3HJQA

Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hjqA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hjqA02
3T67A 2BUQB 1YKMB 2BV0B 1EOBA 2AZQA 2BUTB 4WHSA 2BUZA 3HHYA 2BUVB 1EO2A 3PCFA 3PCJM 3PCGM 3PCNM 1EO9A 4WHOD 1EOCA 3T67M 3PCEM 3HHXA 3LMXM 3MV6A 1YKPB 3O5UA 1EOAB 4WHRB 2XSVA 3PCBM 3HGIA 1YKLA 4WHRA 3PCHM 2BUYB 4WHOA 3PCJA 3PCGA 3HJQA 2BUWB 3MI5M 3PCNA 3MV4M 3O6JA 1DMHA 3PCEA 2XSRA 3LMXA 3HKPA 1S9AA 1YKNB 2BUQA 2BUXB 1YKMA 3TH1A 2BV0A 3PCBA 2BUTA 2BUXA 4WHRF 3PCAA 2BUVA 3PCHA 3PCLM 3MI5A 5TD3A 3MV4A 1YKPA 2BURB 1EOAA 3PCAM 3HJSA 1DLQA 2BUUB 4WHPB 2BUYA 3O6RA 2BUWA 2BUMB 3PCLA 3I4VA 2XSUA 1YKOB 4ILTA 3MI1M 2PCDM 1YKNA 3I51A 3I4YA 1YKKB 3PCKA 4WHSD 4ILVA 4WHPD 2BOYA 3PCDM 1DLTA 3PCCM 1EOBB 3PCKM 4WHSB 2BURA 2BUZB 3MI1A 2PCDA 3LKTA 1EO2B 3LXVM 1EO9B 3PCMM 2BUUA 1EOCB 4WHPA 1DLMA 3N9TA 3T63M 2BUMA 3PCIM 3HJ8A 3MFLM 1TMXA 4WHQB 3PCDA 1YKOA 3LKTM 1YKLB 3PCCA 4WHQA 3O32A 3PCFM 1YKKA 4WHOB 3LXVA 3PCMA 3MV6M 3T63A 3PCIA 3MFLA
chains in the Genus database with same CATH superfamily
3T67A 3KSJA 3LVWA 1ORYB 2MR9A 1SG9A 2MROB 2BUTB 2CE7A 2LHGA 5FTMA 3U6CA 1Z5BA 2V1CA 1H6UA 2Y20A 1XHBA 2Z4RA 4IBCA 2XZFA 3PCFA 3A42A 1EO9A 1IBKM 3GLIA 3PCGM 5H37D 1QZEA 2LVAA 1GJTA 3KVWA 4M0WA 3GLHA 3PNVA 5IZ7D 3SFZA 2DAMA 3EIEA 3LMMA 4CJ6A 4D82A 1OAIA 3GLGE 5E6JA 3CF2A 4EIWA 3O5UA 2J7NA 2R65A 1EOAB 4WHRB 1QANA 4QNRA 1Z6TA 1SXJD 3U61B 4RKUF 1WIVA 3NBXX 2CFOA 2QP9X 1NHGC 2UXDM 4X62M 1NY6A 3LQQA 3HJQA 2BUWB 1N77A 3SAVA 2ZTCA 4II7A 4FWHA 3UMMA 4G6ZA 1N32M 3MV4M 2CUZA 4JI3M 4XK8F 2JY5A 1VDLA 2V1UA 4HEOA 4M9ZA 1R7RA 2L2DA 2WSFF 4FCVA 4LJ7A 2MGWA 3HX3A 3GLGA 1I94M 1SXJB 2K0BX 2O25A 3HKPA 4BB9A 5DNYA 2L09A 3U60A 2FH0A 3TQSA 1Y8GA 4LCBA 1DGBA 3PCBA 3FUWA 2BUTA 2LBCA 4GC9A 5BPVA 1GO5A 2D7EA 4DR6M 2HWJA 2J5YA 5IWAM 3OTOM 3GLFE 2XLJA 3U6SA 4G4RA 4LJAA 3MI5A 2R18A 4G4OA 3CGWA 4NSRA 3IG8A 4R3DA 4M9SA 2DI0A 3QYBA 4IBBA 3ZCBB 1WGNA 2JUJA 1TH4A 3HU3A 1EOAA 2ZAOA 3U61A 1NNJA 1OFHA 4X65M 4WHPB 1IM2A 2MJ5B 2R44A 1C1KA 3K9OA 1J09A 2BUWA 3O6RA 2KW0A 1YE9A 3RGPA 1OKSA 1N34M 3TL4X 1NV8A 1TF0B 8CATA 3AOEC 1YKOB 2EKKA 4Z6YA 5ITQA 1SXJA 2L4EA 3FD9A 4IBEA 4X66M 3GQ4A 2ZM6M 4DV6M 4G4NA 3WHLA 1G8PA 3J7AS 3SMPA 2H1RA 2LTUA 3HHWA 3SYKA 1RU3A 4LF8M 1N33M 3J2PB 3B7ZA 1ZMVA 3FUUA 4KO8A 4DV3M 4B3SM 2JZ1A 4JI7M 2HAKA 3MHVC 4LJ5A 3T15A 4I4LA 5EP1A 2BWEA 4BBAA 1OTRA 3GRVA 1QDTA 2XH9A 1G59A 5ITXE 5FTJA 4OU7A 4P16A 2WSEF 4AKIA 4Y28F 