3HJQA

Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hjqA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hjqA02
1DLQA 1EOAB 4WHRB 3PCJM 2BUXA 4WHPA 3LXVM 2BUMB 3O32A 4WHQA 3LKTM 3I4YA 3PCAM 1EO2A 1YKLB 3PCCM 3PCDM 2BUZB 1YKNB 3PCKA 3MV6M 4WHRA 3PCFA 2BUYB 2BUMA 4ILVA 3PCLA 1YKLA 2BUZA 1YKKB 1EO9B 3HGIA 2XSUA 3LXVA 1TMXA 3PCHA 3HHYA 2BUWA 2XSRA 3MV4A 3PCAA 1YKKA 3T63A 3PCDA 1EO9A 2BUQB 3T67M 1DMHA 1EOBB 3PCNA 1DLMA 4WHRF 3MI1M 3TH1A 3MI5M 1EOBA 3LMXA 1EOAA 3PCIM 1DLTA 3HHXA 2BOYA 2BUUB 5TD3A 1YKNA 3PCGM 2BUYA 3O5UA 3PCEM 3HKPA 3PCJA 4WHOB 2BV0B 3LKTA 2BUUA 3HJ8A 1YKOB 3PCCA 2PCDM 3MV6A 3MFLM 1YKMB 3PCMM 3PCBM 2BUVB 3I4VA 3HJSA 2BUQA 2BURB 1YKPB 1YKMA 3I51A 4WHOD 2BURA 3PCKM 1YKPA 2BUTB 3N9TA 3PCFM 3T67A 3MFLA 2BUXB 4WHPB 3HJQA 3PCLM 3O6RA 1EO2B 3MI1A 2BUTA 3MI5A 4WHSD 3PCIA 3PCHM 4WHOA 2XSVA 3MV4M 3T63M 2BV0A 1YKOA 3PCNM 4WHSB 3PCGA 1EOCB 3PCEA 3O6JA 2BUWB 4WHPD 4ILTA 2BUVA 3LMXM 4WHSA 1EOCA 2PCDA 2AZQA 1S9AA 3PCMA 4WHQB 3PCBA
chains in the Genus database with same CATH superfamily
4RF1A 1QDTA 2QBYA 3GRVA 4UN2B 4LRTA 4AKIA 5EQTA 1VQ1A 4G4OA 1L2BA 4OVZB 1NVMA 3O32A 1OJLA 1W5TA 2QCUA 3LKTM 3I4YA 3PCCM 3GPUA 4I4LA 3PCKA 4JN6A 1YKNB 2KZUA 1G71A 5C1BA 2F5SA 3THGA 4QOZC 3C3DA 2C9CA 3A42A 1NSFA 5JI2E 4DV0M 1TDZA 2DAIA 4MGHA 2Y20A 1S3SA 2QHOB 3GLGB 4RKUF 3PCLA 1IBMM 2L7HA 1LTMA 1NV9A 1R2YA 4GKKM 4FCWA 4IBCA 2J7OA 4CISA 3LXVA 2GNOA 3RGPA 4OX9M 4FWHA 3HHYA 5L8RF 3GQ4A 4AKHA 2CV1A 3UZUA 1LV7A 4P17A 1XB2B 5EXPA 4PD2A 4AQYM 4LY6A 1BVSA 2DKLA 1YKKA 3PCDA 2KA6B 4JXJA 3KS8A 3NWLA 2F5QA 1EOBB 2R45A 2WSFF 4L6V6 1HT1E 4KT0F 1ZQ9A 2HAKA 2ZBKB 3MHVC 3AOEC 4CHTB 3U6SA 1IY1A 1I4WA 1TH2A 2E5LM 4YY3M 4WHRF 1V92A 3Q8GA 3MI5M 1ZV1A 3FTFA 5IREB 4GC5A 1PJTA 3SHGB 2KZSA 4X66M 8CATA 3LMXA 2L09A 1SG9A 4GMQA 4HLQA 4F2LA 1C1KA 2P5TA 1DLTA 3FUWA 3FTCA 3PNVA 3H4MA 1GL7A 4LF7M 3PCGM 4FWDA 1GLNA 1X37A 2HCBA 3BBZA 2F5OA 2DAEA 3O5UA 3PCEM 3GLHE 1DGGA 2MGWA 3GLIE 5EJCA 4LFAM 4EIWA 5BPVA 4ZPXA 3JR5A 3U6MA 1UM8A 1WGLA 3U6DA 3C9PA 1XMQM 2PCDM 3BXWA 3HWSA 5A2QS 3MV6A 3W0FA 1YKMB 2VIIA 4GH9A 2D7HA 2MH8A 3MK6A 3ZQJA 1QQWA 2BUVB 4WP2A 3I4VA 1VEJA 2UUBM 1YKPB 2BNKA 2C98A 2CV0A 2FFJA 3KP0E 1G41A 4AG6A 3W0LB 4WHOD 2OOAA 2R62A 3FUTA 3HX3A 4B7HA 2R44A 4MH0E 4JI8M 1NNJA 2CHQA 2XZUA 1K82A 3MFLA 3JR4A 4WW0A 4BBAA 1QUTA 1MU5A 1GKIA 5FTKA 4K0KM 4GKJM 2XH9A 4ITQA 1YSYA 3KSJA 3VKGA 2C96A 1HQCA 3RE8A 1TH3A 1XHBA 4L78A 1K3WA 4NRWA 3E4RA 4MB7A 5KQ8A 2XSZA 3PCHM 3FYCA 2XSVA 4KO8A 3M6AA 3GO8A 2BV0A 1OIPA 3U61A 4FVMA 5FLXS 1GL6A 4PT5A 4AKGA 3U60A 4X64M 4LJ6A 1EOCB 2K0BX 2J7NA 3M0EA 1I94M 3E9SA 5KPRA 3SAVA 2C9OA 4JI6M 4JI2M 4GRIA 1NHGC 4WHSA 5C18A 2CUZA 3B74A 4LF5M 4M9ZA 3TE6A 1J09A 3AKZA 4IJFA 5EP4A 4LJ5A 2Q2EB 5DFLA 4D80A 3GLHA 2Y0TA 3GLIA 3CF6E 4MGZE 4IBGA 4IBIA 4I5SA 3VFDA 3K9OA 4DV2M 1IM2A 1QZEA 4AW4A 3L26A 4LG2A 1DLQA 4CJ6A 4WHRB 3PCJM 3B7QA 3QAUA 2BUXA 4WHPA 2BUMB 1TTEA 1DGHB 2KDLA 1OQYA 3QYEA 4M0DA 1N36M 4WHQA 2F4VM 1XC8A 1R2ZA 2DZLA 5GKNA 2BUZB 1DO0A 2JUJA 3L29A 4FW9A 2YR0A 4DV3M 4G4RA 1TR8A 1F4IA 3PCFA 2I7NA 3K2LA 2DWLA 1D0LA 2M5ZA 1VG5A 3HHWA 2XZFA 1NO1A 1YKLA 2VQFM 4RF0A 1QANA 4M9SA 5IWAM 2UXBM 1EFUB 1IFYA 1V33A 4LGYA 3A46A 4HL4A 1XMOM 1N34M 3FTEA 1VDLA 3A45A 3SAWA 1EO9A 1N78A 1TH4A 4R71A 3T67M 3VDUA 4JI7M 3AFHA 3MMPA 3PCNA 2CRUA 3GRYA 2JWSA 1KFVA 1VEKA 1SXJB 2Z4RA 3J80S 1J7KA 3GPPA 1HNXM 2ZAMA 4NRVA 3TH1A 3FRHA 1IXSA 2FNAA 3KOWE 3J7BA 1GJTA 2JY5A 1N33M 1EOAA 4JYAM 4B3TM 4B3MM 2BOYA 3K1JA 2JZ0A 2O5RA 3PVSA 2LXEA 3EIEA 2YQZA 2BUUB 1E32A 1NHWC 2V6ZM 2JP7A 3J27B 3HU1A 1L2CA 1KSFX 4DV4M 2BUYA 4REZA 5FTLA 1E94E 3HKPA 3KP1E 2N35A 4LJ7A 4MM3B 3SMPA 2BV0B 1IBKM 1Z59A 3TPZA 4MGYE 4L4UA 1IN8A 3KOYE 3PCEA 1IY2A 2QZ4A 3U60B 2EUCA 1T43A 2DWNA 2XGNA 2HKJA 1G59A 5DNYA 3PCMM 1SXJC 3DZDA 5ITXE 3LCVB 3U5ZB 1HJPA 3GRRA 1VEGA 3PFIA 3PCBM 2JNHA 1PJQA 2MROB 3IECA 4R3DA 4ANRA 7CATA 3U6OA 1IY0A 3VK7A 4JI5M 1AIPC 1A5TA 1T3TA 1QYRA 4DUYM 3GLIB 4LFBM 4D81A 4FWGA 4W5WA 4I81A 1NY5A 2KNVA 2QP9X 4PDIA 3FRIA 2BURA 3PCKM 2G5GX 1HNZM 1GABA 2BUTB 2WSEF 3VK8A 4L15A 3SHFA 2BUXB 4WHPB 2L6OA 3GLGE 3PCLM 3O6RA 1D0KA 3C58A 2C99A 2MJ5B 2R0IA 3QYBA 4G3OA 4LRSA 3MI1A 5EP1A 4DR6M 4S12A 3U6EA 3KDSE 1NJFA 5KPTA 2BWEA 2W82A 2XFTA 1XXHB 2KNAA 3FE3A 3PCIA 4WHOA 3L2AA 3GQ3A 5IT9S 2OOBA 3A98B 