2XH9A

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGASPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
total genus 139
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xh9A03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xh9A01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xh9A02
1NJ4A 3VP2A 3OZHA 3BFFA 3AGFA 1MBLA 1SCWA 4R0QA 1ONGA 2C6WB 3PAEA 3UY6A 1YM1A 4KZ3A 4GDBA 1S6RA 4Y0TA 4CPKA 3ISGA 2A49A 3M6BA 1BUEA 3HLDA 5AQ7A 5GLCA 1YLJA 3AGDA 5FAOA 1C3BA 3BLMA 5CHUA 4B88A 5F1FA 3GTCA 1DJBA 4HESA 2WKIA 4YINA 5FQJA 2WK0A 4EBPA 3IF6C 3IXHA 1RCJA 3RXXA 3B3XA 4OLGA 1Q2QA 3IF6A 3QHYA 4S2NA 5GLBA 5CRFA 1L0EA 4B4XA 1L2SA 3S4XA 5CERA 2J8YA 4WEJA 3IWOA 1PW8A 5GHXA 3WS2A 1BLPA 1CI9A 3GVBA 5G18A 5E2GA 3VP4A 1FQGA 1NXYA 1S0WA 4QU3A 1NZUA 4EV4A 3QNCA 5CTMA 2ZM8A 4CJNA 3A3IA 3VP3A 1MWRA 2VGJA 4KZ5A 3OCLA 5D3OA 3BFCA 4GZBA 4JXGA 4FSFA 1XP4A 3BRMA 1I2WA 3TOIA 4KQOA 4U0XA 3HLFA 5M18A 4JXWA 4PM6A 4IVKA 4QHCA 4GD8A 4R3JA 4ZJ3A 3IHAA 4ZTKA 4E3OA 4OQHA 4BJPA 5HW3A 1DY6A 3D4FA 3BECA 4JPMA 3C7VA 1NYYA 3VP0A 1WYBA 1QMFA 2C5WB 1XPBA 2Y2JA 1PIOA 1E3UA 2XR0A 2BLSA 3IXGA 1ERQA 1FCOA 4DDSA 3NDGA 1LLBA 2E8IA 4R4SA 3IWIA 4Q8IA 3DTMA 3WRTA 1E3UD 1SDNA 2JE5A 1LL9A 3M2KA 4O7DA 3UO9A 1ALQA 3LO7A 3VP1A 1XGIA 4IEDA 1JWVA 1PZOA 3IXBA 3V50A 1Q2PA 1VM1A 1XX2A 3DWKA 3MZDA 3O86A 1K25A 4JXSA 1J9MA 3QNBA 5CXWA 4QJGA 2Y2IA 1LI0A 5J8XA 3C4OA 5FQMA 1CK3A 1K4EA 3RJUA 4FH2A 2A3UA 3MZFA 3PBQA 1PI4A 1ES4A 3E2LA 3HVFA 1IKGA 5A90A 2Y2OA 2Y2LA 4E3JA 2WZZA 5HAPA 1RGYA 1I2SA 4MBFA 1H5XA 3NBLA 1ZG6A 4WELA 4Z9QA 5IHVA 4HBTA 1O07A 1YLWA 3CJMA 4RA7A 5EECA 4X56A 5FATA 3G30A 2P9VB 4DDYA 1ZKJA 4OOMA 4XUZA 3W4PA 3ZHHA 1GHIA 1HD8A 5DF8A 1M6KA 4FH4A 5F82A 4RX3A 5F83A 3M6HA 3P09A 4DRTA 2XEPA 4UAAA 2HPBA 4S2MA 1XXMA 1IELA 5GHZA 3OPRA 1L0DA 2WKEA 2X02A 3P98A 4X69A 5E2FA 5AQBA 2HP5A 1YLYA 2IWBA 5A92A 4XUXA 4WZ5C 3Q1FA 4P87A 4ZDXA 3CMZA 3UNWA 4YFMA 4H8RA 4WZ5A 5FAQA 3PTEA 3G2ZA 4LENA 4OH0A 3UN7A 5I94A 2WYXA 4FCFA 1YQSA 4KG6A 4E3MA 4LV3A 3SS4A 2JCHA 4KENB 4X53A 5CGSA 5FQQA 3N6IA 3G2YA 2OLVA 4JF4A 1N9BA 3ZGAB 3C7UA 4S2LA 2Y59A 3V3RA 2UWXA 4KQQA 1RGZA 4N1HA 3EQVA 4LV1A 3BFDA 3CZDA 4LCLA 3ZG5A 2WAFA 1KGGA 5AQAA 1ES5A 2PU4A 3G35A 3IT9A 3PAGA 5EUAA 3BYDA 1EI5A 2OSUA 3JYIA 5EOOA 4ZJ2A 1BT5A 4JXVA 1BLSA 1TVFA 1WYCA 3BEBA 2XF3A 3E2KA 1KGFA 2DNSA 3HREA 3ITBA 4HEFA 4L0LA 5CHMA 4DE2A 1YLZA 1KVLA 5CGXA 4QB8A 3UPOA 1K6RA 4Y7PA 1DJCA 3FZCA 3HUMA 3HUNA 1BULA 3CG5A 2XK1A 3NDEA 4OPRA 3O3VA 3DWZA 2ZJ9A 4JKTA 1FSWA 2ZLYA 3HL9A 3NC8A 2ZM2A 3OCNA 4OQIA 5HARA 4X68A 4ZAMA 4S2OA 1IYSA 1NYMA 5JYOA 3S1YA 2WGWB 4QD4A 5E2EA 2EX2A 3GR2A 2QMIA 4MEZA 2J9PA 4GB7A 4RVAA 4WM9A 2V1ZA 3UDFA 3V39A 4BL3A 1AXBA 2GDNA 3GMWA 1K54C 5EVIB 4EBLA 3ITAA 2XH9A 5M19A 1KDWA 5HX9A 3Q7ZA 4N9LA 4PM5A 4WEKA 2QPNA 4ZBEA 2PBYA 3UE1A 4IVIA 1N4OA 3AGEA 4GNUA 2Q9NA 1ES3A 3LEZA 2PU2A 4IBXA 3LCEA 4OONA 5HL1A 3OPHA 3G31A 2XD5A 3Q7VA 4KZ4A 3IH8A 4OLDA 3VFFA 2H10A 4KG2A 1KVMA 5CECA 3SOIA 4E3NA 4C75A 1K4FA 5FASA 5KMWA 1CI8A 1W8YA 4E3LA 5CEDA 4RX2A 1NRFA 3HUOA 3UPPA 4N9KA 4NETA 1E4DA 1XKZA 1YLPA 3BFGA 4MBKA 2WGVA 3WS0A 2Y2NA 3ZNYA 1M40A 3A3FA 4S2KA 3O88A 4DKIA 3HLBA 1W79A 1H8YA 2CC1A 1KE4A 2Y2QA 5FQKA 5KZHA 2OLUA 2HP9A 4DXCA 3BM6A 4KG5A 4R3BA 5E2HA 4EWFA 1GA0A 2ZD8A 5DTKA 3BFEA 3N8RA 4PM7A 3LY3A 3HLEA 2Q9MA 1HTZA 3FV7A 5CTNA 2ZM0A 1LL5A 1SDEA 1G6AA 1VQQA 2Z2MB 4DE3A 1W5DA 1JVJA 4UA7A 1PWGA 2QZ6A 5FI6A 5JYPA 1RP5A 3IF6B 3IF5A 3PBOA 2Y2MA 3PBSA 4OOYA 5GHYA 5GLAA 1DJAA 2WUQA 3GV9A 4PM9A 4KZ9A 3SH7A 5EVLA 2RL3A 5HAQA 3PBNA 1ZG4A 1G68A 3UDXA 3FKVA 3ZFZA 5FQ9A 3WS4A 4PM8A 3N8LA 4LV0A 3OPLA 1KDSA 3VOZA 2BG1A 4Y0OA 2XQZA 3WWXA 4X6TA 3GSGA 1ZC2A 1NY0A 3MXRA 4C6YA 5GLDA 3G32A 5HFOA 3C4PA 3VMAA 3ZDJA 1YT4A 2Y2HA 3A3JA 4ZJ1A 4MLLA 3FWLA 3Q82A 3A3EA 1ESIA 2V2FF 5DF7A 1MKIA 4BENA 1OMEA 1K6SA 3NIAA 1GA9A 3O87A 4OPQA 1KE0A 2EX9A 3SH8A 5DTTA 2B5RA 2XDMA 1YMSA 4JBFA 4B4ZA 1EROA 1K56A 4PPRA 3FKWA 2HDRA 3VSLA 5FAPA 1HZOA 1L0GA 2WADA 3V5MA 5A93A 2EFXA 1K56D 1FR1A 1W7FA 5DF9A 5AQ9A 2ZC6B 3EQUA 4N92A 3N7WA 1MWSA 2J9OA 4ID4A 2R9XA 2IWCA 3HLCA 4MBHA 5E43A 3ZVTA 5GL9A 1KE3A 3WRZA 3HLGA 4OQGA 4R1GA 4Y0UA 1LI9A 4EUZA 1KGEA 1XA1A 4LCMA 3VSKA 1GCEA 3VFHA 1BSGA 3UPNA 3C5AA 1XGJA 1ES2A 1I5QA 2ZC3B 2Y2PA 1BZAA 4GD6A 1PWCA 1XA7A 2ZC5B 4U3TA 5EPHA 3MBZA 4X55A 3UE0A 2XFTA 2ZMAA 5KSCA 4OVDA 3ZVWA 4OP5A 5TFQA 2ZQ7A 3IWQA 3WS1A 3N8SA 2OV5A 1FSYA 1H8ZA 4S2JA 5DTSA 3NI9A 1PZPA 2G2WA 4KZAA 4OOLA 3Q81A 5HAIA 1TDGA 2X71A 5EOEA 1K54A 2XGNA 4S2NC 4K91A 2X01A 2J7VA 4QY6A 4K0XA 4KZ7A 4BD1A 2JBFA 2HDSA 3OC2A 4OP8A 3MKEA 1FCNA 2Y55A 4MNRA 4U0TA 2JC7A 4JF6A 2HP6A 1QMEA 5M1AA 1SKFA 2P9VA 4DE0A 1MWUA 4XXRA 1YMXA 2P74A 5CGWA 2Y2GA 3M2JA 4BD0A 4DF6A 1PI5A 3IQAA 3NY4A 2WKHA 3GQZA 3MKFA 3G4PA 4OKPA 4S2PA 3ZG0A 1BTLA 4BQMA 3W4QA 4DE1A 2ZQ9A 2H0YA 4C3QA 2V20A 1K55C 5CEBA 4UA9A 2HDQA 2IWDA 3IHBA 4FD8A 4OPYA 1K57C 4KZ8A 1K55A 3ZG8B 3PBRA 2Y91A 1CEFA 2G2UA 2XD1A 2ZQ8A 3HBRA 1JTGA 3W4OA 1GHPA 3UE3A 1K57A 5U47A 4D2OA 4WZ4A 4BL2A 4OQ0A 4R4RA 4BLMA 1MPLA 4IBRA 3MFDA 3W8KA 