2XH9A

Structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
420
Chain Sequence
b'VPTPAEAALAAQTALAADDSPMGDAARWAMGLLTSSRPEDVAARFIPTFNFAETVREWRSKGPFTVRAYHPVAHKGWVVLSAPAGVRYILSLTLDSSGLIRILTLKPETVIPDMVTWNDVEETLHTPGVQHSVYAVRLTPDGHEVLHASAPERPMPTGSAYKLYLMRALVAEIEKGTVGWDEILTLTPELRSLPTGDMQDLPDGTRVTVRETAHKMIALSDNTGADLVADRLGREVVERSLAAAGHHDPSLMRPFLTSHEVFELGWGDPERRAEWVRQDEAGRRELLEKMAGVMTVRGSDLGATVHQLGIDWHMDAFDVVRVLEGLLQDSGRDTSGTVEEILTAYPGLLIDEERWRRVYFKAGASPGVMMFCWLLQDHAGISYVLVLRQSADEQRLIGDGLFLRGIGAKIIEAEAKLLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF12
publication title Structural and mechanistic studies of the orf12 gene product from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
total genus 139
structure length 420
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF18042 ORF_12_N ORF 12 gene product N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.620 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2xh9A03
3.10.450.280 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2xh9A01
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2xh9A02
2XEPA 1DJAA 1W5DA 1ZC2A 2Y2MA 3LCEA 2G2WA 3ITBA 4OQHA 3M2JA 4S2KA 2ZQDA 1W79A 1NY0A 2GDNA 3MKFA 3Q1FA 1K6RA 1YMSA 4OOMA 3FV7A 4WZ5C 4ZAMA 1JWPA 2HP5A 1NZUA 5CGXA 4XUXA 4Y7PA 4GKUA 1S0WA 1IKGA 3A3DA 2HP6A 3UN7A 4Y0TA 4WM9A 3M6HA 3ZG9B 2V1ZA 4DF6A 4QJGA 3Q07A 3ZG5A 3GR2A 4ZJ2A 1RCJA 4EWFA 4S2LA 2WAFA 4DDYA 1RGZA 3AGEA 1JWVA 1W8YA 3IXGA 4GN2A 5L2FA 4JXWA 1XKZA 3BEBA 3IH9A 5U47A 2EXAA 1K4EA 5DF7A 1ZG4A 5CGWA 2Y59A 1ES3A 5CTMA 1SHVA 1KVLA 1WYCA 3PBRA 2WYXA 5M1AA 2WGWB 1LL9A 4IBRA 4F94A 1PWGA 2ZC4B 2H5SA 4IVIA 4D2OA 3DWKA 4GDNA 1MXOA 4JF5A 4OOLA 1IYQA 4X53A 4KZ9A 5EVLA 3MXSA 3IF5A 4JKTA 1K54A 1K55A 1ES4A 3HLWA 3ITAA 3PAEA 1GA0A 2Y55A 5JYPA 3QNBA 4KZBA 1MWRA 1N4OA 5FSRA 3UO9A 3PBQA 3HLGA 3HLEA 4MBHA 3BRMA 3FYZA 5FQJA 3SS4A 4E3NA 4E3LA 3O3VA 2WADA 3N6IA 4DXCA 1LI9A 2HP9A 2RL3A 1EROA 3VMAA 1CI9A 1LLBA 3G31A 2OSUA 4LCLA 1KE0A 2H0YA 3MFDA 3S1YA 1L2SA 1MKIA 4BL2A 1KDSA 4BENA 3GV9A 4DE0A 1TDGA 4RVAA 4R23A 3W4QA 5FATA 4DE3A 2HDQA 3UY6A 4QY6A 5FAOA 1M40A 2XFSA 2WAEA 4JPMA 1DY6A 3TOIA 4WEKA 5FAPA 3VSLA 3ZGAB 3ZFZA 1Z6FA 2PU4A 1O7EA 2PU2A 2Y91A 3IWQA 4K0XA 3VP1A 1L0FA 3UPNA 4Q8IA 3GVBA 1BT5A 3UPOA 5FQKA 3OPLA 4OQIA 4X68A 3HLDA 3G34A 3P09A 3I7JA 1KDWA 5M19A 2P74A 4JXSA 3C7VA 3PTEA 3CG5A 1AXBA 3PAGA 3OC2A 4R3JA 5GL9A 2WKIA 2JC7A 4EUZA 1IKIA 1PIOA 3HUNA 4ZBEA 1BLPA 1IYPA 3TSGA 4EQIA 2XR0A 2EX6A 4QY5A 4UA6A 1QMFA 3PBSA 2ZM0A 3TG9A 5CRFA 2X71A 4LV1A 4OP5A 3IXDA 4HEFA 4MBFA 2Y2PA 4ZJ1A 4U0XA 3MKEA 4GNUA 5HAIA 3VP3A 4HESA 4HBUA 2ZM2A 2WGVA 4KZ6A 5EE8A 3O86A 4HBTA 3WS1A 2XDMA 2WKEA 2C6WB 2H10A 2Z2LB 1HZOA 4OVDA 5GLBA 2BG1A 3FWLA 1YLPA 3BLMA 3GSGA 3A3IA 3HLCA 4FCFA 2ZC3B 2Y2LA 1I5QA 2J9PA 2OLUA 4Y0OA 5DTKA 1K56A 3N8LA 1FCNA 1JTDA 3ZDJA 5DF9A 1YT4A 5A92A 2RCXA 3VFFA 1NYMA 2Y2QA 4C6YA 5EUAA 2J8YA 4K91A 5D3OA 4E3JA 3BFGA 1N9BA 3GRJA 4KQOA 2ZM8A 3NI9A 4E3IA 1KE3A 4BD0A 3LY3A 2XGNA 1I2SA 1SCWA 2ZC5B 2ZMAA 4B4ZA 5HX9A 3V39A 4B88A 3UNWA 4BQMA 3BECA 5FA7A 5A91A 5HARA 1K54C 3BLSA 1K55C 1NXYA 1L0GA 3G2YA 1E4DA 4OQ0A 3N7WA 4U3TA 3GMWA 1W7FA 2DNSA 2WZXA 3HBRA 3ZNTA 2V2FF 4PMAA 3GQZA 4DXBA 4R0QA 5IHVA 3SH8A 3HREA 1SDNA 3W8KA 4IVKA 3S22A 5HAPA 1SKFA 3OCLA 3WRTA 1K38A 3UE1A 3ZVTA 1K6SA 2Q9NA 3NBLA 2Q9MA 4FSFA 3A3EA 4ZJ3A 1KE4A 1E3UA 3HLBA 4JXGA 1YM1A 4EV4A 1YLYA 4ZDXA 5HAQA 3MZDA 5AQBA 1HTZA 3DWZA 1HD8A 3UPPA 3WS0A 3IXBA 2VGJA 4PM8A 3Q7ZA 1CEGA 2VGKA 4X6TA 4B4XA 3G35A 3BFCA 3MXRA 4JF4A 1K25A 4FH4A 5KZHA 4OKPA 3WS4A 3NIAA 1E3UD 4S2IA 3UE0A 2V20A 3G2ZA 1LI0A 5EPHA 2ZJ9A 3N4IA 2IWCA 4M3KA 2Y2HA 2XQZA 4MNRA 1ONGA 3FKWA 1NJ4A 3A3JA 2UWXA 4RX3A 2FFFB 4FD8A 4S2NA 3WRZA 5A90A 3VFHA 1JWZA 3HLFA 3JYIA 4S2MA 4R4SA 4ID4A 3W4PA 5EOEA 4C75A 1I2WA 3IHBA 4KG5A 2HDSA 4X56A 5F1GA 5AQ7A 1HVBA 3GTCA 3NC8A 4E3MA 1CK3A 1NRFA 3S4XA 1XXMA 4Y0UA 5E2GA 2OV5A 4CPKA 1E25A 2Y2JA 4GOGA 1PW1A 1FCOA 3EQVA 3OCNA 3P98A 3Q7VA 4MBKA 3W4OA 3IQAA 4QD4A 1ALQA 4E3KA 1Q2QA 1BZAA 4P85A 4GD8A 1VM1A 4GB7A 4EBLA 1RP5A 4N1XA 2P9VA 2EFXA 4QU3A 5G18A 3AGFA 3UE3A 3G32A 1ES5A 2C5WB 3MZEA 4OQGA 4PM9A 4R3BA 5HL1A 1MWUA 4KZ8A 4BLMA 3ZHHA 1MWTA 2XD1A 4WMCA 3CMZA 2IWBA 3IWOA 5CERA 2JBFA 2X01A 2HDRA 1FR6A 5FI7A 4A5RA 1LHYA 1M6KA 3SOIA 1KGFA 2E8IA 5EVIC 3ZCZA 1PI5A 2Z2MB 4OPRA 5JYOA 3UDXA 3ZG0A 3WS2A 1TDLA 3N8RA 4GD6A 5M18A 5GLDA 4BJPA 5DVAA 4YFMA 3ZG8B 1EI5A 4WMCD 2ZQ7A 4JF6A 5AQ9A 1SDEA 5A93A 2BLSA 4XXRA 3LY4A 5J8XA 3HVFA 4UA9A 4P6BA 4WEJA 5E2HA 4KZAA 4CJNA 4DKIA 5HW3A 2ZQCA 3ZG7B 5KSHA 4Z9QA 1FSWA 3OZHA 1GCEA 5DTSA 1PI4A 4X69A 1BULA 3OPHA 1L0EA 3CJMA 1XX2A 1PZPA 3IWIA 4KG6A 4QB8A 1XPBA 4PPRA 3V50A 4E6WA 3E2KA 5CHJA 1C3BA 2A3UA 3HUOA 5F83A 2EX8A 3NY4A 5EVIA 5FI6A 1OMEA 5KSCA 2Y2OA 2ZQ8A 5TR7A 5GLCA 1MY8A 4E3OA 4OLGA 3OPRA 1RGYA 5FDHA 5GLAA 1J9MA 1YQSA 2FFYA 1K56D 1FCMA 5E2EA 2ZQ9A 3Q7VB 2HDUA 4IBXA 5EVID 1H8YA 5I94A 1TVFA 3VOYA 1IYOA 1GHMA 1KVMA 1O07A 4JLFA 2OLVA 5TGFA 3SS3A 3RXWA 2QPNA 4LCMA 1L0DA 4N1HA 2JCHA 5E43A 4QHCA 4FH2A 1BTLA 4S2NC 2P9VB 1G68A 2XFTA 5CGSA 1CEFA 3RXXA 1WE4A 1GA9A 4EBPA 3AGDA 3V3RA 2QMIA 1BUEA 3SH9A 5FAQA 