4F1IA 2JZ1A 3U6CA 1IBLM 4L8RC 3ZH9B 2L4EA 2X49A 3DFZA 4JI4M 4G4QA 4KODA 2I7PA 2R46A 2QENA 3Q8XA 3UJNA 1N77A 2EKFA 4GHAA 4ILTA 3I04M 3LMXM 4B08A 3SASA 2KEBA 2QBYB 2CP8A 4XGIA 4NXNM 5ITTA 1DV0A 1DO2A 2YNMD 2XEPA 4M0WA 1L2DA 2LVAA 2ZTCA 1MX0A 1R7RA 4DR2M 2DENA 4DV1M 4LGMA 2Z7JA 5EXXA 1L1TA 3F92A 4DR4M 3B7NA 1WHCA 1EOAB 2LHCA 2EJSA 2XFSA 2ZTDA 1VDDA 2DXIA 3DOAA 1L8QA 3J81S 3SARA 3E21A 5ITXA 3KSXA 4QHSA 1NJGA 1EO2A 2QQ8A 2CV2A 3GLFE 3T6PA 3TWKA 2R18A 4B3SM 5E6JA 3NBIA 3MV6M 4MGIE 4Q7JA 1MJGM 4NSOB 3T38A 4JV5M 4OVZA 4DUZM 2BUYB 3K8ZA 3TWMA 3TWLA 1IN5A 4ILVA 3AOEA 3VLFB 1PGYA 4Y28F 2DVWB 2DZOB 5ITUA 2BUQA 2DHYA 2XLJA 5FSWA 1YKKB 3JAMS 3KOXE 3I01M 4LJ8A 1JB0F 4XK8F 4IBBA 1Q39A 3L28A 1IXZA 3CTWB 1IN6A 3DA1A 4PDGA 1TMXA 4GHLA 3GLGA 1ZMVA 2UXCM 2BUWA 2XSRA 3MV4A 1IQPA 1Q3CA 2CWBA 2JA2A 1ZMWA 3FTDA 3GP1A 3T63A 1H6UA 2BUQB 1DMHA 2DAKA 4JI1M 1QDRA 2DWMA 5FTMA 1RU3A 3R9XB 1OAIA 1N75A 2OO9A 3LVWA 2LTUA 3HU3A 4LZZA 2F5PA 1YUBA 4DR1M 3VKHA 1QZMA 1QUSA 1EOBA 4DV5M 4QOSA 1Z5CA 4DBGB 3T15A 3L25A 5E26A 3GRUA 1E9RA 2ERCA 2JY6B 1JR3E 3HY5A 2KW0A 4QNRA 3W68A 5ITRA 2QNJA 3AJIB 1G4AE 2APLA 2RKOA 3AOGA 5TD3A 1ORYB 4DV6M 1XWIA 1P3QQ 3AV0A 4RNAA 1G8PA 1ZMUA 3B89A 4Z8XA 3T1YM 5IZ7D 3NBXX 2O01F 3LQRA 4IBKA 4WHOB 5JI3E 1EE8A 2RRUA 3PCAM 2LWXA 1HQYE 3LKTA 3SBJA 2Z8YM 3SATA 3PCCA 1AUAA 3SC3A 3GPXA 1GVNA 1YLAA 2X8AA 1TDHA 5KQDA 1WR1B 2L4FA 2ZAOA 4B7GA 2D7EA 3J2PB 2UXDM 2K6BA 3U6LA 4LFCM 2Y0QA 2QSFX 4AG5A 4X65M 3GLFA 4LF9M 1TF0B 1OKSA 2JY7A 3H4JA 1CUKA 3KOZE 1WXQA 1YKMA 2R4EA 1YE9A 3VDPA 3K9PA 3D8LA 3LMMA 1R4GA 5BR8M 3KFUG 3GPYA 1GJSA 1KYIA 1NY6A 1W5SA 3I51A 3CGWA 4CGYB 3UMMA 3HHZA 5LMUM 3SYKA 1YKPA 3N9TA 3PCFM 3OTOM 3T1HM 2K9DA 3HJQA 4II7A 3EIHA 3LQQA 1Z5AA 1K3XA 1NNUC 2KRKA 1EO2B 2K47A 2LVOC 4L16A 3U61B 3MI5A 4OW0A 2R6FA 1OAOC 3FUUA 2UU9M 4LF4M 4JI0M 3U6PA 2RGHA 1EIJA 1QAQA 1OIZA 5H37D 4LF6M 1YKOA 3PCNM 4WHSB 3LCUA 3PCGA 4QNMA 3SYLA 3FUXA 2B3TA 5EP3A 1SXJE 2CHGA 1PRBA 1JR3A 1HT2E 4MGKE 1OFHA 3GLHB 3ILKA 5EXSA 2BUWB 2WZJA 3FYDA 3PXGA 4NL4H 3UGJA 3AL0C 4BLCA 1T6OA 2LVNC 3GQ5A 1EOCA 2F5NA 2LVQD 3IHPA 2EA0A 2PCDA 3B7ZA 1WGNA 2KXEA 3CF0A 3D8BA 1PM5A 1XNQM 2QPAA 1S9AA 3W67A 2CFOA 3FKEA 4Z6YA 1IN4A 1JQJC 2VF8A 4IIWA 4WHQB 1PJSA 1JR3D 1TGUA 3FUVA 1Z6TA 3KS4A 4DV7M 4YHHM 5DYGA 3LXVM 5ITYA 3E46A 4R7GA 1Z5BA 4LJ4A 1E9SA 3HU2A 4LJ9A 2L7IA 1R6BX 2DZNB 4JI3M 1YKLB 3PCDM 2V1CA 1QAOA 2JXNA 3WHLA 4A3VB 1C7YA 4WHRA 2BUMA 2H1RA 2R65A 1DGHA 2Z4SA 4FD2A 2OPFA 1WJ7A 3MJ5A 2BUZA 2X4AA 2R4JA 2D7GA 3RFWA 1EO9B 1PJIA 3HGIA 3C3EA 2ZANA 1Y8GA 4IBJA 2XSUA 5ITQA 3KXEC 1D0MA 3PCHA 1Q02A 3L27A 4NSRA 1D2NA 1HR0M 1OFIA 3PCAA 3KVWA 4FCTA 3BOSA 3GLFB 4M9XA 1GO5A 1IXSB 2O25A 3FD9A 5F3WA 3SAUA 3KW6A 1WIVA 2BJVA 1DLMA 1J5EM 2RGOA 3MI1M 1IXRC 4AI6A 3PCBA 3PNYA 2A5YB 4QHTA 5KO3A 4IBFA 4NC6A 4LJAA 4D82A 3J7AS 4GC9A 1XXHE 2DI0A 5KPZA 3PCIM 2LNHC 1SXJA 2AHMA 2C5RA 2DHRA 1XNRM 3HHXA 3QWLA 2NQ8C 4G6ZA 2LHGA 3WHKA 4AZFA 3LVVA 1YKNA 2DWZB 4P16A 4IBDA 3R8FA 2MR9A 5EP2A 3SFZA 2FS1A 2Y21A 4B3RM 4GITA 3PCJA 2WSCF 2J5YA 5DYIA 1UFZA 1V34A 3HJ8A 1HNWM 1YKOB 3V76A 2KNZA 1SXJD 5FTNA 2BUUA 2M60A 3MFLM 2KHHA 5EXTA 1R5LA 3LW5F 4X62M 2JY8A 2FH0A 2GQFA 2VF7A 1MN3A 2FE8A 2L2DA 3B9PA 2H5XA 4GEWA 3HJSA 2LBCA 2BURB 4BB9A 2VQEM 4LZJA 4OU7A 4TUWA 3M7GA 4FCVA 3U5ZA 1N32M 2XSZD 2Z3XA 3IG8A 1FNNA 1QVRA 4LF8M 4DR3M 3U6QA 1FJGM 1DGBA 4GIPA 2YFQA 2CHVA 3T67A 4KLNA 2FOIC 4DR5M 1QAMA 2OQ4A 1IN7A 2EO2A 3ZC7B 3TQSA 2BUTA 1OTRA 4WHSD 2DAMA 5LMNM 3RGSA 2V1UA 4NXMM 4WURA 1G3IA 4DR7M 4IJEA 3MV4M 2HL7A 3K92A 3ZCBB 3IG5A 3TL4X 3UK6A 3T63M 2DNAA 2BWBA 2DAGA 3HZJA 4HEOA 2XF3A 3CF2A 1Q3BA 2LVPC 1L1ZA 1XXHA 1ZAEA 2VDBB 4I8OA 4XBOA 2HHHM 3O6JA 4G4NA 4WHPD 4KHPM 2BUVA 1NV8A 4IBEA 4LCBA 2KRUA 3SMSA 2BJWA 4NOOB 2HWJA 2LH0A 1PJJA 2G8LA 2CE7A 5FTJA 4B7FA 2ZM6M 2UUCM 2CEAA 2EKKA 1DGFA 2AZQA 4PCZA 4CIZA 2UUAM 3PCMA 2G3QA
chains in the Genus database with same CATH topology
