2XH9A

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGASPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords ORF12
total genus 139
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xh9A03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xh9A01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xh9A02
3N8LA 1XPBA 4ZBEA 2VGJA 3PBRA 1FR1A 1NYYA 4IBRA 5CXWA 3B3XA 3CZDA 1HD8A 3BEBA 3LEZA 2FFYA 5KMWA 1E25A 3PBQA 1XXMA 1KDWA 1PI5A 1W8YA 2ZC4B 3V3SA 4R23A 5CTMA 4R4RA 3IWQA 1K4FA 1MPLA 2EX8A 3SH7A 3C4OA 5FAPA 5FSRA 1FOFA 1MBLA 5E2HA 5HFOA 3ZNTA 5EECA 1HZOA 4E3JA 3Q1FA 5E2EA 4OLDA 5HX9A 1MWRA 4WELA 3G2YA 1L0EA 3GV9A 4MBFA 4YINA 5FAQA 2J9OA 4RX2A 1EI5A 2Z2LB 4Q8IA 4X53A 2WGWA 1JWPA 3MZDA 4LENA 3IWIA 1XA7A 4A5RA 2Y2OA 3TOIA 3LO7A 1RGZA 2CC1A 5GHYA 4PM9A 4LV0A 1ONHA 1XGJA 3FWLA 4OP8A 1CK3A 1MKIA 3G31A 4S2JA 2J8YA 1KGGA 1EWZA 1CEGA 1XX2A 3DWZA 4EWFA 4EBNA 3OCLA 2RL3A 1LI0A 3G30A 2EX2A 4WEJA 1I2SA 1N9BA 1BLPA 3GMWA 4PM5A 1VM1A 2C6WB 2P9VA 3MZEA 4E3IA 2UWXA 1IYSA 4S2MA 1ZC2A 1SCWA 2WGWB 2XLNA 3EQVA 3GR2A 5GHXA 3N8RA 4WZ5C 1LL5A 3Q82A 4P87A 2ZM0A 5A93A 5FQIA 3V5MA 4R4SA 3DTMA 3G35A 3I7JA 3V50A 4KG5A 5TFQA 4HEFA 5DTKA 1W7FA 4N9KA 4X55A 3CMZA 4B4XA 1PZPA 4N1HA 4OPRA 4QHCA 4MEZA 1CI8A 4FSFA 3ZVTA 3EQUA 3V3RA 3VP2A 3N8SA 4CJNA 4DE0A 1K4EA 4N9LA 1YLZA 2X01A 1CEFA 3IH9A 2Y59A 1Y54A 4XUZA 1DY6A 1TDGA 2I72A 2Y55A 1K57A 5FQJA 2Y91A 5GLAA 3FKWA 1KGFA 1M6KA 3A3JA 5FQMA 5FQKA 5HARA 3ZG7B 3FYZA 4E6WA 1IKIA 4KQRA 2ZC6B 4PM8A 3PAGA 4PM7A 1TEMA 1ZG6A 3Q81A 4KG2A 5GLDA 2H0TA 3ZCZA 3HVFA 4KG6A 3M6BA 2E8IA 4R1GA 3UE0A 4ZJ2A 5M1AA 4B88A 5EVIC 2EFXA 2J7VA 4Y0OA 4IVIA 4IVKA 2WKHA 3BLSA 3VMAA 5CECA 3NC8A 2H5SA 1N4OA 4EUZA 1K56A 3BRMA 2Y2QA 1K55C 2XEPA 1LLBA 2Y2GA 1ERQA 4FH4A 2OLVA 5FASA 4GDBA 2VGKA 4QD4A 3ITBA 4OPZA 4HBUA 4GZBA 2XFTA 4JLFA 3HL9A 1FCOA 5AQAA 4D2OA 1K38A 3OPLA 1JWVA 4RA7A 2JE5A 3LY4A 3BECA 4NETA 2PU2A 4OOYA 1YMSA 1LHYA 4P6BA 4MLLA 1YMXA 3UPNA 3N7WA 1SDNA 1S6RA 1NJ4A 4GD6A 4UHUA 2WGVA 3W4PA 4GOGA 3WRZA 4DKIA 4ID4A 3BFDA 4YFMA 5A90A 2V1ZA 3P09A 3SS5A 4JXGA 2JCHA 1KE3A 2QMIA 3OZHA 4S2LA 2GDNA 1YLPA 3UPPA 3WS4A 2OV5A 2PU4A 4KZ5A 2JC7A 3AGDA 4K0WA 5EOEA 4S2NC 1ERMA 1H5XA 4KZ7A 1RGYA 3PAEA 1XKZA 1BZAA 1M40A 4P85A 5KZHA 2DRWA 2P9VB 3NIAA 5A91A 4LCMA 3ZVWA 4E3NA 4KZAA 2ZQCA 5FQ9A 3V39A 2XD1A 5CGXA 1NZUA 1XA1A 1S0WA 4C3QA 4E3OA 3IHAA 4CPKA 2ZLYA 4GDNA 1L2SA 1JTGA 2HP6A 4N92A 1NY0A 1XGIA 4KQQA 4U3TA 4XUXA 1BULA 3IF5A 3FV7A 5JYPA 2HP5A 2WYXA 2G2UA 2XR0A 1KDSA 1PI4A 4EV4A 3A3EA 5BOHA 3WWXA 1QMEA 4ZTKA 3QNBA 1E3UA 5HL1A 3VP3A 3ZNYA 4QY6A 5IHVA 3CJMA 4GB7A 2WAFA 5CGWA 1FQGA 4BD1A 1K57C 1MXOA 3HLWA 4FCFA 2Y2NA 3IQAA 3MZFA 4DXBA 2ZC5B 3VP4A 4WEKA 3HREA 3VP1A 5HAPA 3OC2A 2WUQA 5M19A 3N6IA 1SHVA 4ZJ1A 5TGFA 4GN2A 4S2KA 2JBFA 2DNSA 3GVBA 3VOZA 5F1GA 4R0QA 5FI6A 4M3KA 1DJAA 3W4OA 1ESUA 3WS1A 4WZ5A 4KZ4A 1BSGA 1GA9A 2WKEA 3SOIA 4KZ8A 3RJUA 3MFDA 1KVMA 4LV3A 2Y4AA 3FZCA 5CERA 5F1FA 2ZQ7A 3C7VA 4JF6A 4R3BA 5GHZA 4X69A 4RVAA 3ZG8B 4DDSA 3HLFA 3BLMA 4BQMA 5CGSA 2X02A 4GNUA 4HESA 5CEBA 1Q2QA 4L0LA 5M18A 1LL9A 2EXBA 2WAEA 3G2ZA 2HP9A 5F83A 1PWDA 1BLHA 4S2NA 2BG1A 4BL2A 5CTNA 1KGEA 2DCFA 2QZ6A 3O86A 1BUEA 1NXYA 3M2JA 4QB8A 4E3MA 3CG5A 3ZDJA 1K54C 3A3IA 4GKUA 2ZM2A 5J8XA 2HDUA 1PW8A 4EBLA 3HUMA 3IF6A 3E2KA 5GLCA 1YT4A 1KE4A 4ZDXA 1JVJA 5G18A 4BLMA 4O7DA 3DWKA 1MWTA 1YQSA 4OONA 4EBPA 1K55A 1KVLA 5FDHA 5HAIA 5EPHA 1GCEA 4FH2A 3HLBA 4EQIA 5EVIA 2EX6A 3IXBA 3MBZA 3D4FA 3HUNA 1FCMA 2QPNA 2ZJ9A 4JKTA 2A49A 4BL3A 2IWDA 2V20A 4IBXA 5CHUA 1K6SA 1MWUA 1J9MA 3UE3A 3VFHA 2J9PA 1IYQA 5I94A 4GD8A 2XF3A 1PWCA 3IF6B 3WS2A 1BTLA 1O7EA 3NY4A 1XP4A 1PYYA 4ZJ3A 4E3LA 4KZ9A 2WKIA 3A3FA 1K54A 2Y2IA 4C75A 2Y2KA 3IT9A 5AQBA 1PZOA 3VSLA 2P74A 2ZQ9A 3IXGA 3NBLA 4BENA 3HLDA 5EVIB 3AGFA 1W5DA 1BLSA 3Q7VA 3LY3A 4MBHA 4OQIA 4P0MA 5FI2A 2Y2PA 1ES5A 3SS3A 3HLEA 3ZGAB 4N1XA 3SS4A 4UA6A 2WADA 1ES4A 3HLCA 4KZ3A 2ZMAA 1I2WA 1LI9A 5EOOA 5AQ9A 1PIOA 1ZKJA 1VQQA 3UDFA 1E3UD 4Y0TA 1TDLA 3TG9A 4JXWA 3ISGA 2Q9MA 3FKVA 5DF8A 1YLJA 1NRFA 4OPQA 5EE8A 3ZG5A 1YLTA 2ZD8A 1NZOA 2Q9NA 5E2GA 4Y7PA 1GHIA 5EUAA 2ZQAA 1EROA 5FI7A 3PBSA 3LCEA 4JBFA 3BFGA 4DRTA 2EFUA 2R9XA 3DW0A 5AQ7A 2C5WB 3UE1A 3GQZA 3ZHHA 4OQGA 2ZQDA 3MXRA 2WGIA 3UPOA 3G4PA 4DE2A 2ZC3B 3MKFA 5FA7A 2H10A 1YLWA 1I5QA 1FR6A 1GA0A 3WRTA 3PBTA 1IYPA 2EX9A 5A92A 3QNCA 5EVLA 4OPYA 4OOMA 3Q7ZA 3GSGA 5CRFA 4KENB 5DTSA 3W4QA 3O3VA 2PBYA 3ZFZA 4KZ6A 4PPRA 1YM1A 5CHMA 3NCKA 3A3DA 3S1YA 2HDRA 4C6YA 3UY6A 4LCLA 2XQZA 3OPRA 2EXAA 3IWOA 5DF9A 4IEDA 4FD8A 3OCNA 2RCXA 4DDYA 4DE3A 5U47A 3NI9A 1SDEA 1RP5A 1W79A 4OVDA 4XXRA 3SH8A 4JXSA 4WMCA 3C4PA 1OMEA 4F94A 1Q2PA 3IXDA 2Y2HA 3IXHA 1HTZA 4X68A 1ONGA 1WYCA 3VP0A 1GHMA 3IHBA 1G6AA 3MXSA 4RYEA 3GTCA 4BD0A 5GL9A 2R9WA 4UAAA 4QY5A 4Y0UA 3UNWA 3SH9A 3N4IA 5GLBA 1QMFA 1HVBA 3HLGA 2Z2MB 4S2PA 1GHPA 3BFEA 5HW3A 2XH9A 5L2FA 2XD5A 4OQ0A 2A3UA 3QHYA 2XFSA 2XK1A 4OH0A 4WM9A 4ZAMA 3ZG0A 4S2OA 4QJGA 3O88A 3OPHA 4UA9A 1FSWA 2X71A 1C3BA 3NDGA 5F82A 3M2KA 3E2LA 4UA7A 3BM6A 3IH8A 1K6RA 2IWCA 3BFCA 3S4XA 