3WS5A 1W8QA 4E3KA 1TEMA 2H5SA 3SH9A 4E6WA 1CEGA 1WE4A 5TGFA 3ZG7B 2VGKA 1MY8A 1BLCA 1GHMA 1PWDA 2FFFB 2WGIA 4JLFA 1Z6FA 4M3KA 4WBGA 2R9WA 4S2IA 3IXDA 3I7JA 1HVBA 2H0TA 3ZCZA 5TR7A 1FOFA 4P6BA 2EXAA 5FI2A 4GN2A 4N1XA 1SHVA 5KSHA 4DXBA 3A3DA 4WYYA 4E6XA 1LHYA 1MXOA 4GOGA 5FQIA 3SS3A 2FFYA 4PMAA 5FDHA 1ONHA 1IYQA 1JTDA 1JWPA 4GKUA 5DVAA 3UDIA 3VOYA 3MZEA 1IEMA 4E3IA 1IYPA 2RCXA 4R23A 3NCKA 4JF5A 4EQIA 2EXBA 1BLHA 3DW0A 2Y4AA 4UHUA 1IKIA 1YLTA 4KZ6A 5CHJA 3N4IA 3BLSA 4LV2A 4NK3A 2WAEA 2ZC7A 3V3SA 3ZG9B 1Y54A 2XFSA 4QY5A 2WGWA 1TDLA 2Z2LB 4GDNA 5EE8A 3Q7VB 4P0MA 2EX8A 5EVIC 1ESUA 4OPZA 1E25A 1NZOA 1K38A 5BOHA 3IH9A 1FR6A 5A91A 2DCFA 3TSGA 5EVIA 3GRJA 1O7EA 4WMCA 2ZC4B 5FI7A 4UA6A 5L2FA 3TG9A 4P85A 2WZXA 4KZBA 2HDUA 5EVID 5F1GA 3RXWA 4A5RA 2ZQAA 1ERMA 3Q07A 4WMCD 3FYZA 4K0WA 1PW1A 3LY4A 2ZQDA 2I72A 1MWTA 5FSRA 1L0FA 1JWZA 2XLNA 3G34A 3S22A 3ZNTA 4F94A 3MXSA 3HLWA 4HBUA 1FCMA 2EFUA 1EWZA 3SS5A 1U60A 4RYEA 1PYYA 4KQRA 3OPPA 2Y2KA 2EX6A 2DRWA 1IYOA 2ZQCA 4EBNA 3PBTA 5FA7A
chains in the Genus database with same CATH superfamily
1CQSA 1YI23 1NJ4A 3UE6A 3LQRA 2XROA 4GS9B 2ZBKB 3V76A 1IDPA 3IX3A 1MBLA 1SCWA 1W5ZA 2W0QA 2W03A 4IPBA 3OWYA 2C6WB 3PAEA 2A24A 3UY6A 1YM1A 1CEWI 4HZ9B 1S6RA 5ELUA 1L1ZA 2ZAMA 5GLCA 4PAUA 3QYBA 2H0HA 1TU5A 4HP4A 3AGDA 1C3BA 1HNWM 1HYFA 1L2CA 2GEXA 1DJBA 1IV9A 1R7RA 5IW9A 1RNBA 3F1PA 2I7PA 4HESA 3F92A 3UMEA 4YINA 2JWSA 4EBPA 2DHYA 3AJIB 3B3XA 2L7IA 1JZOA 4ILFA 4R9KA 4DR2M 1D7EA 3CPW2 1W01A 5CRFA 1G3IA 3PYJA 1L0EA 3H7WA 1L2SA 2CRUA 5CERA 2J7NA 1N32M 3IWOA 3D8BA 3PCSA 1VDDA 2OOVA 1D6UA 3WS2A 1ROVA 1KC84 1LT0A 4B3MM 1QANA 3VP4A 3X3YA 3BBZA 5CTMA 3URPA 5EVEA 1RN7A 3VP3A 3GZYB 1JN5A 4CCVA 3RGSA 5D3OA 3KP0E 5C18A 1DP8A 3HI7A 2JN7A 4IIWA 4GIPA 4QNMA 1HU9A 2W9QA 2K3DA 4R3AA 3TOIA 2V1LA 4U0XA 5M18A 4R38A 4IVKA 2CK3H 4YY3M 3NQZA 2HOHA 4GD8A 2QP9X 7GSPA 5EQTA 2NUTC 4OQHA 2HKJA 1HLUP 1WMNA 4JPMA 2K0MA 4X25A 2W3EA 1STDA 3GO8A 1WYBA 2C5WB 1GY7A 4STDA 4GB5A 2BLSA 5DJTA 5DYGA 4IBBA 3X40A 4DDSA 3NDGA 4H61A 2F86B 4X2OA 5D82A 4F2LA 7RNTA 2DENA 3JUOA 1B2MA 1LL9A 1YJ93 2VV6A 1ALQA 1G6OA 1V9ZA 1XGIA 3R8FA 4LRYC 1YLAA 5AJGA 3MZDA 3TWKA 4QJGA 3MHVC 1L2DA 1J9MA 1VEUA 2M7OA 1RGEA 2C4BA 3FKAA 1LI0A 1IVWA 1CK3A 4P16A 4JV5M 3RJUA 2A3UA 4WWUC 1ES4A 3LTDA 1IKGA 2F5OA 1A67A 4NG2A 3TPZA 3NBLA 4ME4A 1ZG6A 3U4LP 3UJMA 4Z9QA 2BIRA 2WKQA 3D9YA 5IHVA 4HBTA 3CNMA 1O07A 3HHWA 4EXRA 3N8BA 1T3BA 4RA7A 1IVXA 2ML5A 3UNLA 2EA9A 3L28A 1E3RA 1QUTA 1FNNA 2V1UA 3N54B 1ZKJA 1T18A 3ZHHA 3NXJA 2I9VA 5DF8A 1M6KA 4FH4A 5F5YA 4RX3A 2W56B 3M6HA 1OACA 1IU7A 2KX6A 4S2MA 3DGOA 2WKEA 1JBSA 4FWHA 4X69A 1MNLA 5AQBA 1XJ4A 4DV7M 3JUQA 2IYJA 2O9BA 3KOXE 2CP8A 2SBLA 2ZL1B 5LBRA 3L9KA 3B4PA 3UNWA 4H8RA 5FAQA 2KHHA 2WKRA 5J3WA 5I94A 1YQSA 4KG6A 1OH0A 1US1A 4LV3A 2CEAA 3SC3A 2D42A 3ER7A 1G28A 2O99A 2R45A 1NJGA 4MGIE 3X41A 1I70A 4EV5A 2OLVA 4JF4A 2J80A 2G3QA 4S2LA 4KQQA 3SFZA 4NL4H 3N9HA 3S28A 2HCBA 3CZDA 3X3ZA 4HH2A 4LSOA 1ES5A 1J09A 2KLIA 2J5YA 3CPOA 2VGLM 1EI5A 4KT0F 3PAGA 4NXEA 3ALAA 3OX9A 4K08A 4X62M 3S7NA 3JVVA 1KWIA 2VF7A 1JKGB 2Y0QA 1TDZA 1N8QA 4EW5A 2DNSA 3HREA 1YLZA 2IUJA 5JPPA 1OT6A 3UPOA 1BANA 3M7GA 3PZWA 5KP4A 3U5ZA 1SG9A 3VK7A 3OLOA 2ACGA 1N34M 3NDEA 4OPRA 1ZTUA 3VLFB 2CFWA 5HWTA 4GRIA 4JKTA 4BLCA 2Z8YM 1BRIA 3CPTA 4ZAMA 3WHLA 1FGMA 3S1YA 3DGNA 1VQ43 1K734 1MC0A 1JB5A 4P6ZM 1DO0A 2L2DA 1HJPA 3GR2A 3SZTA 1BUQA 2V1ZA 4HM6B 3MWZA 2QIYA 3PS8A 2GDNA 2C96A 4Y5FA 4EBLA 5F68A 1XJ2A 1XNQM 5M19A 1KDWA 5DFYA 4N9LA 1ZQ9A 5AIFA 5EXPA 3JPUA 3D4AA 5EXSA 2BNKA 1FUTA 2FOIC 4UN2B 2XA7M 1LOYA 5HL1A 1N5HA 1UCIA 1FGQA 4KG2A 3KE7A 2KF6A 3KP1E 5DJUA 4E3NA 4C75A 3S7QA 1K4FA 2Y79A 3Q90A 2K0BX 4Y15A 3BQAA 2L6OA 1IFYA 1N9NA 2Z6DA 1M1K4 4N9KA 1RRHA 4WYKA 1E4DA 2CWTA 4GLQA 4MBKA 1YVBI 1TF1A 3KS8A 3ZNYA 4XDVA 4HM4B 3O88A 2DZNB 3TJZC 3W2ZA 1TRPA 3SOYA 2Y2QA 1GL6A 2OWJA 3BM6A 4R3BA 1DVDA 4EWFA 3DZLA 1FUWA 2Z76A 1S1ZA 2YFJB 3KOYE 4U13A 3GLIA 3N8RA 3KYZA 1VB6A 5C1BA 3CLOA 3F1PB 4LJ6A 1HKXA 2IY2A 1IFQA 1FUSA 1OPXA 1TDHA 4BBTA 1VQQA 1G6AA 3AMOA 3H82A 1PWGA 1S5AA 2QZ6A 5FI6A 1UI8A 1V57A 4JGRA 1S66L 3H7WB 4JXJA 3NJAA 4RNYA 1JV2B 3TQSA 4YHHM 4JN6A 1AVKA 4HVNA 2RL3A 1B20A 3H51A 3UDXA 3ILKA 5KO3A 1XHBA 2VX8A 3WS4A 4ZM8A 1STZA 2DHRA 3N8LA 4I3AA 4GC5A 1TS0A 2QZ4A 3KOWE 1NWWA 3DY5A 1JN5B 2RRUA 3LH4A 3VOZA 2BG1A 2KEBA 2XQZA 1NWZA 2P7JA 4X6TA 3GSGA 3A98B 2CFKA 1ZC2A 3F7XA 4C6YA 4GHLA 3BQ8A 5K5BA 4RKUF 1BSBA 1G5UA 1R4CA 4Q53A 4R9LA 5IEPA 4HLQA 3FUWA 5BU4A 3EHCA 4LJAA 1CH0A 2RBIA 4HYZA 4LJ7A 1MKIA 3CF2A 1Q39A 4J8TA 4WP5A 2QKPA 3DTIA 5DF7A 1O7GB 3IX4A 1K6SA 4NSOB 4MDZA 4RBNA 5DTTA 2O3OA 3HK4A 1IN8A 3FTCA 3G8ZA 2XRXB 5RNTA 1Q7Y4 3FKWA 1Z5AA 2WSEF 3HU1A 1HNZM 3KFQC 1OTRA 2FFJA 5EP3A 2P0XA 3FUTA 5KPTA 5DF9A 2ZC6B 3A42A 2CG1A 4N92A 2L1SA 2J9OA 1VEUB 2R9XA 3CCJ3 2L4EA 2UX0A 3KKGA 4K1VA 2JP7A 5GL9A 3LICA 3WRZA 1UCLA 3B47A 2G8LA 1KGEA 1VQ63 1XA1A 3U6CA 3I4YA 3I04M 2DWZB 1T5YA 3C5AA 3U60A 3MHEA 4XM4A 2ZC3B 2JXNA 3E0YA 1BZAA 3JR4A 2GBWB 4AKIA 4GD6A 1XA7A 3MXQA 4U3TA 3UE0A 4X55A 1DV0A 2IA2A 2WOHA 