4RF1A 2QBYA 3GRVA 4LRTA 4AKIA 5EQTA 4G4OA 1L2BA 4OVZB 1NVMA 3O32A 1OJLA 1W5TA 2QCUA 3LKTM 3I4YA 3PCCM 3GPUA 4I4LA 3PCKA 4JN6A 1YKNB 2KZUA 4QOZC 5C1BA 2F5SA 3THGA 2C9CA 3A42A 1NSFA 5JI2E 4DV0M 1TDZA 4MGHA 2Y20A 1S3SA 3GLGB 3PCLA 1IBMM 2L7HA 4GKKM 1R2YA 4FCWA 4IBCA 2J7OA 4CISA 3LXVA 3RGPA 4OX9M 4FWHA 3HHYA 3GQ4A 4AKHA 2CV1A 3UZUA 1LV7A 4PD2A 5EXPA 4AQYM 1YKKA 3PCDA 4LY6A 2KA6B 4JXJA 3KS8A 3NWLA 2F5QA 1EOBB 2R45A 1HT1E 1ZQ9A 2ZBKB 3MHVC 3AOEC 4CHTB 3U6SA 1IY1A 1I4WA 1TH2A 2E5LM 4YY3M 4WHRF 3MI5M 3FTFA 5IREB 4GC5A 3LMXA 3SHGB 2KZSA 4X66M 8CATA 2L09A 4GMQA 4HLQA 1DLTA 1C1KA 2P5TA 3FUWA 3FTCA 3PNVA 3H4MA 1GL7A 4LF7M 3PCGM 4FWDA 1GLNA 1X37A 2HCBA 2F5OA 3O5UA 3PCEM 1DGGA 5EJCA 4LFAM 4EIWA 5BPVA 4ZPXA 3JR5A 3U6MA 1UM8A 3U6DA 1XMQM 2PCDM 3HWSA 5A2QS 3MV6A 3W0FA 1YKMB 2VIIA 4GH9A 2D7HA 3MK6A 1QQWA 2BUVB 3I4VA 2UUBM 1YKPB 2BNKA 2C98A 2CV0A 2FFJA 3KP0E 1G41A 4AG6A 3W0LB 4WHOD 3FUTA 2R62A 4JI8M 4B7HA 4MH0E 1NNJA 2CHQA 2XZUA 1K82A 3MFLA 3JR4A 4WW0A 4BBAA 1MU5A 1GKIA 5FTKA 4K0KM 4GKJM 2XH9A 4ITQA 1YSYA 3KSJA 3VKGA 2C96A 1HQCA 3RE8A 1TH3A 1XHBA 4L78A 1K3WA 4NRWA 3E4RA 4MB7A 5KQ8A 2XSZA 3PCHM 3FYCA 2XSVA 4KO8A 3M6AA 3GO8A 2BV0A 3U61A 4FVMA 5FLXS 1GL6A 4PT5A 4AKGA 3U60A 4X64M 4LJ6A 1EOCB 2J7NA 3M0EA 1I94M 3E9SA 5KPRA 3SAVA 2C9OA 4JI6M 4JI2M 4GRIA 1NHGC 4WHSA 5C18A 2CUZA 4LF5M 4M9ZA 3TE6A 1J09A 3AKZA 4IJFA 5EP4A 4LJ5A 2Q2EB 4D80A 3GLHA 2Y0TA 3GLIA 3CF6E 4MGZE 4IBGA 4IBIA 4I5SA 3VFDA 4DV2M 1IM2A 4AW4A 3L26A 4LG2A 1DLQA 4WHRB 3PCJM 3QAUA 2BUXA 4WHPA 2BUMB 1DGHB 4M0DA 4WHQA 1N36M 2F4VM 1XC8A 1R2ZA 5GKNA 2BUZB 1DO0A 3L29A 4FW9A 4DV3M 2YR0A 4G4RA 3PCFA 2I7NA 3K2LA 2DWLA 2M5ZA 3HHWA 2XZFA 1YKLA 2VQFM 4RF0A 1QANA 4M9SA 5IWAM 2UXBM 3A46A 4LGYA 3FTEA 4HL4A 1XMOM 1N34M 3A45A 3SAWA 1EO9A 1N78A 1TH4A 3T67M 3VDUA 4JI7M 3AFHA 3PCNA 3GRYA 1KFVA 1SXJB 2Z4RA 3J80S 1J7KA 3GPPA 1HNXM 2ZAMA 4NRVA 3TH1A 2FNAA 3KOWE 3J7BA 1EOAA 1N33M 4JYAM 4B3TM 4B3MM 2BOYA 3K1JA 3PVSA 2O5RA 2LXEA 3EIEA 2YQZA 2BUUB 1E32A 1NHWC 2V6ZM 3J27B 3HU1A 1L2CA 1KSFX 4DV4M 2BUYA 4REZA 5FTLA 1E94E 3HKPA 3KP1E 4LJ7A 4MM3B 3SMPA 2BV0B 1IBKM 1Z59A 3TPZA 4MGYE 4L4UA 1IN8A 3KOYE 3PCEA 1IY2A 2QZ4A 3U60B 2EUCA 2DWNA 2XGNA 2HKJA 1G59A 5DNYA 3PCMM 1SXJC 3DZDA 5ITXE 3U5ZB 3PCBM 3GRRA 3PFIA 3VK7A 2BUQA 4R3DA 7CATA 3U6OA 1IY0A 4JI5M 1T3TA 1QYRA 4DUYM 3GLIB 4LFBM 4D81A 4FWGA 4W5WA 4I81A 1NY5A 2QP9X 4PDIA 2BURA 3PCKM 2G5GX 1HNZM 2BUTB 3VK8A 4L15A 3SHFA 2BUXB 4WHPB 2L6OA 3PCLM 3O6RA 3C58A 2C99A 3MI1A 4LRSA 5EP1A 4DR6M 4S12A 3U6EA 3KDSE 1NJFA 5KPTA 2W82A 2XFTA 1XXHB 3PCIA 4WHOA 3L2AA 3GQ3A 5IT9S 3A98B 3U6CA 1IBLM 4L8RC 3ZH9B 3DFZA 2X49A 4JI4M 4G4QA 4KODA 2I7PA 2R46A 2QENA 3Q8XA 3UJNA 1N77A 4GHAA 4ILTA 3LMXM 4B08A 3SASA 2KEBA 2QBYB 4XGIA 4NXNM 5ITTA 1DO2A 2YNMD 2XEPA 4M0WA 1L2DA 1MX0A 1R7RA 4DR2M 4DV1M 4LGMA 2Z7JA 5EXXA 1L1TA 4DR4M 1EOAB 2XFSA 1VDDA 2DXIA 3DOAA 1L8QA 3J81S 3SARA 5ITXA 3KSXA 4QHSA 1NJGA 1EO2A 3PCAM 2CV2A 3TWKA 2R18A 4B3SM 5E6JA 3NBIA 3MV6M 4MGIE 4NSOB 4JV5M 3T38A 2BUYB 4OVZA 4DUZM 3K8ZA 3TWMA 3TWLA 1IN5A 4ILVA 3AOEA 3VLFB 5ITUA 2DVWB 2DZOB 2XLJA 5FSWA 1YKKB 3JAMS 3KOXE 4LJ8A 4IBBA 1Q39A 3L28A 1IXZA 3CTWB 1IN6A 3DA1A 4PDGA 1TMXA 4GHLA 3GLGA 2BUWA 2UXCM 2XSRA 3MV4A 1Q3CA 1IQPA 2JA2A 3T63A 3FTDA 3GP1A 1H6UA 2BUQB 1DMHA 4JI1M 3R9XB 2DWMA 5FTMA 1N75A 3LVWA 2F5PA 3HU3A 4LZZA 1YUBA 4DR1M 3VKHA 1QZMA 1EOBA 4DV5M 4QOSA 1Z5CA 3L25A 3T15A 5E26A 3GRUA 1E9RA 2ERCA 4QNRA 2KW0A 5ITRA 3AJIB 1G4AE 2RKOA 3AOGA 5TD3A 1ORYB 4DV6M 1XWIA 3AV0A 4RNAA 1G8PA 4Z8XA 3T1YM 5IZ7D 3LQRA 4IBKA 4WHOB 5JI3E 1EE8A 2LWXA 1HQYE 3LKTA 3SBJA 3SATA 3PCCA 3SC3A 3GPXA 1GVNA 2X8AA 1TDHA 5KQDA 2ZAOA 4B7GA 2D7EA 3J2PB 2UXDM 3U6LA 4LFCM 2Y0QA 4AG5A 4X65M 3GLFA 4LF9M 3KOZE 1WXQA 1YKMA 2R4EA 1YE9A 3VDPA 3D8LA 3LMMA 5BR8M 3KFUG 3GPYA 1KYIA 1NY6A 1W5SA 3I51A 4CGYB 3UMMA 3HHZA 5LMUM 3SYKA 1YKPA 3N9TA 3PCFM 3OTOM 3T1HM 3HJQA 4II7A 3EIHA 3LQQA 1Z5AA 1K3XA 1NNUC 2KRKA 1EO2B 2K47A 4L16A 3U61B 3MI5A 4OW0A 3FUUA 2UU9M 4LF4M 4JI0M 3U6PA 2RGHA 1QAQA 5H37D 4LF6M 1YKOA 3PCNM 4WHSB 3PCGA 4QNMA 3SYLA 3FUXA 5EP3A 1SXJE 2CHGA 4MGKE 1JR3A 1HT2E 2BUWB 1OFHA 3GLHB 3ILKA 5EXSA 3FYDA 3PXGA 4NL4H 3UGJA 3AL0C 4BLCA 3GQ5A 1EOCA 2F5NA 2EA0A 2PCDA 3CF0A 2KXEA 3D8BA 1PM5A 1XNQM 2QPAA 1S9AA 2CFOA 3FKEA 4Z6YA 1IN4A 1JQJC 4IIWA 4WHQB 1JR3D 1TGUA 3FUVA 1Z6TA 3KS4A 4DV7M 4YHHM 5DYGA 3LXVM 5ITYA 4R7GA 1Z5BA 4LJ4A 1E9SA 3HU2A 4LJ9A 2L7IA 1R6BX 2DZNB 4JI3M 1YKLB 3PCDM 2V1CA 1QAOA 4WHRA 3WHLA 4A3VB 2BUMA 2H1RA 2R65A 1DGHA 2Z4SA 4FD2A 2OPFA 3MJ5A 2BUZA 2X4AA 2R4JA 2D7GA 3RFWA 1EO9B 1PJIA 3HGIA 2XSUA 2ZANA 4IBJA 5ITQA 3KXEC 3PCHA 3L27A 4NSRA 1D2NA 1HR0M 1OFIA 3PCAA 3KVWA 4FCTA 3BOSA 3GLFB 4M9XA 1IXSB 3FD9A 