2XH9A

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
420
Chain Sequence
VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGASPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 139
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xh9A03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xh9A01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xh9A02
4WMCD 5CTNA 4EBNA 1GA0A 1FQGA 4PMAA 2WZZA 4R1GA 1E25A 5F82A 2ZQCA 2DNSA 3VOYA 3W8KA 4BD1A 1NJ4A 1CI9A 2ZC7A 4ZJ2A 4NETA 1ZG4A 4WZ5C 1PWGA 1W79A 2WKEA 4LV1A 4DXCA 3BLSA 4GZBA 4E3JA 5HW3A 3Q1FA 3BRMA 4OPYA 3HLGA 4JF6A 4YFMA 3ZHHA 3C5AA 3BFCA 4IVIA 2XD5A 3FZCA 4LV2A 3AGEA 3V3SA 1EWZA 1KVMA 3IF6C 1BLCA 3IXBA 1FCNA 3M2JA 4N9KA 5A90A 1C3BA 3ZFZA 2H0YA 3PBOA 5A93A 1L0EA 3E2KA 3P09A 5E2GA 3VOZA 1G6AA 1YQSA 3IH9A 5FI7A 1E3UD 2OSUA 2ZMAA 3G30A 3ZVWA 5KMWA 4Y0OA 1FCOA 3N8SA 1JVJA 2XDMA 3BFDA 3VP1A 3S4XA 1KGEA 1WYCA 5M18A 1SKFA 4WYYA 3UDFA 3NIAA 4FH2A 4LCMA 3QNCA 3GV9A 4OH0A 2V20A 1IEMA 5CGSA 3UPNA 4JPMA 3HLDA 3UDIA 1H5XA 4E3NA 3HUNA 2EX2A 1JWVA 1MWRA 1YM1A 1YLJA 3NCKA 3IXHA 4CPKA 1K6SA 2ZM8A 1MXOA 3G35A 1M40A 4GD6A 4X69A 2WAFA 3PBRA 1LLBA 5FAPA 5EVIC 3UPOA 3FV7A 4MBHA 1NYMA 3SH8A 1ES2A 1PW8A 4K91A 3PBSA 5CECA 3ITBA 1IYSA 4JLFA 1IYQA 3OPLA 1KE4A 3LCEA 2HP6A 1LL5A 4BQMA 3BEBA 4DDYA 5FASA 3IF6B 3VSLA 2QZ6A 2Y2MA 1JWZA 1YMXA 1Q2PA 3BLMA 4GB7A 4LV0A 5FQ9A 4N9LA 1JTGA 1PIOA 3LO7A 3TOIA 3CZDA 1PWDA 1VQQA 5CHUA 3PAGA 5E2EA 3V50A 1K55C 4MLLA 1K38A 3TSGA 2XFSA 2VGJA 3VFHA 2Y2QA 5M19A 1K57A 4A5RA 2JC7A 4X53A 2FFFB 1E3UA 1ONHA 4M3KA 3C7UA 1XKZA 4KZ4A 4MNRA 4KZBA 1ES3A 1Y54A 5KSHA 3SS4A 4E6WA 1RP5A 2Z2LB 2VGKA 2ZLYA 3AGFA 1Z6FA 2Y2PA 4KQRA 1HVBA 3B3XA 2DCFA 4R3JA 1FCMA 1N4OA 4X55A 2P9VA 3IXDA 4S2MA 5FQJA 1YLTA 1YMSA 5FQMA 4U0XA 5FI6A 4JKTA 4BL2A 2WZXA 1CI8A 3A3FA 2P74A 4B4ZA 3ITAA 1ES5A 1ONGA 2EFXA 2V1ZA 3MBZA 4S2OA 5E43A 3M2KA 4EUZA 5FSRA 4ZTKA 1MWTA 1XGIA 2XLNA 2RCXA 3Q81A 2Q9NA 3QHYA 4KZ5A 5HX9A 3A3DA 3A3IA 3PBTA 1I2WA 4U0TA 2ZC4B 3AGDA 4S2NC 3RJUA 4KZ6A 2RL3A 3N7WA 2QPNA 4K0XA 3ZG8B 5EUAA 4BLMA 4BJPA 1TVFA 4OLGA 1YLYA 4GDBA 2V2FF 3IXGA 4QY6A 2ZQ8A 5FAOA 5EOEA 2WGWA 2WKIA 3IWIA 3WS1A 2QMIA 1JWPA 4FCFA 4R3BA 1K57C 4IEDA 3JYIA 3OCNA 5CERA 3HREA 1TEMA 1LI0A 5BOHA 4WBGA 2C5WB 3NDGA 1IELA 1K54A 4GD8A 3I7JA 5AQBA 2X01A 3UPPA 3WRZA 3DWKA 2Y2LA 3LEZA 1KVLA 5CGWA 2UWXA 1W8YA 1H8ZA 4UA7A 3BFGA 4Y7PA 4R0QA 3UE3A 2A3UA 2Y4AA 3BFEA 5CXWA 2EX8A 2H0TA 4OPQA 1FR1A 4HEFA 4S2KA 4WELA 5GL9A 1PYYA 3NBLA 2Y2JA 5CHJA 5CTMA 1BLHA 1XGJA 4OOYA 5FQIA 5G18A 5GHZA 3M6HA 4E3IA 2XH9A 2ZC5B 5CRFA 5CGXA 3GTCA 2CC1A 1ERQA 1FOFA 1ZG6A 4QD4A 3LY4A 4R4SA 3UE1A 2HPBA 3O86A 3OPRA 1CEGA 4S2JA 1S0WA 3N8RA 5M1AA 4DKIA 2WGIA 2HP9A 5D3OA 3HBRA 4OVDA 3UY6A 1YLPA 3QNBA 3FYZA 1XA7A 2JCHA 4PM5A 2Y2IA 1ESIA 1HD8A 1RGYA 4PM7A 4WEKA 3FKWA 3VFFA 4Q8IA 4QY5A 1K6RA 3N6IA 4IVKA 3C4PA 5L2FA 5IHVA 3WRTA 4JBFA 1ZC2A 1K4EA 5A91A 3LY3A 4MBFA 3UN7A 4IBXA 2R9XA 2WADA 3FKVA 3HLWA 3HLEA 2G2UA 3MZFA 2DRWA 4ID4A 3G4PA 2P9VB 3IWQA 5GLCA 4OOMA 3ZCZA 3GRJA 3IF5A 1M6KA 3MKEA 1L0DA 4DE2A 2ZQ7A 3DWZA 5KZHA 1LL9A 4E3LA 3OPPA 4JF4A 5GLDA 4KG2A 3D4FA 1MBLA 2ZC3B 1YT4A 3MXRA 4HBTA 4RX3A 3BM6A 3SS3A 1NRFA 1XX2A 1TDLA 1RGZA 3HVFA 4KG5A 3UO9A 1KGGA 1DJAA 1OMEA 3Q07A 1EROA 3ZG5A 1GHIA 3A3JA 4UA9A 5TGFA 3ZVTA 4F94A 1K4FA 2C6WB 1DY6A 2Y2NA 1S6RA 2I72A 2Y59A 4EQIA 1NZOA 2XR0A 1PW1A 2Y55A 4K0WA 4N1HA 5FQKA 1L0FA 1PZPA 4KQOA 2OV5A 3G31A 1K56A 4KZ3A 4B4XA 1BTLA 3VP3A 3ZNYA 4KZ8A 2WGWB 4DE1A 4KZ7A 1KGFA 4EBPA 3GMWA 2GDNA 5DVAA 3ZGAB 3O3VA 1J9MA 2HP5A 4HESA 1IYOA 4N1XA 1I5QA 1VM1A 4RA7A 3BYDA 5FAQA 3IT9A 5DF7A 1W7FA 4OKPA 4DDSA 5F1FA 2ZJ9A 5AQAA 5F1GA 1TDGA 2EX9A 3G32A 2E8IA 5FDHA 1AXBA 4C3QA 4E6XA 2R9WA 5F83A 1BLSA 1WYBA 2Y2GA 4RVAA 4OLDA 2OLUA 3GSGA 3HLBA 3Q7VA 1WE4A 1PI4A 2XEPA 2Q9MA 4BL3A 2HDUA 5I94A 3HLFA 2ZQDA 1Q2QA 3OC2A 2WK0A 3SH9A 3HUMA 4ZJ1A 3ZDJA 1CK3A 5AQ9A 3NC8A 4KQQA 4XXRA 4QU3A 5EVLA 3VSKA 1NZUA 4WEJA 4JXGA 1KE3A 3PBNA 4OPRA 3ZG0A 4ZDXA 3O88A 1QMFA 1XA1A 4X68A 4Z9QA 5FATA 4B88A 5HL1A 1YLWA 2ZM0A 4DE0A 1BT5A 1SHVA 1W8QA 2OLVA 2B5RA 4KZ9A 5GHXA 1BULA 1IKGA 5GLBA 2XQZA 1EI5A 4RX2A 4NK3A 3C7VA 5HFOA 5DTTA 1MPLA 2WYXA 1U60A 1ESUA 3C4OA 5FI2A 3ZG7B 2XD1A 3RXWA 5A92A 1L0GA 4KG6A 2J7VA 3CMZA 2X02A 5GLAA 3BECA 1ALQA 2X71A 4LCLA 1ZKJA 3NI9A 5TR7A 2ZC6B 3FWLA 4ZJ3A 1HZOA 4PPRA 2J8YA 4EBLA 4FSFA 3O87A 5CHMA 1GHMA 1O07A 2XK1A 1NXYA 3DW0A 3VP2A 5EVIA 2IWBA 1YLZA 4E3OA 2G2WA 5TFQA 3CG5A 2Y2HA 4OP5A 1KDSA 3W4OA 5EECA 3PBQA 2PU4A 2Z2MB 4GOGA 1K56D 1ERMA 5CEBA 4PM9A 1BUEA 4OQHA 3NDEA 4FH4A 1KE0A 1XPBA 3OPHA 5FQQA 1CEFA 1L2SA 1MWUA 3VP0A 3V5MA 1MKIA 4U3TA 4UA6A 5KSCA 1XP4A 3WWXA 3NY4A 3EQVA 4XUXA 3N4IA 1K55A 3G2YA 1PI5A 1SCWA 4BENA 3WS4A 5HAIA 5DTSA 4QHCA 5JYOA 1N9BA 2HDQA 1NY0A 3DTMA 4GN2A 2A49A 4OONA 3RXXA 2WGVA 4MBKA 4RYEA 4L0LA 4GNUA 2IWDA 4P0MA 1SDEA 4D2OA 3EQUA 1RCJA 4X6TA 1K54C 2HDRA 5CEDA 5EPHA 3ZG9B 2Y2KA 3IHBA 4LV3A 4KENB 3BFFA 4YINA 5J8XA 2IWCA 4PM8A 2Y91A 1BSGA 4OQGA 4S2LA 2HDSA 4UAAA 3P98A 4JXVA 3G2ZA 4C6YA 5U47A 2J9PA 1G68A 2ZM2A 3GR2A 