2XH9A

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGASPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 139
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xh9A03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xh9A01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xh9A02
4E6XA 2WAEA 1MWRA 5CTMA 4FH2A 3PBNA 1K56A 1JWVA 1NY0A 1FOFA 4BD0A 3TOIA 4D2OA 4DE2A 5EOOA 1BULA 1CK3A 3IHBA 3IWIA 5FSRA 1YLZA 5GLAA 4OP8A 3IXGA 4KENB 3DW0A 4QY6A 4JXSA 3A3JA 2XEPA 1H8ZA 2PU4A 3O3VA 3V39A 4E6WA 3IQAA 4RVAA 2DNSA 4NK3A 2J8YA 1NZUA 1K55C 4L0LA 1I2SA 4OKPA 4C6YA 2Y91A 4QY5A 1BTLA 3G2ZA 3MKFA 4QU3A 5IHVA 5HX9A 3BFCA 1I5QA 3ZVTA 4EWFA 1ESUA 3FKVA 1PYYA 3G2YA 4E3KA 1MWTA 4E3NA 3N7WA 4OONA 1K38A 5EVID 1Q2PA 4OLGA 5E2EA 1CEGA 2WKEA 2WGWB 1MY8A 1RGZA 2X71A 3MXSA 4IBRA 5FQQA 3VOYA 3G4PA 3NIAA 1AXBA 2FFFB 3QNCA 3UE3A 5DF7A 2ZQCA 2PU2A 2ZM0A 1TDLA 3HUMA 4PM6A 3GTCA 3VSLA 4DE1A 3WS1A 2ZD8A 5GHYA 2P9VA 4M3KA 1NRFA 3RXXA 5KSHA 3A3DA 1QMEA 3HUOA 1FR1A 3AGFA 2ZC6B 3WS0A 3MFDA 4DKIA 4KG2A 1FR6A 1PWCA 5M19A 2HP9A 1NYYA 2I72A 4JPMA 3IH8A 3RXWA 3ZHHA 4MBKA 5EVIC 5HAQA 1OMEA 2Y2KA 4R1GA 3M6HA 5M18A 5DTSA 4WMCD 3BM6A 4O7DA 4WELA 1L0FA 2HDSA 3HLDA 2VGJA 4K0WA 3RJUA 2R9XA 1C3BA 2Y2MA 4R3JA 4S2NC 3Q81A 2IWCA 1IYPA 2QMIA 5CXWA 1QMFA 1JTGA 4KZ5A 2BLSA 2A3UA 3CG5A 2B5RA 4QHCA 4CJNA 4WZ5A 1E3UD 5DF9A 4LV2A 5CHJA 4EBNA 4PM5A 5E2HA 2BG1A 2CC1A 4IBXA 4JXWA 1TDGA 5M1AA 3UE1A 5JYOA 3GSGA 3CMZA 3FWLA 4B4XA 4S2JA 3N8SA 2Y2NA 3ZNTA 2Y55A 4C3QA 3BECA 1IYSA 5FASA 2ZM2A 3B3XA 4GD6A 2UWXA 1K54A 3N6IA 4ZAMA 5FAPA 2QPNA 2ZC7A 1K25A 2H0TA 2WZZA 3ZG7B 1E3UA 1IELA 4GZBA 3CZDA 4JF4A 3DWKA 5EE8A 1HVBA 3SH9A 1BT5A 4JBFA 4QB8A 4PPRA 1HD8A 4IVIA 3M6BA 1PI4A 3VFHA 3W4PA 2ZJ9A 2EFUA 5EPHA 1WYCA 2HP5A 2X02A 5HAPA 3UDXA 4Y0TA 3SS3A 5CGWA 5DTKA 3OPHA 3VP1A 5CTNA 2HDQA 3UPOA 3FYZA 2R9WA 1U60A 5FATA 5HFOA 4EBLA 1XXMA 1MPLA 4U0TA 1K54C 4GB7A 4HBTA 5FI6A 3ITAA 4WEKA 5D3OA 2XGNA 1KE0A 5TR7A 3DTMA 1RCJA 3A3EA 3IF6B 2DRWA 2WYXA 2Z2LB 3IXDA 2WKHA 5DTTA 1W7FA 4EBPA 1PW8A 3OPRA 2ZC5B 1CEFA 1YLYA 3LO7A 3VP4A 5JYPA 2A49A 5CEDA 5I94A 4LV0A 1JWZA 3VP0A 3S4XA 3D4FA 5F1FA 1EWZA 3HVFA 1BLCA 5BOHA 4N9KA 3ZDJA 4EQIA 4S2NA 4DDYA 5L2FA 4WBGA 4U0XA 1KGGA 4A5RA 4DRTA 2EX6A 4BLMA 5KMWA 1ZG4A 3BLMA 1GCEA 5F83A 3QNBA 3LCEA 4OPRA 5HL1A 1LL5A 3PAEA 4KZBA 4P6BA 3P09A 4DE0A 2ZQ7A 2WZXA 5F1GA 2EXAA 2P74A 3Q1FA 1G68A 5EUAA 5F82A 3V3RA 1PIOA 3PBSA 2OLVA 1ZG6A 1SCWA 3SOIA 1KDWA 1XA7A 3FV7A 5EVLA 1JTDA 3ZG0A 2PBYA 4KG5A 3IWOA 1ZKJA 3A3FA 2H5SA 5FQJA 3ZG5A 1PI5A 1PWDA 1W8YA 3VSKA 3SS5A 1FCOA 3MBZA 5FA7A 4Y0OA 3ZNYA 2Y2GA 3VOZA 3BEBA 2Q9MA 4KZ7A 3N8RA 1L0GA 5FQMA 3W4OA 3WRTA 2VGKA 2XD1A 2XR0A 3O88A 5E2GA 3HLEA 4WEJA 3HBRA 4P0MA 1MWUA 4XUXA 2ZM8A 1N9BA 2G2WA 1YLTA 3IF5A 5GHXA 4IVKA 1KE3A 5DVAA 1FCMA 4X55A 4RYEA 3TG9A 1LI0A 1HTZA 5GLDA 4UA7A 5KZHA 1DY6A 5GLCA 2OLUA 1S6RA 4PM9A 4UA6A 2WADA 5FAOA 3MKEA 3GV9A 1VQQA 4HEFA 2JCHA 3BYDA 4N92A 3ZG9B 1NYMA 4R4RA 1KE4A 3WWXA 1TVFA 2HPBA 2WGVA 4BL3A 1XX2A 1JVJA 5EOEA 4S2LA 3NBLA 4S2MA 4JXVA 4ZJ2A 4BJPA 4X69A 1WE4A 1S0WA 1GA0A 4S2IA 3SH8A 3V50A 1KDSA 1E25A 1H8YA 3ITBA 3NC8A 4LV1A 1L0DA 4OP5A 3O86A 4X68A 5CGSA 2Y2QA 1GHMA 5A93A 1GHIA 2V20A 4ZJ3A 1W79A 2Y2IA 3Q07A 2RL3A 4WZ4A 1IKGA 1K4FA 1ERQA 1N4OA 3UY6A 1I2WA 3G34A 4FSFA 4S2PA 3VP2A 3PAGA 3NY4A 5KSCA 3IWQA 3PBRA 3UPPA 1XKZA 3UNWA 3BFDA 4LCLA 4KZ8A 3HL9A 1BUEA 2Y2HA 3E2KA 1HZOA 3PTEA 3UPNA 2V2FF 3P98A 3IHAA 5GHZA 5FAQA 5AQBA 5DF8A 1K57A 3I7JA 2XD5A 4OPZA 3C5AA 1YM1A 3ZG8B 4RX2A 4ZJ1A 3UN7A 4KZ6A 3C4OA 3AGEA 2EX2A 4QJGA 3NI9A 1E4DA 2ZQAA 3HUNA 1KVLA 1FSWA 2WUQA 3GVBA 3ZVWA 4JLFA 5AQ7A 4KZ4A 4S2KA 3UDFA 2JE5A 3W8KA 4N1HA 3MXRA 4OOMA 4KZAA 1IYQA 1PZOA 3C4PA 1IEMA 3MZDA 3N8LA 3OCNA 2WKIA 2ZQ9A 3S22A 4JXGA 1DJCA 4ID4A 1NZOA 3QHYA 4X6TA 2ZC3B 4QD4A 4ZBEA 1NJ4A 2RCXA 1BSGA 3FZCA 2H0YA 3GRJA 4HBUA 4OPQA 3WS2A 3Q7VB 4E3JA 5HW3A 1XGJA 4GD8A 3C7UA 3UE0A 1ES2A 2Y4AA 5CHMA 2ZLYA 3IF6A 4NETA 5HAIA 3UO9A 4RA7A 3G30A 4EV4A 2H10A 1M40A 1IKIA 2XDMA 1J9MA 1YMSA 2XQZA 3C7VA 3G32A 4P87A 3FKWA 2P9VB 4MNRA 2X01A 1IYOA 5G18A 4C75A 1JWPA 1WYBA 1KGEA 4K0XA 4KZ9A 3Q82A 2FFYA 1XGIA 1ESIA 3GQZA 1MKIA 4JKTA 4ZDXA 1GHPA 3PBOA 1SDNA 3G35A 2JC7A 4R3BA 3WRZA 3M2JA 4LENA 3UDIA 2J7VA 3LY3A 1FSYA 3NCKA 4PM8A 5FQIA 1Y54A 2C5WB 3Q7VA 3VMAA 1MXOA 4KG6A 5CECA 2EXBA 5FI2A 4KQRA 4E3OA 1BZAA 4JF5A 4MBHA 2ZC4B 4GOGA 5A91A 2QZ6A 1O07A 3GR2A 1L0EA 1SKFA 5E43A 1ONGA 4OOLA 3IH9A 3OPPA 4XUZA 2ZMAA 4DE3A 4WMCA 1TEMA 2EFXA 3NDGA 4GKUA 3SS4A 5HARA 4R0QA 2GDNA 1G6AA 2J9OA 3BFEA 5EVIB 3S1YA 1W5DA 1YQSA 2XH9A 2OV5A 3WS5A 1SHVA 2HDRA 5AQ9A 3JYIA 1L2SA 4E3IA 4FH4A 4MEZA 1ONHA 2WK0A 1BLSA 1LLBA 3HLBA 4MBFA 4CPKA 3CJMA 3HLGA 2EX9A 2IWDA 4R23A 2IWBA 5A90A 4GDNA 3TSGA 2XK1A 4BD1A 1KGFA 1PWGA 4FCFA 5FQ9A 3WS4A 2WGIA 3EQUA 4BQMA 3OZHA 4YFMA 5U47A 3HLCA 2C6WB 4Y7PA 1FCNA 4S2OA 3ZGAB 1EROA 1EI5A 5CERA 3V3SA 1ALQA 3OPLA 3E2LA 3HLWA 3PBTA 4E3LA 2ZQDA 4OLDA 1PZPA 1YLWA 1BLHA 3A3IA 4KQQA 4PMAA 5FDHA 4KZ3A 2XFSA 1GA9A 2JBFA 3W4QA 1SDEA 4Z9QA 4BENA 1K6SA 4OQIA 