1DLTA 4NXNM 1T6OA 3IECA 4LJ6A 5KQDA 3GPPA 3T1YM 2DNAA 2BWBA 3Q8GA 2K9DA 2QSFX 4DR7M 4PCZA 2PCDA 1HNXM 1IFYA 4M9XA 3PCMM 1XXHE 2DXIA 2Z3XA 4WHPA 2VF7A 3LCVB 3T63M 1ZV1A 3HJ8A 3FTFA 4DV4M 2YR0A 4GKKM 1NSFA 3W0LB 1NO1A 5ITXA 1YKOA 1MX0A 3KXEC 3L26A 3CF0A 1LTMA 1IN7A 4WHQA 4I5SA 3QWLA 3VKHA 2K47A 5FTNA 1VEJA 4XBOA 3GPXA 4JYAM 1Z5AA 1EFUB 2KNZA 2C98A 4JN6A 4RF0A 1GVNA 1PRBA 1HJPA 3MV6M 2FFJA 2XGNA 1T43A 2O01F 3SMSA 3GQ5A 4DR5M 1PM5A 5L8RF 4K0KM 4AKGA 3MFLA 4D81A 4FVMA 3U6MA 4FD2A 2KHHA 1T3TA 1YKMB 4TUWA 3KS4A 2VF8A 3AV0A 2L6OA 2LH0A 4B7GA 1R6BX 4CHTB 4NOOB 3BOSA 5EXPA 2MH8A 4A3VB 2OPFA 2ZBKB 4DV2M 2CV2A 3IHPA 3GRYA 3GPUA 4JI1M 1MN3A 2EO2A 1DO0A 3LMXM 1FNNA 3H4JA 4NRVA 1HQYE 4MGZE 3TPZA 2A5YB 1NJGA 1E94E 1AUAA 2K6BA 1W5SA 2DAKA 4WURA 1IN5A 2BUYB 3PCHM 3MMPA 4LFBM 5ITRA 3PCGA 2C9OA 4MGIE 1JR3A 2Z8YM 5EJCA 3J80S 2D7HA 3SHGB 3IG5A 3U60B 4L4UA 3T67M 2RKOA 2GQFA 3CF6E 4QNMA 2JP7A 4DR3M 1WGLA 1YKMA 1DGFA 1J5EM 3TH1A 3PNYA 2KZUA 4WHRF 4IBKA 3K1JA 4KT0F 4KHPM 1YUBA 2JY7A 3SAUA 3DZDA 1QAQA 2KNAA 4GMQA 4DUYM 3PCCA 3MV4A 2L7HA 4GHAA 2I7PA 1SXJC 5KPZA 3GPYA 3THGA 5KPTA 4LFAM 1J7KA 2P5TA 3HJSA 1DLQA 1P3QQ 1QYRA 3UGJA 4LJ9A 2C99A 3ZC7B 4DR1M 3GLFB 4AQYM 2BUUB 4W5WA 3I01M 5FTKA 4AI6A 1OQYA 1XB2B 2DENA 2G5GX 4GRIA 2BUYA 1IXSB 4WP2A 1XC8A 5FTLA 1KFVA 3M7GA 3I4VA 2BNKA 1QAMA 4ILTA 1IY2A 3MI1M 3L29A 2WZJA 3VFDA 3FUVA 4F1IA 3EIHA 4JV5M 2JNHA 3I4YA 1VQ1A 2XSZD 4G3OA 1PJIA 3JR4A 3W67A 2LVNC 4WHPD 1IN4A 3SAWA 2F5NA 1OAOC 2UUBM 2DZNB 2LVQD 3PCDM 1QAOA 3JAMS 1PJJA 1K82A 3PCCM 3K8ZA 2BUZB 4FW9A 1GABA 3W68A 3KFUG 5DFLA 1HR0M 1OIPA 4P17A 5EXTA 3B7QA 3FUXA 1KYIA 3GLFA 4JXJA 2BUUA 4LF6M 3T38A 1EOCB 3SBJA 4IJFA 1IXSA 5A2QS 2UU9M 3PCIM 3E9SA 1MU5A 4X64M 4B3MM 4CIZA 2JWSA 1TDZA 4WHQB 1NV9A 4QOSA 2XEPA 4DV0M 3VKGA 3A98B 3LCUA 1HT1E 4GEWA 1Z59A 4XGIA 2FNAA 5FLXS 4JI8M 4WHOB 1XXHB 4MB7A 1F4IA 3KOZE 5C1BA 1DO2A 2H5XA 3L28A 4LF4M 1HQCA 5EXXA 3PCMA 2R45A 2NQ8C 4B7HA 2ZAMA 1XMOM 1G3IA 1UFZA 3T63A 4LRSA 1L1ZA 4DV5M 4GC5A 1IN6A 3U6DA 2C9CA 3DA1A 1VDDA 1Q3CA 2OQ4A 1GJSA 2BUMA 2VDBB 3F92A 4WW0A 3VLFB 2XSZA 3I04M 2DWMA 4L6V6 2DWLA 1HNWM 2CV0A 1XNRM 2BUZA 2LHCA 3HHYA 2QPAA 4JI5M 3PCJM 4MGHA 3PCNM 1MJGM 2G8LA 1EOCA 3PCEM 1JR3D 3FTCA 3HHXA 4MGKE 3KOXE 3MV6A 1YKPB 5EQTA 1E9SA 2FOIC 2R6FA 1YSYA 2KZSA 1EE8A 2R62A 4AG6A 2DHRA 3V76A 3HHZA 1C7YA 3SATA 3FYCA 3HGIA 5FSWA 3SYLA 3KSXA 4JI2M 2CRUA 2B3TA 2RGOA 4MM3B 1JB0F 2EKFA 4B3TM 3VK8A 