4I8OA 5EUAA 5EXTA 4LFUA 1NRJA 1F98A 3W0LB 3IWQA 3WS1A 1VEGA 3R9XB 3N8SA 4KUOA 2P38A 1DO2A 1H8ZA 1E32A 3CITA 5DTSA 2B95A 3NI9A 5JI2E 4KZAA 3Q81A 2X71A 4LRTA 4N6UA 3CC73 2C5RA 2J7VA 1XXHA 1NY5A 2JBFA 2ZOHA 3OC2A 4CJ6A 2JNHA 1R5LA 1K8A4 1TR8A 4OU7A 3NX0A 4DE0A 2WSCF 3A46A 4LEHA 4MJDA 2P74A 3SXXA 2JQ5A 3FH1A 2W3FA 1GVNA 1BNGA 3M2JA 1QZEA 3IQAA 2ZHXB 3E99A 3SMSA 1W4NA 3GQZA 5FL3A 3G4PA 1AY7A 5CF2A 1LOXA 4JRFA 1QALA 2V20A 4BU4A 3CGWA 2UUBM 4UA9A 4Q0IA 5FTJA 1AIPC 2IWDA 1K57C 2HL7A 4NRWA 4B9OA 4IBCA 3W4OA 1K57A 5U47A 1N33M 1YAXA 4BL2A 1K9M4 3BW6A 3J80S 3HJIA 1MPLA 5E6JA 1TEMA 3SH9A 3WDGB 1AUAA 2XSOB 1JNUA 3E4PA 3GLGE 1BLCA 3QP6A 3GRDA 1JNQA 1Z6FA 4JLFA 1TD5A 1XJ3A 1G96A 3NBXX 1B2XA 4CGYB 4NHFA 3EIHA 1FOFA 5FTLA 4FMCA 2WGOA 1V92A 2VZWA 1NLZA 3CPTB 1YIT3 2BU4A 2G7UA 3Q1CA 5IG4A 4GOGA 5E26A 5HL6A 3LR5A 4IBIA 5I5LA 3E46A 2F5PA 3GLGA 1HQCA 1ONHA 1JWPA 3UB9A 4GKUA 3VOYA 4AG6A 1IEMA 4DN0A 1WNHA 2VA0A 3J7Yd 3DGMA 5AYSC 3VOLA 1VDLA 1EKMA 3PYPA 3VGNA 1GKIA 1X1YA 1YLTA 2JY5A 3QAUA 2O9UX 1KSIA 4NK3A 3VF1A 5HD5A 3V3SA 1YUBA 4LLOB 1E97A 3IBJA 1TDLA 1EIJA 2GBXB 2A15A 3KSHA 1IQYA 4PHTA 4Q0HA 1I94M 2D7HA 3IH9A 1OAOC 3GRVA 3M8CA 1EUIC 1N5PA 1O7EA 1C7HA 2PBDP 1P3QQ 1IBKM 3LMMA 3CU3A 3CME3 4WYKB 2W04A 2CMNA 2CV1A 1X1WA 4UA6A 1HT1E 4UQIS 3R7WA 2XR8B 2O9AA 2B1XB 2M1CA 4HP9A 2K7SA 2JY8A 2C99A 4CIZA 2ZTCA 2ZQAA 3CUEC 1SKOB 5L2FA 4B7FA 2AHMA 1LOWA 1EG9B 2GZAA 2ZM6M 2DZOB 3CUEA 1PW1A 1UGUA 3CCE3 2NQ8C 3FYZA 3BY9A 1L0FA 1R6BX 4GITA 2XLNA 1Y4OA 4F94A 1SXJE 3B74A 4BTWA 1QAFA 1QJGA 3SS5A 3WMDA 1U60A 4RYEA 2FXTA 2Y2KA 3FF2A 2DRWA 3Q3FA 1GO5A 1IYOA 3C58A 1IVUA 5HPFA 5LMUM 1A2PA 2LQVA 3AMOB 2R4EA 3H82B 2HMKB 1SXJC 2KXEA 5HPIA 2Y21A 1RLSA 4R0QA 1NNUC 4E04A 1IY1A 3HIIA 2VJWA 4GDBA 3AL0C 1FYSA 4Y0TA 3GQ5A 2A49A 2MR9A 3M6BA 3HLDA 5AQ7A 4DBGB 5A2QS 3NM7A 1NHWC 1YLJA 4DR3M 4EC6A 1L5GB 4H6JA 5F1FA 3L26A 3B8LA 1L3LA 1DP6A 5F6AA 1SZVA 3LVWA 3FD9A 6RNTA 3H9WA 5FQJA 3T1QB 3IF6C 3K1JA 1QDTA 3DGYA 3CCM3 1DVCA 5FGOA 1VETB 4JGQA 2K54A 4OLGA 2XRNA 3I4VA 3IF6A 3QHYA 2UUAM 4MGKE 3S4XA 3LI9A 4NC6A 4JI0M 5KPZA 3T15A 2JDIH 1CI9A 4HOHA 3GVBA 1WIVA 2XSZA 1DRMA 3EQQB 1G8PA 2O25A 4JI7M 3KYEA 1I2FA 1N77A 2ZM8A 2H1RA 5IU1A 1MWRA 5EXXA 2A5YB 2XSZD 3OCLA 3ECFA 1BAOA 4JXGA 4L78A 5EP4A 4ARZA 3BRMA 2CHQA 3LCUA 4KQOA 2KCDA 1WGNA 3L0RA 4LZJA 1G0TA 4MGZE 4PDGA 2ZL1A 8CATA 4PM6A 4FCWA 1MN3A 1X0OA 3KSFA 2KDLA 4R3JA 1XMQM 4ZJ3A 4PD2A 4ETXA 1W2B2 2OQEC 6STDA 3IMAB 1BRHA 3C7VA 4R70A 3AKZA 1NYYA 1BRSA 1MGRA 1PIOA 2LTUA 1IN5A 1E3UA 2XR0A 3IXGA 3CMA3 3SHFA 1FCOA 4XT2A 3KW6A 3U60B 4JI1M 2H28A 2G5GX 3HY5A 2RGHA 1T1BA 3IWIA 3DTMA 4R4SA 4Q8IA 1E3UD 3M2KA 4O7DA 4JYAM 3D79A 3NV0B 1SARA 2D7EA 3V50A 1VM1A 1XX2A 3F1NB 3O86A 5CXWA 2KDKA 4OUQA 2VK3A 2ZAOA 5FQMA 4FR9A 1RJOA 4FH2A 2H0IA 3PBQA 1PI4A 3HVFA 1GL7A 1RU3A 2Y2OA 1R4YA 2Y2LA 4FCJA 4FTXA 5IT5A 3C2WA 1RGYA 2QQ8A 2Y8HA 2DI0A 4JGOA 3CCS3 5IG3A 4MCWA 1NV9A 3CJMA 4R7GA 1ZO2A 1UI7A 4ANRA 2IA7A 3G30A 3SAUA 1DMNA 4K1UA 1BIRA 1Y28A 2DNAA 4OOMA 3CCU3 3I553 1E3VA 3W4PA 1NU3A 2Z7JA 1F5MA 1HD8A 1ZAEA 4L8RC 3T1YM 1WHCA 3LCVB 4HY8A 2KRTA 3UMDA 3P09A 3STDA 1RRLA 3HKPA 3HJQA 1F8NA 1YSPA 1EA2A 2MGWA 1XXMA 1IELA 3K3DA 5GHZA 1NJI4 3KZTA 1YLYA 4HOIA 4XUXA 4EQ1A 4WZ5C 1IY2A 3PXGA 3Q1FA 3KSJA 4G3WA 4L9GA 3CMZA 4BB9A 4WZ5A 1PNEA 2EJSA 1CQAA 1RGKA 1TS6A 4HNBA 1YE9A 4J9AA 4E3MA 1JR3E 4KENB 3C3EA 3D3LA 4X53A 5CGSA 2DVWB 1DMMA 1PU4A 3G2YA 3J2PB 1N9BA 1OHOA 2E2TA 2R46A 3KO6A 3ZGAB 4GMQA 2RSXA 2V1CA 3V3RA 3CF0A 3HHYA 1RGZA 3KS4A 3OTOM 3RE8A 3S27A 3T4JA 4FOFA 3EC9A 5EVHA 3ZG5A 3BFDA 2JKTM 1TH4A 1I3IA 1Q3BA 4REZA 2WAFA 1KGGA 5TGFA 1BU4A 1IQ8A 2D02A 4LF5M 3GLFE 4J5GA 1JB0F 2PU4A 1T1AA 3IT9A 3JYIA 5EOOA 1OQYA 1Q02A 1QDRA 3GLGB 1BT5A 2AADA 1QAMA 4M9SA 1A2VA 3E2KA 1KGFA 4DE2A 3AOGA 5CHMA 2ZL8A 5CGXA 4R3DA 5EFWA 2VDBB 2OOBA 5FSWA 3JR5A 1DJCA 3E9SA 4R4KA 1R2YA 2V0UA 1BULA 1K0KA 2W6JH 1E94E 3GP1A 3GLFA 4IJGA 3HL9A 3NC8A 3OCNA 4ZPXA 4OQIA 1W5TA 1IYSA 1T3TA 1OKSA 5JYOA 4F3LA 1W2ZA 3NECA 5HDDA 1OTIA 2JUJA 3FLJA 2EX2A 1U5OA 2QMIA 7CATA 2J9PA 4WM9A 5E2EA 4BL3A 5FTMA 3UJNA 3LOYA 1W00A 2D1WA 1Q814 3D8LA 1Q824 2EWVA 1UUVB 1LSVA 5ITXE 2QHKA 1VQ73 3ITAA 4WW0A 3R7WB 3H4MA 4DJ3A 4LF9M 2QPNA 1GMRA 3J7AS 1BGSA 3UE1A 4IVIA 1H6UA 4II7A 3R4KA 3BU4A 4NXMM 4XBTA 1ES3A 4DV6M 3T0UA 2PU2A 3LEZA 4IBXA 3LCEA 3F14A 3OPHA 1QYRA 1N9OA 3T4KA 2KOIA 3VFFA 1KVMA 4X1LA 3CC23 5KMWA 1CI8A 1W8YA 4E3LA 2ZMVA 1OTDA 3FZWA 4ORLA 1NRFA 4FCTA 4RX2A 4DR7M 1XB2B 4LRSA 1RGAA 3K3CA 3LR3A 1E9RA 2WGVA 4Y2FA 1JQJC 1M40A 1N78A 4DKIA 3HLBA 1W79A 4X66M 3DH2A 5KP3A 1C54A 1ACFA 1G71A 1YPRA 3DOAA 3S29A 5FQKA 2PZVA 1SXJB 1GABA 3B4OA 1JB4A 3EN8A 2HP9A 4DV4M 3L27A 3LIAA 4PM7A 2Q9MA 4H6JB 1J2BA 4CLCE 3B7NA 3SEDA 1FIKA 5CTNA 4EETB 3EX9A 1KYIA 2ZM0A 4GHIA 2GNOA 1SDEA 3B33A 1JVJA 2EUCA 4UA7A 2RFRA 2R41A 3VK8A 4OVZB 1BRNL 5JYPA 2CHGA 1RP5A 3IF6B 3EGXC 1OPYA 1PRBA 2RCDA 1I4WA 4CLCC 2Q0OA 2KNAA 3CAXA 1TH3A 3GV9A 1RGFA 3EWKA 2P05A 5MC7A 1BYWA 1W5SA 2HF6A 4HM3B 5EVLA 1IOUA 3PBNA 2JA2A 3AFHA 3FTFA 2UU9M 1N8R4 5FQ9A 1L8QA 1PJQA 5TJJA 4HJ4A 