2XH9A

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGASPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 139
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xh9A03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xh9A01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xh9A02
5DF8A 2Y2NA 1BLHA 2Y2JA 1FCOA 2IWCA 1KGEA 1S6RA 4S2NC 4JXVA 4JLFA 1W5DA 2EXBA 1PI4A 5FATA 4E3LA 3VP3A 3ISGA 1E3UD 4OPRA 1Q2PA 5CHUA 4N92A 3E2LA 3NDEA 3M2KA 4OPYA 3UDXA 5FASA 1LL9A 1I5QA 3V5MA 4E6XA 3OCNA 1VQQA 3G2YA 3WRZA 4WMCD 1CEFA 3O87A 5FAPA 3ZG8B 3UDIA 3A3FA 3M2JA 1HD8A 1EROA 3O88A 5EVID 2ZM0A 1XKZA 4JXWA 2XQZA 5GL9A 5HARA 3TSGA 3MXRA 4QHCA 4IVIA 1IKGA 5HAIA 3V39A 3WWXA 3NBLA 5EVLA 4UHUA 3C5AA 3FWLA 2EX9A 3VP1A 2HDRA 4KZ8A 1N9BA 4RX2A 3NCKA 1RGYA 4UAAA 1K56D 2HDUA 3RJUA 3UE0A 2Y4AA 3GRJA 2ZJ9A 1NYMA 1EI5A 1XA7A 1PWCA 2WUQA 5E43A 4E3KA 2A49A 5E2GA 2C6WB 1CI9A 1FCMA 1TDLA 3HLGA 3ZGAB 4N1XA 1K6RA 4OPZA 3BM6A 2Z2MB 2J8YA 1SDNA 4KZ4A 2V20A 4UA6A 4L0LA 4KENB 3VOYA 4BLMA 5F83A 5M1AA 5KMWA 5KSCA 5AQAA 4KZ5A 3HLFA 4KQQA 1LI0A 3UE3A 3OPRA 2V2FF 4EUZA 2Y2QA 3SS4A 1TEMA 4WZ5C 3MKEA 1KE0A 3NI9A 2BLSA 2VGJA 3WS0A 2P9VB 4F94A 4PM6A 3CG5A 4E3IA 3N8SA 3GV9A 3DWZA 3MBZA 3ITBA 4P6BA 4GDNA 5AQBA 4MBKA 3A3IA 5F1GA 3ZVTA 1YLWA 1PZOA 4WM9A 4E3OA 1KGFA 5CGWA 3ZFZA 3NDGA 1Q2QA 4JF4A 4KZ9A 4OLGA 3A3EA 3LY4A 2FFYA 2H0TA 3FKWA 2GDNA 1PYYA 4R1GA 2Y55A 4BL3A 3N4IA 3IF5A 1ES4A 4OP8A 4OOLA 5AQ9A 3N8RA 3HLWA 1I2SA 1SCWA 4N9LA 1BSGA 3D4FA 4DXBA 3BFGA 1GHIA 4KZAA 5DTSA 3IF6B 1XA1A 3OZHA 2B5RA 3HL9A 4DE1A 1DY6A 5FQJA 1MKIA 2DNSA 4PM7A 1Z6FA 3AGFA 3IQAA 1PWGA 3SS3A 4ZJ2A 5FSRA 3DW0A 4BD1A 4EQIA 2JBFA 3VFFA 5CRFA 2H10A 5M19A 4EBLA 1PIOA 5FAOA 2WADA 3BECA 3CZDA 4KZ6A 2H5SA 5E2FA 3TOIA 5A93A 4P0MA 5E2HA 1L0DA 4ZTKA 2V1ZA 3Q07A 4KG6A 4KG2A 1K4FA 5HW3A 3IXHA 3A3DA 1I2WA 4H8RA 3VFHA 4MNRA 1ZG6A 3QHYA 2OLUA 4Z9QA 5DTKA 4R3BA 4PM5A 3EQUA 3S1YA 1NXYA 2XEPA 1CEGA 2Y2IA 4C6YA 1H5XA 2Y2LA 1LL5A 4KQOA 2XK1A 2WGWA 2XFSA 5A91A 1JWZA 3BYDA 4FCFA 4E6WA 5GHXA 3IWIA 1M40A 3OCLA 1BT5A 1JVJA 5CGXA 1NZUA 2Y2HA 4S2PA 2G2UA 2WGIA 1Y54A 2ZQAA 3BLMA 3G31A 3A3JA 3MZDA 4HEFA 4ZAMA 1NZOA 4CPKA 1GHPA 4P87A 5FI6A 4R23A 5CXWA 1W79A 3ZNYA 4WELA 1ALQA 3AGDA 2H0YA 2R9WA 3IH9A 5DF9A 4E3JA 2XF3A 4QY5A 4DRTA 4LENA 5TR7A 3SH8A 4KZ7A 3UN7A 5JYOA 2WAFA 2ZLYA 3VSLA 4RVAA 1JWVA 4WZ5A 4MLLA 1ESIA 2ZC7A 2HPBA 2XD1A 2IWBA 1GHMA 3TG9A 5M18A 1WE4A 3NY4A 3BFFA 2HDSA 3PAEA 1ZC2A 2WAEA 1XPBA 2EXAA 1TDGA 1XX2A 2HP6A 3QNBA 3FV7A 4JF6A 2HDQA 3DWKA 1FSYA 1ZKJA 3HBRA 4N9KA 3WS1A 4FH2A 3Q82A 4KZ3A 3VOZA 1ERMA 3HVFA 2DCFA 3LY3A 4RYEA 1H8ZA 4JKTA 1YLZA 4S2NA 3VP0A 4GOGA 3BEBA 2Y91A 3MZEA 4GKUA 3ZDJA 4B88A 4ZJ1A 3OC2A 2JCHA 4NETA 2Q9NA 3WS4A 5CEDA 2WYXA 1FQGA 1N4OA 4N1HA 4ZBEA 1K38A 3FYZA 2R9XA 1GCEA 5CTMA 4DKIA 3SOIA 3N8LA 3PTEA 1K56A 1ESUA 2WZXA 5E2EA 5EPHA 1WYBA 1FCNA 2ZM8A 3G4PA 4PPRA 5JYPA 1JWPA 3IHBA 4NK3A 1KE4A 4OKPA 1ES2A 1FOFA 3O3VA 2WGVA 1YQSA 3FZCA 5G18A 4Y0TA 5KZHA 5CECA 4R4SA 1NRFA 2ZMAA 1IYOA 1PWDA 2EFUA 3C4PA 3G35A 1W8QA 4GD8A 4LV2A 4RA7A 1O7EA 1MWTA 4JBFA 3UO9A 3PBTA 4KG5A 4IBRA 4Y0OA 2WGWB 3CMZA 5HAQA 3M6BA 4OVDA 1DJAA 1KGGA 4GZBA 4KQRA 1BZAA 5F1FA 2QZ6A 4M3KA 1KDWA 4FD8A 2RCXA 1L0EA 1KE3A 4CJNA 4HBUA 4K91A 1C3BA 5F82A 2FFFB 5EOEA 5FI2A 3P09A 4GB7A 4LV0A 4OQIA 1ONGA 3GVBA 3PBNA 1LLBA 3GSGA 1QMEA 3IWQA 2Z2LB 1YLYA 2XD5A 3Q7ZA 3MZFA 3UDFA 1BUEA 4OQGA 1YM1A 4WEJA 3WRTA 4MBHA 3N7WA 3S22A 4DE0A 1QMFA 3IT9A 1LHYA 1RCJA 2ZC6B 4KZBA 4DDSA 3WS5A 3UPOA 4BL2A 1BLPA 3SH7A 2ZQCA 1DJBA 2OSUA 2PU2A 1ERQA 4QU3A 1M6KA 3HLCA 2XR0A 4EWFA 4UA7A 2PU4A 2X01A 4GD6A 2DRWA 4X69A 2Y2KA 2VGKA 3PBOA 1FR1A 3HLEA 3IF6A 4QB8A 3DTMA 5GLDA 3ZVWA 4O7DA 4A5RA 1CK3A 3ZG5A 1GA9A 5L2FA 3UY6A 4OH0A 3OPHA 2OLVA 4OLDA 5EVIC 4BJPA 4MBFA 3UE1A 2G2WA 1VM1A 4P85A 1K54A 1H8YA 1ONHA 2I72A 5EE8A 5GLBA 3MFDA 3LCEA 4X53A 1E25A 3E2KA 3GR2A 2Q9MA 1JTGA 1O07A 2ZQ7A 5U47A 4DDYA 2WKIA 1MBLA 1IYPA 5HFOA 1BTLA 4S2OA 2J7VA 5CHJA 5A92A 1PW8A 2P9VA 1G68A 1XP4A 3QNCA 2XGNA 1G6AA 4JPMA 3G32A 4YFMA 4DXCA 5CEBA 3GMWA 5HX9A 1NY0A 4S2KA 4S2IA 3GQZA 1L2SA 4OOYA 3JYIA 4C75A 3M6HA 3Q81A 4HBTA 3VMAA 3LEZA 5EECA 3EQVA 4E3NA 4Q8IA 5HAPA 1K57A 4WBGA 3OPPA 4K0XA 5FQKA 4UA9A 2X71A 4GNUA 2ZQ8A 4B4XA 4XUXA 3UPPA 5CTNA 1IKIA 2CC1A 4X55A 2WK0A 4WMCA 4EBNA 4YINA 3HLBA 1WYCA 3BLSA 2EX6A 4JXSA 4PMAA 5FI7A 5FQ9A 1IEMA 1BLCA 1XXMA 4JXGA 1XGJA 4LCMA 1NJ4A 3W4PA 4Y0UA 3S4XA 1TVFA 2ZQ9A 1K54C 5A90A 5KSHA 2ZC5B 3GTCA 3I7JA 1K55A 3ZHHA 2HP5A 1S0WA 2A3UA 2EFXA 1YLTA 4ID4A 3G2ZA 1EWZA 3IXDA 2UWXA 5DTTA 3UPNA 3VSKA 4E3MA 3P98A 2Y2MA 3IHAA 4C3QA 2ZC4B 1PZPA 4XUZA 1MWUA 4X68A 4OPQA 4EBPA 1KVLA 1MPLA 2BG1A 3MKFA 3V50A 1MWRA 4R3JA 2QMIA 1KVMA 2ZD8A 1FR6A 2XH9A 4LV3A 4OP5A 4PM9A 1NYYA 2WKHA 4HESA 1SHVA 2XFTA 3NIAA 4QD4A 4BENA 1FSWA 4XXRA 3BRMA 1L0GA 3HUOA 4ZDXA 4B4ZA 3SH9A 5DF7A 2XDMA 5TFQA 3ZG9B 5CERA 3MXSA 1PI5A 4S2JA 1PW1A 3G30A 4DF6A 3HUNA 1CI8A 1MXOA 4WYYA 4DE3A 4QY6A 2C5WB 5FDHA 3W4OA 4EV4A 5BOHA 4GN2A 3N6IA 3LO7A 4LV1A 4FSFA 2JE5A 4LCLA 2P74A 3C7UA 1E4DA 2E8IA 