9A 1VDLA 1T6OA 1TR8A 2DAMA 2JZ0A 2L4FA 1EFUB 2BWBA 2LBCA 4GEWA 3GLFE 1SG9A 4R71A 2LTUA 1NV9A 1OAIA 2KHHA 3IECA 2L2DA 2EKKA 1P3QQ 2JY8A 1WGLA 1OTRA 2LVQD 3H4JA 1DO2A 1ZMWA 2K0BX 2KNAA 3E46A 5DFLA 4DBGB 1TTEA 1ZMVA 2RRUA 1E94E 2QSFX 2DAGA 2DAEA 2JY5A 3K9PA 4F2LA 1WR1B 1QZEA 2DHYA 2BWEA 1OQYA 3T6PA 1VEGA 2L4EA 1NV8A 2JY7A 2O25A 3B89A 3FRIA 2EJSA 2JZ1A 2G3QA 1V92A 2K9DA 1PGYA 2JUJA 1WHCA 2MROB 4UN2B 1VQ1A 1VG5A 2KNVA 2R0IA 1HJPA 1Q02A 3BBZA 2DAIA 1CUKA 2WZJA 2MGWA 2QHOB
chains in the Genus database with same CATH superfamily
4LF7M 1K3XA 3T15A 1Z5CA 3D8LA 2VF7A 2XSZD 3K8ZA 4L16A 4DR3M 4GH9A 2EKFA 3AKZA 3FTEA 4G4QA 1YLAA 3L29A 3MHVC 2ZM6M 3HWSA 1XXHA 2QENA 4HEOA 3PFIA 4LF6M 4G4NA 2R46A 1UM8A 1DV0A 2F5OA 3GLGE 1TDHA 2C99A 3A45A 3I51A 2FNAA 1DGBA 1IBKM 1IY2A 1FJGM 1N33M 3FUXA 4DV2M 3J27B 4K0KM 1HNXM 4B08A 3FE3A 4B3SM 4IBGA 1QDTA 3Q8GA 3QYBA 4MM3B 2KZSA 1PRBA 4FCWA 2LNHC 4B3TM 1E9RA 3J80S 2Z4RA 1JR3A 3HU2A 4GHLA 2ZTDA 4MGZE 2DI0A 2L6OA 3AFHA 1IM2A 4IJEA 4FCVA 1IXSA 5FLXS 2LH0A 3DZDA 3L25A 1R4GA 1PJJA 3KFUG 2OQ4A 3JAMS 2JP7A 4Z6YA 2Z4SA 3H4MA 4PT5A 3GQ3A 5EXSA 2H1RA 3KP1E 3U6SA 2C98A 3DOAA 2B3TA 3BXWA 1SXJA 2CRUA 1GJSA 5GKNA 5EP3A 2DKLA 2KRUA 4IBIA 2XFTA 1NVMA 4HL4A 2F5QA 2FE8A 3LW5F 4NXMM 2X4AA 5ITTA 1L2CA 3SAUA 2A5YB 3KOWE 2KNZA 3THGA 1W5SA 1ZMUA 3CTWB 4MB7A 1GJTA 2XFSA 1D0MA 3B7ZA 2EA0A 3VK8A 4MGKE 2NQ8C 2LVAA 3SAWA 1QANA 2KZUA 1XXHE 2XZUA 1XHBA 2R18A 2HCBA 3D8BA 3SASA 4X65M 2QCUA 1X37A 3PNYA 3F92A 4QNMA 2G8LA 2CHQA 1T6OA 2QBYB 1SXJB 2JZ0A 2F5PA 3K1JA 5E26A 1E32A 3SFZA 1GL6A 1OAIA 4S12A 3B9PA 1D0KA 4JI6M 3NWLA 2EKKA 3TWKA 1WGLA 1TH4A 5BPVA 2R4EA 4LGMA 2LVQD 1D2NA 1DO2A 1QAMA 1IXRC 4QOZC 2JWSA 2C5RA 3PXGA 3J7BA 4EIWA 2RRUA 1PJQA 4D82A 3FTCA 1XMOM 1N36M 2QQ8A 3I01M 1VDDA 4NSRA 2LHGA 1TH3A 3I4YA 4MGIE 1E9SA 3UK6A 1JQJC 1XWIA 4G6ZA 4JI0M 3U60A 1IBMM 2L7HA 3W0FA 3GLFB 3LQRA 2GNOA 1FNNA 2G3QA 1H6UA 1V92A 1IN6A 1SXJD 2R65A 1Z6TA 5LMNM 3J2PB 4Z8XA 1XXHB 1DGHA 4M0DA 2CUZA 1QAOA 2QPAA 3TL4X 1N75A 4AZFA 4JI8M 2K6BA 4LZZA 5EQTA 5FTNA 3GRUA 1PJSA 5DYIA 1CUKA 4GIPA 3RE8A 3E9SA 2MGWA 3TWMA 3W68A 4RF1A 5KPZA 3GLFA 1OIPA 4DV0M 2I7NA 4M9XA 2L09A 2DXIA 5FTLA 1HQCA 4GITA 2DHRA 3L26A 3SATA 1NNJA 3SARA 1JB0F 1VEJA 3NBIA 1L1ZA 2KDLA 2HKJA 2LVNC 3FUWA 3WHLA 4DUYM 4R3DA 2KXEA 1HQYE 2D7HA 2X49A 2CV2A 4DR5M 4NC6A 2JXNA 1J7KA 1OKSA 4LJ4A 4M9SA 4NRVA 3EIHA 2DZNB 2DWMA 1C1KA 3LMMA 4DR6M 1KYIA 2R4JA 3K9OA 3TWLA 2L7IA 4YY3M 4I81A 5KO3A 2I7PA 1YSYA 3WHKA 1GKIA 2YR0A 3U6OA 3FTDA 4AKGA 4PDGA 3HU3A 1L8QA 1XB2B 2CHVA 3C9PA 2ZAMA 4FCTA 3L27A 