5F3WA 3SAUA 3KW6A 2BJVA 1DLMA 1J5EM 2RGOA 3MI1M 1IXRC 4AI6A 3PNYA 2A5YB 4QHTA 5KO3A 4IBFA 4LJAA 4D82A 3J7AS 4GC9A 5KPZA 3PCIM 2LNHC 1SXJA 2AHMA 2C5RA 2DHRA 1XNRM 3HHXA 3QWLA 2NQ8C 4G6ZA 3WHKA 4AZFA 3LVVA 1YKNA 2DWZB 4P16A 4IBDA 3R8FA 5EP2A 3SFZA 4B3RM 2Y21A 3PCJA 4GITA 5DYIA 3HJ8A 1HNWM 1YKOB 2BUUA 1SXJD 5FTNA 2M60A 3MFLM 5EXTA 4X62M 3B9PA 2FE8A 3HJSA 2BURB 4BB9A 2VQEM 4LZJA 4OU7A 4TUWA 3M7GA 4FCVA 3U5ZA 1N32M 2XSZD 2Z3XA 3IG8A 1FNNA 1QVRA 4LF8M 4DR3M 3U6QA 1FJGM 1DGBA 4GIPA 2YFQA 2CHVA 3T67A 4KLNA 2FOIC 4DR5M 1QAMA 2OQ4A 1IN7A 2EO2A 3ZC7B 3TQSA 2BUTA 4WHSD 5LMNM 3RGSA 2V1UA 4NXMM 4WURA 1G3IA 4DR7M 4IJEA 3MV4M 2HL7A 3K92A 3ZCBB 3IG5A 3TL4X 3UK6A 3T63M 2XF3A 3CF2A 1Q3BA 1L1ZA 1XXHA 1ZAEA 4I8OA 4XBOA 2HHHM 3O6JA 4G4NA 4WHPD 4KHPM 2BUVA 4IBEA 4LCBA 2KRUA 3SMSA 2BJWA 4NOOB 2LH0A 1PJJA 2G8LA 2CE7A 5FTJA 4B7FA 2ZM6M 2UUCM 2CEAA 1DGFA 2AZQA 4PCZA 2UUAM 3PCMA 3PCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DLQ A;  1EOA B;  4WHR B;  3PCJ M;  2BUX A;  4WHP A;  3LXV M;  2BUM B;  3O32 A;  4WHQ A;  3LKT M;  3I4Y A;  3PCA M;  1EO2 A;  1YKL B;  3PCC M;  3PCD M;  2BUZ B;  1YKN B;  3PCK A;  3MV6 M;  4WHR A;  3PCF A;  2BUY B;  2BUM A;  4ILV A;  3PCL A;  1YKL A;  2BUZ A;  1YKK B;  1EO9 B;  3HGI A;  2XSU A;  3LXV A;  1TMX A;  3PCH A;  3HHY A;  2BUW A;  2XSR A;  3MV4 A;  3PCA A;  1YKK A;  3T63 A;  3PCD A;  1EO9 A;  2BUQ B;  3T67 M;  1DMH A;  1EOB B;  3PCN A;  1DLM A;  4WHR F;  3MI1 M;  3TH1 A;  3MI5 M;  1EOB A;  3LMX A;  1EOA A;  3PCI M;  1DLT A;  3HHX A;  2BOY A;  2BUU B;  5TD3 A;  1YKN A;  3PCG M;  2BUY A;  3O5U A;  3PCE M;  3HKP A;  3PCJ A;  4WHO B;  2BV0 B;  3LKT A;  2BUU A;  3HJ8 A;  1YKO B;  3PCC A;  2PCD M;  3MV6 A;  3MFL M;  1YKM B;  3PCM M;  3PCB M;  2BUV B;  3I4V A;  3HJS A;  2BUQ A;  2BUR B;  1YKP B;  1YKM A;  3I51 A;  4WHO D;  2BUR A;  3PCK M;  1YKP A;  2BUT B;  3N9T A;  3PCF M;  3T67 A;  3MFL A;  2BUX B;  4WHP B;  3HJQ A;  3PCL M;  3O6R A;  1EO2 B;  3MI1 A;  2BUT A;  3MI5 A;  4WHS D;  3PCI A;  3PCH M;  4WHO A;  2XSV A;  3MV4 M;  3T63 M;  2BV0 A;  1YKO A;  3PCN M;  4WHS B;  3PCG A;  1EOC B;  3PCE A;  3O6J A;  2BUW B;  4WHP D;  4ILT A;  2BUV A;  3LMX M;  4WHS A;  1EOC A;  2PCD A;  2AZQ A;  1S9A A;  3PCM A;  4WHQ B;  3PCB A; 
#chains in the Genus database with same CATH topology
 4RF1 A;  1QDT A;  2QBY A;  3GRV A;  4UN2 B;  4LRT A;  4AKI A;  5EQT A;  1VQ1 A;  4G4O A;  1L2B A;  4OVZ B;  1NVM A;  3O32 A;  1OJL A;  1W5T A;  2QCU A;  3LKT M;  3I4Y A;  3PCC M;  3GPU A;  4I4L A;  3PCK A;  4JN6 A;  1YKN B;  2KZU A;  1G71 A;  5C1B A;  2F5S A;  3THG A;  4QOZ C;  3C3D A;  2C9C A;  3A42 A;  1NSF A;  5JI2 E;  4DV0 M;  1TDZ A;  2DAI A;  4MGH A;  2Y20 A;  1S3S A;  2QHO B;  3GLG B;  4RKU F;  3PCL A;  1IBM M;  2L7H A;  1LTM A;  1NV9 A;  1R2Y A;  4GKK M;  4FCW A;  4IBC A;  2J7O A;  4CIS A;  3LXV A;  2GNO A;  3RGP A;  4OX9 M;  4FWH A;  3HHY A;  5L8R F;  3GQ4 A;  4AKH A;  2CV1 A;  3UZU A;  1LV7 A;  4P17 A;  1XB2 B;  5EXP A;  4PD2 A;  4AQY M;  4LY6 A;  1BVS A;  2DKL A;  1YKK A;  3PCD A;  2KA6 B;  4JXJ A;  3KS8 A;  3NWL A;  2F5Q A;  1EOB B;  2R45 A;  2WSF F;  4L6V 6;  1HT1 E;  4KT0 F;  1ZQ9 A;  2HAK A;  2ZBK B;  3MHV C;  3AOE C;  4CHT B;  3U6S A;  1IY1 A;  1I4W A;  1TH2 A;  2E5L M;  4YY3 M;  4WHR F;  1V92 A;  3Q8G A;  3MI5 M;  1ZV1 A;  3FTF A;  5IRE B;  4GC5 A;  1PJT A;  3SHG B;  2KZS A;  4X66 M;  8CAT A;  3LMX A;  2L09 A;  1SG9 A;  4GMQ A;  4HLQ A;  4F2L A;  1C1K A;  2P5T A;  1DLT A;  3FUW A;  3FTC A;  3PNV A;  3H4M A;  1GL7 A;  4LF7 M;  3PCG M;  4FWD A;  1GLN A;  1X37 A;  2HCB A;  3BBZ A;  2F5O A;  2DAE A;  3O5U A;  3PCE M;  3GLH E;  1DGG A;  2MGW A;  3GLI E;  5EJC A;  4LFA M;  4EIW A;  5BPV A;  4ZPX A;  3JR5 A;  3U6M A;  1UM8 A;  1WGL A;  3U6D A;  3C9P A;  1XMQ M;  2PCD M;  3BXW A;  3HWS A;  5A2Q S;  3MV6 A;  3W0F A;  1YKM B;  2VII A;  4GH9 A;  2D7H A;  2MH8 A;  3MK6 A;  3ZQJ A;  1QQW A;  2BUV B;  4WP2 A;  3I4V A;  1VEJ A;  2UUB M;  1YKP B;  2BNK A;  2C98 A;  2CV0 A;  2FFJ A;  3KP0 E;  1G41 A;  4AG6 A;  3W0L B;  4WHO D;  2OOA A;  2R62 A;  3FUT A;  3HX3 A;  4B7H A;  2R44 A;  4MH0 E;  4JI8 M;  1NNJ A;  2CHQ A;  2XZU A;  1K82 A;  3MFL A;  3JR4 A;  4WW0 A;  4BBA A;  1QUT A;  1MU5 A;  1GKI A;  5FTK A;  4K0K M;  4GKJ M;  