3MK6A 4LF7M 4CISA 4NRWA 4WHOA 1XXHA 2WSCF 4GITA 2F5SA 3AL0C 4R7GA 3U6OA 2OO9A 3D8BA 3RGSA 5IT9S 1YLAA 3SARA 3SASA 1Q02A 1DMHA 3CTWB 4JI6M 3TWLA 3K9PA 1GL6A 3LMXA 2BJVA 2DAIA 1Q39A 4FWGA 2CWBA 1DGGA 2AHMA 2D7GA 2Z4SA 3B9PA 1YKNB 5GKNA 4IIWA 3SHFA 2BV0A 1G4AE 2Z7JA 3B74A 2BUXA 4Z8XA 3PCAA 1N36M 2DZOB 3PCHA 1XWIA 3PCLM 3TWMA 1NNUC 3HY5A 3Q8XA 4IJEA 2VQEM 2N35A 4KLNA 1WHCA 3H4MA 1YKPA 1K3XA 1W5TA 3AOGA 4NSOB 2EA0A 4IBGA 3L25A 2UXBM 2BURB 1QUTA 3AOEA 3GRRA 3PCAM 2DKLA 1L8QA 1I4WA 2OOBA 3WHKA 3UZUA 2UUCM 4GHLA 1IBLM 4S12A 1QQWA 4QOZC 2CHQA 2R46A 1HT2E 2FS1A 2W82A 3ZH9B 4DBGB 2KEBA 2QZ4A 3FE3A 3VK7A 4OX9M 1G71A 5ITYA 3FTDA 2XFTA 4IBFA 1V33A 1TTEA 2KNVA 2LXEA 3BXWA 2DWZB 3T6PA 1EIJA 1YKNA 4YY3M 2LVOC 3JR5A 2I7NA 4WHSD 1V92A 4Q7JA 2YFQA 1L1TA 2M60A 2JZ0A 4IBJA 5E26A 4KODA 2DAEA 4B7FA 1TR8A 5EXSA 1VEGA 5JI2E 4JI4M 1OIZA 1PGYA 2F5QA 1HNZM 2KRUA 4DUZM 2V6ZM 1EOBB 1A5TA 4WHSB 2BURA 2GNOA 1QZMA 3MI1A 3GO8A 5JI3E 1GLNA 3AFHA 4DV1M 3U5ZB 1R2YA 2KDLA 1BVSA 1EO2B 1NY5A 1N78A 3LXVM 3M6AA 4QHTA 3QAUA 1DLMA 1E32A 4RNAA 1PJSA 4I8OA 1UM8A 2JY8A 3L27A 4LZZA 1V34A 4OVZA 3U6LA 3KS8A 2KA6B 1R5LA 3KW6A 4LY6A 4DV7M 3PCDA 3FRHA 3FRIA 3KOWE 3K2LA 1XNQM 1YKLB 2BJWA 2KXEA 2OOAA 2QNJA 2ERCA 3NWLA 5BR8M 4NXMM 1NJFA 1QUSA 3MJ5A 3PVSA 4PT5A 1L2CA 3BBZA 3PCFM 5KQ8A 3J7BA 1D0LA 3J27B 4FWDA 3U6EA 2JA2A 3U6QA 1WXQA 3A46A 3HU2A 1ZQ9A 3C9PA 2XF3A 3J81S 1TGUA 1JQJC 1GL7A 2JY6B 2VIIA 3E46A 3KP1E 3GQ3A 3K92A 2C5RA 3PCIA 1WR1B 1TH3A 4REZA 1R4GA 3ILKA 2BUQB 1AIPC 3LVVA 1DGHB 5ITTA 1EOBA 2AZQA 4ANRA 4WHSA 4JI0M 4IBDA 2YQZA 3UJNA 1VEKA 4ITQA 1KSFX 2DZLA 3U5ZA 1EO2A 4CGYB 2BUVB 4WHOD 2LWXA 4IBIA 1IBMM 3M0EA 2R0IA 5EP4A 4DR2M 5KO3A 1ZAEA 3D8LA 2UUAM 1R2ZA 1GKIA 2M5ZA 3TWKA 3DFZA 3FKEA 4ZPXA 4AG5A 4G4QA 2CHVA 2CP8A 4I81A 4NL4H 3E4RA 1SXJE 1IY0A 3A45A 4LJ8A 1YKLA 2XSVA 3PCBM 3GP1A 3GRUA 2E5LM 2F5PA 3KOYE 3QYEA 4WHRA 3R9XB 2R4EA 2EUCA 4UN2B 3PCJA 3TE6A 3RFWA 4F2LA 3MI5M 2DHYA 3PCNA 1CUKA 1OJLA 2QCUA 2HKJA 3KP0E 3O6JA 1WJ7A 3PCEA 1N75A 2XSRA 2F4VM 2DAGA 1D2NA 2X49A 1DV0A 4L16A 1XMQM 1S9AA 2BUQA 2HL7A 2CEAA 1NHWC 2BUXB 4FCWA 1QVRA 1DGHA 2HCBA 1D0MA 4MH0E 4B08A 3FUTA 4L8RC 4GH9A 5EP3A 2BV0B 3RE8A 4QHSA 3UK6A 3W0FA 3E21A 4LG2A 2F5OA 2BUVA 3B89A 4LGMA 4LGYA 7CATA 5TD3A 3C58A 5ITUA 4LF9M 2Y21A 3C3DA 4LF5M 4AKHA 1VG5A 4RF1A 2X4AA 4GKJM 4LJ4A 2LVPC 2ZTDA 2QENA 4AW4A 2R4JA 2ZANA 1K3WA 2J7OA 3FTEA 5LMUM 2FE8A 1FJGM 1IXZA 2RRUA 5KPRA 2XFSA 3T1HM 