1XXMA 3MFDA 3V39A 3E2LA 1O7EA 3Q7ZA 4C75A 4QJGA 4WMCA 3TG9A 4GDNA 1ES4A 4ZBEA 4EV4A 3W4PA 3HL9A 1LHYA 3Q7VB 3IH8A 3UE0A 2XF3A 3S1YA 3VP4A 4WZ4A 2BG1A 3SS5A 4PM6A 4S2NA 2XGNA 1PZOA 2WKHA 5DF9A 5EE8A 3VMAA 4OQIA 5GHYA 3GVBA 4EWFA 1GCEA 3M6BA 3OCLA 4R4RA 4UHUA 4DE3A 1QMEA 3Q82A 1IYPA 4P87A 3WS5A 2ZQ9A 4S2PA 4S2IA 3MZDA 1FSYA 4OPZA 2EX6A 3IWOA 4P85A 3ZNTA 3PTEA 4OP8A 4DXBA 1HTZA 4GKUA 4DF6A 3G34A 3ISGA 1GA9A 3HUOA 4R23A 1BZAA 1H8YA 1FSWA 4XUZA 5AQ7A 4CJNA 5EVID 4FD8A 4JF5A 4JXWA 3N8LA 3V3RA 1W5DA 3A3EA 4N92A 1DJCA 4WZ5A 3WS0A 1JTDA 2J9OA 2WUQA 2JE5A 1NYYA 4BD0A 3IHAA 2EFUA 3S22A 2FFYA 5HAQA 4KZAA 4Y0TA 1BLPA 3UDXA 5DF8A 5EOOA 3MZEA 4ZAMA 2JBFA 3IF6A 4QB8A 3SOIA 2ZD8A 5DTKA 4MEZA 4X56A 5HAPA 2EXAA 3OZHA 4OOLA 5JYPA 3MKFA 2PBYA 5EVIB 3CJMA 1KDWA 1DJBA 2EXBA 4HBUA 1SDNA 4JXSA 4H8RA 3MXSA 4OQ0A 1MWSA 4P6BA 2XFTA 4IBRA 3PAEA 4E3KA 3UNWA 4E3MA 3W4QA 1FR6A 3HLCA 4WM9A 4Y0UA 2PU2A 4LENA 1K25A 3GQZA 4O7DA 2Y2OA 3SH7A 1GHPA 5E2FA 3IQAA 3WS2A 5FA7A 1MY8A 1LI9A 1PWCA 2H10A 4DRTA 2H5SA 5HARA 2ZQAA 1I2SA 2WAEA 5E2HA 1E4DA 2BLSA 1IKIA
chains in the Genus database with same CATH superfamily
1B3SA 2ZANA 3X3XA 1GA0A 2GZAA 5IU1A 2PZVA 4L8OA 1IY1A 2IYJA 3HZJA 4R1GA 5EVEA 4BD1A 5C1BA 3TL4X 1BUQA 3LTAA 2UUCM 5L09A 4I81A 2L4VA 1GABA 1ZG4A 4DXCA 4E3JA 5HW3A 1PJSA 2C98A 4JF6A 2LXEA 3VFDA 2XZUA 1JNQA 1QAKA 4IPBA 1R7RA 4RBNA 1JKGA 1IQYA 1LSWA 1YPRA 4IVIA 3E4PA 3FZCA 5F6AA 3V3SA 3GLHB 3BQ8A 5EM0A 1D6ZA 1BLCA 4BU4A 5AYRB 4AKYA 4IIWA 2WOHA 2HL7A 3MYTA 4N9KA 2D01A 1C3BA 3FG8A 3T38A 5A93A 3PBOA 1L0EA 1YSQA 2AVXA 4L9GA 1UDII 3P09A 5E2GA 5AVFA 3CC23 3MF0A 1DYUA 1LOYA 3EQQB 5I97A 3G30A 3SARA 3SX1A 5KMWA 1S4SA 1JVJA 4G4RA 5L8RF 5FLXS 2CHVA 2JKRM 2Z3XA 1BRGA 2XSOB 3Q1CA 1SKFA 2B18A 3TPZA 3SXXA 3LMMA 4HVNA 5EEOA 2CK3H 2XSHB 4FH2A 4LCMA 5JI3E 1BRNL 1DGFA 1RNBA 3PVSA 3FCSB 1WMOA 1YIJ3 1F9IA 1IEMA 3GV9A 4ZRRA 2K7SA 4NXBA 1R5LA 2JN7A 3HLDA 3BOSA 3UDIA 4N6UA 1WR1B 1H5XA 1JWVA 2B3TA 2CX0A 3NCKA 4X1LA 4CPKA 2P05A 1O7MB 2LH0A 1QVF2 2XZFA 1MXOA 1Y28A 1SXJB 5HZHA 3U6MA 2WAFA 3FG1A 4N6LA 3CCL3 3PBRA 1LLBA 3HIIA 1G8PA 1HJPA 4IUKA 1RGKA 1NYMA 2W0NA 3BBZA 3PBSA 2KRTA 1N77A 3OTOM 3R4KA 2IMJA 3KSJA 2OOBA 4J9AA 5AIHA 2LVAA 5IERA 3AMOA 5FASA 6GSPA 3IMAB 1PM5A 3IF6B 4DJ2A 4LV0A 4BWIA 1SJWA 4FCVA 4HM4B 4D82A 3TOIA 5FW5A 3A76A 3CZDA 5HWWA 4K1UA 1M1K4 1Z09A 3JVUA 5CHUA 3EF8A 2W82A 2VLGA 3TWMA 5CX7A 2V1CA 2K31A 1K38A 5FDSA 2XFSA 2VGJA 1WTHA 5F5YA 1W6GA 3RFWA 2C9CA 1N9LA 1IFYA 2JC7A 4X53A 3FKAA 2GNOA 1ONHA 1D6UA 5KSHA 4MNRA 1ES3A 4G3WA 3KSFA 2VGKA 2R0IA 1DGGA 3QWLA 5IEOA 4EXRA 3KW6A 2W0QA 1OTDA 3B3XA 2DCFA 4R3JA 1FCMA 5J4EA 3B4PA 1N4OA 2CRUA 4X65M 4J5KA 1YLTA 3NOPC 1H0MA 3CCS3 3SYKA 4FR9A 5AIIA 4KO8A 3A3FA 2JKRI 2KDKA 1I3IA 5JPPA 3T1SA 2ZBKB 1NLZA 1ES5A 1TF0B 3MBZA 4S2OA 4J8TA 5E43A 1JB4A 1IN5A 5KIZA 4B7HA 1AUAA 3BXWA 2XLNA 3Q81A 5D81A 3QHYA 4K61A 4KZ5A 3AKZA 3T4LA 1G4AE 1DVDA 4LFBM 1B2UA 3VDUA 3A3IA 5HX9A 2P0XA 3GLIE 1ASKA 4EW5A 3RJUA 4KZ6A 3S7QA 3N7WA 3V98A 2VEAA 3K1JA 1BOXA 3CF2A 3EIEA 5BVBA 3JAMS 4HP4A 1RSNA 4LGQA 5K5BA 1HR0M 2L7IA 4STDA 2VGLM 3C58A 1E9RA 3L28A 2UU9M 1ZS7A 3T1QB 3PCSA 4L8PA 2ZL1A 5EOEA 3H4JA 3WS1A 4BBAA 1YAXA 1TFKA 2QMIA 2CH9A 4M0DA 4PEJA 1UCIA 3GLFB 1GJTA 3CC73 1HKXA 3N8BA 1N75A 1IXSA 4FCTA 3AHSA 3BNDA 3L25A 3RDEA 4WBGA 5EM1A 1VEGA 3F8XA 5AQBA 3GZXB 1X1XA 4I3AA 1S3SA 5KO3A 2DXIA 1B2SA 5CGWA 5EVHA 5JPUA 1RCKA 5LC7A 3HU1A 5STDA 1OT6A 3D4AA 4R0QA 5CXWA 2DAMA 5I5LA 1N32M 4OPQA 4XM4A 3W0LB 3SHGB 4K08A 3VK8A 3FTEA 2EO2A 4WELA 5DKLA 5FSWA 1D2NA 2M60A 3GRYA 2O01F 1BLHA 4LPZA 4OOYA 4PT5A 3M6HA 5E6JA 1VQ1A 2W6JH 2QPAA 3R9XB 3K2LA 2AADA 4I3IA 4R4SA 1I3FA 4B9OA 3UE1A 4X2OA 1Z59A 2K2NA 4HQAA 4O02B 4RF1A 2Z76A 2ZL8A 1S0WA 3LICA 4HEOA 3B89A 3UY6A 3GLGB 2HP9A 4OVDA 5L07A 3LIDA 1QAOA 5ITUA 3J80S 4PM5A 4GC9A 4PM7A 1L5GB 2HKJA 2HV1A 4Q8IA 2B1XB 4QY5A 3I01M 2JY5A 3D8LA 4JXJA 2C4BA 1L1TA 3FD9A 1HYFA 3D5IA 5IHVA 4NXFA 2DAGA 1N33M 4N6TA 2WADA 3HLWA 1IN7A 3LUQA 3IX3A 1UWNX 1I94M 4NXEA 1H8MA 2HJEA 1HNWM 3QYBA 2XRXB 3IWQA 5GLCA 3FUVA 2V1UA 4QWOA 4OOMA 4II7A 2F4VM 3GZBA 3GRJA 3N9HA 1L0DA 4DE2A 3CXC2 2ZQ7A 2PNCA 2VQFM 3DWZA 3WHLA 2Q07A 4GRIA 5KP1A 1LL9A 4P16A 3OPPA 3P7NA 3D4FA 4KG2A 1D7EA 2BMQB 1S723 2ZC3B 1YT4A 4HBTA 1NRFA 3HWSA 2P0MA 4Y17A 5DJUA 1KGGA 3Q07A 1EROA 3ZG5A 5DFLA 3SVAA 5TGFA 3UB5P 3OV4A 4NREA 4N6NB 1GLNA 3KE7A 1GSWA 1NZOA 2XR0A 5FQKA 1NSFA 3NV0A 4JGPA 1L0FA 5DYIA 4X2HA 3E21A 3NBJA 1YGWA 3MKIA 5IENA 1K56A 4B4XA 1L3LA 1BTLA 4KZ8A 4DE1A 4FVMA 3GMWA 1BRIA 1XMQM 1XXHA 4LFAM 3U6LA 1OIPA 1IYOA 1TS8A 2O9AA 3BYDA 2R4IA 5DF7A 3D72A 3U6SA 1EG9B 2EX9A 3VDPA 1G96A 1AXBA 3HX3A 3HHZA 3W2ZA 3UL5A 1DMMA 4G6ZA 3LW5F 2OLUA 3GSGA 1FGQA 2SBLA 1NLYA 2KZSA 2XEPA 2IUJA 4BL3A 3L26A 3HK4A 1OF5B 1RHLA 1LOXA 2WK0A 3B9PA 3HUMA 3D8BA 3WA2X 2A15A 2APLA 4NOOB 1BUJA 1SKOA 5IG0A 4DR5M 1K3WA 4KQQA 3KO6A 2B02A 2NUTC 2LHGA 4WEJA 3AOGA 2W04A 1VEUB 2CG0A 3FH1A 3ZG0A 1KE3A 2E2UA 3GLIA 3CCV3 4IJEA 5IF6A 2V8FA 3FKEA 2K3DA 1QMFA 4Z9QA 1TR8A 2QSFX 3KZTA 5JBSA 5DYGA 3K2NA 1YE9A 1DMQA 5CK6A 3VF1A 4ARZA 