2XH9 A;  4ITQ A;  1YSY A;  3KSJ A;  3VKG A;  2C96 A;  1HQC A;  3RE8 A;  1TH3 A;  1XHB A;  4L78 A;  1K3W A;  4NRW A;  3E4R A;  4MB7 A;  5KQ8 A;  2XSZ A;  3PCH M;  3FYC A;  2XSV A;  4KO8 A;  3M6A A;  3GO8 A;  2BV0 A;  1OIP A;  3U61 A;  4FVM A;  5FLX S;  1GL6 A;  4PT5 A;  4AKG A;  3U60 A;  4X64 M;  4LJ6 A;  1EOC B;  2K0B X;  2J7N A;  3M0E A;  1I94 M;  3E9S A;  5KPR A;  3SAV A;  2C9O A;  4JI6 M;  4JI2 M;  4GRI A;  1NHG C;  4WHS A;  5C18 A;  2CUZ A;  3B74 A;  4LF5 M;  4M9Z A;  3TE6 A;  1J09 A;  3AKZ A;  4IJF A;  5EP4 A;  4LJ5 A;  2Q2E B;  5DFL A;  4D80 A;  3GLH A;  2Y0T A;  3GLI A;  3CF6 E;  4MGZ E;  4IBG A;  4IBI A;  4I5S A;  3VFD A;  3K9O A;  4DV2 M;  1IM2 A;  1QZE A;  4AW4 A;  3L26 A;  4LG2 A;  1DLQ A;  4CJ6 A;  4WHR B;  3PCJ M;  3B7Q A;  3QAU A;  2BUX A;  4WHP A;  2BUM B;  1TTE A;  1DGH B;  2KDL A;  1OQY A;  3QYE A;  4M0D A;  1N36 M;  4WHQ A;  2F4V M;  1XC8 A;  1R2Z A;  2DZL A;  5GKN A;  2BUZ B;  1DO0 A;  2JUJ A;  3L29 A;  4FW9 A;  2YR0 A;  4DV3 M;  4G4R A;  1TR8 A;  1F4I A;  3PCF A;  2I7N A;  3K2L A;  2DWL A;  1D0L A;  2M5Z A;  1VG5 A;  3HHW A;  2XZF A;  1NO1 A;  1YKL A;  2VQF M;  4RF0 A;  1QAN A;  4M9S A;  5IWA M;  2UXB M;  1EFU B;  1IFY A;  1V33 A;  4LGY A;  3A46 A;  4HL4 A;  1XMO M;  1N34 M;  3FTE A;  1VDL A;  3A45 A;  3SAW A;  1EO9 A;  1N78 A;  1TH4 A;  4R71 A;  3T67 M;  3VDU A;  4JI7 M;  3AFH A;  3MMP A;  3PCN A;  2CRU A;  3GRY A;  2JWS A;  1KFV A;  1VEK A;  1SXJ B;  2Z4R A;  3J80 S;  1J7K A;  3GPP A;  1HNX M;  2ZAM A;  4NRV A;  3TH1 A;  3FRH A;  1IXS A;  2FNA A;  3KOW E;  3J7B A;  1GJT A;  2JY5 A;  1N33 M;  1EOA A;  4JYA M;  4B3T M;  4B3M M;  2BOY A;  3K1J A;  2JZ0 A;  2O5R A;  3PVS A;  2LXE A;  3EIE A;  2YQZ A;  2BUU B;  1E32 A;  1NHW C;  2V6Z M;  2JP7 A;  3J27 B;  3HU1 A;  1L2C A;  1KSF X;  4DV4 M;  2BUY A;  4REZ A;  5FTL A;  1E94 E;  3HKP A;  3KP1 E;  2N35 A;  4LJ7 A;  4MM3 B;  3SMP A;  2BV0 B;  1IBK M;  1Z59 A;  3TPZ A;  4MGY E;  4L4U A;  1IN8 A;  3KOY E;  3PCE A;  1IY2 A;  2QZ4 A;  3U60 B;  2EUC A;  1T43 A;  2DWN A;  2XGN A;  2HKJ A;  1G59 A;  5DNY A;  3PCM M;  1SXJ C;  3DZD A;  5ITX E;  3LCV B;  3U5Z B;  1HJP A;  3GRR A;  1VEG A;  3PFI A;  3PCB M;  2JNH A;  1PJQ A;  2MRO B;  3IEC A;  4R3D A;  4ANR A;  7CAT A;  3U6O A;  1IY0 A;  3VK7 A;  4JI5 M;  1AIP C;  1A5T A;  1T3T A;  1QYR A;  4DUY M;  3GLI B;  4LFB M;  4D81 A;  4FWG A;  4W5W A;  4I81 A;  1NY5 A;  2KNV A;  2QP9 X;  4PDI A;  3FRI A;  2BUR A;  3PCK M;  2G5G X;  1HNZ M;  1GAB A;  2BUT B;  2WSE F;  3VK8 A;  4L15 A;  3SHF A;  2BUX B;  4WHP B;  2L6O A;  3GLG E;  3PCL M;  3O6R A;  1D0K A;  3C58 A;  2C99 A;  2MJ5 B;  2R0I A;  3QYB A;  4G3O A;  4LRS A;  3MI1 A;  5EP1 A;  4DR6 M;  4S12 A;  3U6E A;  3KDS E;  1NJF A;  5KPT A;  2BWE A;  2W82 A;  2XFT A;  1XXH B;  2KNA A;  3FE3 A;  3PCI A;  4WHO A;  3L2A A;  3GQ3 A;  5IT9 S;  2OOB A;  3A98 B;  4F1I A;  2JZ1 A;  3U6C A;  1IBL M;  4L8R C;  3ZH9 B;  2L4E A;  2X49 A;  3DFZ A;  4JI4 M;  4G4Q A;  4KOD A;  2I7P A;  2R46 A;  2QEN A;  3Q8X A;  3UJN A;  1N77 A;  2EKF A;  4GHA A;  4ILT A;  3I04 M;  3LMX M;  4B08 A;  3SAS A;  2KEB A;  2QBY B;  2CP8 A;  4XGI A;  4NXN M;  5ITT A;  1DV0 A;  1DO2 A;  2YNM D;  2XEP A;  4M0W A;  1L2D A;  2LVA A;  2ZTC A;  1MX0 A;  1R7R A;  4DR2 M;  2DEN A;  4DV1 M;  4LGM A;  2Z7J A;  5EXX A;  1L1T A;  3F92 A;  4DR4 M;  3B7N A;  1WHC A;  1EOA B;  2LHC A;  2EJS A;  2XFS A;  2ZTD A;  1VDD A;  2DXI A;  3DOA A;  1L8Q A;  3J81 S;  3SAR A;  3E21 A;  5ITX A;  3KSX A;  4QHS A;  1NJG A;  1EO2 A;  2QQ8 A;  2CV2 A;  3GLF E;  3T6P A;  3TWK A;  2R18 A;  4B3S M;  5E6J A;  3NBI A;  3MV6 M;  4MGI E;  4Q7J A;  1MJG M;  4NSO B;  3T38 A;  4JV5 M;  4OVZ A;  4DUZ M;  2BUY B;  3K8Z A;  3TWM A;  3TWL A;  1IN5 A;  4ILV A;  3AOE A;  3VLF B;  1PGY A;  4Y28 F;  2DVW B;  2DZO B;  5ITU A;  2BUQ A;  2DHY A;  2XLJ A;  5FSW A;  1YKK B;  3JAM S;  3KOX E;  3I01 M;  4LJ8 A;  1JB0 F;  4XK8 F;  4IBB A;  1Q39 A;  3L28 A;  1IXZ A;  3CTW B;  1IN6 A;  3DA1 A;  4PDG A;  1TMX A;  4GHL A;  3GLG A;  1ZMV A;  2UXC M;  2BUW A;  2XSR A;  3MV4 A;  1IQP A;  1Q3C A;  2CWB A;  2JA2 A;  1ZMW A;  3FTD A;  3GP1 A;  3T63 A;  1H6U A;  2BUQ B;  1DMH A;  2DAK A;  4JI1 M;  1QDR A;  2DWM A;  5FTM A;  1RU3 A;  3R9X B;  1OAI A;  1N75 A;  2OO9 A;  