1GMPA 1HQYE 3OPLA 1KDSA 4GH9A 1OHSA 3DMCA 3WWXA 4ARZB 3F9SA 2M5ZA 1OTAA 4LRXC 5G4ZA 1N9JA 1PFLA 2BMQB 2BJVA 1YJN3 1NY0A 3G32A 1XMOM 1YIJ3 5HFOA 2HMOB 2R6FA 3VMAA 3MQQA 4X2HA 4CDLA 2Y2HA 3A3JA 4ZJ1A 3ZDJA 4AFIA 5L09A 3Q82A 1H0MA 3A3EA 1ESIA 3LR0A 3U6DA 1Z6TA 2LBCA 3IG5A 1D6ZA 3LTAA 1I2EA 4G1MB 1YMSA 2LVOC 3LFVA 4XT2B 3T1XA 3LW5F 1BNIA 1NDOB 5FAPA 1OJLA 3GQ3A 2CFOA 3FGYA 3FG1A 1YNVX 4O2HA 1Q7HA 3S7OA 1W7FA 2FE8A 1MWSA 1T6OA 4WLAA 3WA2X 4FVMA 2IWCA 3HLCA 4MBHA 5E43A 3ZVTA 4G4QA 4LF4M 5KP1A 3DAVA 3HLGA 1PJTA 2GJ3A 4R1GA 1UCKA 4B7GA 4Y0UA 3FUVA 3VSKA 2YR0A 4Z6YA 3AOEC 1BSGA 2CFLA 2INXA 2J7OA 3AOEA 1I3FA 3DTKA 1FW7A 2Y2PA 1G41A 2C98A 3E98A 4MN7A 1GSXA 4EEUA 2W0NA 3QWLA 2ZC5B 3U1WA 2CWVA 3ZQ5A 3A0SA 1MX0A 4R6LA 2PD7A 2R44A 4OP5A 2OV5A 1LQGC 3LGOA 2QCUA 2OCTA 5GSPA 4D81A 2ZDJA 3SYLA 3K7CA 1Y8GA 1L2BA 3HJKA 3FG4A 2FH0A 1B27A 1O7MB 5AIHA 4S2NC 3VDUA 2F5WA 4KZ7A 3EBTA 1Z5BA 5AEWB 4OP8A 3BXWA 2JC7A 4WN5A 1QMEA 1F9IA 4O8SA 1SKFA 3JUPA 1TJDA 2HJ9C 1TTEA 1MWUA 2PD8A 3MG1A 2P0MA 5CGWA 4KFFA 1FZUA 1GY5A 3PXPA 1ZV1A 3MKFA 1Y4KA 2XZUA 3B7CA 2N35A 4N6OB 3ZG0A 4DE1A 3RGPA 2ZQ9A 4AW4A 2QPAA 4K61A 5CEBA 3V99A 4OPYA 2B18A 1SKOA 1VHMA 2M7UA 5IENA 5EP1A 3HBRA 1CEFA 2G2UA 3PBRA 1Z1SA 1SPUA 1JZDA 3OWUA 3W67A 3NBJA 3OV4A 2YQZA 2UV0E 2XLJA 4LGMA 3GPXA 3W8KA 4BLMA 3MFDA 3WS5A 1VQN3 1CEGA 1WE4A 1OIPA 5LC6A 2H5XA 3HU3A 3MG3A 4L9FA 1MY8A 4QNRA 1PWDA 3MQOA 5HZHA 1DMQA 4B3TM 5STDA 2VQFM 5FLXS 2E5LM 1HVBA 1G4AE 4LY6A 5FTKA 5IZ7D 3VDPA 3MPHA 4L6V6 4QHTA 1GJTA 5TR7A 3FCSB 3GLFB 3JVUA 1B2UA 5KSHA 2HMJB 3MSOA 1X37A 5EJCA 4WYYA 3PVSA 4F3LB 2F5QA 1LHYA 1MXOA 3SS3A 5AI1A 2L09A 5DFLA 5DVAA 4FWDA 3MZEA 1IYPA 4R23A 3NCKA 4JF5A 4RQ9A 4XK8F 1MZUA 4L16A 5DKKA 4G3OA 5HD3A 1NB3I 3VE3A 4EQIA 4MMXB 4ITQA 2EXBA 3U6MA 4N6NB 2WSFF 1IKIA 2UUGC 3CTWB 1VETA 5KQDA 1EE8A 2OQ4A 2PT7A 1S723 1OAIA 3DA1A 3E21A 3ZG9B 2C10A 2XFSA 2W3DA 4QY5A 2WGWA 1O7HB 5EE8A 1D0LA 4LF6M 1W6YA 3CWFA 3MKIA 1E25A 3G6E3 1S3SA 3A45A 5A91A 2LB5A 3GZRA 1T1CA 3SARA 2QENA 4WMCA 2APLA 2PYRA 4B93A 3TG9A 1UWNX 4PCZA 2WZXA 4P85A 4H3UA 1MOLA 2YKFA 1TF0B 2HMMB 3KVWA 3A76A 1D06A 4M9XA 1OHPA 4WMCD 5G1KA 4PKYA 4EU0A 4B08A 3AHWA 1A2KA 3O5YA 4IHQA 3SASA 2OAP1 1MWTA 3DGLA 3V98A 2GXFA 1JWZA 3G34A 3S22A 2J3TC 5FW5A 4M9ZA 3U6SA 3W0FA 1ULIB 3FKEA 2EFUA 3SAWA 3B42A 4BTXA 3ZCBB 3RNTA 1KSFX 4KQRA 4ETZA 1G02A 3CNXA 1N9LA 4GHIB 1GSWA 4EBNA 1B2SA 4NXFA 2J3TD 2KZSA 1LRAA 5L8MA 3VP2A 3OZHA 2H0GA 2O0YA 2KF5A 1NB5I 1ONGA 2UGIA 3NQYA 1O7WB 3NV0A 1UGHI 4GHOA 4CPKA 4FWGA 3MS6A 3ISGA 4RNTA 4FMDA 3F1NA 3OXAA 4CLCB 2STDA 2K2NA 5EM1A 3HCYA 1QMAA 4ESPA 4I4LA 1NSFA 3LIFA 5FAOA 1LNIA 3KSIA 4UQIM 4L8OA 2WKIA 1MU5A 3GLHE 1LTMA 2WK0A 3IXHA 4PDIA 1RCJA 5DREA 2JY7A 1RCKA 5DNYA 2X49A 3G16A 2LWXA 1VQ53 1HR0M 5ITQA 4LPZA 4B4XA 4R71A 2F4VM 4CQHA 3GRUA 2J8YA 1PY3A 1ROAA 1OGXA 2JKTI 4WEJA 1PW8A 5ITTA 3HX3A 2QBYB 3NWLA 4AG5A 1S67L 2VV8A 2W1TA 1BLPA 3BLZA 2F5SA 3IX8A 5E2GA 1T2HA 1S0WA 4QU3A 1AR0A 3NHXA 1DP9A 1NZUA 2FNAA 4JI5M 1PFPA 1TRQA 4CJNA 3A3IA 4NEED 3T12B 4KZ5A 2XSSA 3BFCA 4FSFA 3LMLA 1XP4A 1LNHA 3FG8A 4AKHA 3U2AA 3MYTA 2HAKA 4DV5M 3KOZE 4RNAA 4GEWA 3M6AA 2EKFA 2HMNB 3NBBA 4JXWA 1A90A 1RSNA 5HDCA 4WP2A 4ZTKA 5HW3A 5A0OB 3D4FA 3Q8GA 1FILA 3VP0A 1J3WA 2GNXA 4YNRA 1I2GA 2DZLA 1ERQA 1ZMVA 4MMZB 2JY6B 3K0ZA 4X65M 2E8IA 3GECA 3WRTA 1LSWA 2GSPA 2R4JA 2SARA 1SDNA 2DAMA 3LO7A 1S4RA 3T4SA 3VP1A 2QJ5A 4IEDA 3K9PA 1PZOA 4LZZA 1B3SA 1K25A 4HJ6A 3PHYA 2Y2IA 3SYUA 1K82A 3C4OA 1K4EA 1OTEA 4G6ZA 3MZFA 3E2LA 3ICYA 2HWJA 2Z4RA 4PT5A 3KYQA 3FC7A 1I2SA 3VSYA 4I4KA 1H5XA 1R4GA 2GX5A 3CF6E 1IM2A 2BNGA 4BWIA 4N3VA 5EECA 2ZTDA 3M0EA 3G0KA 4X56A 3BWLA 5IG5A 5EP2A 1Q40A 3NUVA 1W6CA 4KQDA 3EF8A 3QP5A 2PDRA 3LTCA 5FEGA 2DAKA 5F82A 2R78A 1OGZA 3T1HM 2LH0A 4DRTA 4LJ8A 1V74A 3B9PA 1HNXM 4UAAA 1ORYB 4FCZA 1JJ22 2B02A 2HPBA 1LVNA 2AAEA 4LJ5A 4KT3B 1L0DA 3P98A 5E2FA 2IWBA 1KOUA 2HP5A 1NO1A 1STFI 2B3TA 4O8GA 2ZANA 4ZDXA 3X3XA 1WTHA 2PR6A 4M0WA 4YFMA 4XBOA 3RH8B 3X42A 1TP6A 3PTEA 3G2ZA 4LENA 2DWLA 2WYXA 4FCFA 3SS4A 2JCHA 1CF0A 4BTYA 1AV4A 5FEFA 4WL9A 3K8ZA 1VQP3 2F4YA 3N6IA 3IS2A 4D60A 4LFAM 1VG5A 3WR2A 5A8BA 4QWOA 2Y59A 5EEOA 2UWXA 4HHDA 1XNRM 5DFXA 3CHWP 4G4NA 4NRVA 1D0MA 3FG3A 3EQVA 4LV1A 3Q8XA 4HJ3A 4BBVA 1TS7A 3C30A 1SXJA 5CLKA 3BYDA 1X1UA 1VQM3 3RDEA 4ZJ2A 2DAEA 1D6YA 5F69A 4JXVA 1BLSA 1WYCA 2XF3A 4MGYE 4HEFA 1P97A 1DGBA 1SXJD 3UMMA 1R2ZA 4O02B 3L29A 1B21A 4QB8A 3FZCA 5BPVA 3T8NA 4HKVB 3HUNA 3HUMA 2XK1A 3O3VA 1RGCA 2ZJ9A 1TTOA 1L1TA 4OVZA 1FSWA 2Z6BA 2ZM2A 4NXNM 5HARA 4S2OA 2JHEA 2YFQA 1NYMA 4KFEA 3UB8A 2WGWB 3QP4A 3HHZA 2JKRI 2MROB 2CIUA 4DJ2A 4QD4A 5AVFA 4GB7A 3UDFA 3VKHA 3V39A 2EA0A 2PAVP 3FRIA 1YVSA 5LC7A 2KNZA 2P08A 1AXBA 3DBAA 3GMWA 1K54C 2P04A 3LIBA 2L0WA 2ZOIA 5KIZA 2XH9A 5BIRA 3Q7ZA 2LHGA 2P5TA 4Z8XA 1TGUA 1IN4A 4WEKA 1AQZA 1GOYA 4YOFA 3IBRA 2CH9A 3LYXA 3MJ5A 4R1KA 2PBYA 4ZBEA 4BBUA 2CW9A 1ZMUA 5FDSA 3MG2A 3KSGA 4HM5B 2VQEM 5J7EA 2BJWA 4HM2B 3I01M 1BSAA 4EXOA 3G31A 3GRRA 2XD5A 4KZ4A 3PCRA 3IH8A 5IEOA 2AVXA 5CECA 3G713 3T38A 1G59A 3SW1A 4EYCA 1VQO3 3ULFA 