5EVIA 3VP4A 5EUAA 4U0TA 3B3XA 3UNWA 2EX2A 2HP9A 1YMSA 4D2OA 3V3SA 3WS2A 5DVAA 1IELA 2QPNA 4IBXA 2IWDA 2Y59A 1J9MA 1K55C 1ES5A 4PM8A 3ZG7B 3IWOA 2ZC3B 4JF5A 4ZJ3A 1ES3A 1BLSA 4IVKA 4K0WA 4R0QA 4S2MA 2OV5A 3Q7VA 3BFCA 4BD0A 3ZNTA 2Y2PA 3O86A 5TGFA 1K4EA 4FH4A 1MWSA 4GDBA 4OONA 5FAQA 1RGZA 3G34A 2RL3A 1AXBA 4X56A 1YMXA 3SS5A 4RX3A 3CJMA 4QJGA 1K57C 1SDEA 2J9PA 3BFDA 4R4RA 2ZQDA 3ZG0A 1YLPA 2EX8A 3C7VA 5GHYA 4OQ0A 3BFEA 1MY8A 3IH8A 5I94A 1W8YA 5IHVA 1JTDA 4IEDA 1IYQA 3HLDA 4S2LA 3V3RA 1IYSA 4OQHA 3VP2A 5FQQA 1U60A 5CHMA 1BULA 3W8KA 5J8XA 3HUMA 4WZ4A 4X6TA 5AQ7A 2PBYA 3IXBA 4WEKA 4U0XA 3PBSA 1E3UA 2WKEA 3IXGA 5FQIA 3AGEA 3PBRA 1K25A 1SKFA 2Y2GA 1XGIA 3Q7VB 1HZOA 2ZM2A 5CGSA 3ZCZA 1OMEA 1KDSA 1YT4A 5FQMA 1HVBA 1K6SA 5D3OA 1LI9A 3PBQA 1RP5A 5FA7A 5GLCA 3W4QA 3NC8A 5EOOA 4OOMA 3FKVA 1GA0A 1W7FA 4BQMA 3HREA 1ZG4A 2J9OA 2XLNA 5GHZA 1L0FA 3ITAA 3OPLA 1YLJA 3RXWA 2JC7A 3IF6C 5EVIB 5HL1A 3C4OA 2WZZA 4MEZA 4DE2A 1HTZA 3Q1FA 2X02A 2Y2OA 4Y7PA 3RXXA 5GLAA 1DJCA 4U3TA 3PAGA
chains in the Genus database with same CATH superfamily
2Y2NA 2C9OA 3CLOA 1WHCA 1FCOA 2VGLS 4JXVA 1W2B2 4JLFA 3W68A 2VEAA 3TWMA 1M904 3EBYA 1UM8A 3KFUG 4E3LA 1S1YA 1LOYA 3LYXA 1QUSA 1E3UD 2MC8A 4OPRA 1Q2PA 5CHUA 2BWBA 3LCVB 1IFQA 3E2LA 3RFWA 3M2KA 3NDEA 3SHGB 3SARA 3OCNA 3LTCA 3F40A 3LH4A 1W01A 1IXSA 1EFUB 3T50A 5FAPA 3KOYE 1IV7A 3UDIA 1ROAA 3OXAA 5EVID 5ITQA 2XQZA 1VQ93 3MR0A 5HARA 3S5CA 3TSGA 3WWXA 5HAIA 3IECA 1A2KA 1IKGA 1CF0A 3D9YA 3D72A 1GYBA 4NC6A 3NULA 3CCU3 2QCUA 4KZ8A 1N9BA 5HDSA 4RX2A 4L8OA 4L8RC 3CCV3 1O7WB 1RGYA 2EA9A 1K56D 2HDUA 3LR4A 3RJUA 1RNTA 3GRJA 2QBYB 2VA0A 2Y79A 4B08A 3EHCA 2ZJ9A 3NOUC 1L2DA 3CME3 5J3WA 5IT5A 3W0FA 4CLCC 2VDBB 1Y8GA 1TTEA 4XT2A 5E2GA 1CI9A 3HLGA 1TDLA 1K6RA 1RGCA 4NXFA 1UUWB 2Z2MB 4LSOA 2J8YA 2V20A 2W1TA 3E21A 5KO3A 4BLMA 1CUKA 5KSCA 5EEOA 4KZ5A 1PNEA 1P3QQ 2EWWA 4GB5A 1AR0A 2Y2QA 3SS4A 3NI9A 2BLSA 2VGJA 4YHHM 3K8ZA 1RCKA 4JI0M 1NLZA 2P9VB 2CEAA 2CFWA 1L3LA 3EB8A 2GX5A 1SQWA 4P6BA 2RSXA 3DAVA 1PJTA 2KHHA 4MM3B 1GY5A 4LG2A 3KSJA 4KZ9A 3UMMA 2GDNA 1PYYA 2DZLA 8CHOA 2Y55A 2CE7A 3N4IA 4G3KA 1B21A 4OOLA 5AQ9A 1N75A 3AJIB 2LXEA 2V1LA 1BOXA 3BFGA 1GHIA 5G1LA 4KZAA 4X62M 3AV0A 2MROB 3OZHA 3PYJA 4DE1A 3T4OA 3AHSA 3B7NA 1IXZA 1MKIA 4PKYA 4HH3A 3CCJ3 5CX7A 3BJNA 2Z3XA 1VETA 3HK4A 3WR2A 5I97A 3CCE3 2OAP1 2JA2A 2YQZA 4EQIA 3T4LA 4EBLA 5FAOA 4LYLB 1FYSA 5A93A 1NNJA 3CPW2 1J7KA 4NXNM 3TOIA 3LMLA 4P0MA 1X1WA 5KIZA 2INWA 5HW3A 2MJ5B 4R1KA 3IXHA 3HHXA 4MGIE 2CRUA 4R3DA 4MN5A 4X25A 2W3DA 1GSPA 4MNRA 2CHVA 2DAGA 1ZG6A 3QHYA 3NWLA 4HM3B 5AEWB 1Q7Y4 3LI8A 4L9FA 3K9PA 4P6ZM 4XBTA 4GH9A 1AIPC 3PNYA 7CATA 5FGOA 2Y2LA 6STDA 3JAMS 4OX9M 2QSFX 4LZZA 1D6UA 2CFLA 3T1RA 3UJMA 2WGWA 3KSPA 2L4RA 3SMSA 3MWZA 4R80A 3FGYA 2FOIC 5GHXA 3IWIA 1M40A 3GLIB 3SYLA 1JVJA 5CGXA 2Y2HA 4DR4M 2WGIA 3HHWA 2KNZA 4PKYG 3G31A 4ZAMA 1A2PA 1GHPA 3ZNYA 2OWHA 5J4EA 3E4QA 2CV0A 4WL9A 1CJFA 3MPHA 4G1MB 3AGDA 2XF3A 4CGYB 3MG2A 2W9QA 4KZ7A 3KSHA 3SVAA 4IJEA 4PT5A 2J7NA 1RGLA 2ZL8A 2UXDM 1W5SA 3B4OA 1E97A 3CF2A 1W5TA 1BRSA 4YOFA 2XSZA 1V34A 4X2HA 1VQ53 1MZUA 2IWBA 3BFFA 3OWYA 3PAEA 1XPBA 3K5TA 2DAIA 2H28A 2JY6B 1A2VA 4FMBA 3LTBA 3SYKA 2ZDJA 4JF6A 5D82A 7STDA 2N35A 5IWAM 1ZKJA 4R38A 4LFUA 1OJLA 4FH2A 4NXGA 3Q82A 3U6QA 3CWFA 3LQRA 2BT3A 2DCFA 1QAOA 4N6LA 3PXMA 4HAAA 1LT0A 2ZMFA 3LY3A 4RYEA 3RH8B 1RGAA 1D0KA 4M9ZA 2F5QA 3SEDA 7GSPA 2Y91A 2B3TA 1NV9A 3K1JA 4BTWA 1RN1A 3VGNA 1NLYA 4ZJ1A 5FLXS 2L4EA 1GD4A 1YPRA 2JCHA 1IBKM 4NETA 5CEDA 1BUQA 3KOWE 2WYXA 4WUJA 1FQGA 4I8OA 4F1IA 1HLUP 4N1HA 1K38A 3PZWA 1JBRA 4IBKA 1GCEA 3L26A 3I0YA 1NJGA 2CHCA 3J2PB 1ESUA 4DV1M 1WNHA 5EQLA 2EWVA 4N6OB 1OT9A 4XT2B 1FCNA 3JR4A 4R4KA 3G4PA 4L16A 5JYPA 1JWPA 2CH9A 1I0VA 2GU3A 3SHFA 2CG1A 4MGZE 3F8XA 1IDPA 4PCZA 3K63A 1VB6A 2ZHXB 4MDZA 4KVHA 1NV8A 1DE3A 3G35A 3U2AA 3GLIA 4WWUC 4LV2A 2YX9A 3S29A 1O7EA 1MWTA 4WW0A 1GOUA 3KYEA 2CG0A 1DJAA 4GZBA 1NNUC 1S3SA 5F1FA 2QZ6A 1QDRA 1KDWA 4I81A 1K0KA 4J5GA 3QP5A 1KE3A 1WMNA 3F14A 4FMCA 2O5RA 5FL3A 1AV4A 1C3BA 1XFQA 4IBCA 3KSED 3NUVA 4N3VA 1ONGA 1V74A 4OQIA 5IG4A 4DR2M 3IWQA 1YLYA 3Q7ZA 4OVZB 2F5NA 3F1NB 1BUEA 1VHMA 3WHOA 5IZ7D 1QAFA 1T6OA 2STDA 3EJVA 5AYRB 2OTL3 4ETXA 4DE0A 3IT9A 2DI0A 1LHYA 2GQFA 3C38A 2FNQA 4KZBA 7RNTA 1XNQM 1DGHB 4DDSA 3UPOA 3JVCA 1BRIA 3TE8A 5EXXA 1O7GB 2KF4A 5GKNA 1DJBA 1G28A 1ERQA 1E32A 2GZAA 1AVKA 4NL4H 5EP3A 5DYIA 2X01A 2PU4A 3F1PB 1D6YA 4GSPA 1QUTA 2VGKA 2PR5A 2CWTA 4B7GA 2W6JH 1LL8A 2V1BA 3HHZA 4L8PA 1OF5B 1DP8A 1GA9A 4HJLB 3E4OA 3LT8A 3GWRA 3UY6A 5JPPA 2IMJA 4J5KA 3JR5A 4BTYA 5EVIC 4MBFA 3UE1A 2G2WA 1K54A 1H8YA 2E2VA 2V8CA 1W2ZA 1WIVA 5F68A 3LCEA 4G3WA 1OPXA 1O07A 1FGQA 5U47A 1SJWA 2BJVA 3U61A 4HVNA 1R2ZA 1IYPA 3U6SA 1FIKA 2J7VA 4KODA 4OW0A 2R6FA 5ITUA 4DV3M 1PW8A 1XP4A 5AIIA 2XGNA 4DXCA 5CEBA 4YFMA 3N9HA 4GHOA 3NX0A 5HWVA 5EM1A 4S2IA 1JNUA 1X37A 1ZS7A 1DO0A 4C75A 3Q81A 1BVSA 1QALA 1TS0A 5HAPA 2W04A 2DAKA 3R4KA 4WBGA 4K0XA 1BNSA 2OWJA 5FQKA 1BGSA 4CLCA 1I0XA 1YGWA 2IA2A 4B4XA 2JN7A 2QBYA 1FNNA 1G41A 1JQJC 4BBAA 3B42A 5CTNA 3W67A 2WK0A 