1LI9A 1RGYA 4OPYA 4YINA 1PW1A 1K55A 2Y2OA 1RP5A 3AGDA 4GN2A 1KVMA 1LL9A 1NXYA 2Y2JA 5CRFA 5FQKA 5TFQA 3VFFA 3OCLA 1LHYA 4UAAA 1CI8A 2Y59A 4DXCA 3SH7A 3MZEA 4U3TA 4K91A 4LCMA 4UA9A 1DJBA 1DJAA 3EQVA 4H8RA 2OSUA 2WGWA 4XXRA 4B88A 2ZQ8A 4KQOA 4E3MA 1YLJA 3GMWA 4R4SA 4BL2A 4B4ZA 3IF6C 1M6KA 1W8QA 4WM9A 3ZCZA 3BFGA 3PBQA 3VP3A 1YMXA 1ZC2A 4RX3A 5AQAA 3IT9A 4N9LA 4PM7A 3V5MA 1K56D 4DDSA 4OQGA 3M2KA 3BRMA 3HREA 3G31A 2Y2LA 5FI7A 3NDEA 5E2FA 5TGFA 1XP4A 1YLPA 2Y2PA 4OH0A 4Q8IA 3LEZA 4JF6A 4DF6A 3DWZA 4UHUA 4LV3A 4OVDA 4WZ5C 4N1XA 4IEDA 1K6RA 4X56A 1ES5A 2XF3A 1K57C 5J8XA 1XPBA 1YT4A 4GNUA 4X53A 1Q2QA 5GL9A 3Q7ZA 1ERMA 2EX8A 4Y0UA 5A92A 2Z2MB 3BFFA 1VM1A 2HDUA 3MZFA 4GDBA 2G2UA 5EECA 3ZFZA 1O7EA 1ES4A 5EVIA 2XFTA 2DCFA 1CI9A 1MBLA 4FD8A 4OQHA 3IXBA 2WAFA 1H5XA 4MLLA 2XLNA 3BLSA 3N4IA 4ZTKA 3LY4A 5CGXA 1FQGA 3O87A 5GLBA 4P85A 2E8IA 3IXHA 2J9PA 2V1ZA 3HLFA 4EUZA 1XA1A 3OC2A 5CEBA 1ES3A 4WYYA 4OOYA 3ISGA 2HP6A 4F94A 4OQ0A 1MWSA 1Z6FA 2Q9NA 1K4EA 4DXBA 1BLPA 5CHUA 4HESA
chains in the Genus database with same CATH superfamily
3KIIA 2WAEA 3HIGA 1YPRA 5DYGA 2YFLB 4FH2A 4O8GA 5AVFA 1FOFA 1R4YA 4BD0A 1BULA 1CK3A 3IHBA 4ARZA 1GY7A 3AL0C 3CAXA 2OWJA 4GCZA 4OP8A 5GLAA 5KQDA 3IXGA 2G7UA 2DHRA 3DW0A 2JP7A 3C38A 2YFJB 3MR0A 3VE4A 2DNSA 1WTHA 2J8YA 1NZUA 3A0RA 3V76A 3QP5A 5IS1A 4OKPA 3D9YA 4R1KA 3AJIB 4LPZA 3KSXA 3FSDA 3Q90A 1BTLA 1QDRA 3NV0B 1MGRA 5KO3A 1I5QA 1BVSA 1ESUA 5ITXE 3LI9A 3E0YA 3N7WA 5EVID 3FUVA 4XK8F 4OLGA 3F92A 1R6BX 4UQIM 3LVVA 1FYSA 4HOHA 4N6MA 1BSCA 1MY8A 5FQQA 1E3RA 1JB2A 2J5YA 3J27B 3GQ3A 1IBKM 1ULJB 3G4PA 2B02A 2BASA 1AXBA 4HJ3A 1B3SA 4LYLB 3UE3A 1Z5CA 3HUMA 3VSLA 2F98A 3C3DA 1XXHA 2PDRA 1DO2A 2G5GX 1WMNA 3RXXA 3B4OA 4M9XA 1XMQM 2V1UA 3WS0A 1K734 4Q0JA 4KG2A 1BSBA 2KF3A 4PDGA 2HP9A 4GKKM 2BNGA 1GY6A 4JPMA 3IH8A 3SC3A 3VF1A 5HAQA 1OFHA 4LZZA 3HX3A 2OTJ3 2Y2KA 1BRNL 2ZBBA 5EVIC 4DDSA 2D01A 5KPZA 4WMCD 4PT5A 3HLDA 2VGJA 3OLOA 1JBRA 4JV5M 4MN7A 2V8CA 1N9LA 2E2TA 3TDGA 1AVKA 2JKGA 2R4EA 4KZ5A 5FTKA 4NL4H 4QHCA 4CJNA 1E3UD 4LRYC 1T19A 2RBIA 5CHJA 3E9SA 3QP2A 2BMOB 1TDGA 3B7ZA 4GITA 1BRSA 4K1UA 1JR3D 2EUCA 3QAUA 2JKRM 1VHMA 2Y2NA 2Y55A 2ZOHA 3N8SA 3BECA 4C3QA 2GBWB 3UB6A 3GECA 1BNEA 2UWXA 1QDTA 2LVPC 2F4VM 1WMOA 2Q07A 3N6IA 3CCL3 4L15A 2ZC7A 5FTMA 2B1XB 2CIUA 5DRVA 2H0TA 6GSPA 2LVAA 3OWYA 5G4YA 4GZBA 4MMYB 3CZDA 3K92A 5LMNM 1BNGA 5TGNA 5MC7A 1ZS7A 5G1KA 2INXA 1BT5A 4DV4M 4JBFA 2LNHC 4I5QA 4QWTA 1VDLA 2HGVA 4YWZA 3M6BA 1PI4A 3VFHA 2F5OA 3U5ZA 1IQYA 4MH0E 5ITUA 1IN5A 1ULIB 2EFUA 3X3XA 1WYCA 2HP5A 2RGOA 3BNCA 1YAXA 4Y0TA 3L2AA 3OX9A 2ZL1A 3NBBA 1S67L 4LMIA 3HX8A 3GLFA 5K5BA 3VP1A 1Y28A 2HDQA 5FATA 4WLAA 1SXJA 1S1ZA 3DH2A 1A5TA 1GL6A 4HM6B 2W3HA 3ITAA 2CC3A 4WEKA 5D3OA 1RCKA 3IF6B 2DRWA 3N9HA 3EC9A 3NQZA 1V57A 5G2GA 4CIZA 1Q9EA 2C98A 1YLYA 2O9BA 3MJQA 5CEDA 1I4WA 1JWZA 1OHSA 1OAIA 4B7HA 4BBVA 2FGTA 2LB9A 2VX8A 1EWZA 3GPXA 1TFOA 1N5PA 4REZA 1WNHA 1LXEA 4EQIA 2DKLA 4DDYA 4WURA 2O9UX 4WBGA 5L10A 4JI6M 4YOFA 1NDOB 3CPW2 1DGFA 3PVSA 3J81S 3LCEA 3QNBA 4Z1WA 3SVAA 5HL1A 3PAEA 2MGWA 4KZBA 3HHWA 1E97A 3WMDA 4P6BA 3STDA 4EW7A 1VQ93 4L9FA 4KHPM 1UGHI 5F1GA 2Y8HA 1MKMA 1QMAA 1HKXA 2BT3A 1G68A 3LYGA 4Y28F 1TJDA 2JY6B 5KP1A 4LRSA 2W3EA 3FV7A 3IBRA 4XBTA 3T1XA 1QAQA 3IWOA 3LTDA 2V1BA 5EEOA 1RJOA 3LGOA 3GLGE 4MB7A 3ZG5A 1YJW3 5FQJA 2OQEA 1TGUA 3H7WB 3VSKA 4BIRA 4Y13A 1FCOA 4Y0OA 3EGDC 2DWLA 2Y2GA 3I553 2UXDM 4KZ7A 1L0GA 3CU3A 2E2VA 1EEJA 3KX0X 5IZ7D 3WRTA 2VGKA 4HBRA 4OK0A 3O88A 3UB8A 1NHGC 2GZAA 5EFWA 4LG2A 3HBRA 4HM7B 3GLIA 5HZHA 3TWKA 1R5LA 1HT2E 2JKFA 2CFDA 1S4RA 2FOIC 1G0TA 5KP3A 1SXJC 5GHXA 5ITXA 1KE3A 2L0WA 2OOLA 1ORYB 1B2SA 1B27A 1KQS2 5GLCA 1NSFA 1ZMWA 4I3AA 5J7EA 3V99A 1TS7A 2Y73A 3MKEA 1HR0M 1NRJA 4HEFA 5A2QS 1DP8A 1KE4A 1TVFA 1BGSA 5LBRA 4BL3A 2LTUA 4L16A 3JVCA 1JVJA 1GJTA 5EOEA 2L4VA 1NWWA 3EGXC 5KQ8A 3VK8A 1S0WA 1WE4A 1LNHA 4NKPA 1Q814 2DZLA 4NXNM 4OP5A 2CFLA 4JXJA 1Q824 1NU3A 3KDSE 1HQYE 1MU5A 1TTEA 1V92A 3EHCA 1W79A 3LR4A 4WZ4A 5CK6A 3J7BA 1U5OA 1CYVA 3G34A 4F3LB 2W9PA 1I2EA 3PAGA 3QP1A 5KIZA 3IWQA 5LC7A 5BU4A 4I3JA 4NPBA 3M6AA 2PT7A 3CF6E 2WO0A 4J5KA 2LVOC 3S28A 2Y2HA 2L7HA 1HZOA 3PTEA 3CPTB 4OUQA 5GHZA 7CATA 5BIRA 5DF8A 4I4LA 5JBSA 3BWLA 6RNTA 1F9IA 5DKKA 2VDBB 5IREB 4DV6M 4RX2A 4JN6A 4ZJ1A 3O5YA 3D79A 3DGLA 5IEPA 1YHQ3 3NI9A 5DREA 1FSWA 2WUQA 1T1BA 3E99A 2EO2A 4F1IA 4KZ4A 2W6JH 1GS3A 4LJ4A 4O02B 5BXQA 3UDFA 3W8KA 1T2HA 1B2MA 4OOMA 3KCHA 1Y4OA 5TBMB 4L6V6 3S22A 3MZDA 3RGSA 2AADA 2ZQ9A 2WGQA 3T1SA 1DJCA 3CNMA 4IUHA 3EF8A 1IFYA 4X6TA 3TL4X 1YNVX 3BIRA 2BNKA 1GSXA 8CATA 2KNVA 3L29A 4GH9A 1NV8A 4HBUA 2R46A 3Q7VB 3M0EA 1WJ7A 1UCIA 2BWBA 5EP4A 1PFPA 2ZLYA 1YE9A 3KSHA 4N6V0 2NQ8C 3ZH9B 4HOIA 3D5GA 2CWVA 2GJ3A 1Q40B 5AEUB 1M40A 3KYQA 2CHQA 1YMSA 3HJIA 3PGBA 1GYBA 2ERCA 5EP2A 2X01A 1A2PA 3GLIB 3HK4A 4PCZA 1QANA 1W2ZA 4K0XA 3LMLA 1US1A 2KF5A 4H61A 1ESIA 1PNEA 3DZLA 3IS2B 2Y0TA 4FMBA 4X65M 2FE8A 3LFVA 1A67A 1IK3A 2VV8A 1BAOA 3I0YA 2YFIB 2D02A 1OTIA 5IWAM 3FLJA 4PM8A 1YSYA 5IW9A 2WSCF 3LUQA 3Q7VA 1N34M 3VMAA 1PJJA 2JY5A 5DFLA 