1HZ1A 5FASA 1IT7A 3NBIA 3RGRA 3LI8A 2BMOB 2HJEA 3EGDC 1NNVA 2OQEA 4NETA 3LZAA 1XKZA 3UPPA 1YLPA 3BFGA 4N6V0 1BSDA 1M9GA 3A5EA 3JAMS 4EV2A 1XFQA 1K3XA 4JI2M 2MH8A 3LYGA 5G4YA 3CCQ3 3B89A 4AZFA 3E4QA 4J5KA 1MGWA 1BRKA 4GHAA 1PJJA 3T4QA 5DTKA 3P01A 3CXC2 3BFEA 2M60A 3MFXA 4R80A 4LJ4A 4I5SA 1Q42A 8CHOA 1LL5A 2DMWA 5CX7A 2Z2MB 4DR1M 3UK6A 4OVMA 1W5DA 1N36M 3LQQA 4XGIA 1BRGA 3TE8A 4DMZA 1LQMB 4JI4M 1VQ93 2OTJ3 3EEHA 2EO2A 3T1RA 2Y2MA 4EESA 3C8CA 5GHYA 2QWSA 4D82A 2WZJA 4PM9A 4KZ9A 3SH7A 3L2AA 4AI6A 1V9YA 2W1TB 3B7QA 5HAQA 4Z1WA 1G68A 1IY0A 3ZFZA 5IG0A 4ZRRA 3OOVA 3K63A 4HM0B 3FF0A 3HU2A 2UXCM 3AV0A 1NY6A 2D7GA 2UXBM 1ODVA 3F8HA 4NKPA 3C38A 3F1OB 5GLDA 3C4PA 4B3SM 5HDSA 4QOZC 1NJFA 1YT4A 4MLLA 3FWLA 1IQXA 3UB1A 2VF8A 1QZMA 3IG8A 1K28A 3E4OA 2CV0A 4BENA 3GQ4A 1CYVA 2X8AA 4N6LA 1OMEA 1GA9A 3O87A 4OPQA 2WOFA 1KE0A 1VQK3 4YWZA 4JBFA 3HZJA 1EROA 2K31A 4IBFA 4IUHA 1K3WA 1K56A 4PPRA 3VV4A 3UL6A 2QJ7A 3BY8A 3VSLA 3WOFB 1TS8A 1HZOA 2QYBA 2WADA 4DUYM 2DWNA 2E2UA 3S7PA 3V5MA 1DETA 3QP2A 5A93A 3D3OA 4DV2M 1JR3A 1K56D 3TE6A 2R0IA 1O7NB 4AKZA 3OW22 1QAOA 2CG0A 1Q864 1ZHHB 3LTBA 3SOAA 5I97A 1T2IA 4PKYG 3G4S3 1GSVA 4ID4A 2RNTA 3O8YA 3Q2PA 1OIZA 4OX9M 1JR3D 3A0RA 4NOOB 4OQGA 1I0VA 1LI9A 4LCMA 1F2KA 5IS1A 2LNHC 1SIIA 2YFIB 4FUWA 1H3QA 3NOTC 3S5CA 1ES2A 3CC43 1I5QA 4HM7B 3D5IA 1GOUA 1UCJA 4LFCM 5IREB 5EPHA 2V9AA 2ZMAA 5KSCA 1Q40B 4FMBA 4OVDA 5FI7A 2YKHA 3EEAA 2GQFA 5TFQA 2ZQ7A 4Y13A 2UXDM 1GLNA 1LSXA 3GPYA 5AYRB 1EEJA 1ZS7A 1PZPA 3KFUG 2G2WA 4GJ4A 4OOLA 5HAIA 3AHSA 5EOEA 1JBRA 2XGNA 4K91A 4QY6A 4QPRA 4I3IA 4K0XA 4BD1A 3WODG 2HDSA 3MKEA 1FCNA 2Y55A 4EIWA 4LF8M 4MNRA 4U0TA 1WA9A 2HP6A 1H8MA 1F4IA 5M1AA 3IECA 4IT7A 2P9VA 2OOVC 3U6QA 3K2NA 1YMXA 4XXRA 2K9DA 3C3DA 2F56A 7STDA 5ITYA 3TWLA 5ITXA 4LF7M 2KRKA 2BTFP 1V34A 2WKHA 1BSEA 3P7NA 2QSFX 3CI6A 3FRHA 3KDSE 3PNYA 3K92A 4IBGA 1BTLA 3IS2B 3W4QA 5JI3E 2XZFA 1OTBA 1IT8A 4LCBA 4C3QA 4LMIA 1SJWA 3I563 3IHBA 1I0XA 1W7CA 4KZ8A 3ZG8B 2Y91A 2ZQ8A 3BNDA 1PGYA 1KQS2 2LHCA 1GHPA 4OK0A 3UE3A 4D2OA 4HBRA 1BSCA 2CE7A 4OQ0A 4R4RA 2OO9A 1JRQA 4IBRA 3K9OA 3QYEA 1LV7A 5ITRA 1RN1A 2BO9B 4NXBA 4KODA 2VGKA 4UEYA 1NLYA 3DTEA 2FFFB 5EV0A 1ISKA 1IVVA 2R9WA 1PRQA 4XB5A 4MMNA 1RNTA 4Q7JA 3IXDA 2Q07A 2OOLA 3I7JA 3C9PA 3HIGA 3GRYA 4XBXA 4P6BA 5DKLA 2EXAA 4RZMA 3EJVA 1WGLA 4PEJA 4GN2A 5GKNA 1NVMA 4LYLB 5BXQA 4DXBA 2VV7A 1DGFA 4AQYM 2JKGA 1BNSA 3A3DA 4E6XA 2YX9A 5L07A 3RGAA 3KXEC 2HZ5A 1RGHA 2FFYA 3FUUA 1PYLA 4CLCA 1IYQA 3K2LA 3AGOA 3UDIA 4E3IA 4MGHA 2RCXA 2QEX3 1IBLM 4HEOA 1RMSA 4CLCD 2Q2EB 2CX1A 2Y4AA 4UHUA 2L4FA 3DZDA 4HM1B 3MSHA 3EOIA 3T4TA 5CHJA 1IXZA 3BLSA 4LV2A 1ZMWA 3HWSA 4DV3M 1NV8A 3DFZA 2VEAA 4GDNA 4P0MA 2FGTA 2KZUA 5EVIC 2LVPC 2KXGA 1IXSA 1ESUA 2QBYA 5BOHA 1N75A 2QNJA 2V6ZM 2Z3XA 4MM3B 1FR6A 3PNVA 1CYUA 2DCFA 3TSGA 3NOUC 5EVIA 3GRJA 4RF0A 2W2CA 5HWWA 2ZC4B 2O5RA 4KUKA 1FGRA 5EVID 4IJFA 2BWEA 3Q07A 1ERMA 4A3VB 2QA43 2JKRM 4O01A 2R18A 4I5QA 3T8UA 2V0WA 1EW0A 3NULA 3LY4A 4K0WA 4Y28F 2ZQDA 2I72A 5FSRA 1VEKA 1IYYA 3UB6A 4LFBM 3HLWA 5G1LA 3K5TA 3MXSA 4GCZA 4HBUA 1FCMA 4BMWA 1EWZA 4IIAA 1GJSA 5L8RF 3B7ZA 3BNEA 1KD14 4KFDA 3OPPA 2I9WA 4G3KA 2O01F 1FA3A 3PBTA 2O9CA 1UW1A 5TGNA 5FA7A 1VZZA 3F8XA 1W63M 4M4XA 5EM0A 3BFFA 3AGFA 4MMYB 4IBKA 3U6OA 2HMLB 3T4LA 4EBGA 4KZ3A 4JI8M 1S4SA 2W9PA 1BUEA 1YKDA 1SQWA 1YHQ3 4LGYA 3LXUX 3BLMA 4X1MA 1A0KA 5CHUA 5BVBA 3GTCA 4B88A 4JI6M 1E9SA 3HJ8A 4DR6M 3EE1A 2KF4A 3D5GA 1NHGC 3GPPA 3RXXA 4EEPA 3KSXA 2RGQA 1Q2QA 4S2NA 4MH0E 5GLBA 3VKGA 2RKOA 1LOVA 4O3VA 4HI4A 1OT9A 1N9EA 1QAQA 3HJSA 4NXGA 3SAVA 1YGWA 5GHXA 3FUXA 2WO0A 3V92A 2HV1A 1I8VA 3MMPA 4FD2A 5G18A 4Q0JA 3K9MC 1FQGA 1NXYA 1UUGB 2B24B 1VEJA 2YFLB 4EV4A 1M1XB 4JI3M 3QNCA 2VGJA 4F1IA 2FNQA 1C1KA 1AWIA 2ZA4A 4GZBA 1J7KA 4MEIA 2WGQA 3MMHA 1I2WA 3V67A 2W1RA 3I51A 3HLFA 2BASA 5IWAM 1TFOA 3WOEB 3PFIA 3TL4X 4RF1A 4GKJM 1K41A 4QHCA 1NO3A 1YGEA 3IHAA 4E3OA 3GAXA 1GY6A 4BJPA 1WQLB 1DY6A 3BECA 3HZPA 3SMPA 4WURA 1QMFA 3GLIE 1XPBA 2Y2JA 1GYBA 2JZ1A 2KNVA 4FCVA 3T1SA 3W68A 3WHOA 4HQAA 1LLBA 4HM8B 2OTL3 3SVAA 4CHTB 1V33A 2JE5A 3UO9A 3MR0A 2A24B 3TRCA 1SIHA 1DYUA 3KSPA 1JWVA 3JUNA 2V8FA 3IXBA 1IN7A 1Q2PA 3DWKA 4JXSA 3VFDA 3QNBA 1T43A 2DAGA 5J8XA 3LT9A 3RFWA 4HZBB 3GZXB 2MF7A 3CCV3 4WFOA 5A90A 3FPVA 4G4OA 2V1AA 1XFNA 3RFBA 3H4JA 2INWA 3LT8A 2WZZA 4E3JA 1D1JA 5HAPA 1RGLA 4MBFA 3D9RA 2Z6CA 2LVNC 2YNMD 4WELA 3FSDA 2L7HA 1YSQA 3FE3A 1YLWA 2HHHM 3SATA 2K47A 9RNTA 4B7HA 3ZH9B 2A2LA 5FATA 2EWWA 1QVF2 2P9VB 4DDYA 4XUZA 2VGLS 1GHIA 2K6BA 3QP8A 3PR6A 3RTYA 3CD63 1CJFA 2PR5A 5F83A 2Z4SA 1ZGXA 1RDSA 2Z7AA 2QGUA 3LVVA 2XEPA 1PM5A 2Y20A 3BOSA 3QP1A 3NBRA 3OPRA 4DV0M 2X02A 5A92A 4L15A 4WHAA 3KSED 2BMRB 3BJNA 4P87A 4K90B 4FCMA 5LMNM 3UB7A 2CHCA 2OAQ1 1KFVA 5ELJA 3G6OA 1B2ZA 5HOHA 4OH0A 4P6ZS 3UN7A 4NPBA 3HOHA 1WR1B 3DUKA 5FQQA 2UUCM 2PHYA 3U61A 2PNCA 2PRFA 1S1YA 5L10A 3ZYTA 3SX1A 2CUZA 3C7UA 4BIRA 3OBFA 4N1HA 4TX4A 4IUKA 2Z77A 1DGHA 4LCLA 3MJQA 4I39A 1QUSA 4BBAA 1BRJA 5AQAA 3G35A 3KX0X 1FGOA 3THGA 2OSUA 2XA7S 1O7PB 4TUWA 1TVFA 3BEBA 3ITBA 4L0LA 3U97A 