3T6PA 3MK6A 3CMA3 4FWDA 2B95A 2EX6A 4PMAA 4NOOB 3X3ZA 1ODVA 4IBBA 4B3SM 4KO8A 2J3TC 1CQAA 5HWTA 2DZOB 2KF6A 1XGJA 4LCMA 3OWUA 1NJ4A 1FGRA 4MB7A 3BXWA 2ZMVA 4HQAA 4Y0UA 2ZQ9A 3S4XA 1K54C 3LR3A 4Z8XA 3GQ4A 3UGJA 4L15A 3DZLA 3RFBA 3H4MA 3DM8A 3WA2X 3EIHA 1UCKA 1QMAA 1T18A 2X49A 3IHAA 2ZC4B 3S7NA 4MN7A 4XUZA 4C3QA 4X68A 1BNFA 1A5TA 1P0ZA 1OAIA 4OPQA 1MPLA 3V50A 4WP5A 3E99A 1MWRA 5G2GA 1NNVA 5L8RF 3TJZC 2CFKA 1EW0A 1FR6A 4LV3A 1SHVA 2PD8A 1FSWA 1IM2A 3DOAA 1N5PA 2RGHA 3X40A 4PAUA 2XDMA 1HKXA 3T1XA 5HOHA 2NUTC 5CERA 1PI5A 4XBOA 3IHPA 5FSWA 1TFKA 1CI8A 1MXOA 2ZOHA 2C5WB 2JHEA 5FDHA 3W4OA 4EV4A 2J5YA 4WURA 5BOHA 1YSYA 2P74A 1E4DA 1N33M 1S67L 3S7QA 5ITXA 4Y5FA 1BU4A 2APLA 1OGZA 1TUHA 3MFXA 2C4BA 3T4SA 1WA9A 3DGNA 2HP9A 1PJQA 1PYLA 1G3IA 2EUCA 4HP9A 1DVCA 2JKFA 3ZG7B 4LJ7A 1S5AA 2PT7A 4K0WA 4S2MA 2UXCM 4H6JB 3Q7VA 4BD0A 1NHGC 1UCIA 1LNIA 1K4EA 4FH4A 3FRIA 4DV4M 1OIPA 3K3DA 1V9ZA 4GDBA 1M9GA 3PXPA 3G34A 1SG9A 3CXC2 2PD7A 1STFI 4G3OA 4Y28F 3PS8A 3HJKA 4LGYA 1UWPX 4QJGA 2W0NA 4DMZA 1VEKA 1XNRM 4AKHA 2DVWB 3WOFB 3ZG0A 2J9PA 3DA1A 4G4OA 1BSCA 1UGUA 2JKRM 4R4RA 3URPA 2YNMD 1IQXA 4O2HA 3BFEA 1MY8A 4EUVA 2CWBA 2GEXA 2CK3H 1Q3BA 1QAMA 3EN8A 1JBSA 2PR6A 3V3RA 3RNTA 4AG5A 1VDLA 3U1WA 3IX3A 3VP2A 1N9NA 3KO6A 1J5EM 5CHMA 1NHWC 2JY7A 1VQ63 3EF8A 3W8KA 5DKKA 1ZO2A 4X6TA 4G6ZA 3S7OA 3PBSA 1Z59A 1E3UA 2WKEA 4REZA 4HJ4A 4WLAA 1IU7A 3T4QA 4WHAA 5ITYA 1T1AA 1K25A 3Q7VB 4M9SA 1BYWA 2JUJA 4HM7B 2KNAA 1YT4A 5KPRA 2OOBA 2L6OA 3A0RA 2JZ0A 1C7YA 5EOOA 3S7PA 3FKVA 4BQMA 1ZG4A 1JR3A 3VF1A 1W6CA 2XLNA 5A2QS 4WYKB 5GHZA 1OH0A 3F1OB 2J3WA 2ZANA 3IF6C 5EVIB 1ZX2A 4GIPA 4X1MA 2ZTDA 3F92A 1EA2A 5HL1A 3C4OA 4LF6M 1VQP3 4FVMA 4ZRRA 5G1KA 2X02A 3BQAA 1N9JA 2V1CA 3UK6A 1R4CA 2V9AA 3V76A 1FGOA 2F5MA 1WQLB 3TQSA 4NG2A 4S2NC 3U60A 1WR1B 1DYUA 2LVPC 5HZHA 3U5ZB 5FATA 3X41A 1YKDA 4EQ1A 2JKRI 4GHLA 3SASA 1AUAA 4OPYA 3UDXA 5FASA 3EIEA 5AJGA 1NSFA 1I5QA 1GMRA 4HJ6A 1KWIA 3E9SA 2H0IA 2AADA 5DFYA 3CHWP 1LSWA 1VQQA 1NJFA 2CWUA 4PEJA 2R78A 3T38A 3ALAA 1CEWI 3OLOA 2YFJB 4WMCD 5HD3A 3C58A 3O87A 1TH3A 3ZG8B 3AFHA 3FKAA 3LYGA 3O88A 1EKMA 1XJ3A 4JXWA 4G4RA 4O0PA 2O01F 3MXRA 1PRQA 4IVIA 3OBFA 4QHCA 3V39A 2YKHA 2EX9A 2HDRA 2EKFA 4MMXB 1UI8A 4HJ3A 2HAKA 3IS2B 3K92A 1UI7A 5LC7A 3GRUA 1IY1A 2Y4AA 2JY5A 1NYMA 1OTRA 1OHSA 1EI5A 2VV7A 4BTXA 1QVF2 1XA7A 4AKZA 2ZBBA 4DV7M 2A49A 4AI6A 3ZGAB 1I70A 2ZM6M 1OIZA 1ULIB 3ZC7B 4UA6A 2HHHM 1W63M 2K31A 3MG3A 3B89A 1VQN3 3FZWA 1EIJA 4KQQA 1LI0A 4AKGA 5EFWA 3UE3A 4JI2M 4EUZA 1SKOA 4GL6A 2PYPA 3GZXB 3MKEA 1KE0A 5HDCA 4F94A 4JGQA 3CG5A 1M1K4 4HZBB 1K3WA 1SIIA 3JUNA 1P9WA 2CFDA 3ITBA 4BMWA 3SX1A 5EP2A 1FGTA 5AQBA 4N6MA 3ZVTA 4KFDA 2FZ0A 1BNEA 2G3QA 3NDGA 4JF4A 3EQQB 2FFYA 2H0TA 3NBBA 2HMMB 3M6AA 2VF8A 1WMPA 5AIGA 1UUGB 3IF5A 3NBJA 4OP8A 2HMKB 3N8RA 2KDLA 1F4IA 1BSGA 2PYRA 3IPTA 1FA3A 3KP1E 2LB9A 2ZL1B 3HL9A 1DY6A 3OV4A 3NQZA 4AW4A 3SC3A 3SFZA 1T3TA 4PM7A 3AGFA 3IQAA 3EX9A 4HIAA 5HL6A 2NQ8C 4HYZA 4RNZA 3VFFA 1K82A 2ACGA 1KD14 3ER7A 4B93A 4BBUA 8RNTA 1PIOA 5IW9A 4KZ6A 1Q40B 1YE9A 4OVZA 3CNXA 3F1NA 4ZTKA 2V1ZA 3Q07A 1F5MA 4KG6A 4M9XA 4TX4A 1K4FA 3AMOA 4KT0F 5DREA 3CITA 4LF8M 3A3DA 3MQOA 4H8RA 4KQDA 5DFXA 3VFHA 2F4VM 1KQS2 2XGLA 1OTBA 1PJIA 4LJAA 4XDWA 3Q2PA 4ME4A 1VEUA 4EYCA 4R3BA 4PM5A 3HOHA 1CEGA 3OWSA 4C6YA 2YR0A 1H5XA 3H7WA 4EW5A 4KQOA 5IREB 2FS1A 3U6EA 1BSBA 2XR8B 3T4JA 3UB1A 1FGMA 1XMOM 3H82B 1Z5AA 1DP9A 2FNAA 1DP6A 1US1A 3O5YA 5EJCA 3T4TA 2R65A 2JKGA 2KXEA 3F9SA 1Y54A 2A2LA 5E6JA 3P01A 4I4KA 5EVHA 2L1MA 4EERA 3BLMA 3MZDA 3A3JA 1YLAA 4CPKA 3K9OA 4LFAM 2CV1A 3FG3A 2C99A 4WELA 2R9WA 2WOFA 3D5IA 3D4AA 4E3JA 4QY5A 4LJ9A 4NSRA 1RLSA 4KUOA 4LENA 3UB6A 3HX3A 2BU4A 4LJ8A 2Z77A 2ZLYA 5TBMA 3GLHB 4RVAA 2OQEA 4AQYM 4MLLA 3JUMA 2HPBA 2XD1A 1GHMA 3BY8A 1ZC2A 2VX8A 1RGGA 5IENA 3AHWA 2UUAM 2CMNA 3D9RA 1BSDA 5KQDA 1UGIA 2Z6CA 2BTFP 4O3VA 3CF6E 3HZJA 4MMZB 4Q53A 2HP6A 3QNBA 4GS9B 3GAXA 3Q1CA 3FV7A 1JZOA 3DWKA 1F2KA 4D81A 1D06A 2E2TA 2P5TA 3MJQA 4KZ3A 2A15A 3HVFA 2VQEM 3LR5A 2OWPA 4EV5A 2A24B 1H8ZA 3A0SA 3VP0A 2Y8HA 1LQMB 3KIIA 1H3QA 4X1LA 4JI7M 3X3YA 2KOIA 4B88A 2D02A 4QNMA 4J8TA 3GLGB 3G0KA 1JNQA 5L10A 2G5GX 2UUGC 3CC73 3NECA 3F7SA 5AVFA 1N4OA 2W3HA 1KFVA 5CTMA 4N6NB 2V1AA 1HR0M 4JGOA 1J09A 5EPHA 2FH0A 1SXJB 3HJQA 4QOSA 5CF2A 4JI3M 3SAWA 2CUZA 1KSIA 3FUVA 4OKPA 5CF1A 3O3VA 1FOFA 1BNRA 1NO3A 1YQSA 1WMOA 5G18A 4DV6M 3KSIA 3H9WA 5CECA 1GJSA 3I563 1NRFA 4R4SA 3BWLA 1IYOA 1PWDA 1GS3A 2EFUA 4JXJA 1R4YA 4IBJA 4GD8A 4RA7A 1DETA 2M5ZA 1X1XA 2D7HA 5IEPA 1JJ22 4JBFA 1PY3A 2MR9A 3UO9A 4EETB 5BR8M 2WGWB 3G713 1SPUA 1GO5A 1B2ZA 3M6BA 3VV4A 3SBJA 1BZAA 3DTKA 2YFLB 2OOLA 4M3KA 2LVOC 3X3XA 3TW8A 3VE3A 2RCXA 5CLKA 4GCZA 3PHYA 5FI2A 2FFFB 2G8LA 4FOFA 3GVBA 3PBNA 3I01M 1LTMA 1E9RA 2KZUA 1QMEA 2Z2LB 3LIFA 2XD5A 2WKRA 2WKQA 4DV5M 5DKLA 5HDDA 3F8HA 4LMIA 1YM1A 3WRTA 4IBFA 4BLCA 2QENA 2OQ4A 4I5QA 1G4AE 1NRJA 2ZC6B 5G4ZA 3T12B 3VE4A 4BL2A 2CP8A 1H6UA 1BLPA 2ZQCA 1H8MA 2P04A 3HCYA 4X66M 4EWFA 2F5WA 2OOVC 2KRUA 1M6KA 2XR0A 1O7NB 3HZPA 3QAUA 1VQ1A 2DRWA 2RBIA 4X69A 4HH2A 