1K57A 5EOOA 2X02A 5FI2A 1WYBA 3WS5A 3HUMA 3CZDA 4K0WA 4E6XA 3G4PA 4PM6A 4P0MA 2Y2IA 3C4PA 3Q81A 1ERMA 3G30A 4BD1A 4S2JA 1NYYA 2J9OA 4GZBA 4UAAA 3SH7A 4C3QA 1U60A 2DRWA 4BL3A 4KZ4A 3IF6A 2ZLYA 4N9KA 4NETA 2WUQA 4YINA 4OOYA 4GDBA 3IXHA 1XGJA 3ZNYA 4OP8A 4P87A 1PWDA 1KGGA 2XK1A 3DTMA 5DF8A 1XA7A 3PBTA 1IELA 2XH9A 2IWDA 2J7VA 2ZC6B 1PWCA 3FKVA 5CTNA 3VSKA 4LV3A 3NDEA 4LENA 3IH8A 2JE5A 3M6BA 4RA7A 4WYYA 1K4FA 1BSGA 5CXWA 4WZ5A 1KGEA 4KZ7A 1FR1A 3RJUA 1G6AA 3WWXA 4MEZA 4OONA 4RX2A 1CI8A 4N92A 1ES2A 4ZTKA 3QNCA 4EBNA 4PM5A 1DJCA 2I72A 5EVIB 5F1FA 1ERQA 1YLZA 3BFDA 1ZG6A 3LEZA 4RYEA 4U0TA 1S6RA 4UHUA 1GHIA 1GHPA 3SS5A 4UA7A 1EWZA 4S2PA 2EXBA 1FSYA 3DW0A 1W8QA 1YLTA 2WZZA 1DJBA 1H8ZA 2XD5A 3MZFA 5F82A 4LV2A 3V5MA 4KZ5A 5FQ9A 4KZ3A 1FQGA 2A49A 3M2KA 3NCKA 2WGIA 3O87A 1VQQA 4WBGA 1ZKJA 2PBYA 1IEMA 1XGIA 1BLHA 3BFEA 3C5AA 1ONHA 4NK3A 3UDIA 2EFUA 1XP4A 1FOFA 3OPPA 2ZD8A 3E2LA 3B3XA 2XF3A 2XLNA 1BLSA 4OPZA 2H0TA 3PBNA 2B5RA 3BFFA 4MLLA 2DCFA 3ISGA 1PYYA 3C4OA 1ESIA 5E2FA 3VP4A 2ZC7A 3QHYA 1TEMA 2WK0A 4KQRA 3LO7A 1IYSA 4O7DA 3VP0A 1XA1A 3MBZA 4KENB 4JXVA 2CC1A 3BYDA 2WKHA 1PZOA 1PW8A 2QZ6A 1BLCA 2R9WA 5FQMA 4KQQA 5HFOA 1YLWA 4WELA 5CECA 3Q82A 1NZOA 3IF6B 3A3FA 4DRTA 3O88A 2Y2GA 4OLDA 5FQQA 5KMWA 1JTGA 1MWSA 2HPBA 3N8SA 4OH0A 3NDGA 4R4RA 4R1GA 2WGWA 1LL5A 3ZVWA 1JVJA 3EQUA 4IEDA 4KG2A 4XUZA 4PM7A 3HL9A 5FQIA 1MPLA 2G2UA 4OPYA 5AQAA 3V3SA 1K57C 1H5XA 2Y2NA 2R9XA 2EX9A 3C7UA 3VOZA 4JBFA 1MBLA 1YMXA 1Q2PA 4DDSA 4H8RA 4N9LA 3UDFA 1ESUA 3FZCA 4DE2A 2ZQAA 5CHMA 4OPQA 1YLJA 3D4FA 5TFQA 1Y54A 5GHYA 2EX2A 5CEDA 3IF6C 5CHUA 4DE1A 2Y2KA 3BM6A 4L0LA 5CEBA 5GHXA 5GHZA 5DTTA 3IT9A 1QMEA 5FASA 4X55A 3PBOA 5EECA 2Y4AA 4WZ4A 4S2OA 5BOHA 3VP2A 4LV0A 3IHAA
chains in the Genus database with same CATH superfamily
1DJAA 4FWGA 5IT9S 2WGOA 3ITBA 3M2JA 2VDBB 4S2KA 2GDNA 3SW1A 3A0SA 1VQO3 4LGYA 2KW0A 2OWJA 1CH0A 5KPTA 1OF5B 3H7WB 4OOMA 3SATA 1X1UA 5CGXA 1NZUA 1R7RA 3KIIA 1IKGA 1JB4A 2BASA 1E32A 4RNZA 5EJCA 2QJ5A 4WM9A 1YI23 3JPUA 2DZOB 2V1ZA 1OGZA 4QJGA 3Q07A 1WNHA 3ZG5A 3GR2A 4ZJ2A 4EWFA 2M7OA 4DDYA 1RGZA 3AL0C 2CFDA 3GLFE 3NQZA 4LRZE 4ARZB 3NUVA 4BBVA 4JXWA 1IN6A 3BEBA 3L28A 2KDLA 2CG1A 3S67A 2LB5A 1HR0M 2P04A 3F1OB 4HP4A 1IN8A 1CUKA 1YE9A 2GX5A 3LIBA 2GSPA 5CGWA 2Y59A 2W9PA 3T1QB 2W1TA 1TTOA 2WYXA 3PBRA 1LL9A 2LVQD 1PWGA 2D42A 3GLHB 5AYSC 4L16A 5AJGA 4XT2A 4MGIE 1ZO2A 2UUBM 1K54A 3V76A 4GKKM 1RGHA 1K55A 1K82A 2Y74A 3ITAA 3MJQA 4WUJA 1D0KA 3BNEA 3DTEA 3OLOA 2Z76A 1MWRA 1N4OA 4WL9A 3UO9A 4EQ1A 1N77A 1BSAA 2IA7A 3HLGA 2WSFF 3CMZA 1W5ZA 1IN7A 1A2KA 1CEWI 4DXCA 1Q824 3CTWB 3QYBA 3VMAA 1G41A 2X49A 4DN0A 1IY0A 1Z1SA 3LIEA 2GBXB 1HJPA 1Q40A 3LEQA 2W3HA 4RVAA 5FATA 3UZUA 2FNQA 1EUIC 2CKFB 1UWPX 1M40A 1AR0A 3F92A 3TOIA 1DY6A 3IJEB 1RN1A 3ZFZA 5FAPA 4BBTA 4HVNA 3SXXA 1Z6FA 2PU4A 1O7EA 1V34A 1TU5A 3IWQA 4K0XA 2CX0A 4MGZE 1MZUA 2R4EA 2HGVA 1T5YA 3UB1A 3RGAA 1OTDA 3E0YA 2OOAA 3OPLA 2PAVP 3LQQA 5IERA 5FQKA 5AIHA 3I7JA 1G96A 1K0KA 1DETA 3GZRA 3C7VA 4AZFA 1RN4A 2I7NA 4KO8A 3CG5A 1AXBA 1S1YA 3PAGA 3FPWA 4L8PA 2WKIA 3TSGA 4EQIA 1BLPA 2XR0A 3OW22 3E4QA 3TRCA 5IT5A 1Q3CA 3PBSA 4JGRA 5CRFA 4A3VB 2YR0A 3QK9A 2XZFA 1XJ3A 2A5YB 2CWBA 3K9OA 2AVXA 4JI5M 4OU7A 4HEFA 2W3EA 2O9CA 4ZJ1A 2V1LA 4GNUA 3S7QA 4HESA 4HBUA 1UGHI 2ZM2A 1PJJA 2CRUA 1XXHA 3CGWA 3SC3A 2XA7M 2WKEA 1IBMM 1SXJA 3SBJA 3RFWA 2P09A 1NRJA 2BG1A 3SHFA 2V1BA 3CC43 3D72A 1BSBA 2Y2LA 2J9PA 2OLUA 1Y28A 1D2NA 3N8LA 3B33A 4IBJA 3LR0A 3MYTA 2O99A 2OQEA 5DF9A 4R6LA 3VFFA 1YUBA 1O7HB 2Y2QA 4GC5A 1OHSA 5D3OA 3BFGA 3U61A 4KQOA 3NI9A 1KE3A 4QHTA 4I4LA 1I2SA 1SCWA 2ZMAA 4DV0M 1SKOA 5HX9A 3V39A 4B4ZA 1UGUA 3SHGB 3B47A 3UNWA 1A67A 2ML5A 1QAMA 1G4AE 3X3XA 1NXYA 4I3IA 1Z6TA 1E4DA 3HU1A 5LMUM 1FNNA 1QJGA 1JNQA 3HBRA 4GRIA 5G1KA 1B2SA 2HJEA 4DXBA 4R0QA 1VQ53 1XJ4A 3W8KA 5HAPA 1T19A 2NQ8C 4Q7JA 1JN5B 2R62A 4J5GA 4RKUF 2W3FA 1P97A 2A24B 3AOEA 4J8TA 3KSIA 3HJSA 2MR9A 2QCUA 3WRTA 3CNMA 1K38A 3U6OA 4L6V6 1OH0A 2Q9NA 3I0YA 4JXGA 2N35A 4RBNA 1YM1A 3CPTA 4KFDA 1ULIB 3UPPA 1PU4A 2VGJA 5EXPA 1KSIA 1CEGA 3G35A 4JF4A 3X40A 1KD14 1K25A 5JPUA 3WS4A 3DOAA 3DH2A 4FCTA 3UE0A 3A0VA 5EPHA 2FH5A 2ZJ9A 1NY6A 3CPW2 3N4IA 2IWCA 1IBKM 3FKEA 1ONGA 4N6NB 1NJ4A 3KSFA 4B7GA 4X62M 2EWVA 5A90A 3HLFA 3JYIA 1FJGM 4PDIA 1L1TA 3GLFB 3IHBA 3KYZA 1ODVA 4X56A 5F1GA 3UB6A 3NC8A 1I2GA 4E3MA 1XXMA 4Y0UA 3DGMA 2Y2JA 2ZL1A 4WW0A 2CFLA 3MG2A 1BRJA 3EQVA 3OCNA 4FR9A 4MBKA 3W4OA 3D8BA 4QD4A 3KKGA 5ITYA 4XB5A 5AIIA 2EKKA 1BZAA 4P85A 4GB7A 1PNEA 3I04M 4N1XA 1G71A 2LVAA 2K6BA 2ZBBA 5ITXA 5ITQA 3AGFA 2KZSA 2C5WB 4OQGA 5HL1A 2RGOA 1RGLA 4EYCA 1DV0A 3CF6E 3O8YA 1J5EM 3I563 1JV2B 1F5MA 2FE8A 4WMCA 5TJJA 3FYCA 1EE8A 2RBIA 2IWBA 2MROB 2X01A 1QANA 4H6JB 5FI7A 3T1XA 3SOIA 3CLOA 3CME3 3BY8A 3HJQA 2E8IA 3ZCZA 1K3XA 1STFI 3HJKA 2VF7A 2Z2MB 2WOHA 3EB8A 3VOLA 1Q42A 2ZANA 4KVHA 4Q0IA 5JYOA 1GY6A 2CE7A 2NUTC 4BJPA 4YFMA 3FG3A 5IU1A 3DMCA 2HCBA 3D4AA 5AQ9A 1LSXA 5EM0A 2G8LA 1G8PA 5J8XA 1FGMA 4DKIA 4P6BA 4UA9A 4WEJA 4KZAA 1X1YA 2HMMB 3CITA 4LF4M 1B2ZA 2ZQCA 3B4PA 4KODA 2VGLS 4IBCA 2KEBA 2VEAA 3CJMA 1HQYE 3C58A 2VGLM 2O3OA 3IWIA 1XMQM 4KG6A 1XPBA 5D83A 3PFIA 2Z4RA 4XBOA 1VQK3 