4NRVA 2K47A 3UZUA 1PU4A 4WN5A 4O8SA 2B5RA 4KZ9A 4DE0A 3UE6A 5GLBA 4RX2A 1X1WA 5HFOA 1IBMM 4M9SA 1NV8A 3C4OA 5FI2A 1OJ5A 3ZG7B 2ERCA 3BNCA 4NXNM 4RNYA 5GLAA 2OCTA 2B95A 1BVSA 3WOFB 3GQ4A 3UNLA 3O87A 3WHKA 1QVRA 3DW0A 1YLZA 3HI7A 2W1TB 2QGUA 5EQTA 5FTJA 3CG5A 2OQ4A 3T4OA 4IJFA 1AY7A 4OP5A 3FTFA 4R80A 1R4CA 2UXDM 1BIRA 3X3ZA 2VKSA 2JY7A 2Z2MB 1FGTA 3VV4A 4RQ9A 2OTJ3 5CEBA 2K0MA 1WQLB 3LT9A 1K0KA 2HMJB 3UB6A 1BNSA 4HM2B 3GPUA 2CFDA 4U3TA 4UA6A 3I04M 1Y8GA 1XP4A 2KHHA 3FE3A 3NJAA 2L4EA 1NJGA 4JI6M 1QMAA 2M7VA 4BENA 4IIAA 1Q40B 5DREA 3WS4A 2INWA 5IT9S 1NO3A 3D79A 5DTSA 5JYOA 1IXRC 2QHOB 4GN2A 1SXJD 1BVIA 4MBKA 3S67A 4P0MA 1Q3CA 4AG5A 4AG6A 1WGLA 2CMNA 4XGIA 3LXUX 2OOLA 2CHGA 1JBSA 1ZHHB 4JI7M 3ZG9B 3SOAA 5J8XA 3BFFA 3DM8A 1VQM3 4YINA 2MF7A 3LMLA 1GOUA 3MXQA 4OQGA 4DBGB 4FCJA 5EV0A 1MN3A 3GPXA 3CMA3 3X41A 1PY3A 2VF7A 2DWMA 3NECA 1XXMA 4HOIA 2PAVP 3QP1A 4QJGA 1Q9EA 3Q7ZA 2CWBA 4MCWA 4KLNA 1WHCA 4KQDA 1I4WA 3UB7A 3UE0A 1TF1A 3RGSA 3S1YA 1KWIA 2KNZA 4PM6A 1PZOA 2WKHA 5EE8A 3VMAA 2KXEA 1G5UA 3AGNA 4YHHM 3V92A 2FH5A 4JI2M 3MWZA 3GVBA 4OQIA 1GCEA 4NKPA 4DE3A 1IYPA 4P87A 4G3KA 3CME3 3MZDA 3CCR3 3F1OA 1FSYA 2GQFA 4OPZA 4P85A 3ZNTA 1N5PA 1HTZA 1BANA 4R71A 4IJGA 2QJ5A 2PHYA 4LEHA 3LIFA 1QVG2 3HUOA 1B20A 3EWKA 3VLFB 3VOLA 3URPA 2V6ZM 2Z4RA 2O3OA 4XUZA 4WWUC 5HPFA 4JF5A 4JXWA 1OFIA 3A3EA 4R7GA 5TBMA 1B21A 4PD2A 1GMPA 4BD0A 1GS3A 3IHAA 2EFUA 3S22A 1GO5A 3H82B 2R62A 5L8MA 5DF8A 4ZAMA 3K9OA 2VDBB 3DZDA 1N8QA 4OOLA 1BU4A 2Z6DA 3R7WA 5EVIB 2R44A 4JYAM 1DJBA 1MGWA 2Z8YM 3MXSA 1MWSA 2QZ4A 1OJLA 3U6DA 4JI4M 3CC43 4G4QA 4GEWA 1FJGM 2KX6A 1DGHB 4WUJA 4LF9M 3EIHA 2PU2A 3LOYA 1K25A 5KQDA 1GHPA 4IHQA 2V0UA 3PNVA 3KCHA 3C8CA 1VQ93 1MY8A 4HM7B 4PKYG 3LR5A 3T15A 1JQJC 1S66L 3Q3FA 4G3OA 4F3LB 2J7OA 3BY8A 4KUKA 4PCZA 1OAOC 4D2OA 3T6PA 5CTNA 3ECFA 1FQGA 1NU3A 1XJ6A 5F82A 1E25A 3PXPA 2MJ6A 3CCE3 2ZC7A 1BNEA 1SXJC 1PJJA 3CCM3 1QUTA 2VV8A 4ZJ2A 4EEPA 1QAMA 1TDHA 2ZAMA 4LV1A 1E94E 4EETB 4MGZE 4OPYA 3CLOA 5IG5A 1FGMA 2CP8A 2Z7AA 3K0ZA 2WGOA 1MJGM 4B3TM 3SLUA 2M1CA 1IT8A 3AGEA 4LRTA 1KVMA 3IF6C 4GL6A 3CPTB 3DBAA 1SIIA 3M2JA 1HZ1A 4LJ4A 4FMBA 3TWLA 1V9YA 5AJGA 5EP2A 2W1RA 4LF5M 3E2KA 1HT1E 3AOEC 3VOZA 1G6AA 1TUHA 3KX0X 3FZWA 3GQ5A 4QHTA 1W4NA 3B8LA 1JBTA 1GSVA 1PGYA 3OBFA 4Y0OA 1FCOA 3BFDA 4KUOA 3NBXX 1OQYA 1KSIA 1N36M 3B7QA 3S4XA 1KGEA 1WYCA 3E0YA 3KIIA 3BJNA 3UDFA 3PYPA 4HOHA 2ZMVA 3H51A 4I39A 1LSVA 3U6QA 1XJ3A 1QJGA 5CGSA 1KYIA 2HAKA 4LSOA 1XFNA 4QWTA 4E3NA 2W9PA 1MWRA 6RNTA 1N78A 4D60A 1K6SA 1M40A 1Q7HA 3MHVC 2CWTA 1R2ZA 2IUKA 3SBJA 3C38A 3NHQA 2FGTA 1ES2A 1PW8A 4K91A 4HYZA 3ITBA 3KSIA 3OPLA 3MK6A 3LCEA 3V76A 1Q39A 1IY2A 1LL5A 3BEBA 2L4FA 1S67L 4OK0A 5FQ9A 1PJIA 5FEFA 5HGRA 3U6PA 1T43A 2DVWB 2EWWA 1PIOA 3LO7A 1IQ8A 4LG2A 4K1VA 3KSHA 3MJQA 2XSZD 5ITRA 1RNTA 5E2EA 1W7CA 3TE6A 3KYEA 5M19A 5J7EA 2OWJA 1L2CA 4A5RA 1E3UA 1UFZA 4JV5M 1LVNA 1RMSA 3T0UA 4KZBA 2BASA 4N6V0 2Z2LB 2Y2PA 2OO9A 1B2XA 3M8CA 1UM8A 2O9CA 3IXDA 1ZX2A 3J81S 2L1MA 1YJW3 1DVCA 2PYRA 5FQMA 3B7ZA 5FI6A 1RGLA 2CFGA 1HLUP 2L4RA 3SOYA 3QYEA 2CFKA 2Y20A 4CHTB 1GY7A 2B24B 7STDA 3ITAA 3SZTA 2EFXA 3CCU3 2Y8HA 1D0KA 3M2KA 1ZMUA 4LJ9A 3IJEB 1CEWI 4PDIA 4JN6A 2HHHM 3HZPA 2W9QA 2RCXA 4LF4M 4BIRA 4R6LA 2Q9NA 4B7GA 3CTWB 4Y3IA 1UI7A 3PBTA 1I2WA 3ZYTA 4MB7A 3U6CA 3S5CA 2ZC4B 1XHBA 3M6AA 1HT2E 3AGDA 1JKGB 1OTEA 2RL3A 5EUAA 4BLMA 1HQCA 3G4S3 2CKFB 1ZGXA 4O3VA 4QHSA 2J3WA 3C2WA 1W2ZA 4L7KA 3IXGA 2ZQ8A 3CF6E 1SG9A 1EFUB 2QCUA 3AFHA 2WGWA 4X64M 2KAAA 3FC7A 2RKOA 2A24A 1EUIC 4R3BA 1US1A 3F40A 1K57C 4IEDA 1YIT3 4H6JA 2NQ8C 1TEMA 3DGYA 1IBLM 5ITQA 4LF8M 3S7PA 1T5YA 5FTMA 4HM6B 4DJ3A 3FRHA 3NDGA 3LCVB 5GSPA 1WNHA 3UPPA 2P04A 3DWKA 3C9PA 4R9LA 4NC6A 1FNNA 1QZEA 1IV9A 1W6YA 1V58A 3EBTA 1QYRA 1H8ZA 4UA7A 2BNGA 4Y7PA 4DV2M 4HM0B 3EB8A 3JUPA 3GPPA 4AKZA 3BFEA 1FW7A 4BTXA 1Y4OA 4S2KA 5GL9A 4D80A 3NBLA 1ZQ9A 5ITXE 1R4GA 5G1LA 5GHZA 4E3IA 1NO1A 4IBBA 2O25A 2HMLB 2HPBA 2I9WA 4S2JA 5AIFA 3N8RA 1LV7A 4LMIA 4DKIA 1AWIA 2CUZA 4R3AA 4RZMA 5IT5A 4XDWA 4B08A 4WEKA 5TJJA 5FTNA 4DUYM 1WXQA 4IVKA 3UMDA 4KT3B 2DWLA 3I4YA 1QUSA 3WRTA 3HCYA 1ZC2A 5A91A 4HZBB 2QBYA 4MBFA 4IBXA 4JI5M 2GEYA 3HLEA 3KSGA 1OH0A 3HU3A 2W56A 4FD2A 3OOVA 2KF5A 3NXJA 3B7NA 3TQSA 1KQS2 2F98A 3MKEA 4GKKM 2KF3A 3G16A 3CCQ3 2SARA 3EJVA 4DUZM 3E9SA 5HWTA 1VDLA 1BNIA 4DR7M 4G4NA 1TS6A 5HL6A 2EUCA 3MXRA 4IT7A 5DFXA 5CF2A 1RGZA 3KOWE 1XXHE 3U97A 4F94A 4IBEA 1K4FA 2C6WB 3DA1A 2YNMD 3QP2A 2Y2NA 4NG2A 1JV2B 1T1BA 1ZAEA 3SMSA 3J27B 4K0WA 5LMUM 4N1HA 4JI0M 4BBTA 1CYVA 4XT2A 1VQ83 1PZPA 2W3EA 3QP4A 2J80A 2R18A 4NL4H 3G31A 4KZ3A 1DGBA 3GRDA 3LYGA 2ZL1B 4R1KA 4JGOA 4CCVA 1X0OA 2ZBBA 5H37D 4HHDA 4EBPA 3ZGAB 3O3VA 1MOLA 3KYZA 1J9MA 1N34M 2HP5A 2JXNA 2LNHC 3WHOA 4EUVA 1IXSB 1RGHA 3U6OA 2OTL3 4DDSA 2FS1A 3S28A 3HHWA 5F1FA 1UUVB 3BNEA 5F1GA 3VKGA 4C3QA 1SXJA 2OWHA 4LFUA 4LZJA 1BSBA 2BWBA 4ME4A 4OLDA 1OKSA 4WURA 5EXTA 4OVZA 1X1YA 2P09A 4QOZC 1CUKA 4MGHA 1PI4A 3KP1E 2EKKA 4IBJA 1GD4A 5I94A 1A2PA 3FRIA 1D0MA 3LT8A 3X40A 1T19A 4G4OA 3SH9A 4FUWA 7CATA 1ZO2A 1CK3A 1GD3A 2VGLS 5AQ9A 