2IMJA 1KVLA 4NREA 1K6RA 4HJLB 1BUJA 4LG2A 4Y7PA 2F99A 1NNJA 3CG5A 2M7VA 3FYDA 3DWZA 4KVHA 1LXEA 2ZLYA 2C11A 5CXOA 1P9RA 4X68A 1XXHE 3IHPA 2JZ0A 1IK3A 4LGWA 2P09A 4K0KM 2FH5A 1RTUA 3F7SA 1YSYA 1OF5A 3ZG7B 1BVIA 1IXSB 4FW9A 1IV7A 4MEZA 4RVAA 5TBMA 2R62A 1GSPA 2GEYA 4PM5A 3GLHA 5EVIB 1WMPA 5KQ8A 3H3HA 3SHGB 1OJGA 3LIDA 4X64M 5HX9A 4IJEA 2BWBA 3PGBA 1N4OA 3AGEA 2F5MA 4GNUA 4I81A 2BT3A 4DR4M 5D83A 2DKLA 1GOVA 2DXIA 2Q9NA 1GD3A 3F1OA 4OONA 3LUQA 1IQPA 3Q7VA 4E6WA 4OLDA 1RN4A 2H10A 1UWPX 3NM2A 3SOIA 3GPUA 1EFUB 4EERA 1UGIA 1P0ZA 5CEDA 3BIRA 3OWSA 1Q3CA 3HUOA 2CC3A 4G4RA 2LXEA 4KLNA 3WS0A 4AKGA 2Y2NA 3EIEA 2MJ5B 2X4AA 1XC8A 3PXMA 3A3FA 4S2KA 1OCVA 3SBJA 1UFZA 3UB5P 3EN1B 1H8YA 3U6LA 2CC1A 4QHSA 1KE4A 5KZHA 2OLUA 4KHPM 2J8XB 8RNTA 1FGTA 4KG5A 2QHOB 2KW0A 5E2HA 3T50A 4DXCA 1GA0A 2ZD8A 4LGQA 3LY3A 3HLEA 5AIIA 1HTZA 1BNFA 3FV7A 4L4UA 3U5ZB 3AGNA 4JF8A 4DE3A 4DR5M 1VQ83 4KO8A 4GS9A 3LR4A 5H37D 3IF5A 3PBOA 3ROBA 2JKFA 3PBSA 4OOYA 2LVQD 5GLAA 1C7YA 1DJAA 2WUQA 2VIIA 1V58A 2OPFA 1YJW3 5JBSA 3FTDA 1ZG4A 3FKVA 1BOXA 4PM8A 2W3GA 4LV0A 2E8JA 4LRZE 4N6TA 1D0KA 1BNEA 5IF6A 4Y0OA 1FJGM 3MK6A 3QRDA 3MXRA 3KIIA 2IUKA 3NHQA 1TUHA 5C5KA 5AEUB 1UUWB 2V2FF 4GSPA 3BB9A 3EBYA 3NIAA 1OFHA 2EX9A 3SH8A 4I38A 1M904 2B5RA 3UZUA 2XDMA 4QOSA 4B4ZA 1Z09A 4G3VA 2KF3A 4WF0A 3SLUA 5HGRA 2HDRA 4MN5A 1MJGM 3T6PA 1L0GA 3JUMA 4XBYA 4WUJA 1IXRC 3I0YA 4L9EA 1W63Q 1QVRA 4CISA 3DM8A 2EFXA 3L25A 1FR1A 1U8CB 2VLGA 4GC9A 5AQ9A 3EQUA 1QVG2 3N7WA 2ERCA 1RHLA 2OOAA 3JVCA 1OFIA 2CFGA 4B3RM 3J27B 3GLIB 2F98A 4IBEA 1KE3A 2CHVA 4IBDA 4D80A 1MKMA 4EUZA 2BHMA 1XWIA 1GCEA 3VFHA 3UPNA 1XGJA 5FTNA 5CF1A 5IERA 4EW7A 1PWCA 5BR8M 2CKFB 2D01A 3MBZA 2XFTA 5J4EA 1A5TA 3ZVWA 1P9WA 4DUZM 1FSYA 4S2JA 4W5WA 2PYPA 4LJ9A 3MQ0A 3DXOA 2EKKA 3TDGA 1ZX2A 1TDGA 1BNRA 5AVEA 1K54A 2OWPA 4IBJA 3S67A 2X01A 3CCR3 1JB2A 1PJSA 1EQKA 3EB8A 4HIAA 1Z59A 3HGIA 1GD4A 4JF6A 1GS3A 2DWMA 2MC8A 2LB9A 4RNZA 4HH3A 2V8CA 1JBTA 2J3WA 3UGJA 1TIJA 1WMOA 1TH2A 2Y2GA 4BD0A 1WXQA 4DF6A 2W82A 1PI5A 3NY4A 2L4VA 2Y74A 2W56A 2XGLA 4EUVA 2CX0A 4S2PA 4OKPA 3U61B 4QWTA 6GSPA 3TWMA 4BQMA 2NUPC 3J81S 1OJ5A 3BNBA 2H0YA 2CV2A 1K55C 1X1XA 1LL8A 2W27A 4MN6A 1UDII 3QK9A 3HHXA 2FZ0A 2HDQA 4FD8A 3D72A 2RGOA 4I3JA 1K55A 3J7BA 4HAAA 1VQL3 1DGHB 3GZBA 2XSHB 2XD1A 4FMAA 4L8PA 1JTGA 2C9OA 3SYKA 4GW9A 1PJIA 3BNCA 1DGGA 2HGVA 4O0PA 4WZ4A 1ULJB 1GMQA 1W6GA 3HX8A 2CWUA 1W8QA 4E3KA 2H5SA 1DE3A 4S12A 3F40A 3LIEA 2GU3A 4AEQA 1D2NA 5DYIA 4HL4A 2DAIA 1GHMA 3U6PA 2WGIA 1TFKA 2OWHA 4M3KA 4WBGA 4S2IA 1BVSA 3GWRA 3FYCA 3UL5A 1QQWA 2LYXA 4OW0A 2H0TA 2ML6A 4KZ1A 3ZCZA 4GKKM 3CCL3 4XDWA 3ZC7B 1AVLA 5EQLA 5FI2A 4N1XA 1SHVA 3MF0A 1W02A 5FQIA 2L1MA 3VE4A 2W3HA 5HWVA 1OF5B 5D81A 1RGGA 5IT9S 4PMAA 5FDHA 4GL6A 5TBMB 1JKGA 2R65A 2E2VA 1JTDA 1QAKA 2ZMFA 1Q9EA 1XJ6A 3GLHB 2I7NA 3T4OA 3E4RA 5DRVA 3GDIA 1WJ7A 3ZQJA 2MJ6A 1BLHA 3KCHA 3WA3A 3DW0A 2GU1A 3IJEB 2L4RA 1XXHB 2VKSA 1OUNA 4KZ6A 3N4IA 2WAEA 2ZC7A 3TW8A 2Y73A 1Y54A 5HSQA 2FS1A 4Y17A 3NOPC 5JPUA 1IN6A 1IBMM 5G2GA 2Z2LB 2CWBA 2KA6B 4N6MA 3Q7VB 2EX8A 4MB7A 4OPZA 1ASKA 2V1BA 4L7KA 1NZOA 1K38A 1J5EM 3IPTA 1RCLA 2KRUA 1HT2E 3KN4A 4DV1M 1VQ1A 3WHKA 3FTEA 1BNJA 1RKYA 1Z5CA 2F5NA 2CFDA 4NSRA 4KZBA 2HDUA 2LVAA 2KAAA 3GSPA 4Y3IA 2Y0TA 5CK6A 5F1GA 3FPWA 3RXWA 2ZBBA 4A5RA 1UM8A 5KPRA 1T19A 4AKYA 4JGPA 4M0DA 2C9CA 3ZNTA 5AIGA 5ITUA 3A0VA 2WKPA 1PYYA 3L7HA 4LZIA 3U6EA 2EX6A 2ZQCA 4P17A 5F3WA 1CUKA 3LEQA 2R4IA
chains in the Genus database with same CATH topology
1CQSA 1YI23 1NJ4A 3LQRA 2ZBKB 1IDPA 1MBLA 1SCWA 1W5ZA 2W0QA 2W03A 4IPBA 3OWYA 2C6WB 3PAEA 3UY6A 1YM1A 1CEWI 4HZ9B 1S6RA 5ELUA 1L1ZA 2ZAMA 5GLCA 1TU5A 3AGDA 1C3BA 1HNWM 1L2CA 2GEXA 1DJBA 1IV9A 1R7RA 5IW9A 4HESA 2I7PA 4YINA 4EBPA 3AJIB 3B3XA 2L7IA 4R9KA 4DR2M 3CPW2 1W01A 5CRFA 1G3IA 3PYJA 1L0EA 1L2SA 5CERA 2J7NA 1N32M 3IWOA 3D8BA 3PCSA 1VDDA 2OOVA 1D6UA 3WS2A 1ROVA 1KC84 4B3MM 1QANA 3VP4A 3X3YA 5CTMA 3VP3A 1RN7A 3GZYB 1JN5A 4CCVA 3RGSA 5D3OA 3KP0E 5C18A 3HI7A 3TOIA 4IIWA 4GIPA 4QNMA 1HU9A 2W9QA 2V1LA 4U0XA 5M18A 4IVKA 2CK3H 4YY3M 3NQZA 4GD8A 2QP9X 4OQHA 5EQTA 2HKJA 1WMNA 4JPMA 2K0MA 1STDA 3GO8A 1WYBA 2C5WB 1GY7A 4STDA 4GB5A 2BLSA 5DYGA 4IBBA 3X40A 4DDSA 3NDGA 4H61A 2F86B 4X2OA 5D82A 3JUOA 1LL9A 1YJ93 1ALQA 1XGIA 3R8FA 3MZDA 3TWKA 4QJGA 3MHVC 1L2DA 1J9MA 2M7OA 3FKAA 1LI0A 1IVWA 1CK3A 4P16A 4JV5M 3RJUA 2A3UA 4WWUC 1ES4A 3LTDA 1IKGA 2F5OA 1A67A 3TPZA 3NBLA 1ZG6A 3UJMA 4Z9QA 5IHVA 4HBTA 3CNMA 1O07A 3HHWA 4EXRA 3N8BA 4RA7A 1IVXA 2ML5A 3UNLA 3L28A 1E3RA 2V1UA 1FNNA 3N54B 1ZKJA 3ZHHA 3NXJA 5DF8A 1M6KA 4FH4A 4RX3A 2W56B 3M6HA 1OACA 1IU7A 4S2MA 3DGOA 2WKEA 4X69A 4FWHA 1MNLA 5AQBA 4DV7M 3JUQA 3KOXE 2SBLA 3B4PA 3UNWA 4H8RA 5FAQA 5I94A 1YQSA 4KG6A 1OH0A 1US1A 4LV3A 2CEAA 3SC3A 2D42A 3ER7A 2R45A 1NJGA 4MGIE 3X41A 4EV5A 2OLVA 4JF4A 4S2LA 4KQQA 3SFZA 4NL4H 3N9HA 3S28A 2HCBA 3CZDA 3X3ZA 4LSOA 1ES5A 1J09A 3PAGA 3CPOA 1EI5A 3ALAA 3OX9A 4X62M 1KWIA 1JKGB 2Y0QA 1TDZA 1N8QA 2DNSA 3HREA 1YLZA 2IUJA 5JPPA 3UPOA 3M7GA 3PZWA 5KP4A 3U5ZA 3VK7A 1N34M 3NDEA 4OPRA 2CFWA 3VLFB 4GRIA 