1PWGA 3HUOA 3UDIA 5HAQA 5CEDA 3TSGA 2XDMA 1FCNA 3MKEA 5D3OA 5E2FA 4LV1A 1JTDA 4Z9QA 3UN7A 1IELA 3UDXA 1DJCA 5DTTA 3UO9A 1H8ZA 4E6XA 4LV2A 3S22A 3M6HA 1L0GA 2V2FF 4JF4A 1K56D 2IWBA 1L0DA 1SKFA 1G68A 1TVFA 4RX3A 1JWZA 3PBOA 1BLCA 1RCJA 1Z6FA 2HDQA 2ZC7A 3BYDA 1WYBA 3P98A 5FATA 1IEMA 4OQHA 2ZQ8A 3Q7VB 4OP5A 2WK0A 1DJBA 5DVAA 3VOYA 3NDEA 2Y2MA 1ES2A 2HDSA 4PM6A 4S2IA 4DXCA 3G32A 4K91A 3C7UA 1ALQA 5TR7A 3C5AA 2Y2JA 2BLSA 3Q07A 4U0XA 4HBTA 3WS5A 3ZG9B 4DF6A 1U60A 5E43A 1YLYA 4U0TA 1CI9A 3JYIA 2ZM8A 3PBNA 3BFFA 1ES3A 4NK3A 4BJPA 4K0XA 1MWSA 4MNRA 1AXBA 4DE1A 1ZG4A 4JPMA 1KE0A 3W8KA 4MBKA 4B4ZA 4JF5A 5EVID 1K25A 4X6TA 2B5RA 4OKPA 2OLUA 1E4DA 2FFFB 3G34A 3RXXA 3AGEA 4X56A 2XGNA 2G2WA 1ESIA 1O07A 4OLGA 1PW1A 5FQQA 3RXWA 3VFFA 1L0FA 4WMCD 3VSKA 5CHJA 3PTEA 4R3JA 4WZ4A 5JYOA 2Y2LA 4WBGA 1FSYA 2H0YA 1BT5A 3IF6C 2WZXA 3ITAA 4QU3A 4WYYA 5DF7A 4KZBA 2WZZA 3GRJA 1W8QA 3OPPA 1MY8A 4PMAA 4KQOA 1WE4A 5FAOA 1NYMA 4JXVA 4OOLA 4H8RA 1IYOA 2HPBA 3O87A 2OSUA 3HBRA 3WS0A 4E3KA 1IKGA 1H8YA 5KSCA 5KSHA
chains in the Genus database with same CATH superfamily
3N8LA 3CF2A 3UGJA 1K3WA 2VGJA 4BMWA 2HF6A 1BAOA 1FR1A 1NYYA 4GC5A 5AIIA 5HOHA 5CXWA 1W8YA 3KOZE 1RN1A 3QRDA 3Q90A 4R1KA 3L9KA 1FILA 3J7BA 1VQO3 2J3TC 4WN5A 3RFWA 1MPLA 5CF2A 1OTDA 4FW9A 1W6YA 5FSRA 5E2HA 1AWIA 4JN6A 3Q2PA 3JUPA 1R5LA 4FVMA 5FL3A 3G2YA 1EI5A 2YKFA 4AEQA 2Z2LB 2ZL1A 1T18A 3TWMA 2WGWA 3MZDA 2ZM6M 2Z4RA 1ROAA 5A0OB 2VDBB 4L8RC 4HM5B 4LENA 2VJWA 5GHYA 3CTWB 4GSPA 4DR7M 2O3OA 2MGWA 5FTLA 4G3WA 3PR6A 3G31A 1DMMA 2J8YA 1KGGA 5EM0A 1EWZA 8CHOA 2SBLA 1XX2A 4IHQA 1UGHI 4GITA 4LEHA 3NULA 3OCLA 2L4FA 1LI0A 1XNQM 5LC6A 4LZZA 2ZL1B 4WEJA 1BNEA 3GMWA 1LVNA 4A3VB 1H3QA 4EIWA 3LMLA 3Q3FA 2EO2A 2C6WB 2P9VA 3SATA 2PD7A 2B02A 4NL4H 1ZC2A 4LGMA 1EIJA 2JY5A 3CCS3 3HWSA 4P87A 4WZ5C 2ZM0A 4NC6A 5DREA 5FQIA 2XSSA 1XXHE 3I7JA 4FCVA 2V1CA 1E3VA 1BSBA 3H51A 3URPA 4KG5A 4HEFA 4G3VA 5CF1A 2O9AA 1DGHB 4N9KA 1V92A 1QQWA 3BQAA 4OPRA 4QHCA 2DXIA 3I553 5FW5A 2R0IA 3VP2A 3E46A 4X1MA 4N9LA 4D60A 2LHGA 1LT0A 1M904 1F5MA 3LIEA 3D8LA 1KGFA 3QP6A 1IXSB 4LLOB 5FQMA 5ITXE 2LXEA 2CFDA 3V99A 1IKIA 4KQRA 2XSZD 3LR4A 3A98B 5GLDA 2NUPC 2YKHA 1I3FA 3HVFA 4MGIE 2Z4SA 4F2LA 3RGRA 2BWBA 3NBJA 3PS8A 5CK6A 1S4SA 1J3WA 1OF5B 4XBTA 2EFXA 2J7VA 4J8TA 4G4OA 3J80S 1R4CA 2CIUA 3HCYA 5CECA 3M0EA 2C10A 3DM8A 5FEGA 4N3VA 1K56A 1X1XA 3ECFA 1IY2A 3TWKA 3FLJA 2J80A 2Y2GA 5TBMA 1QAQA 1PJIA 1M9GA 4BLCA 4RNTA 4GDBA 1DP6A 2WSEF 3NXJA 3NUVA 3HL9A 4CGYB 3R4KA 4ZM8A 2AAEA 5AQAA 4D2OA 4LJ7A 2OO9A 3HHZA 4RA7A 2JE5A 3J7Yd 4P6ZM 3NM2A 2BMOB 3NQZA 1LOVA 2V1AA 3HHXA 3NECA 1BUQA 4JI2M 2IUJA 1LHYA 1O7NB 1YMXA 1UFZA 2HMOB 3X41A 2JHEA 3JVCA 2BMQB 1CYUA 2Q07A 3SEDA 4UHUA 1WR1B 2F99A 5EP3A 4ETZA 2O5RA 2V1ZA 1DVCA 3LVWA 3HJIA 3KYQA 3OZHA 2X4AA 4OU7A 3EJVA 3F7XA 2HCBA 1OACA 2XRXB 1VQ93 1OGZA 4I5QA 4R38A 4LF7M 2CV2A 4HKVB 5FTNA 4MGYE 2CEAA 3TL4X 1PFLA 1TF1A 4IBFA 1YGEA 1ERMA 2GQFA 4IBJA 1AVLA 1F8NA 2W0QA 4L15A 3DGOA 2DAKA 2DZOB 3MWZA 5KZHA 2P9VB 4HM0B 1T3TA 3TQSA 1F98A 1OJ5A 4LCMA 4F3LB 1D6YA 3T8UA 2ZQCA 2FOIC 2CWBA 4ILFA 2RGOA 1XA1A 4C3QA 4JRFA 3B74A 1K3XA 1NO3A 4L8OA 4LMIA 1JTGA 1G02A 4FWDA 1NY0A 1XGIA 3OW22 4DBGB 4U3TA 3KOWE 1Q40B 2INXA 2HP5A 3K3CA 2XA7S 3IBRA 2XR0A 3UMDA 4HM1B 1IBKM 1NWZA 2BT3A 5DFLA 3G4S3 3L7HA 2VGLS 3QNBA 4ARZB 5HL1A 5IHVA 5HDDA 3VF1A 2PBDP 2WAFA 3BLZA 3OBFA 4BD1A 3HLWA 1ORYB 5BU4A 1GY5A 2RGHA 3HOHA 3MHVC 3EBYA 1NNVA 3VP4A 4WEKA 3VP1A 5HAPA 2WUQA 4GEWA 2KDKA 4OX9M 4ZJ1A 5G4ZA 3UK6A 1IXZA 3WODG 1YSYA 3GVBA 3VOZA 4WL9A 2HGVA 5F1GA 5FI6A 2QENA 4M3KA 1DJAA 5IW9A 2Z6DA 3TDGA 1ESUA 3D9RA 3U5ZB 3AMOB 1ZMUA 2CV0A 3K2NA 3C2WA 4KZ8A 1G8PA 1FUWA 3MFDA 3RJUA 1W5ZA 3BIRA 4DJ3A 3L2AA 3FZCA 1IOUA 3L25A 1NV8A 3I04M 4R3BA 3MPHA 4RVAA 3ZG8B 1JKGB 3BLMA 3HLFA 3K1JA 2JKTM 2ZBBA 3AGNA 4HESA 5L8MA 5KQ8A 2VQFM 4L0LA 1LL9A 1GLNA 3SHGB 2EXBA 1IBMM 4J5GA 1PWDA 1PM5A 2JKTI 3NV0B 1TFOA 1XXHA 2AVXA 1YSQA 4PKYG 1OF5A 1KGEA 1TS7A 3O86A 1TTOA 4IBKA 3HIIA 1STDA 2VV7A 1K54C 3PNYA 2ZM2A 2DNAA 1PFPA 1GO5A 3CPW2 3DUKA 2ZTCA 1BGSA 4EW5A 1RGEA 4DR1M 4ZDXA 2KW0A 2OTL3 4BLMA 2LVNC 5FEFA 4HM8B 4O7DA 3R9XB 3AOEC 5FDHA 2O9CA 4X64M 2WKPA 3D72A 3U6DA 5AIGA 1G96A 1VZZA 1GY7A 3NBBA 3AV0A 4GKJM 4BL3A 1ZHHB 3ER7A 1MWUA 3VFHA 4KT3B 4B3SM 1HNXM 4WP5A 1VQ63 1JNUA 1S1YA 2HMLB 2XF3A 3LR3A 1SXJC 1O7EA 3NY4A 3V92A 3IX3A 1T43A 2UXDM 1Q40A 4O01A 3A3FA 4RF1A 1OCVA 2VV8A 3FPWA 3TJZC 4M9ZA 3FF2A 3CGWA 4M9XA 2Y2KA 2P74A 2ZQ9A 4B7HA 1VETB 1W5DA 3AGFA 1VB6A 1P0ZA 2DWMA 5JI2E 1P9RA 4P0MA 5FI2A 1ES5A 3I01M 1D0KA 4EQ1A 3AOEA 3ZGAB 1KYIA 1N32M 4AG6A 1KD14 1W63M 4ITQA 1I2WA 4K1VA 1HZ1A 5EOOA 1H0MA 1ZKJA 1D0MA 1VQQA 4R80A 1YVBI 3UDFA 1T5YA 4L78A 3TG9A 2F56A 1YKDA 2Q9MA 2QZ4A 1YLJA 1NRFA 4OPQA 1BSCA 3W0FA 3CNMA 2P0XA 2B18A 3J27B 4M4XA 1CQAA 3CD63 2DWZB 2KDLA 5EUAA 1EROA 4JGOA 2JUJA 1N75A 3B4PA 3O5YA 5EFWA 4JBFA 3A76A 1LNIA 5DJUA 1VQK3 4O8SA 1T1CA 4MB7A 2QP9X 3GQZA 2FNAA 3UPOA 4G4NA 4XDVA 5A2QS 4DV4M 2ZC3B 5FA7A 3OWSA 2PYPA 2F5SA 3DH2A 1LNHA 2D42A 1D2NA 2R65A 1W01A 1UGUA 4CIZA 2O99A 5JBSA 4OPYA 