3SYUA 1HZ1A 3HLEA 3VK7A 4QB8A 2H1RA 2LHGA 3N54B 4W5WA 1FUTA 1YJW3 3ZG5A 2HJ9C 3LZAA 2HCBA 1N8QA 2CX1A 1ZQ9A 4OH0A 3EN1B 1T3BA 2WSEF 3OX9A 1A90A 1VM1A 2K54A 1ONHA 2W1RA 5GLBA 3QRDA 1D0MA 3MFDA 2BASA 1FUWA 1EQKA 2ZQ7A 2FE8A 3MJ5A 2WKIA 2D7EA 1BTLA 5HFOA 1N78A 4HM1B 4IPBA 3E98A 4Z1WA 3CPOA 4IIWA 4LJ4A 2P9VA 4EEUA 1VQ73 3ICYA 2KDKA 1N77A 5LBRA 1E3RA 1G6AA 2XZFA 2M7OA 2F5OA 1T1CA 1I3FA 5L09A 1NY0A 4LGWA 4S2KA 4EW7A 4HBRA 5E26A 3GQZA 3U6DA 1L2SA 1GABA 1F8NA 3T8NA 3S28A 1OJGA 4WF0A 4Q8IA 4N6TA 2K2NA 4QNRA 1V57A 1H0MA 3GQ3A 4LGQA 2HMJB 1MGWA 1HQYE 4DR1M 1JB2A 4H3UA 4GITA 4XUXA 4JI8M 1G96A 2WGQA 1IKIA 3NQYA 4WMCA 2CHQA 2O25A 3BLSA 5F69A 2IYJA 1IEMA 1MOLA 1QYRA 2M60A 1BLCA 4MEIA 1VQO3 1LXEA 3U4LP 4RF0A 1TVFA 5FW5A 3B4PA 1KC84 4LEHA 5KSHA 3AL0C 1K55A 3QWLA 2R45A 1B20A 2JDIH 3GECA 1IXSB 2CFGA 2I9WA 4M4XA 3G2ZA 1IVWA 4JGRA 1BAOA 3L27A 1DGBA 1PZPA 4YNRA 1DGGA 4K61A 4B9OA 3KP0E 4IIAA 1ZTUA 1Z1SA 4NRVA 2XZUA 1NY6A 1JRQA 1VQ83 1KVMA 2L7HA 1ISKA 4OP5A 1Q864 1TJDA 2WKHA 2CX0A 2OPFA 3NIAA 1BRGA 1JBTA 3TWKA 1OPYA 1RN7A 4BENA 3BRMA 5AIHA 3HUOA 1OTIA 4MJDA 3SH9A 4B4ZA 3PYPA 5TFQA 2K0MA 3GLGE 1RGKA 4IBGA 3A0VA 4AKIA 2OO9A 1PW1A 3G30A 4WYYA 2DWMA 5HGRA 4QY6A 2P05A 1IOUA 4DV2M 4LF9M 4KFEA 3LO7A 4LCLA 3VP4A 3C7UA 1QAQA 5IF6A 4DUYM 5JPUA 2EO2A 5EXPA 1YMSA 2LYXA 3C9PA 1IK3A 5DVAA 1SXJE 3UB9A 1W7CA 3CCR3 1L2BA 2CIUA 4DJ2A 2Y59A 4KHPM 5ELJA 3K3CA 1OTAA 1IY0A 4PM8A 3B7CA 4QPRA 3NXJA 3FG4A 2ZC3B 1S4SA 4IVKA 3LIBA 1SXJD 3GPXA 1FZUA 2Y2PA 1AVLA 2CHGA 1PFPA 3LR0A 4NKPA 4NXEA 4M0WA 4OONA 4B7FA 2PHYA 1AXBA 1HU9A 3T15A 1TH4A 2LTUA 3RGAA 4PDGA 4RX3A 3CPTB 3U6PA 4JGPA 2BMOB 2ZQDA 1IQYA 4OQ0A 1PM5A 5TGNA 5I94A 5STDA 5AI1A 2VK3A 3NV0B 1KOUA 1IN5A 2X4AA 2Z7JA 5FQQA 5IG5A 1UDII 5JBSA 2QA43 1BULA 2GJ3A 3LT9A 1PGYA 2DHYA 5KQ8A 1BANA 3MKIA 5AQ7A 2IUKA 4JRFA 3MMPA 2QQ8A 4OUQA 3IX4A 3PBRA 3GRVA 2YKFA 1L5GB 1QZEA 1ZV1A 2MF7A 1XGIA 1HZOA 2LNHC 4AG6A 1QAKA 3PCSA 5CGSA 4G4QA 2K9DA 1IXRC 1Q42A 2Y74A 3ZCZA 2CFOA 5ITTA 2AHMA 1BIRA 2GBWB 1JR3E 4DR5M 1N9LA 5D3OA 3B7QA 1LI9A 3PBQA 5FA7A 5IG3A 2DWNA 4EIWA 3DGLA 2M7VA 4NPBA 4LJ5A 2LB5A 2JWSA 3HREA 2WO0A 1IT7A 3VLFB 3ITAA 3N8BA 2JC7A 4O8GA 2P0XA 3MSOA 3FKEA 4N6UA 3UMDA 1OTEA 4DE2A 3UJNA 5DRVA 5GLAA 3SZTA 3E46A 2DAEA 3W0LB 4LF4M 4U3TA 1HT2E 1BNIA 2KA6B 4LY6A 2BWEA 5DF8A 2SARA 2IWCA 4JN6A 1BVIA 1OACA 1W5DA 5A0OB 1RRHA 3HY5A 2DMWA 3U6CA 3CAXA 5TJJA 2IY2A 3ISGA 3VP3A 4B3MM 2P7JA 3B74A 1NWWA 2CKFB 4N92A 4U13A 3PNVA 2A5YB 2O9AA 3WDGB 3G2YA 3NBRA 1DMNA 3UL6A 2B02A 1CEFA 3WRZA 2KZSA 3GPYA 4EU0A 1TP6A 2LBCA 3NM2A 4LZIA 3SOYA 2W3GA 3FF2A 1EROA 2Z6DA 2CV2A 3GDIA 1L1ZA 3M2JA 4IUHA 3LUQA 1C7HA 2ZM0A 1D2NA 1XKZA 5F5YA 3NBLA 2PAVP 5EVLA 3WODG 5KP4A 3C5AA 3VP1A 4JI1M 4BU4A 4WP2A 3RGPA 3NCKA 2F56A 4CLCD 3UE0A 2L4FA 1TDHA 3BNEA 2HJEA 3A46A 4K0KM 3KS8A 3HWSA 5BXQA 3B33A 2WUQA 1D6ZA 2RCDA 1SXJA 3UL5A 4AKYA 3KE7A 1V92A 1DMMA 1QVG2 4LF5M 3MHVC 5IEOA 3BM6A 3DBAA 5KPTA 4KZ4A 5HWWA 1QZMA 4KENB 4L0LA 3VOYA 5FEFA 4Z6YA 3H3HA 1LOWA 5F83A 1IVXA 5M1AA 2O0YA 5KMWA 4DUZM 1I4WA 1OGXA 3A42A 1W6YA 3OTOM 1S66L 1T2IA 1L2CA 3I4YA 2V2FF 4L9GA 3UB5P 3CTWB 3GLGA 3G16A 3WS0A 1K28A 4Q0JA 2W82A 4GHIB 2BNGA 3N8SA 3MBZA 3NBIA 5RNTA 4GDNA 3DMCA 2XSZD 3HIIA 2QNJA 5CXOA 3A3IA 3E0YA 4O02B 3L7HA 5F1GA 1YLWA 1PZOA 1KGFA 3BOSA 5G4YA 3ZFZA 2UGIA 1Q2QA 4OLGA 3LY4A 1Q814 1OT6A 3KOXE 3FKWA 1NVMA 4GMQA 3UB7A 4R1GA 4BL3A 1Q39A 5ITRA 3F7XA 1HYFA 3QP2A 1S4RA 2EJSA 3FE3A 4Q7JA 1W5ZA 1JB4A 1XXHA 1ZMWA 1I2SA 2M7UA 2GNXA 1R4GA 3GQ5A 2GSPA 1YIT3 3IF6B 3EC9A 1XA1A 2B5RA 4NHFA 5FQJA 2H0HA 2VF7A 1YIJ3 1RGFA 3FUUA 2DNSA 2MGWA 3CD63 3GLHA 1LNHA 4IT7A 1Z6FA 3FCSB 4LRXC 2XRNA 5EP1A 1U5OA 4ZJ2A 5FSRA 2VZWA 3D3OA 1G8PA 4RNYA 4BD1A 1NB5I 2W27A 4HHDA 4IBEA 3K0ZA 5LC6A 4G3VA 1D1JA 3J7Yd 3MXQA 2Z8YM 5M19A 4MH0E 3SATA 5EXSA 3CZDA 5E2FA 1SZVA 2H5SA 3I4VA 4Y17A 1L0DA 1YVSA 1YVBI 4KG2A 2OTJ3 1E94E 1PJJA 4GKKM 4NREA 1I2WA 3I553 1Q824 3TPZA 4PDIA 3BY9A 3C3DA 3KCHA 4K1UA 3EQUA 3S1YA 4N6V0 2XEPA 1NXYA 3THGA 1AY7A 3FYCA 1LL5A 2XK1A 3L9KA 1SARA 5A91A 1LOVA 1JWZA 4FCFA 3JVUA 4E6WA 1GOVA 1Q7HA 3OCLA 1BT5A 1Q9EA 4L6V6 3AMOB 4S2PA 4ARZB 4E04A 2G2UA 4AFIA 3HKPA 3J27B 4HKVB 4HM6B 1C1KA 1JKGA 3QP4A 1AWIA 1NZOA 4KUKA 4LLOB 4P87A 1Q40A 3DY5A 1ALQA 2WGOA 2H0YA 4G4NA 4JI6M 2WSFF 1A67A 1NB3I 1MKMA 1IQPA 2WAFA 3UN7A 5JYOA 2KF3A 4AZFA 4I3AA 3NJAA 3DXOA 2ZC7A 1B2XA 2XRXB 3GLFB 1K9M4 4FWHA 3TG9A 4FCTA 1WE4A 3NY4A 2HDSA 3BQ8A 2LQVA 2WAEA 4HL4A 1TF1A 5MC7A 1TDGA 1GSXA 3WA3A 3WHKA 2JY8A 4K1VA 3DTEA 2K47A 1A0KA 4EV2A 3FC7A 4Y2FA 2KX6A 2ZTCA 4N9KA 3S67A 3WS1A 1STZA 2QHOB 2VLGA 3VOZA 3D8LA 5AYSC 3HX8A 1Y28A 2VIIA 3EEAA 3LTDA 4ITQA 3GZYB 2QYBA 8CATA 3STDA 4GHIA 4HOIA 3LEQA 2O9BA 4X64M 2GU1A 1BNJA 2FXTA 4L4UA 2KF5A 3OC2A 1MC0A 4MGYE 5BU4A 2P0MA 1Q3CA 3CCS3 1IN4A 3GPPA 1YI23 2WSCF 3VKGA 1VQ43 2Q07A 4MGKE 4R70A 3FYZA 2R9XA 3GLFA 2Q0OA 3M0EA 2VJWA 3PGBA 3KVWA 3C3EA 5K5BA 1FJGM 1O7PB 1NU3A 2RGOA 1YAXA 4DJ3A 4FWGA 5EV0A 3SLUA 1W02A 1ACFA 4DN0A 1R6BX 2XSOB 1V33A 3KYQA 1X1UA 1D0LA 4NK3A 1KE4A 2DWZB 3GLHE 5L07A 4GHAA 2C9CA 1ES2A 