4XBOA 4NRWA 1V9ZA 1NJFA 4QU3A 2RNTA 1Q7Y4 3U2AA 4AEQA 1OT9A 1XJ2A 3AOEA 1N9EA 1DP8A 4OPRA 3DXOA 2YX9A 1XA1A 3O88A 2PDRA 4B88A 2HCBA 1KOUA 4XK8F 2H5XA 1SHVA 2XA7M 2V1BA 1EI5A 3B7CA 3TDGA 2W3HA 1NVMA 2WKPA 3CF0A 5KPTA 3H7WA 4NK3A 3HIGA 5DTTA 2WYXA 1JRQA 5A2QS 2KRKA 3EGDC 3T8NA 2WSFF 2XD1A 2DKLA 5A92A 3RTYA 3BECA 3MFXA 2X71A 2F99A 1BRSA 2GX5A 3NI9A 1RRHA 4I5SA 3JPUA 2ZC6B 1HZOA 2X49A 1RGAA 2J8YA 4EBLA 2QWSA 3UJMA 4FSFA 1O07A 2XK1A 3MJ5A 3VP2A 3SYLA 3U60A 4E3OA 4ETZA 1F98A 1VB6A 4EEUA 3LGOA 1YNVX 3LTBA 2PU4A 4GOGA 4H61A 1ERMA 1LXEA 5IZ7D 1K8A4 2FOIC 1BUEA 1NY6A 2KOIA 5EP3A 2PBDP 3MSOA 2XLJA 1OTBA 3NDEA 3OPHA 5FQQA 3A45A 1CEFA 2P08A 1KSFX 1OTAA 4IBGA 1T1CA 5KSCA 5ITXA 3WWXA 4LGWA 3BQAA 2KCDA 4CDLA 1EE8A 1P9WA 2V9AA 5IG3A 1PI5A 2HZ5A 3PHYA 1A5TA 4DV0M 4FWDA 2FNAA 1NY0A 3DTMA 2A49A 4R70A 3NV0B 4BBVA 1KFVA 5BPVA 2K9DA 1AVLA 3GLFA 4DR6M 4BTYA 3FYDA 1QAFA 4R38A 1GKIA 5A8BA 4X6TA 5HOHA 5C18A 3DMCA 1K54C 3CITA 1TS0A 1IV7A 4FCMA 4MMZB 1GMQA 5EPHA 4N6OB 4KENB 1BSAA 3K9MC 3A0SA 1JB5A 3SYUA 4LJ7A 1BSGA 1DV0A 4S2LA 2A5YB 3BLZA 2CFOA 2WGQA 3VKHA 1JZOA 5EXPA 2UUBM 2HMNB 3P98A 3GZYB 1LOVA 2J9PA 1MGRA 1G68A 3K7CA 3MFDA 3V39A 2QIYA 1O7EA 4C75A 2FNQA 3TG9A 1ES4A 3LH4A 1LNHA 2FZ0A 1J2BA 3W4PA 1K3XA 2XGLA 2VV6A 1AIPC 3EOIA 2MC8A 4AI6A 2XF3A 5G4ZA 3VP4A 1B2MA 3SS5A 2LVOC 4LF6M 2O5RA 2C11A 3LCUA 5GHYA 4EWFA 4B93A 3VGNA 3Q82A 1V74A 4S2IA 2RGQA 4HM8B 1DP9A 4O8GA 3LR3A 2KDLA 3C3EA 1RRLA 2VIIA 2LQVA 3GRRA 4OP8A 3GLIB 2H0IA 3NBBA 4HBRA 4HZ9B 2VV7A 3DTIA 3G34A 1GA9A 1BRHA 4R23A 4FW9A 1STFI 1H8YA 3VSYA 1FSWA 2W3GA 1E97A 2FXTA 4FMDA 2PT7A 1XC8A 4CJNA 4BBUA 5AI1A 2WOFA 2CG1A 3F9SA 3FUXA 1VQO3 2JY8A 3QRDA 2CWVA 2WUQA 7GSPA 3J7Yd 3NOTC 4JI8M 1CF0A 1QDRA 5EP4A 1JB0F 2CFLA 1W00A 5BR8M 2E2VA 4HJLB 2FFYA 2CEAA 3MR0A 4KZAA 4Y0TA 2OOVC 1S1YA 2DENA 3MZEA 3SOIA 2JBFA 4DV1M 2ZD8A 3TJZC 4CLCD 4NXGA 5EXXA 3MKFA 3CJMA 5AEUB 2EXBA 2J5YA 2D42A 4JXSA 3Q8GA 3SATA 1UUGB 1B27A 4H8RA 1VETA 4OQ0A 4Q0JA 1YUBA 2L7HA 3NBIA 1CQSA 2CIUA 1NNUC 3Q90A 1OPXA 2OAP1 2ZOHA 4P6BA 4E3KA 1IXZA 1AR0A 3HJKA 2HMKB 4TX4A 3HLCA 3LR4A 4K0KM 4LENA 3GQZA 2CWUA 4N6MA 1OTIA 2X4AA 5FA7A 3HJIA 2W2CA 1PWCA 3KFQC 5BXQA 5BU4A 1RDSA 3JUOA 1JB2A 1I2SA 2CX1A 2ZQAA 1K82A 5FL3A 3GWRA 1STZA 1R4YA 3GPYA 1Q2PA 2XSZA 4M4XA 4PMAA 2VJWA 2EJSA 2QQ8A 1CI9A 2P38A 1Q02A 1NJ4A 1RGFA 1DMNA 4WZ5C 2MROB 1PWGA 1W79A 2WKEA 3IX8A 4GZBA 2K6BA 3Q1FA 4F2LA 1O7GB 1L2BA 3KP0E 4F1IA 2BWEA 3U5ZA 2XD5A 2ZMFA 4LV2A 5F69A 4XBYA 1XFQA 2KZUA 1HNZM 1Z6TA 3VK7A 3T4KA 1K28A 3ZFZA 1ZTUA 2H0YA 2JY6B 2C99A 5DNYA 5JI2E 1ODVA 1WMPA 1T6OA 4EC6A 4L6V6 2JNHA 2UXCM 1YQSA 3IH9A 5FI7A 1VEKA 2YR0A 1VG5A 2F56A 2Y0TA 2BNKA 1V92A 3L27A 4MGYE 2JZ0A 3G8ZA 1NJI4 4LLOB 3ZVWA 3T1HM 2LVPC 5M18A 3F1OB 3J7AS 2H0HA 1P97A 1F5MA 3AGOA 3W68A 3S29A 3T8UA 2V20A 4OH0A 3HU2A 3CU3A 4GS9A 3E4QA 5MC7A 3F1PA 4LYLB 3NM2A 3I4VA 4ILFA 1TJDA 1YHQ3 1VQK3 4BB9A 1UWPX 2LB9A 4RKUF 1YM1A 2ZDJA 3OLOA 2ZM8A 1MNLA 5AIGA 2GU3A 4HM1B 4P6ZS 3F92A 2KNAA 4GSPA 5DFYA 1S5AA 4GD6A 3CPW2 4S12A 5IREB 4HP9A 5TBMB 5FAPA 3DGOA 3U61A 2RGOA 1UCKA 3F8HA 5CECA 1UGIA 1C7YA 4HJ6A 1IYSA 4JLFA 1OGXA 3IBRA 4LGYA 1KE4A 5AVEA 2HP6A 4UQIS 4BQMA 3WODG 4DDYA 3MQOA 4GB7A 1JJ22 1PRQA 3CWFA 3Q2PA 4ESPA 2C5RA 4MMYB 1GL6A 3NOUC 1OHOA 2PR5A 1TP6A 4CLCC 4MMNA 1W5TA 1OUNA 1GYBA 1K55C 3U6EA 2Y2QA 4GKJM 3LQRA 3OXAA 4A3VB 4RNTA 4M3KA 1NWZA 2F4YA 4E6WA 3SW1A 4IBDA 1RP5A 4K90B 1Z6FA 1HVBA 1RN4A 2L2DA 4U13A 4P17A 2HMOB 2P9VA 3D3LA 3JVVA 1YMSA 4U0XA 1HQYE 4NSRA 4JKTA 4Y13A 2J3TD 3IX4A 1UI8A 1CI8A 5DJTA 4M9XA 4LJ6A 3KFUG 2P74A 4GIPA 3F14A 5IW9A 4LRYC 4B4ZA 2QEX3 1FZUA 2V1ZA 4HJ3A 2PYPA 4EUZA 1KC84 5FSRA 1MWTA 1XGIA 2WO0A 1DO2A 3EGXC 4FCZA 4BTWA 4WYKA 2R6FA 3A3DA 4WF0A 4N3VA 3W0FA 3D5GA 1GY6A 1D6YA 4S2NC 3D3OA 4CISA 2XROA 3HGIA 2P5TA 3ZG8B 3MSHA 3B74A 3BWLA 3KSPA 1ZMVA 1KD14 4UEYA 4YOFA 2MJ5B 1IN6A 3EBYA 3NWLA 2GBXB 2V2FF 2Y74A 1DP6A 2XRNA 1TH2A 4JI1M 2DNAA 2D02A 5FAOA 1GL7A 2Y79A 1P3QQ 2JHEA 2KW0A 2LVQD 3HHXA 5J3WA 5HWVA 1Q824 6STDA 1JWPA 3FF2A 1YLAA 3IG5A 5CERA 3OCNA 3S7OA 2YKFA 1TGUA 4X66M 1TD5A 1K41A 2C5WB 2J7NA 2JKGA 3I0YA 1K54A 3NHXA 3I7JA 3QP6A 4PDGA 3F1NA 2X01A 3WRZA 1Q864 2Y2LA 3LEZA 4LZIA 1Y4KA 2C96A 1FGRA 1FYSA 2F86B 4X62M 1W8YA 1AV4A 2K54A 4I4KA 2L09A 4I5QA 1ZMWA 1OHPA 3W67A 2P7JA 1JN5B 2H0TA 4ZM8A 1FR1A 1J09A 1G6OA 2QHKA 2UUGC 5CTMA 2Y2JA 5CHJA 4GB5A 4GH9A 4CLCE 5FQIA 3C3DA 4IBCA 2XH9A 5CRFA 3B47A 1IDPA 3GTCA 2GNXA 1FOFA 1ZG6A 4QD4A 2W27A 3LY4A 1N9JA 1SARA 3O86A 1K734 3F7XA 5KP4A 2Z4SA 1K9M4 3MMPA 4AW4A 4DR1M 1CEGA 2KLIA 2F5PA 4AKGA 3RGAA 3H4MA 2WGIA 2BU4A 1G0TA 1VQL3 3HX8A 3G6E3 5D3OA 3QP8A 2G3QA 2VA0A 1UCLA 1YLPA 1IQPA 4Y28F 4KODA 2JCHA 4XBTA 2Y2IA 1ESIA 4BLCA 2X8AA 3IECA 1Z5AA 4EV5A 5IEPA 2UUAM 3L9KA 1IFQA 1SZVA 3N6IA 2BT3A 5L2FA 4LY6A 2E2TA 1HNXM 1QDTA 3UJNA 1K4EA 3KDSE 2QKPA 4GCZA 4MM3B 1RGEA 3CD63 2R9XA 3UN7A 1W02A 9RNTA 2G2UA 1CH0A 3MZFA 3UMMA 2DRWA 2JKTM 2MH8A 3G4PA 3FLJA 3ZCZA 3IF5A 3IS2A 1ULJB 3K3CA 3ZQ5A 1W01A 1GOVA 4WLAA 3MHEA 4EW7A 2R45A 3FPVA 3GP1A 5KPRA 2OOVA 4JF4A 5GLDA 1EW0A 2J3TC 4JF8A 