4LRSA 3E4RA 3HJ8A 4WP2A 2HWJA 1KSFX 3VFDA 4OX9M 2C9OA 3VDUA 3LCVB 2V1UA 5ITXE 1VEKA 2KW0A 8CATA 4FVMA 1I94M 1T43A 3PVSA 5DYGA 3J81S 2LXEA 1WXQA 1LTMA 3GLHE 1AIPC 5EJCA 3UGJA 2CHGA 5FTMA 5EXXA 2OO9A 4JI7M 4QHSA 4BB9A 1NO1A 3K2LA 3MK6A 4IJFA 2QNJA 4W5WA 3W67A 4DV4M 3SYLA 4KT0F 3C58A 1DGGA 2OPFA 2ERCA 1L2BA 2OOBA 5F3WA 3GLIE 1WGNA 4IBCA 4L4UA 3FUTA 4QOSA 3SC3A 1HNZM 1QVRA 3SHGB 3GLFE 1EFUB 4LGYA 4G4OA 3FYDA 4LRTA 4LFBM 1NV9A 3VK7A 4NSOB 2KHHA 3QAUA 4IBDA 4WW0A 3SMSA 3GLGB 1TGUA 2YNMD 1TDZA 3GP1A 2M60A 2DWLA 4LF5M 4LG2A 4PD2A 3E46A 5DFLA 4CHTB 2LWXA 1ZMVA 4B7FA 4FW9A 4DV6M 2HHHM 1E94E 1TH2A 2QSFX 1IBLM 3K9PA 3UJNA 4GC5A 3ZCBB 1WR1B 3VLFB 1OFHA 2APLA 1G59A 1VEGA 4KO8A 2L4EA 1NV8A 2XF3A 1G71A 2O25A 3FRIA 2EJSA 1R2YA 4FD2A 2JZ1A 4ZPXA 2K9DA 3KOYE 3B7QA 2DVWB 4P17A 4LFAM 3R8FA 4MH0E 4G4RA 1RU3A 2J7OA 1NY5A 1QQWA 2MROB 4JI2M 2UXBM 3KXEC 2MH8A 2VIIA 4REZA 1SXJC 1GLNA 3UZUA 1QZMA 3GPUA 2D7GA 4NOOB 1OAOC 5FSWA 1IQPA 2E5LM 3BBZA 2WZJA 3AOGA 3GQ5A 1N77A 4LF8M 4NRWA 2QHOB 3IHPA 3FKEA 4L15A 4OVZB 5EP2A 4AG6A 3J7AS 3JR4A 1ZV1A 3T38A 5EXPA 3DA1A 1MX0A 2XEPA 4NL4H 4P16A 3SYKA 2Q2EB 4DV3M 3B7NA 1PJIA 3R9XB 2KRKA 2XLJA 3PNVA 4L78A 2CP8A 3NBXX 1NHGC 1WJ7A 3MJ5A 1PM5A 4CISA 1IFYA 3VKGA 4MGYE 3A42A 4LJ8A 1MN3A 4XK8F 4RNAA 1K3WA 2YQZA 2DWZB 2OOAA 3KW6A 1Z5AA 3SMPA 4LJ5A 3UMMA 4JXJA 2BNKA 3U6QA 4OVZA 3RGSA 3GQ4A 4LJAA 2N35A 4LJ7A 5A2QS 2FOIC 2LVPC 2ZTCA 1R2ZA 2EO2A 2FFJA 2D7EA 3K92A 2UUBM 2DWNA 3GO8A 4KODA 3TQSA 2WSCF 3GRVA 3IG8A 3U6DA 1PJTA 4DV5M 4ITQA 3AJIB 1J5EM 1Y8GA 1IXSB 2H5XA 2R62A 3I4VA 4QNRA 4RF0A 5E6JA 4JI4M 4DUZM 3HY5A 1G4AE 2F4VM 4IBFA 4B3RM 1YUBA 1JR3E 2O5RA 3BOSA 2X8AA 1EE8A 4CGYB 1L2DA 3I04M 3LCUA 4BBAA 4F1IA 1IXZA 2GQFA 4DR1M 2CV0A 4I4LA 1R6BX 4B3MM 1SXJE 1IN5A 5KPRA 3MMPA 5FTKA 3OTOM 3EIEA 3IG5A 2Y0QA 3KS8A 3AV0A 3U6PA 2YFQA 3AL0C 4JI3M 4GC9A 5ITRA 1GO5A 3U6CA 2HAKA 3Q8XA 1Q3CA 5JI2E 2ZANA 3FRHA 3HHWA 4DV1M 3AOEA 3SHFA 1I4WA 1T3TA 5H37D 5L8RF 1GABA 2LVOC 1VDLA 4M9ZA 4Y28F 1TR8A 2AHMA 1G8PA 4AW4A 1Z59A 1MU5A 3JR5A 3GLHB 1ZAEA 1QYRA 3HX3A 1Z5BA 4OU7A 3U61B 3U61A 2KA6B 3IECA 2L2DA 4OW0A 2JY8A 2DZOB 4B7HA 1MJGM 3GLGA 3T1YM 4TUWA 3KVWA 3VKHA 1OTRA 2J5YA 3ZQJA 3CF6E 2KNAA 3HHZA 1AUAA 2BJWA 4IBKA 1R5LA 4LZJA 4CIZA 1DGFA 4AQYM 2QP9X 4PDIA 3M7GA 2WSEF 3CF0A 1QUTA 3RFWA 3U60B 2W82A 3HHXA 1J09A 3HGIA 4F2LA 1QZEA 3GPXA 3DFZA 2BWEA 1OQYA 3T6PA 2RGOA 3C3DA 2JY7A 1HNWM 1KFVA 2UUAM 4PCZA 3TPZA 2LHCA 4IBBA 3LQQA 2JUJA 2V6ZM 2O01F 4AG5A 4LFCM 4R7GA 2Z7JA 2VQFM 1HR0M 1V34A 4M0WA 4AI6A 4I5SA 2R44A 4D81A 3LVWA 3HJSA 5ITUA 4GMQA 