2WGVA 1XXHE 1B2UA 1JKGB 4Y0TA 5KZHA 5LMNM 1D7EA 2XA7S 4QWOA 4RZMA 4DR7M 1J3WA 3HI7A 3T1QB 3FTEA 4NXBA 1G59A 2K6BA 1VEGA 3PBTA 4ETZA 2KEBA 5FTMA 4CISA 3CMZA 1Q02A 5C1BA 2RGQA 4OVDA 2HOHA 1KGGA 2R44A 1TRQA 4D82A 2LH0A 3QYEA 2YFIB 5HPIA 1OFIA 3LICA 2R62A 3CCM3 2OOAA 5F82A 5EOEA 1YHQ3 3P09A 1XFNA 1HJPA 1VQL3 3GZBA 5HSQA 1LOXA 3LI9A 3B8LA 3UDFA 4OQGA 3PFIA 3JUOA 3I04M 3KZTA 4DR3M 4WEJA 2R4EA 3IBJA 3N7WA 4MBHA 3EGXC 1QMFA 2V6ZM 3FUWA 1F98A 1RCJA 2LVNC 1BUJA 4QHSA 3CI6A 3WS5A 1S1ZA 5D83A 4EXRA 1V9YA 2VKSA 4K08A 2GXFA 1QANA 2OSUA 1ORYB 2HWJA 4D80A 4QU3A 4UA7A 4GD6A 3JUQA 4XDVA 3LVWA 5DYGA 2Y0QA 3BIRA 1FR1A 1B3SA 5L8MA 5HD5A 3IX8A 1IFYA 3DTMA 4WYKA 4A5RA 2OCTA 4FCMA 5L2FA 3Q3FA 4XBXA 1O7HB 3OW22 4K90B 2OLVA 1TD5A 3OPHA 1ROVA 4BJPA 4HM8B 1Z5BA 4HP4A 1VDDA 3L25A 1T5YA 2L1SA 1E25A 5ITXE 1JTGA 2FH5A 4HEOA 3OOVA 2V1UA 1G02A 3QP6A 3G6E3 4S2OA 4B3TM 3JPUA 3KFQC 1ULJB 2O9CA 1N32M 1LRAA 5CHJA 4H61A 2BIRA 1G68A 4JYAM 4IHQA 1TIJA 4MGHA 3V99A 2PZVA 3QNCA 4JPMA 3G32A 1M1XB 3GMWA 3L29A 3FTFA 1X1YA 5HX9A 1VQK3 1MJGM 4CDLA 2DNAA 4OOYA 4BBTA 3M6HA 4PHTA 3LEZA 5EECA 3EQVA 4E3NA 2HMLB 4GC5A 4UA9A 3DGOA 2OOVA 2X71A 2KCDA 4GNUA 2ZQ8A 1SXJC 3U97A 4OU7A 3GPUA 1GKIA 3UPPA 4R9LA 5EQTA 1RHLA 3VKHA 2LVAA 5IU1A 1YNVX 2Z6BA 3IJEB 3D8BA 3NBXX 1WYCA 1BRKA 4JXSA 5FQ9A 2DHRA 1W6GA 1GJTA 1MGRA 1T2HA 3ECFA 3W4PA 4BBVA 4JF8A 3CGWA 3D79A 3V92A 2ZC5B 3GTCA 3GLFE 1UGHI 1R5LA 1GY6A 2HP5A 1HT1E 3RE8A 4B7HA 1YLTA 4ID4A 3KSXA 2V8FA 5DTTA 3TL4X 2F5PA 4E3MA 3DH2A 4MMYB 3LGOA 5IT9S 1KVLA 3UB8A 4RBNA 3WMDA 1B27A 4ANRA 2PBDP 4LRYC 3UZUA 3UE6A 2ML5A 1HNZM 4DR6M 1MX0A 4MMNA 4PM9A 4F2LA 1NYYA 4HESA 2XFTA 4QD4A 4DBGB 2HMOB 1DV0A 4UQIM 1N34M 4R9KA 5LMUM 2V0WA 2F5SA 3PCRA 3VDUA 1P9RA 2BHMA 3ZG9B 2L09A 1UFZA 1JN5A 4S2JA 2QEX3 4DF6A 4IBDA 4DE3A 1TH2A 4GN2A 3N6IA 4LV1A 3JVVA 3FH1A 5EUAA 3W2ZA 4FCVA 2DXIA 2Y21A 3UNWA 2L4VA 3UNLA 2I7PA 4D2OA 3FUXA 2VV6A 3QP1A 1IELA 2HV1A 4MCWA 3PR6A 2IWDA 1IN8A 1O7MB 1K55C 1MN3A 3VSYA 5FEGA 1HNWM 1XJ6A 1IBMM 3LIEA 3IWOA 4O01A 3V67A 3HU3A 4JF5A 1UCJA 2W0QA 4HY8A 4ZJ3A 3KX0X 3FUTA 4R0QA 2OV5A 2KAAA 3T4KA 4KT3B 4KLNA 3BFCA 3ZNTA 3O86A 2BMRB 1VG5A 4GJ4A 5TGFA 1RN4A 2UUCM 3EEHA 1RGZA 2D01A 2RL3A 4LPZA 3I51A 1YMXA 2J3TD 2GBXB 2CC3A 1B2SA 2LVQD 1K57C 1NJI4 1XWIA 1GD3A 3BFDA 2PNCA 1RU3A 1GL6A 5GHYA 4TUWA 2J7OA 1OHOA 3AOEA 3K9MC 1W8YA 3SOAA 4HM4B 2D1WA 2L0WA 4IEDA 1I94M 2ZBKB 2QGUA 1IYSA 3FTDA 1EG9B 2J80A 3CC43 1G5UA 5F6AA 3Q90A 1P97A 2Y20A 2KW0A 5EXTA 2D42A 2DKLA 4NRWA 4CQHA 2PBYA 4D60A 2R0IA 2DZNB 3FYDA 3IXBA 4WEKA 4U0XA 3DGYA 3FTCA 1W4NA 3IXGA 2ERCA 5KP1A 2KRTA 4HOHA 3CUEC 1T19A 3U61B 1SKFA 1MU5A 2Y2GA 3A98B 3WOEB 1OFHA 3D5GA 5FQMA 1GSVA 3ZQJA 1K6SA 4LGMA 1LQGC 2JZ1A 1EE8A 1K41A 2JQ5A 1WJ7A 3DFZA 1RP5A 1GL7A 4EC6A 3LVVA 4OOMA 1TTOA 2J9OA 3DTIA 4JI5M 1OF5A 1L0FA 3OPLA 1T43A 2X8AA 1RNBA 3LTAA 4FCWA 3F1PA 2WZZA 3MHEA 4MEZA 2G7UA 2Y0TA 3Q1FA 1JN5B 4Y7PA 3KSFA 3B47A 3MYTA 1YJN3 3QK9A 3FG8A 1DGHA 3PAGA 3AOGA 2PDRA 5FTJA 4AEQA 2Z4SA 1IV9A 1BSAA 1BLHA 1N36M 1LV7A 2PRFA 2Y2JA 3SAVA 3LFVA 4EEPA 1KGEA 1PFLA 1S6RA 3MQ0A 2EXBA 1PI4A 4IJFA 4DV0M 2UXBM 2L7IA 2DAMA 3TWLA 1LL9A 2VGLM 3ROBA 3TRCA 2JNHA 1KSFX 3V5MA 4E6XA 4LF7M 1STDA 1VQM3 1ZHHB 4QHTA 1RCLA 1WTHA 4JI4M 2W3FA 4LRSA 2KLIA 1VEJA 3A3FA 1HD8A 3FRHA 2IUJA 3JUPA 3EWKA 5GL9A 1YJ93 4X2OA 1ZAEA 4XGIA 1RSNA 3L0RA 4UHUA 3FWLA 1GY7A 2B18A 4GLQA 1WGNA 1BRHA 2UX0A 1L8QA 4UAAA 3RTYA 2RRUA 3M8CA 4P17A 4BIRA 3BNCA 2UUBM 3FSDA 5E43A 2Z76A 1PWCA 4E3KA 2W9PA 3E4RA 4EBGA 4II7A 1W63Q 1FCMA 4L78A 2EKKA 2C11A 2INXA 2C6WB 4LRZE 4N1XA 4FMDA 4OPZA 5I5LA 3KKGA 5J7EA 1SDNA 1IN6A 2QP9X 2P38A 5AQAA 4Y15A 3BU4A 5FTKA 1GLNA 3HLFA 1IVUA 3OPRA 1HQCA 1TRPA 1V58A 3CF0A 4I3JA 1J2BA 2SBLA 1TEMA 3NOPC 4WZ5C 4NXMM 1FILA 1YSPA 4I4LA 4PM6A 3T1HM 4E3IA 1FW7A 4CIZA 3BNDA 3GV9A 3DWZA 2E2UA 2H0GA 3GZRA 2F86B 4MBKA 5FDSA 2UU9M 1NY5A 4GW9A 1YSQA 1XB2B 4QWTA 1TS7A 2A24A 4WM9A 4E3OA 5CGWA 4RNTA 4XM4A 3BLZA 3GLIE 3A3EA 3LQQA 4ZPXA 2C10A 1GMQA 1F9IA 2XSSA 1NO1A 4CHTB 1DMQA 3HIGA 3B7ZA 2FGTA 4I39A 3HJSA 1ES4A 2B24B 2JXNA 1WGLA 3HGIA 2ZAMA 1L1TA 3HLWA 4NEED 1SCWA 4N9LA 3D4FA 3NOTC 1LSVA 4FTXA 4YWZA 5DFLA 4DXBA 1OQYA 1RTUA 5DTSA 3MS6A 1TR8A 1RRLA 1I3IA 2MH8A 1QDTA 2R4JA 5TBMB 1I2GA 1DVDA 1PWGA 3SS3A 4IJGA 4GRIA 3DW0A 3CCL3 1U8CB 1R2YA 2JBFA 5JI3E 3RGRA 2H10A 5CRFA 1HNXM 1WXQA 2R46A 2R4IA 2WADA 1C54A 3BECA 4BWIA 5E2HA 2AAEA 1GOYA 1RGHA 2O3OA 2C5RA 4FMAA 4B3RM 1E9SA 1Z09A 3MG1A 3H82A 4P16A 3GP1A 3AGNA 2OAQ1 2MJ6A 5GSPA 3MQQA 4YY3M 2OLUA 4Z9QA 5DTKA 2KRKA 3EGDC 2FFJA 4NSOB 4XBYA 2Y2IA 3H7WB 2K7SA 4J9AA 5AVEA 1VEUB 4L7KA 2R18A 1N8R4 4UEYA 2XFSA 3BYDA 3LIAA 2Y73A 2JP7A 4UN2B 1NZUA 1OHPA 3PVSA 5IS1A 2W03A 2E8JA 2ZQAA 1BSEA 4WFOA 3KYZA 4HEFA 5FI6A 4R23A 5CXWA 1W79A 4Q0HA 4RF1A 3HHYA 3AGOA 3BB9A 2P09A 3IH9A 2WZJA 5DF9A 4DRTA 5TR7A 3VOLA 3SH8A 2XA7M 3QP8A 4RQ9A 3VSLA 3SW1A 1VETB 1JWVA 4WZ5A 3D3LA 1ESIA 1FUSA 3NHXA 5M18A 1TGUA 4UQIS 2HGVA 2EXAA 3V98A 3LIDA 1XX2A 3IMAB 3IG5A 2HF6A 1ZGXA 3HJIA 2GNOA 2HDQA 1RJOA 3S27A 1FSYA 3HBRA 1OCVA 1UWNX 1N9OA 2HKJA 