4GW9A 4GHAA 3BM6A 1MX0A 3SS3A 1IN4A 1XX2A 1TDLA 4KG5A 3CPTA 3UO9A 4I38A 2E8JA 2DWZB 2BO9B 2OOAA 4HL4A 2KNVA 1A2VA 1GHIA 3A3JA 3ZVTA 1E3VA 2GXFA 4W5WA 4UN2B 2Y59A 1Q3BA 3Q8XA 5ITTA 2I72A 7RNTA 2D7GA 2LBCA 2FFJA 1TH4A 1PW1A 3ZCBB 2M7UA 2CV1A 1TRPA 3E4OA 3T4SA 3NQZA 1SXJE 2JA2A 3KOXE 1UUWB 2YKHA 4KQOA 2OV5A 1BYWA 5FGOA 1MU5A 3VP3A 2WGWB 4L15A 2A24B 2GDNA 5DVAA 3THGA 4L9FA 4HESA 4DR3M 3ZC7B 2UXBM 4H6JB 4N1XA 5IS1A 1VM1A 1WA9A 2Q2EB 2Z6BA 4DV7M 2H1RA 3FG4A 2BTFP 1AQZA 5FTLA 4LJAA 2ZJ9A 5AQAA 1TDGA 3MQQA 3G32A 1S1ZA 5CXOA 4E6XA 1RU3A 3WR2A 2R9WA 1BLSA 1WYBA 2Y2GA 5F83A 3S7NA 5IG4A 3HLBA 3BW6A 3Q7VA 3SMPA 2L0WA 1YKDA 2DI0A 3T1XA 4R9KA 3HLFA 3GZRA 1Q2QA 3OC2A 2JKTI 1SPUA 4Z6YA 4XBXA 2LVNC 2PD7A 3NC8A 4O2HA 3EE1A 5TGNA 4GJ4A 4HY8A 2EA0A 4Y2FA 4LRZE 3KXEC 4PHTA 2HF6A 3M0EA 1YI23 4ZDXA 4FWHA 3MG1A 4X68A 3LVWA 4WP2A 1BNJA 1YLWA 2ZM0A 4AZFA 3NULA 2H0GA 2EA9A 4GLQA 3PXMA 4O01A 1IN8A 1BT5A 5GHXA 3MPHA 3K63A 4OW0A 4FTXA 1BULA 1IKGA 1BNRA 2YFQA 2CV0A 4FOFA 3C7VA 4HM5B 1MPLA 2C9OA 2F5QA 1U60A 2GBWB 3LEQA 3L29A 3RH8B 1IVXA 1LRAA 3RXWA 5HPIA 1RLSA 1U5OA 2KF4A 3LZAA 4HKVB 3EN1B 3CMZA 3KSED 1RJOA 3BU4A 1ALQA 1I2GA 4LCLA 2QBYB 1X37A 3JUMA 1I8VA 3FWLA 4ZJ3A 4PPRA 4WHAA 1XNQM 2W03A 2W56B 5CHMA 1NXYA 2K0BX 2IWBA 5TFQA 2JDIH 3OWUA 5F68A 3AMOB 1BRJA 2DAIA 3E46A 3W4OA 4YWZA 3GLFE 1IT7A 3CNXA 5KQ8A 1XJ4A 5LMNM 3DY5A 1VDDA 4OQHA 4FH4A 2KXGA 5KP3A 1L2SA 3K3DA 3KOYE 4LJ8A 1J7KA 4CLCA 1W63Q 3HJ8A 3NY4A 1OFHA 1QANA 1K55A 3G2YA 4EV2A 1L1ZA 2Y73A 4QHCA 1BNGA 3CCJ3 1N9BA 1UCJA 4GHIA 1NNVA 4OONA 4AQYM 3RXXA 2WGVA 3A0VA 4I4LA 4RYEA 1OGZA 3DTKA 2IWDA 4XT2B 4MJDA 1SDEA 1RTUA 4X1MA 3EQUA 5ELJA 1DETA 1RCJA 3T1YM 2Y2KA 3IHBA 4LV3A 4NEED 1R6BX 1DRMA 3FUWA 2Y91A 1FUWA 3H3HA 1W5SA 4HH2A 2UGIA 2RGHA 3KN4A 3KYQA 4AFIA 2VF8A 1FIKA 4JXVA 1UGHI 5U47A 3BB9A 3F7SA 3GRVA 2ZM2A 3KOZE 2LTUA 3DFZA 1FUTA 3X42A 1TS7A 3E2LA 3P01A 2MGWA 3GLHA 3GLGE 1QAQA 1VZZA 2QNJA 1TDZA 3TRCA 2JUJA 3PNYA 4OVZB 1F8NA 1O7WB 3HL9A 2BJWA 3IH8A 3CNMA 3I553 2BG1A 4ZPXA 1I0VA 4S2NA 2XGNA 1OIZA 1PNEA 4KZ1A 1NHGC 3FTCA 3PR6A 1TRQA 4UHUA 2D1WA 2ZQ9A 3WDGB 4S2PA 2WSCF 1H3QA 3LIEA 3UMEA 1D0LA 3LQQA 5D83A 1MKMA 2EX6A 3IWOA 5G1KA 3AJIB 2M7OA 4GKUA 1YSPA 3I563 1L2DA 1YVBI 2D7HA 2HMMB 3G0KA 4I3JA 1BZAA 3HOHA 4YY3M 2KF6A 3ALAA 3CGWA 3KSXA 3RGRA 3FF0A 5EVID 4FD8A 3T12B 4EESA 5CF1A 1DE3A 3N8LA 4OX9M 3H7WB 2DZLA 3VE4A 2WSEF 3DAVA 3WS0A 2UV0E 4MMXB 1O7HB 2RCDA 2GJ3A 2Y21A 3EHCA 1GSXA 4I8OA 1N9OA 3U4LP 3E4RA 4NHFA 2JWSA 5HAQA 1M1XB 3EX9A 1ULIB 5EOOA 3IF6A 4QB8A 1O7NB 8CHOA 5DTKA 1PFLA 4MEZA 4X56A 1V33A 2EXAA 2V1AA 5JYPA 3U60B 2MR9A 1E9SA 3AHWA 4XB5A 1KDWA 2WZJA 1SDNA 4HBUA 3B33A 4WW0A 4D81A 1C7HA 1V34A 2XFTA 4IBRA 1XB2B 1SIHA 4IBIA 2C10A 1IU7A 3PAEA 3UNWA 1NB3I 3W4QA 4WM9A 1AVKA 3PXGA 3WMDA 4PAUA 2PRFA 4FMAA 1PJTA 4O7DA 2Y2OA 3LYXA 3LIAA 4MDZA 2XA7S 4J5GA 2YFLB 3IQAA 3WS2A 3HHYA 2LB5A 2VK3A 4CIZA 5HDDA 2CE7A 4IBFA 3CHWP 3HJSA 5E2HA 1E4DA 1M9GA 2F5NA 2BLSA 3CPOA 3GDIA 1IKIA 4WMCD 4EBNA 3VOYA 2WZZA 3W8KA 2ZQCA 2DNSA 3A46A 1I2EA 1P9RA 2CW9A 3G713 1G41A 4NETA 5AYSC 4DN0A 3BLSA 1BRKA 2GEXA 1JR3D 3BRMA 1BAOA 1X1UA 4OUQA 3HLGA 4YFMA 3ZHHA 1JNUA 3BIRA 3GAXA 2V8CA 3C5AA 4HH3A 3BFCA 3GSPA 5EJCA 3ZH9B 1D1JA 2CHCA 1EWZA 3T4TA 3ULFA 3FTDA 2L1SA 3LI8A 3IXBA 3ZQJA 3OWSA 1IM2A 2D7EA 3ER7A 1FCNA 3EN8A 5A90A 2R46A 2G8LA 3KS8A 4B3RM 5EQLA 4MGKE 1TTOA 4EXOA 4HNBA 4L9EA 1E3UD 2OSUA 1VQ63 2ZMAA 1G71A 3PCRA 2VX8A 3N8SA 4REZA 1LOWA 2XDMA 3VP1A 4G3VA 1G3IA 2PR6A 3PGBA 2ZAOA 2QENA 4WYYA 3NIAA 1VEJA 1BSEA 2CC3A 3QNCA 4LJ5A 1XXHB 2HOHA 3A5EA 3UPNA 4JPMA 1P0ZA 3HKPA 4ANRA 1IVUA 3WA3A 3D9YA 2EX2A 3HUNA 2Z77A 1IVWA 1YLJA 1IOUA 3IXHA 4L78A 2KRUA 1TTEA 3G35A 2GSPA 1OPYA 4X69A 2FE8A 4R3DA 3UPOA 3NM7A 5EVIC 3DGLA 3WOEB 3FV7A 3O5YA 4MBHA 3SH8A 2KA6B 1T2IA 3SHFA 5G4YA 1IYQA 2QJ7A 5L10A 3VSLA 2R41A 3DGNA 1JWZA 2JZ1A 4EYCA 1YMXA 2IY2A 2QZ6A 2Y2MA 3BLMA 4N9LA 1SKOB 3KS4A 2W3DA 2Z6CA 3IPTA 1JTGA 3GLGA 1VQQA 5BIRA 1PWDA 2O9UX 1VETB 2W3FA 4HJ4A 3PAGA 5HDCA 3FPWA 3SASA 5FEGA 3V50A 4MLLA 4AKHA 3TSGA 3VFHA 1W2B2 2EWVA 5AEWB 1CYUA 2YQZA 2VQEM 1QZMA 1K57A 4ARZB 4L4UA 1BNFA 4HM3B 2FFFB 4EERA 4FCWA 1RN1A 2DHYA 3IHPA 1T3BA 1XKZA 2HJ9C 2OAQ1 1Y54A 3C7UA 4KZ4A 3SS4A 3AGFA 3JR4A 2ZLYA 3FUUA 4KQRA 3QK9A 1T1AA 4X55A 1F4IA 2BIRA 4S2MA 2ACGA 5FQJA 5E26A 4RF0A 2AAEA 4BL2A 2WZXA 2NUPC 5CLKA 1Q42A 3UB9A 3OW22 2Q0OA 1ONGA 2YFJB 3STDA 4CGYB 4ZTKA 2R65A 1DO0A 2BMRB 4DR4M 2OWPA 8CATA 2CFWA 3L2AA 4U0TA 1W5ZA 3U5ZB 4K0XA 4FMCA 1NRJA 2QPNA 3VE3A 2UX0A 2KEBA 4BJPA 1TVFA 1A67A 4OLGA 1YLYA 3NUVA 4GDBA 4EQ1A 5HD5A 4ETXA 4QY6A 4H3UA 8RNTA 4L8RC 2RBIA 3FSDA 1N9NA 3D9RA 1T3TA 1XNRM 4OVMA 1B2ZA 1M904 2WKIA 3IWIA 1VQP3 4FCFA 4LGMA 1CQAA 1ROVA 1EA2A 3JYIA 4HIAA 4MN7A 2IA2A 3HREA 1LI0A 4PKYA 4WL9A 3DUKA 4B3SM 3NX0A 5BOHA 2QP9X 2I7PA 3E99A 3V67A 1EKMA 4GS9B 3B4OA 1IELA 4GD8A 2ZHXB 4OU7A 2YFIB 3F1PB 4FWGA 2ML6A 1V57A 3JR5A 4QNRA 1KVLA 3TW8A 1NHWC 2UWXA 4KVHA 2BMOB 3BFGA 3UE3A 2A3UA 2G5GX 3K9PA 3QAUA 1T18A 2EX8A 2Y4AA 1OF5A 3U61B 2F5MA 1LSXA 3DZLA 1R2YA 1I0XA 1LT0A 4HEFA 3A98B 1PYYA 1H6UA 