2QBYA 2KNVA 4DR4M 4FWGA 1HJPA 3KS4A 2DAIA 1GL7A 2V1CA 2CFOA 4JYAM 1JR3D 3GPPA 2HL7A 2P5TA 1ORYB 3KSXA 5KQDA 1OIZA 3A46A 1G3IA 4Q7JA 1EIJA 2JNHA 4FWHA 1IN4A 1S3SA 3GLIA 1A5TA 2C9CA 2QZ4A 3FD9A 1N34M 1D0LA 3V76A 5C1BA 3B74A 3ZH9B 5IZ7D 1YE9A 2XGNA 2DAKA 2VDBB 3CF2A 1V33A 2KEBA 3HU1A 1N32M 4CJ6A 3KP0E 4HLQA 3HHYA 5BR8M 3C3EA 1NY6A 5ITYA 4AKIA 1WIVA 3L28A 1BVSA 4JI5M 4IIWA 2F5SA 2Y20A 2CWBA 1OJLA 4AKHA 2MJ5B 3HKPA 1DGHB 4LCBA 3KDSE 4IBJA 5DNYA 3RGPA 5LMUM 1L1TA 2CE7A 1NJFA 5EP1A 4GHAA 3U5ZB 1UFZA 3GRYA 5EXTA 2XSZA 3HJQA 3QYEA 3KOZE 4LJ9A 5C18A 3U6MA 2Z8YM 4RKUF 2Y21A 4XBOA 2JY6B 3FUUA 1R7RA 4NXNM 2UXDM 2K47A 4LY6A 4D80A 2DZLA 3GLHA 2RKOA 1NSFA 4DV7M 1C7YA 3E21A 1F4IA 4GKKM 4JI1M 4I8OA 5ITXA 4DR7M 1XC8A 2DNAA 1G41A 2G5GX 5IREB 3U5ZA 1HT1E 4G3OA 1XNRM 2DENA 4BLCA 3M0EA 2JA2A 3KOXE 3TE6A 3ILKA 2UU9M 3ZC7B 2UXCM 1HT2E 3KSJA 3U6LA 3L2AA 1LV7A 1DO0A 2CV1A 5JI3E 1QAQA 2MR9A 3FYCA 4II7A 4WURA 2DAMA 2L4FA 4GEWA 3FUVA 2BWBA 2LBCA 4IBEA 2WSFF 4LJ6A 1XNQM 1SG9A 4R71A 2LTUA 2XH9A 3T1HM 2BJVA 2FS1A 4XGIA 1P3QQ 1W5TA 1NJGA 1IN7A 4X62M 2XZFA 3GPYA 4MGHA 3CGWA 4LF4M 3VDPA 4L8RC 4GKJM 3H4JA 5FTJA 1ZMWA 2F5NA 2K0BX 1QUSA 3A98B 3SAVA 4JV5M 2R45A 4DBGB 1TTEA 5EP4A 4B7GA 4LF9M 3AOEC 2DAGA 2DAEA 2JY5A 3SBJA 4DR2M 4KHPM 1GVNA 2Y0TA 4FWDA 1Q3BA 4X66M 2R6FA 3FTFA 3LVVA 3W0LB 7CATA 2DHYA 2CEAA 2FH0A 2ZAOA 3M6AA 5ITQA 3HZJA 5KPTA 5KQ8A 4ANRA 2VQEM 2Z3XA 3B89A 4QHTA 5IT9S 2J7NA 1Q39A 1IY1A 1PGYA 3GLIB 4JN6A 1OFIA 1ZQ9A 5IWAM 1WHCA 1NHWC 4L6V6 4UN2B 2VF8A 3QWLA 1K82A 1N78A 4X64M 1QDRA 1VQ1A 2RGHA 4GRIA 4YHHM 4KLNA 1VG5A 1IN8A 2EUCA 1TF0B 3GRRA 2UUCM 1IY0A 1NNUC 1XMQM 3U6EA 2ZBKB 2R0IA 2C96A 1Q02A 2M5ZA 4A3VB
chains in the Genus database with same CATH topology
1ZV1A 2EKFA 1G3IA 4Q7JA 1YLAA 2JNHA 1A5TA 1VEJA 4HEOA 2CP8A 2LVNC 1WJ7A 1IFYA 1DV0A 1HQYE 1MN3A 3GLGE 2DAKA 2OOAA 1OKSA 3FE3A 1KYIA 2LVPC 2ZTCA 1WIVA 3K9OA 1BVSA 2CWBA 2MJ5B 2ZTDA 2DI0A 1IM2A 1IXSA 3IHPA 1XB2B 1R4GA 1Y8GA 1UFZA 2JP7A 2H5XA 4WP2A 2HWJA 1G4AE 2JY6B 3LCVB 1VEKA 1JR3E 2B3TA 1T43A 2DZLA 3LCUA 2DKLA 4F1IA 3GLHE 1AIPC 1C7YA 3E21A 1F4IA 3MMPA 2KNZA 2DNAA 1G41A 1ZMUA 2OO9A 2QNJA 1HT1E 4G3OA 1GO5A 2DENA 2HAKA 5JI2E 2LVAA 3FRHA 2OOBA 1XXHE 3GLIE 1WGNA 1HT2E 1DO0A 3F92A 2LVOC 2MR9A 1VDLA 1T6OA 1TR8A 2DAMA 2JZ0A 2L4FA 1EFUB 2BWBA 2LBCA 4GEWA 3GLFE 1SG9A 4R71A 2LTUA 1NV9A 1OAIA 2KHHA 3IECA 2L2DA 2EKKA 1P3QQ 2JY8A 1WGLA 1OTRA 2LVQD 3H4JA 1DO2A 1ZMWA 2K0BX 2KNAA 3E46A 5DFLA 4DBGB 1TTEA 1ZMVA 2RRUA 1E94E 2QSFX 2DAGA 2DAEA 2JY5A 3K9PA 4F2LA 1WR1B 1QZEA 2DHYA 2BWEA 1OQYA 3T6PA 