2QBYB 2JXNA 4YHHM 2BUMB 3PCLA 5LMNM 3LW5F 3VDPA 1OFIA 3NBIA 1S3SA 2XSUA 3HWSA 3L2AA 3DOAA 4GIPA 2XZUA 2HHHM 4R71A 2DWNA 4PDIA 2PCDM 1Z5CA 3B7NA 3I51A 4LFCM 5F3WA 1YKKB 4HL4A 2O5RA 4NC6A 3AJIB 3LQRA 3U6PA 3PCKA 1ZMWA 4ILVA 2C96A 1IQPA 2LNHC 1TDHA 3FYDA 3PFIA 4L15A 4L78A 4PDGA 4FCTA 2BOYA 2QQ8A 1L2BA 1PJTA 4MGYE 1D0KA 3AKZA 5IREB 3PCKM 1L2DA 3PXGA 3SC3A 4LRTA 2APLA 3R8FA 1IXRC 3LKTA 1ZMUA 4DR4M 3ZQJA 3HU1A 3GLIB 2QBYA 4PD2A 1EO9B 2KRKA 3GLHB 4OVZB 2CV1A 1IY1A 2YNMD 3N9TA 1JR3E 1TH2A 1QDRA 1X37A 2L4FA 2CHGA 3C3EA 4M0DA 4LZJA 4AZFA 3KDSE 1TMXA 2G3QA 3MFLM 1Q3BA 1PJQA 1LV7A 3HZJA 5C18A 4HLQA 2VQFM 4OW0A 4BLCA 2L7IA 3LKTM 1G41A 2UXCM 3O32A 2Y0TA 2DVWB 1IN8A 2RGHA 1YKKA 2EJSA 3VDUA 3GLIE 5DYIA 2Y0QA 1E9RA 2QHOB 3LXVA 3GLHE 4D80A 5EP2A 5DYGA 1NVMA 3GLGB 2X8AA 4B3RM 2Q2EB
chains in the Genus database with same CATH topology
3T67A 3KSJA 3LVWA 1ORYB 2BUTB 2CE7A 5FTMA 3U6CA 1Z5BA 2V1CA 1H6UA 2Y20A 1XHBA 2Z4RA 4IBCA 2XZFA 3PCFA 3A42A 1EO9A 1IBKM 3GLIA 3PCGM 5H37D 5IZ7D 3KVWA 4M0WA 3SFZA 3GLHA 3PNVA 4D82A 3T67M 3EIEA 3LMMA 5E6JA 3CF2A 4EIWA 3O5UA 2J7NA 2R65A 1EOAB 4WHRB 1QANA 4QNRA 1Z6TA 1SXJD 3U61B 2CFOA 2QP9X 1NHGC 2UXDM 4X62M 1NY6A 3LQQA 3HJQA 2BUWB 1N77A 3SAVA 4II7A 4FWHA 3UMMA 4G6ZA 1N32M 3MV4M 2CUZA 4JI3M 2V1UA 4M9ZA 1R7RA 4FCVA 4LJ7A 3GLGA 1I94M 1SXJB 3HKPA 4BB9A 5DNYA 2L09A 3U60A 3TQSA 4LCBA 1DGBA 3PCBA 3FUWA 2BUTA 4GC9A 5BPVA 2D7EA 4DR6M 3OTOM 5IWAM 3U6SA 2XLJA 4G4RA 4LJAA 3MI5A 2R18A 4G4OA 4NSRA 3IG8A 4R3DA 4M9SA 4IBBA 3ZCBB 1EOAA 3HU3A 1TH4A 2ZAOA 3U61A 1NNJA 1OFHA 4X65M 4WHPB 1IM2A 1C1KA 3O6RA 1J09A 2BUWA 2KW0A 1YE9A 3RGPA 1N34M 3TL4X 8CATA 3AOEC 1YKOB 4Z6YA 5ITQA 1SXJA 3FD9A 4IBEA 4X66M 3GQ4A 2ZM6M 4DV6M 4G4NA 3WHLA 1G8PA 3J7AS 3SMPA 2H1RA 3SYKA 3HHWA 4LF8M 1N33M 3J2PB 3FUUA 4DV3M 4JI7M 4KO8A 4B3SM 3MHVC 4LJ5A 3T15A 4I4LA 5EP1A 4BBAA 3GRVA 2XH9A 1G59A 5ITXE 5FTJA 4OU7A 4P16A 4AKIA 1DLTA 4NXNM 3GPPA 4LJ6A 5KQDA 3T1YM 4DR7M 4PCZA 2PCDA 1HNXM 4M9XA 3PCMM 2DXIA 2Z3XA 4WHPA 3T63M 3HJ8A 3FTFA 4DV4M 2YR0A 4GKKM 1NSFA 3W0LB 5ITXA 1YKOA 1MX0A 3KXEC 3L26A 3CF0A 1IN7A 4WHQA 4I5SA 3QWLA 3VKHA 2K47A 5FTNA 3GPXA 4XBOA 4JYAM 1Z5AA 2C98A 4JN6A 4RF0A 1GVNA 3MV6M 2FFJA 2XGNA 3SMSA 3GQ5A 4DR5M 1PM5A 4K0KM 4AKGA 3MFLA 4D81A 4FVMA 3U6MA 4FD2A 1T3TA 1YKMB 4TUWA 3KS4A 3AV0A 2L6OA 2LH0A 4B7GA 1R6BX 4CHTB 4NOOB 3BOSA 5EXPA 4A3VB 2OPFA 2CV2A 2ZBKB 4DV2M 3GRYA 3GPUA 4JI1M 2EO2A 1DO0A 3LMXM 1FNNA 4NRVA 1HQYE 