4PPRA 5CHJA 1BNIA 1C3BA 2CHGA 1GJTA 2L2DA 2J3WA 4MM3B 2ZQ8A 2VF8A 3GDIA 2Q2EB 3EIHA 4OVZB 3SEDA 4KQDA 2DAKA 3QP6A 4OLGA 3OPRA 1RGYA 1Z59A 5F69A 4JI8M 1QMAA 3WHOA 2FFYA 3V98A 2H5XA 1O7NB 3FF0A 2ZQ9A 3QRDA 1ZX2A 3FUVA 3Q7VB 4EEPA 4MGYE 3UB8A 4JN6A 1O07A 4JLFA 3T4OA 2OLVA 3CD63 5TGFA 2B3TA 5FSWA 3CCL3 1IM2A 1NY5A 1GOYA 3TWMA 2ZA4A 3LTDA 4BWIA 4FH2A 1E3VA 3CU3A 4GSPA 2B18A 1G68A 1EIJA 5DFLA 4WYKA 1BYWA 2EWWA 1GA9A 5G4ZA 1N9EA 4EBPA 1B2MA 2KZUA 3AV0A 3SH9A 4II7A 1W6YA 3JUOA 4HH2A 5FAQA 5EOOA 2X02A 4REZA 3I553 3MJ5A 1MGWA 2VK3A 1BRHA 1BUJA 4TX4A 4S2JA 2J9OA 2WSCF 4UAAA 4YOFA 5G1LA 3U5ZB 2DRWA 3S7NA 1TDZA 3SARA 5DYIA 3IXHA 3CCJ3 4IBEA 2OOVA 3ZNYA 3GRUA 4DBGB 4J9AA 5KQ8A 2BO9B 3V92A 4N6UA 4ME4A 2XK1A 1GABA 2JNHA 2YFQA 3AMOA 4X2HA 3PBTA 2XH9A 3LIFA 3KO6A 3BW6A 2ZC6B 3QWLA 3VSKA 1ZS7A 2P38A 3IMAB 3K3DA 3NDEA 4LENA 3IH8A 1FGTA 5J7EA 3M6BA 3HJIA 2R0IA 3HK4A 1K4FA 4DR1M 3GECA 2YX9A 3FC7A 4UQIS 4WZ5A 3FTEA 2CH9A 1G5UA 5FEFA 2F5OA 1YLAA 1ZMVA 4EBNA 4PM5A 2I72A 2WKQA 3BFDA 1ZG6A 3DTIA 3J80S 4MCWA 1BNGA 1GHIA 1BRSA 1UCIA 1EWZA 2FZ0A 4F3LB 2LHCA 3LIDA 1W8QA 1YLTA 2WZZA 5F82A 1QUTA 4LZIA 1HZ1A 3MQQA 5FQ9A 4HM4B 1FQGA 1JBSA 5FTKA 2JHEA 3VLFB 3OTOM 1NO3A 4HEOA 3LZAA 4WBGA 2QEX3 3KW6A 1M9GA 2XR8B 2EA0A 1BLHA 3BNCA 1VETA 3OPPA 1Q7Y4 1V33A 3J27B 3B3XA 3KS8A 1TH3A 1YJN3 4AKGA 3GZXB 1HNXM 3GPUA 5ITUA 2LVNC 3BFFA 2DCFA 4ETXA 3C4OA 3LGOA 3P7NA 1NNVA 3VP4A 3FG4A 5IWAM 2LH0A 2JWSA 4LF6M 1IYSA 4MEIA 4KENB 4LRXC 3VP0A 2CC1A 5HL6A 2R9WA 1J7KA 1PW8A 1BLCA 1EA2A 4P6ZS 3SMPA 4X64M 3JUQA 3O88A 2Y2GA 3B7NA 5FQQA 5KMWA 2KXGA 1JTGA 2HPBA 1FUSA 4R4RA 4HJ4A 2D7HA 3CNXA 2WGWA 3ZVWA 1QZMA 3DGOA 4FCWA 1JVJA 3KSHA 3QP1A 4IEDA 5KPRA 1K9M4 1SIHA 1OJGA 3HL9A 4MDZA 2CFGA 3FD9A 1MPLA 3KZTA 2P05A 3HZPA 1S1ZA 4MMNA 3V3SA 4CLCA 4B3TM 1K41A 2R9XA 2C10A 1BVIA 3VOZA 2CEAA 5EXSA 2KNAA 1YMXA 2Y0QA 2JKFA 3UGJA 3FZCA 2ZQAA 1VEGA 5TFQA 5GHYA 5CHUA 4PHTA 4L0LA 1W5SA 3CCU3 3QYEA 1NB5I 3CCM3 5IREB 4O8GA 2VV7A 1QMEA 5FASA 1DYUA 1QVG2 1YHQ3 1WTHA 4I39A 4X55A 2KOIA 2Y4AA 4FWHA 1TP6A 1I0VA 3U6MA 1PFPA 4LV0A 1FA3A 3E98A 1QVRA 1W5DA 2BHMA 4IUKA 4R70A 4O8SA 2G2WA 4OQHA 2QIYA 3NM7A 2ZQDA 3MKFA 2R4JA 8CATA 1N33M 2P0XA 5EP3A 3S29A 2HOHA 3Q1FA 4HIAA 4NXGA 1S723 3H4MA 2RFRA 2GEYA 1JWPA 1BUQA 1NSFA 4NSRA 1NHWC 2R78A 1RGKA 2H28A 3A3DA 4KUKA 1XXHE 1S4SA 4DF6A 4O01A 1W5TA 1H8MA 1SXJE 2VKSA 4R7GA 2FH0A 2X8AA 1YVBI 1RCJA 4GIPA 1GLNA 1GD4A 3KSED 2VQEM 3Q8XA 1NWWA 3C3DA 3K92A 5ITRA 4B3MM 3ZH9B 4LJ6A 2D7GA 1XKZA 4NXNM 2E8JA 2EXAA 4XM4A 2Z8YM 2DVWB 1RNTA 1SHVA 1KVLA 3FH1A 4EESA 3T1YM 3H9WA 3EN8A 5M1AA 2J8XB 4IBRA 5EXTA 4MN5A 2D02A 4F94A 3IX3A 3KS4A 1QDRA 4JI1M 1Z09A 3OXAA 1MXOA 2P08A 4QNRA 3D9RA 4HM0B 4X53A 1OQYA 2F5SA 5EVLA 1RJOA 2CWVA 3IF5A 4KT0F 3HX3A 3CUEA 2SBLA 1ES4A 3FTCA 2F99A 3PAEA 1T2IA 2Y55A 3U6EA 3NJAA 4LMIA 4FMAA 1JQJC 5FSRA 5KP1A 1C7HA 1NJI4 1TTEA 4GH9A 3FYZA 4I4KA 4HM7B 2OPFA 2RL3A 2HP9A 2G7UA 2PHYA 2HMKB 2YNMD 5IENA 1LLBA 3BQ8A 2O9BA 2LQVA 1KE0A 4FMDA 4NSOB 3S1YA 1L2SA 2QSFX 1GJSA 1US1A 4DE0A 3W4QA 4DE3A 5IG0A 1YPRA 4AI6A 3VKGA 3RTYA 2XFSA 4DUYM 1RNBA 3IS2B 3L25A 1RRHA 2OTJ3 3VSLA 4I5SA 1XHBA 1RCLA 2F86B 3EBYA 3MF0A 2Y91A 3RGPA 3U4LP 1NB3I 3KOZE 1L0FA 4Q8IA 1G3IA 3UPOA 5TBMA 2JKTI 4OQIA 2MJ6A 2ZAMA 4AW4A 4QPRA 5EFWA 3P09A 4N6TA 5H37D 3W0LB 5AVEA 4JXSA 3HY5A 3BXWA 3G8ZA 4PCZA 1UUGB 3DGLA 4R3JA 2OAP1 1OAOC 1D0LA 2CX1A 2GEXA 4GKJM 4UA6A 1B21A 3LI9A 4L8RC 1WMPA 4LGMA 5IF6A 3NBJA 2Y79A 1IDPA 3FZWA 3U6QA 1BRKA 3LW5F 2OOLA 1QAKA 1SQWA 2DKLA 2W1TB 2DZNB 3X41A 3H82A 1ACFA 3KP1E 7GSPA 1Q9EA 4EXOA 1EKMA 2KNVA 3QP2A 4I3AA 3M7GA 4HBTA 3LUQA 2Q07A 2J7OA 3SVAA 4NRWA 3IHPA 4GL6A 5ITXE 1HZOA 5GLBA 3GSGA 4FCFA 1FZUA 6STDA 3A3IA 1TR8A 3BLMA 2IMJA 3A5EA 1OGXA 4EERA 3BY9A 3MR0A 1I5QA 5DTKA 3GLIB 1K56A 3FUWA 5BIRA 1FCNA 1JTDA 1AV4A 2CFKA 1SXJD 1NWZA 1YT4A 5A92A 2BTFP 2BWBA 2W3DA 4LJ7A 4P16A 4OK0A 1DMNA 1NYMA 4C6YA 2P5TA 5JPPA 4K91A 4E3JA 4JXJA 3GRJA 4HJLB 4GHAA 5ELJA 4P17A 4E3IA 2L6OA 1Q40B 3PR6A 4W5WA 2W03A 4B88A 1Q814 3BECA 2LYXA 1S5AA 4PEJA 5A91A 1OJLA 2UUGC 2PBDP 3BQAA 3BLSA 5HARA 1L2DA 3G2YA 1JB5A 1UCLA 4LLOB 1Q39A 1W00A 8RNTA 3UB7A 5F6AA 1W7FA 2WZXA 1MJGM 2R65A 4R9LA 2OAQ1 1Y4OA 1OPYA 5IHVA 3SASA 1SDNA 2KF6A 4XBYA 1EG9B 1BNRA 1GS3A 2FFJA 3WHKA 3T15A 3NHXA 3EOIA 4ETZA 4LFBM 2KRKA 3F14A 4GHIA 3NOTC 2JZ0A 2ZAOA 4NL4H 1WA9A 2QHKA 1R2YA 3NX0A 4M0WA 5DFYA 1H6UA 1VQ1A 2DENA 1UGIA 3HLBA 4M4XA 1IXSA 2BMQB 1IY1A 1HTZA 3DWZA 1HD8A 2UXDM 5DRVA 3RNTA 2KRTA 3CWFA 2VV6A 2DAEA 2JDIH 3WS0A 3IXBA 1TS6A 2XSZD 4Y2FA 3D8LA 3B89A 3Q7ZA 3G4S3 2VGKA 4B4XA 2XSSA 2W04A 2BNGA 3K7CA 5KZHA 4KT3B 3EGXC 1ASKA 4IJGA 5FTJA 2F5MA 4OKPA 3K5TA 1W63Q 1NVMA 4S2IA 2V20A 2V0UA 3VKHA 3S7PA 1XXHB 4M3KA 2Y2HA 2L7HA 2QGUA 4FVMA 3FKWA 1LVNA 1SXJB 3A3JA 3HOHA 2PRFA 5JI2E 4HY8A 3WRZA 3CCE3 1GMQA 1OT9A 1CQSA 2QPAA 2PYPA 2A15A 2YFJB 3AGOA 3F1PA 1I2WA 1MKMA 5EOEA 4KG5A 4C75A 5HWVA 2HDSA 4HM5B 2O25A 3V67A 1CK3A 4LF9M 4DV5M 4CPKA 1GL6A 5RNTA 2PDRA 5E2GA 4QWOA 4GOGA 1PJTA 4GC9A 1F4IA 4AFIA 3U61B 1LOVA 2KX6A 2RCDA 4CGYB 2QBYA 3BWLA 3IQAA 4RQ9A 1Q2QA 4BLCA 3ZQJA 3KYQA 4L4UA 2STDA 1CQAA 4B9OA 1L8QA 3JVVA 2YKHA 3UE3A 3FYDA 4IHQA 5G18A 