1VEGA 2L4EA 1NV8A 2JY7A 2O25A 3B89A 3FRIA 2EJSA 2JZ1A 2G3QA 1V92A 2K9DA 1PGYA 2JUJA 1WHCA 2MROB 4UN2B 1VQ1A 1VG5A 2KNVA 2R0IA 1HJPA 1Q02A 3BBZA 2DAIA 1CUKA 2WZJA 2MGWA 2QHOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZV1 A;  2EKF A;  1G3I A;  4Q7J A;  1YLA A;  2JNH A;  1A5T A;  1VEJ A;  4HEO A;  2CP8 A;  2LVN C;  1WJ7 A;  1IFY A;  1DV0 A;  1HQY E;  1MN3 A;  3GLG E;  2DAK A;  2OOA A;  1OKS A;  3FE3 A;  1KYI A;  2LVP C;  2ZTC A;  1WIV A;  3K9O A;  1BVS A;  2CWB A;  2MJ5 B;  2ZTD A;  2DI0 A;  1IM2 A;  1IXS A;  3IHP A;  1XB2 B;  1R4G A;  1Y8G A;  1UFZ A;  2JP7 A;  2H5X A;  4WP2 A;  2HWJ A;  1G4A E;  2JY6 B;  3LCV B;  1VEK A;  1JR3 E;  2B3T A;  1T43 A;  2DZL A;  3LCU A;  2DKL A;  4F1I A;  3GLH E;  1AIP C;  1C7Y A;  3E21 A;  1F4I A;  3MMP A;  2KNZ A;  2DNA A;  1G41 A;  1ZMU A;  2OO9 A;  2QNJ A;  1HT1 E;  4G3O A;  1GO5 A;  2DEN A;  2HAK A;  5JI2 E;  2LVA A;  3FRH A;  2OOB A;  1XXH E;  3GLI E;  1WGN A;  1HT2 E;  1DO0 A;  3F92 A;  2LVO C;  2MR9 A;  1VDL A;  1T6O A;  1TR8 A;  2DAM A;  2JZ0 A;  2L4F A;  1EFU B;  2BWB A;  2LBC A;  4GEW A;  3GLF E;  1SG9 A;  4R71 A;  2LTU A;  1NV9 A;  1OAI A;  2KHH A;  3IEC A;  2L2D A;  2EKK A;  1P3Q Q;  2JY8 A;  1WGL A;  1OTR A;  2LVQ D;  3H4J A;  1DO2 A;  1ZMW A;  2K0B X;  2KNA A;  3E46 A;  5DFL A;  4DBG B;  1TTE A;  1ZMV A;  2RRU A;  1E94 E;  2QSF X;  2DAG A;  2DAE A;  2JY5 A;  3K9P A;  4F2L A;  1WR1 B;  1QZE A;  2DHY A;  2BWE A;  1OQY A;  3T6P A;  1VEG A;  2L4E A;  1NV8 A;  2JY7 A;  2O25 A;  3B89 A;  3FRI A;  2EJS A;  2JZ1 A;  2G3Q A;  1V92 A;  2K9D A;  1PGY A;  2JUJ A;  1WHC A;  2MRO B;  4UN2 B;  1VQ1 A;  1VG5 A;  2KNV A;  2R0I A;  1HJP A;  1Q02 A;  3BBZ A;  2DAI A;  1CUK A;  2WZJ A;  2MGW A;  2QHO B; 
#chains in the Genus database with same CATH topology
 4LF7 M;  1K3X A;  3T15 A;  1Z5C A;  3D8L A;  2VF7 A;  2XSZ D;  3K8Z A;  4L16 A;  4DR3 M;  4GH9 A;  2EKF A;  3AKZ A;  3FTE A;  4G4Q A;  1YLA A;  3L29 A;  3MHV C;  2ZM6 M;  3HWS A;  1XXH A;  2QEN A;  4HEO A;  3PFI A;  4LF6 M;  4G4N A;  2R46 A;  1UM8 A;  1DV0 A;  2F5O A;  3GLG E;  1TDH A;  2C99 A;  3A45 A;  3I51 A;  2FNA A;  1DGB A;  1IBK M;  1IY2 A;  1FJG M;  1N33 M;  3FUX A;  4DV2 M;  3J27 B;  4K0K M;  1HNX M;  4B08 A;  3FE3 A;  4B3S M;  4IBG A;  1QDT A;  3Q8G A;  3QYB A;  4MM3 B;  2KZS A;  1PRB A;  4FCW A;  2LNH C;  4B3T M;  1E9R A;  3J80 S;  2Z4R A;  1JR3 A;  3HU2 A;  4GHL A;  2ZTD A;  4MGZ E;  2DI0 A;  2L6O A;  3AFH A;  1IM2 A;  4IJE A;  4FCV A;  1IXS A;  5FLX S;  2LH0 A;  3DZD A;  3L25 A;  1R4G A;  1PJJ A;  