4JGPA 2W56A 1QZEA 3A76A 2J80A 4GIPA 5F68A 2LHGA 2BMRB 1Z5AA 2QZ6A 8RNTA 2VEAA 4MGZE 1SKFA 4DR4M 2OAQ1 3UMEA 3FD9A 3HU3A 4NRVA 4JI8M 1B2ZA 2GU3A 2EFXA 3NDGA 4HM0B 2IUJA 3GZRA 5HARA 1XXHE 4R0QA 3S1YA 2WKPA 2YX9A 1HJPA 1HNWM 3PXMA 5LC6A 3CCV3 1SHVA 1SQWA 3LTCA 1L2SA 3HY5A 3AGNA 1RNBA 1ONHA 1TH4A 2W1TA 4CPKA 4WP2A 2EX9A 3NHXA 5D81A 1VQ53 1LOYA 5A90A 2K47A 5FTJA 4GDNA 4EERA 4B93A 4BD1A 2UUAM 1EA2A 1PM5A 4Y15A 3VOLA 1DETA 1BRHA 1EROA 2LBCA 3V3SA 3PBTA 3GLIE 1GSPA 1W7CA 3CXC2 2DI0A 1MN3A 4IJGA 1DVCA 4D82A 5IERA 2N35A 3W0LB 1YLWA 4IBFA 2L4EA 2ZDJA 4MMNA 2HOHA 3CUEA 2OOVC 1TP6A 2JBFA 4KZ3A 2KA6B 1IN6A 4OQIA 4AKZA 3MF0A 3R9XB 2F4YA 4LFUA 3DUKA 1FIKA 3GLHA 1P3QQ 1LL9A 1NXYA 4M0WA 2QSFX 4NOOB 2F56A 1OT6A 3H82A 2CEAA 1CI8A 3GZYB 4LJ5A 4Y17A 4G4QA 3BY9A 2G3QA 4UA9A 3K2LA 1DJBA 1CJFA 4GRIA 3G16A 4BTWA 1MC0A 2WGWA 4XXRA 3DFZA 4KQOA 1YLJA 3GMWA 4GHIB 4BL2A 1EKMA 4B4ZA 4ME4A 4LLOB 1M6KA 2PYPA 2RNTA 3UNLA 3WR2A 3KKGA 1FJGM 2Z76A 3NM7A 1V34A 1GOYA 2WGOA 4AKIA 4MDZA 3PBQA 1IQPA 3T4TA 1ZC2A 1BNJA 1STFI 1FUWA 4KFEA 1TUHA 4DBGB 1LQMB 1OCVA 5IU1A 1WHCA 4ETZA 1ZTUA 1A2KA 3TJZC 1OJ5A 2BJVA 3MPHA 1JN5B 1ACFA 4R4KA 4MMXB 4UHUA 1TFKA 4B7GA 4LV3A 1SARA 1XJ2A 4R9KA 1K6RA 5BVBA 3FPWA 1GY5A 1NLZA 2F5SA 3U6CA 1RTUA 4GNUA 4EEUA 1RGHA 3U6DA 2EX8A 1UM8A 1O7PB 3GWRA 3KFQC 1FUSA 5A92A 5FSWA 5F3WA 1LQGC 4B9OA 4II7A 3TQSA 1WGLA 1SKOA 2JKTI 1O7EA 3GLHE 4R7GA 3NM2A 3WOEB 1E3VA 3MS6A 4HLQA 5EVIA 5J3WA 4ZTKA 1X0OA 4CLCC 4LFCM 3UJMA 3TWMA 3LY4A 1FQGA 5CGXA 1L5GB 1ISKA 4LF4M 1IVVA 2C9CA 1AIPC 2JDIH 2J9PA 2V1ZA 4EUZA 5CEBA 3OC2A 2Z7AA 4IUKA 1N8R4 1HT1E 2EKFA 4BU4A 2HP6A 1HNZM 4OQ0A 2FH5A 5DKLA 1Z6FA 5HSQA 2Q9NA 4DXBA 2HWJA 1AY7A 4K61A 2H28A 2JKRI 4MGYE 4HEOA 4HESA 3PBNA 3VSYA 1NY0A 2HV1A 2Y20A 5AEWB 3JR4A 2DZOB 3FH1A 3HIIA 4DE2A 3T0UA 4FCMA 1G6OA 2WOHA 2QWSA 2R45A 3BLZA 5IG4A 4CLCE 2KZSA 3VLFB 1NVMA 3A3JA 3PR6A 2ZHXB 3UB7A 3MYTA 2IA7A 3O3VA 1JB4A 3OWSA 4E6WA 3OTOM 4KO8A 3CCE3 1RGEA 1K55C 1K8A4 2KRTA 3NOUC 4C6YA 3ALAA 5AVEA 4G4RA 2Y91A 3K8ZA 3CF0A 1T3TA 1Q3BA 1XB2B 4X1LA 2DAIA 3LIFA 1VEUB 3MKFA 4IT7A 1PFLA 4Q0HA 3FKVA 3B7QA 5HDCA 3VE3A 1PYYA 3G2YA 2OQEC 4DV2M 3F9SA 3F7SA 3DAVA 2L1MA 2PYRA 5E6JA 2WKEA 3EEAA 3DGOA 2WGWB 2CRUA 3FE3A 3FGYA 2KXGA 1DP9A 2O25A 1D1JA 3KOXE 2ZMVA 1QQWA 3C3EA 1XJ4A 3PCRA 3MXSA 1SIHA 3NIAA 4BB9A 4LCBA 1GMQA 2MJ5B 1TIJA 1KFVA 3EQQB 1WR1B 1W5ZA 3F7XA 3JPUA 1YGWA 2OAP1 1T1AA 2C4BA 2ZD8A 4M3KA 3FUUA 4LRTA 1F98A 3UMDA 1VQ1A 3A3DA 4N6NB 1QMEA 2DWZB 3WHKA 2DVWB 1FR1A 2ZC6B 4RBNA 3C30A 4N3VA 3LYXA 4E04A 3FKEA 1FR6A 1WQLB 1E32A 4GSPA 3EE1A 1AV4A 4FMCA 4R9LA 2A24A 1OTRA 1OMEA 2DENA 2A15A 4R1GA 1XNRM 1H3QA 1PGYA 3CC43 4WELA 1L0FA 2P5TA 1IBMM 1XFNA 3RJUA 1DV0A 3D3OA 4PAUA 1ZAEA 1SXJD 2QMIA 3CCJ3 1ASKA 3ZQ5A 3DMCA 1FILA 2B5RA 3KXEC 4BWIA 1JB5A 5DF9A 3IECA 4YHHM 4L78A 4LV2A 4JI2M 5E2HA 1B20A 3ICYA 4IBXA 1PJSA 4JXWA 3CPTA 3UE1A 1NY6A 3I563 1GKIA 3GO8A 2ZOIA 2OO9A 2RGHA 3VDPA 4FWDA 2QIYA 2ZTCA 4P17A 3HJQA 3WHLA 4LF9M 3ZG7B 1IBLM 2LVNC 1E3UA 2QBYA 4NREA 3PNYA 1GABA 2ZL1B 4EUVA 1OACA 4M9ZA 3UJNA 4BTXA 3F1OA 1KD14 1TD5A 4L8RC 4AEQA 4ILFA 1BU4A 2X02A 1FGMA 3F8HA 5IG0A 1RDSA 1JV2B 3OPHA 4DMZA 3UPOA 4XBXA 1R2ZA 2R9WA 4EBLA 1RGLA 1MPLA 5FI6A 5TR7A 4QHTA 3SAUA 3KO6A 3A3EA 5STDA 1LOVA 2VKSA 3IXDA 2HCBA 2Z2LB 3DXOA 4CDLA 2WKHA 5DTTA 1W7FA 2B18A 1PW8A 3OPRA 1IQ8A 4LJ7A 3PHYA 4L9EA 2A49A 1I2GA 4K0KM 3HJKA 3S4XA 2H5XA 4LJ9A 4OU7A 4LF8M 1G02A 3CMA3 1RCLA 4GJ4A 3ZDJA 4S2NA 2GU1A 1JBTA 1T3BA 2D7GA 5L2FA 3MWZA 4WFOA 1VG5A 4B3TM 4U0XA 2R44A 1KGGA 4BLMA 2YKHA 2ZAOA 1ZG4A 3KP0E 3BLMA 5F83A 1DGGA 4DR3M 1W6YA 2JZ0A 1LL5A 4ETXA 1T5YA 3LCUA 4NEED 5EUAA 2P05A 4IJEA 5F82A 3V3RA 1V33A 3MG3A 2HZ5A 2OLVA 2GX5A 2IYJA 3SOIA 3NBXX 1XA7A 3CC73 3ZG0A 1RGGA 2PBYA 1S4SA 4ORLA 2QJ5A 3AOEC 1ODVA 3A3FA 3C58A 1Y4KA 1PI5A 2PD7A 3CD63 5IF6A 2CFOA 2CHGA 4LF6M 2JNHA 2UU9M 3MBZA 4EETB 3U1WA 4RNZA 4CQHA 5C5KA 4KQDA 3FUXA 2GEXA 5TBMA 3VOZA 4I38A 3N8RA 5J4EA 3G0KA 5FQMA 3AV0A 2OOVA 2XR0A 3H7WA 3HLEA 1MWUA 2LYXA 4IBBA 1YSQA 2M7UA 3NBIA 2JZ1A 2VIIA 2FXTA 2W82A 4FOFA 4GB5A 4IVKA 4X55A 4RYEA 3TG9A 1HTZA 3P7NA 2JA2A 2KRUA 3EN8A 2OLUA 4UEYA 3UE6A 1T6OA 2VK3A 4AZFA 1IXZA 2QJ7A 1VQQA 2JCHA 4IBJA 1NYMA 3W67A 2K2NA 2WGVA 3U6OA 1K41A 2DAMA 1XX2A 1EFUB 1G59A 3CCS3 3NBLA 2XGLA 3IHPA 4IBCA 4MCWA 4S2LA 4S2MA 4X69A 4S2IA 1UI8A 2Z7JA 3SH8A 2R78A 1KDSA 1H8YA 3LIAA 1BNIA 3K3CA 4X68A 1GHMA 4PDIA 1GHIA 1T2IA 4CLCB 4ZJ3A 3W0FA 1YVSA 2Q0OA 3Q07A 4GS9A 4X1MA 1M1XB 1H8MA 1ERQA 1N4OA 3CHWP 1Z5BA 1OF5B 1FW7A 1IDPA 3T8UA 3NY4A 3VP2A 2BIRA 1G71A 4J8TA 1RRHA 3GQ5A 1E94E 2BTFP 3BFDA 3LR0A 3CCR3 4LF5M 4DJ3A 3HL9A 3E2KA 3UPNA 5D82A 2PZVA 1BOXA 3BQ8A 3IHAA 3W2ZA 5AQBA 2CMNA 2PR5A 4OPZA 1JZDA 4WN5A 3NXJA 1GLNA 3CITA 1H0MA 2EX2A 1GL7A 4N6OB 4EW5A 4R6LA 4X62M 4MEIA 1MGWA 3GVBA 2Z6DA 1TF1A 3IPTA 3H51A 5IG3A 4S2KA 4N1HA 1IYQA 1PZOA 2KXEA 1RLSA 1ZMVA 1IEMA 1P97A 4WP5A 3OCNA 5A8BA 4ID4A 2HMJB 3X3ZA 5TJJA 1L1TA 3GRUA 1IXRC 2ZC3B 4ZBEA 1G4AE 3BJNA 2L4FA 5AIFA 1SIIA 4WL9A 3JUPA 5G1LA 1QVRA 4BBTA 1BSGA 4OPQA 3RNTA 2WOFA 3T15A 