3EIHA 1Z1SA 4YNRA 1N9EA 1J7KA 2XSHB 3A46A 4B3TM 4FMBA 2C11A 2CFGA 3W4QA 4D82A 3D5IA 4KZ6A 2LB5A 1EEJA 2HDRA 2CHVA 1IT7A 3UY6A 5FTKA 3IWOA 4OVZA 1NRJA 2H0HA 4WYKB 5KO3A 3T1QB 1Q3CA 4DDYA 1D6ZA 5EQTA 3NI9A 4DR5M 2UUGC 1PU4A 4O0PA 5HL6A 2E2VA 2HJEA 3E98A 1UUGB 3WOFB 2Y2HA 1A0KA 1ONGA 3GSPA 1N8QA 1Q814 2NUTC 3NQYA 5TGNA 3GTCA 1XXHB 3GAXA 4BD0A 3GZYB 2R9WA 4UAAA 1W63Q 4JXJA 1LOYA 4Y0UA 3UNWA 2VGLM 3SH9A 3N4IA 5GLBA 1HVBA 3HLGA 3GLIA 4M0DA 2B95A 1NNUC 2VLGA 3KN4A 3PNVA 2A3UA 2Y20A 3V67A 1T6OA 2VK3A 3AHSA 2UX0A 1B2MA 1FSWA 2X71A 2CRUA 1XJ3A 3M2KA 2G3QA 4UA7A 3BM6A 3UDIA 2M5ZA 1IN5A 2QJ5A 3N54B 4DJ2A 2LQVA 1QVF2 3VOLA 5CEDA 2JZ1A 1DGBA 2PR5A 4X1LA 5D3OA 1BRIA 4HJ6A 3UN7A 1BRJA 3UDXA 1E32A 3CC73 1BRNL 3FKAA 5F69A 5DTTA 3UO9A 4E6XA 3LYXA 1P97A 2D7HA 2OAQ1 4JYAM 2V2FF 2Z6CA 1L0DA 3D9YA 2ML6A 3P7NA 1TVFA 1WNHA 1RGKA 4RX3A 4EEUA 5KQDA 3UB7A 3L0RA 4Z1WA 2KRTA 5AIFA 4R70A 3P98A 3SW1A 4OP5A 5AYRB 2WK0A 4TUWA 1ES2A 4S2IA 2IA7A 3S5CA 4GH9A 4B93A 4DXCA 1TDZA 3FD9A 4K91A 4X65M 3C7UA 3KS8A 1HT2E 3Q07A 3EWKA 4EU0A 4U0XA 4HBTA 2RSXA 3F92A 2DHRA 5EP4A 2KF4A 3S29A 3IS2B 2XR8B 4EERA 4STDA 4HH2A 3KOXE 2PYRA 3KP1E 1I0XA 1L3LA 1Q824 3DGLA 2GZAA 3GLGE 2L7HA 3VSYA 1AXBA 4DE1A 2CFLA 2XSOB 3R8FA 4LGYA 2Y73A 1B20A 4B4ZA 5EVID 1K25A 3NWLA 1G0TA 1ASKA 1BVSA 1DP9A 2KZSA 2KRUA 1B2SA 3C30A 1I2GA 4WUJA 4X2HA 2W0NA 1V57A 3EGDC 3RXWA 2LVOC 3UZUA 1DVDA 4G4RA 5CHJA 4BB9A 3EN8A 2W2CA 1RHLA 4NPBA 4N6MA 1HQYE 1EW0A 2Y2LA 2ZOHA 5JYOA 2MJ6A 1FSYA 3F1PA 1K734 3BXWA 4HZBB 3X42A 4G6ZA 1YSPA 3HX8A 3ITAA 3IECA 4WYYA 3GRJA 1W8QA 2J3WA 2K0MA 4R3AA 2DMWA 1IQXA 1NY6A 2R78A 2D7GA 2H5XA 4NEED 5FAOA 1NYMA 4JXVA 4GMQA 4E3KA 2KRKA 5EVEA 4KVHA 3DTEA 1EE8A 5KSCA 2W3FA 1OUNA 4NXNM 1N9NA 2W6JH 1QAMA 3F1OA 3B3XA 4HY8A 4MMXB 1GSPA 1E25A 5F6AA 1PJQA 1XXMA 2UUCM 1BUJA 2ZC4B 3T8NA 3H4MA 5KP4A 2HMKB 2P0MA 3BY9A 2CC3A 1XJ2A 3WMDA 2A15A 1F9IA 1FOFA 1N9OA 5HWVA 3PFIA 2A24A 5IS1A 3VK8A 4JV5M 3K5TA 4AQYM 1BANA 5HPFA 3VKHA 1GS3A 2W56B 5ELJA 4GLQA 5HX9A 1G59A 3FZWA 3MG3A 3GV9A 1QYRA 2OQEC 4HIAA 5FAQA 5GSPA 4Y13A 2P04A 1PGYA 4REZA 1ZV1A 1JWPA 4JGPA 3O8YA 3FF0A 3FTDA 2CC1A 1J2BA 3VDUA 4FCZA 4OP8A 4B08A 2OQ4A 1LRAA 1K8A4 1CK3A 2CH9A 1KOUA 3B89A 1N34M 1X1YA 3G16A 1MKIA 1BRKA 3IS2A 2MC8A 3N8BA 1CEGA 1KFVA 3S67A 4EWFA 3VFDA 1Q864 2EWVA 1R6BX 4N6LA 4CISA 3C3DA 1N9BA 4PM5A 1D06A 4LJ6A 2GSPA 3T1YM 3SXXA 2WKQA 3CUEC 4S2MA 1SCWA 2XLNA 5E6JA 3EQVA 2QYBA 3GR2A 3QP1A 5ITQA 2K2NA 4LRTA 3NBXX 3FH1A 4NREA 4EXOA 4R4SA 3DTMA 3H9WA 3PCRA 1T1AA 2W1TB 3W2ZA 1W7FA 3CMZA 4EEPA 1QVRA 1PZPA 4N1HA 1RU3A 2JY7A 2RFRA 1CI8A 3U6QA 2ZAOA 4MGHA 4AKIA 4CJNA 2W1RA 1YLZA 3LIBA 2MF7A 5RNTA 2Q2EB 4RF0A 1CEFA 2Y59A 3JVVA 1DY6A 2I72A 1GD4A 4L9GA 5FQJA 5GLAA 1SG9A 1L2CA 3LT8A 3ZG7B 3T4SA 3SC3A 4RZMA 3SYUA 2CK3H 1RCKA 4RNZA 5IEPA 4PM8A 4PM7A 1OHSA 3IBJA 1ZG6A 3Q81A 3FUWA 2OWJA 2CX1A 3HZJA 3KZTA 2J7OA 4L7KA 1N9JA 5M1AA 3UNLA 3CF6E 4IVIA 1MX0A 4IVKA 3BLSA 3WHLA 4YWZA 3WA2X 4D81A 2F5NA 1N4OA 4EUZA 4PT5A 3U61B 2KNVA 1IT8A 3HI7A 3BRMA 5IREB 1NO1A 2XEPA 1ERQA 4MDZA 1UI7A 2JNHA 5FASA 5JPUA 4HBUA 4GZBA 2YX9A 1YLAA 4L16A 3T4QA 1FCOA 1K38A 3OPLA 1JWVA 3EE1A 2F86B 4G1MB 4RNAA 4LF4M 2CHCA 6RNTA 3OXAA 4HP4A 2OQEA 4XBOA 1YMSA 4DV7M 2BHMA 4DV2M 1LXEA 3N7WA 4QPRA 1BVIA 3DY5A 1OFIA 4GD6A 4O2HA 5G1LA 3BFDA 4YFMA 1WXQA 1SIIA 2FXTA 4Y5FA 4JXGA 3CCM3 2JCHA 3FUUA 3D79A 1JB2A 4EBGA 3CPTA 3SLUA 1YLPA 2OV5A 1Q7HA 1QZEA 2PU4A 4KZ5A 2JC7A 3U6EA 2ZL8A 2QA43 3B7CA 3FRHA 4H6JA 5EOEA 4S2NC 1UWPX 3T6PA 3ALAA 3FUVA 4FD2A 4QNRA 4OK0A 2OTJ3 1RGYA 4J9AA 3BY8A 3LQQA 3QP2A 4DV1M 1S66L 2QHKA 5IG5A 4HL4A 1VQ53 3EIEA 3B7QA 4QWOA 1GMRA 1NDOB 5IZ7D 3HHYA 3V39A 5CGXA 2CUZA 3GPYA 4IBCA 1CYVA 1MNLA 2VA0A 1S0WA 2L7IA 3HX3A 3IHAA 4QOSA 4D80A 4K0KM 1L2SA 2MJ5B 1I4WA 3IF5A 3FV7A 4KZ7A 1BSEA 2PHYA 2WYXA 2G2UA 1HYFA 3U6LA 4EV4A 4GIPA 3WWXA 1NY5A 3GLFA 1E3UA 3VP3A 4QY6A 4P17A 3IHPA 4M9SA 5CGWA 1FQGA 3WDGB 1MXOA 2ZOIA 3MQQA 1FGOA 5CXOA 1R4YA 1OJGA 1ROVA 3UB6A 3P01A 1WTHA 3D3LA 2XZUA 4WW0A 4MMYB 3BJNA 3HREA 3SAVA 3OC2A 5GKNA 1M1K4 2W3DA 1EFUB 2BJVA 1TGUA 4XT2A 2DNSA 1UDII 1JNQA 3U6MA 3D4AA 3SARA 2DWLA 1AIPC 2G7UA 2E2TA 2HOHA 2L0WA 4WZ5A 1TH2A 3KSPA 2LVAA 4LYLB 4KZ4A 3F7SA 1GA9A 1IVUA 2WKEA 3SOIA 3B9PA 4FWGA 5CERA 1OT6A 3MK6A 3C7VA 3LCVB 4X69A 1IVVA 2YFLB 2X02A 1TRPA 4GNUA 3FG4A 4EV5A 5CX7A 2IY2A 3DAVA 5CEBA 1WJ7A 1Q2QA 1ACFA 3GP1A 3LUQA 2ZA4A 1V34A 4DR2M 3IG5A 2HP9A 4NXGA 5F83A 5HDCA 2Y0TA 4S2NA 2GBWB 3MXQA 2HHHM 1RKYA 2HV1A 2QWSA 3H4JA 2QZ6A 4MMZB 3M2JA 3ZDJA 4DMZA 4AG5A 4ZPXA 7STDA 3CPTB 4HJLB 2CG1A 1SXJA 1NHGC 2Z7AA 4JGRA 1W6CA 1PW8A 4EBLA 4GHOA 1IYYA 4CCVA 4PKYA 1YT4A 1RGLA 4WURA 4EBPA 3DWKA 1MWTA 1YQSA 4P16A 1OAOC 2LNHC 4DR4M 3RGAA 1GYBA 4UN2B 5EPHA 4FH2A 1DV0A 2EX6A 3BB9A 3MBZA 1RDSA 2Z76A 1FCMA 2QPNA 2ZJ9A 2A49A 2VEAA 1DGFA 3B7NA 2LB9A 2V20A 4IBXA 4ESPA 5EXSA 1WA9A 2D02A 2KF5A 3JAMS 5C1BA 2L1MA 3PHYA 1R2YA 1YIJ3 3T15A 4GD8A 1DO2A 3WS2A 1WMNA 1BTLA 1PYYA 4PDIA 2C9OA 2WKIA 3GPXA 3DOAA 2Y2IA 5STDA 4MMNA 5DKKA 1VHMA 1JBRA 1HLUP 3IXGA 4B7GA 3HLDA 2OCTA 3Q7VA 2QNJA 2OAP1 