4GKJM 1ERMA 1IN7A 3A76A 3FLJA 4JKTA 3J81S 1YLZA 6RNTA 4S2NA 2O99A 2QJ5A 4GOGA 3BEBA 3B9PA 4XK8F 4M0DA 5ELUA 3G4S3 3MZEA 4GKUA 3T1SA 3ZDJA 3KOZE 4GS9A 1QJGA 1G0TA 4LZJA 1SKOB 3WS4A 2Q9NA 3R8FA 2XSHB 3PXGA 2OQEC 2QJ7A 1YGEA 3K7CA 4ZBEA 3K2NA 1PJSA 4DKIA 3CC23 3SOIA 3N8LA 2W1TB 1Y4OA 3PTEA 1OAOC 1K56A 3MF0A 1UW1A 4EESA 5A8BA 3BBZA 4GC9A 1JV2B 2WZXA 5E2EA 1WYBA 4IBIA 2YFQA 3J80S 2ZM8A 5IERA 3IBRA 2UV0E 3ILKA 4PPRA 3DUKA 4R71A 3IHBA 4CJ6A 2Q2EB 3DZDA 2R41A 3IS2A 1PU4A 3FZCA 2W2CA 2ZMAA 3EE1A 5EM0A 3VDPA 1RDSA 4ARZA 2DENA 3FD9A 5BIRA 3C4PA 1W8QA 1OKSA 2B1XB 1Z6TA 2K3DA 1N9EA 3FF0A 2HL7A 1TF0B 4IBRA 4KG5A 2RKOA 4Y0OA 3HU1A 1TS6A 3MMHA 5HAQA 4RKUF 2IA7A 3L2AA 4KQRA 2NUPC 4CLCE 4EXOA 2I7NA 1ASKA 1QQWA 3SXXA 5KP3A 4FD8A 1CQSA 1L0EA 5C18A 4CJNA 5C5KA 4HBUA 4K91A 3T1YM 2GEYA 3TE6A 3IG8A 4GB7A 4LV0A 2QHKA 2LWXA 3FPWA 3LCUA 1LLBA 3GSGA 2I9VA 3KSGA 1GMPA 3MZFA 3SAUA 1XMQM 1OUNA 3WHLA 3P7NA 3U60B 2ZAOA 4P6ZS 1VZZA 3S22A 3CNMA 4LRTA 5CK6A 2V0UA 3GO8A 5DJTA 5F3WA 4HI4A 3H4JA 4OK0A 2J8XB 3GRRA 1IBLM 4CCVA 1IYYA 3C30A 4HM0B 3SH7A 2PU2A 4FUWA 3KXEC 3A5EA 1XJ2A 1ZMUA 3HLCA 5BVBA 1TDZA 1OJ5A 2WKPA 3GRYA 3ZH9B 2AVXA 2Y2KA 3PBOA 2ZL1A 4GEWA 1LVNA 4LFBM 3IF6A 5GLDA 3ZVWA 4O7DA 4F3LB 2ML6A 1CK3A 1R7RA 3ZCBB 1XJ4A 3AOEC 1CH0A 1XXHB 5IG0A 1G6OA 4ESPA 4OLDA 1JB5A 2BNKA 2W56B 4P85A 1DGFA 3J7AS 2I72A 3T8UA 5EE8A 1IY2A 1MNLA 2W3EA 2DWLA 1IT8A 3E2KA 4X53A 1UCLA 3GR2A 2Q9MA 4MN6A 4DDYA 1MBLA 2D7GA 4ILFA 3RDEA 3CUEA 2BO9B 1NWZA 3E4PA 5A92A 4FCZA 5AIFA 3LXUX 3G8ZA 2XLJA 1OTDA 1TS8A 3KW6A 4FD2A 2KNVA 1CYVA 3VFDA 3JYIA 5FTLA 3L28A 4RNAA 4HBTA 3TDGA 3VMAA 3O8YA 2HMNB 5BPVA 1BRNL 2RFRA 1K3XA 4HM5B 1K57A 2F4YA 3OPPA 1GVNA 2F99A 3ZYTA 1EUIC 3EBTA 1B2MA 2VV8A 1AQZA 2QWSA 1G71A 2C96A 4KZ1A 2P08A 5DNYA 4LJ6A 2CC1A 4X55A 3EOIA 3ZQ5A 2HZ5A 3C2WA 4YINA 4EBNA 3LOYA 3VK8A 3HLBA 5FI7A 1I2EA 4KFFA 1W00A 3H51A 1XXMA 4JXGA 2Z7AA 1X0OA 4X65M 4A3VB 5A90A 4ZM8A 3I7JA 3ZHHA 1S0WA 3A45A 1IQ8A 2A3UA 2EFXA 9RNTA 4BB9A 3U6LA 3KS4A 2VQFM 3MSHA 5EP4A 5AEUB 1EWZA 3KDSE 1BRJA 2UWXA 3IXDA 5HPFA 3UPNA 3VSKA 3P98A 2M1CA 2Y2MA 2F98A 1IVVA 4I3IA 1MWUA 4STDA 3J7BA 4EBPA 2CW9A 1TFOA 2JKTI 2BG1A 3MKFA 1YUBA 4S12A 1ZMVA 4R7GA 3U5ZA 4R3JA 2QMIA 4JV5M 1TU5A 3GRDA 2ZD8A 2XH9A 3M7GA 3R7WB 2XROA 3R7WA 4XXRA 1L0GA 1S723 4FW9A 4ZDXA 4L9EA 2L2DA 3C8CA 1DRMA 5DF7A 3MXSA 2K0BX 3K2LA 3HUNA 4I38A 4FR9A 1GSWA 3ULFA 1E3VA 3BW6A 4FSFA 2JE5A 5EVIA 2E8IA 3F1OA 4U0TA 1BNGA 3B3XA 2QZ4A 1SIHA 3CCQ3 2EX2A 2CWVA 1XHBA 3V3SA 3WS2A 1CYUA 2QPNA 1I8VA 4IBXA 1KYIA 1NDOB 1J9MA 3RGSA 1I2FA 4FCJA 1ES5A 2ZOIA 4Q0IA 2WOHA 1ES3A 1BLSA 1RGEA 4O8SA 4XB5A 3T0UA 3U6OA 1MWSA 2EA0A 3Q8GA 4HZ9B 5FAQA 1DO2A 4WN5A 2Z4RA 1N5HA 2QIYA 4QOZC 4I5SA 4X56A 3CU3A 3FG1A 3Q8XA 3SS5A 3CJMA 2BJWA 3X42A 4OVMA 1SDEA 4CLCB 3R9XB 3GSPA 1YLPA 2EX8A 1JZDA 3C7VA 3NV0A 3IH8A 4Y13A 5IHVA 1JTDA 1IYQA 2ZA4A 3HLDA 4S2LA 5DJUA 4OQHA 3U6MA 3HJ8A 2BMQB 3LMMA 4PD2A 1U60A 3HU2A 5J8XA 3CPTA 3HUMA 1RKYA 4WZ4A 2E5LM 3NHQA 4Y3IA 5D81A 3FPVA 5EVEA 1JR3D 4IUKA 5FQIA 5H37D 5KPZA 3QYBA 1QVRA 3LW5F 2KXGA 3BNBA 3AGEA 2QKPA 3SMPA 4H6JA 2ZM2A 1OMEA 1KDSA 1XC8A 1HVBA 3UMEA 3KN4A 4ORLA 4HLQA 1K734 4R3AA 2W56A 2H5XA 5GLCA 5JI2E 4LFCM 3W4QA 3NC8A 1EEJA 4HNBA 1GA0A 1W7FA 3G6OA 4R6LA 2JKTM 1RMSA 3NM7A 1K8A4 2RNTA 1Z5CA 1T1BA 4F3LA 1YLJA 3RXWA 3AKZA 1UUVB 1Y4KA 1LSXA 1PRBA 2LHCA 6GSPA 2O9UX 1HTZA 5FTNA 1JB0F 2C98A 3DGMA 2Y2OA 3RXXA 1DJCA 4HM2B 4LCBA 2QPAA
chains in the Genus database with same CATH topology
2Y2NA 2C9OA 1FCOA 4JXVA 1W2B2 4JLFA 3TWMA 1M904 3EBYA 1UM8A 3KFUG 4E3LA 1E3UD 2MC8A 4OPRA 1Q2PA 5CHUA 3E2LA 3RFWA 3M2KA 3NDEA 3SHGB 3SARA 3OCNA 3LTCA 3F40A 3LH4A 1W01A 5FAPA 3KOYE 1IV7A 3UDIA 1ROAA 3OXAA 5EVID 5ITQA 2XQZA 1VQ93 5HARA 3S5CA 3TSGA 3WWXA 5HAIA 1IKGA 1A2KA 1GYBA 3CCU3 2QCUA 4KZ8A 1N9BA 4RX2A 4L8OA 4L8RC 3CCV3 1O7WB 1RGYA 1K56D 2HDUA 3RJUA 3GRJA 2QBYB 2ZJ9A 4B08A 3EHCA 1L2DA 3CME3 3W0FA 5E2GA 1CI9A 3HLGA 1TDLA 1K6RA 1UUWB 2Z2MB 4LSOA 2J8YA 2V20A 5KO3A 4BLMA 5KSCA 5EEOA 4KZ5A 4GB5A 1AR0A 2Y2QA 3SS4A 3NI9A 2BLSA 2VGJA 4YHHM 3K8ZA 2P9VB 4JI0M 2CEAA 2CFWA 3EB8A 1SQWA 4P6BA 2RSXA 4MM3B 1GY5A 4LG2A 3KSJA 4KZ9A 3UMMA 2GDNA 1PYYA 8CHOA 2Y55A 2CE7A 3N4IA 4OOLA 5AQ9A 1N75A 3AJIB 2LXEA 2V1LA 3BFGA 1GHIA 4KZAA 4X62M 3AV0A 3OZHA 3PYJA 4DE1A 1IXZA 1MKIA 3CCJ3 2Z3XA 3HK4A 5I97A 3CCE3 2JA2A 2YQZA 4EQIA 4EBLA 5FAOA 5A93A 1NNJA 3CPW2 1J7KA 4NXNM 3TOIA 3LMLA 4P0MA 5HW3A 3IXHA 4R1KA 3HHXA 4MGIE 4R3DA 4MNRA 2CHVA 1ZG6A 3QHYA 3NWLA 4HM3B 5AEWB 1Q7Y4 4XBTA 4GH9A 3PNYA 7CATA 5FGOA 2Y2LA 6STDA 3JAMS 4OX9M 4LZZA 1D6UA 2CFLA 3UJMA 2WGWA 3KSPA 3SMSA 3MWZA 4R80A 3FGYA 2FOIC 5GHXA 3IWIA 1M40A 3GLIB 3SYLA 1JVJA 5CGXA 2Y2HA 4DR4M 2WGIA 3HHWA 3G31A 4ZAMA 1GHPA 3ZNYA 2CV0A 3AGDA 3MPHA 4G1MB 2XF3A 4CGYB 3MG2A 2W9QA 4KZ7A 3SVAA 4IJEA 4PT5A 2J7NA 2ZL8A 2UXDM 1W5SA 3B4OA 1E97A 3CF2A 1W5TA 2IWBA 2XSZA 4X2HA 1VQ53 3BFFA 3OWYA 3PAEA 1XPBA 3K5TA 1A2VA 4FMBA 3LTBA 3SYKA 2ZDJA 4JF6A 5D82A 7STDA 5IWAM 1ZKJA 1OJLA 4FH2A 3Q82A 3U6QA 3LQRA 2BT3A 2DCFA 1QAOA 4N6LA 3PXMA 3LY3A 4RYEA 4M9ZA 2F5QA 