3KFU G;  2OQ4 A;  3JAM S;  2JP7 A;  4Z6Y A;  2Z4S A;  3H4M A;  4PT5 A;  3GQ3 A;  5EXS A;  2H1R A;  3KP1 E;  3U6S A;  2C98 A;  3DOA A;  2B3T A;  3BXW A;  1SXJ A;  2CRU A;  1GJS A;  5GKN A;  5EP3 A;  2DKL A;  2KRU A;  4IBI A;  2XFT A;  1NVM A;  4HL4 A;  2F5Q A;  2FE8 A;  3LW5 F;  4NXM M;  2X4A A;  5ITT A;  1L2C A;  3SAU A;  2A5Y B;  3KOW E;  2KNZ A;  3THG A;  1W5S A;  1ZMU A;  3CTW B;  4MB7 A;  1GJT A;  2XFS A;  1D0M A;  3B7Z A;  2EA0 A;  3VK8 A;  4MGK E;  2NQ8 C;  2LVA A;  3SAW A;  1QAN A;  2KZU A;  1XXH E;  2XZU A;  1XHB A;  2R18 A;  2HCB A;  3D8B A;  3SAS A;  4X65 M;  2QCU A;  1X37 A;  3PNY A;  3F92 A;  4QNM A;  2G8L A;  2CHQ A;  1T6O A;  2QBY B;  1SXJ B;  2JZ0 A;  2F5P A;  3K1J A;  5E26 A;  1E32 A;  3SFZ A;  1GL6 A;  1OAI A;  4S12 A;  3B9P A;  1D0K A;  4JI6 M;  3NWL A;  2EKK A;  3TWK A;  1WGL A;  1TH4 A;  5BPV A;  2R4E A;  4LGM A;  2LVQ D;  1D2N A;  1DO2 A;  1QAM A;  1IXR C;  4QOZ C;  2JWS A;  2C5R A;  3PXG A;  3J7B A;  4EIW A;  2RRU A;  1PJQ A;  4D82 A;  3FTC A;  1XMO M;  1N36 M;  2QQ8 A;  3I01 M;  1VDD A;  4NSR A;  2LHG A;  1TH3 A;  3I4Y A;  4MGI E;  1E9S A;  3UK6 A;  1JQJ C;  1XWI A;  4G6Z A;  4JI0 M;  3U60 A;  1IBM M;  2L7H A;  3W0F A;  3GLF B;  3LQR A;  2GNO A;  1FNN A;  2G3Q A;  1H6U A;  1V92 A;  1IN6 A;  1SXJ D;  2R65 A;  1Z6T A;  5LMN M;  3J2P B;  4Z8X A;  1XXH B;  1DGH A;  4M0D A;  2CUZ A;  1QAO A;  2QPA A;  3TL4 X;  1N75 A;  4AZF A;  4JI8 M;  2K6B A;  4LZZ A;  5EQT A;  5FTN A;  3GRU A;  1PJS A;  5DYI A;  1CUK A;  4GIP A;  3RE8 A;  3E9S A;  2MGW A;  3TWM A;  3W68 A;  4RF1 A;  5KPZ A;  3GLF A;  1OIP A;  4DV0 M;  2I7N A;  4M9X A;  2L09 A;  2DXI A;  5FTL A;  1HQC A;  4GIT A;  2DHR A;  3L26 A;  3SAT A;  1NNJ A;  3SAR A;  1JB0 F;  1VEJ A;  3NBI A;  1L1Z A;  2KDL A;  2HKJ A;  2LVN C;  3FUW A;  3WHL A;  4DUY M;  4R3D A;  2KXE A;  1HQY E;  2D7H A;  2X49 A;  2CV2 A;  4DR5 M;  4NC6 A;  2JXN A;  1J7K A;  1OKS A;  4LJ4 A;  4M9S A;  4NRV A;  3EIH A;  2DZN B;  2DWM A;  1C1K A;  3LMM A;  4DR6 M;  1KYI A;  2R4J A;  3K9O A;  3TWL A;  2L7I A;  4YY3 M;  4I81 A;  5KO3 A;  2I7P A;  1YSY A;  3WHK A;  1GKI A;  2YR0 A;  3U6O A;  3FTD A;  4AKG A;  4PDG A;  3HU3 A;  1L8Q A;  1XB2 B;  2CHV A;  3C9P A;  2ZAM A;  4FCT A;  3L27 A;  4LRS A;  3E4R A;  3HJ8 A;  4WP2 A;  2HWJ A;  1KSF X;  3VFD A;  4OX9 M;  2C9O A;  3VDU A;  3LCV B;  2V1U A;  5ITX E;  1VEK A;  2KW0 A;  8CAT A;  4FVM A;  1I94 M;  1T43 A;  3PVS A;  5DYG A;  3J81 S;  2LXE A;  1WXQ A;  1LTM A;  3GLH E;  1AIP C;  5EJC A;  3UGJ A;  2CHG A;  5FTM A;  5EXX A;  