1OT9A 4O0PA 1L2BA 3FKAA 4DUYM 1ES2A 2Y4AA 3A42A 3IF6A 5HAIA 3SLUA 2LH0A 3MSOA 2H10A 4DV7M 1NWZA 5JI2E 5HPFA 1IKIA 3B74A 3SEDA 1J9MA 4P87A 3G32A 1TS0A 2Z4RA 3EWKA 5CLKA 2IUKA 4MNRA 4C75A 2OOAA 4GHAA 3OOVA 1JWPA 3MQOA 1KGEA 2W04A 4LJAA 3K3DA 1JB0F 3NBRA 4MN6A 1UCKA 1UCJA 3ZC7B 3D8LA 4ZDXA 2QYBA 3PBOA 1SDNA 2UX0A 2J7VA 3IG5A 2HKJA 4B3RM 3LY3A 3KSJA 5FQIA 3L9KA 4RKUF 2EXBA 5FI2A 3PFIA 4ANRA 2KOIA 3HJSA 2ZL8A 3SYLA 2GSPA 1O07A 3GR2A 4AFIA 3IH9A 3IG8A 1D0MA 1TDHA 5IEOA 2ZMAA 4DE3A 3LIDA 1G28A 2B3TA 3HZJA 1NLYA 3EX9A 3DTEA 2HF6A 3FTEA 1RGKA 3E98A 1W5DA 3CCQ3 3J2PB 1I3FA 3WS5A 2XH9A 1GOVA 2OPFA 2OCTA 1QJGA 3JYIA 2MROB 4FH4A 3HLBA 4MBFA 3SOAA 2IWDA 4R23A 1QYRA 4OVZB 1GMPA 4Q7JA 2WGIA 1NNUC 8CHOA 3HLCA 2JY7A 2XSZD 4S2OA 4F2LA 4EXRA 3E46A 5CERA 6STDA 3HLWA 2J7OA 4E3LA 4WWUC 3HHYA 1XJ3A 2XA7M 4JI4M 2ZQDA 4LZJA 3LI8A 1PZPA 1NHWC 2F5NA 4N6UA 5EXTA 3WHOA 1VQM3 1FZUA 1SDEA 1LI9A 1TH2A 1B2UA 3U4LP 3FTCA 2QCUA 4EYCA 1RP5A 1R4GA 1YKDA 3VKGA 2Y2JA 5FQKA 5TFQA 3ILKA 2DWNA 2KEBA 2P08A 2HJEA 2UUCM 2UV0E 2Y59A 4UAAA 4D60A 3SH7A 4HM8B 4K91A 5LMUM 4U3TA 2O5RA 4DR2M 4O3VA 1DJAA 1I94M 2EWWA 3EQVA 1OQYA 4H8RA 1FA3A 1ZQ9A 2ZANA 4OW0A 2ZQ8A 4JI0M 4EQ1A 1PY3A 1YJ93 3U6PA 4WM9A 3ZCZA 2H1RA 1ROAA 4NXGA 1EE8A 1EG9B 4DR7M 3HJ8A 3KZTA 1O7NB 4RX3A 5AQAA 3KN4A 3IT9A 4LRZE 3FRHA 4N9LA 1M1K4 3B9PA 3MG1A 2EJSA 2Z3XA 3SATA 1W63M 2XA7S 3PNVA 4GHIA 4OQGA 3HREA 4JGQA 3G31A 1RGCA 1YLAA 3U97A 4ZM8A 4LF7M 2FZ0A 1YLPA 2Y2PA 4OH0A 4QHSA 9RNTA 4Q8IA 4DF6A 1Z59A 3DWZA 2RFRA 5EQTA 3NQYA 3J7AS 1HZ1A 2XSOB 1ES5A 1K57C 3E4RA 4K08A 5J8XA 1RRLA 4X53A 1JN5A 4WF0A 2LVQD 4B7FA 3L25A 2HDUA 1OTAA 3NBJA 3IMAB 5EECA 1L1ZA 1RN7A 2G2UA 2RSXA 1EQKA 5HDSA 2ZMFA 1K3XA 1BNRA 4LGYA 2UUGC 2P38A 3IXBA 1H5XA 1O7HB 4HZ9B 2W3DA 2XLNA 3BLSA 4HJ6A 3HWSA 1YGEA 4P85A 4JYAM 1IVWA 1XA1A 4WYYA 3MJ5A 3FUWA 4OOYA 3JVUA 1OJGA 2NUTC 1PU4A 1K4EA 1QAKA 2H0HA 4E6XA 1PRBA 5CTMA 4EV2A 3I4YA 1K56A 2EWVA 3CCM3 4R70A 2GXFA 5F6AA 3TOIA 4IPBA 4D2OA 2HMNB 2C99A 1JKGB 3FCSB 2LWXA 3IWIA 2XRNA 1YLZA 2F86B 4TX4A 1JJ22 3T1RA 4JGRA 4LY6A 3B47A 1FGRA 4YNRA 2OQ4A 4JXSA 4FWHA 1MZUA 1X1YA 1H8ZA 4B08A 2LQVA 3GP1A 2E5LM 2PU4A 4RVAA 3V39A 4CCVA 1TF0B 1GD3A 1PJQA 1GSVA 4W5WA 4L0LA 4HAAA 1I2SA 2B95A 1UWNX 1SJWA 5AIGA 3N8BA 4QY5A 3QYEA 1OH0A 3G2ZA 5HWVA 3VKHA 5HX9A 3ZVTA 2DZNB 4IIWA 4DUZM 3BNEA 3LICA 1MWTA 2V6ZM 1QAOA 2W3GA 4OONA 3RTYA 4E3KA 4E3NA 4BLCA 4MGHA 3B33A 3BNDA 2BHMA 3GLFE 3FTFA 1XMOM 2OTL3 3OW22 1G5UA 3UB5P 2X71A 3VOYA 2DNAA 1IV9A 3QNCA 2FFFB 3C8CA 3U60A 1CEWI 1DVDA 2ZQCA 2GNXA 4PM6A 3GTCA 1FUTA 4FR9A 3K9PA 3MFXA 5GHYA 1NRFA 4N6LA 1IXSB 2GNOA 2Z77A 3HUOA 5IT5A 1V58A 3PYPA 1R4CA 3LT9A 3IS2A 1W01A 4LEHA 2J3TD 2K9DA 1NYYA 2W27A 2UXBM 4MBKA 4X64M 4AI6A 4WHAA 5M18A 2AAEA 2MF7A 5DTSA 4KFDA 4O7DA 5JI3E 2ZTDA 4K0WA 4L4UA 1D6ZA 1IU7A 2R9XA 1Q3CA 1HYFA 1W02A 3Q81A 4R3JA 2IWCA 4KZ1A 2UUBM 4R80A 4GHLA 5CXWA 2KRKA 1JTGA 3TW8A 3S27A 5CF1A 3KE7A 2JKTM 3E21A 1O7WB 3J7Yd 2W1RA 4X2OA 4B3MM 4EBNA 1VEJA 1LT0A 4HP4A 5JYOA 5M1AA 3GSPA 5L8MA 1SPUA 3FWLA 4S2JA 2W2CA 2E8JA 3SFZA 4L9GA 3DGMA 2Y74A 1C54A 2ZM2A 1LRAA 3FG1A 3RGAA 3V98A 3RE8A 3L27A 3B3XA 3CWFA 2CV0A 4GD6A 1K54A 5FAPA 2QP9X 1I0XA 2QPNA 3BU4A 1K25A 5ITRA 3B42A 1QAFA 3BXWA 5EE8A 4CHTB 2DAGA 2KNAA 3KVWA 1HVBA 2M60A 1GMRA 1MNLA 3SH9A 3MXQA 4FW9A 2DWMA 4PPRA 3N54B 3F1PB 1DGBA 5EVEA 2P0XA 4KUOA 1OPXA 3U61B 1TTOA 5EPHA 3THGA 3CC23 4HVNA 2QA43 1UGUA 3UDXA 1N9NA 4GLQA 5F69A 2R6FA 5FGOA 1FGQA 1WA9A 2O9CA 3K2NA 3GRRA 3FYZA 1U60A 1Q7HA 1XXMA 1DRMA 2EKKA 2XGNA 1KE0A 3DTMA 1BSAA 1BRKA 2BU4A 5BPVA 2WYXA 5EQLA 4JI1M 4EBPA 4R71A 2Z6CA 2ZC5B 3LO7A 5JYPA 1TH3A 4IBGA 1AWIA 1IFQA 5EM1A 5FTLA 3BBZA 1W6CA 4FCTA 5F1FA 1VDDA 1UUWB 3HVFA 3HHXA 1BLCA 2CK3H 5BOHA 1W5TA 4N9KA 2W0NA 3AOEA 3NULA 4NSRA 3R7WA 4JI3M 3MHVC 5HD3A 5KMWA 1RSNA 4OPRA 1WGNA 2C5RA 3NWLA 3GAXA 1DO0A 3LZAA 3JVVA 4HQAA 3P09A 1J5EM 2JHEA 2K54A 2KLIA 4NC6A 4KLNA 3GRDA 2EXAA 1HQCA 2CUZA 2XZFA 1R2YA 1DMMA 3JUNA 1F2KA 2P74A 2WKRA 4B3SM 3Q1FA 1QUSA 3LTBA 3DBAA 1XJ6A 3DTKA 2IA2A 1N9OA 4TUWA 2OWPA 1ZG6A 1SCWA 2W03A 2INWA 3RFWA 3QP4A 1N36M 2O99A 4HL4A 1VB6A 2O01F 3ULFA 1ZKJA 3X3YA 3NUVA 2KCDA 3LW5F 4NRWA 1PWDA 1G3IA 4STDA 1W8YA 1VEUA 3WDGB 1BYWA 3SS5A 1XNQM 2V9AA 4FWGA 2MR9A 2SBLA 3ZQJA 2Q9MA 3BEBA 3W4OA 4LSOA 1IY2A 2BO9B 2KW0A 2XD1A 3BY8A 1D2NA 4I4KA 4LGQA 4XUXA 1YVBI 2K3DA 4NHFA 5EXSA 2APLA 4HY8A 2J3WA 1N9BA 2ML6A 1UW1A 2G2WA 1C1KA 2CW9A 3IF5A 2DAEA 3A5EA 4WYKB 4I5SA 2VQFM 2I9WA 2RRUA 4UQIS 5KZHA 4LGMA 1LI0A 5GLDA 3SAWA 4UA7A 1DY6A 3EEHA 3U6MA 4FVMA 4PM9A 1S6RA 4UA6A 5FAOA 3SARA 1VQ43 3BYDA 7STDA 4R4RA 1P9WA 2K6BA 4GKJM 2ZAMA 3KSIA 4ESPA 4MGKE 4JF8A 1YIT3 4JXVA 1VQO3 2Z6BA 1GA0A 3V50A 4OVMA 1IQXA 3AKZA 1L0DA 3O86A 5FDSA 5CGSA 1TRPA 5HOHA 2Y2QA 5DFYA 4Y3IA 5A93A 1IY0A 2LXEA 5JPUA 3NECA 2BWEA 1MJGM 2K7SA 2Y2IA 3SBJA 1BIRA 3K9MC 4QOZC 2RL3A 3HZPA 1IKGA 1K4FA 2ACGA 5FTNA 1N33M 4FSFA 1GOUA 1S5AA 1XKZA 1BRIA 3NX0A 3L0RA 2HMMB 2DAKA 3HCYA 2V1LA 1XFQA 3MG2A 5D83A 5FAQA 3MQQA 3SW1A 1DP6A 3D8BA 3K1JA 3I7JA 1KWIA 2XD5A 3C5AA 1YM1A 2BMQB 1UGIA 