3LVW A;  2LTU A;  3HU3 A;  4LZZ A;  2F5P A;  1YUB A;  4DR1 M;  3VKH A;  1QZM A;  1QUS A;  1EOB A;  4DV5 M;  4QOS A;  1Z5C A;  4DBG B;  3T15 A;  3L25 A;  5E26 A;  3GRU A;  1E9R A;  2ERC A;  2JY6 B;  1JR3 E;  3HY5 A;  2KW0 A;  4QNR A;  3W68 A;  5ITR A;  2QNJ A;  3AJI B;  1G4A E;  2APL A;  2RKO A;  3AOG A;  5TD3 A;  1ORY B;  4DV6 M;  1XWI A;  1P3Q Q;  3AV0 A;  4RNA A;  1G8P A;  1ZMU A;  3B89 A;  4Z8X A;  3T1Y M;  5IZ7 D;  3NBX X;  2O01 F;  3LQR A;  4IBK A;  4WHO B;  5JI3 E;  1EE8 A;  2RRU A;  3PCA M;  2LWX A;  1HQY E;  3LKT A;  3SBJ A;  2Z8Y M;  3SAT A;  3PCC A;  1AUA A;  3SC3 A;  3GPX A;  1GVN A;  1YLA A;  2X8A A;  1TDH A;  5KQD A;  1WR1 B;  2L4F A;  2ZAO A;  4B7G A;  2D7E A;  3J2P B;  2UXD M;  2K6B A;  3U6L A;  4LFC M;  2Y0Q A;  2QSF X;  4AG5 A;  4X65 M;  3GLF A;  4LF9 M;  1TF0 B;  1OKS A;  2JY7 A;  3H4J A;  1CUK A;  3KOZ E;  1WXQ A;  1YKM A;  2R4E A;  1YE9 A;  3VDP A;  3K9P A;  3D8L A;  3LMM A;  1R4G A;  5BR8 M;  3KFU G;  3GPY A;  1GJS A;  1KYI A;  1NY6 A;  1W5S A;  3I51 A;  3CGW A;  4CGY B;  3UMM A;  3HHZ A;  5LMU M;  3SYK A;  1YKP A;  3N9T A;  3PCF M;  3OTO M;  3T1H M;  2K9D A;  3HJQ A;  4II7 A;  3EIH A;  3LQQ A;  1Z5A A;  1K3X A;  1NNU C;  2KRK A;  1EO2 B;  2K47 A;  2LVO C;  4L16 A;  3U61 B;  3MI5 A;  4OW0 A;  2R6F A;  1OAO C;  3FUU A;  2UU9 M;  4LF4 M;  4JI0 M;  3U6P A;  2RGH A;  1EIJ A;  1QAQ A;  1OIZ A;  5H37 D;  4LF6 M;  1YKO A;  3PCN M;  4WHS B;  3LCU A;  3PCG A;  4QNM A;  3SYL A;  3FUX A;  2B3T A;  5EP3 A;  1SXJ E;  2CHG A;  1PRB A;  1JR3 A;  1HT2 E;  4MGK E;  1OFH A;  3GLH B;  3ILK A;  5EXS A;  2BUW B;  2WZJ A;  3FYD A;  3PXG A;  4NL4 H;  3UGJ A;  3AL0 C;  4BLC A;  1T6O A;  2LVN C;  3GQ5 A;  1EOC A;  2F5N A;  2LVQ D;  3IHP A;  2EA0 A;  2PCD A;  3B7Z A;  1WGN A;  2KXE A;  3CF0 A;  3D8B A;  1PM5 A;  1XNQ M;  2QPA A;  1S9A A;  3W67 A;  2CFO A;  3FKE A;  4Z6Y A;  1IN4 A;  1JQJ C;  2VF8 A;  4IIW A;  4WHQ B;  1PJS A;  1JR3 D;  1TGU A;  3FUV A;  1Z6T A;  3KS4 A;  4DV7 M;  4YHH M;  5DYG A;  3LXV M;  5ITY A;  3E46 A;  4R7G A;  1Z5B A;  4LJ4 A;  1E9S A;  3HU2 A;  4LJ9 A;  2L7I A;  1R6B X;  2DZN B;  4JI3 M;  1YKL B;  3PCD M;  2V1C A;  1QAO A;  2JXN A;  3WHL A;  4A3V B;  1C7Y A;  4WHR A;  2BUM A;  2H1R A;  2R65 A;  1DGH A;  2Z4S A;  4FD2 A;  2OPF A;  1WJ7 A;  3MJ5 A;  2BUZ A;  2X4A A;  2R4J A;  2D7G A;  3RFW A;  1EO9 B;  1PJI A;  3HGI A;  3C3E A;  2ZAN A;  1Y8G A;  4IBJ A;  2XSU A;  5ITQ A;  3KXE C;  1D0M A;  3PCH A;  1Q02 A;  3L27 A;  4NSR A;  1D2N A;  1HR0 M;  1OFI A;  3PCA A;  3KVW A;  4FCT A;  3BOS A;  3GLF B;  4M9X A;  1GO5 A;  1IXS B;  2O25 A;  3FD9 A;  5F3W A;  3SAU A;  3KW6 A;  1WIV A;  2BJV A;  1DLM A;  1J5E M;  2RGO A;  3MI1 M;  1IXR C;  4AI6 A;  3PCB A;  3PNY A;  2A5Y B;  4QHT A;  5KO3 A;  4IBF A;  4NC6 A;  4LJA A;  4D82 A;  3J7A S;  4GC9 A;  1XXH E;  2DI0 A;  5KPZ A;  3PCI M;  2LNH C;  1SXJ A;  2AHM A;  2C5R A;  2DHR A;  1XNR M;  3HHX A;  3QWL A;  2NQ8 C;  4G6Z A;  2LHG A;  3WHK A;  4AZF A;  3LVV A;  1YKN A;  2DWZ B;  4P16 A;  4IBD A;  3R8F A;  2MR9 A;  5EP2 A;  3SFZ A;  2FS1 A;  2Y21 A;  4B3R M;  4GIT A;  3PCJ A;  2WSC F;  2J5Y A;  5DYI A;  1UFZ A;  1V34 A;  3HJ8 A;  1HNW M;  1YKO B;  3V76 A;  2KNZ A;  1SXJ D;  5FTN A;  2BUU A;  2M60 A;  3MFL M;  2KHH A;  5EXT A;  1R5L A;  3LW5 F;  4X62 M;  2JY8 A;  2FH0 A;  2GQF A;  2VF7 A;  1MN3 A;  2FE8 A;  2L2D A;  3B9P A;  2H5X A;  4GEW A;  3HJS A;  2LBC A;  2BUR B;  4BB9 A;  2VQE M;  4LZJ A;  4OU7 A;  4TUW A;  3M7G A;  4FCV A;  3U5Z A;  1N32 M;  2XSZ D;  2Z3X A;  3IG8 A;  1FNN A;  1QVR A;  4LF8 M;  4DR3 M;  3U6Q A;  1FJG M;  1DGB A;  4GIP A;  2YFQ A;  2CHV A;  3T67 A;  4KLN A;  2FOI C;  4DR5 M;  1QAM A;  2OQ4 A;  1IN7 A;  2EO2 A;  3ZC7 B;  3TQS A;  2BUT A;  1OTR A;  4WHS D;  2DAM A;  5LMN M;  3RGS A;  2V1U A;  4NXM M;  4WUR A;  1G3I A;  4DR7 M;  4IJE A;  3MV4 M;  2HL7 A;  3K92 A;  3ZCB B;  3IG5 A;  3TL4 X;  3UK6 A;  3T63 M;  2DNA A;  2BWB A;  2DAG A;  3HZJ A;  4HEO A;  2XF3 A;  3CF2 A;  1Q3B A;  2LVP C;  1L1Z A;  1XXH A;  1ZAE A;  2VDB B;  4I8O A;  4XBO A;  2HHH M;  3O6J A;  4G4N A;  4WHP D;  4KHP M;  2BUV A;  1NV8 A;  4IBE A;  4LCB A;  2KRU A;  3SMS A;  2BJW A;  4NOO B;  2HWJ A;  2LH0 A;  1PJJ A;  2G8L A;  2CE7 A;  5FTJ A;  4B7F A;  2ZM6 M;  2UUC M;  2CEA A;  2EKK A;  1DGF A;  2AZQ A;  4PCZ A;  4CIZ A;  2UUA M;  3PCM A;  2G3Q A; 