3SS3A 2VKSA 1YUBA 4NXMM 3SS4A 5EQLA 4FOFA 4UA6A 4G3OA 2Q0OA 3HLCA 3TPZA 4KZ3A 4NG2A 2RKOA 2LYXA 1WQLB 3S27A 1XFNA 3A5EA 1G71A 4JXWA 2HKJA 3D8BA 3FKVA 3KX0X 2J5YA 2K3DA 2M7UA 2W03A 2ZD8A 4Q0HA 1F2KA 2Q9NA 5HD3A 4W5WA 1XC8A 3HJSA 4PHTA 4KHPM 1TTEA 1OHOA 4JI1M 3OLOA 3QK9A 3LICA 3K2LA 3N9HA 3HY5A 4MCWA 4AKZA 2QBYB 5HZHA 4DRTA 2BMRB 5AQ7A 1T1BA 1XHBA 2VZWA 3J81S 3MXRA 3GZXB 1VQ83 2F4YA 3UB8A 3MKFA 4X62M 1A67A 2H10A 3EB8A 3U6OA 1UI8A 1YLWA 5IT5A 1G5UA 1FNNA 1BU4A 3CUEA 3PBTA 3FUTA 3RNTA 4BTYA 1IY0A 2BO9B 1MZUA 1TH4A 4IIWA 4FUWA 4MN6A 3HZPA 4LF8M 3GSGA 5CRFA 1YE9A 4KENB 5DTSA 4CLCC 4HYZA 3UB9A 3F1NA 2APLA 3ZFZA 2PBYA 4PPRA 2N35A 3KCHA 5CHMA 2PDRA 3T12B 3EEHA 4C6YA 4BBVA 3B7ZA 2GNXA 1J09A 4LFUA 2CWVA 3GZBA 4HM2B 1A2KA 3OCNA 2RCXA 5DNYA 3CLOA 2CX0A 4DE3A 3NX0A 1RGCA 4CLCA 5KPRA 1TU5A 2GX5A 3F1NB 1RTUA 2UUAM 2AHMA 2ZAMA 4JI3M 1NHWC 3GWRA 4B9OA 2NQ8C 1Q2PA 2X8AA 3UL5A 3IXHA 1QAOA 1WYCA 3JUNA 3IHBA 3MXSA 8CATA 1UCLA 4YY3M 1V9YA 1L5GB 1HKXA 1Q39A 4IBDA 2KHHA 1NB5I 4XT2B 4Z8XA 4JI8M 1M1XB 2CE7A 1A90A 4GC9A 1A5TA 2Z2MB 1XNRM 1DP8A 3MSHA 1N8R4 5L2FA 4OQ0A 3ZCBB 2XFSA 2G8LA 4WM9A 1UUVB 1N9LA 5MC7A 5KP3A 4R9KA 3FG1A 5G2GA 1N77A 4UA9A 1IQPA 1B2ZA 1C3BA 5F82A 2FS1A 1O7MB 1KQS2 2IWCA 3S4XA 3MR0A 1QDTA 4AFIA 2XRNA 3A0SA 3TSGA 1FCNA 3MKEA 3HGIA 5E2FA 1NLYA 4HJ3A 2J7NA 5KPZA 3S22A 1Y4KA 1AUAA 3M6HA 1LQMB 2D01A 4XDWA 3IJEB 1AV4A 1ZGXA 1SKFA 2V1BA 1MKMA 1JWZA 2JWSA 3PBOA 3FPVA 1BLCA 5HGRA 1ZQ9A 2QIYA 1UGIA 1IEMA 1VQP3 4IT7A 2ZQ8A 3MQOA 3FE3A 5KP1A 1SZVA 3Q7VB 1DJBA 4L4UA 2Y2MA 3LIDA 4DUZM 2HDSA 4NRWA 2JKRI 2MR9A 3T4JA 2WZJA 3EX9A 1NJFA 2Y2JA 2DVWB 2BLSA 2Z8YM 2XROA 4DV0M 2C5RA 3ZG9B 4DF6A 4DV3M 1SIHA 1OKSA 2Z6BA 4U0TA 4TX4A 5CLKA 3LXUX 3OWUA 1JRQA 1OTBA 2PT7A 3LIFA 4LFAM 1ES3A 4NK3A 2ML5A 2K31A 4MNRA 1E94E 2F5MA 1GSWA 5FSWA 2V0WA 1ZG4A 3FYDA 4LRZE 4MBKA 3QP5A 3M8CA 1DO0A 2R4EA 1OTAA 4OKPA 2HWJA 2VX8A 2OLUA 2M60A 4LF9M 2FFFB 3G34A 3KIIA 3AGEA 2XGNA 4X56A 4BJPA 1ULJB 5ITRA 1L0FA 4WMCD 1I94M 3PTEA 1D6UA 1GMPA 3K92A 4I3JA 1L1ZA 4WBGA 3F9SA 3FSDA 3OV4A 3WOEB 1DRMA 3MFXA 4KQDA 3IF6C 3RFBA 2QEX3 1OTRA 4S12A 3LI8A 2LHCA 1BRHA 4KZBA 3OPPA 5DF7A 5HDSA 2E8JA 2CP8A 4QHTA 3DGYA 5BIRA 2R46A 3EN1B 3K3DA 4KQOA 2GBXB 1WE4A 3EGXC 4EETB 3EHCA 2FGTA 3G6E3 4I38A 4AI6A 1H8YA 1J5EM 3SMSA 3C58A 1EUIC 5AEWB 1OTEA 2CHGA 1XPBA 4ZBEA 2C98A 2UXCM 2HMMB 4XB5A 3CCL3 5IG0A 2KNAA 1IV9A 3CXC2 4IBRA 3CZDA 3GRUA 3BEBA 3FC7A 3LEZA 2QHOB 3V3SA 1Y28A 4IPBA 1Z5BA 3LTDA 1CJFA 5CTMA 1C7YA 1N33M 1K4FA 3IWQA 5ITXA 2EX8A 4BIRA 3KSIA 5F5YA 3S7QA 3SH7A 4JF8A 4E04A 4WLAA 3LH4A 3C4OA 3DTKA 3L29A 1MBLA 4G3KA 4R71A 2C4BA 5EECA 4CHTB 4E3JA 2LVQD 5E2EA 1DMQA 4OLDA 2UU9M 1MWRA 4WELA 5BVBA 2XZFA 4YINA 3CMA3 3SX1A 4PEJA 4RX2A 3D3OA 1FJGM 1GABA 4CLCB 4GS9B 1IK3A 2BWEA 2QPAA 2DZLA 5JI3E 3TOIA 1W6GA 3LO7A 1RGZA 2H0GA 4PM9A 2H1RA 4LV0A 3VGNA 3FWLA 1JR3D 3L26A 3SOAA 2OOAA 3GLFE 4S2JA 3RE8A 4L9FA 1VQN3 2GU3A 3DWZA 3U4LP 2F5PA 4X66M 3G30A 2EX2A 4K61A 1I2SA 2KLIA 1BLPA 3R7WA 2X49A 3MZEA 2VF7A 3SAUA 2K0BX 1YPRA 3U2AA 3GQ3A 5GHXA 4LRSA 3EBTA 1VG5A 3T4TA 2Y8HA 1DETA 1LL5A 3CITA 6GSPA 5A93A 3V5MA 1JR3A 2O25A 3CCR3 3G35A 1X0OA 2R4IA 2P38A 2Y21A 4RKUF 4GJ4A 3LTBA 5TFQA 1OAIA 3B42A 5DTKA 2L4VA 3KSJA 3IMAB 4X55A 4B4XA 1RRLA 4CDLA 4P6ZS 3EOIA 4HAAA 5J7EA 4M0WA 4QWTA 4MEZA 3C8CA 3ZVTA 4FSFA 3EQUA 3V3RA 2UUBM 1W00A 4N6V0 2X01A 2YFQA 2AADA 4UEYA 5C18A 3IH9A 4AZFA 1TDGA 2Y55A 2BJWA 3I0YA 2Y91A 3FKWA 5HARA 3A3JA 1UCIA 4E6WA 2FH0A 3F1OB 2ZC6B 4L9EA 4MEIA 3H7WA 3PAGA 1EKMA 2QGUA 4KG2A 4KG6A 4LG2A 3M6BA 3UE0A 1VEGA 4B3MM 2JY6B 5EVIC 1SXJE 2W9PA 3KOYE 2R44A 1V74A 3TWLA 3CCQ3 3MG1A 2ZBKB 2H5SA 3E4QA 3GLGB 5AI1A 1OIZA 4KFEA 1LLBA 4LZIA 4LGQA 1UUWB 4FH4A 3H7WB 2C96A 2VGKA 3ITBA 1BNFA 1S67L 4OPZA 3TRCA 2Y74A 4JLFA 1Y8GA 4IJFA 1O7PB 1VDDA 3Q8XA 4KT0F 1IN7A 3HIGA 3TE6A 2FH5A 3M7GA 4FR9A 2PU2A 1US1A 1TUHA 4HEOA 1QJGA 1V33A 4MLLA 2OOVA 3UJMA 4P6BA 3UPNA 4L8PA 1G6OA 2P7JA 2YFJB 1MJGM 1RGAA 1JZDA 1ZO2A 1S5AA 2JKFA 2JQ5A 2B3TA 2WGVA 4GOGA 3W4PA 3WRZA 4ID4A 1T19A 3QP8A 3P09A 4ME4A 3LEQA 2IMJA 3LOYA 2QMIA 3MQ0A 2Z7JA 3GO8A 2GDNA 2QQ8A 3D5GA 1BIRA 2INWA 4UQIS 3X3ZA 3LZAA 1GD3A 4FMCA 2YQZA 1XKZA 3RTYA 5L10A 3GZRA 3F8XA 1RSNA 2DRWA 3NIAA 1UM8A 2F5QA 1CF0A 3PXPA 5A91A 4NOOB 1QAKA 3ZVWA 4N6NB 1TR8A 4Q53A 1EA2A 4HNBA 1Z59A 5FQ9A 1XWIA 2R4JA 2XD1A 1CH0A 1NZUA 2BTFP 2ZLYA 1JBTA 5L8RF 1NJGA 2F98A 1R7RA 4IUKA 4N92A 1DGHA 3AKZA 1BULA 5JYPA 3X40A 4BU4A 1YJW3 3THGA 1VQ73 1KDSA 2VIIA 4HH3A 5TJJA 1QMEA 3G6OA 3SAWA 1BNRA 4HVNA 1P9WA 7CATA 4GB7A 1RLSA 2EWWA 1IN6A 4GHLA 1KSIA 1K57C 1FIKA 3R7WB 2LBCA 2KCDA 5I97A 1KSFX 4FCFA 2Y2NA 3MZFA 4DXBA 3QP4A 3NBIA 5M19A 2B1XB 1IFYA 3N6IA 4FTXA 3VK7A 4JI7M 1SHVA 4LGWA 1H6UA 5DKLA 1IY1A 4GN2A 2GEXA 4DR3M 3LT9A 3PYPA 4K08A 4R0QA 5AVEA 1Q7Y4 1YAXA 1T3BA 2MROB 3W4OA 3ZC7B 3WS1A 1FGTA 2CV1A 2JXNA 1KVMA 1QUTA 4GB5A 4LV3A 3PXMA 2Y4AA 4II7A 3A0RA 5F1FA 2ZQ7A 1B3SA 4JF6A 5GHZA 3CCV3 2RRUA 1JZOA 1NNJA 3E21A 2OWPA 1RN7A 3LYGA 3CCJ3 5M18A 4GHIB 2ERCA 3E99A 1BLHA 2WKRA 3K7CA 1RGFA 2R6FA 1JR3E 1NU3A 4LZJA 2DCFA 