2OO9 A;  4JI7 M;  4QHS A;  4BB9 A;  1NO1 A;  3K2L A;  3MK6 A;  4IJF A;  2QNJ A;  4W5W A;  3W67 A;  4DV4 M;  3SYL A;  4KT0 F;  3C58 A;  1DGG A;  2OPF A;  2ERC A;  1L2B A;  2OOB A;  5F3W A;  3GLI E;  1WGN A;  4IBC A;  4L4U A;  3FUT A;  4QOS A;  3SC3 A;  1HNZ M;  1QVR A;  3SHG B;  3GLF E;  1EFU B;  4LGY A;  4G4O A;  3FYD A;  4LRT A;  4LFB M;  1NV9 A;  3VK7 A;  4NSO B;  2KHH A;  3QAU A;  4IBD A;  4WW0 A;  3SMS A;  3GLG B;  1TGU A;  2YNM D;  1TDZ A;  3GP1 A;  2M60 A;  2DWL A;  4LF5 M;  4LG2 A;  4PD2 A;  3E46 A;  5DFL A;  4CHT B;  2LWX A;  1ZMV A;  4B7F A;  4FW9 A;  4DV6 M;  2HHH M;  1E94 E;  1TH2 A;  2QSF X;  1IBL M;  3K9P A;  3UJN A;  4GC5 A;  3ZCB B;  1WR1 B;  3VLF B;  1OFH A;  2APL A;  1G59 A;  1VEG A;  4KO8 A;  2L4E A;  1NV8 A;  2XF3 A;  1G71 A;  2O25 A;  3FRI A;  2EJS A;  1R2Y A;  4FD2 A;  2JZ1 A;  4ZPX A;  2K9D A;  3KOY E;  3B7Q A;  2DVW B;  4P17 A;  4LFA M;  3R8F A;  4MH0 E;  4G4R A;  1RU3 A;  2J7O A;  1NY5 A;  1QQW A;  2MRO B;  4JI2 M;  2UXB M;  3KXE C;  2MH8 A;  2VII A;  4REZ A;  1SXJ C;  1GLN A;  3UZU A;  1QZM A;  3GPU A;  2D7G A;  4NOO B;  1OAO C;  5FSW A;  1IQP A;  2E5L M;  3BBZ A;  2WZJ A;  3AOG A;  3GQ5 A;  1N77 A;  4LF8 M;  4NRW A;  2QHO B;  3IHP A;  3FKE A;  4L15 A;  4OVZ B;  5EP2 A;  4AG6 A;  3J7A S;  3JR4 A;  1ZV1 A;  3T38 A;  5EXP A;  3DA1 A;  1MX0 A;  2XEP A;  4NL4 H;  4P16 A;  3SYK A;  2Q2E B;  4DV3 M;  3B7N A;  1PJI A;  3R9X B;  2KRK A;  2XLJ A;  3PNV A;  4L78 A;  2CP8 A;  3NBX X;  1NHG C;  1WJ7 A;  3MJ5 A;  1PM5 A;  4CIS A;  1IFY A;  3VKG A;  4MGY E;  3A42 A;  4LJ8 A;  1MN3 A;  4XK8 F;  4RNA A;  1K3W A;  2YQZ A;  2DWZ B;  2OOA A;  3KW6 A;  1Z5A A;  3SMP A;  4LJ5 A;  3UMM A;  4JXJ A;  2BNK A;  3U6Q A;  4OVZ A;  3RGS A;  3GQ4 A;  4LJA A;  2N35 A;  4LJ7 A;  5A2Q S;  2FOI C;  2LVP C;  2ZTC A;  1R2Z A;  2EO2 A;  2FFJ A;  2D7E A;  3K92 A;  2UUB M;  2DWN A;  3GO8 A;  4KOD A;  3TQS A;  2WSC F;  3GRV A;  3IG8 A;  3U6D A;  1PJT A;  4DV5 M;  4ITQ A;  3AJI B;  1J5E M;  1Y8G A;  1IXS B;  2H5X A;  2R62 A;  3I4V A;  4QNR A;  4RF0 A;  5E6J A;  4JI4 M;  4DUZ M;  3HY5 A;  1G4A E;  2F4V M;  4IBF A;  4B3R M;  1YUB A;  1JR3 E;  2O5R A;  3BOS A;  2X8A A;  1EE8 A;  4CGY B;  1L2D A;  3I04 M;  3LCU A;  4BBA A;  4F1I A;  1IXZ A;  2GQF A;  4DR1 M;  2CV0 A;  4I4L A;  1R6B X;  4B3M M;  1SXJ E;  1IN5 A;  5KPR A;  3MMP A;  5FTK A;  3OTO M;  3EIE A;  3IG5 A;  2Y0Q A;  3KS8 A;  3AV0 A;  3U6P A;  2YFQ A;  3AL0 C;  4JI3 M;  4GC9 A;  5ITR A;  1GO5 A;  3U6C A;  2HAK A;  3Q8X A;  1Q3C A;  5JI2 E;  2ZAN A;  3FRH A;  3HHW