#chains in the Genus database with same CATH homology
 4RF1 A;  2QBY A;  3GRV A;  4LRT A;  4AKI A;  5EQT A;  4G4O A;  1L2B A;  4OVZ B;  1NVM A;  3O32 A;  1OJL A;  1W5T A;  2QCU A;  3LKT M;  3I4Y A;  3PCC M;  3GPU A;  4I4L A;  3PCK A;  4JN6 A;  1YKN B;  2KZU A;  4QOZ C;  5C1B A;  2F5S A;  3THG A;  2C9C A;  3A42 A;  1NSF A;  5JI2 E;  4DV0 M;  1TDZ A;  4MGH A;  2Y20 A;  1S3S A;  3GLG B;  3PCL A;  1IBM M;  2L7H A;  4GKK M;  1R2Y A;  4FCW A;  4IBC A;  2J7O A;  4CIS A;  3LXV A;  3RGP A;  4OX9 M;  4FWH A;  3HHY A;  3GQ4 A;  4AKH A;  2CV1 A;  3UZU A;  1LV7 A;  4PD2 A;  5EXP A;  4AQY M;  1YKK A;  3PCD A;  4LY6 A;  2KA6 B;  4JXJ A;  3KS8 A;  3NWL A;  2F5Q A;  1EOB B;  2R45 A;  1HT1 E;  1ZQ9 A;  2ZBK B;  3MHV C;  3AOE C;  4CHT B;  3U6S A;  1IY1 A;  1I4W A;  1TH2 A;  2E5L M;  4YY3 M;  4WHR F;  3MI5 M;  3FTF A;  5IRE B;  4GC5 A;  3LMX A;  3SHG B;  2KZS A;  4X66 M;  8CAT A;  2L09 A;  4GMQ A;  4HLQ A;  1DLT A;  1C1K A;  2P5T A;  3FUW A;  3FTC A;  3PNV A;  3H4M A;  1GL7 A;  4LF7 M;  3PCG M;  4FWD A;  1GLN A;  1X37 A;  2HCB A;  2F5O A;  3O5U A;  3PCE M;  1DGG A;  5EJC A;  4LFA M;  4EIW A;  5BPV A;  4ZPX A;  3JR5 A;  3U6M A;  1UM8 A;  3U6D A;  1XMQ M;  2PCD M;  3HWS A;  5A2Q S;  3MV6 A;  3W0F A;  1YKM B;  2VII A;  4GH9 A;  2D7H A;  3MK6 A;  1QQW A;  2BUV B;  3I4V A;  2UUB M;  1YKP B;  2BNK A;  2C98 A;  2CV0 A;  2FFJ A;  3KP0 E;  1G41 A;  4AG6 A;  3W0L B;  4WHO D;  3FUT A;  2R62 A;  4JI8 M;  4B7H A;  4MH0 E;  1NNJ A;  2CHQ A;  2XZU A;  1K82 A;  3MFL A;  3JR4 A;  4WW0 A;  4BBA A;  1MU5 A;  1GKI A;  5FTK A;  4K0K M;  4GKJ M;  2XH9 A;  4ITQ A;  1YSY A;  3KSJ A;  3VKG A;  2C96 A;  1HQC A;  3RE8 A;  1TH3 A;  1XHB A;  4L78 A;  1K3W A;  4NRW A;  3E4R A;  4MB7 A;  5KQ8 A;  2XSZ A;  3PCH M;  3FYC A;  2XSV A;  4KO8 A;  3M6A A;  3GO8 A;  2BV0 A;  3U61 A;  4FVM A;  5FLX S;  1GL6 A;  4PT5 A;  4AKG A;  3U60 A;  4X64 M;  4LJ6 A;  1EOC B;  2J7N A;  3M0E A;  1I94 M;  3E9S A;  5KPR A;  3SAV A;  2C9O A;  4JI6 M;  4JI2 M;  4GRI A;  1NHG C;  4WHS A;  5C18 A;  2CUZ A;  4LF5 M;  4M9Z A;  3TE6 A;  1J09 A;  3AKZ A;  4IJF A;  5EP4 A;  4LJ5 A;  2Q2E B;  4D80 A;  3GLH A;  2Y0T A;  3GLI A;  3CF6 E;  4MGZ E;  4IBG A;  4IBI A;  4I5S A;  3VFD A;  4DV2 M;  1IM2 A;  4AW4 A;  3L26 A;  4LG2 A;  1DLQ A;  4WHR B;  3PCJ M;  3QAU A;  2BUX A;  4WHP A;  2BUM B;  1DGH B;  4M0D A;  4WHQ A;  1N36 M;  2F4V M;  1XC8 A;  1R2Z A;  5GKN A;  2BUZ B;  1DO0 A;  3L29 A;  4FW9 A;  4DV3 M;  2YR0 A;  4G4R A;  3PCF A;  2I7N A;  3K2L A;  2DWL A;  2M5Z A;  3HHW A;  2XZF A;  1YKL A;  2VQF M;  4RF0 A;  1QAN A;  4M9S A;  5IWA M;  2UXB M;  3A46 A;  4LGY A;  3FTE A;  4HL4 A;  1XMO M;  1N34 M;  3A45 A;  3SAW A;  1EO9 A;  1N78 A;  1TH4 A;  3T67 M;  3VDU A;  4JI7 M;  3AFH A;  3PCN A;  3GRY A;  1KFV A;  1SXJ B;  2Z4R A;  3J80 S;  1J7K A;  3GPP A;  1HNX M;  2ZAM A;  4NRV A;  3TH1 A;  2FNA A;  3KOW E;  3J7B A;  1EOA A;  1N33 M;  4JYA M;  4B3T M;  4B3M M;  2BOY A;  3K1J A;  3PVS A;  2O5R A;  2LXE A;  3EIE A;  2YQZ A;  2BUU B;  1E32 A;  1NHW C;  2V6Z M;  3J27 B;  3HU1 A;  1L2C A;  1KSF X;  4DV4 M;  2BUY A;  4REZ A;  5FTL A;  1E94 E;  3HKP A;  3KP1 E;  4LJ7 A;  4MM3 B;  3SMP A;  2BV0 B;  1IBK M;  1Z59 A;  3TPZ A;  4MGY E;  4L4U A;  1IN8 A;  3KOY E;  3PCE A;  1IY2 A;  2QZ4 A;  3U60 B;  2EUC A;  2DWN A;  2XGN A;  2HKJ A;  1G59 A;  5DNY A;  3PCM M;  1SXJ C;  3DZD A;  5ITX E;  3U5Z B;  3PCB M;  3GRR A;  3PFI A;  3VK7 A;  2BUQ A;  4R3D A;  7CAT A;  3U6O A;  1IY0 A;  4JI5 M;  1T3T A;  1QYR A;  4DUY M;  3GLI B;  4LFB M;  4D81 A;  4FWG A;  4W5W A;  4I81 A;  1NY5 A;  2QP9 X;  4PDI A;  2BUR A;  3PCK M;  2G5G X;  1HNZ M;  2BUT B;  3VK8 A;  4L15 A;  3SHF A;  2BUX B;  4WHP B;  2L6O A;  3PCL M;  3O6R A;  3C58 A;  2C99 A;  3MI1 A;  4LRS A;  5EP1 A;  4DR6 M;  4S12 A;  3U6E A;  3KDS E;  1NJF A;  5KPT A;  2W82 A;  2XFT A;  1XXH B;  3PCI A;  4WHO A;  3L2A A;  3GQ3 A;  5IT9 S;  3A98 B;  3U6C A;  1IBL M;  4L8R C;  3ZH9 B;  3DFZ A;  2X49 A;  4JI4 M;  4G4Q A;  4KOD A;  2I7P A;  2R46 A;  2QEN A;  3Q8X A;  3UJN A;  1N77 A;  4GHA A;  4ILT A;  3LMX M;  4B08 A;  3SAS A;  2KEB A;  2QBY B;  4XGI A;  4NXN M;  5ITT A;  1DO2 A;  2YNM D;  