3H82A 3DZDA 1BUEA 4RNYA 1NXYA 4QB8A 3CG5A 4H6JB 3A3IA 4GKUA 2RBIA 4HQAA 4NRVA 2HDUA 3EC9A 4FCJA 5F68A 2ZTDA 3IF6A 2KA6B 3E2KA 3RDEA 1Z6TA 3DGMA 3T0UA 1IN4A 2MH8A 4ORLA 1K55A 1PNEA 1UCKA 5HAIA 1R2ZA 1GCEA 5I5LA 3HLBA 3GLHB 3DA1A 3IXBA 3D4FA 5IT9S 3C9PA 3MYTA 2QBYA 1D1JA 3S7NA 2IWDA 3KW6A 2ZMVA 1SJWA 5CHUA 1K6SA 1BNIA 2IUKA 5IG4A 1O7WB 3K0ZA 2Z3XA 3IF6B 3UMEA 1BSDA 4E3LA 3SASA 4K90B 3U97A 1XP4A 1W2ZA 4KZ9A 1NLZA 1NSFA 3E4PA 3GPUA 3IT9A 1PZOA 4BENA 3HK4A 4NSRA 1GOVA 1E9SA 2E5LM 2R41A 2BIRA 1Q02A 1BLSA 2P08A 5EVIB 2O01F 4KUOA 2HJ9C 3HLEA 2HL7A 4N1XA 1ULIB 2DENA 2PR6A 2ZMAA 2LVPC 3GLHE 1PIOA 5IERA 4LFBM 2BASA 5DFXA 3ISGA 1IBLM 1QDRA 1LSXA 3S7OA 3U60B 3CF0A 5EE8A 4Y15A 1NZOA 4BTWA 5E2GA 4XBXA 3T4KA 4Y7PA 2W3GA 4FWHA 2ZQAA 3MJ5A 4PDGA 4WWUC 1XB2B 1O7HB 3PBSA 3GRYA 3QAUA 3CNXA 1EQKA 1RGGA 2W3HA 3BFGA 2V8FA 4B7FA 1T2IA 2EFUA 2R9XA 4GRIA 1I3IA 2ZQDA 1UWNX 4O3VA 2WGIA 2O0YA 3G4PA 4F3LA 4DE2A 2I7PA 3JPUA 1TF0B 3DGNA 4LSOA 1N78A 1C7HA 4GW9A 3KDSE 4I39A 1I5QA 4NXBA 1FR6A 1IYPA 5EVLA 3Q8GA 4KUKA 1T2HA 2DAIA 3Q7ZA 4JGQA 1SXJB 1VQM3 5AJGA 2O9BA 3H3HA 3H82B 2OOVC 3ZQ5A 3GLIE 4O8GA 4XBYA 4QHSA 3JR5A 3O3VA 4ETXA 5ELUA 2A24B 3NCKA 2F4VM 3A3DA 1K41A 4BBTA 4LCLA 2XQZA 3OPRA 3K9OA 4Q7JA 5DF9A 4IEDA 4Y17A 4I8OA 1MC0A 1P3QQ 1K0KA 3FTEA 4FD8A 2KEBA 1A2VA 5U47A 4Y28F 1SDEA 2EJSA 1STZA 1W79A 3KSGA 2J8XB 1A2PA 2OOBA 5FTJA 4JXSA 2I9WA 1IDPA 1K9M4 2PAVP 2ZANA 2V0UA 4WMCA 3F40A 1OMEA 3JVUA 1NV9A 1UCJA 1QVG2 4NXEA 3VP0A 1BOXA 1G6AA 2DAGA 1HQCA 2SARA 2PRFA 5E26A 4QY5A 1OQYA 2C99A 2H28A 1JB0F 1QMFA 1E3RA 4LPZA 1YJ93 3FYCA 1GHPA 3BFEA 4B3RM 1LTMA 5LBRA 1VQ43 3QHYA 3T4LA 2BNKA 3UMMA 2XK1A 5LMNM 2CWTA 4S2OA 2ACGA 2K47A 3NDGA 3A42A 3KFQC 4JI5M 5LC7A 1YI23 3IH8A 1K6RA 3DBAA 3GLFB 1GOYA 3RH8B 5HAQA 3GRVA 2RNTA 2K9DA 3NOTC 3GRRA 3AL0C 4BWIA 3KSED 3PYJA 3DZLA 3RGPA 1FGMA 1DJCA 1S1ZA 1H8ZA 3CAXA 1LSVA 3CC43 2EA0A 3KSXA 3FCSB 4MN7A 1K56D 3LFVA 3KFUG 1B27A 2IWBA 1NWWA 1RRHA 4Y3IA 1RNTA 1Z6FA 4PCZA 2YR0A 1ZTUA 1E9RA 5FATA 4OQHA 5DYGA 1VETA 5FTMA 5K5BA 3LQRA 2KF3A 1TH3A 2HZ5A 4PM6A 4OW0A 2GJ3A 1FZUA 3FRIA 3U6SA 1OT9A 3G32A 5TR7A 1W02A 1ALQA 3C5AA 1YVSA 4BBAA 3GRDA 2EA9A 3MG2A 3AJIB 4Z6YA 3WS5A 2EKKA 2L6OA 3NBRA 3OOVA 3U61A 1RN4A 5E43A 1YLYA 3E0YA 2WOHA 2JDIH 1CI9A 2A2LA 2ZM8A 3BFFA 3X3YA 3FKEA 5AYSC 1WGLA 3NHQA 4K0XA 1MWSA 1LQGC 3W67A 1YNVX 3MJQA 2V6ZM 2DKLA 3L27A 4G4QA 4JPMA 1KE0A 1TJDA 4JF5A 3I51A 2XLJA 1ZAEA 3WR2A 2B5RA 4X6TA 3VV4A 3CC23 1E4DA 2D7EA 4DN0A 3L28A 1HU9A 3I563 4OLGA 3VFFA 1NVMA 3G0KA 1Z09A 5KIZA 1OPXA 1Z5CA 1PYLA 1CQSA 4WZ4A 2BNGA 1W7CA 1KC84 3GQ5A 2H0YA 1BT5A 2WZXA 4QU3A 1QUSA 4N6OB 4AKHA 1NJI4 3KE7A 1ZMWA 3AFHA 3UE6A 3MMPA 4DUYM 3LCUA 7GSPA 4R9LA 4PMAA 3T1XA 4OOLA 3GLIB 4H8RA 5IU1A 5JPPA 3O87A 2JZ0A 3WS0A 1EG9B 3HBRA 3V98A 3KP0E 2CFOA 4MGKE 1RJOA 1IKGA 2QJ7A 3C38A 3B33A 3T1SA 1IU7A 1OJLA 3KKGA 1LSWA 3PBRA 4KLNA 2I7NA 5EXXA 2R18A 1L2DA 1VEUB 3LGOA 3UB1A 1K82A 2W56A 1W4NA 1IQYA 1GSVA 4I4KA 1HD8A 1IFQA 4FCTA 2FFYA 4HHDA 3GPPA 5KMWA 3PBQA 1KDWA 1PI5A 2W82A 4R23A 4R4RA 1F4IA 1GOUA 3JUQA 2UGIA 4R3DA 4O02B 5FAPA 4R4KA 4LY6A 5HFOA 3ZNTA 1HZOA 1BNJA 4IBEA 1AY7A 4PAUA 1O7GB 3Q1FA 2CW9A 3PGBA 3S7PA 3W68A 3SVAA 1Q42A 4WP2A 3I4VA 3J2PB 1L0EA 1W5SA 4MBFA 1B2XA 4OVMA 2J9OA 3CPOA 4Q8IA 1U5OA 3FTFA 2UXBM 4MN5A 4X53A 4IBGA 2HMJB 1IXSA 2V1UA 2RGQA 4HOIA 4A5RA 3IWIA 4L6V6 1MGRA 3DFZA 2STDA 1SKOA 4AW4A 4HM6B 5IEOA 1XA7A 2W3EA 2Y2OA 1ONHA 1XGJA 5J4EA 1DYUA 1Z5AA 3HJ8A 2CKFB 3ULFA 1S723 2L4RA 4GCZA 4BTXA 5A8BA 4EBNA 2GEYA 3E4OA 1ZMVA 2JA2A 2WSFF 2RL3A 1BNSA 2CMNA 4KFFA 4R7GA 5IF6A 3BNEA 3HU3A 1VM1A 2UV0E 2XSZA 3K63A 1HJPA 1G28A 5EV0A 4EUVA 5L09A 2VF8A 4E3IA 2UWXA 4IJEA 1IYSA 4GS9A 2WGWB 5FDSA 1MGWA 4KODA 1ISKA 3CCE3 3N8RA 3K9MC 3Q82A 4KZ1A 4XK8F 3NM7A 2LH0A 4XM4A 1ODVA 1TS6A 3V50A 1VQL3 1JJ22 5ITTA 3BW6A 4LF6M 5KPTA 3GQ4A 1CEWI 3FG3A 3KSFA 4LJAA 3N8SA 3EQQB 1PRQA 1K4EA 1JB5A 4DE0A 3ICYA 2IA2A 2IYJA 3RGSA 5H37D 3B8LA 5BXQA 1Y54A 4XUZA 1K57A 4LJ4A 4GHAA 1M6KA 3AGOA 4U13A 2M7OA 3T1HM 5FQKA 3FYZA 3IX4A 2K7SA 3VE4A 2DWNA 3QYEA 2JKGA 4HI4A 4MJDA 1TEMA 1PJJA 1STFI 2H0TA 3ZCZA 2E8IA 2L4EA 3GDIA 4R1GA 1JQJC 1VQ1A 4J5KA 4ZJ2A 2WOFA 4B88A 5F3WA 3DTIA 3U6PA 1TS8A 4Y0OA 3VLFB 3J7AS 4R6LA 2PNCA 3S28A 2WKHA 3VMAA 1FUSA 3DMCA 5AEUB 3NC8A 1DE3A 3IG8A 3CU3A 2Y2QA 1K55C 2W9QA 5EXPA 4LJ9A 3BWLA 2OLVA 1G4AE 4H61A 4EXRA 4QD4A 4EV2A 4DV5M 2XFTA 4X25A 1VDLA 3LVVA 3VDPA 3JUOA 1PRBA 4FCWA 4F1IA 3BOSA 2CFKA 4MM3B 3LY4A 4IBBA 1JB4A 3BECA 3HU1A 2W27A 1SARA 1KWIA 3DXOA 1MN3A 1IVWA 4WHAA 1SXJD 4NETA 4OOYA 1XJ6A 5EP2A 1SDNA 1S6RA 4JI4M 1NJ4A 1GJTA 1SKOB 4JI0M 2V9AA 3T38A 2DHYA 4DKIA 5DYIA 2JY8A 5A90A 3SS5A 1KE3A 3HJQA 1DMNA 1GL6A 1HR0M 1OGXA 1OTIA 3NJAA 3HJKA 4S2LA 3UPPA 3WS4A 5EP1A 1OHPA 4HP9A 4NKPA 9RNTA 5FGOA 5HPIA 1I0VA 3UB5P 1OPYA 5ITUA 3AGDA 4K0WA 1H5XA 3PAEA 1BNGA 3ILKA 1QANA 2LTUA 4LJ8A 1BZAA 1M40A 4P85A 3LMMA 4WF0A 3KVWA 3WA3A 1TS0A 4E3NA 3PXGA 4CLCE 8RNTA 1D7EA 2I9VA 2YNMD 2RCDA 4KZAA 3M6AA 3GLGA 3LIAA 4EW7A 1IV7A 1U8CB 3U6CA 3QYBA 2ZHXB 1NB3I 4RBNA 1JKGA 4CPKA 4E3OA 4GDNA 