4MGZE 3TPZA 2A5YB 1NJGA 1E94E 1W5SA 4WURA 1IN5A 2BUYB 3PCHM 4LFBM 5ITRA 3PCGA 2C9OA 4MGIE 1JR3A 5EJCA 3J80S 2D7HA 3SHGB 3IG5A 3U60B 4L4UA 2RKOA 3CF6E 4QNMA 4DR3M 1YKMA 1DGFA 1J5EM 3TH1A 3PNYA 2KZUA 4WHRF 4IBKA 3K1JA 4KHPM 1YUBA 3SAUA 3DZDA 1QAQA 4GMQA 4DUYM 3MV4A 2L7HA 4GHAA 2I7PA 1SXJC 5KPZA 3GPYA 3THGA 5KPTA 4LFAM 1J7KA 2P5TA 3HJSA 1DLQA 1QYRA 3UGJA 4LJ9A 2C99A 3ZC7B 4DR1M 3GLFB 4AQYM 2BUUB 4W5WA 5FTKA 4AI6A 2G5GX 4GRIA 2BUYA 1IXSB 5FTLA 1KFVA 3M7GA 3I4VA 2BNKA 1QAMA 4ILTA 1IY2A 3MI1M 3L29A 3VFDA 3FUVA 3EIHA 4JV5M 3I4YA 2XSZD 1PJIA 3JR4A 4WHPD 1IN4A 3SAWA 2F5NA 2UUBM 2DZNB 3PCDM 1QAOA 3JAMS 1PJJA 1K82A 3PCCM 3K8ZA 2BUZB 4FW9A 3KFUG 1HR0M 5EXTA 3FUXA 1KYIA 3GLFA 4JXJA 2BUUA 4LF6M 3T38A 1EOCB 3SBJA 4IJFA 2UU9M 5A2QS 3PCIM 3E9SA 1MU5A 4X64M 4B3MM 4WHQB 1TDZA 4QOSA 2XEPA 4DV0M 3VKGA 3A98B 1HT1E 1Z59A 4XGIA 2FNAA 5FLXS 4JI8M 4WHOB 1XXHB 4MB7A 3KOZE 5C1BA 1DO2A 3L28A 4LF4M 1HQCA 5EXXA 3PCMA 2R45A 2NQ8C 4B7HA 2ZAMA 1XMOM 1G3IA 3T63A 4LRSA 1L1ZA 4DV5M 4GC5A 1IN6A 3U6DA 2C9CA 3DA1A 1VDDA 1Q3CA 2OQ4A 3VLFB 2BV0B 4WW0A 2DWLA 2XSZA 2DWMA 1HNWM 2BUZA 1XNRM 2CV0A 3HHYA 2QPAA 4JI5M 3PCJM 4MGHA 3PCNM 2G8LA 1EOCA 3PCEM 1JR3D 3FTCA 3HHXA 4MGKE 3KOXE 3MV6A 1YKPB 5EQTA 1E9SA 2FOIC 1YSYA 2KZSA 1EE8A 2R62A 4AG6A 2DHRA 3HHZA 3SATA 3FYCA 3HGIA 5FSWA 3SYLA 3KSXA 4JI2M 4B3TM 2RGOA 4MM3B 3VK8A 3MK6A 4LF7M 4CISA 4NRWA 4WHOA 1XXHA 4GITA 2F5SA 3AL0C 4R7GA 3U6OA 3RGSA 3D8BA 5IT9S 3SARA 3SASA 1DMHA 3CTWB 4JI6M 3TWLA 1GL6A 3LMXA 2BJVA 1Q39A 4FWGA 2Z4SA 1DGGA 2AHMA 2D7GA 3B9PA 1YKNB 5GKNA 4IIWA 3SHFA 2BV0A 1G4AE 2Z7JA 2BUXA 4Z8XA 3PCAA 1N36M 2DZOB 3PCHA 1XWIA 3PCLM 3TWMA 1NNUC 3Q8XA 4IJEA 2VQEM 4KLNA 3H4MA 1YKPA 1K3XA 1W5TA 3AOGA 4NSOB 2EA0A 4IBGA 3L25A 2UXBM 2BURB 3AOEA 3GRRA 3PCAM 1L8QA 1I4WA 3WHKA 3UZUA 2UUCM 4GHLA 1IBLM 4S12A 1QQWA 4QOZC 2CHQA 2R46A 1HT2E 2W82A 3ZH9B 2KEBA 2QZ4A 3VK7A 4OX9M 5ITYA 3FTDA 2XFTA 4IBFA 2LXEA 1YKNA 2DWZB 4YY3M 3JR5A 2I7NA 4WHSD 2YFQA 1L1TA 2M60A 5E26A 4IBJA 4KODA 4B7FA 5EXSA 5JI2E 4JI4M 2F5QA 1HNZM 2KRUA 4DUZM 2V6ZM 1EOBB 4WHSB 2BURA 1QZMA 3MI1A 3GO8A 5JI3E 1GLNA 3AFHA 4DV1M 3U5ZB 1EO2B 3LXVM 1NY5A 1N78A 3M6AA 4QHTA 3QAUA 1DLMA 1E32A 4RNAA 4I8OA 1UM8A 3L27A 4LZZA 3U6LA 4OVZA 3KS8A 2KA6B 3KW6A 4LY6A 4DV7M 3PCDA 3KOWE 3K2LA 1XNQM 1YKLB 2BJWA 2KXEA 3NWLA 5BR8M 2ERCA 4NXMM 3PCCA 1NJFA 3MJ5A 3PVSA 4PT5A 3PCFM 1L2CA 5KQ8A 3J7BA 3J27B 4FWDA 3U6EA 2JA2A 3U6QA 1WXQA 3A46A 3HU2A 1ZQ9A 2XF3A 