1ES5A 3GO8A 4R3BA 4PM9A 2W2CA 1OF5A 4LF8M 4Y3IA 3IG8A 1IV9A 3ZHHA 1IVWA 3LOYA 2XD1A 1VEJA 2YKFA 2M7UA 5BU4A 5CERA 1N32M 4ZM8A 3TJZC 1P0ZA 1MN3A 2M1CA 4EU0A 3WS2A 1JZOA 3NXJA 5M18A 1PJSA 4GD6A 8CHOA 1RGAA 2XZUA 1Q3BA 3ECFA 1BU4A 4HOIA 1EI5A 4WMCD 2PR5A 1WR1B 2WKRA 2OQ4A 1CF0A 3M6AA 4LJAA 3CPTB 1P9RA 1XFNA 2PZVA 3LFVA 4YNRA 4FMBA 1IOUA 4EV2A 1SDEA 2JKTM 4HH3A 3HVFA 1T3TA 4CJNA 4EW7A 1CYUA 3U6DA 5HW3A 1TS8A 1BSDA 3ZG7B 5KSHA 4NEED 4Z9QA 4MN7A 1JR3A 3OPHA 3KYEA 4Q0HA 3EC9A 1XX2A 3KSXA 4D80A 2G3QA 4HL4A 2PD7A 3UMMA 4LPZA 2BMOB 3EBTA 3V50A 5LMNM 1P9WA 3GQ3A 3WA2X 5F83A 4N3VA 1V57A 1D06A 1W7CA 3H4JA 3KE7A 2Y2OA 5GLCA 4FW9A 3WOEB 2JN7A 3PXPA 2V8FA 1SG9A 2AADA 2DZLA 3BIRA 4QNMA 1D6ZA 1R5LA 1B2XA 1VQM3 3T4LA 1FCMA 3GWRA 4IBGA 4ZPXA 4R4KA 1PJIA 2IY2A 1BNFA 1IXZA 5IG5A 3SS3A 1QVF2 3RXWA 5AYRB 3UJNA 4N1HA 1GSWA 1NHGC 1W6GA 4S2NC 1WMNA 3NQYA 1A90A 2I7PA 3RXXA 3AGDA 3ICYA 3V3RA 2QMIA 3DZDA 1BUEA 4CLCE 2EKFA 2UUCM 4CCVA 2DI0A 1K57A 4Y28F 3WS5A 4K61A 3GPXA 1T3BA 3CZDA 3MG1A 3D5IA 5EXXA 2Y2IA 2V0WA 2C96A 1ERMA 2M60A 3AHWA 3SOYA 2RRUA 4NXMM 4B3SM 4GZBA 4Y15A 4C3QA 1U60A 1JJ22 4U13A 2HZ5A 4Z1WA 3IF6A 4NETA 2WUQA 2V1CA 4HM2B 3OX9A 1N9JA 2D01A 3EQQB 4OP8A 1TJDA 1PWDA 4GJ4A 2F98A 3PNVA 3DZLA 3GZYB 1O7PB 3KFUG 3KOWE 1XA7A 4B3RM 2J7VA 1N8R4 5HDCA 3WOFB 3OV4A 4FMCA 4N6V0 3FKVA 4DR6M 2H0IA 4WWUC 4WYYA 5D81A 1BSGA 2LXEA 4K0KM 2AHMA 3EN1B 2JP7A 1HNZM 1H3QA 1KGEA 4KZ7A 1FR1A 3WWXA 5GKNA 1JB2A 5C5KA 4HM1B 1CI8A 1NV8A 4ZTKA 1RSNA 1VQ73 4JGPA 2Z6CA 4MGKE 3E99A 1ERQA 1YLZA 1JBTA 3LEZA 4U0TA 4UHUA 1S6RA 3RDEA 3LYXA 2ZTCA 3PYJA 4UA7A 3SLUA 2I9VA 1D0MA 4AEQA 1K3WA 1GY7A 1H8ZA 3EIEA 4L15A 3F7XA 1HU9A 1VQ43 2CFOA 3R7WA 1XFQA 1OFIA 4M0DA 4ITQA 1Y4KA 3GSPA 4JGOA 3GAXA 2PBYA 1BVSA 2RNTA 2HMJB 1G59A 1LNIA 1IEMA 7CATA 1W01A 1DP8A 1ONHA 4NK3A 1XP4A 5FTNA 3W68A 2XROA 3EJVA 5AIFA 3VSYA 3L26A 4WYKB 1BLSA 4AQYM 3SYLA 2F5PA 2H0TA 2BNKA 3FCSB 1G28A 4MH0E 3ZYTA 3EWKA 5E2FA 1BNSA 4NKPA 2ZC7A 1TEMA 3PZWA 3NECA 4KQRA 2C9CA 3CAXA 4DR5M 3BYDA 3DA1A 2QZ6A 4LJ5A 2VZWA 5FTMA 2A24A 1WQLB 3Q82A 1NZOA 1WGLA 4IJEA 3A3FA 4DRTA 4M9XA 3T12B 4CDLA 3KXEC 1XWIA 1DGFA 1STDA 1ZQ9A 2DWNA 4OH0A 2FNAA 3KP0E 3HHYA 4HJ3A 4GLQA 3KSJA 2E2VA 2QQ8A 3EQUA 4KG2A 2O0YA 6GSPA 4XUZA 2WOFA 1D6YA 3Q2PA 3EGDC 2INWA 2HAKA 7RNTA 3T4QA 3I51A 3GLGA 3BLZA 4JF8A 3HHWA 3T4JA 4WP5A 5EQTA 4IBKA 3X42A 4JBFA 3WA3A 4JV5M 4XBTA 4H8RA 4N9LA 1ISKA 4YY3M 2J5YA 3D4FA 2WGQA 2EX2A 1JZDA 4HM8B 4XK8F 2Y2KA 3BM6A 4CLCD 2Z3XA 4HAAA 2ML6A 5L8RF 1BSEA 3UL6A 1BIRA 3A76A 3LVWA 1RHLA 2L09A 3GPYA 2RKOA 4CISA 2SARA 4K90B 1D7EA 4ANRA 2O01F 2W6JH 3M8CA 1VQP3 5FEGA 4BB9A 2XEPA 2Y2MA 1ZC2A 5K5BA 3PS8A 3LCEA 3T4TA 1HT1E 2BJVA 1G02A 1MNLA 1NY0A 1YVSA 2Q0OA 3TE6A 1S4RA 1K6RA 4MB7A 3FV7A 4ZAMA 2CHCA 2HP5A 3HWSA 4Y7PA 2R41A 2DWZB 3D3OA 4GKUA 4PKYA 4G3VA 1L1ZA 1S0WA 4AG6A 4FTXA 3UN7A 2HP6A 4GW9A 3MHVC 1ORYB 3ZG9B 4EIWA 2PR6A 5E6JA 2GU3A 3JUMA 1F98A 2P7JA 1I8VA 3VE4A 4JI0M 3NV0B 3AGEA 1W8YA 4GN2A 4H6JA 4IBFA 3CPOA 3UB5P 1UW1A 3DUKA 4QOZC 1YGWA 5EP1A 3W2ZA 2BJWA 3ZC7B 2HMLB 1DVCA 3CCQ3 4LF7M 3UB9A 2B95A 1WYCA 2WGWB 4H3UA 4LZJA 4GMQA 1UI8A 5EP2A 2ZC4B 1WIVA 3U6PA 4IVIA 4D2OA 4GDNA 3T1SA 1GYBA 3TE8A 1IYQA 2HL7A 4UQIM 4CLCB 3VV4A 1IQ8A 4KZ9A 4JKTA 4Z8XA 2GU1A 2DWLA 4PT5A 5AIGA 5A0OB 1F2KA 3FSDA 2R18A 4L9FA 1ZMUA 4M9ZA 2JUJA 3PBQA 4BTWA 3X3YA 4L8OA 1YGEA 4E3LA 4E3NA 1CJFA 1NU3A 1LI9A 2HKJA 1GSXA 1EROA 1KYIA 1V74A 1CI9A 2OSUA 1W4NA 2H0YA 1RMSA 1VQL3 4IBBA 3MFDA 1MKIA 3CC23 4I81A 2JQ5A 1YKDA 1ZV1A 1TDGA 1E3RA 4R23A 5C18A 4BENA 4MGHA 2HDQA 4WP2A 1LL8A 4QY6A 1WJ7A 3UK6A 5IEPA 5HOHA 1RKYA 4DR2M 3S5CA 3L9KA 2H1RA 3SAUA 1N9LA 1PM5A 2CG0A 2PU2A 3VP1A 3NM2A 3UPNA 1VQ93 3GVBA 3K63A 1VQ63 1PFLA 1N9NA 4AKZA 3G34A 3HLDA 4WURA 1NJFA 3N8BA 3L7HA 4G4RA 1W02A 5G4YA 5ITTA 2LNHC 3OC2A 4P6ZM 5GL9A 2JC7A 3KX0X 5FW5A 1PIOA 4ZBEA 3U60B 1QUSA 4QY5A 5AVFA 3GZBA 2C99A 2XSHB 2BWEA 2BIRA 3LT9A 1TDHA 5STDA 5IW9A 2ZM0A 4R80A 3TWKA 4WLAA 1DGBA 1IBLM 2PT7A 3SOAA 4LV1A 2W0NA 3K2LA 1ZTUA 1I3IA 3DTKA 5D82A 4MBFA 3CHWP 2KA6B 1O7GB 2UV0E 2UGIA 3WODG 3VP3A 4EUVA 1W2ZA 1TFKA 3J7AS 4Y17A 3O86A 5EE8A 4L9EA 4L9GA 1T2HA 3K0ZA 2V1UA 2Z2LB 2QWSA 1STZA 5HSQA 4OVDA 4BBUA 5BR8M 2R6FA 5FGOA 1DGHB 1YLPA 1BRIA 3HLCA 2LWXA 1RCKA 4BTYA 4JI3M 3J81S 1UCKA 5TGNA 2W56B 3NOPC 2KNZA 1OIZA 3S27A 3BJNA 4OVMA 3BBZA 4Y0OA 2ZBKB 1NO1A 3VDPA 2K54A 3AHSA 1MOLA 4KFFA 1YAXA 1RN7A 5DKKA 3ZDJA 5G2GA 4MN6A 3O5YA 1MGRA 3LR4A 3U6CA 5EUAA 4LFUA 3W0FA 1N9BA 1YJW3 2KLIA 2E2UA 3LY3A 2XGNA 4K1UA 3T38A 1PRBA 1IV7A 1HYFA 1JKGA 2K0BX 4LYLB 3FF2A 4BQMA 3WMDA 2MGWA 4Y13A 3T50A 1TH4A 3BOSA 1SPUA 1K54C 2QJ7A 3B7QA 1K55C 1S67L 3JVUA 1L0GA 4OQ0A 3N7WA 3ILKA 2DNSA 2DXIA 1JR3E 2O5RA 4PMAA 5TBMB 3B74A 1QQWA 2B02A 3HREA 4JRFA 4IVKA 1U5OA 1OFHA 2JKGA 2XRNA 3J7BA 4WF0A 1SZVA 1Z5BA 1RDSA 5HZHA 5ELUA 3OCLA 3A46A 1L2CA 5HPIA 1BANA 2HJ9C 4FSFA 4LRTA 2JY8A 3A0RA 2ZDJA 1E3UA 3A3EA 4G4OA 4EV4A 5HAQA 4LJ8A 4ZRRA 2KHHA 3MZDA 1LQGC 5AQBA 2KF3A 2F5QA 1WMOA 1XMOM 4NREA 4NXEA 2JZ1A 1GSPA 4L78A 4PM8A 2DWMA 4RF0A 1L3LA 3BFCA 4FH4A 3V99A 3RGRA 3MHEA 3LXUX 3H82B 3NIAA 3G2ZA 4E04A 1Y8GA 4X65M 2WZJA 1MU5A 3CCV3 5DKLA 1SIIA 1N8QA 1OJ5A 