4JKTA 4BLCA 4ZAMA 3WHLA 1FGMA 3S1YA 3DGNA 1VQ43 1K734 1JB5A 1DO0A 3GR2A 1BUQA 2V1ZA 4HM6B 3MWZA 2QIYA 3PS8A 2GDNA 2C96A 4EBLA 1XNQM 5M19A 1KDWA 4N9LA 1ZQ9A 5AIFA 5EXPA 5EXSA 2BNKA 2FOIC 5HL1A 1N5HA 1FGQA 4KG2A 3KE7A 3KP1E 4E3NA 4C75A 1K4FA 3Q90A 2L6OA 1M1K4 4N9KA 1RRHA 4WYKA 1E4DA 2CWTA 4MBKA 1YVBI 3KS8A 3ZNYA 4XDVA 4HM4B 3O88A 2DZNB 3SOYA 2Y2QA 1GL6A 3BM6A 4R3BA 1DVDA 4EWFA 3DZLA 1FUWA 2Z76A 2YFJB 3KOYE 4U13A 3GLIA 3N8RA 5C1BA 4LJ6A 1HKXA 1TDHA 1G6AA 1VQQA 3AMOA 1PWGA 1S5AA 2QZ6A 5FI6A 1UI8A 4JXJA 4RNYA 1JV2B 3TQSA 4YHHM 4JN6A 1AVKA 4HVNA 2RL3A 3H51A 3UDXA 3ILKA 5KO3A 1XHBA 3WS4A 4ZM8A 2DHRA 3N8LA 4GC5A 2QZ4A 3KOWE 1NWWA 3DY5A 1JN5B 3LH4A 3VOZA 2BG1A 2KEBA 2XQZA 4X6TA 3GSGA 3A98B 2CFKA 1ZC2A 3F7XA 4C6YA 4GHLA 1R4CA 4Q53A 4R9LA 5IEPA 4HLQA 3FUWA 3EHCA 4LJAA 4HYZA 4LJ7A 1MKIA 3CF2A 1Q39A 4J8TA 4WP5A 5DF7A 1O7GB 1K6SA 4NSOB 4RBNA 5DTTA 2O3OA 3HK4A 1IN8A 3FTCA 3G8ZA 2XRXB 1Q7Y4 3FKWA 1Z5AA 3HU1A 1HNZM 3KFQC 2FFJA 5EP3A 2P0XA 3FUTA 5KPTA 5DF9A 2ZC6B 3A42A 2CG1A 4N92A 2J9OA 2R9XA 3CCJ3 2UX0A 3KKGA 4K1VA 5GL9A 3WRZA 2G8LA 1KGEA 1VQ63 1XA1A 3U6CA 3I4YA 2DWZB 1T5YA 3C5AA 3U60A 3MHEA 4XM4A 2ZC3B 1BZAA 3JR4A 2GBWB 4AKIA 4GD6A 1XA7A 4U3TA 3UE0A 4X55A 2WOHA 4I8OA 5EXTA 3W0LB 3IWQA 3WS1A 3N8SA 3R9XB 2P38A 1DO2A 1H8ZA 1E32A 5DTSA 3NI9A 5JI2E 4KZAA 3Q81A 2X71A 4LRTA 4N6UA 3CC73 2C5RA 2J7VA 1XXHA 1NY5A 2JBFA 3OC2A 1K8A4 4OU7A 3NX0A 4DE0A 3A46A 4LEHA 4MJDA 2P74A 3SXXA 2JQ5A 3FH1A 1GVNA 3M2JA 3IQAA 3E99A 3SMSA 1W4NA 3GQZA 3G4PA 5CF2A 1LOXA 4JRFA 1QALA 2V20A 2UUBM 4UA9A 5FTJA 2IWDA 1K57C 2HL7A 4NRWA 4IBCA 3W4OA 1K57A 5U47A 1N33M 4BL2A 1K9M4 3J80S 1MPLA 5E6JA 1TEMA 3SH9A 3WDGB 2XSOB 1BLCA 3GRDA 1JNQA 1Z6FA 4JLFA 1G96A 4CGYB 4NHFA 3EIHA 1FOFA 5FTLA 4FMCA 2WGOA 1YIT3 3Q1CA 5IG4A 4GOGA 5E26A 4IBIA 2F5PA 3GLGA 1HQCA 1ONHA 1JWPA 4GKUA 3VOYA 4AG6A 1IEMA 1WNHA 3J7Yd 3DGMA 5AYSC 1EKMA 3VGNA 1GKIA 1YLTA 3QAUA 2O9UX 1KSIA 4NK3A 3VF1A 3V3SA 1YUBA 1E97A 1TDLA 2GBXB 2A15A 1IQYA 2D7HA 1I94M 3IH9A 3GRVA 3M8CA 1N5PA 1O7EA 1C7HA 5FI7A 5L2FA 1IBKM 3CU3A 3LMMA 3CME3 4WYKB 2W04A 4UA6A 2CV1A 1HT1E 2XR8B 2B1XB 2C99A 2ZQAA 4B7FA 2AHMA 1EG9B 2ZM6M 2DZOB 3FYZA 1PW1A 3CCE3 2NQ8C 1L0FA 1R6BX 4GITA 2XLNA 4F94A 1SXJE 4BTWA 1QAFA 1QJGA 3SS5A 3WMDA 1U60A 4RYEA 2FXTA 2Y2KA 3FF2A 2DRWA 1IYOA 3C58A 1IVUA 5LMUM 2LQVA 3AMOB 2R4EA 2HMKB 1SXJC 2KXEA 2Y21A 4R0QA 1NNUC 1IY1A 3HIIA 4GDBA 3AL0C 4Y0TA 3GQ5A 2A49A 3M6BA 3HLDA 5AQ7A 5A2QS 3NM7A 1NHWC 1YLJA 4DR3M 4EC6A 1L5GB 5F1FA 3L26A 3B8LA 3LVWA 3FD9A 5FQJA 3IF6C 3K1JA 3CCM3 1DVCA 5FGOA 2K54A 4OLGA 3I4VA 3IF6A 3QHYA 2UUAM 4MGKE 3S4XA 4JI0M 5KPZA 3T15A 2JDIH 1CI9A 3GVBA 2XSZA 3EQQB 1G8PA 4JI7M 1N77A 2ZM8A 2H1RA 1MWRA 5EXXA 2A5YB 2XSZD 3OCLA 3ECFA 4JXGA 4L78A 5EP4A 3BRMA 2CHQA 4KQOA 2KCDA 3L0RA 4LZJA 4MGZE 4PDGA 8CATA 4PM6A 4FCWA 4R3JA 1XMQM 4ZJ3A 4PD2A 1W2B2 2OQEC 6STDA 3IMAB 3C7VA 3AKZA 1NYYA 1PIOA 1E3UA 1IN5A 2XR0A 3IXGA 3CMA3 3SHFA 1FCOA 3KW6A 3U60B 4JI1M 2G5GX 4R4SA 2RGHA 3IWIA 4Q8IA 3DTMA 1E3UD 3M2KA 4O7DA 4JYAM 3NV0B 2D7EA 3V50A 1VM1A 1XX2A 3O86A 5CXWA 4OUQA 2ZAOA 5FQMA 4FR9A 1RJOA 4FH2A 3PBQA 1PI4A 3HVFA 1GL7A 2Y2OA 2Y2LA 4FCJA 1RGYA 3CCS3 5IG3A 3CJMA 4R7GA 1ZO2A 1UI7A 2IA7A 3G30A 3SAUA 1DMNA 4K1UA 4OOMA 3CCU3 3I553 1E3VA 3W4PA 1NU3A 2Z7JA 1HD8A 1ZAEA 4L8RC 3T1YM 2KRTA 3P09A 3STDA 1RRLA 3HKPA 3HJQA 1F8NA 1EA2A 1XXMA 1IELA 5GHZA 1NJI4 3KZTA 1YLYA 4XUXA 4WZ5C 1IY2A 3PXGA 3Q1FA 3KSJA 3CMZA 4BB9A 4WZ5A 1YE9A 4J9AA 4E3MA 4KENB 3D3LA 4X53A 5CGSA 2DVWB 1DMMA 1PU4A 3G2YA 3J2PB 1N9BA 1OHOA 2E2TA 2R46A 3ZGAB 4GMQA 2RSXA 2V1CA 3V3RA 3CF0A 3HHYA 1RGZA 3KS4A 3OTOM 3RE8A 3S27A 3EC9A 5EVHA 3BFDA 3ZG5A 1TH4A 1Q3BA 4REZA 2WAFA 1KGGA 5TGFA 2PU4A 1IQ8A 3IT9A 4LF5M 5EUAA 3JYIA 5EOOA 3GLGB 1BT5A 1QAMA 4M9SA 1A2VA 3E2KA 1KGFA 4DE2A 3AOGA 5CHMA 2ZL8A 5CGXA 4R3DA 5FSWA 3JR5A 1DJCA 3E9SA 4R4KA 1R2YA 1BULA 2W6JH 1E94E 3GP1A 3GLFA 3HL9A 3NC8A 3OCNA 4ZPXA 4OQIA 1W5TA 1IYSA 1T3TA 5JYOA 1W2ZA 5E2EA 3FLJA 2EX2A 1U5OA 2QMIA 7CATA 2J9PA 4WM9A 4BL3A 5FTMA 3UJNA 3LOYA 1W00A 2D1WA 1Q814 3D8LA 1Q824 1UUVB 5ITXE 1VQ73 3ITAA 4WW0A 3H4MA 4LF9M 2QPNA 3J7AS 3UE1A 4IVIA 1H6UA 4II7A 4NXMM 4XBTA 1ES3A 4DV6M 3T0UA 2PU2A 3LEZA 4IBXA 3LCEA 3F14A 3OPHA 1QYRA 3VFFA 1KVMA 3CC23 5KMWA 1CI8A 1W8YA 4E3LA 3FZWA 4ORLA 1NRFA 4FCTA 4RX2A 4DR7M 4LRSA 1E9RA 2WGVA 1JQJC 1M40A 1N78A 4DKIA 3HLBA 1W79A 4X66M 5KP3A 3DOAA 3S29A 5FQKA 2PZVA 1SXJB 3B4OA 1JB4A 3EN8A 2HP9A 4DV4M 3L27A 4PM7A 2Q9MA 1J2BA 3SEDA 5CTNA 3EX9A 1KYIA 2ZM0A 1SDEA 1JVJA 2EUCA 4UA7A 2RFRA 3VK8A 4OVZB 5JYPA 2CHGA 1RP5A 3IF6B 1OPYA 2RCDA 1I4WA 1TH3A 3GV9A 2P05A 1W5SA 4HM3B 5EVLA 3PBNA 2JA2A 3AFHA 3FTFA 2UU9M 1N8R4 5FQ9A 1L8QA 3OPLA 1HQYE 1KDSA 4GH9A 1OHSA 3DMCA 3WWXA 3F9SA 2M5ZA 1N9JA 2BMQB 2BJVA 1YJN3 1NY0A 3G32A 1XMOM 1YIJ3 5HFOA 2HMOB 3VMAA 3ZDJA 4X2HA 4CDLA 2Y2HA 3A3JA 4ZJ1A 3Q82A 3A3EA 1ESIA 3U6DA 1Z6TA 3IG5A 1D6ZA 3LTAA 4G1MB 1YMSA 1NDOB 5FAPA 1OJLA 3GQ3A 2CFOA 3FGYA 3FG1A 4O2HA 1W7FA 2FE8A 1MWSA 3WA2X 4FVMA 2IWCA 3HLCA 4MBHA 5E43A 3ZVTA 4G4QA 4LF4M 5KP1A 3HLGA 4R1GA 4Y0UA 4B7GA 3FUVA 3VSKA 2YR0A 