3J81S 1TGUA 1JQJC 1GL7A 3GQ3A 2VIIA 3KP1E 3K92A 2C5RA 3PCIA 1TH3A 4REZA 2BUQB 3ILKA 3LVVA 1DGHB 5ITTA 1EOBA 2AZQA 4WHSA 4JI0M 4IBDA 2YQZA 3UJNA 2BUVB 4ITQA 1KSFX 3U5ZA 1EO2A 4CGYB 4WHOD 2LWXA 4IBIA 1IBMM 3M0EA 5EP4A 4DR2M 5KO3A 1ZAEA 3D8LA 2UUAM 1R2ZA 1GKIA 2M5ZA 3TWKA 3DFZA 3FKEA 4ZPXA 4AG5A 4G4QA 2CHVA 4I81A 4NL4H 3E4RA 1SXJE 1IY0A 3A45A 4LJ8A 1YKLA 2XSVA 3PCBM 3GP1A 3GRUA 2E5LM 2F5PA 3KOYE 4WHRA 3R9XB 2R4EA 2EUCA 3PCJA 3TE6A 3RFWA 3MI5M 3PCNA 1OJLA 2QCUA 2HKJA 3KP0E 3O6JA 3PCEA 1N75A 2XSRA 2F4VM 1D2NA 2X49A 4L16A 1XMQM 1S9AA 2BUQA 2HL7A 2CEAA 1NHWC 2BUXB 4FCWA 1QVRA 1DGHA 2HCBA 4MH0E 4B08A 3FUTA 4L8RC 4GH9A 5EP3A 3RE8A 4QHSA 3UK6A 3W0FA 4LG2A 2BUVA 2F5OA 4LGMA 4LGYA 7CATA 5TD3A 3C58A 5ITUA 4LF9M 2Y21A 4LF5M 4AKHA 4RF1A 2X4AA 4GKJM 4LJ4A 2QENA 4AW4A 2R4JA 2ZANA 1K3WA 2J7OA 3FTEA 5LMUM 2FE8A 1FJGM 1IXZA 2QBYB 5KPRA 2XFSA 3T1HM 4YHHM 2BUMB 3PCLA 5LMNM 3VDPA 1OFIA 3NBIA 1S3SA 2XSUA 3HWSA 3L2AA 3DOAA 4GIPA 2XZUA 2HHHM 2DWNA 4PDIA 2PCDM 1Z5CA 3I51A 4LFCM 5F3WA 1YKKB 4HL4A 2O5RA 3U6PA 3AJIB 3LQRA 3PCKA 4ILVA 2C96A 1IQPA 2LNHC 1TDHA 3FYDA 3PFIA 4L15A 4L78A 4PDGA 4FCTA 2BOYA 1L2BA 4MGYE 3AKZA 5IREB 3PCKM 1L2DA 3PXGA 3SC3A 4LRTA 3R8FA 1IXRC 3LKTA 4DR4M 1EO9B 3HU1A 3GLIB 2QBYA 4PD2A 2KRKA 3GLHB 4OVZB 2CV1A 1IY1A 2YNMD 3N9TA 1TH2A 1X37A 4M0DA 4LZJA 2CHGA 4AZFA 2BUMA 3MFLM 3KDSE 1TMXA 1Q3BA 2VQFM 1LV7A 1XC8A 5C18A 4HLQA 1R2YA 4OW0A 4BLCA 2L7IA 3LKTM 1G41A 2UXCM 3O32A 2Y0TA 2DVWB 1IN8A 2RGHA 1YKKA 3VDUA 5DYIA 2Y0QA 1E9RA 3LXVA 4D80A 5EP2A 5DYGA 1NVMA 3GLGB 2X8AA 4B3RM 2Q2EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T67 A;  2BUQ B;  1YKM B;  2BV0 B;  1EOB A;  2AZQ A;  2BUT B;  4WHS A;  2BUZ A;  3HHY A;  2BUV B;  1EO2 A;  3PCF A;  3PCJ M;  3PCG M;  3PCN M;  1EO9 A;  4WHO D;  1EOC A;  3T67 M;  3PCE M;  3HHX A;  3LMX M;  3MV6 A;  1YKP B;  3O5U A;  1EOA B;  4WHR B;  2XSV A;  3PCB M;  3HGI A;  1YKL A;  4WHR A;  3PCH M;  2BUY B;  4WHO A;  3PCJ A;  3PCG A;  3HJQ A;  2BUW B;  3MI5 M;  3PCN A;  3MV4 M;  3O6J A;  1DMH A;  3PCE A;  2XSR A;  3LMX A;  3HKP A;  1S9A A;  1YKN B;  2BUQ A;  2BUX B;  1YKM A;  3TH1 A;  2BV0 A;  3PCB A;  2BUT A;  2BUX A;  4WHR F;  3PCA A;  2BUV A;  3PCH A;  3PCL M;  3MI5 A;  5TD3 A;  3MV4 A;  1YKP A;  2BUR B;  1EOA A;  3PCA M;  3HJS A;  1DLQ A;  2BUU B;  4WHP B;  2BUY A;  3O6R A;  2BUW A;  2BUM B;  3PCL A;  3I4V A;  2XSU A;  1YKO B;  4ILT A;  3MI1 M;  2PCD M;  1YKN