1C54A 2V6ZM 1X1XA 2F4YA 3F9SA 2UWXA 3LTBA 4FD8A 4RX3A 1JWZA 3E46A 3AFHA 1BAOA 3IX4A 3W4PA 1MX0A 3HX8A 1B20A 5AQ7A 3AOGA 3GP1A 1YJ93 4EEUA 4NXBA 1NRFA 1TS7A 3S4XA 2JY7A 4N6OB 1FYSA 1E25A 2YFIB 1PW1A 3DXOA 3RH8B 3J2PB 4E3KA 4LEHA 4WN5A 1GKIA 5LBRA 4GD8A 1VM1A 3EEAA 4EBLA 1SXJC 1LSWA 1GL7A 2P9VA 4QHSA 2EFXA 4I3JA 2HMOB 3G32A 4HKVB 2CW9A 3MZEA 2WSEF 3WHLA 4KZ8A 1DO0A 1AUAA 1NDOB 5KO3A 1MC0A 5J4EA 1QDTA 3SFZA 5LC7A 1IXRC 2KXEA 5I97A 4DR3M 1T43A 2JBFA 2HDRA 1FR6A 4A5RA 2Y0TA 1GOUA 2CFWA 2FGTA 5GSPA 7STDA 5AEWB 3S28A 1LHYA 2OQEC 3Q3FA 3P01A 2Y20A 1N78A 4RNYA 1PI5A 1UM8A 2FXTA 4TUWA 2Z6BA 1TDLA 3N8RA 4LFAM 3K8ZA 1SARA 3CF0A 4NC6A 2R44A 4DJ3A 1LQMB 1A2VA 5CXOA 3KVWA 2PYRA 1RGEA 4MMYB 3NWLA 5A93A 2BLSA 4B08A 3LY4A 2Y73A 4EC6A 1E97A 3T4KA 5L10A 1XB2B 2CIUA 1BGSA 3U97A 4XT2B 2R45A 2GXFA 4F2LA 1B27A 4LRYC 2XGLA 2IA2A 3DY5A 3OZHA 2DHRA 2H0GA 1PI4A 3FG8A 3TW8A 1BULA 1L0EA 2YQZA 2MJ5B 4NHFA 3URPA 3FTFA 1UCJA 3AOEC 1TGUA 4E6WA 1IN5A 3E2KA 4NPBA 2A3UA 3HUOA 1RGFA 5LC6A 3NY4A 4HI4A 5EVIA 5FL3A 3EEHA 1PYLA 1JR3D 2RGHA 1OMEA 4KHPM 2K0MA 2EA9A 3MQOA 1MY8A 2M7VA 3A45A 1LOXA 1NJGA 2OO9A 4X2OA 1IQPA 5FDHA 1I2EA 1YIT3 1J9MA 2DNAA 1YQSA 4MMZB 2W0QA 3FTDA 6RNTA 1T1CA 4XGIA 4IBXA 4LJ4A 1H8YA 2AAEA 5I94A 1IYOA 3D79A 3HHXA 3KOYE 2JXNA 4XBXA 3GQ4A 3FGYA 4LCMA 1FILA 2C5RA 1L0DA 2KAAA 4EETB 1KWIA 5E43A 3HCYA 1BTLA 2QA43 1T18A 5CGSA 1CEFA 2C4BA 1WE4A 3IS2A 3FLJA 3GLGE 3PYPA 4LGWA 1I0XA 5FI2A 2Z4SA 2E2TA 4K0WA 4GS9A 3JR5A 1B3SA 3G4PA 2BMRB 3SYKA 3Q81A 4RNAA 4P0MA 4WHAA 3FRIA 4G6ZA 1JRQA 2CC3A 2VQFM 1FGRA 4BTXA 3G0KA 3SH7A 2J3TC 3DAVA 4IPBA 1M1XB 4BL3A 2HHHM 4HLQA 2ZLYA 4N9KA 1S3SA 3EHCA 4YINA 1YNVX 4OOYA 3HJ8A 3X3ZA 3M0EA 4R1KA 1VEUA 1XGJA 1J3WA 2YFLB 1IVXA 2LTUA 5C1BA 3I4VA 4G4NA 1RGGA 3DTMA 1Z5AA 3NBRA 2HF6A 1DMMA 1T1BA 1IELA 2IUJA 2IWDA 3L0RA 3AJIB 1OPXA 2ZOIA 3L2AA 2ERCA 3S7OA 1YSYA 5CTNA 3AKZA 4HZ9B 2JE5A 3B8LA 2QHOB 4O2HA 1OIPA 3EF8A 1G6AA 4B7FA 3TPZA 1YSPA 4JI2M 3QNCA 4HQAA 3MG3A 1DJCA 5E26A 4UN2B 4JYAM 3F1NA 1GHPA 2R4IA 2P0MA 3SS5A 3T0UA 3NOUC 4S2PA 5F3WA 1GO5A 1UUVB 2EXBA 1FSYA 2JA2A 3KOXE 5JI3E 3MWZA 3VE3A 1V92A 1OTAA 3R4KA 3GLIA 1SKOB 5CX7A 3FUTA 3FUUA 4KZ5A 3C8CA 3TQSA 4GHLA 2A49A 5JBSA 1S66L 3C30A 3NCKA 1W2B2 4IJFA 2V9AA 2OWPA 3NBBA 2J3TD 3D5GA 3DGNA 1R4YA 3BFEA 3OWSA 1N5HA 2GJ3A 3C5AA 3H7WA 3UDIA 2EFUA 1VQ83 3CXC2 1FOFA 4CJ6A 3E2LA 2L0WA 2B1XB 2MF7A 2DAIA 1M904 2XLNA 1D6UA 3FG1A 2B5RA 3FPVA 3NBXX 5IZ7D 3ISGA 3KCHA 3E4OA 3OBFA 3A98B 1ESIA 1GVNA 3QHYA 2WK0A 4R9KA 4O7DA 2GBWB 3MBZA 1ZMWA 4JXVA 4J5KA 2WKHA 4JGQA 1IU7A 1EEJA 5FQMA 4ARZA 1IT8A 4PDGA 1PY3A 4D60A 4KQQA 5HFOA 3F1OA 4WELA 3IF6B 2LVOC 4OW0A 9RNTA 1VB6A 2OCTA 4OLDA 2ZHXB 1GMRA 5CF2A 3NDGA 3UMDA 4R1GA 4LCBA 1RU3A 1J09A 1DMQA 3KFQC 5CK6A 1LL5A 3E4PA 3Q90A 2XSOB 3FRHA 3GRYA 3K1JA 1HQCA 3E4RA 3IECA 5HD3A 3GLHA 3N9HA 4FCZA 2G2UA 5AQAA 1I2FA 1H5XA 3FUXA 3B9PA 3U6SA 2CV2A 1AQZA 2EX9A 3C7UA 2DAMA 2DHYA 4G3OA 4LY6A 4KLNA 3H3HA 2XA7S 1AVKA 4MMXB 4DDSA 3UDFA 4DE2A 1QAQA 1GOVA 1T6OA 2WO0A 1YLJA 3UJMA 1Y54A 3TDGA 4K1VA 2L1SA 4DE1A 2ZL1B 2INXA 3RE8A 1XJ2A 3GRVA 3E9SA 2OOVC 3D9YA 3PBOA 5EECA 3MSOA 2QZ4A 1DP9A 4S2OA 3KSGA 3MQ0A 5BOHA 3N54B 3VP2A 4Y5FA 3IHAA 3R7WB 5DREA 5F68A 4B93A 1A0KA 1G6OA 1W79A 3VDUA 4DV6M 1YMSA 2ZM6M 1R2ZA 4N6MA 4WZ5C 5DYGA 1AVLA 2Y21A 1LOYA 2Z77A 4XUXA 4LRSA 3Q8GA 1OUNA 3IPTA 4JI7M 5IG4A 4LG2A 4Y0TA 4JI6M 3D3LA 3M6HA 3I4YA 3DBAA 1HKXA 2KRUA 1DRMA 4DJ2A 4BU4A 3U1WA 4RZMA 4HOHA 4NOOB 1QAFA 2L4EA 2CV0A 4AKHA 4LSOA 3CCS3 2WAFA 4S2LA 2FOIC 2OTL3 2CHVA 1JWVA 4N6LA 3IXGA 5L2FA 4DR7M 1D1JA 2XSZA 4HYZA 3IH9A 5U47A 5DF7A 1K4EA 3MKIA 1CYVA 1ZG4A 1N9OA 4Q0JA 3DM8A 3ALAA 2WKPA 5CTMA 1ES3A 2CUZA 3CCR3 3AGNA 1FW7A 2FS1A 1N75A 3ULFA 3HU3A 1E94E 3MSHA 3SAVA 1C1KA 2H5SA 1KQS2 3BU4A 3DWKA 1C7YA 1N5PA 1V58A 4JF5A 4OOLA 2PNCA 3GLGB 1JBRA 1GMPA 3UNLA 4EV5A 1LT0A 2PD8A 3MXSA 3RFBA 2ACGA 1I70A 1IVUA 1ZGXA 2LBCA 3F8XA 1N36M 3HLWA 2VV8A 2HMNB 5DNYA 1UUWB 1E9SA 1GA0A 5HWTA 5JYPA 1IN4A 3MMPA 4AKIA 1EW0A 3QNBA 4KZBA 1Q864 3RGSA 2VX8A 3HLEA 4MBHA 3BRMA 5FQJA 3SS4A 3O3VA 4LJ9A 3R9XB 2WADA 3N6IA 4CQHA 3LI8A 2Z7AA 1TRPA 3G31A 4LCLA 1OTBA 1BOXA 1OTIA 3LT8A 1LRAA 4BL2A 1KDSA 3GV9A 2UXBM 5DJTA 1V9YA 3UY6A 1VG5A 3JUPA 4CLCC 1FUTA 5FAOA 3SYUA 1TF1A 3PCSA 5DFXA 4HNBA 2WAEA 4JPMA 4FWDA 4WEKA 3ZGAB 4UEYA 3QAUA 2GNOA 3G713 4FCVA 1BT5A 3BNDA 4GB5A 4X68A 2BU4A 1WHCA 3PHYA 1JN5A 3PXMA 5M19A 1KDWA 3GQ5A 2P74A 2L4VA 3H51A 4HM6B 4O3VA 3PTEA 5EP4A 1QZEA 3B4OA 1BRNL 3Q1CA 3MK6A 2W1RA 3G6OA 1IKIA 3HUNA 4EUZA 1IYPA 2KCDA 2EX6A 3PXGA 4L7KA 3ROBA 1QMFA 3FE3A 4S12A 3KSPA 1DE3A 3TG9A 4GITA 3DFZA 3AMOB 1M1K4 1T1AA 2JKRI 4HBRA 4X1LA 3STDA 3CC73 2X71A 4RF1A 3LMMA 5KP3A 1IFYA 4OP5A 3IXDA 2Y2PA 4U0XA 3MKEA 3PVSA 5HAIA 2QNJA 2WGVA 1DP6A 4KZ6A 3WS1A 2XDMA 5AI1A 4F1IA 1LSVA 2C6WB 2H10A 1IT7A 3LTAA 4IT7A 4EBGA 1KC84 5F5YA 3FWLA 2JY5A 3HI7A 4ORLA 3B7ZA 3GPPA 2ZC3B 3JAMS 3MXQA 3GLFA 3PCRA 1N34M 2APLA 1O7WB 3L27A 4FD2A 1LOWA 1YSQA 1OACA 3OOVA 3QP5A 4FUWA 4ESPA 3QP8A 3OWYA 4PKYG 1E9RA 4Q53A 2RCXA 1K8A4 1KSFX 2J8YA 2W82A 4YHHM 1GY5A 2ZM8A 4BD0A 5EEOA 1VETB 2ZC5B 3HU2A 4IUHA 3HKPA 5FA7A 1IQYA 3F7SA 2QP9X 3CUEC 5EVEA 