5G18A 1XGJA 4IUHA 3M7GA 2ZC5B 5HSQA 3SC3A 5CGXA 2CC1A 1ERQA 1GY5A 1NDOB 1VEUA 2OPFA 4EIWA 2L6OA 2H28A 3GQ3A 3CUEC 4HLQA 4NPBA 3EEHA 3OPRA 3LTDA 5M1AA 1T2HA 3T50A 3HBRA 1IQXA 1YVSA 3QNBA 3FYZA 1GOYA 2OQEC 4ORLA 2I7NA 1XA7A 1HD8A 2G7UA 1RGYA 4E04A 3FKWA 3VFFA 1K6RA 3C4PA 3N54B 4GITA 5DKKA 1EIJA 4JBFA 3RNTA 3AL0C 4Q0HA 1L8QA 2ZOIA 3PYJA 1C54A 3LY3A 2O9BA 2BJVA 3FKVA 4B7FA 3PZWA 1N5HA 4ID4A 4DMZA 2P9VB 1S4RA 5EXSA 1O7PB 2DZOB 4X25A 2W1TA 1M6KA 4NSOB 3IG8A 2O99A 1ISKA 1C1KA 3RGPA 1JR3E 4QNMA 1JZDA 5KZHA 1FGOA 4GHLA 2BHMA 3CI6A 2ZA4A 4E3LA 3R7WB 4TUWA 5F3WA 2LHCA 1F2KA 1MBLA 3ILKA 2A2LA 4P6ZM 4DV4M 4RX3A 1OACA 1NV9A 1VQ53 4WYKB 2F5OA 3DOAA 3HVFA 1DJAA 1OMEA 4RNAA 3UB1A 3I51A 4DV3M 2Y0QA 3A42A 4UA9A 5G2GA 1DY6A 3V99A 1Z1SA 5D82A 4R4KA 1Q40A 1S6RA 3TE8A 4EQIA 4UQIM 2Y55A 3JVCA 2E5LM 1J3WA 1RGGA 1JBRA 4IBKA 1QALA 4BMWA 5IWAM 5HDSA 3J7BA 3UGJA 1HU9A 3ZNYA 1E32A 3JUNA 3SAVA 3FYCA 1KGFA 4M9ZA 4KZ7A 3FGYA 5ELUA 1FA3A 1PFPA 1VQN3 1I5QA 4GHOA 4RA7A 3E98A 5FAQA 3IT9A 3GO8A 1W7FA 3EEAA 2DZNB 4OKPA 1BGSA 3F1NB 3U1WA 2E8IA 5FDHA 1U8CB 4RVAA 2AHMA 3DGMA 4LRXC 2Z7JA 4QPRA 2R4EA 1WE4A 1TH3A 4MN5A 2Q9MA 2FH0A 2HDUA 3R8FA 2ZQDA 3HJQA 2EKFA 1N8R4 3ZDJA 4ZJ1A 4AKIA 2WKRA 1NWWA 2DWNA 1LL8A 4XXRA 2V1LA 1RGCA 4KFFA 1ACFA 1Q814 3SAWA 5EVLA 3VSKA 1WIVA 2F5SA 1NZUA 2DAKA 4JXGA 3IBJA 2R4JA 1PRBA 1GSPA 3X3YA 1EEJA 3PBNA 1YGEA 5FTKA 1OJGA 5FATA 1OCVA 3LIBA 5EFWA 5HL1A 1Z5BA 1I2FA 3J2PB 1W8QA 2DMWA 2OLVA 3O8YA 3ICYA 3HY5A 1G28A 4KHPM 2XQZA 1MZUA 4CQHA 2ZM6M 4LF7M 2QA43 2V0WA 4DF6A 1ESUA 2XR8B 3KKGA 1IK3A 5LBRA 4JGRA 1L0GA 4KG6A 2J7VA 2RSXA 3MQ0A 4DR2M 1Z5CA 2X02A 3SEDA 3T1RA 3MS6A 3H82A 1ZKJA 4MH0E 5TR7A 1LQMB 4DV6M 3FG3A 3TWKA 1YSYA 1TIJA 1G59A 1GHMA 4DV5M 1XMOM 4XDVA 4EBGA 5EVIA 3MG2A 3NBRA 3IS2B 2N35A 2PD8A 1I70A 2G2WA 3GRUA 1W6CA 1OTRA 2Y2HA 2JQ5A 2LWXA 4Z8XA 1KDSA 1LNIA 5EECA 3PBQA 4JI3M 1DGHA 3L0RA 1TU5A 1K56D 2CHQA 1GVNA 1OHSA 4PM9A 1PYLA 1KE0A 3BNBA 1XPBA 3PFIA 3LFVA 3VP0A 1BSCA 1MWUA 3V5MA 4YNRA 2GU1A 4WP5A 1E3RA 1MKIA 1LTMA 3EQVA 1CJFA 3N4IA 3KVWA 4XUXA 3UB8A 1SCWA 1VHMA 5HAIA 1VQ43 4RNZA 4F3LA 2HDQA 3LR0A 3LVVA 1WGNA 4Q0IA 3GLHE 4L0LA 4B3MM 4GNUA 3K8ZA 3S27A 2ML5A 1IBKM 3NQYA 2HGVA 4LZZA 3RE8A 4Q7JA 2HDRA 4MN6A 5CEDA 3K92A 3OWYA 4LFCM 2VZWA 1ORYB 2IWCA 4PM8A 3BY9A 2HDSA 4HI4A 4UAAA 1NB5I 3FUTA 1RCLA 3G2ZA 2JP7A 2RFRA 4C6YA 2F5WA 2R78A 3GR2A 4JRFA 1GJSA 5LC6A 2O0YA 3T4QA 1FUSA 4WMCA 4GDNA 4ZBEA 3AV0A 3LI9A 5RNTA 1JN5A 4EV4A 3C30A 1TFOA 1IVVA 2WKQA 1LHYA 3Q7VB 4EU0A 4WZ4A 4LRSA 1A2KA 5DF9A 4Z1WA 3H9WA 3DTEA 5HD3A 1JR3A 2DHRA 4GMQA 3M6BA 4M0WA 3OCLA 4R4RA 1A0KA 1QMEA 4O0PA 3WS5A 3RFBA 5C5KA 1MC0A 2JKFA 4JGQA 1G02A 4WFOA 4KT0F 3G6OA 1A90A 3PTEA 4DXBA 3T4JA 4CJ6A 1BSDA 4Y15A 3MG3A 2ZTCA 1UW1A 3GECA 4Y5FA 1SQWA 1STDA 3ISGA 3SAUA 3QP5A 1ZV1A 1J5EM 4GC5A 4L16A 4MGIE 1FILA 2DAEA 2ZTDA 1RN7A 3L7HA 1UGUA 5AQ7A 2I9VA 2CV2A 3PS8A 1WJ7A 4HAAA 1NNJA 4ITQA 3OX9A 3EC9A 3V3RA 4KFEA 1W5DA 4N92A 2STDA 5DRVA 1DJCA 4WZ5A 3CAXA 2RRUA 4MEIA 1JTDA 2J9OA 2M5ZA 2JE5A 1NYYA 1IY0A 2IA7A 1QQWA 3UL6A 1YJN3 1D06A 2LYXA 1NY5A 1BLPA 3UDXA 5HAPA 2J8XB 3OZHA 2PBYA 3K5TA 3ROBA 1RKYA 3A0RA 4Q53A 4LCBA 3SFZA 4G1MB 2XSSA 1W63M 1OAIA 3JUQA 3LTCA 4E3MA 5KPZA 1FR6A 5EP1A 4Y0UA 3CUEA 1EQKA 3SH7A 3DH2A 2INXA 1GMRA 1IYYA 5E2FA 1VQ73 5ITYA 3B42A 3UK6A 1YJ93 5A0OB 4KFDA 1LI9A 2H10A 4CLCB 4DRTA 1WMNA 2OQEA 1XWIA 2H5SA 2QYBA 5HARA 5GKNA 1ROAA 2HWJA 2WAEA 4QOSA 1PJQA 3MMHA 4NXMM 4GHIB 1LQGC
chains in the Genus database with same CATH topology
2ZANA 3X3XA 1GA0A 2PZVA 4L8OA 1IY1A 4R1GA 4BD1A 5C1BA 3TL4X 1BUQA 3LTAA 2UUCM 4I81A 2L4VA 1ZG4A 4DXCA 4E3JA 5HW3A 2C98A 4JF6A 2LXEA 3VFDA 2XZUA 1JNQA 1QAKA 4IPBA 1R7RA 4RBNA 1JKGA 1IQYA 4IVIA 3FZCA 3V3SA 3GLHB 1D6ZA 1BLCA 5AYRB 4AKYA 4IIWA 2WOHA 2HL7A 3MYTA 4N9KA 1C3BA 3T38A 5A93A 3PBOA 1L0EA 3P09A 5E2GA 3CC23 1DYUA 3EQQB 5I97A 3G30A 3SARA 3SX1A 5KMWA 1JVJA 4G4RA 5FLXS 2CHVA 2Z3XA 2XSOB 3Q1CA 1SKFA 3TPZA 3SXXA 3LMMA 4HVNA 5EEOA 2CK3H 2XSHB 4FH2A 4LCMA 5JI3E 1DGFA 3GV9A 3PVSA 3FCSB 1WMOA 1YIJ3 1IEMA 3HLDA 3BOSA 3UDIA 4N6UA 1H5XA 1JWVA 3NCKA 4CPKA 2P05A 1O7MB 1QVF2 2XZFA 1MXOA 1SXJB 3U6MA 2WAFA 3FG1A 4N6LA 3CCL3 3PBRA 1LLBA 3HIIA 1G8PA 1NYMA 3PBSA 2KRTA 1N77A 3OTOM 2IMJA 3KSJA 4J9AA 5AIHA 5IERA 3AMOA 5FASA 3IF6B 3IMAB 1PM5A 4LV0A 1SJWA 4FCVA 4HM4B 4D82A 3TOIA 5FW5A 3A76A 3CZDA 4K1UA 1M1K4 5CHUA 3EF8A 2W82A 3TWMA 2V1CA 1K38A 2XFSA 2VGJA 1WTHA 1W6GA 3RFWA 2C9CA 2JC7A 4X53A 3FKAA 1ONHA 1D6UA 5KSHA 4MNRA 1ES3A 2VGKA 1DGGA 3QWLA 5IEOA 4EXRA 3KW6A 2W0QA 3B3XA 2DCFA 4R3JA 1FCMA 3B4PA 1N4OA 4X65M 1YLTA 3CCS3 3SYKA 4FR9A 5AIIA 4KO8A 3A3FA 5JPPA 2ZBKB 1ES5A 3MBZA 4S2OA 4J8TA 5E43A 1JB4A 1IN5A 4B7HA 2XLNA 3Q81A 5D81A 3QHYA 4K61A 4KZ5A 3AKZA 1G4AE 1DVDA 4LFBM 5HX9A 3VDUA 3A3IA 2P0XA 1ASKA 3RJUA 4KZ6A 3N7WA 3V98A 3K1JA 3CF2A 3EIEA 5BVBA 3JAMS 4LGQA 1HR0M 2L7IA 4STDA 3C58A 1E9RA 3L28A 2UU9M 3PCSA 4L8PA 5EOEA 3WS1A 4BBAA 1TFKA 2QMIA 2CH9A 4M0DA 4PEJA 3GLFB 3CC73 1HKXA 3N8BA 1N75A 4FCTA 3BNDA 4WBGA 3L25A 3RDEA 3F8XA 5AQBA 3GZXB 1S3SA 5KO3A 2DXIA 5CGWA 5EVHA 