2K6BA 2HP6A 4IUHA 4I3IA 2KAAA 2DAEA 4KQQA 4XUXA 2DAMA 3OX9A 3CCU3 2K54A 5DJTA 2KF6A 5BPVA 1PI4A 1WMOA 4ZRRA 3A3EA 5BOHA 1TFKA 2CFWA 1L1TA 4ZTKA 1FW7A 1BYWA 3LTAA 3ZNYA 1C1KA 4OUQA 2KOIA 3CJMA 2FNQA 5EXTA 2B24B 2JN7A 1SQWA 3IX8A 5ITYA 1N5HA 3I4YA 5HWTA 4GKKM 3IQAA 3KYEA 3G8ZA 2ZC5B 1OH0A 2GU1A 1ZX2A 5TGFA 1XJ4A 3UJNA 3U1WA 1LOWA 4S2KA 3FG8A 2JBFA 2WSCF 3SZTA 3HKPA 4HLQA 4ARZA 1OIPA 3CME3 1I2FA 1BSGA 5G4YA 1B21A 3K8ZA 1WGNA 4HOHA 4KO8A 3T1RA 3T4OA 4GL6A 4CJ6A 1GVNA 3OWYA 1YIT3 3TW8A 4DDSA 2P05A 3JR4A 3E9SA 4BQMA 5CGSA 1H8MA 4YHHM 4DV6M 3B47A 4K1UA 4LCBA 5HSQA 3A45A 1MU5A 1VEJA 2L1SA 3MF0A 1FUTA 4PD2A 1IQ8A 1BSAA 3F14A 2WAEA 1IVXA 1V9ZA 3G2ZA 5EM1A 1GY6A 2BG1A 4BL2A 5CTNA 2CG0A 3F8HA 1W2B2 3G713 3NOUC 2P5TA 4E3MA 3EEAA 4RQ9A 3W0LB 3K9PA 3WHOA 5J8XA 2XGLA 5EEOA 3PCSA 1PJTA 2PD8A 4LF5M 1WMPA 3HUMA 3U60A 2R62A 1FGRA 4EC6A 5GLCA 1KE4A 1JVJA 1HT1E 5D82A 5G18A 1Q9EA 2EKFA 4GHIA 4OONA 1KVLA 3PZWA 1IXRC 1X37A 4HBRA 5EVIA 4EQIA 5FLXS 1RCLA 1N5PA 3HUNA 4JKTA 1B2UA 1TP6A 1J9MA 3HU2A 3UE3A 2ZMFA 2J9PA 1IYQA 1JN5B 3MKIA 3SYKA 5I94A 4HM4B 1PWCA 3TE8A 4ZJ3A 4NSOB 1YGWA 3BNCA 3NOPC 2W04A 2WO0A 1K54A 3SBJA 4JI6M 4N6TA 4C75A 1GL7A 5D81A 5AQBA 3VSLA 1HNWM 3NBLA 4LFCM 3GLHA 1RMSA 1FYSA 4MBHA 3LY3A 4OQIA 4FCMA 4IBIA 2Y2PA 4CLCD 2PZVA 3NV0A 3T50A 3SYLA 3CWFA 2J3TD 1GKIA 1IM2A 1I2EA 5D83A 1ES4A 2WADA 5AQ9A 1LI9A 2A5YB 1X1UA 5IWAM 1AR0A 4Y0TA 1E3UD 2KZUA 2E2UA 1TDLA 2O9UX 1PJSA 2L09A 3JUMA 3MSOA 5DF8A 7RNTA 1LOXA 3ZG5A 1YLTA 1IN8A 3FGYA 3BNBA 1QAFA 4X2OA 3KO6A 2KXGA 2CHQA 6STDA 2WGOA 2DZNB 1GHIA 3GECA 1XMQM 5FI7A 2Y79A 1RNBA 2KXEA 1Y4OA 4I3AA 5C5KA 3LCEA 5DRVA 5HD5A 4I5SA 3LW5F 1DGGA 5BR8M 2F5OA 4KFDA 1TIJA 3DW0A 2C5WB 3UE1A 3ZHHA 4OQGA 1GSXA 2HAKA 2BU4A 1D0LA 3KYZA 4Y2FA 3Q1CA 1K28A 3ZQJA 1GA0A 3WRTA 2EUCA 3V76A 2EX9A 5A92A 3QNCA 5IG3A 3A0VA 4ANRA 3VKGA 4OOMA 1AQZA 2Y0QA 2C9CA 1FA3A 1QZMA 4HZ9B 5EVHA 1TD5A 4XGIA 1YM1A 3NHXA 2R45A 4AKYA 3SMPA 3OTOM 3S1YA 1XFQA 3KS4A 3C3EA 2EXAA 4FMDA 1W5TA 2W1TA 1GJSA 1FGQA 3HHWA 5DFYA 2JKRM 1BRGA 1RP5A 4OVDA 4XXRA 1N36M 4LRYC 3SH8A 3AHWA 3C4PA 2DI0A 3VE3A 4F94A 1G41A 3SHFA 4QNMA 3IXDA 4X68A 1HTZA 2H0IA 1GHMA 2FFJA 1JN5A 4RYEA 4I81A 4WFOA 2OPFA 5GL9A 4EYCA 4QOZC 2JP7A 4WYKA 3PVSA 5G1KA 1QMAA 4EESA 1UW1A 4S2PA 5HW3A 1I8VA 2XH9A 3FTCA 3LTCA 2XD5A 1OFHA 3SOYA 2OOLA 3BBZA 4OH0A 2M7VA 3MS6A 1QALA 3ZG0A 4ZAMA 3MHEA 1Q3BA 1R4GA 1YHQ3 4Q0IA 4QJGA 1VEKA 3O88A 3OPHA 2KNZA 1G3IA 2XA7M 2G5GX 3E2LA 1E97A 3BFCA 4Q0JA 1PWGA 3HUOA 4HM7B 4BBUA 2XDMA 2D1WA 4LV1A 1XMOM 1VEUA 2FZ0A 1JTDA 4Z9QA 1I70A 1IELA 1SPUA 1YJN3 5HWWA 3FUXA 1AVKA 2HMNB 4LV2A 3UL6A 1L0GA 4JF4A 3ZH9B 2M1CA 4UQIM 4IJGA 1CUKA 2LWXA 4MH0E 1G68A 1L8QA 1C54A 5AIHA 4DR6M 3X3XA 1RCJA 5AVFA 2HDQA 1X1WA 2QSFX 2QKPA 1WYBA 2ZC7A 3BYDA 4LRXC 3MMHA 2FE8A 1L2BA 2YFIB 5DVAA 3VOYA 3NDEA 3CHWP 3U5ZA 3AMOA 1JBSA 3LR5A 5L07A 1V58A 1BRSA 1S3SA 4HM3B 5IENA 4N6UA 2GNOA 2CWUA 4YOFA 1MOLA 1ZS7A 4IIAA 4NXFA 4LJ5A 5EJCA 1U60A 1GMQA 4HJ4A 2QCUA 4OVZB 3CI6A 3ZYTA 2P09A 3JYIA 3E4RA 3PBNA 2V8CA 3STDA 3F1PB 1TRQA 4I4LA 3EF8A 4NHFA 4CQHA 2V1LA 5J3WA 2VV6A 3WHKA 3W8KA 3IPTA 5LMUM 3KSHA 1PY3A 1TDHA 4FMAA 3LI9A 3B4OA 4AKGA 3ROBA 1HNZM 2F5WA 3RXXA 2G2WA 1ESIA 1O07A 3KXEC 1PW1A 5FQQA 3VSKA 3AOGA 2ZDJA 3LR0A 4R3JA 4MGZE 2OWHA 5TBMB 2KX6A 2VQEM 1WHCA 3BNDA 1LV7A 2WZZA 1LL8A 1MY8A 1JV2B 1WIVA 3BQ8A 2WGQA 3SFZA 2Z77A 2L2DA 3QWLA 3BU4A 4H3UA 1IYOA 2HPBA 2OSUA 2GXFA 1RGHA 1S4RA 5KSHA
chains in the Genus database with same CATH topology
3N8LA 3CF2A 3UGJA 1K3WA 2VGJA 1FR1A 1NYYA 4GC5A 5AIIA 5CXWA 1W8YA 3KOZE 3QRDA 3Q90A 4R1KA 3J7BA 1VQO3 3RFWA 1MPLA 5CF2A 4FW9A 1W6YA 5FSRA 5E2HA 4JN6A 3Q2PA 3JUPA 4FVMA 3G2YA 1EI5A 2Z2LB 4AEQA 3TWMA 2WGWA 3MZDA 2ZM6M 2Z4RA 1ROAA 5A0OB 4L8RC 4HM5B 4LENA 5GHYA 3CTWB 4DR7M 2O3OA 5FTLA 3G31A 1DMMA 2J8YA 1KGGA 1EWZA 8CHOA 2SBLA 1XX2A 4GITA 4LEHA 3OCLA 1LI0A 1XNQM 5LC6A 4LZZA 4WEJA 3GMWA 1LVNA 4A3VB 4EIWA 3LMLA 2C6WB 2EO2A 2P9VA 3SATA 4NL4H 1ZC2A 4LGMA 3CCS3 3HWSA 4P87A 4WZ5C 2ZM0A 5DREA 5FQIA 3I7JA 4FCVA 2V1CA 1E3VA 3H51A 4KG5A 4HEFA 5CF1A 4N9KA 1DGHB 1QQWA 4OPRA 4QHCA 2DXIA 3I553 5FW5A 3VP2A 4N9LA 1M904 3D8LA 1KGFA 5FQMA 1IXSB 5ITXE 2LXEA 2CFDA 3V99A 1IKIA 4KQRA 2XSZD 3A98B 5GLDA 3HVFA 4MGIE 2Z4SA 3RGRA 3NBJA 3PS8A 5CK6A 1OF5B 4XBTA 2EFXA 2J7VA 4J8TA 4G4OA 3J80S 1R4CA 2CIUA 5CECA 3M0EA 2C10A 3DM8A 4N3VA 1K56A 3ECFA 1IY2A 3TWKA 3FLJA 2Y2GA 1QAQA 1PJIA 1M9GA 4BLCA 4GDBA 3NXJA 3NUVA 3HL9A 4CGYB 4ZM8A 5AQAA 4D2OA 4LJ7A 3HHZA 4RA7A 2JE5A 3J7Yd 3NM2A 2BMOB 3NQZA 3HHXA 1BUQA 4JI2M 2IUJA 1LHYA 1O7NB 1YMXA 2HMOB 3X41A 3JVCA 2BMQB 1CYUA 2Q07A 3SEDA 4UHUA 2F99A 5EP3A 2O5RA 2V1ZA 1DVCA 3LVWA 3OZHA 2X4AA 4OU7A 3EJVA 3F7XA 2HCBA 1OACA 2XRXB 1VQ93 1OGZA 4LF7M 2CV2A 4HKVB 5FTNA 4MGYE 2CEAA 3TL4X 4IBFA 1YGEA 1ERMA 2W0QA 4IBJA 1AVLA 3MWZA 1F8NA 4L15A 3DGOA 2DZOB 4KZ7A 5KZHA 2P9VB 4HM0B 1T3TA 3TQSA 4LCMA 1D6YA 3T8UA 2ZQCA 2FOIC 2RGOA 1XA1A 4C3QA 4JRFA 1K3XA 1NO3A 4L8OA 4LMIA 1JTGA 4FWDA 1NY0A 1XGIA 3OW22 4U3TA 3KOWE 1Q40B 2INXA 2HP5A 2XR0A 4HM1B 1IBKM 2BT3A 3G4S3 3QNBA 5HL1A 