A;  4DV1 M;  3AOE A;  3SHF A;  1I4W A;  1T3T A;  5H37 D;  5L8R F;  1GAB A;  2LVO C;  1VDL A;  4M9Z A;  4Y28 F;  1TR8 A;  2AHM A;  1G8P A;  4AW4 A;  1Z59 A;  1MU5 A;  3JR5 A;  3GLH B;  1ZAE A;  1QYR A;  3HX3 A;  1Z5B A;  4OU7 A;  3U61 B;  3U61 A;  2KA6 B;  3IEC A;  2L2D A;  4OW0 A;  2JY8 A;  2DZO B;  4B7H A;  1MJG M;  3GLG A;  3T1Y M;  4TUW A;  3KVW A;  3VKH A;  1OTR A;  2J5Y A;  3ZQJ A;  3CF6 E;  2KNA A;  3HHZ A;  1AUA A;  2BJW A;  4IBK A;  1R5L A;  4LZJ A;  4CIZ A;  1DGF A;  4AQY M;  2QP9 X;  4PDI A;  3M7G A;  2WSE F;  3CF0 A;  1QUT A;  3RFW A;  3U60 B;  2W82 A;  3HHX A;  1J09 A;  3HGI A;  4F2L A;  1QZE A;  3GPX A;  3DFZ A;  2BWE A;  1OQY A;  3T6P A;  2RGO A;  3C3D A;  2JY7 A;  1HNW M;  1KFV A;  2UUA M;  4PCZ A;  3TPZ A;  2LHC A;  4IBB A;  3LQQ A;  2JUJ A;  2V6Z M;  2O01 F;  4AG5 A;  4LFC M;  4R7G A;  2Z7J A;  2VQF M;  1HR0 M;  1V34 A;  4M0W A;  4AI6 A;  4I5S A;  2R44 A;  4D81 A;  3LVW A;  3HJS A;  5ITU A;  4GMQ A;  2QBY A;  2KNV A;  4DR4 M;  4FWG A;  1HJP A;  3KS4 A;  2DAI A;  1GL7 A;  2V1C A;  2CFO A;  4JYA M;  1JR3 D;  3GPP A;  2HL7 A;  2P5T A;  1ORY B;  3KSX A;  5KQD A;  1OIZ A;  3A46 A;  1G3I A;  4Q7J A;  1EIJ A;  2JNH A;  4FWH A;  1IN4 A;  1S3S A;  3GLI A;  1A5T A;  2C9C A;  2QZ4 A;  3FD9 A;  1N34 M;  1D0L A;  3V76 A;  5C1B A;  3B74 A;  3ZH9 B;  5IZ7 D;  1YE9 A;  2XGN A;  2DAK A;  2VDB B;  3CF2 A;  1V33 A;  2KEB A;  3HU1 A;  1N32 M;  4CJ6 A;  3KP0 E;  4HLQ A;  3HHY A;  5BR8 M;  3C3E A;  1NY6 A;  5ITY A;  4AKI A;  1WIV A;  3L28 A;  1BVS A;  4JI5 M;  4IIW A;  2F5S A;  2Y20 A;  2CWB A;  1OJL A;  4AKH A;  2MJ5 B;  3HKP A;  1DGH B;  4LCB A;  3KDS E;  4IBJ A;  5DNY A;  3RGP A;  5LMU M;  1L1T A;  2CE7 A;  1NJF A;  5EP1 A;  4GHA A;  3U5Z B;  1UFZ A;  3GRY A;  5EXT A;  2XSZ A;  3HJQ A;  3QYE A;  3KOZ E;  4LJ9 A;  5C18 A;  3U6M A;  2Z8Y M;  4RKU F;  2Y21 A;  4XBO A;  2JY6 B;  3FUU A;  1R7R A;  4NXN M;  2UXD M;  2K47 A;  4LY6 A;  4D80 A;  2DZL A;  3GLH A;  2RKO A;  1NSF A;  4DV7 M;  1C7Y A;  3E21 A;  1F4I A;  4GKK M;  4JI1 M;  4I8O A;  5ITX A;  4DR7 M;  1XC8 A;  2DNA A;  1G41 A;  2G5G X;  5IRE B;  3U5Z A;  1HT1 E;  4G3O A;  1XNR M;  2DEN A;  4BLC A;  3M0E A;  2JA2 A;  3KOX E;  3TE6 A;  3ILK A;  2UU9 M;  3ZC7 B;  2UXC M;  1HT2 E;  3KSJ A;  3U6L A;  3L2A A;  1LV7 A;  1DO0 A;  2CV1 A;  5JI3 E;  1QAQ A;  2MR9 A;  3FYC A;  4II7 A;  4WUR A;  2DAM A;  2L4F A;  4GEW A;  3FUV A;  2BWB A;  2LBC A;  4IBE A;  2WSF F;  4LJ6 A;  1XNQ M;  1SG9 A;  4R71 A;  2LTU A;  2XH9 A;  3T1H M;  2BJV A;  2FS1 A;  4XGI A;  1P3Q