5JPUA 5LC7A 3HU1A 5STDA 4R0QA 5CXWA 1N32M 4OPQA 4XM4A 3W0LB 3SHGB 3VK8A 3FTEA 2EO2A 4WELA 5FSWA 1D2NA 2M60A 3GRYA 1BLHA 4OOYA 4PT5A 3M6HA 5E6JA 2W6JH 2QPAA 3R9XB 3K2LA 4R4SA 3UE1A 4X2OA 1Z59A 4O02B 4RF1A 2Z76A 2ZL8A 1S0WA 3UY6A 3GLGB 2HP9A 4OVDA 1QAOA 5ITUA 3J80S 4PM5A 4GC9A 4PM7A 1L5GB 2HKJA 4Q8IA 2B1XB 4QY5A 4JXJA 3D8LA 1L1TA 3FD9A 5IHVA 1N33M 4N6TA 2WADA 3HLWA 1IN7A 1I94M 1HNWM 3IWQA 2XRXB 5GLCA 3FUVA 2V1UA 4OOMA 4II7A 2F4VM 3GZBA 3GRJA 3N9HA 1L0DA 4DE2A 3CXC2 2ZQ7A 2PNCA 2VQFM 3DWZA 3WHLA 2Q07A 4GRIA 5KP1A 1LL9A 4P16A 3OPPA 4KG2A 3D4FA 2BMQB 1S723 2ZC3B 1YT4A 4HBTA 1NRFA 3HWSA 2P0MA 1KGGA 3Q07A 1EROA 3ZG5A 3SVAA 5TGFA 3OV4A 4NREA 4N6NB 1GLNA 3KE7A 1NZOA 2XR0A 5FQKA 1NSFA 3NV0A 1L0FA 5DYIA 4X2HA 3NBJA 3MKIA 1K56A 5IENA 4B4XA 1BTLA 4KZ8A 4DE1A 4FVMA 3GMWA 1XMQM 1XXHA 4LFAM 3U6LA 1IYOA 3BYDA 2R4IA 5DF7A 3U6SA 1EG9B 2EX9A 3VDPA 1G96A 1AXBA 3HHZA 3UL5A 1DMMA 4G6ZA 2OLUA 3GSGA 1FGQA 2SBLA 2KZSA 2XEPA 2IUJA 4BL3A 3L26A 3HK4A 1OF5B 1LOXA 2WK0A 3B9PA 3HUMA 3D8BA 3WA2X 2A15A 4NOOB 4KQQA 5IG0A 4DR5M 1K3WA 4WEJA 3AOGA 2W04A 2CG0A 3FH1A 1KE3A 3ZG0A 2E2UA 3GLIA 3CCV3 4IJEA 5IF6A 3FKEA 1QMFA 4Z9QA 5JBSA 3KZTA 5DYGA 1YE9A 1DMQA 5CK6A 3VF1A 4NRVA 2K47A 3UZUA 1PU4A 4DE0A 4O8SA 2B5RA 4KZ9A 5GLBA 4RX2A 5HFOA 1IBMM 4M9SA 3C4OA 5FI2A 3ZG7B 2ERCA 3BNCA 4NXNM 4RNYA 5GLAA 2OCTA 3WOFB 3GQ4A 3UNLA 3O87A 3WHKA 1QVRA 3DW0A 1YLZA 3HI7A 2QGUA 5EQTA 5FTJA 3CG5A 2OQ4A 4IJFA 4OP5A 3FTFA 4R80A 1R4CA 2UXDM 3X3ZA 2Z2MB 1FGTA 2OTJ3 5CEBA 2K0MA 1WQLB 3LT9A 2HMJB 4HM2B 3GPUA 2CFDA 4U3TA 4UA6A 1XP4A 1NJGA 4JI6M 1QMAA 4BENA 4IIAA 1Q40B 5DREA 3WS4A 5IT9S 1NO3A 5DTSA 5JYOA 1IXRC 4GN2A 1SXJD 4MBKA 3S67A 4P0MA 1Q3CA 4AG5A 4AG6A 4XGIA 3LXUX 2CHGA 3ZG9B 4JI7M 5J8XA 3SOAA 3BFFA 3DM8A 1VQM3 4YINA 2MF7A 3LMLA 4OQGA 4FCJA 3GPXA 3CMA3 3X41A 2DWMA 1XXMA 4QJGA 3Q7ZA 4KLNA 1I4WA 3UE0A 3S1YA 3RGSA 1KWIA 4PM6A 1PZOA 2WKHA 5EE8A 3VMAA 2KXEA 4OQIA 3V92A 4YHHM 4JI2M 3MWZA 3GVBA 1GCEA 4DE3A 1IYPA 4P87A 3CME3 3MZDA 3CCR3 1FSYA 4OPZA 4P85A 3ZNTA 1N5PA 1HTZA 4LEHA 1QVG2 3HUOA 3VLFB 2V6ZM 2Z4RA 2O3OA 4XUZA 4WWUC 4JF5A 4JXWA 1OFIA 3A3EA 4R7GA 4PD2A 4BD0A 1GS3A 3IHAA 2EFUA 3S22A 2R62A 5DF8A 4ZAMA 3DZDA 1N8QA 4OOLA 5EVIB 4JYAM 1DJBA 3MXSA 1MWSA 2QZ4A 1OJLA 3U6DA 4JI4M 3CC43 4G4QA 1FJGM 1DGHB 4LF9M 3EIHA 2PU2A 3LOYA 1K25A 5KQDA 1GHPA 3PNVA 1VQ93 1MY8A 4HM7B 3T15A 1JQJC 2J7OA 4PCZA 4D2OA 5CTNA 3ECFA 1FQGA 1NU3A 5F82A 1E25A 3CCE3 2ZC7A 1SXJC 1PJJA 3CCM3 4ZJ2A 1QAMA 1TDHA 2ZAMA 4LV1A 1E94E 4MGZE 4OPYA 5IG5A 1FGMA 3K0ZA 2Z7AA 2WGOA 4B3TM 3SLUA 1IT8A 3AGEA 4LRTA 1KVMA 3IF6C 4GL6A 1SIIA 3M2JA 4LJ4A 4FMBA 3TWLA 5EP2A 4LF5M 3E2KA 1HT1E 3AOEC 3VOZA 1G6AA 1TUHA 3FZWA 3GQ5A 4QHTA 1W4NA 3B8LA 4Y0OA 1FCOA 3BFDA 1KSIA 1N36M 3S4XA 1KGEA 1WYCA 3KIIA 3UDFA 3H51A 3U6QA 1QJGA 5CGSA 1KYIA 4LSOA 4QWTA 4E3NA 2W9PA 1MWRA 1N78A 1K6SA 1M40A 3MHVC 2CWTA 1R2ZA 2IUKA 3SBJA 2FGTA 1ES2A 1PW8A 4K91A 4HYZA 3ITBA 3OPLA 3MK6A 3LCEA 1LL5A 1Q39A 1IY2A 3BEBA 4OK0A 5FQ9A 1PJIA 5HGRA 3U6PA 2DVWB 1PIOA 3LO7A 1IQ8A 4LG2A 4K1VA 2XSZD 5ITRA 5E2EA 1W7CA 3TE6A 5M19A 1L2CA 4A5RA 1E3UA 4JV5M 1LVNA 3T0UA 4KZBA 4N6V0 2Z2LB 2Y2PA 3M8CA 1UM8A 3IXDA 1ZX2A 3J81S 1YJW3 1DVCA 5FQMA 5FI6A 2CFGA 3SOYA 2CFKA 2Y20A 4CHTB 1GY7A 2B24B 7STDA 3ITAA 2EFXA 3CCU3 3M2KA 4LJ9A 3IJEB 1CEWI 4PDIA 4JN6A 2HHHM 3HZPA 2W9QA 2RCXA 4LF4M 2Q9NA 4B7GA 3CTWB 1UI7A 3PBTA 1I2WA 4MB7A 3U6CA 3S5CA 2ZC4B 1XHBA 3M6AA 1HT2E 3AGDA 1JKGB 2RL3A 5EUAA 4BLMA 1HQCA 3G4S3 2CKFB 4O3VA 4QHSA 1W2ZA 4L7KA 3IXGA 2ZQ8A 3CF6E 2QCUA 3AFHA 2WGWA 4X64M 2RKOA 4R3BA 1US1A 3F40A 1K57C 4IEDA 1YIT3 2NQ8C 1TEMA 1IBLM 5ITQA 4LF8M 1T5YA 5FTMA 4HM6B 3NDGA 3UPPA 1WNHA 3DWKA 4R9LA 1FNNA 1IV9A 1W6YA 3EBTA 1QYRA 1H8ZA 4UA7A 2BNGA 4Y7PA 4DV2M 4HM0B 3EB8A 3JUPA 3GPPA 4AKZA 3BFEA 4BTXA 4S2KA 5GL9A 4D80A 3NBLA 1ZQ9A 5ITXE 5GHZA 4E3IA 4IBBA 2HMLB 2HPBA 2I9WA 4S2JA 5AIFA 3N8RA 1LV7A 4LMIA 4DKIA 2CUZA 4RZMA 4XDWA 4B08A 4WEKA 5FTNA 4DUYM 1WXQA 4IVKA 2DWLA 3I4YA 3WRTA 1ZC2A 5A91A 4HZBB 2QBYA 4MBFA 4IBXA 4JI5M 2GEYA 3HLEA 1OH0A 3HU3A 2W56A 4FD2A 3NXJA 3TQSA 1KQS2 2F98A 3MKEA 4GKKM 3G16A 3CCQ3 4DUZM 3E9SA 4DR7M 4G4NA 2EUCA 3MXRA 4IT7A 5CF2A 1RGZA 3KOWE 3U97A 4F94A 4IBEA 1K4FA 2C6WB 3DA1A 2YNMD 2Y2NA 1JV2B 4K0WA 1ZAEA 3SMSA 3J27B 5LMUM 4N1HA 4JI0M 1CYVA 1VQ83 1PZPA 2R18A 4NL4H 3G31A 4KZ3A 1DGBA 3GRDA 3LYGA 4R1KA 4CCVA 5H37D 4EBPA 3ZGAB 3O3VA 1MOLA 1J9MA 1N34M 2HP5A 2LNHC 1IXSB 3U6OA 2OTL3 4DDSA 3S28A 3HHWA 5F1FA 1UUVB 3BNEA 5F1GA 3VKGA 4C3QA 1SXJA 4LZJA 4OLDA 4WURA 5EXTA 4OVZA 2P09A 4QOZC 4MGHA 1PI4A 3KP1E 4IBJA 1GD4A 5I94A 3LT8A 3X40A 4G4OA 3SH9A 7CATA 1ZO2A 1CK3A 1GD3A 5AQ9A 4XBOA 4NRWA 1NJFA 4QU3A 1Q7Y4 4AEQA 3AOEA 1N9EA 4OPRA 3DXOA 2YX9A 1XA1A 3O88A 4B88A 2HCBA 1SHVA 1EI5A 3B7CA 3TDGA 4NK3A 1NVMA 3CF0A 5KPTA 5DTTA 3HIGA 2WYXA 1JRQA 5A2QS 2KRKA 3T8NA 2XD1A 5A92A 3BECA 2X71A 2F99A 3NI9A 1RRHA 4I5SA 2ZC6B 1HZOA 2X49A 2J8YA 4EBLA 3UJMA 4FSFA 1O07A 2XK1A 3MJ5A 3VP2A 3SYLA 3U60A 4E3OA 3LTBA 2PU4A 4GOGA 4H61A 1ERMA 1LXEA 5IZ7D 1K8A4 2FOIC 1BUEA 1NY6A 3NDEA 5EP3A 3MSOA 2XLJA 3OPHA 5FQQA 3A45A 1CEFA 