5IHVA 3VF1A 2WAFA 3BLZA 4BD1A 3HLWA 1ORYB 1GY5A 2RGHA 3MHVC 3EBYA 3VP4A 4WEKA 3VP1A 5HAPA 2WUQA 4OX9M 4ZJ1A 3UK6A 1IXZA 3WODG 1YSYA 3GVBA 3VOZA 5F1GA 5FI6A 2QENA 4M3KA 1DJAA 5IW9A 3TDGA 1ESUA 3D9RA 3U5ZB 3AMOB 2CV0A 4KZ8A 1G8PA 1FUWA 3MFDA 3RJUA 1W5ZA 3L2AA 3FZCA 3L25A 4R3BA 3MPHA 4RVAA 3ZG8B 1JKGB 3BLMA 3HLFA 3K1JA 4HESA 5KQ8A 2VQFM 4L0LA 1LL9A 1GLNA 3SHGB 2EXBA 1IBMM 1PWDA 1PM5A 3NV0B 1TFOA 1XXHA 1OF5A 1KGEA 3O86A 4IBKA 3HIIA 1STDA 1K54C 3PNYA 2ZM2A 1PFPA 3CPW2 3DUKA 4DR1M 4ZDXA 2KW0A 2OTL3 4BLMA 4HM8B 4O7DA 3R9XB 3AOEC 5FDHA 4X64M 3U6DA 5AIGA 1G96A 1VZZA 1GY7A 3NBBA 3AV0A 4GKJM 4BL3A 3ER7A 1MWUA 3VFHA 4B3SM 1HNXM 4WP5A 1VQ63 2HMLB 2XF3A 1SXJC 1O7EA 3NY4A 3V92A 2UXDM 1Q40A 3A3FA 4RF1A 1OCVA 4M9ZA 3FF2A 4M9XA 2Y2KA 2P74A 2ZQ9A 4B7HA 3AGFA 1W5DA 2DWMA 5JI2E 4P0MA 5FI2A 1ES5A 3AOEA 3ZGAB 1KYIA 1N32M 4AG6A 1KD14 4ITQA 1I2WA 4K1VA 5EOOA 1ZKJA 4R80A 1VQQA 1YVBI 3UDFA 1T5YA 4L78A 3TG9A 2Q9MA 2QZ4A 1YLJA 1NRFA 4OPQA 3W0FA 3CNMA 2P0XA 3J27B 5EUAA 3CD63 2DWZB 1EROA 1N75A 3B4PA 4JBFA 3A76A 1VQK3 4O8SA 4MB7A 2QP9X 3GQZA 2FNAA 3UPOA 4G4NA 4XDVA 5A2QS 4DV4M 2ZC3B 5FA7A 3OWSA 2F5SA 1LNHA 2D42A 1D2NA 2R65A 1W01A 5JBSA 4OPYA 3EIHA 1Z1SA 1N9EA 1J7KA 2XSHB 3A46A 4B3TM 4FMBA 2C11A 2CFGA 3W4QA 4D82A 4KZ6A 2HDRA 2CHVA 1IT7A 3UY6A 5FTKA 3IWOA 4OVZA 4WYKB 5KO3A 1Q3CA 4DDYA 1D6ZA 5EQTA 3NI9A 4DR5M 1PU4A 2E2VA 3WOFB 2Y2HA 1ONGA 1N8QA 1Q814 3NQYA 5TGNA 3GTCA 1XXHB 3GAXA 4BD0A 3GZYB 2R9WA 4UAAA 4JXJA 4Y0UA 3UNWA 3SH9A 3N4IA 5GLBA 1HVBA 3HLGA 3GLIA 4M0DA 1NNUC 3KN4A 3PNVA 2A3UA 2Y20A 2UX0A 1FSWA 2X71A 3M2KA 4UA7A 3BM6A 3UDIA 2M5ZA 1IN5A 3N54B 2LQVA 1QVF2 5CEDA 1DGBA 5D3OA 3UN7A 3UDXA 1E32A 3CC73 3FKAA 5DTTA 3UO9A 4E6XA 2D7HA 2V2FF 4JYAM 1L0DA 2ML6A 1TVFA 1WNHA 4RX3A 5KQDA 3L0RA 2KRTA 5AIFA 3P98A 4OP5A 5AYRB 2WK0A 4TUWA 1ES2A 4S2IA 2IA7A 3S5CA 4GH9A 4DXCA 1TDZA 3FD9A 4K91A 4X65M 3C7UA 3KS8A 1HT2E 3Q07A 4U0XA 4HBTA 2RSXA 2DHRA 5EP4A 3S29A 2XR8B 4STDA 3KOXE 3KP1E 1Q824 3DGLA 2L7HA 3VSYA 1AXBA 4DE1A 2CFLA 2XSOB 3R8FA 4LGYA 2Y73A 4B4ZA 5EVID 1K25A 3NWLA 1ASKA 2KZSA 2KRUA 4X2HA 3RXWA 3UZUA 1DVDA 4G4RA 5CHJA 4BB9A 3EN8A 2W2CA 4N6MA 1HQYE 2Y2LA 5JYOA 1FSYA 1K734 3X42A 4HZBB 4G6ZA 3ITAA 3HX8A 4WYYA 3GRJA 1W8QA 2K0MA 1IQXA 1NY6A 2D7GA 5FAOA 1NYMA 4JXVA 4GMQA 4E3KA 2KRKA 4KVHA 1EE8A 5KSCA 1OUNA 4NXNM 2W6JH 1QAMA 3B3XA 4MMXB 1E25A 1XXMA 2UUCM 2ZC4B 3T8NA 3H4MA 5KP4A 2HMKB 2P0MA 2CC3A 3WMDA 2A15A 1FOFA 3PFIA 3VK8A 4JV5M 3K5TA 4AQYM 3VKHA 1GS3A 2W56B 5ELJA 5HX9A 1G59A 3FZWA 3MG3A 3GV9A 1QYRA 2OQEC 5FAQA 4REZA 1JWPA 3O8YA 3FF0A 3FTDA 2CC1A 1J2BA 3VDUA 4FCZA 4OP8A 4B08A 2OQ4A 1K8A4 1CK3A 1MKIA 2CH9A 1N34M 3G16A 2MC8A 3N8BA 1CEGA 1KFVA 3S67A 4EWFA 3VFDA 1Q864 1R6BX 4N6LA 4CISA 1N9BA 4PM5A 4LJ6A 3T1YM 3SXXA 4S2MA 1SCWA 2XLNA 5E6JA 3EQVA 3GR2A 5ITQA 4LRTA 3FH1A 4NREA 4R4SA 3DTMA 3PCRA 1W7FA 3CMZA 1QVRA 1PZPA 4N1HA 1CI8A 2RFRA 3U6QA 2ZAOA 4MGHA 4AKIA 4CJNA 1YLZA 2MF7A 2Q2EB 4RF0A 1CEFA 2Y59A 1DY6A 2I72A 1GD4A 5FQJA 5GLAA 1L2CA 3LT8A 3ZG7B 3SC3A 4RZMA 2CK3H 4RNZA 5IEPA 4PM8A 4PM7A 1OHSA 1ZG6A 3Q81A 3FUWA 3KZTA 2J7OA 4L7KA 1N9JA 3UNLA 5M1AA 3CF6E 4IVIA 1MX0A 4IVKA 3BLSA 3WHLA 3WA2X 4D81A 2F5NA 1N4OA 4EUZA 4PT5A 3U61B 1IT8A 3HI7A 3BRMA 5IREB 2XEPA 1ERQA 1UI7A 5FASA 5JPUA 4HBUA 4GZBA 2YX9A 4L16A 1FCOA 1K38A 3OPLA 1JWVA 3EE1A 2F86B 4G1MB 4RNAA 4LF4M 2CHCA 3OXAA 2OQEA 4XBOA 1YMSA 4DV7M 2BHMA 4DV2M 1LXEA 3N7WA 3DY5A 1OFIA 4GD6A 4O2HA 3BFDA 4YFMA 1WXQA 1SIIA 2FXTA 4JXGA 3CCM3 2JCHA 3FUUA 1JB2A 4EBGA 3SLUA 1YLPA 2OV5A 2PU4A 4KZ5A 2JC7A 3U6EA 2ZL8A 2QA43 3B7CA 5EOEA 4S2NC 3ALAA 4OK0A 3FUVA 4FD2A 4QNRA 2OTJ3 1RGYA 4J9AA 3LQQA 4DV1M 5IG5A 4HL4A 1VQ53 3EIEA 1NDOB 5IZ7D 3HHYA 3V39A 5CGXA 2CUZA 3GPYA 4IBCA 1CYVA 1MNLA 1S0WA 2L7IA 3IHAA 4QOSA 4D80A 4K0KM 1L2SA 1I4WA 3IF5A 3FV7A 2WYXA 2G2UA 3U6LA 4EV4A 4GIPA 3WWXA 1NY5A 3GLFA 1E3UA 3VP3A 4QY6A 4M9SA 5CGWA 1FQGA 3WDGB 1MXOA 1FGOA 5CXOA 1ROVA 1WTHA 3D3LA 2XZUA 4WW0A 4MMYB 3HREA 3SAVA 3OC2A 5GKNA 1M1K4 2BJVA 1TGUA 2DNSA 1JNQA 3U6MA 3SARA 2DWLA 2E2TA 4WZ5A 1TH2A 3KSPA 4KZ4A 3F7SA 1GA9A 1IVUA 2WKEA 3SOIA 3B9PA 4FWGA 5CERA 3MK6A 3C7VA 4X69A 1IVVA 2YFLB 2X02A 4GNUA 3FG4A 4EV5A 5CEBA 1Q2QA 3GP1A 4DR2M 3IG5A 2HP9A 5F83A 2Y0TA 4S2NA 2GBWB 2HHHM 1RKYA 2QZ6A 4MMZB 3M2JA 3ZDJA 4AG5A 4ZPXA 7STDA 2CG1A 4HJLB 1SXJA 1NHGC 2Z7AA 1W6CA 1PW8A 4EBLA 4CCVA 1YT4A 4WURA 4EBPA 3DWKA 1MWTA 1YQSA 4P16A 2LNHC 4DR4M 3RGAA 1GYBA 5EPHA 4FH2A 2EX6A 3BB9A 3MBZA 2Z76A 1FCMA 2QPNA 2ZJ9A 2A49A 1DGFA 2V20A 4IBXA 5EXSA 3JAMS 5C1BA 1R2YA 1YIJ3 3T15A 4GD8A 1DO2A 3WS2A 1WMNA 1BTLA 1PYYA 4PDIA 2C9OA 2WKIA 3GPXA 3DOAA 2Y2IA 5STDA 3IXGA 4B7GA 3HLDA 2OCTA 3Q7VA 3SS3A 1YUBA 4NXMM 3SS4A 5EQLA 4UA6A 3HLCA 4KZ3A 3TPZA 2RKOA 2LYXA 1WQLB 3S27A 4JXWA 2HKJA 3D8BA 3FKVA 2W03A 2ZD8A 2Q9NA 4W5WA 1XC8A 3HJSA 4KHPM 4JI1M 1OHOA 3QK9A 3K2LA 3N9HA 4AKZA 2QBYB 4DRTA 2BMRB 5AQ7A 1XHBA 3J81S 3MXRA 3GZXB 1VQ83 3MKFA 4X62M 1A67A 2H10A 3EB8A 3U6OA 1UI8A 1YLWA 1FNNA 3PBTA 3FUTA 4BTYA 1IY0A 2BO9B 1TH4A 4IIWA 3HZPA 4LF8M 3GSGA 5CRFA 1YE9A 4KENB 5DTSA 4HYZA 2PBYA 3ZFZA 4PPRA 5CHMA 