3UN7A 1B21A 1IT8A 4KZ6A 3C4OA 3AGEA 5ITQA 3C2WA 5DJUA 4R3AA 2ZQAA 1Q02A 4PEJA 2DMWA 3HOHA 3ZVWA 4GHOA 2Y79A 1HU9A 1G96A 2M7OA 1GSWA 4MN5A 5AQ7A 5EP1A 3SX1A 1N78A 1CQSA 3OBFA 1VZZA 2JE5A 2L4RA 3MXRA 2X49A 4XGIA 4KZAA 1JRQA 1DGHB 2WKIA 4JXGA 2WSFF 3CLOA 1NZOA 3T6PA 5I97A 4HH2A 3JAMS 2ZM6M 4H6JA 2W3FA 1YI23 1ZX2A 4QD4A 4P6ZM 1NJ4A 5KP4A 3G713 2RCXA 2VF7A 3LQRA 4IBKA 2XSHB 3LR5A 2H0YA 3GRJA 3J80S 2J3TC 4E3JA 2RGQA 4RF1A 3S7QA 1KSIA 2Z4SA 1JNQA 4HM3B 2STDA 3UE0A 3C7UA 3IX8A 4HM2B 2CV2A 5CHMA 3T4QA 1VQK3 4BTYA 3UO9A 3TE8A 4IBIA 4O2HA 3EIHA 3QP6A 3AGOA 1ZHHB 2PRFA 4AW4A 4GC5A 4HM4B 3C7VA 3T8NA 4ITQA 5ITTA 4NXBA 1J09A 4CISA 1Q864 2VGLM 5G18A 1WYBA 1JNUA 3CGWA 4KZ9A 3Q82A 2FFYA 4RZMA 1XGIA 3AHWA 1GD4A 5AYSC 1IV7A 3G35A 3AOGA 4FCVA 2JC7A 2XSZA 2W1TB 5FW5A 3FYDA 4EEPA 3M2JA 3LQQA 4HJ4A 4EXOA 1SG9A 2AHMA 2QPAA 2H0GA 3LR3A 2VQEM 1W6GA 4A3VB 3SXXA 3NHQA 1Y54A 1OKSA 4I81A 2D7HA 1MXOA 3LIBA 2CHVA 3FYCA 4KQRA 1AUAA 4E3OA 5L07A 1IOUA 4RNAA 4JRFA 2CWUA 2RKOA 2KF6A 1OGXA 2R65A 4G3OA 1K28A 3VDUA 3PS8A 4QNMA 3K0ZA 5E43A 5HGRA 1ONGA 5AI1A 3OPPA 3CI6A 4XUZA 2V0UA 3CTWB 4WMCA 3D9RA 4KT3B 1SKOB 2E2UA 1K3WA 5DNYA 1JZOA 4GKUA 2XLJA 4KFFA 5EVIB 2GDNA 2J9OA 3BFEA 4HKVB 4ARZB 3P01A 1D7EA 2OV5A 4L8PA 2HDRA 1BRJA 3VGNA 3FTDA 4JI5M 4O8SA 2WK0A 1BLSA 2WSEF 4MM3B 1LLBA 3EJVA 4DJ2A 3VK7A 1RMSA 3CJMA 3HLGA 2F5WA 3GPPA 2IWBA 4G4OA 1OTDA 3KSGA 1PJIA 3C9PA 3TSGA 3SHGB 3QRDA 1RN1A 1XXHB 3K7CA 1KGFA 1PWGA 4FCFA 5L8RF 3FUTA 3OZHA 4MJDA 3OV4A 2L2DA 4WUJA 2XSSA 2C6WB 4Y7PA 3S7NA 4PKYA 4JGOA 4XDVA 2ZBKB 2RCDA 3CNXA 2MJ6A 1ALQA 3U6EA 3CF2A 2CFGA 2KHHA 3E2LA 1UCLA 4Z6YA 3SMSA 3URPA 4EIWA 3DY5A 3D72A 2CG1A 4OLDA 3A3IA 4PMAA 3U6QA 4AKGA 5FDHA 2DXIA 1UUGB 3W4QA 3OXAA 3L28A 2D42A 3WODG 4Z9QA 1FNNA 2CG0A 4NXEA 4OPYA 2Q2EB 1RGAA 1LL8A 3EBYA 4IIAA 3T1QB 2C96A 3VFFA 2XRXB 3MQ0A 1LHYA 1XWIA 1BNFA 4DXCA 4BBUA 3H3HA 1D6UA 1NO3A 4HJLB 3T4KA 3UMMA 4S12A 2HL7A 2OSUA 4B88A 5EXXA 1LOWA 4E3MA 4R4SA 1OTEA 2QGUA 4J9AA 3PCSA 4DV3M 3T4JA 7RNTA 3F1NA 3KS4A 2CKFB 2A2LA 3CCU3 3FC7A 3VP3A 2QZ4A 3D5IA 1YMXA 2LB5A 3V5MA 3B8LA 3VFDA 1K56D 1LSVA 4FCZA 3U6SA 2J8XB 3BRMA 1LVNA 1I0VA 2Y2LA 5RNTA 5E2FA 5FI7A 5TGFA 1XP4A 1CH0A 1K0KA 1N75A 2F99A 4JF6A 2R0IA 4FTXA 1W5SA 3GLHB 1PYLA 2W56B 4OVDA 4N1XA 2FFJA 4IEDA 3PZWA 1T43A 1N77A 3K9OA 1GO5A 1N5HA 3ROBA 5GL9A 2MH8A 2YQZA 3Q7ZA 3LTAA 3Q8GA 5EVHA 2CHCA 1ERMA 2CE7A 3U2AA 3UGJA 3BFFA 5FEFA 1FGOA 2JN7A 3GPYA 3MZFA 4GDBA 1NB3I 3JUOA 1J2BA 3ECFA 1P0ZA 4CJ6A 4HM1B 5CF2A 1Z6TA 3D4AA 3KOZE 3N4IA 4GL6A 1L3LA 5GLBA 3U61A 2E8IA 3FG8A 3V67A 3HLFA 2V1AA 4EU0A 4F94A 3M7GA 3UB1A 1MWSA 1TRQA 1UWPX 1N32M 3CPOA 4D81A 2JY8A 1IY1A 3MKIA 4OX9M 4EV5A 1BLPA 5CHUA 1E9SA 1SZVA 4PHTA 4BMWA 1BUQA 2LHCA 1MWRA 1W63Q 1JWVA 4XBYA 1XC8A 3FF0A 3T50A 5EOOA 5AIHA 1STZA 1S1YA 2O3OA 2L7IA 5GSPA 5FSRA 4KENB 4Y5FA 5F5YA 3B4PA 4QY6A 4ZPXA 2XEPA 3UL5A 1JBSA 5G4ZA 3IQAA 3GLGB 1RU3A 2QHKA 4NK3A 4DR1M 2PAVP 3KW6A 2XR8B 1D06A 1B2XA 2HMLB 2OWHA 1S723 3R7WB 4QNRA 1KC84 4QU3A 5IHVA 3E4PA 1QVG2 3BFCA 2QHOB 4EWFA 5E26A 2CX0A 1VEGA 2OOBA 1OPYA 3T12B 4Q0IA 4M0DA 2P0MA 1K38A 4X2HA 1K82A 1Q2PA 5E2EA 1CEGA 1D0KA 1T1CA 2HMKB 2ML5A 1N8QA 5C18A 1RGZA 4IBRA 4X25A 2VV6A 1BRGA 2XROA 1WXQA 3SAVA 4QPRA 4ZRRA 3PYJA 1NY5A 2KNZA 2F5PA 4JI7M 7GSPA 3U6LA 2PU2A 3EOIA 5DF7A 2ZM0A 5FL3A 1LOXA 1TDLA 2R41A 4DE1A 3WS1A 4M9SA 1W00A 3LH4A 3BB9A 2P9VA 1D6YA 1OTBA 3GZBA 5KSHA 2CWBA 3L26A 4NXMM 3QK9A 3AGFA 3MFDA 4XM4A 4DKIA 1PWCA 1VETB 3FG3A 5M19A 1L2CA 3H4MA 4QWOA 3RXWA 2KZUA 2I72A 3ZHHA 1X1XA 3AMOB 2V0WA 4FUWA 4FCWA 3M6HA 2I7PA 1JR3A 3T1YM 2CX1A 2HDSA 3BM6A 4I3IA 1BNSA 1O7GB 1LV7A 2QEX3 2VA0A 4FMAA 1QALA 1RKYA 1C3BA 2Y2MA 1Q40A 4S2NC 1IYPA 4EC6A 1K9M4 1QMFA 1RN4A 1I2FA 2A3UA 2BLSA 5CX7A 3CG5A 1IVUA 5HD5A 1NNJA 3QWLA 4IBEA 3A45A 1BUJA 1Q7Y4 4U13A 4WZ5A 5AJGA 2FNQA 1HNXM 4HNBA 1W2B2 4PM5A 2BG1A 2CC1A 1ZO2A 4RQ9A 3GSGA 3CMZA 4B4XA 1LSXA 1UI7A 1DMQA 2KX6A 3ZNTA 3FF2A 4FCJA 1IYSA 2WZJA 2WKQA 5FASA 4LJ6A 2M1CA 4ZAMA 2L1SA 3KSPA 1C7HA 2F5MA 2WZZA 1ZGXA 1UFZA 3UB9A 1IELA 5H37D 1IN4A 1Y8GA 4JF4A 3DWKA 3MSHA 2V1CA 3UK6A 4GMQA 4QB8A 1HD8A 2QKPA 4IVIA 3EIEA 4OVZA 2QQ8A 1IN7A 1SXJB 3T38A 3W4PA 3AHSA 2ZJ9A 1EIJA 3H82B 3SZTA 3Q1CA 4L7KA 5HAPA 3SS3A 5CGWA 3MMPA 3DGNA 5FEGA 5DTKA 4Z8XA 2P09A 5CTNA 2FNAA 1F8NA 5JPPA 5HFOA 5C1BA 4U0TA 1K54C 4GB7A 4HBTA 2Y0QA 1LNIA 2O9AA 3Q8XA 1RCJA 5ELJA 3MHEA 1NJI4 1Q39A 2IMJA 1X1UA 4PD2A 2YKFA 1QZMA 2P04A 2PNCA 4LGWA 3JUQA 1CEFA 3VP4A 1NJGA 4LJ8A 4LV0A 1NJFA 5I94A 1TR8A 3X41A 2EA9A 3HU1A 3VP0A 3SYUA 3LT8A 5EJCA 1E9RA 3TWLA 3D4FA 3EN1B 4HM5B 3BOSA 1NNVA 4I8OA 1OFIA 1V74A 1LTMA 3S67A 1H6UA 1V9ZA 3KFUG 3X40A 2K0BX 2VJWA 3F14A 5EXPA 4G3WA 2JWSA 3DZDA 1FGTA 3H4JA 4A5RA 2EX6A 4DRTA 3KSED 4WW0A 1GCEA 1PRQA 1IT7A 1VEKA 4KODA 2ZA4A 4DE0A 4FMDA 2DHYA 2ZQ7A 2WZXA 3T4OA 2K0MA 3KOYE 1I3IA 3RH8B 1Z09A 2C9OA 1GJSA 1M904 5ITYA 4XBOA 1PIOA 3PBSA 1G41A 1RGFA 4PKYG 4M4XA 1TDZA 1OHPA 4DV0M 1KDWA 5EVLA 2M7VA 1JTDA 4FD2A 4KG5A 4HZBB 4H3UA 2NUPC 3LMMA 2H5SA 1TS8A 3SHFA 2PD8A 1G8PA 2B24B 1SXJE 5FA7A 3JR5A 2CWTA 