4WFOA 4CIZA 2H0HA 4U3TA 3C9PA 3GMWA 2NUPC 1IVVA 3ZNTA 2V2FF 3GQZA 4R3DA 3SH8A 1LXEA 4FCJA 5HD5A 3R8FA 1I4WA 1P3QQ 1O7MB 3S22A 1TD5A 2K9DA 3LTCA 4DV7M 4DUZM 2L1MA 1SKFA 5FLXS 2K3DA 2W3GA 5IG3A 5I5LA 3ZVTA 3UE1A 1K6SA 3NBLA 3U2AA 3UMEA 1EFUB 2HWJA 2UUAM 4OX9M 1X1WA 1KE4A 2Q9MA 4ZJ3A 1YLYA 1IK3A 4ZDXA 4YWZA 3WDGB 3UE6A 3UL5A 1QYRA 4MJDA 2V1AA 3NBIA 3U6LA 4X6TA 3K9MC 4HJ6A 3MXRA 3C3EA 3LYGA 5L09A 4IBDA 1E3UD 1QAOA 4NRVA 2B24B 5IEOA 4DV2M 1RLSA 1LI0A 4KZ1A 3G6E3 4EXRA 2XQZA 3W67A 4MNRA 1VDLA 4IIWA 4D81A 3LICA 2O9UX 2FFFB 4S2NA 3J7Yd 1X37A 4BIRA 3VFHA 5HPFA 4AKYA 1IYYA 2CK3H 4S2MA 4R4SA 5IS1A 4ID4A 3PGBA 1IQXA 1VQN3 2UU9M 4M9SA 5HGRA 5L07A 3PNYA 4OVZA 1UI7A 2D7EA 1L5GB 1HVBA 3GTCA 2OWHA 1NLYA 1HT2E 1FUWA 1NNJA 2ZMVA 2OV5A 1AY7A 4FOFA 1FCOA 4X25A 1KFVA 2QYBA 1BRGA 1ULJB 3P98A 3T8NA 3Q7VA 5HWWA 1I94M 2UX0A 2LHGA 1ALQA 2ZOHA 5BXQA 4PAUA 3VK7A 3A42A 3T1RA 1JKGB 2K7SA 1TRQA 2CWTA 2DAGA 5HDDA 1RP5A 2J80A 1R4GA 4KUOA 4O0PA 1OTRA 1BNEA 4QU3A 4G3KA 3KN4A 5DJUA 2GNXA 1OCVA 1DO2A 1ZHHB 1RTUA 3HIGA 1MWUA 3B7CA 3EE1A 4BLMA 1H0MA 1MWTA 3LVVA 1Z5CA 3IWOA 1F8NA 5CF1A 1VEKA 2CWUA 2F5NA 1M6KA 1KGFA 4BBAA 5EVIC 2F56A 4OPRA 1EQKA 1DGGA 3LMLA 3ZG0A 3UDXA 4K08A 3U5ZA 4DR4M 5GLDA 2LB9A 1PJQA 5DVAA 1NV9A 3F40A 3ZG8B 3NV0A 1B2UA 1J2BA 2ZQ7A 1G0TA 3VF1A 1PGYA 1OAIA 4STDA 4XXRA 3SZTA 1ZAEA 1IFQA 3MPHA 3GLIE 3T1HM 1RGCA 5E2HA 2RGQA 1LNHA 1RRLA 1FSWA 1GCEA 5DTSA 4X69A 2CP8A 1TF0B 1PZPA 4DMZA 4GHOA 1TS0A 5A8BA 4QB8A 2C98A 1X0OA 3L29A 3JUNA 1R6BX 4DV1M 3ZQ5A 2O9AA 2MH8A 2K47A 2JKRM 2EX8A 4QWTA 1ROAA 2M5ZA 1XJ6A 2EUCA 5FI6A 5KSCA 5TR7A 2MC8A 1NNUC 2VIIA 4E3OA 2EJSA 4F3LA 3K2NA 3MFXA 5GLAA 4DV4M 3BB9A 4XDWA 4AG5A 4ILFA 1K56D 5E2EA 2KF5A 2OOBA 2HDUA 5EVID 1TVFA 3VOYA 3BNBA 1L2BA 1GHMA 1KVMA 3E21A 2CMNA 3ZCBB 1Q7HA 2QPNA 2JCHA 1F9IA 4LF5M 4QHCA 1JNUA 1HLUP 4GEWA 1WGNA 3OWUA 2P9VB 1K28A 2L7IA 2XFTA 4B7HA 4LZZA 4HZBB 3GLHE 2F4VM 4OUQA 3G16A 5EQLA 3K3CA 3I01M 1TIJA 2EO2A 1WYBA 3HUMA 2K2NA 1FGQA 4XDVA 2LVPC 4E6XA 3THGA 4PM6A 3C4PA 2F5WA 2JY6B 3LR5A 3G30A 1U8CB 4X1MA 4BD1A 1NYYA 3VGNA 1V9ZA 3NULA 1VHMA 1HNWM 5J3WA 3IBRA 1KOUA 2HV1A 3HIIA 4KZ4A 3LH4A 3MS6A 4Z6YA 2VJWA 3LCUA 4GDBA 1W63M 3U60A 3F8HA 4P87A 4I38A 1XC8A 1GD3A 2DMWA 4GCZA 3TL4X 4PD2A 1KGGA 2RSXA 1Q02A 5DF8A 2W27A 4QOSA 2X4AA 3CMA3 2GQFA 2D1WA 5BPVA 1PWCA 4KFEA 4LV3A 4I5QA 1A5TA 2ZL8A 3SMSA 4H61A 4RA7A 3JR4A 2E5LM 1UWNX 4JF6A 5CXWA 5EM1A 3C38A 1OKSA 2W9QA 3SAWA 1NLZA 3RJUA 3KDSE 4FCMA 1OHOA 4IIAA 4HM3B 1OT6A 4MEZA 4OONA 4RX2A 4N92A 1QALA 1ES2A 1GSVA 3K9PA 5MC7A 1FIKA 5EVIB 5F1FA 3CI6A 4RYEA 5KIZA 2L4RA 2KDKA 1DGHA 4I8OA 3B42A 3TWLA 2BT3A 5HDSA 1JB0F 5KPZA 2W56A 5EV0A 3DW0A 1K734 2GZAA 3MZFA 1OHPA 1WXQA 3LQRA 1DJBA 2XD5A 3IG5A 2IUKA 5BVBA 1XNQM 1TUHA 1DVDA 4KZ3A 2G5GX 4LV2A 3V5MA 3M2KA 2WGIA 3EX9A 4LGQA 4RNTA 5L8MA 1UDII 3O87A 1VQQA 1IY2A 3GRRA 3ER7A 1ZKJA 3QP4A 2VA0A 5FTLA 1XGIA 1R4CA 1LV7A 2ZD8A 3CF2A 2XF3A 2C11A 2QENA 3LCVB 4BMWA 4GHIB 4OPZA 2KF4A 4LFCM 3MMHA 5FDSA 3PBNA 4NXFA 4MLLA 2K31A 1PYYA 4D82A 3T4SA 2V8CA 3SX1A 4GS9B 1ROVA 4G4QA 4JI4M 1VDDA 3LO7A 1IXSB 4EW5A 1XA1A 1A2PA 3LR3A 1PZOA 3HHZA 5CECA 4G1MB 1YLWA 2R46A 2C9OA 2IYJA 3C2WA 3JVCA 5KP4A 2CV1A 2I9WA 1MWSA 1VEUB 3N8SA 3WR2A 1YIJ3 4X66M 5EVHA 2CHQA 2XRXB 4PM7A 1TH2A 1I3FA 3T8UA 1PRQA 5FQIA 2XLJA 2ZMFA 3T6PA 3VK8A 1OTEA 2Y8HA 4R38A 3IX8A 4OPYA 1TFOA 1K57C 2Y2NA 3VFDA 3DGYA 4HP9A 4G3WA 4R71A 1BSCA 2J7NA 1MBLA 3F1PB 2L4FA 2QKPA 3LIAA 4IBIA 1Q2PA 5KQDA 1ESUA 2Z6DA 1LTMA 5CLKA 5CHMA 3NHQA 3IBJA 2UXCM 1W6CA 4OPQA 4DV3M 1BNJA 2ZTDA 4R3AA 5CEDA 2VLGA 3HZJA 3IF6C 5CEBA 2Z7JA 1XNRM 3F1NB 5GHXA 5GHZA 5DTTA 5AEUB 1AIPC 3IT9A 1FGOA 3FKAA 4HHDA 2QBYB 1AWIA 4O02B 1SJWA 2A2LA 5A2QS 4WZ4A 1UFZA 3HGIA 3GRDA 4CHTB 4NG2A 1VZZA
chains in the Genus database with same CATH topology
1DJAA 4FWGA 5IT9S 2WGOA 3ITBA 3M2JA 4S2KA 2GDNA 1VQO3 4LGYA 2KW0A 5KPTA 1OF5B 4OOMA 3SATA 5CGXA 1NZUA 1R7RA 3KIIA 1IKGA 1JB4A 1E32A 4RNZA 5EJCA 4WM9A 1YI23 2DZOB 2V1ZA 1OGZA 4QJGA 3Q07A 1WNHA 3ZG5A 3GR2A 4ZJ2A 4EWFA 2M7OA 4DDYA 1RGZA 3AL0C 2CFDA 3NQZA 3NUVA 4JXWA 1IN6A 3BEBA 3L28A 2CG1A 3S67A 1HR0M 1IN8A 1YE9A 5CGWA 2Y59A 2W9PA 3PBRA 2WYXA 1LL9A 1PWGA 2D42A 3GLHB 5AYSC 4L16A 4MGIE 1ZO2A 2UUBM 1K54A 4GKKM 1K55A 1K82A 2Y74A 3ITAA 3BNEA 2Z76A 1MWRA 1N4OA 3UO9A 1N77A 2IA7A 3HLGA 1W5ZA 1IN7A 1A2KA 1CEWI 4DXCA 1Q824 3CTWB 3VMAA 1G41A 2X49A 1IY0A 1Z1SA 2GBXB 1Q40A 4RVAA 5FATA 3UZUA 2FNQA 2CKFB 1M40A 1AR0A 3TOIA 1DY6A 3IJEB 3ZFZA 5FAPA 4HVNA 3SXXA 1Z6FA 2PU4A 1O7EA 1TU5A 3IWQA 4K0XA 4MGZE 2R4EA 1T5YA 3UB1A 3RGAA 3OPLA 5FQKA 3LQQA 5IERA 5AIHA 3I7JA 1G96A 3GZRA 3C7VA 4AZFA 2I7NA 4KO8A 3CG5A 1AXBA 3PAGA 4L8PA 2WKIA 3TSGA 4EQIA 1BLPA 2XR0A 3OW22 1Q3CA 3PBSA 5CRFA 4A3VB 2YR0A 3QK9A 2XZFA 2A5YB 4JI5M 4OU7A 4HEFA 4ZJ1A 2V1LA 4GNUA 4HESA 4HBUA 2ZM2A 1PJJA 1XXHA 3SC3A 2WKEA 1IBMM 1SXJA 3SBJA 3RFWA 2P09A 2BG1A 3SHFA 3CC43 2Y2LA 2J9PA 2OLUA 3N8LA 1D2NA 4IBJA 3MYTA 5DF9A 2OQEA 3VFFA 1YUBA 1O7HB 2Y2QA 4GC5A 1OHSA 5D3OA 3BFGA 3U61A 4KQOA 3NI9A 1KE3A 4QHTA 4I4LA 1I2SA 1SCWA 2ZMAA 4DV0M 4B4ZA 5HX9A 3V39A 3SHGB 3UNWA 1A67A 2ML5A 1QAMA 1G4AE 3X3XA 1NXYA 1Z6TA 1E4DA 3HU1A 5LMUM 1FNNA 1QJGA 