4Z6YA 3AOEC 1BSGA 2CFLA 2INXA 2J7OA 3AOEA 2Y2PA 1G41A 2C98A 3QWLA 2ZC5B 3U1WA 2CWVA 1MX0A 4OP5A 2OV5A 2QCUA 2OCTA 4D81A 2ZDJA 3SYLA 3K7CA 1L2BA 3FG4A 1O7MB 5AIHA 4S2NC 3VDUA 4KZ7A 3EBTA 1Z5BA 5AEWB 4OP8A 2JC7A 1QMEA 4O8SA 1SKFA 3JUPA 1MWUA 3MG1A 2P0MA 5CGWA 4KFFA 1GY5A 3MKFA 1Y4KA 2XZUA 3B7CA 4N6OB 3ZG0A 4DE1A 3RGPA 2ZQ9A 4AW4A 2QPAA 4K61A 5CEBA 3V99A 4OPYA 5IENA 5EP1A 3HBRA 1CEFA 2G2UA 3PBRA 1Z1SA 1SPUA 3OWUA 3NBJA 3OV4A 2YQZA 2XLJA 4LGMA 3GPXA 3W8KA 4BLMA 3MFDA 3WS5A 1VQN3 1CEGA 1WE4A 5LC6A 3HU3A 3MG3A 1MY8A 4QNRA 1PWDA 1DMQA 4B3TM 5STDA 2VQFM 5FLXS 2E5LM 1HVBA 3MPHA 1G4AE 4LY6A 5FTKA 5IZ7D 3VDPA 4QHTA 5TR7A 3FCSB 3GLFB 5KSHA 2HMJB 3MSOA 1X37A 5EJCA 4WYYA 3PVSA 2F5QA 1LHYA 1MXOA 3SS3A 5AI1A 2L09A 5DVAA 4FWDA 3MZEA 1IYPA 4R23A 3NCKA 4JF5A 4L16A 1NB3I 4EQIA 4MMXB 4ITQA 2EXBA 3U6MA 4N6NB 1IKIA 3CTWB 5KQDA 1EE8A 2OQ4A 1S723 3DA1A 3ZG9B 2C10A 2XFSA 4QY5A 2WGWA 1O7HB 5EE8A 4LF6M 1W6YA 3MKIA 1E25A 3G6E3 1S3SA 3A45A 5A91A 3GZRA 3SARA 2QENA 4WMCA 3TG9A 4PCZA 2WZXA 4P85A 4H3UA 1MOLA 2HMMB 3KVWA 3A76A 4M9XA 1OHPA 4WMCD 4B08A 1A2KA 3SASA 3DGLA 3V98A 1MWTA 2GXFA 1JWZA 3G34A 3S22A 5FW5A 4M9ZA 3U6SA 3W0FA 1ULIB 3FKEA 2EFUA 3SAWA 4BTXA 3ZCBB 1KSFX 4KQRA 3CNXA 4EBNA 2KZSA 3VP2A 3OZHA 1NB5I 1ONGA 3NQYA 1O7WB 3NV0A 4CPKA 4FWGA 3ISGA 4FMDA 3OXAA 2STDA 1QMAA 4I4LA 1NSFA 5FAOA 4L8OA 2WKIA 1MU5A 2WK0A 3IXHA 4PDIA 1RCJA 5DREA 5DNYA 2X49A 3G16A 2LWXA 1VQ53 1HR0M 5ITQA 4B4XA 2F4VM 3GRUA 2J8YA 1OGXA 1ROAA 4WEJA 1PW8A 5ITTA 2QBYB 3NWLA 4AG5A 1BLPA 3BLZA 2F5SA 5E2GA 1S0WA 4QU3A 1AR0A 3NHXA 1NZUA 2FNAA 4JI5M 1PFPA 4CJNA 3A3IA 4KZ5A 3BFCA 4FSFA 3LMLA 1XP4A 1LNHA 4AKHA 3MYTA 4DV5M 3KOZE 4RNAA 2HMNB 3M6AA 3NBBA 4JXWA 1A90A 4ZTKA 5HW3A 5A0OB 3D4FA 3VP0A 1ERQA 4MMZB 3K0ZA 4X65M 2E8IA 3WRTA 2R4JA 1SDNA 3LO7A 3VP1A 4IEDA 1PZOA 4LZZA 1K25A 2Y2IA 1K82A 3C4OA 1K4EA 4G6ZA 3MZFA 3E2LA 2Z4RA 4PT5A 1I2SA 3VSYA 4I4KA 1H5XA 3CF6E 1IM2A 2BNGA 4N3VA 5EECA 3M0EA 3G0KA 4X56A 5IG5A 5EP2A 1Q40A 3NUVA 1W6CA 3EF8A 3LTCA 5F82A 1OGZA 3T1HM 2LH0A 4DRTA 4LJ8A 1V74A 3B9PA 1HNXM 4UAAA 1ORYB 4FCZA 1JJ22 2HPBA 1LVNA 4LJ5A 1L0DA 5E2FA 3P98A 2IWBA 2HP5A 1STFI 2ZANA 4ZDXA 3X3XA 1WTHA 4M0WA 4YFMA 4XBOA 3X42A 1TP6A 3PTEA 3G2ZA 4LENA 2DWLA 2WYXA 4FCFA 3SS4A 2JCHA 4BTYA 1AV4A 3K8ZA 1VQP3 3N6IA 4LFAM 2Y59A 5EEOA 2UWXA 1XNRM 4G4NA 4NRVA 3FG3A 3EQVA 4LV1A 3Q8XA 1SXJA 5CLKA 3BYDA 1VQM3 3RDEA 4ZJ2A 1D6YA 4JXVA 1BLSA 1WYCA 2XF3A 4MGYE 4HEFA 1DGBA 1SXJD 3UMMA 1R2ZA 4O02B 3L29A 4QB8A 3FZCA 5BPVA 3T8NA 4HKVB 3HUNA 3HUMA 2XK1A 3O3VA 2ZJ9A 1L1TA 4OVZA 1FSWA 2Z6BA 2ZM2A 4NXNM 5HARA 4S2OA 2YFQA 1NYMA 4KFEA 2WGWB 3HHZA 2CIUA 4QD4A 4GB7A 3UDFA 3VKHA 3V39A 2EA0A 5LC7A 1AXBA 3GMWA 1K54C 2XH9A 3Q7ZA 4PM5A 2P5TA 4Z8XA 1TGUA 1IN4A 4WEKA 2CH9A 4ZBEA 3MJ5A 4R1KA 2PBYA 2CW9A 3MG2A 4HM5B 2VQEM 2BJWA 4HM2B 3G31A 3GRRA 2XD5A 4KZ4A 3PCRA 3IH8A 5IEOA 5CECA 3G713 3T38A 1G59A 4EYCA 1VQO3 5FASA 1IT7A 3NBIA 3RGRA 2BMOB 3UPPA 2OQEA 4NETA 3LZAA 1XKZA 1YLPA 3BFGA 4N6V0 1M9GA 3JAMS 4EV2A 1K3XA 4JI2M 3LYGA 3CCQ3 4AZFA 4GHAA 1PJJA 5DTKA 3CXC2 3BFEA 2M60A 4R80A 4LJ4A 4I5SA 1Q42A 8CHOA 1LL5A 2Z2MB 4DR1M 3UK6A 4OVMA 1W5DA 1N36M 3LQQA 4XGIA 4JI4M 1VQ93 2OTJ3 2EO2A 2Y2MA 5GHYA 4D82A 4PM9A 4KZ9A 3SH7A 3L2AA 4AI6A 5HAQA 1G68A 1IY0A 3ZFZA 5IG0A 3K63A 4HM0B 3FF0A 3HU2A 2UXCM 3AV0A 1NY6A 2D7GA 2UXBM 3F8HA 5GLDA 3C4PA 4B3SM 4QOZC 1NJFA 1YT4A 4MLLA 3FWLA 1IQXA 3UB1A 1QZMA 3IG8A 1K28A 2CV0A 4BENA 3GQ4A 1CYVA 2X8AA 4N6LA 1OMEA 1GA9A 3O87A 4OPQA 2WOFA 1KE0A 1VQK3 4JBFA 1EROA 4IBFA 1K3WA 1K56A 4PPRA 3UL6A 3VSLA 3WOFB 1HZOA 2WADA 4DUYM 2DWNA 2E2UA 3V5MA 5A93A 4DV2M 1JR3A 1K56D 3TE6A 1O7NB 4AKZA 3OW22 1QAOA 2CG0A 1Q864 3LTBA 3SOAA 5I97A 3G4S3 4ID4A 3O8YA 3Q2PA 4OX9M 1JR3D 4NOOB 4OQGA 1LI9A 4LCMA 2LNHC 1SIIA 2YFIB 3S5CA 1ES2A 3CC43 1I5QA 4HM7B 4LFCM 5IREB 5EPHA 5KSCA 2ZMAA 1Q40B 4FMBA 4OVDA 5TFQA 2ZQ7A 2UXDM 1GLNA 3GPYA 5AYRB 1PZPA 3KFUG 2G2WA 4OOLA 5HAIA 5EOEA 2XGNA 4K91A 4QY6A 4K0XA 4BD1A 3WODG 2HDSA 3MKEA 1FCNA 2Y55A 4EIWA 4LF8M 4MNRA 4U0TA 2HP6A 5M1AA 4IT7A 2P9VA 2OOVC 3U6QA 4XXRA 1YMXA 7STDA 5ITYA 3TWLA 5ITXA 4LF7M 2KRKA 2WKHA 3KDSE 3PNYA 3K92A 4IBGA 1BTLA 3W4QA 5JI3E 2XZFA 1IT8A 4LCBA 4C3QA 4LMIA 1SJWA 3I563 3IHBA 1W7CA 4KZ8A 3ZG8B 2Y91A 2ZQ8A 3BNDA 1KQS2 1GHPA 4OK0A 3UE3A 4D2OA 4HBRA 2CE7A 4OQ0A 4R4RA 1JRQA 4IBRA 1LV7A 5ITRA 2BO9B 4KODA 2VGKA 2FFFB 1ISKA 1IVVA 2R9WA 4XB5A 3IXDA 2Q07A 3I7JA 3HIGA 3GRYA 4XBXA 4P6BA 2EXAA 4RZMA 3EJVA 4PEJA 4GN2A 5GKNA 1NVMA 5BXQA 4DXBA 1DGFA 4AQYM 3A3DA 4E6XA 2YX9A 3RGAA 3KXEC 2FFYA 3FUUA 1IYQA 3K2LA 3UDIA 4E3IA 4MGHA 2RCXA 2QEX3 1IBLM 2Q2EB 2Y4AA 4UHUA 3DZDA 4HM1B 5CHJA 1IXZA 3BLSA 4LV2A 3HWSA 4DV3M 3DFZA 4GDNA 4P0MA 2FGTA 2KZUA 5EVIC 1ESUA 2KXGA 2QBYA 5BOHA 1N75A 2V6ZM 2Z3XA 4MM3B 1FR6A 3PNVA 1CYUA 2DCFA 3TSGA 5EVIA 3GRJA 2W2CA 4RF0A 2ZC4B 2O5RA 1FGRA 5EVID 4IJFA 3Q07A 1ERMA 4A3VB 2QA43 2R18A 3T8UA 4K0WA 3LY4A 2ZQDA 2I72A 5FSRA 4LFBM 3HLWA 3MXSA 3K5TA 4HBUA 1FCMA 1EWZA 4IIAA 1KD14 3BNEA 4KFDA 3OPPA 2I9WA 1FA3A 3PBTA 5FA7A 1UW1A 5TGNA 1VZZA 3F8XA 3BFFA 3AGFA 4MMYB 4IBKA 3U6OA 2HMLB