Q;  1W5T A;  1NJG A;  1IN7 A;  4X62 M;  2XZF A;  3GPY A;  4MGH A;  3CGW A;  4LF4 M;  3VDP A;  4L8R C;  4GKJ M;  3H4J A;  5FTJ A;  1ZMW A;  2F5N A;  2K0B X;  1QUS A;  3A98 B;  3SAV A;  4JV5 M;  2R45 A;  4DBG B;  1TTE A;  5EP4 A;  4B7G A;  4LF9 M;  3AOE C;  2DAG A;  2DAE A;  2JY5 A;  3SBJ A;  4DR2 M;  4KHP M;  1GVN A;  2Y0T A;  4FWD A;  1Q3B A;  4X66 M;  2R6F A;  3FTF A;  3LVV A;  3W0L B;  7CAT A;  2DHY A;  2CEA A;  2FH0 A;  2ZAO A;  3M6A A;  5ITQ A;  3HZJ A;  5KPT A;  5KQ8 A;  4ANR A;  2VQE M;  2Z3X A;  3B89 A;  4QHT A;  5IT9 S;  2J7N A;  1Q39 A;  1IY1 A;  1PGY A;  3GLI B;  4JN6 A;  1OFI A;  1ZQ9 A;  5IWA M;  1WHC A;  1NHW C;  4L6V 6;  4UN2 B;  2VF8 A;  3QWL A;  1K82 A;  1N78 A;  4X64 M;  1QDR A;  1VQ1 A;  2RGH A;  4GRI A;  4YHH M;  4KLN A;  1VG5 A;  1IN8 A;  2EUC A;  1TF0 B;  3GRR A;  2UUC M;  1IY0 A;  1NNU C;  1XMQ M;  3U6E A;  2ZBK B;  2R0I A;  2C96 A;  1Q02 A;  2M5Z A;  4A3V B; 
#chains in the Genus database with same CATH homology
 1ZV1 A;  2EKF A;  1G3I A;  4Q7J A;  1YLA A;  2JNH A;  1A5T A;  1VEJ A;  4HEO A;  2CP8 A;  2LVN C;  1WJ7 A;  1IFY A;  1DV0 A;  1HQY E;  1MN3 A;  3GLG E;  2DAK A;  2OOA A;  1OKS A;  3FE3 A;  1KYI A;  2LVP C;  2ZTC A;  1WIV A;  3K9O A;  1BVS A;  2CWB A;  2MJ5 B;  2ZTD A;  2DI0 A;  1IM2 A;  1IXS A;  3IHP A;  1XB2 B;  1R4G A;  1Y8G A;  1UFZ A;  2JP7 A;  2H5X A;  4WP2 A;  2HWJ A;  1G4A E;  2JY6 B;  3LCV B;  1VEK A;  1JR3 E;  2B3T A;  1T43 A;  2DZL A;  3LCU A;  2DKL A;  4F1I A;  3GLH E;  1AIP C;  1C7Y A;  3E21 A;  1F4I A;  3MMP A;  2KNZ A;  2DNA A;  1G41 A;  1ZMU A;  2OO9 A;  2QNJ A;  1HT1 E;  4G3O A;  1GO5 A;  2DEN A;  2HAK A;  5JI2 E;  2LVA A;  3FRH A;  2OOB A;  1XXH E;  3GLI E;  1WGN A;  1HT2 E;  1DO0 A;  3F92 A;  2LVO C;  2MR9 A;  1VDL A;  1T6O A;  1TR8 A;  2DAM A;  2JZ0 A;  2L4F A;  1EFU B;  2BWB A;  2LBC A;  4GEW A;  3GLF E;  1SG9 A;  4R71 A;  2LTU A;  1NV9 A;  1OAI A;  2KHH A;  3IEC A;  2L2D A;  2EKK A;  1P3Q Q;  2JY8 A;  1WGL A;  1OTR A;  2LVQ D;  3H4J A;  1DO2 A;  1ZMW A;  2K0B X;  2KNA A;  3E46 A;  5DFL A;  4DBG B;  1TTE A;  1ZMV A;  2RRU A;  1E94 E;  2QSF X;  2DAG A;  2DAE A;  2JY5 A;  3K9P A;  4F2L A;  1WR1 B;  1QZE A;  2DHY A;  2BWE A;  1OQY A;  3T6P A;  1VEG A;  2L4E A;  1NV8 A;  2JY7 A;  2O25 A;  3B89 A;  3FRI A;  2EJS A;  2JZ1 A;  2G3Q A;  1V92 A;  2K9D A;  1PGY A;  2JUJ A;  1WHC A;  2MRO B;  4UN2 B;  1VQ1 A;  1VG5 A;  2KNV A;  2R0I A;  1HJP A;  1Q02 A;  3BBZ A;  2DAI A;  1CUK A;  2WZJ A;  2MGW A;  2QHO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...