1JNQA 3HBRA 4GRIA 4DXBA 4R0QA 1VQ53 3W8KA 5HAPA 2NQ8C 1JN5B 2R62A 3AOEA 4J8TA 3HJSA 2QCUA 3WRTA 3CNMA 1K38A 3U6OA 1OH0A 2Q9NA 3I0YA 4JXGA 4RBNA 1YM1A 4KFDA 1ULIB 3UPPA 1PU4A 2VGJA 5EXPA 1KSIA 1CEGA 3G35A 4JF4A 3X40A 1KD14 1K25A 5JPUA 3WS4A 3DOAA 4FCTA 3UE0A 5EPHA 2ZJ9A 1NY6A 3CPW2 3N4IA 2IWCA 1IBKM 3FKEA 1ONGA 4N6NB 1NJ4A 4B7GA 4X62M 5A90A 3HLFA 3JYIA 1FJGM 4PDIA 1L1TA 3GLFB 3IHBA 4X56A 5F1GA 3NC8A 4E3MA 1XXMA 4Y0UA 3DGMA 2Y2JA 4WW0A 2CFLA 3MG2A 3EQVA 3OCNA 4FR9A 4MBKA 3W4OA 3D8BA 4QD4A 3KKGA 5ITYA 4XB5A 5AIIA 1BZAA 4P85A 4GB7A 4N1XA 5ITXA 5ITQA 3AGFA 2KZSA 2C5WB 4OQGA 5HL1A 2RGOA 4EYCA 3O8YA 3CF6E 3I563 1J5EM 1JV2B 4WMCA 2FE8A 3FYCA 1EE8A 2IWBA 2X01A 1QANA 5FI7A 3SOIA 3CME3 3HJQA 2E8IA 3ZCZA 1K3XA 1STFI 5JYOA 2Z2MB 2WOHA 3EB8A 1Q42A 2ZANA 4KVHA 1GY6A 2CE7A 4BJPA 4YFMA 3FG3A 3DMCA 2HCBA 5AQ9A 2G8LA 1G8PA 5J8XA 1FGMA 4UA9A 4P6BA 4WEJA 4DKIA 4KZAA 2HMMB 4LF4M 2ZQCA 3B4PA 4KODA 4IBCA 2KEBA 3CJMA 1HQYE 3C58A 2O3OA 3IWIA 1XMQM 4KG6A 1XPBA 5D83A 3PFIA 2Z4RA 4XBOA 1VQK3 4PPRA 5CHJA 1C3BA 2CHGA 4MM3B 2ZQ8A 2Q2EB 3EIHA 4OVZB 3SEDA 4OLGA 3OPRA 1RGYA 1Z59A 4JI8M 1QMAA 2FFYA 3V98A 1O7NB 3FF0A 2ZQ9A 3QRDA 1ZX2A 3FUVA 3Q7VB 4MGYE 4JN6A 1O07A 4JLFA 2OLVA 3CD63 5TGFA 5FSWA 3CCL3 1IM2A 1NY5A 3LTDA 3TWMA 4FH2A 1E3VA 3CU3A 1G68A 4WYKA 4EBPA 1GA9A 1N9EA 2KZUA 3AV0A 3SH9A 4II7A 1W6YA 3JUOA 5FAQA 5EOOA 2X02A 4REZA 3I553 3MJ5A 4TX4A 4S2JA 2J9OA 4UAAA 3U5ZB 2DRWA 1TDZA 3SARA 5DYIA 3IXHA 3CCJ3 4IBEA 2OOVA 3ZNYA 3GRUA 4J9AA 5KQ8A 2BO9B 3V92A 4N6UA 2XK1A 2YFQA 3AMOA 4X2HA 3PBTA 2XH9A 2ZC6B 3QWLA 3VSKA 2P38A 3IMAB 3NDEA 4LENA 3IH8A 1FGTA 3M6BA 1K4FA 3HK4A 4DR1M 2YX9A 4WZ5A 3FTEA 2CH9A 2F5OA 4EBNA 4PM5A 2I72A 3BFDA 1ZG6A 3J80S 1GHIA 1EWZA 1W8QA 1YLTA 2WZZA 5F82A 4LZIA 5FQ9A 4HM4B 1FQGA 5FTKA 3VLFB 3OTOM 3LZAA 1NO3A 4WBGA 2QEX3 3KW6A 1M9GA 2XR8B 2EA0A 1BLHA 3BNCA 3OPPA 1Q7Y4 3J27B 3B3XA 3KS8A 1TH3A 1YJN3 4AKGA 3GZXB 1HNXM 3GPUA 5ITUA 3BFFA 2DCFA 3C4OA 3VP4A 3FG4A 5IWAM 2LH0A 4LF6M 1IYSA 3VP0A 4MEIA 4KENB 2CC1A 2R9WA 1J7KA 1PW8A 1BLCA 1EA2A 3SMPA 4X64M 3JUQA 3O88A 2Y2GA 5FQQA 5KMWA 2KXGA 1JTGA 2HPBA 4R4RA 2D7HA 3CNXA 2WGWA 3ZVWA 1QZMA 3DGOA 4FCWA 1JVJA 4IEDA 5KPRA 1K9M4 1SIHA 3HL9A 2CFGA 3FD9A 1MPLA 3KZTA 2P05A 3HZPA 3V3SA 4B3TM 1K41A 2R9XA 2C10A 3VOZA 2CEAA 5EXSA 1YMXA 2Y0QA 3UGJA 3FZCA 2ZQAA 5TFQA 5GHYA 5CHUA 4L0LA 1W5SA 3CCU3 1NB5I 3CCM3 5IREB 1QMEA 5FASA 1DYUA 1QVG2 1YHQ3 1WTHA 4X55A 2Y4AA 4FWHA 1TP6A 3U6MA 1PFPA 4LV0A 1FA3A 1QVRA 1W5DA 2BHMA 4O8SA 2G2WA 4OQHA 2QIYA 3NM7A 2ZQDA 3MKFA 2R4JA 8CATA 1N33M 2P0XA 5EP3A 3S29A 3Q1FA 1S723 3H4MA 2RFRA 2GEYA 1JWPA 1BUQA 1NSFA 4NSRA 1NHWC 3A3DA 4DF6A 1W5TA 1SXJE 4R7GA 2X8AA 1YVBI 1RCJA 4GIPA 1GLNA 1GD4A 3KSED 2VQEM 3Q8XA 1NWWA 3K92A 5ITRA 4B3MM 3ZH9B 4LJ6A 2D7GA 1XKZA 4NXNM 2EXAA 4XM4A 2DVWB 1SHVA 1KVLA 3FH1A 3T1YM 3EN8A 5M1AA 4IBRA 5EXTA 4F94A 3KS4A 4JI1M 3OXAA 1MXOA 4QNRA 3D9RA 4HM0B 4X53A 2F5SA 5EVLA 1RJOA 2CWVA 3IF5A 2SBLA 1ES4A 3FTCA 2F99A 3PAEA 2Y55A 3U6EA 4LMIA 4FMAA 1JQJC 5FSRA 5KP1A 1C7HA 1NJI4 3FYZA 4GH9A 4I4KA 4HM7B 2OPFA 2RL3A 2HP9A 2HMKB 2YNMD 5IENA 1LLBA 2LQVA 1KE0A 4FMDA 4NSOB 3S1YA 1L2SA 1US1A 4DE0A 3W4QA 4DE3A 5IG0A 4AI6A 3VKGA 2XFSA 4DUYM 3L25A 1RRHA 2OTJ3 3VSLA 4I5SA 1XHBA 2F86B 3EBYA 2Y91A 3RGPA 1NB3I 3KOZE 1L0FA 4Q8IA 1G3IA 3UPOA 4OQIA 2ZAMA 4AW4A 3P09A 4N6TA 5H37D 3W0LB 4JXSA 3G8ZA 4PCZA 3DGLA 4R3JA 2GEXA 4GKJM 4UA6A 4L8RC 1WMPA 4LGMA 5IF6A 3NBJA 1IDPA 3FZWA 3U6QA 1QAKA 1SQWA 2DZNB 3X41A 3KP1E 1EKMA 3M7GA 4HBTA 2Q07A 2J7OA 3SVAA 4NRWA 4GL6A 5ITXE 1HZOA 5GLBA 3GSGA 4FCFA 6STDA 3BLMA 3A3IA 2IMJA 1OGXA 1I5QA 5DTKA 3GLIB 1K56A 3FUWA 1FCNA 1JTDA 1AV4A 2CFKA 1SXJD 1YT4A 5A92A 4LJ7A 4P16A 4OK0A 1DMNA 1NYMA 4C6YA 2P5TA 5JPPA 4K91A 4E3JA 4JXJA 3GRJA 4HJLB 4GHAA 5ELJA 4E3IA 2L6OA 1Q40B 4W5WA 2W03A 4B88A 1Q814 3BECA 2LYXA 1S5AA 4PEJA 5A91A 1OJLA 5HARA 3BLSA 1L2DA 3G2YA 1JB5A 1Q39A 1W00A 1W7FA 2WZXA 2R65A 4R9LA 1OPYA 5IHVA 3SASA 1SDNA 4XBYA 1EG9B 1GS3A 3NHXA 2FFJA 3T15A 3WHKA 4LFBM 2KRKA 3F14A 2ZAOA 4NL4H 1R2YA 3NX0A 4M0WA 1H6UA 3HLBA 2BMQB 1IY1A 1HTZA 3DWZA 1HD8A 2UXDM 5DRVA 2KRTA 3WS0A 2JDIH 3IXBA 2XSZD 3D8LA 3Q7ZA 3G4S3 2VGKA 4B4XA 2W04A 2BNGA 3K7CA 5KZHA 4OKPA 1ASKA 5FTJA 3K5TA 4S2IA 1NVMA 2V20A 3VKHA 1XXHB 4M3KA 2Y2HA 2L7HA 2QGUA 4FVMA 3FKWA 1LVNA 1SXJB 3A3JA 5JI2E 3WRZA 3CCE3 1CQSA 2QPAA 5EOEA 2A15A 2YFJB 4C75A 1I2WA 4KG5A 2HDSA 4HM5B 1CK3A 4LF9M 4DV5M 5E2GA 1GL6A 4CPKA 4GOGA 4GC9A 3U61B 2RCDA 4CGYB 2QBYA 3IQAA 1Q2QA 4BLCA 4L4UA 2STDA 1L8QA 3UE3A 3FYDA 5G18A 1ES5A 3GO8A 4R3BA 4PM9A 2W2CA 1OF5A 4LF8M 3ZHHA 3IG8A 1IV9A 1IVWA 3LOYA 2XD1A 5CERA 1N32M 4ZM8A 3WS2A 3NXJA 5M18A 4GD6A 8CHOA 2XZUA 1Q3BA 3ECFA 1EI5A 4WMCD 4JF6A 2OQ4A 3M6AA 4LJAA 2PZVA 4FMBA 4EV2A 1SDEA 3HVFA 1T3TA 4CJNA 1CYUA 3U6DA 5HW3A 3ZG7B 5KSHA 4Z9QA 1JR3A 3OPHA 3EC9A 1XX2A 3KSXA 4D80A 4HL4A 3UMMA 2BMOB 3EBTA 3V50A 5LMNM 3GQ3A 3WA2X 5F83A 4N3VA 1W7CA 3KE7A 2Y2OA 5GLCA 4FW9A 3WOEB 4QNMA 1D6ZA 1VQM3 1FCMA 3GWRA 4IBGA 4ZPXA 4R4KA 1PJIA 1IXZA 5IG5A 3SS3A 1QVF2 3RXWA 5AYRB 3UJNA 4N1HA 1NHGC 1W6GA 4S2NC 1WMNA 3NQYA 1A90A 2I7PA 3RXXA 3AGDA 3V3RA 2QMIA 3DZDA 1BUEA 2UUCM 4CCVA 1K57A 3WS5A 4K61A 3GPXA 3CZDA 3MG1A 