A;  3I51 A;  3I4Y A;  1YKK B;  3PCK A;  4WHS D;  4ILV A;  4WHP D;  2BOY A;  3PCD M;  1DLT A;  3PCC M;  1EOB B;  3PCK M;  4WHS B;  2BUR A;  2BUZ B;  3MI1 A;  2PCD A;  3LKT A;  1EO2 B;  3LXV M;  1EO9 B;  3PCM M;  2BUU A;  1EOC B;  4WHP A;  1DLM A;  3N9T A;  3T63 M;  2BUM A;  3PCI M;  3HJ8 A;  3MFL M;  1TMX A;  4WHQ B;  3PCD A;  1YKO A;  3LKT M;  1YKL B;  3PCC A;  4WHQ A;  3O32 A;  3PCF M;  1YKK A;  4WHO B;  3LXV A;  3PCM A;  3MV6 M;  3T63 A;  3PCI A;  3MFL A; 
#chains in the Genus database with same CATH topology
 3T67 A;  3KSJ A;  3LVW A;  1ORY B;  2MR9 A;  1SG9 A;  2MRO B;  2BUT B;  2CE7 A;  2LHG A;  5FTM A;  3U6C A;  1Z5B A;  2V1C A;  1H6U A;  2Y20 A;  1XHB A;  2Z4R A;  4IBC A;  2XZF A;  3PCF A;  3A42 A;  1EO9 A;  1IBK M;  3GLI A;  3PCG M;  5H37 D;  1QZE A;  2LVA A;  1GJT A;  3KVW A;  4M0W A;  3GLH A;  3PNV A;  5IZ7 D;  3SFZ A;  2DAM A;  3EIE A;  3LMM A;  4CJ6 A;  4D82 A;  1OAI A;  3GLG E;  5E6J A;  3CF2 A;  4EIW A;  3O5U A;  2J7N A;  2R65 A;  1EOA B;  4WHR B;  1QAN A;  4QNR A;  1Z6T A;  1SXJ D;  3U61 B;  4RKU F;  1WIV A;  3NBX X;  2CFO A;  2QP9 X;  1NHG C;  2UXD M;  4X62 M;  1NY6 A;  3LQQ A;  3HJQ A;  2BUW B;  1N77 A;  3SAV A;  2ZTC A;  4II7 A;  4FWH A;  3UMM A;  4G6Z A;  1N32 M;  3MV4 M;  2CUZ A;  4JI3 M;  4XK8 F;  2JY5 A;  1VDL A;  2V1U A;  4HEO A;  4M9Z A;  1R7R A;  2L2D A;  2WSF F;  4FCV A;  4LJ7 A;  2MGW A;  3HX3 A;  3GLG A;  1I94 M;  1SXJ B;  2K0B X;  2O25 A;  3HKP A;  4BB9 A;  5DNY A;  2L09 A;  3U60 A;  2FH0 A;  3TQS A;  1Y8G A;  4LCB A;  1DGB A;  3PCB A;  3FUW A;  2BUT A;  2LBC A;  4GC9 A;  5BPV A;  1GO5 A;  2D7E A;  4DR6 M;  2HWJ A;  2J5Y A;  5IWA M;  3OTO M;  3GLF E;  2XLJ A;  3U6S A;  4G4R A;  4LJA A;  3MI5 A;  2R18 A;  4G4O A;  3CGW A;  4NSR A;  3IG8 A;  4R3D A;  4M9S A;  2DI0 A;  3QYB A;  4IBB A;  3ZCB B;  1WGN A;  2JUJ A;  1TH4 A;  3HU3 A;  1EOA A;  2ZAO A;  3U61 A;  1NNJ A;  1OFH A;  4X65 M;  4WHP B;  1IM2 A;  2MJ5 B;  2R44 A;  1C1K A;  3K9O A;  1J09 A;  2BUW A;  3O6R A;  2KW0 A;  1YE9 A;  3RGP A;  1OKS A;  1N34 M;  3TL4 X;  1NV8 A;  1TF0 B;  8CAT A;  3AOE C;  1YKO B;  2EKK A;  4Z6Y A;  5ITQ A;  1SXJ A;  2L4E A;  3FD9 A;  4IBE A;  4X66 M;  3GQ4 A;  2ZM6 M;  4DV6 M;  4G4N A;  3WHL A;  1G8P A;  3J7A S;  3SMP A;  2H1R A;  2LTU A;  3HHW A;  3SYK A;  1RU3 A;  4LF8 M;  1N33 M;  3J2P B;  3B7Z A;  1ZMV A;  3FUU A;  4KO8 A;  4DV3 M;  4B3S M;  2JZ1 A;  4JI7 M;  2HAK A;  3MHV