4CLCD 3GPUA 3ZNYA 3HKPA 5HWWA 3UL6A 4IBDA 5EM0A 3F1PA 3GRVA 2I7NA 3HU2A 1RNTA 1VQ73 3SOYA 3PXPA 4IHQA 1OF5A 1LSWA 3FG4A 5E2GA 4MMZB 4WEJA 1IVXA 2CV1A 1KOUA 4P0MA 3K5TA 4GEWA 1KSFX 3NOPC 2ZM8A 3GLFB 3X42A 1YLTA 2JUJA 4KUKA 5IENA 3B7NA 5DVAA 2KAAA 1FCMA 3LCVB 1T18A 3OWUA 4XT2A 3GLGA 2WADA 3HHZA 4N6TA 3H9WA 1U8CB 1Z1SA 3GV9A 3ZG9B 1ZV1A 4K90B 4XDWA 4N92A 3WWXA 4K1VA 2CFKA 3A0SA 2HPBA 1CYUA 2G8LA 2L09A 1OHOA 3F8XA 2HHHM 1EW0A 4BJPA 4ZJ2A 3A46A 4Y2FA 3DM8A 3RFBA 2UXCM 1DMNA 4LFBM 1MOLA 1E25A 3ITBA 3IX3A 5CXOA 3NC8A 4LV1A 4CGYB 2V20A 1NB5I 1OIPA 4R38A 3M8CA 3UY6A 4EESA 1I2WA 4RNYA 4S2PA 2F5QA 1C7YA 2VZWA 5KSCA 3PBRA 2FS1A 3UPPA 3UNWA 1OAOC 4LCLA 3FRIA 4O01A 1J7KA 4DR5M 2GQFA 3EBTA 4KZ8A 4UN2B 1JR3E 2Y21A 3W68A 1BUEA 2V2FF 3P98A 3U5ZB 3ZYTA 3L7HA 3QP8A 1IM2A 1W4NA 3IX4A 4F3LA 1K57A 3ZG8B 2HMOB 3S7PA 4P6ZS 1QAMA 3KSFA 3G6OA 2D1WA 3S29A 4QJGA 2FH0A 1E4DA 1ZMUA 3HUNA 2PBDP 1KVLA 3WA3A 3R4KA 5KPRA 4HI4A 4JLFA 3R8FA 1S66L 3GRYA 4H6JB 1N9JA 1L2DA 2UGIA 3IJEB 1AVLA 3C4PA 3N8LA 5EV0A 4GS9B 4L8OA 5L09A 3QHYA 1F5MA 4GW9A 1IXSA 3DOAA 5DYIA 2XZUA 1DE3A 3I51A 5HPIA 3LOYA 1YIJ3 3FZCA 1JQJC 1M9GA 1OJLA 1Q42A 3V92A 2H0IA 3KP1E 4HYZA 1L8QA 3WS2A 5HW3A 1XGJA 4J5GA 2KDLA 1I8VA 3BQAA 4GD8A 3A98B 3G8ZA 4LZIA 4BBAA 4NETA 4RA7A 3G30A 4EV4A 2C10A 2O0YA 2I9VA 3KS8A 4GC9A 3BW6A 5A0OB 4X66M 4HHDA 2XDMA 3DGYA 2XQZA 3SYKA 3FKWA 3Q2PA 1P9RA 2P7JA 3NV0A 4KVHA 3UZUA 3I4VA 1V9YA 2P9VB 2PR6A 1IYOA 5FLXS 4NXFA 1QUTA 5DJTA 3NOTC 4DN0A 3E4OA 3S5CA 1VETA 1GVNA 3E4QA 1MKIA 2CFWA 3GQZA 4JKTA 3D3LA 1GHPA 2X8AA 2W9QA 3AMOA 4LFAM 1F4IA 1AR0A 2K31A 4R3BA 3WRZA 2AVXA 4LENA 2VGLS 3T1HM 3UDIA 1ROVA 1A90A 1BANA 1XHBA 1FSYA 3NCKA 1O7MB 1VQN3 1IYYA 2C5WB 4KG6A 5CECA 1CQAA 1OGZA 1I70A 1BZAA 4JF5A 4MBHA 3LVWA 5EP3A 2ZC4B 4GOGA 3S7OA 3ZCBB 5A91A 2C11A 4WYKA 3G4S3 1YUBA 5I5LA 1RHLA 1L0EA 3DTIA 4OOLA 2SARA 1UDII 1IN8A 4QOSA 2VLGA 4RF0A 3I04M 1TEMA 1YSPA 4DR6M 2CH9A 2V8FA 3SS4A 3ER7A 5HL6A 4MGIE 4DV5M 1G6AA 1KYIA 3WA2X 1YQSA 4KT0F 1A2VA 2CP8A 5HWTA 5AQ9A 3AFHA 4E3IA 4MEZA 2QENA 4R3DA 2R18A 5AIIA 3TE6A 2JXNA 4AKYA 2JQ5A 2HAKA 2XK1A 3F1OB 2Z8YM 5AYRB 3TPZA 5FQ9A 3WS4A 3T4SA 4EBGA 3EQUA 4BQMA 4YFMA 3RGPA 5U47A 4HH3A 1FCNA 3ZGAB 1EI5A 1PJTA 3OPLA 1JKGA 1S3SA 4I39A 2IY2A 4Q53A 1X1WA 1TS6A 2R4IA 4XB5A 1A0KA 4G6ZA 3CUEC 1BLHA 4G3VA 4KQQA 3T4LA 4HIAA 3MK6A 2XFSA 1GA9A 2HJ9C 4HP9A 4IJFA 1K6SA 4P16A 3LIEA 4BENA 2M5ZA 1RGYA 4YINA 1PW1A 1K55A 3TRCA 2Y2OA 3AGDA 1CF0A 1KVMA 4GN2A 1DYUA 5CRFA 2YFQA 3G6E3 3OCLA 5BR8M 3F1NB 3GZXB 5KPTA 1VQP3 3MZEA 3KOWE 2EA0A 4LCMA 5DFXA 1NO1A 1J3WA 4YY3M 1OUNA 3IBJA 1BSDA 5HDDA 1TU5A 4DV1M 2A24B 5IT9S 4G3KA 3IF6C 1W8QA 3LXUX 1STDA 2PHYA 4D80A 3F40A 2D7EA 3U60B 3FZWA 3BFGA 1R7RA 3MMHA 3SASA 1WMPA 4NSOB 4PM7A 3RGRA 4G4NA 1EUIC 3Q3FA 3M2KA 1MX0A 3HI7A 3DA1A 1D0LA 4RNTA 5IG5A 3NDEA 4CLCA 1X37A 2A5YB 3B89A 3KYEA 3VV4A 2KDKA 4G1MB 4AQYM 3KYZA 1DGHA 3LEZA 3NJAA 1QVF2 1HLUP 2X4AA 2YR0A 3LEQA 3GQ4A 2R4JA 1YJN3 4WZ5C 4X56A 3K63A 4NG2A 3JUMA 3QYBA 2XF3A 2MC8A 3HGIA 1AQZA 1BSEA 1OIZA 1XPBA 2QNJA 2J7NA 1YT4A 3O8YA 1Q2QA 3FPVA 1VQ83 4LRXC 3I01M 3RDEA 4Y0UA 3WOFB 3A0VA 2Z2MB 3GDIA 1CUKA 4AKHA 4AG6A 1NV9A 2YNMD 5GKNA 1UUVB 2QBYB 1VM1A 2VV7A 1N9EA 3ZFZA 2VF8A 3BNBA 2W0QA 1ES4A 2BJWA 2GEYA 2XFTA 2DCFA 1CI9A 1MBLA 4FD8A 4OQHA 3B7CA 5ELUA 2KF4A 2WAFA 4MLLA 4AG5A 2R62A 3SMPA 1VQL3 3O87A 3EB8A 2L6OA 2GBXB 3IXHA 4XT2B 1ES3A 3ISGA 3CME3 3PXGA 1BVIA 1VQ63 1WIVA
chains in the Genus database with same CATH topology
3KIIA 2WAEA 3HIGA 4FH2A 5DYGA 2YFLB 1FOFA 4BD0A 1BULA 1CK3A 3IHBA 1GY7A 3AL0C 5GLAA 4OP8A 5KQDA 3IXGA 2DHRA 3DW0A 2YFJB 2DNSA 1WTHA 2J8YA 1NZUA 4OKPA 4R1KA 3AJIB 3KSXA 3FSDA 3Q90A 1BTLA 3NV0B 5KO3A 1I5QA 1ESUA 5ITXE 3N7WA 5EVID 3FUVA 4OLGA 1R6BX 3LVVA 4N6MA 1MY8A 5FQQA 1E3RA 1JB2A 3J27B 1ULJB 3GQ3A 1IBKM 3G4PA 1AXBA 3UE3A 1Z5CA 3HUMA 3VSLA 2F98A 1XXHA 1DO2A 2G5GX 1WMNA 3RXXA 3B4OA 4M9XA 1XMQM 2V1UA 3WS0A 1K734 4KG2A 4PDGA 2HP9A 4GKKM 2BNGA 1GY6A 4JPMA 3IH8A 3SC3A 3VF1A 5HAQA 1OFHA 4LZZA 2OTJ3 2Y2KA 5EVIC 5KPZA 4WMCD 4PT5A 3HLDA 2VGJA 4JV5M 2E2TA 3TDGA 1AVKA 2R4EA 4KZ5A 5FTKA 4NL4H 4QHCA 4CJNA 1E3UD 5CHJA 3E9SA 2BMOB 1TDGA 4GITA 4K1UA 1JR3D 2EUCA 3QAUA 2Y2NA 3N8SA 2Y55A 4C3QA 3BECA 2GBWB 2UWXA 2F4VM 1WMOA 2Q07A 3N6IA 3CCL3 4L15A 2ZC7A 5FTMA 2B1XB 2CIUA 5DRVA 2H0TA 3OWYA 4GZBA 4MMYB 3CZDA 3K92A 5LMNM 5TGNA 2INXA 1BT5A 4DV4M 4JBFA 2LNHC 4QWTA 3M6BA 1PI4A 3VFHA 2F5OA 3U5ZA 1IQYA 4MH0E 5ITUA 1IN5A 1ULIB 2EFUA 3X3XA 1WYCA 2HP5A 2RGOA 3BNCA 4Y0TA 3L2AA 3OX9A 3NBBA 4LMIA 3HX8A 3GLFA 3VP1A 2HDQA 5FATA 1SXJA 1GL6A 4HM6B 3ITAA 4WEKA 5D3OA 2CC3A 3IF6B 2DRWA 3N9HA 3EC9A 3NQZA 5G2GA 2C98A 1YLYA 5CEDA 1I4WA 1JWZA 1OHSA 4B7HA 2FGTA 1EWZA 3GPXA 1TFOA 1N5PA 4REZA 1WNHA 1LXEA 4EQIA 4DDYA 4WURA 2O9UX 4WBGA 4JI6M 1NDOB 3CPW2 1DGFA 3PVSA 3J81S 3LCEA 3QNBA 5HL1A 3SVAA 3PAEA 4KZBA 3HHWA 1E97A 3WMDA 4P6BA 3STDA 1VQ93 4KHPM 5F1GA 1QMAA 1HKXA 2BT3A 1G68A 3LYGA 5KP1A 4LRSA 3FV7A 4XBTA 1QAQA 3IWOA 3LTDA 5EEOA 1RJOA 5FQJA 1YJW3 4MB7A 3ZG5A 2OQEA 1TGUA 3VSKA 1FCOA 4Y0OA 2DWLA 2Y2GA 3I553 