2Y2IA 5EXXA 2C96A 1ERMA 2M60A 3SOYA 4NXMM 4B3SM 4GZBA 4C3QA 1U60A 1JJ22 4U13A 3IF6A 4NETA 2WUQA 2V1CA 4HM2B 3OX9A 1N9JA 3EQQB 4OP8A 1PWDA 2F98A 3DZLA 3PNVA 3GZYB 1O7PB 3KFUG 3KOWE 1XA7A 4B3RM 2J7VA 1N8R4 3WOFB 3OV4A 4FMCA 4N6V0 3FKVA 4DR6M 4WWUC 4WYYA 5D81A 1BSGA 2LXEA 4K0KM 2AHMA 3EN1B 1HNZM 1KGEA 4KZ7A 1FR1A 3WWXA 5GKNA 1JB2A 4HM1B 1CI8A 4ZTKA 1VQ73 4MGKE 3E99A 1ERQA 1YLZA 3LEZA 4U0TA 4UHUA 1S6RA 3RDEA 3PYJA 4UA7A 3SLUA 4AEQA 1K3WA 1GY7A 1H8ZA 3EIEA 4L15A 3F7XA 1HU9A 1VQ43 2CFOA 1OFIA 4M0DA 4ITQA 1Y4KA 3GAXA 2PBYA 2HMJB 1G59A 1IEMA 7CATA 1W01A 1ONHA 4NK3A 1XP4A 5FTNA 3EJVA 5AIFA 3VSYA 3L26A 4WYKB 1BLSA 4AQYM 3SYLA 2F5PA 2H0TA 2BNKA 3FCSB 4MH0E 5E2FA 2ZC7A 1TEMA 3PZWA 4KQRA 2C9CA 4DR5M 3BYDA 3DA1A 2QZ6A 4LJ5A 5FTMA 1WQLB 3Q82A 1NZOA 4IJEA 3A3FA 4DRTA 4M9XA 4CDLA 3KXEC 1XWIA 1DGFA 1STDA 1ZQ9A 2DWNA 4OH0A 2FNAA 3KP0E 3HHYA 3KSJA 2E2VA 3EQUA 4KG2A 4XUZA 2WOFA 1D6YA 3Q2PA 3I51A 3GLGA 3BLZA 4JF8A 3HHWA 4WP5A 5EQTA 4IBKA 3X42A 4JBFA 3WA3A 4JV5M 4XBTA 4H8RA 4N9LA 1ISKA 4YY3M 3D4FA 2WGQA 2EX2A 4HM8B 2Y2KA 3BM6A 2Z3XA 2ML6A 3UL6A 3A76A 3LVWA 3GPYA 2L09A 2RKOA 4CISA 4K90B 2W6JH 3M8CA 1VQP3 4BB9A 2XEPA 2Y2MA 1ZC2A 3PS8A 3LCEA 1HT1E 2BJVA 1MNLA 1NY0A 3TE6A 1K6RA 4MB7A 3FV7A 4ZAMA 2CHCA 2HP5A 3HWSA 4Y7PA 2DWZB 4GKUA 1L1ZA 1S0WA 4AG6A 3UN7A 2HP6A 3MHVC 1ORYB 3ZG9B 4EIWA 5E6JA 2GU3A 3JUMA 4JI0M 3NV0B 3AGEA 1W8YA 4GN2A 4IBFA 3CPOA 1UW1A 3DUKA 4QOZC 5EP1A 2BJWA 3ZC7B 2HMLB 1DVCA 3CCQ3 4LF7M 1WYCA 2WGWB 4H3UA 4LZJA 4GMQA 1UI8A 5EP2A 2ZC4B 3U6PA 4IVIA 4D2OA 4GDNA 1GYBA 1IYQA 2HL7A 1IQ8A 4KZ9A 4JKTA 4Z8XA 2GU1A 2DWLA 4PT5A 5AIGA 5A0OB 3FSDA 2R18A 4M9ZA 3PBQA 4BTWA 3X3YA 4L8OA 1YGEA 4E3LA 4E3NA 1NU3A 1LI9A 2HKJA 1EROA 1KYIA 1V74A 1CI9A 2OSUA 1W4NA 2H0YA 1VQL3 4IBBA 3MFDA 1MKIA 3CC23 4I81A 2JQ5A 4BENA 1TDGA 1E3RA 4R23A 5C18A 4MGHA 2HDQA 4QY6A 3UK6A 5IEPA 1RKYA 4DR2M 3S5CA 2H1RA 3SAUA 2PU2A 1PM5A 2CG0A 3VP1A 3NM2A 3UPNA 1VQ93 3GVBA 3K63A 1VQ63 3HLDA 3G34A 4AKZA 4WURA 1NJFA 3N8BA 4G4RA 1W02A 5ITTA 2LNHC 3OC2A 5GL9A 2JC7A 5FW5A 1PIOA 4ZBEA 3U60B 4QY5A 3GZBA 2C99A 2XSHB 3LT9A 1TDHA 5STDA 5IW9A 2ZM0A 4R80A 3TWKA 1DGBA 1IBLM 3SOAA 4LV1A 3K2LA 4MBFA 5D82A 2KA6B 1O7GB 3WODG 3VP3A 1W2ZA 1TFKA 3J7AS 5EE8A 3O86A 3K0ZA 2V1UA 2Z2LB 4OVDA 5BR8M 5FGOA 1DGHB 1YLPA 3HLCA 2LWXA 4BTYA 4JI3M 3J81S 5TGNA 2W56B 3S27A 4OVMA 4Y0OA 2ZBKB 3VDPA 2K54A 4KFFA 1MOLA 3ZDJA 1RN7A 5G2GA 3U6CA 5EUAA 3W0FA 1N9BA 1YJW3 2E2UA 3LY3A 2XGNA 4K1UA 3T38A 1JKGA 1IV7A 3FF2A 4BQMA 3WMDA 1TH4A 3BOSA 1SPUA 1K54C 1K55C 1L0GA 4OQ0A 3N7WA 3ILKA 2DNSA 2DXIA 2O5RA 4PMAA 1QQWA 3HREA 4JRFA 4IVKA 1U5OA 1OFHA 3J7BA 1Z5BA 5ELUA 3OCLA 3A46A 1L2CA 4FSFA 4LRTA 3A3EA 2ZDJA 1E3UA 4G4OA 4EV4A 5HAQA 4LJ8A 3MZDA 5AQBA 2F5QA 1WMOA 1XMOM 4NREA 4L78A 4PM8A 2DWMA 4RF0A 3BFCA 4FH4A 3V99A 3RGRA 3MHEA 3LXUX 3NIAA 3G2ZA 4X65M 1MU5A 3CCV3 1SIIA 1N8QA 2V6ZM 3F9SA 2UWXA 4RX3A 3LTBA 4FD8A 1JWZA 3AFHA 3W4PA 1MX0A 3HX8A 5AQ7A 3AOGA 3GP1A 1YJ93 1NRFA 3S4XA 4N6OB 1E25A 2YFIB 1PW1A 3DXOA 3J2PB 4E3KA 4LEHA 1GKIA 4GD8A 1VM1A 4EBLA 1SXJC 1GL7A 2P9VA 4QHSA 2EFXA 2HMOB 3G32A 4HKVB 2CW9A 3MZEA 3WHLA 4KZ8A 1DO0A 5KO3A 1NDOB 3SFZA 5LC7A 1IXRC 2KXEA 5I97A 4DR3M 2JBFA 3CMZA 2HDRA 1FR6A 4A5RA 2Y0TA 2CFWA 2FGTA 1LHYA 7STDA 5AEWB 3S28A 2OQEC 2Y20A 1N78A 4RNYA 1PI5A 1UM8A 2FXTA 4TUWA 2Z6BA 1TDLA 3N8RA 4LFAM 3K8ZA 3CF0A 1A2VA 5CXOA 3KVWA 4MMYB 3NWLA 5A93A 2BLSA 4B08A 3LY4A 2Y73A 4EC6A 1E97A 2CIUA 3U97A 2R45A 2GXFA 2XGLA 3DY5A 3OZHA 2DHRA 1PI4A 1BULA 1L0EA 2YQZA 4NHFA 3FTFA 3AOEC 1TGUA 4E6WA 1IN5A 3E2KA 2A3UA 3HUOA 5LC6A 3NY4A 5EVIA 1JR3D 2RGHA 1OMEA 4KHPM 2K0MA 1MY8A 3A45A 1LOXA 1NJGA 4X2OA 1IQPA 5FDHA 1YIT3 1J9MA 1YQSA 4MMZB 2W0QA 3FTDA 4XGIA 4IBXA 4LJ4A 1H8YA 5I94A 1IYOA 3HHXA 3KOYE 4XBXA 3GQ4A 3FGYA 4LCMA 1L0DA 2C5RA 1KWIA 5E43A 1BTLA 2QA43 5CGSA 1CEFA 1WE4A 3FLJA 5FI2A 2Z4SA 2E2TA 4K0WA 3JR5A 3G4PA 2BMRB 3SYKA 3Q81A 4RNAA 4P0MA 4WHAA 4G6ZA 1JRQA 2CC3A 2VQFM 1FGRA 4BTXA 3G0KA 3SH7A 4IPBA 1M1XB 4BL3A 2HHHM 4HLQA 2ZLYA 4N9KA 1S3SA 3EHCA 4YINA 4OOYA 3HJ8A 3X3ZA 3M0EA 4R1KA 1XGJA 2YFLB 1IVXA 5C1BA 3I4VA 4G4NA 3DTMA 3NBRA 1Z5AA 1DMMA 1IELA 2IUJA 2IWDA 3L0RA 3AJIB 3L2AA 2ERCA 1YSYA 5CTNA 3AKZA 4HZ9B 2JE5A 3B8LA 4O2HA 3EF8A 1G6AA 4B7FA 3TPZA 4JI2M 3QNCA 3MG3A 1DJCA 5E26A 4JYAM 1GHPA 2R4IA 2P0MA 3SS5A 3T0UA 4S2PA 5F3WA 1UUVB 2EXBA 1FSYA 2JA2A 3KOXE 5JI3E 3MWZA 3GLIA 3FUTA 3FUUA 4KZ5A 3TQSA 4GHLA 2A49A 5JBSA 3NCKA 1W2B2 4IJFA 3NBBA 2OWPA 3DGNA 3BFEA 3OWSA 1N5HA 3C5AA 3UDIA 2EFUA 1VQ83 3CXC2 1FOFA 3E2LA 2B1XB 2MF7A 1M904 2XLNA 1D6UA 3FG1A 2B5RA 5IZ7D 3ISGA 3A98B 1ESIA 1GVNA 3QHYA 2WK0A 4R9KA 4O7DA 2GBWB 3MBZA 4JXVA 2WKHA 1IU7A 5FQMA 1IT8A 4PDGA 4KQQA 5HFOA 4WELA 3IF6B 4OW0A 2OCTA 4OLDA 5CF2A 3NDGA 4R1GA 4LCBA 1DMQA 1J09A 3KFQC 5CK6A 1LL5A 3Q90A 2XSOB 3K1JA 3GRYA 1HQCA 3E4RA 3GLHA 3N9HA 4FCZA 2G2UA 5AQAA 1H5XA 3FUXA 3B9PA 3U6SA 2CV2A 2EX9A 3C7UA 4LY6A 4KLNA 3H3HA 1AVKA 4MMXB 4DDSA 3UDFA 4DE2A 1QAQA 2WO0A 1YLJA 3UJMA 1Y54A 3TDGA 4K1VA 4DE1A 2INXA 3RE8A 3GRVA 3E9SA 2OOVC 3PBOA 5EECA 3MSOA 2QZ4A 4S2OA 5BOHA 3N54B 3VP2A 3IHAA 5DREA 1W79A 3VDUA 4DV6M 1YMSA 2ZM6M 1R2ZA 4N6MA 4WZ5C 5DYGA 1AVLA 2Y21A 2Z77A 4XUXA 4LRSA 1OUNA