1KSFX 4IBGA 5KSCA 5ITXA 3WWXA 2KCDA 4CDLA 1EE8A 5IG3A 1PI5A 4DV0M 4FWDA 2FNAA 1NY0A 3DTMA 2A49A 3NV0B 1KFVA 5BPVA 1AVLA 3GLFA 4DR6M 4BTYA 3FYDA 1QAFA 1GKIA 4X6TA 5C18A 3DMCA 1K54C 1IV7A 4FCMA 4MMZB 5EPHA 4N6OB 4KENB 3K9MC 1JB5A 4LJ7A 1BSGA 4S2LA 2A5YB 3BLZA 2CFOA 2WGQA 3VKHA 5EXPA 2UUBM 2HMNB 3P98A 3GZYB 2J9PA 1G68A 3K7CA 3MFDA 3V39A 2QIYA 1O7EA 4C75A 2FNQA 3TG9A 1ES4A 3LH4A 1LNHA 1J2BA 3W4PA 1K3XA 2XGLA 2MC8A 4AI6A 2XF3A 3VP4A 3SS5A 4LF6M 2O5RA 2C11A 5GHYA 4EWFA 3VGNA 3Q82A 1V74A 4S2IA 2RGQA 4HM8B 1RRLA 2VIIA 2LQVA 3GRRA 4OP8A 3GLIB 3NBBA 4HBRA 4HZ9B 3G34A 1GA9A 4R23A 4FW9A 1STFI 1H8YA 3VSYA 1FSWA 1E97A 2FXTA 4FMDA 1XC8A 4CJNA 5AI1A 2WOFA 2CG1A 3F9SA 3FUXA 1VQO3 3QRDA 2CWVA 2WUQA 3J7Yd 4JI8M 5EP4A 2CFLA 1W00A 5BR8M 2E2VA 4HJLB 2FFYA 2CEAA 4KZAA 4Y0TA 2OOVC 3SOIA 3MZEA 2JBFA 4DV1M 2ZD8A 5EXXA 3MKFA 3CJMA 5AEUB 2EXBA 2D42A 4JXSA 3SATA 4H8RA 4OQ0A 1YUBA 2CIUA 2L7HA 3NBIA 1CQSA 3Q90A 1NNUC 4P6BA 4E3KA 1IXZA 1AR0A 3HLCA 2HMKB 4TX4A 4K0KM 4LENA 3GQZA 2CWUA 4N6MA 2X4AA 5FA7A 2W2CA 1PWCA 3KFQC 5BXQA 2ZQAA 3JUOA 1JB2A 1I2SA 1K82A 3GWRA 3GPYA 1Q2PA 2XSZA 4PMAA 1NJ4A 1CI9A 2P38A 1DMNA 4WZ5C 1PWGA 1W79A 2WKEA 4GZBA 3Q1FA 1O7GB 1L2BA 3KP0E 2XD5A 3U5ZA 4LV2A 4XBYA 2KZUA 1HNZM 1Z6TA 3VK7A 1K28A 3ZFZA 2H0YA 5DNYA 2C99A 5JI2E 1WMPA 4EC6A 2UXCM 1YQSA 3IH9A 5FI7A 2YR0A 2Y0TA 2BNKA 3L27A 1NJI4 4MGYE 3G8ZA 3ZVWA 3T1HM 5M18A 3J7AS 3S29A 3T8UA 2V20A 4OH0A 3HU2A 3CU3A 1YHQ3 3NM2A 3I4VA 1VQK3 4BB9A 1YM1A 2ZDJA 2ZM8A 1MNLA 5AIGA 2GU3A 4HM1B 1S5AA 4GD6A 3CPW2 4S12A 5IREB 5FAPA 3DGOA 3U61A 2RGOA 3F8HA 5CECA 1IYSA 4JLFA 1OGXA 4LGYA 1KE4A 2HP6A 4BQMA 3WODG 4DDYA 4GB7A 1JJ22 3Q2PA 2C5RA 4MMYB 1GL6A 1OHOA 1TP6A 1W5TA 1OUNA 1GYBA 1K55C 3U6EA 2Y2QA 4GKJM 3LQRA 3OXAA 4A3VB 4M3KA 4E6WA 4IBDA 1RP5A 4K90B 1Z6FA 1HVBA 4U13A 2HMOB 2P9VA 3D3LA 1YMSA 4U0XA 1HQYE 4NSRA 4JKTA 1UI8A 1CI8A 4M9XA 4LJ6A 3KFUG 2P74A 4GIPA 3F14A 5IW9A 4B4ZA 2QEX3 2V1ZA 4EUZA 1KC84 5FSRA 1MWTA 1XGIA 2WO0A 1DO2A 4FCZA 4BTWA 4WYKA 3A3DA 4N3VA 3W0FA 1GY6A 1D6YA 4S2NC 4CISA 3HGIA 2P5TA 3ZG8B 3KSPA 1KD14 1IN6A 3EBYA 3NWLA 2GBXB 2V2FF 2Y74A 1TH2A 4JI1M 5FAOA 1GL7A 2KW0A 3HHXA 1Q824 6STDA 1JWPA 3FF2A 3IG5A 5CERA 3OCNA 1TGUA 4X66M 1K41A 2C5WB 2J7NA 3I0YA 1K54A 3NHXA 3I7JA 2X01A 4PDGA 3WRZA 1Q864 2Y2LA 3LEZA 4LZIA 1Y4KA 2C96A 1FGRA 2F86B 4X62M 1W8YA 1AV4A 2K54A 4I4KA 2L09A 1OHPA 1JN5B 2H0TA 4ZM8A 1FR1A 1J09A 5CTMA 2Y2JA 5CHJA 4GB5A 4GH9A 5FQIA 4IBCA 2XH9A 5CRFA 1IDPA 3GTCA 1FOFA 1ZG6A 4QD4A 3LY4A 1N9JA 3O86A 1K734 3F7XA 5KP4A 2Z4SA 1K9M4 4AW4A 4DR1M 1CEGA 2F5PA 4AKGA 3RGAA 3H4MA 2WGIA 1VQL3 5D3OA 3HX8A 3G6E3 1YLPA 1IQPA 4KODA 2JCHA 4XBTA 2Y2IA 1ESIA 4BLCA 2X8AA 1Z5AA 4EV5A 5IEPA 2UUAM 3N6IA 2BT3A 5L2FA 4LY6A 2E2TA 1HNXM 3UJNA 1K4EA 3KDSE 3UN7A 4MM3B 3CD63 2R9XA 1W02A 2G2UA 3MZFA 3UMMA 2DRWA 3G4PA 3FLJA 3ZCZA 3IF5A 1ULJB 1W01A 3MHEA 2R45A 3GP1A 5KPRA 2OOVA 4JF4A 5GLDA 4JF8A 4GHAA 3BM6A 1MX0A 3SS3A 1IN4A 1XX2A 1TDLA 4KG5A 3UO9A 2DWZB 2BO9B 4HL4A 1A2VA 1GHIA 3A3JA 3ZVTA 1E3VA 2GXFA 4W5WA 2Y59A 1Q3BA 3Q8XA 5ITTA 2I72A 2D7GA 2FFJA 1TH4A 1PW1A 3ZCBB 2CV1A 3NQZA 1SXJE 2JA2A 3KOXE 1UUWB 4KQOA 2OV5A 5FGOA 1MU5A 3VP3A 2WGWB 4L15A 2GDNA 5DVAA 3THGA 4HESA 4DR3M 3ZC7B 2UXBM 4N1XA 1VM1A 2Q2EB 2Z6BA 4DV7M 2H1RA 3FG4A 5FTLA 4LJAA 2ZJ9A 5AQAA 1TDGA 3G32A 5CXOA 4E6XA 2R9WA 5F83A 1BLSA 1WYBA 2Y2GA 5IG4A 3HLBA 3Q7VA 3SMPA 4R9KA 4NXMM 3HLFA 3GZRA 1Q2QA 3OC2A 1SPUA 4Z6YA 4XBXA 3NC8A 4O2HA 3EE1A 5TGNA 2EA0A 3KXEC 3M0EA 1YI23 4ZDXA 4FWHA 3MG1A 4X68A 3LVWA 1YLWA 2ZM0A 4AZFA 3PXMA 1IN8A 1BT5A 5GHXA 3MPHA 3K63A 4OW0A 1BULA 1IKGA 2YFQA 2CV0A 3C7VA 4HM5B 1MPLA 2C9OA 2F5QA 1U60A 2GBWB 3L29A 1IVXA 3RXWA 3LZAA 1U5OA 4HKVB 3CMZA 3EN1B 3KSED 1RJOA 1ALQA 4LCLA 2QBYB 1X37A 3JUMA 3FWLA 4ZJ3A 4PPRA 4WHAA 1XNQM 2W03A 2W56B 5CHMA 1NXYA 2IWBA 5TFQA 2JDIH 3OWUA 3AMOB 3W4OA 1IT7A 3CNXA 5KQ8A 5LMNM 3DY5A 1VDDA 4OQHA 4FH4A 2KXGA 5KP3A 1L2SA 3KOYE 4LJ8A 1J7KA 3HJ8A 3NY4A 1OFHA 1QANA 1K55A 3G2YA 4EV2A 1L1ZA 2Y73A 4QHCA 3CCJ3 1N9BA 4OONA 4AQYM 3RXXA 2WGVA 4I4LA 4RYEA 1OGZA 2IWDA 4MJDA 1SDEA 3EQUA 5ELJA 1RCJA 3T1YM 2Y2KA 3IHBA 4LV3A 1R6BX 3FUWA 2Y91A 1FUWA 3H3HA 1W5SA 2RGHA 3KN4A 4JXVA 5U47A 3BB9A 3F7SA 3GRVA 2ZM2A 3KOZE 3DFZA 3X42A 3E2LA 3GLHA 1QAQA 1VZZA 1TDZA 3PNYA 4OVZB 1F8NA 1O7WB 3HL9A 2BJWA 3IH8A 3CNMA 3I553 2BG1A 4ZPXA 4S2NA 2XGNA 4KZ1A 1NHGC 3FTCA 4UHUA 2D1WA 2ZQ9A 3WDGB 4S2PA 3LQQA 5D83A 2EX6A 3IWOA 3AJIB 2M7OA 4GKUA 3I563 1L2DA 1YVBI 2D7HA 2HMMB 3G0KA 1BZAA 4YY3M 3ALAA 3KSXA 3RGRA 3FF0A 5EVID 4FD8A 5CF1A 3N8LA 4OX9M 3WS0A 4MMXB 1O7HB 2RCDA 2Y21A 3EHCA 4I8OA 3E4RA 4NHFA 5HAQA 1M1XB 3EX9A 1ULIB 5EOOA 3IF6A 4QB8A 1O7NB 8CHOA 5DTKA 4MEZA 4X56A 2EXAA 5JYPA 3U60B 1E9SA 4XB5A 1KDWA 4HBUA 1SDNA 4WW0A 4D81A 1C7HA 2XFTA 4IBRA 4IBIA 1SIHA 3PAEA 2C10A 1IU7A 3UNWA 3W4QA 1NB3I 4WM9A 1AVKA 3PXGA 3WMDA 4FMAA 4O7DA 2Y2OA 3IQAA 2YFLB 3WS2A 3HHYA 2CE7A 4IBFA 3HJSA 5E2HA 1E4DA 1M9GA 2F5NA 2BLSA 3CPOA 1IKIA 4WMCD 4EBNA 3VOYA 2WZZA 3W8KA 2ZQCA 2DNSA 3A46A 2CW9A 3G713 1G41A 4NETA 5AYSC 3BLSA 2GEXA 1JR3D 3BRMA 4OUQA 3HLGA 4YFMA 3ZHHA 3GAXA