2UXDM 4KZ7A 1L0GA 3CU3A 2E2VA 5IZ7D 3WRTA 2VGKA 4HBRA 4OK0A 3O88A 1NHGC 4LG2A 3HBRA 4HM7B 3GLIA 3TWKA 1HT2E 2CFDA 2FOIC 5KP3A 1SXJC 5GHXA 5ITXA 1KE3A 1ORYB 1KQS2 5GLCA 1NSFA 3V99A 2Y73A 3MKEA 1HR0M 4HEFA 5A2QS 1KE4A 1TVFA 4BL3A 4L16A 3JVCA 1JVJA 5EOEA 2L4VA 1NWWA 5KQ8A 3VK8A 1S0WA 1WE4A 1LNHA 1Q814 4NXNM 4OP5A 2CFLA 4JXJA 1Q824 1NU3A 3KDSE 1HQYE 1MU5A 3EHCA 1W79A 4WZ4A 5CK6A 3J7BA 1U5OA 1CYVA 3G34A 2W9PA 3PAGA 3IWQA 5LC7A 3M6AA 3CF6E 2WO0A 3PTEA 2Y2HA 3S28A 2L7HA 1HZOA 4OUQA 5GHZA 7CATA 5DF8A 4I4LA 5JBSA 5IREB 4DV6M 4RX2A 4JN6A 4ZJ1A 3DGLA 5IEPA 1YHQ3 3NI9A 5DREA 1FSWA 2WUQA 3E99A 2EO2A 4KZ4A 2W6JH 1GS3A 4LJ4A 4O02B 5BXQA 3UDFA 3W8KA 4OOMA 3S22A 3MZDA 3RGSA 2ZQ9A 2WGQA 1DJCA 3CNMA 3EF8A 4X6TA 3TL4X 2BNKA 8CATA 3L29A 4GH9A 4HBUA 2R46A 3Q7VB 3M0EA 5EP4A 1PFPA 2ZLYA 1YE9A 4N6V0 2NQ8C 3ZH9B 2CWVA 1Q40B 5AEUB 1M40A 2CHQA 1YMSA 3PGBA 1GYBA 2ERCA 5EP2A 2X01A 3GLIB 3HK4A 4PCZA 1QANA 1W2ZA 4K0XA 3LMLA 1US1A 4H61A 1ESIA 3DZLA 2Y0TA 4FMBA 4X65M 2FE8A 1A67A 1IK3A 3I0YA 2YFIB 5IWAM 3FLJA 4PM8A 1YSYA 5IW9A 3Q7VA 1N34M 3VMAA 1PJJA 2W56A 3A76A 4GIPA 2BMRB 1Z5AA 2QZ6A 4MGZE 1SKFA 4DR4M 3FD9A 3HU3A 4NRVA 4JI8M 2GU3A 2EFXA 3NDGA 4HM0B 2IUJA 3GZRA 5HARA 4R0QA 3S1YA 2YX9A 1HNWM 3PXMA 5LC6A 3CCV3 1SHVA 1SQWA 3LTCA 1L2SA 1ONHA 1TH4A 4CPKA 2EX9A 3NHXA 5D81A 1VQ53 5A90A 2K47A 5FTJA 4GDNA 4BD1A 2UUAM 1EA2A 1PM5A 1EROA 3V3SA 3PBTA 1W7CA 3CXC2 1DVCA 4D82A 5IERA 3W0LB 1YLWA 4IBFA 2ZDJA 2OOVC 1TP6A 2JBFA 4KZ3A 2KA6B 1IN6A 4OQIA 4AKZA 3R9XB 3DUKA 3GLHA 1NXYA 1LL9A 4M0WA 4NOOB 2CEAA 1CI8A 3GZYB 4LJ5A 4G4QA 4UA9A 3K2LA 1DJBA 4GRIA 3G16A 4BTWA 2WGWA 4XXRA 3DFZA 4KQOA 1YLJA 3GMWA 4BL2A 1EKMA 4B4ZA 1M6KA 3UNLA 3KKGA 1FJGM 2Z76A 3NM7A 2WGOA 4AKIA 3PBQA 1IQPA 1ZC2A 1STFI 1FUWA 4KFEA 1TUHA 1OCVA 1A2KA 2BJVA 3MPHA 1JN5B 4R4KA 4MMXB 4UHUA 1TFKA 4B7GA 4LV3A 4R9KA 1K6RA 5BVBA 1GY5A 2F5SA 3U6CA 4GNUA 3U6DA 2EX8A 1UM8A 1O7PB 3GWRA 3KFQC 5A92A 5FSWA 5F3WA 4II7A 3TQSA 1O7EA 3NM2A 4R7GA 3WOEB 1E3VA 4HLQA 5EVIA 4ZTKA 4LFCM 3UJMA 3TWMA 3LY4A 1FQGA 5CGXA 1L5GB 1ISKA 4LF4M 1IVVA 2C9CA 2JDIH 2J9PA 2V1ZA 4EUZA 5CEBA 3OC2A 2Z7AA 1N8R4 1HT1E 2HP6A 1HNZM 4OQ0A 1Z6FA 2Q9NA 4DXBA 4K61A 4MGYE 4HESA 3PBNA 3VSYA 1NY0A 2Y20A 5AEWB 3JR4A 2DZOB 3FH1A 3HIIA 4DE2A 3T0UA 4FCMA 2WOHA 2R45A 3BLZA 5IG4A 2KZSA 3VLFB 1NVMA 3A3JA 3MYTA 2IA7A 3O3VA 1JB4A 3OWSA 4E6WA 3OTOM 4KO8A 3CCE3 1K55C 1K8A4 2KRTA 4C6YA 3ALAA 4G4RA 2Y91A 3K8ZA 3CF0A 1T3TA 1Q3BA 3MKFA 4IT7A 3FKVA 1PYYA 3G2YA 2OQEC 4DV2M 3F9SA 3F7SA 5E6JA 2WKEA 3DGOA 2WGWB 3FGYA 2KXGA 3KOXE 1QQWA 3MXSA 3PCRA 1SIHA 3NIAA 4BB9A 4LCBA 1TIJA 1KFVA 3EQQB 3F7XA 1W5ZA 2ZD8A 4M3KA 3FUUA 4LRTA 3A3DA 4N6NB 1QMEA 2DWZB 3WHKA 2DVWB 1FR1A 2ZC6B 4RBNA 4N3VA 3FKEA 1FR6A 1WQLB 1E32A 3EE1A 1AV4A 4FMCA 4R9LA 1OMEA 2A15A 4R1GA 1XNRM 3CC43 4WELA 1L0FA 2P5TA 1IBMM 3RJUA 1ZAEA 1SXJD 2QMIA 3CCJ3 1ASKA 3DMCA 2B5RA 3KXEC 1JB5A 5DF9A 4YHHM 4L78A 4LV2A 4JI2M 5E2HA 4IBXA 4JXWA 3UE1A 1NY6A 3I563 1GKIA 3GO8A 2RGHA 3VDPA 4FWDA 2QIYA 3HJQA 3WHLA 4LF9M 3ZG7B 1IBLM 1E3UA 2QBYA 4NREA 3PNYA 1OACA 4M9ZA 3UJNA 4BTXA 1KD14 4L8RC 4AEQA 2X02A 1FGMA 3F8HA 5IG0A 1JV2B 3OPHA 3UPOA 4XBXA 1R2ZA 2R9WA 4EBLA 1MPLA 5FI6A 5TR7A 4QHTA 3SAUA 3A3EA 5STDA 3IXDA 2HCBA 2Z2LB 3DXOA 4CDLA 2WKHA 5DTTA 1W7FA 1PW8A 3OPRA 1IQ8A 4LJ7A 2A49A 4K0KM 3S4XA 4LJ9A 4OU7A 4LF8M 3CMA3 3ZDJA 4S2NA 2GU1A 2D7GA 5L2FA 3MWZA 4WFOA 4B3TM 4U0XA 1KGGA 4BLMA 2ZAOA 1ZG4A 3KP0E 3BLMA 5F83A 1DGGA 4DR3M 1W6YA 1LL5A 1T5YA 5EUAA 2P05A 4IJEA 5F82A 3V3RA 3MG3A 2OLVA 3SOIA 1XA7A 3CC73 3ZG0A 2PBYA 4ORLA 3AOEC 3A3FA 3C58A 1Y4KA 1PI5A 3CD63 5IF6A 2CFOA 2CHGA 4LF6M 2UU9M 3MBZA 3U1WA 4RNZA 3FUXA 2GEXA 3VOZA 3N8RA 3G0KA 5FQMA 3AV0A 2OOVA 2XR0A 3HLEA 1MWUA 2LYXA 4IBBA 3NBIA 2VIIA 2FXTA 2W82A 4GB5A 4IVKA 4X55A 4RYEA 3TG9A 1HTZA 2JA2A 2KRUA 3EN8A 2OLUA 4AZFA 1IXZA 1VQQA 2JCHA 4IBJA 1NYMA 2WGVA 3U6OA 1K41A 1XX2A 1G59A 3CCS3 3NBLA 2XGLA 4S2LA 4IBCA 4S2MA 4X69A 4S2IA 1UI8A 2Z7JA 3SH8A 1KDSA 1H8YA 4X68A 1GHMA 4PDIA 1GHIA 4ZJ3A 3W0FA 3Q07A 1M1XB 1ERQA 1N4OA 1Z5BA 1OF5B 1IDPA 3T8UA 3NY4A 3VP2A 4J8TA 3GQ5A 1E94E 1RRHA 3BFDA 3CCR3 4LF5M 3HL9A 3E2KA 3UPNA 5D82A 2PZVA 3IHAA 5AQBA 4OPZA 3NXJA 1GLNA 2EX2A 1GL7A 4N6OB 4X62M 4MEIA 3GVBA 3IPTA 3H51A 5IG3A 4S2KA 4N1HA 1IYQA 1PZOA 2KXEA 1IEMA 3OCNA 4WP5A 4ID4A 2HMJB 3X3ZA 1L1TA 3GRUA 1IXRC 2ZC3B 4ZBEA 1G4AE 5AIFA 1SIIA 3JUPA 1QVRA 1BSGA 4OPQA 2WOFA 3T15A 1L2BA 3FKAA 4DUYM 1ES2A 2Y4AA 3A42A 3IF6A 5HAIA 3SLUA 2LH0A 3MSOA 2H10A 4DV7M 5JI2E 1IKIA 3SEDA 1J9MA 4P87A 3G32A 2Z4RA 5CLKA 2IUKA 4MNRA 4C75A 4GHAA 1JWPA 1KGEA 2W04A 4LJAA 3NBRA 3ZC7B 3D8LA 4ZDXA 3PBOA 1SDNA 2UX0A 2J7VA 3IG5A 2HKJA 4B3RM 3LY3A 3KSJA 5FQIA 2EXBA 5FI2A 3PFIA 3HJSA 2ZL8A 3SYLA 1O07A 3GR2A 3IH9A 3IG8A 1TDHA 5IEOA 2ZMAA 4DE3A 3EX9A 3FTEA 1W5DA 3CCQ3 3J2PB 3WS5A 2XH9A 2OPFA 2OCTA 1QJGA 3JYIA 4FH4A 3HLBA 4MBFA 3SOAA 2IWDA 4R23A 1QYRA 4OVZB 2WGIA 1NNUC 8CHOA 3HLCA 2XSZD 4S2OA 4EXRA 5CERA 6STDA 3HLWA 2J7OA 4E3LA 4WWUC 3HHYA 4JI4M 2ZQDA 4LZJA 1PZPA 1NHWC 2F5NA 4N6UA 5EXTA 1VQM3 1SDEA 1LI9A 1TH2A 3FTCA 2QCUA 4EYCA 1RP5A 