3SEDA 2Y91A 3K1JA 4BTWA 3VGNA 4ZJ1A 5FLXS 1GD4A 2JCHA 1IBKM 4NETA 5CEDA 1BUQA 3KOWE 2WYXA 1FQGA 4I8OA 4N1HA 1K38A 3PZWA 4IBKA 1GCEA 3L26A 3I0YA 1NJGA 2CHCA 3J2PB 1ESUA 4DV1M 1WNHA 5EQLA 4N6OB 1FCNA 3JR4A 4R4KA 3G4PA 4L16A 5JYPA 1JWPA 2CH9A 2GU3A 3SHFA 2CG1A 4MGZE 3F8XA 1IDPA 4PCZA 3K63A 4KVHA 3G35A 3GLIA 4WWUC 4LV2A 2YX9A 3S29A 1O7EA 1MWTA 4WW0A 2CG0A 1DJAA 4GZBA 1NNUC 1S3SA 5F1FA 2QZ6A 1KDWA 4I81A 1KE3A 1WMNA 3F14A 4FMCA 2O5RA 1AV4A 1C3BA 4IBCA 3KSED 3NUVA 4N3VA 1ONGA 1V74A 4OQIA 5IG4A 4DR2M 3IWQA 1YLYA 3Q7ZA 4OVZB 2F5NA 1BUEA 5AYRB 5IZ7D 1QAFA 2STDA 3EJVA 2OTL3 4DE0A 3IT9A 1LHYA 2FNQA 4KZBA 1XNQM 1DGHB 4DDSA 3UPOA 3JVCA 5EXXA 1O7GB 1DJBA 5GKNA 1ERQA 1E32A 1AVKA 4NL4H 5EP3A 5DYIA 2X01A 2PU4A 1D6YA 2VGKA 4B7GA 2CWTA 2W6JH 3HHZA 4L8PA 1OF5B 1GA9A 4HJLB 3UY6A 3LT8A 3GWRA 5JPPA 2IMJA 3JR5A 4BTYA 5EVIC 4MBFA 3UE1A 2G2WA 1K54A 1H8YA 2E2VA 1W2ZA 3LCEA 1O07A 1FGQA 5U47A 1SJWA 2BJVA 3U61A 4HVNA 1R2ZA 1IYPA 3U6SA 2J7VA 4KODA 4OW0A 5ITUA 4DV3M 1PW8A 1XP4A 5AIIA 2XGNA 4DXCA 5CEBA 4YFMA 3N9HA 3NX0A 4S2IA 1X37A 4C75A 1DO0A 3Q81A 1QALA 5HAPA 2W04A 4WBGA 4K0XA 5FQKA 4B4XA 2QBYA 1FNNA 1G41A 1JQJC 4BBAA 5CTNA 2WK0A 3MK6A 3CMA3 4FWDA 2EX6A 4PMAA 4NOOB 3X3ZA 4IBBA 4B3SM 4KO8A 2DZOB 1XGJA 4LCMA 3OWUA 1NJ4A 1FGRA 4MB7A 4Y0UA 3S4XA 2ZQ9A 1K54C 4Z8XA 3GQ4A 3UGJA 4L15A 3DZLA 3H4MA 3DM8A 3WA2X 3EIHA 1QMAA 2X49A 3IHAA 2ZC4B 4C3QA 4XUZA 4X68A 4OPQA 1MPLA 3V50A 4WP5A 3E99A 1MWRA 5G2GA 2CFKA 1FR6A 4LV3A 1SHVA 1FSWA 1IM2A 3DOAA 1N5PA 2RGHA 3X40A 2XDMA 1HKXA 5CERA 1PI5A 4XBOA 5FSWA 1TFKA 1CI8A 1MXOA 5FDHA 2C5WB 3W4OA 4EV4A 4WURA 5BOHA 1YSYA 2P74A 1E4DA 1N33M 5ITXA 1OGZA 1TUHA 3DGNA 2HP9A 1G3IA 2EUCA 1DVCA 3ZG7B 4LJ7A 1S5AA 4K0WA 4S2MA 2UXCM 3Q7VA 4BD0A 1NHGC 1K4EA 4FH4A 4DV4M 4GDBA 1M9GA 3G34A 3CXC2 1STFI 3PS8A 4LGYA 4QJGA 1XNRM 4AKHA 2DVWB 3WOFB 2J9PA 4R4RA 3DA1A 4G4OA 3ZG0A 2YNMD 1IQXA 4O2HA 3BFEA 1MY8A 2GEXA 2CK3H 1Q3BA 1QAMA 3EN8A 3V3RA 4AG5A 3U1WA 3VP2A 1J5EM 5CHMA 1NHWC 3W8KA 1VQ63 3EF8A 1ZO2A 4X6TA 4G6ZA 3PBSA 1Z59A 1E3UA 2WKEA 4REZA 1IU7A 4WHAA 5ITYA 1K25A 3Q7VB 4M9SA 4HM7B 1YT4A 5KPRA 2L6OA 5EOOA 3FKVA 4BQMA 1ZG4A 1JR3A 3VF1A 1W6CA 2XLNA 5A2QS 4WYKB 5GHZA 1OH0A 2ZANA 3IF6C 5EVIB 1ZX2A 4GIPA 5HL1A 1EA2A 3C4OA 4LF6M 1VQP3 4FVMA 2X02A 1N9JA 2V1CA 3UK6A 1R4CA 1FGOA 1WQLB 3TQSA 4S2NC 3U60A 1DYUA 3U5ZB 5FATA 3X41A 4GHLA 3SASA 4OPYA 5FASA 3UDXA 3EIEA 1NSFA 1I5QA 1KWIA 3E9SA 1VQQA 1NJFA 2CWUA 4PEJA 4WMCD 3T38A 3ALAA 1CEWI 2YFJB 3C58A 3O87A 1TH3A 3ZG8B 3AFHA 3FKAA 3LYGA 3O88A 1EKMA 4JXWA 4G4RA 3MXRA 4QHCA 4IVIA 3V39A 2EX9A 2HDRA 4MMXB 1UI8A 3K92A 1UI7A 5LC7A 3GRUA 1IY1A 2Y4AA 1NYMA 1OHSA 1EI5A 4BTXA 1QVF2 1XA7A 4AKZA 4DV7M 2A49A 4AI6A 3ZGAB 2ZM6M 1ULIB 3ZC7B 4UA6A 2HHHM 3MG3A 1VQN3 3FZWA 4KQQA 1LI0A 4AKGA 3UE3A 4JI2M 4EUZA 4GL6A 3GZXB 3MKEA 1KE0A 4F94A 3CG5A 1M1K4 4HZBB 1K3WA 1SIIA 3JUNA 2CFDA 3ITBA 3SX1A 5EP2A 1FGTA 5AQBA 4N6MA 3ZVTA 4KFDA 3NDGA 4JF4A 3EQQB 2FFYA 2H0TA 3NBBA 2HMMB 3M6AA 1WMPA 5AIGA 3IF5A 3NBJA 4OP8A 2HMKB 3N8RA 1BSGA 3IPTA 1FA3A 3KP1E 3HL9A 1DY6A 3OV4A 3NQZA 4AW4A 3SC3A 3SFZA 1T3TA 4PM7A 3AGFA 3IQAA 3EX9A 2NQ8C 4HYZA 4RNZA 3VFFA 1K82A 1KD14 3ER7A 1PIOA 5IW9A 4KZ6A 1Q40B 1YE9A 4OVZA 3CNXA 4ZTKA 2V1ZA 3Q07A 4KG6A 4M9XA 4TX4A 1K4FA 3AMOA 5DREA 4LF8M 3A3DA 4H8RA 3VFHA 2F4VM 1KQS2 2XGLA 1PJIA 4LJAA 4XDWA 3Q2PA 4R3BA 4EYCA 4PM5A 1CEGA 3OWSA 4C6YA 2YR0A 1H5XA 4KQOA 5IREB 3U6EA 2XR8B 3UB1A 1FGMA 1XMOM 1Z5AA 2FNAA 1US1A 5EJCA 2R65A 2KXEA 3F9SA 1Y54A 5E6JA 4I4KA 5EVHA 3BLMA 3MZDA 3A3JA 4CPKA 4LFAM 2CV1A 3FG3A 2C99A 4WELA 2R9WA 2WOFA 4E3JA 4QY5A 4LJ9A 4NSRA 4LENA 4LJ8A 2Z77A 2ZLYA 3GLHB 4RVAA 2OQEA 4AQYM 4MLLA 3JUMA 2HPBA 2XD1A 1GHMA 1ZC2A 5IENA 2UUAM 3D9RA 5KQDA 2HP6A 4O3VA 3CF6E 4MMZB 4Q53A 3QNBA 3GAXA 3Q1CA 3FV7A 3DWKA 4D81A 2E2TA 2P5TA 4KZ3A 2A15A 3HVFA 2VQEM 2OWPA 4EV5A 1H8ZA 3VP0A 3KIIA 4JI7M 3X3YA 4B88A 4QNMA 4J8TA 3GLGB 3G0KA 1JNQA 2G5GX 3CC73 3F7SA 1N4OA 1KFVA 5CTMA 4N6NB 1HR0M 1J09A 5EPHA 1SXJB 3HJQA 4QOSA 5CF2A 4JI3M 3SAWA 2CUZA 1KSIA 3FUVA 4OKPA 5CF1A 3O3VA 1FOFA 1NO3A 1YQSA 1WMOA 5G18A 4DV6M 5CECA 4R4SA 3I563 1NRFA 1IYOA 1PWDA 1GS3A 2EFUA 4JXJA 4IBJA 4GD8A 4RA7A 2M5ZA 5IEPA 2D7HA 1JJ22 4JBFA 3UO9A 5BR8M 2WGWB 3G713 1SPUA 3M6BA 3SBJA 1BZAA 2YFLB 4M3KA 3X3XA 2RCXA 5CLKA 5FI2A 2FFFB 2G8LA 3GVBA 3PBNA 1E9RA 2KZUA 1QMEA 2Z2LB 2XD5A 4DV5M 3F8HA 4LMIA 1YM1A 3WRTA 4IBFA 4BLCA 2QENA 2OQ4A 1G4AE 2ZC6B 4BL2A 1H6UA 1BLPA 2ZQCA 4X66M 4EWFA 1M6KA 2OOVC 2KRUA 2XR0A 1O7NB 3HZPA 3QAUA 2DRWA 4X69A 3HLEA 3VK7A 4QB8A 2H1RA 3N54B 4W5WA 1YJW3 3ZG5A 3LZAA 2HCBA 1N8QA 1ZQ9A 4OH0A 3EN1B 3OX9A 1A90A 1VM1A 2K54A 1ONHA 5GLBA 3QRDA 3MFDA 1FUWA 1EQKA 2ZQ7A 2FE8A 3MJ5A 2WKIA 2D7EA 1BTLA 5HFOA 1N78A 4HM1B 4IPBA 3CPOA 4IIWA 4LJ4A 2P9VA 1VQ73 1N77A 1E3RA 1G6AA 2XZFA 2M7OA 2F5OA 1NY0A 4S2KA 4HBRA 5E26A 3GQZA 3U6DA 1L2SA 1F8NA 3T8NA 3S28A 4Q8IA 4N6TA 4QNRA 3GQ3A 4LGQA 2HMJB 1HQYE 4DR1M 1JB2A 4H3UA 4GITA 4XUXA 4JI8M 1G96A 2WGQA 1IKIA 3NQYA 4WMCA 2CHQA 3BLSA 1IEMA 1MOLA 1QYRA 2M60A 1BLCA 4MEIA 1VQO3 1LXEA 4RF0A 1TVFA 5FW5A 3B4PA 1KC84 4LEHA 