4C6YA 1J09A 2CWVA 3GZBA 4HM2B 1A2KA 3OCNA 2RCXA 5DNYA 4DE3A 3NX0A 5KPRA 1TU5A 2UUAM 2AHMA 2ZAMA 4JI3M 1NHWC 3GWRA 2NQ8C 1Q2PA 2X8AA 3UL5A 3IXHA 1QAOA 1WYCA 3JUNA 3IHBA 3MXSA 8CATA 4YY3M 1L5GB 1HKXA 1Q39A 4IBDA 1NB5I 4Z8XA 4JI8M 1M1XB 2CE7A 1A90A 4GC9A 2Z2MB 1XNRM 1N8R4 5L2FA 4OQ0A 3ZCBB 2XFSA 2G8LA 4WM9A 1UUVB 5KP3A 4R9KA 3FG1A 5G2GA 1N77A 4UA9A 1IQPA 1C3BA 5F82A 1O7MB 1KQS2 2IWCA 3S4XA 3TSGA 1FCNA 3MKEA 3HGIA 5E2FA 2J7NA 5KPZA 3S22A 1Y4KA 3M6HA 4XDWA 3IJEB 1AV4A 1SKFA 1JWZA 3PBOA 1BLCA 5HGRA 1ZQ9A 2QIYA 1IEMA 1VQP3 4IT7A 2ZQ8A 3Q7VB 5KP1A 1DJBA 4L4UA 2Y2MA 4DUZM 2HDSA 4NRWA 3EX9A 1NJFA 2Y2JA 2DVWB 2BLSA 4DV0M 2C5RA 3ZG9B 4DF6A 4DV3M 1SIHA 2Z6BA 4U0TA 4TX4A 5CLKA 3LXUX 3OWUA 1JRQA 4LFAM 1ES3A 4NK3A 2ML5A 4MNRA 1E94E 5FSWA 1ZG4A 3FYDA 4MBKA 3M8CA 1DO0A 2R4EA 4OKPA 2OLUA 2M60A 4LF9M 2FFFB 3G34A 3KIIA 3AGEA 2XGNA 4X56A 4BJPA 1ULJB 5ITRA 1L0FA 4WMCD 1I94M 3PTEA 1D6UA 3K92A 1L1ZA 4WBGA 3F9SA 3FSDA 3OV4A 3WOEB 3IF6C 2QEX3 4S12A 5DF7A 4KZBA 3OPPA 4QHTA 2R46A 3EN1B 4KQOA 2GBXB 1WE4A 3EHCA 2FGTA 3G6E3 4AI6A 1H8YA 1J5EM 3SMSA 3C58A 5AEWB 2CHGA 1XPBA 4ZBEA 2C98A 2UXCM 2HMMB 4XB5A 3CCL3 5IG0A 1IV9A 3CXC2 4IBRA 3CZDA 3GRUA 3BEBA 3LEZA 3V3SA 4IPBA 1Z5BA 3LTDA 5CTMA 1N33M 3IWQA 1K4FA 5ITXA 2EX8A 3SH7A 4JF8A 3LH4A 3C4OA 3L29A 1MBLA 5EECA 4CHTB 4E3JA 5E2EA 1DMQA 4OLDA 2UU9M 1MWRA 4WELA 5BVBA 2XZFA 4YINA 3CMA3 3SX1A 4PEJA 4RX2A 1FJGM 1IK3A 2QPAA 5JI3E 3TOIA 1W6GA 3LO7A 1RGZA 4PM9A 2H1RA 4LV0A 3VGNA 3FWLA 1JR3D 3L26A 3SOAA 4S2JA 3RE8A 1VQN3 2GU3A 3DWZA 2F5PA 4X66M 3G30A 2EX2A 4K61A 1I2SA 1BLPA 2X49A 3MZEA 3SAUA 3GQ3A 5GHXA 4LRSA 3EBTA 1LL5A 5A93A 3V5MA 1JR3A 3CCR3 3G35A 2R4IA 2P38A 2Y21A 3LTBA 5TFQA 5DTKA 2L4VA 3KSJA 3IMAB 4X55A 4B4XA 1RRLA 4CDLA 4M0WA 4QWTA 4MEZA 3ZVTA 4FSFA 3EQUA 3V3RA 2UUBM 1W00A 4N6V0 2X01A 2YFQA 5C18A 3IH9A 4AZFA 1TDGA 2Y55A 2BJWA 3I0YA 2Y91A 3FKWA 5HARA 3A3JA 4E6WA 2ZC6B 4MEIA 3PAGA 1EKMA 2QGUA 4KG2A 4KG6A 4LG2A 3M6BA 3UE0A 4B3MM 5EVIC 1SXJE 2W9PA 3KOYE 1V74A 3TWLA 3CCQ3 3MG1A 2ZBKB 2H5SA 3GLGB 5AI1A 4KFEA 1LLBA 4LZIA 4LGQA 1UUWB 4FH4A 2C96A 2VGKA 3ITBA 4OPZA 2Y74A 4JLFA 4IJFA 1O7PB 1VDDA 3Q8XA 1IN7A 3HIGA 3TE6A 3M7GA 4FR9A 2PU2A 1US1A 1TUHA 1QJGA 4P6BA 4MLLA 2OOVA 3UJMA 3UPNA 4L8PA 2YFJB 1ZO2A 1S5AA 2WGVA 2JQ5A 3W4PA 4GOGA 3WRZA 4ID4A 3P09A 2IMJA 3LOYA 2QMIA 2Z7JA 3GO8A 2GDNA 3X3ZA 3LZAA 1GD3A 4FMCA 2YQZA 1XKZA 3GZRA 3F8XA 2DRWA 3NIAA 1UM8A 2F5QA 5A91A 4NOOB 1QAKA 3ZVWA 4N6NB 4Q53A 1EA2A 1Z59A 5FQ9A 1XWIA 2R4JA 2XD1A 1NZUA 2ZLYA 1NJGA 2F98A 1R7RA 4N92A 1DGHA 3AKZA 1BULA 5JYPA 3X40A 1YJW3 3THGA 1VQ73 1KDSA 2VIIA 1QMEA 3SAWA 4HVNA 7CATA 4GB7A 1IN6A 4GHLA 1KSIA 1K57C 2KCDA 5I97A 1KSFX 4FCFA 2Y2NA 3MZFA 4DXBA 3NBIA 5M19A 2B1XB 3N6IA 3VK7A 4JI7M 1SHVA 1H6UA 1IY1A 4GN2A 2GEXA 4DR3M 3LT9A 4R0QA 1Q7Y4 3W4OA 3ZC7B 3WS1A 1FGTA 2CV1A 1KVMA 4LV3A 4GB5A 3PXMA 2Y4AA 4II7A 5F1FA 2ZQ7A 4JF6A 5GHZA 3CCV3 1NNJA 2OWPA 1RN7A 3LYGA 3CCJ3 5M18A 2ERCA 3E99A 1BLHA 3K7CA 1NU3A 4LZJA 2DCFA 3DZDA 1BUEA 4RNYA 1NXYA 4QB8A 3CG5A 3A3IA 4GKUA 4NRVA 2HDUA 3EC9A 4FCJA 3IF6A 2KA6B 3E2KA 3RDEA 1Z6TA 3DGMA 3T0UA 1IN4A 4ORLA 1K55A 5HAIA 1R2ZA 1GCEA 3HLBA 3GLHB 3DA1A 3IXBA 3D4FA 5IT9S 3MYTA 2QBYA 2IWDA 3KW6A 5CHUA 1SJWA 1K6SA 2IUKA 5IG4A 1O7WB 3K0ZA 2Z3XA 3IF6B 4E3LA 3SASA 4K90B 3U97A 1XP4A 1W2ZA 4KZ9A 1NSFA 3GPUA 3IT9A 1PZOA 4BENA 3HK4A 4NSRA 1E9SA 2E5LM 5EVIB 1BLSA 3HLEA 2HL7A 4N1XA 1ULIB 2ZMAA 1PIOA 5IERA 4LFBM 3ISGA 1IBLM 3U60B 3CF0A 5EE8A 1NZOA 4BTWA 5E2GA 4XBXA 4Y7PA 4FWHA 2ZQAA 3MJ5A 4PDGA 4WWUC 1O7HB 3PBSA 3GRYA 3QAUA 3CNXA 1EQKA 3BFGA 4B7FA 2EFUA 2R9XA 4GRIA 2ZQDA 4O3VA 2WGIA 3G4PA 4DE2A 2I7PA 3DGNA 4LSOA 1N78A 1C7HA 3KDSE 1I5QA 1FR6A 1IYPA 5EVLA 3Q7ZA 1SXJB 1VQM3 3H3HA 2OOVC 4XBYA 4QHSA 3JR5A 3O3VA 5ELUA 3NCKA 2F4VM 3A3DA 1K41A 4LCLA 2XQZA 3OPRA 5DF9A 4IEDA 4I8OA 3FTEA 4FD8A 2KEBA 1A2VA 5U47A 1SDEA 1W79A 5FTJA 4JXSA 2I9WA 1IDPA 1K9M4 4WMCA 2ZANA 3F40A 1OMEA 1QVG2 3VP0A 1G6AA 1HQCA 5E26A 4QY5A 2C99A 1QMFA 1E3RA 1YJ93 3FYCA 1GHPA 3BFEA 4B3RM 1VQ43 3QHYA 2BNKA 3UMMA 2XK1A 5LMNM 2CWTA 4S2OA 2K47A 3NDGA 3A42A 3KFQC 4JI5M 5LC7A 1YI23 3IH8A 1K6RA 3GLFB 5HAQA 3GRVA 3GRRA 3AL0C 3KSED 3PYJA 3DZLA 3RGPA 1FGMA 1DJCA 1H8ZA 3CC43 2EA0A 3KSXA 3FCSB 1K56D 3KFUG 2IWBA 1NWWA 1RRHA 1Z6FA 4PCZA 2YR0A 1E9RA 5FATA 4OQHA 5DYGA 5FTMA 3LQRA 1TH3A 4PM6A 4OW0A 3U6SA 3G32A 5TR7A 1W02A 1ALQA 3C5AA 4BBAA 3GRDA 3MG2A 3AJIB 4Z6YA 3WS5A 2L6OA 3NBRA 3U61A 5E43A 1YLYA 2WOHA 2JDIH 1CI9A 2ZM8A 3BFFA 3X3YA 3FKEA 5AYSC 4K0XA 1MWSA 2V6ZM 3L27A 4G4QA 4JPMA 1KE0A 4JF5A 3I51A 2XLJA 1ZAEA 4X6TA 2B5RA 3CC23 1E4DA 2D7EA 3L28A 1HU9A 3I563 4OLGA 3VFFA 1NVMA 3G0KA 1Z5CA 1CQSA 4WZ4A 2BNGA 1W7CA 1KC84 3GQ5A 2H0YA 1BT5A 2WZXA 4QU3A 4N6OB 4AKHA 1NJI4 3KE7A 3AFHA 4DUYM 4R9LA 4PMAA 4OOLA 3GLIB 4H8RA 5JPPA 3O87A 3WS0A 1EG9B 3HBRA 3V98A 3KP0E 2CFOA 4MGKE 1RJOA 1IKGA 1IU7A 1OJLA 3KKGA 3PBRA 4KLNA 2I7NA 5EXXA 2R18A 1L2DA 3UB1A 1K82A 2W56A 1W4NA 1IQYA 4I4KA 1HD8A 5KMWA 4FCTA 2FFYA 3GPPA 3PBQA 1KDWA 1PI5A 2W82A 4R23A 4R4RA 3JUQA 4R3DA 4O02B 5FAPA 4R4KA 4LY6A 5HFOA 3ZNTA 1HZOA 4IBEA