5TFQA 2Y2JA 3VKGA 5FQKA 3ILKA 2DWNA 2KEBA 4UAAA 2UUCM 2Y59A 3SH7A 4HM8B 4K91A 5LMUM 4U3TA 2O5RA 4O3VA 4DR2M 1DJAA 1I94M 3EQVA 4H8RA 1FA3A 1ZQ9A 2ZANA 4OW0A 2ZQ8A 4JI0M 1YJ93 3U6PA 4WM9A 3ZCZA 2H1RA 1ROAA 1EE8A 1EG9B 4DR7M 3HJ8A 3KZTA 1O7NB 4RX3A 5AQAA 3KN4A 3IT9A 4N9LA 1M1K4 3B9PA 3MG1A 2Z3XA 4OQGA 3SATA 4DDSA 3PNVA 3HREA 3G31A 3U97A 4ZM8A 4LF7M 1YLPA 2Y2PA 4OH0A 4QHSA 4Q8IA 4DF6A 1Z59A 3DWZA 2RFRA 5EQTA 3NQYA 3J7AS 2XSOB 1ES5A 1K57C 3E4RA 5J8XA 1RRLA 4X53A 1JN5A 4B7FA 3L25A 2HDUA 3NBJA 3IMAB 5EECA 1L1ZA 1RN7A 2G2UA 2RSXA 1EQKA 1K3XA 4LGYA 2P38A 3IXBA 1H5XA 1O7HB 4HZ9B 2XLNA 3BLSA 3HWSA 1YGEA 4P85A 4JYAM 1IVWA 1XA1A 4WYYA 3MJ5A 3FUWA 4OOYA 1PU4A 1K4EA 1QAKA 4E6XA 5CTMA 4EV2A 3I4YA 1K56A 3CCM3 2GXFA 3TOIA 4IPBA 4D2OA 2HMNB 2C99A 1JKGB 3FCSB 2LWXA 3IWIA 1YLZA 2F86B 4TX4A 1JJ22 4LY6A 1FGRA 2OQ4A 4JXSA 4FWHA 1H8ZA 4B08A 2LQVA 3GP1A 2E5LM 2PU4A 4RVAA 3V39A 4CCVA 1GD3A 4W5WA 4L0LA 1I2SA 1SJWA 5AIGA 3N8BA 4QY5A 1OH0A 3G2ZA 3VKHA 5HX9A 3ZVTA 2DZNB 4IIWA 4DUZM 3BNEA 4E3KA 1MWTA 2V6ZM 1QAOA 4OONA 4E3NA 4BLCA 4MGHA 3BNDA 2BHMA 3FTFA 1XMOM 2OTL3 3OW22 2X71A 3VOYA 1IV9A 3QNCA 2FFFB 3U60A 1CEWI 1DVDA 2ZQCA 4PM6A 3GTCA 4FR9A 5GHYA 1NRFA 4N6LA 1IXSB 2Z77A 3HUOA 1R4CA 3LT9A 1W01A 4LEHA 1NYYA 2UXBM 4MBKA 4X64M 4AI6A 4WHAA 5M18A 5DTSA 2MF7A 4KFDA 4O7DA 5JI3E 4K0WA 4L4UA 1D6ZA 1IU7A 2R9XA 1Q3CA 1W02A 4R3JA 3Q81A 2IWCA 4KZ1A 2UUBM 4R80A 4GHLA 5CXWA 2KRKA 1JTGA 3S27A 5CF1A 3KE7A 1O7WB 3J7Yd 4X2OA 4B3MM 4EBNA 5JYOA 5M1AA 1SPUA 3FWLA 4S2JA 2W2CA 3SFZA 3DGMA 2Y74A 2ZM2A 3FG1A 3RGAA 3V98A 3RE8A 3L27A 3B3XA 4GD6A 2CV0A 1K54A 5FAPA 2QP9X 2QPNA 1K25A 5ITRA 1QAFA 5EE8A 4CHTB 3KVWA 1HVBA 2M60A 1MNLA 3SH9A 4FW9A 2DWMA 4PPRA 3N54B 1DGBA 2P0XA 3U61B 5EPHA 3THGA 3CC23 4HVNA 2QA43 3UDXA 5FGOA 1FGQA 3GRRA 3FYZA 1U60A 1XXMA 2XGNA 1KE0A 3DTMA 5BPVA 2WYXA 5EQLA 4JI1M 4EBPA 2ZC5B 3LO7A 5JYPA 1TH3A 4IBGA 5FTLA 1W6CA 4FCTA 5F1FA 1VDDA 1UUWB 3HVFA 3HHXA 1BLCA 2CK3H 5BOHA 1W5TA 4N9KA 3AOEA 4NSRA 4JI3M 3MHVC 5KMWA 4OPRA 2C5RA 3NWLA 3GAXA 1DO0A 3LZAA 3P09A 1J5EM 2K54A 4KLNA 3GRDA 2EXAA 1HQCA 2CUZA 2XZFA 3JUNA 1R2YA 1DMMA 2P74A 3Q1FA 4B3SM 3LTBA 4TUWA 2OWPA 1ZG6A 1SCWA 2W03A 3RFWA 1N36M 4HL4A 1ZKJA 3X3YA 3NUVA 2KCDA 4NRWA 1PWDA 1G3IA 4STDA 1W8YA 3WDGB 3SS5A 1XNQM 4FWGA 2SBLA 3BEBA 2Q9MA 3W4OA 4LSOA 1IY2A 2BO9B 2KW0A 2XD1A 1D2NA 4I4KA 4LGQA 4XUXA 1YVBI 4NHFA 5EXSA 1N9BA 2ML6A 1UW1A 2G2WA 1C1KA 2CW9A 3IF5A 4WYKB 4I5SA 2VQFM 2I9WA 5KZHA 4LGMA 1LI0A 5GLDA 3SAWA 4UA7A 1DY6A 3U6MA 4FVMA 4PM9A 1S6RA 4UA6A 5FAOA 3SARA 1VQ43 3BYDA 7STDA 4R4RA 4GKJM 2ZAMA 4MGKE 4JF8A 1YIT3 4JXVA 1VQO3 2Z6BA 1GA0A 3V50A 4OVMA 1IQXA 3AKZA 1L0DA 3O86A 5CGSA 2Y2QA 5A93A 1IY0A 2LXEA 5JPUA 2Y2IA 3SBJA 3K9MC 4QOZC 2RL3A 3HZPA 1IKGA 1K4FA 5FTNA 1N33M 4FSFA 1XKZA 1S5AA 3NX0A 3L0RA 2HMMB 2V1LA 3MG2A 5D83A 5FAQA 3D8BA 3K1JA 3I7JA 1KWIA 2XD5A 3C5AA 1YM1A 2BMQB 3UN7A 1IT8A 4KZ6A 3C4OA 3AGEA 5ITQA 2ZQAA 4PEJA 3ZVWA 1HU9A 1G96A 2M7OA 5AQ7A 5EP1A 3SX1A 1N78A 1CQSA 1VZZA 2JE5A 3MXRA 2X49A 4XGIA 4KZAA 1JRQA 1DGHB 2WKIA 4JXGA 1NZOA 5I97A 3JAMS 2ZM6M 4QD4A 1YI23 1ZX2A 1NJ4A 5KP4A 3G713 2RCXA 3LQRA 4IBKA 2XSHB 2H0YA 3GRJA 3J80S 4E3JA 2RGQA 4RF1A 1KSIA 2Z4SA 1JNQA 4HM3B 2STDA 3UE0A 3C7UA 4HM2B 2CV2A 5CHMA 1VQK3 4BTYA 3UO9A 4IBIA 4O2HA 3EIHA 4AW4A 4GC5A 4HM4B 3C7VA 3T8NA 4ITQA 5ITTA 1J09A 4CISA 1Q864 5G18A 1WYBA 4KZ9A 3Q82A 2FFYA 4RZMA 1XGIA 1GD4A 5AYSC 1IV7A 3G35A 3AOGA 4FCVA 2JC7A 2XSZA 5FW5A 3FYDA 3M2JA 3LQQA 2AHMA 2QPAA 2VQEM 1W6GA 4A3VB 3SXXA 1Y54A 4I81A 2D7HA 1MXOA 2CHVA 3FYCA 4KQRA 4E3OA 4RNAA 4JRFA 2CWUA 2RKOA 1OGXA 2R65A 1K28A 3VDUA 3PS8A 4QNMA 3K0ZA 5E43A 5HGRA 1ONGA 5AI1A 3OPPA 4XUZA 3CTWB 4WMCA 3D9RA 2E2UA 1K3WA 5DNYA 4GKUA 2XLJA 4KFFA 5EVIB 2GDNA 2J9OA 3BFEA 4HKVB 2OV5A 4L8PA 2HDRA 3VGNA 3FTDA 4JI5M 4O8SA 2WK0A 1BLSA 4MM3B 1LLBA 3EJVA 3VK7A 3CJMA 3HLGA 3GPPA 2IWBA 4G4OA 1PJIA 3TSGA 3SHGB 3QRDA 3K7CA 1XXHB 1KGFA 1PWGA 4FCFA 3FUTA 3OZHA 4MJDA 3OV4A 2C6WB 4Y7PA 4XDVA 2ZBKB 2RCDA 3CNXA 1ALQA 3U6EA 3CF2A 2CFGA 3E2LA 4Z6YA 3SMSA 4EIWA 3DY5A 2CG1A 4OLDA 3A3IA 4PMAA 3U6QA 4AKGA 5FDHA 2DXIA 3W4QA 3OXAA 3L28A 2D42A 3WODG 4Z9QA 1FNNA 2CG0A 4OPYA 2Q2EB 3EBYA 4IIAA 2C96A 3VFFA 2XRXB 1LHYA 1XWIA 4DXCA 3H3HA 1D6UA 1NO3A 4HJLB 3UMMA 4S12A 2HL7A 2OSUA 4B88A 5EXXA 4E3MA 4R4SA 2QGUA 4J9AA 3PCSA 4DV3M 3KS4A 2CKFB 3CCU3 3VP3A 2QZ4A 1YMXA 3V5MA 3B8LA 3VFDA 1K56D 4FCZA 3U6SA 3BRMA 1LVNA 2Y2LA 5FI7A 5E2FA 5TGFA 1XP4A 1N75A 2F99A 4JF6A 3GLHB 1W5SA 2W56B 4OVDA 4N1XA 2FFJA 4IEDA 3PZWA 1N77A 1N5HA 3ROBA 5GL9A 2YQZA 3Q7ZA 3LTAA 5EVHA 2CHCA 1ERMA 2CE7A 3UGJA 3BFFA 1FGOA 3GPYA 3MZFA 4GDBA 1NB3I 3JUOA 1J2BA 3ECFA 4HM1B 5CF2A 1Z6TA 3KOZE 3N4IA 4GL6A 5GLBA 3U61A 2E8IA 3HLFA 4F94A 3M7GA 3UB1A 1MWSA 1N32M 3CPOA 4D81A 1IY1A 3MKIA 4OX9M 4EV5A 1BLPA 5CHUA 1E9SA 1BUQA 1MWRA 1JWVA 4XBYA 1XC8A 3FF0A 5EOOA 5AIHA 2O3OA 2L7IA 5FSRA 4KENB 3B4PA 4QY6A 4ZPXA 2XEPA 3UL5A 3IQAA 3GLGB 4NK3A 4DR1M 3KW6A 2XR8B 2HMLB 1S723 4QNRA 1KC84 4QU3A 5IHVA 1QVG2 3BFCA 4EWFA 5E26A 1OPYA 4M0DA 2P0MA 1K38A 4X2HA 1K82A 1Q2PA 5E2EA 1CEGA 2HMKB 2ML5A