5KSHA 3AL0C 1K55A 3QWLA 2R45A 2JDIH 1IXSB 2CFGA 2I9WA 3G2ZA 1IVWA 3L27A 1DGBA 1PZPA 1DGGA 4K61A 3KP0E 4IIAA 1Z1SA 4NRVA 2XZUA 1NY6A 1JRQA 1VQ83 1KVMA 2L7HA 1ISKA 4OP5A 1Q864 2WKHA 2OPFA 3NIAA 3TWKA 1OPYA 1RN7A 4BENA 3BRMA 5AIHA 3HUOA 4MJDA 3SH9A 4B4ZA 5TFQA 2K0MA 4IBGA 4AKIA 1PW1A 3G30A 4WYYA 2DWMA 5HGRA 4QY6A 2P05A 4DV2M 4LF9M 4KFEA 3LO7A 4LCLA 3VP4A 3C7UA 1QAQA 5IF6A 4DUYM 5JPUA 2EO2A 5EXPA 1YMSA 2LYXA 1IK3A 5DVAA 1SXJE 1W7CA 3CCR3 1L2BA 2CIUA 2Y59A 4KHPM 5ELJA 1IY0A 4PM8A 3B7CA 3NXJA 3FG4A 2ZC3B 4IVKA 1SXJD 3GPXA 2Y2PA 1AVLA 2CHGA 1PFPA 4M0WA 4OONA 4B7FA 1AXBA 1HU9A 3T15A 1TH4A 3RGAA 4PDGA 4RX3A 3U6PA 2BMOB 2ZQDA 1IQYA 4OQ0A 1PM5A 5TGNA 5I94A 5STDA 5AI1A 3NV0B 1IN5A 2X4AA 2Z7JA 5FQQA 5IG5A 5JBSA 2QA43 1BULA 3LT9A 5KQ8A 3MKIA 5AQ7A 2IUKA 4JRFA 4OUQA 3PBRA 3GRVA 1L5GB 2MF7A 1XGIA 5CGSA 1HZOA 2LNHC 4AG6A 1QAKA 3PCSA 3ZCZA 4G4QA 1IXRC 2Y74A 1Q42A 2CFOA 5ITTA 2AHMA 2GBWB 4DR5M 5D3OA 1LI9A 3PBQA 5FA7A 5IG3A 2DWNA 4EIWA 3DGLA 4LJ5A 3HREA 2WO0A 1IT7A 3VLFB 3ITAA 3N8BA 2JC7A 2P0XA 3MSOA 3FKEA 4N6UA 4DE2A 3UJNA 5DRVA 5GLAA 3W0LB 4LF4M 4U3TA 1HT2E 2KA6B 4LY6A 5DF8A 2IWCA 4JN6A 1OACA 1W5DA 5A0OB 1RRHA 3U6CA 3VP3A 3ISGA 4B3MM 4N92A 1NWWA 2CKFB 4U13A 3PNVA 2A5YB 3WDGB 3G2YA 3NBRA 1DMNA 3UL6A 3WRZA 1CEFA 2KZSA 3GPYA 1TP6A 3NM2A 4LZIA 3SOYA 3M2JA 3FF2A 1EROA 2CV2A 1L1ZA 1C7HA 2ZM0A 1D2NA 1XKZA 3NBLA 5EVLA 3WODG 5KP4A 3C5AA 3VP1A 4JI1M 3RGPA 3NCKA 3UE0A 3BNEA 1TDHA 3A46A 4K0KM 3KS8A 3HWSA 5BXQA 2WUQA 1D6ZA 2RCDA 1SXJA 3UL5A 4AKYA 3KE7A 1DMMA 1QVG2 4LF5M 3MHVC 5IEOA 3BM6A 4KZ4A 5KPTA 1QZMA 4KENB 4L0LA 3VOYA 4Z6YA 3H3HA 5F83A 1IVXA 5M1AA 5KMWA 4DUZM 1I4WA 1OGXA 3A42A 1W6YA 3OTOM 1L2CA 3I4YA 2V2FF 3CTWB 3GLGA 3G16A 3WS0A 1K28A 2W82A 2BNGA 3N8SA 3MBZA 3NBIA 4GDNA 3DMCA 2XSZD 3HIIA 5CXOA 3A3IA 4O02B 5F1GA 1YLWA 1PZOA 1KGFA 3BOSA 3ZFZA 1Q2QA 4OLGA 3LY4A 1Q814 3KOXE 3FKWA 1NVMA 4GMQA 4R1GA 4BL3A 1Q39A 5ITRA 3F7XA 1W5ZA 1JB4A 1XXHA 1I2SA 3GQ5A 1YIT3 3IF6B 3EC9A 1XA1A 2B5RA 4NHFA 5FQJA 1YIJ3 3FUUA 2DNSA 3CD63 3GLHA 1LNHA 4IT7A 1Z6FA 3FCSB 5EP1A 1U5OA 4ZJ2A 5FSRA 4BD1A 1G8PA 4RNYA 1NB5I 4IBEA 3K0ZA 5LC6A 3J7Yd 5M19A 4MH0E 3SATA 5EXSA 3CZDA 5E2FA 2H5SA 3I4VA 1L0DA 1YVBI 4KG2A 2OTJ3 1E94E 1PJJA 4GKKM 4NREA 1I2WA 3I553 1Q824 3TPZA 4PDIA 4K1UA 3EQUA 3S1YA 4N6V0 2XEPA 1NXYA 3THGA 3FYCA 1LL5A 2XK1A 5A91A 1JWZA 4FCFA 4E6WA 3OCLA 1BT5A 3AMOB 4S2PA 2G2UA 3HKPA 3J27B 4HKVB 4HM6B 1C1KA 1JKGA 1NZOA 4P87A 1Q40A 3DY5A 1ALQA 2WGOA 2H0YA 4G4NA 4JI6M 1A67A 1NB3I 3UN7A 1IQPA 2WAFA 5JYOA 4AZFA 3DXOA 2ZC7A 2XRXB 3GLFB 1K9M4 4FWHA 3TG9A 4FCTA 1WE4A 3NY4A 2HDSA 2LQVA 2WAEA 4HL4A 1TDGA 3WA3A 3WHKA 4K1VA 2K47A 4EV2A 4N9KA 3S67A 3WS1A 3VOZA 3D8LA 5AYSC 3HX8A 2VIIA 3LTDA 4ITQA 3GZYB 8CATA 3STDA 4X64M 2GU1A 2FXTA 4L4UA 3OC2A 4MGYE 2P0MA 1Q3CA 3CCS3 1IN4A 3GPPA 1YI23 3VKGA 1VQ43 2Q07A 4MGKE 3FYZA 2R9XA 3GLFA 3M0EA 3PGBA 3KVWA 1FJGM 1O7PB 1NU3A 2RGOA 4FWGA 3SLUA 1W02A 1R6BX 2XSOB 4NK3A 1KE4A 2DWZB 4GHAA 2C9CA 1ES2A 2WGVA 1JKGB 4Y0TA 5KZHA 5LMNM 4RZMA 4DR7M 3HI7A 3FTEA 1G59A 3PBTA 2KEBA 5FTMA 4CISA 3CMZA 5C1BA 2RGQA 4OVDA 1KGGA 4D82A 2LH0A 2YFIB 1OFIA 2R62A 3CCM3 5F82A 5EOEA 1YHQ3 3P09A 1VQL3 3GZBA 1LOXA 3B8LA 3UDFA 4OQGA 3PFIA 3JUOA 3KZTA 4DR3M 4WEJA 2R4EA 4MBHA 3N7WA 1QMFA 2V6ZM 3FUWA 1RCJA 4QHSA 3WS5A 5D83A 4EXRA 2GXFA 1QANA 2OSUA 1ORYB 4D80A 4QU3A 4UA7A 4GD6A 3JUQA 4XDVA 3LVWA 5DYGA 2Y0QA 1FR1A 3DTMA 4WYKA 4A5RA 2OCTA 4FCMA 5L2FA 4XBXA 1O7HB 3OW22 4K90B 2OLVA 3OPHA 1ROVA 4BJPA 4HM8B 1Z5BA 1VDDA 3L25A 1T5YA 1E25A 5ITXE 1JTGA 2V1UA 3G6E3 4S2OA 4B3TM 5CHJA 3KFQC 1ULJB 1N32M 4H61A 1G68A 4JYAM 1TIJA 4MGHA 3V99A 2PZVA 3QNCA 4JPMA 3G32A 1M1XB 3GMWA 3L29A 3FTFA 5HX9A 1VQK3 4CDLA 4OOYA 3M6HA 3LEZA 5EECA 3EQVA 4E3NA 2HMLB 4GC5A 4UA9A 3DGOA 2OOVA 2X71A 2KCDA 4GNUA 2ZQ8A 1SXJC 3U97A 4OU7A 3GPUA 1GKIA 3UPPA 4R9LA 5EQTA 3VKHA 2Z6BA 3IJEB 3D8BA 1WYCA 4JXSA 5FQ9A 2DHRA 1W6GA 3ECFA 3W4PA 4JF8A 3V92A 2ZC5B 3GTCA 1GY6A 2HP5A 1HT1E 3RE8A 4B7HA 1YLTA 4ID4A 3KSXA 5DTTA 3TL4X 2F5PA 4E3MA 4MMYB 5IT9S 1KVLA 4RBNA 3WMDA 3UZUA 2ML5A 1HNZM 4DR6M 1MX0A 4PM9A 1NYYA 4HESA 2XFTA 4QD4A 2HMOB 1N34M 4R9KA 5LMUM 2F5SA 3PCRA 3VDUA 2BHMA 3ZG9B 2L09A 1JN5A 4S2JA 2QEX3 4DF6A 4IBDA 4DE3A 1TH2A 4GN2A 3N6IA 4LV1A 3FH1A 5EUAA 4FCVA 2DXIA 2Y21A 3UNWA 2L4VA 3UNLA 2I7PA 4D2OA 3FUXA 1IELA 2IWDA 1IN8A 1O7MB 1K55C 3VSYA 1HNWM 1IBMM 3IWOA 3HU3A 4JF5A 2W0QA 4ZJ3A 3FUTA 4R0QA 2OV5A 4KLNA 3BFCA 3ZNTA 3O86A 2BMRB 5TGFA 2UUCM 1RGZA 2RL3A 3I51A 1YMXA 2GBXB 2CC3A 1K57C 1NJI4 1XWIA 1GD3A 3BFDA 2PNCA 1GL6A 5GHYA 4TUWA 2J7OA 1OHOA 3AOEA 3K9MC 1W8YA 3SOAA 4HM4B 2D1WA 4IEDA 1I94M 2ZBKB 2QGUA 1IYSA 3FTDA 1EG9B 3CC43 3Q90A 2Y20A 2KW0A 5EXTA 2D42A 4NRWA 2PBYA 2DZNB 3FYDA 3IXBA 4WEKA 4U0XA 3FTCA 1W4NA 3IXGA 2ERCA 5KP1A 2KRTA 3U61B 1SKFA 1MU5A 2Y2GA 3A98B 3WOEB 1OFHA 5FQMA 1K6SA 4LGMA 1EE8A 1K41A 2JQ5A 3DFZA 1RP5A 1GL7A 4EC6A 3LVVA 4OOMA 2J9OA 4JI5M 1OF5A 1L0FA 3OPLA 2X8AA 3LTAA 4FCWA 2WZZA 3MHEA 4MEZA 2Y0TA 3Q1FA 1JN5B 4Y7PA 3MYTA 1YJN3 3QK9A 1DGHA 3PAGA 3AOGA 5FTJA 4AEQA 2Z4SA 1IV9A 1BLHA 1N36M 1LV7A 2Y2JA 3SAVA