2XEP A;  4M0W A;  1L2D A;  1MX0 A;  1R7R A;  4DR2 M;  4DV1 M;  4LGM A;  2Z7J A;  5EXX A;  1L1T A;  4DR4 M;  1EOA B;  2XFS A;  1VDD A;  2DXI A;  3DOA A;  1L8Q A;  3J81 S;  3SAR A;  5ITX A;  3KSX A;  4QHS A;  1NJG A;  1EO2 A;  3PCA M;  2CV2 A;  3TWK A;  2R18 A;  4B3S M;  5E6J A;  3NBI A;  3MV6 M;  4MGI E;  4NSO B;  4JV5 M;  3T38 A;  2BUY B;  4OVZ A;  4DUZ M;  3K8Z A;  3TWM A;  3TWL A;  1IN5 A;  4ILV A;  3AOE A;  3VLF B;  5ITU A;  2DVW B;  2DZO B;  2XLJ A;  5FSW A;  1YKK B;  3JAM S;  3KOX E;  4LJ8 A;  4IBB A;  1Q39 A;  3L28 A;  1IXZ A;  3CTW B;  1IN6 A;  3DA1 A;  4PDG A;  1TMX A;  4GHL A;  3GLG A;  2BUW A;  2UXC M;  2XSR A;  3MV4 A;  1Q3C A;  1IQP A;  2JA2 A;  3T63 A;  3FTD A;  3GP1 A;  1H6U A;  2BUQ B;  1DMH A;  4JI1 M;  3R9X B;  2DWM A;  5FTM A;  1N75 A;  3LVW A;  2F5P A;  3HU3 A;  4LZZ A;  1YUB A;  4DR1 M;  3VKH A;  1QZM A;  1EOB A;  4DV5 M;  4QOS A;  1Z5C A;  3L25 A;  3T15 A;  5E26 A;  3GRU A;  1E9R A;  2ERC A;  4QNR A;  2KW0 A;  5ITR A;  3AJI B;  1G4A E;  2RKO A;  3AOG A;  5TD3 A;  1ORY B;  4DV6 M;  1XWI A;  3AV0 A;  4RNA A;  1G8P A;  4Z8X A;  3T1Y M;  5IZ7 D;  3LQR A;  4IBK A;  4WHO B;  5JI3 E;  1EE8 A;  2LWX A;  1HQY E;  3LKT A;  3SBJ A;  3SAT A;  3PCC A;  3SC3 A;  3GPX A;  1GVN A;  2X8A A;  1TDH A;  5KQD A;  2ZAO A;  4B7G A;  2D7E A;  3J2P B;  2UXD M;  3U6L A;  4LFC M;  2Y0Q A;  4AG5 A;  4X65 M;  3GLF A;  4LF9 M;  3KOZ E;  1WXQ A;  1YKM A;  2R4E A;  1YE9 A;  3VDP A;  3D8L A;  3LMM A;  5BR8 M;  3KFU G;  3GPY A;  1KYI A;  1NY6 A;  1W5S A;  3I51 A;  4CGY B;  3UMM A;  3HHZ A;  5LMU M;  3SYK A;  1YKP A;  3N9T A;  3PCF M;  3OTO M;  3T1H M;  3HJQ A;  4II7 A;  3EIH A;  3LQQ A;  1Z5A A;  1K3X A;  1NNU C;  2KRK A;  1EO2 B;  2K47 A;  4L16 A;  3U61 B;  3MI5 A;  4OW0 A;  3FUU A;  2UU9 M;  4LF4 M;  4JI0 M;  3U6P A;  2RGH A;  1QAQ A;  5H37 D;  4LF6 M;  1YKO A;  3PCN M;  4WHS B;  3PCG A;  4QNM A;  3SYL A;  3FUX A;  5EP3 A;  1SXJ E;  2CHG A;  4MGK E;  1JR3 A;  1HT2 E;  2BUW B;  1OFH A;  3GLH B;  3ILK A;  5EXS A;  3FYD A;  3PXG A;  4NL4 H;  3UGJ A;  3AL0 C;  4BLC A;  3GQ5 A;  1EOC A;  2F5N A;  2EA0 A;  2PCD A;  3CF0 A;  2KXE A;  3D8B A;  1PM5 A;  1XNQ M;  2QPA A;  1S9A A;  2CFO A;  3FKE A;  4Z6Y A;  1IN4 A;  1JQJ C;  4IIW A;  4WHQ B;  1JR3 D;  1TGU A;  3FUV A;  1Z6T A;  3KS4 A;  4DV7 M;  4YHH M;  5DYG A;  3LXV M;  5ITY A;  4R7G A;  1Z5B A;  4LJ4 A;  1E9S A;  3HU2 A;  4LJ9 A;  2L7I A;  1R6B X;  2DZN B;  4JI3 M;  1YKL B;  3PCD M;  2V1C A;  1QAO A;  4WHR A;  3WHL A;  4A3V B;  2BUM A;  2H1R A;  2R65 A;  1DGH A;  2Z4S A;  4FD2 A;  2OPF A;  3MJ5 A;  2BUZ A;  2X4A A;  2R4J A;  2D7G A;  3RFW A;  1EO9 B;  1PJI A;  3HGI A;  2XSU A;  2ZAN A;  4IBJ A;  5ITQ A;  3KXE C;  3PCH A;  3L27 A;  4NSR A;  1D2N A;  1HR0 M;  1OFI A;  3PCA A;  3KVW A;  4FCT A;  3BOS A;  3GLF B;  4M9X A;  1IXS B;  3FD9 A;  5F3W A;  3SAU A;  3KW6 A;  2BJV A;  1DLM A;  1J5E M;  2RGO A;  3MI1 M;  1IXR C;  4AI6 A;  3PNY A;  2A5Y B;  4QHT A;  5KO3 A;  4IBF A;  4LJA A;  4D82 A;  3J7A S;  4GC9 A;  5KPZ A;  3PCI M;  2LNH C;  1SXJ A;  2AHM A;  2C5R A;  2DHR A;  1XNR M;  3HHX A;  3QWL A;  2NQ8 C;  4G6Z A;  3WHK A;  4AZF A;  3LVV A;  1YKN A;  2DWZ B;  4P16 A;  4IBD A;  3R8F A;  5EP2 A;  3SFZ A;  4B3R M;  2Y21 A;  3PCJ A;  4GIT A;  5DYI A;  3HJ8 A;  1HNW M;  1YKO B;  2BUU A;  1SXJ D;  5FTN A;  2M60 A;  3MFL M;  5EXT A;  4X62 M;  3B9P A;  2FE8 A;  3HJS A;  2BUR B;  4BB9 A;  2VQE M;  4LZJ A;  4OU7 A;  4TUW A;  3M7G A;  4FCV A;  3U5Z A;  1N32 M;  2XSZ D;  2Z3X A;  3IG8 A;  1FNN A;  1QVR A;  4LF8 M;  4DR3 M;  3U6Q A;  1FJG M;  1DGB A;  4GIP A;  2YFQ A;  2CHV A;  3T67 A;  4KLN A;  2FOI C;  4DR5 M;  1QAM A;  2OQ4 A;  1IN7 A;  2EO2 A;  3ZC7 B;  3TQS A;  2BUT A;  4WHS D;  5LMN M;  3RGS A;  2V1U A;  4NXM M;  4WUR A;  1G3I A;  4DR7 M;  4IJE A;  3MV4 M;  2HL7 A;  3K92 A;  3ZCB B;  3IG5 A;  3TL4 X;  3UK6 A;  3T63 M;  2XF3 A;  3CF2 A;  1Q3B A;  1L1Z A;  1XXH A;  1ZAE A;  4I8O A;  4XBO A;  2HHH M;  3O6J A;  4G4N A;  4WHP D;  4KHP M;  2BUV A;  4IBE A;  4LCB A;  2KRU A;  3SMS A;  2BJW A;  4NOO B;  2LH0 A;  1PJJ A;  2G8L A;  2CE7 A;  5FTJ A;  4B7F A;  2ZM6 M;  2UUC M;  2CEA A;  1DGF A;  2AZQ A;  4PCZ A;  2UUA M;  3PCM A;  3PCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...