C;  4LJ5 A;  3T15 A;  4I4L A;  5EP1 A;  2BWE A;  4BBA A;  1OTR A;  3GRV A;  1QDT A;  2XH9 A;  1G59 A;  5ITX E;  5FTJ A;  4OU7 A;  4P16 A;  2WSE F;  4AKI A;  4Y28 F;  1DLT A;  4NXN M;  1T6O A;  3IEC A;  4LJ6 A;  5KQD A;  3GPP A;  3T1Y M;  2DNA A;  2BWB A;  3Q8G A;  2K9D A;  2QSF X;  4DR7 M;  4PCZ A;  2PCD A;  1HNX M;  1IFY A;  4M9X A;  3PCM M;  1XXH E;  2DXI A;  2Z3X A;  4WHP A;  2VF7 A;  3LCV B;  3T63 M;  1ZV1 A;  3HJ8 A;  3FTF A;  4DV4 M;  2YR0 A;  4GKK M;  1NSF A;  3W0L B;  1NO1 A;  5ITX A;  1YKO A;  1MX0 A;  3KXE C;  3L26 A;  3CF0 A;  1LTM A;  1IN7 A;  4WHQ A;  4I5S A;  3QWL A;  3VKH A;  2K47 A;  5FTN A;  1VEJ A;  4XBO A;  3GPX A;  4JYA M;  1Z5A A;  1EFU B;  2KNZ A;  2C98 A;  4JN6 A;  4RF0 A;  1GVN A;  1PRB A;  1HJP A;  3MV6 M;  2FFJ A;  2XGN A;  1T43 A;  2O01 F;  3SMS A;  3GQ5 A;  4DR5 M;  1PM5 A;  5L8R F;  4K0K M;  4AKG A;  3MFL A;  4D81 A;  4FVM A;  3U6M A;  4FD2 A;  2KHH A;  1T3T A;  1YKM B;  4TUW A;  3KS4 A;  2VF8 A;  3AV0 A;  2L6O A;  2LH0 A;  4B7G A;  1R6B X;  4CHT B;  4NOO B;  3BOS A;  5EXP A;  2MH8 A;  4A3V B;  2OPF A;  2ZBK B;  4DV2 M;  2CV2 A;  3IHP A;  3GRY A;  3GPU A;  4JI1 M;  1MN3 A;  2EO2 A;  1DO0 A;  3LMX M;  1FNN A;  3H4J A;  4NRV A;  1HQY E;  4MGZ E;  3TPZ A;  2A5Y B;  1NJG A;  1E94 E;  1AUA A;  2K6B A;  1W5S A;  2DAK A;  4WUR A;  1IN5 A;  2BUY B;  3PCH M;  3MMP A;  4LFB M;  5ITR A;  3PCG A;  2C9O A;  4MGI E;  1JR3 A;  2Z8Y M;  5EJC A;  3J80 S;  2D7H A;  3SHG B;  3IG5 A;  3U60 B;  4L4U A;  3T67 M;  2RKO A;  2GQF A;  3CF6 E;  4QNM A;  2JP7 A;  4DR3 M;  1WGL A;  1YKM A;  1DGF A;  1J5E M;  3TH1 A;  3PNY A;  2KZU A;  4WHR F;  4IBK A;  3K1J A;  4KT0 F;  4KHP M;  1YUB A;  2JY7 A;  3SAU A;  3DZD A;  1QAQ A;  2KNA A;  4GMQ A;  4DUY M;  3PCC A;  3MV4 A;  2L7H A;  4GHA A;  2I7P A;  1SXJ C;  5KPZ A;  3GPY A;  3THG A;  5KPT A;  4LFA M;  1J7K A;  2P5T A;  3HJS A;  1DLQ A;  1P3Q Q;  1QYR A;  3UGJ A;  4LJ9 A;  2C99 A;  3ZC7 B;  4DR1 M;  3GLF B;  4AQY M;  2BUU B;  4W5W A;  3I01 M;  5FTK A;  4AI6 A;  1OQY A;  1XB2 B;  2DEN A;  2G5G X;  4GRI A;  2BUY A;  1IXS B;  4WP2 A;  1XC8 A;  5FTL A;  1KFV A;  3M7G A;  3I4V A;  2BNK A;  1QAM A;  4ILT A;  1IY2 A;  3MI1 M;  3L29 A;  2WZJ A;  3VFD A;  3FUV A;  4F1I A;  3EIH A;  4JV5 M;  2JNH A;  3I4Y A;  1VQ1 A;  2XSZ D;  4G3O A;  1PJI A;  3JR4 A;  3W67 A;  2LVN C;  4WHP D;  1IN4 A;  3SAW A;  2F5N A;  1OAO C;  2UUB M;  2DZN B;  2LVQ D;  3PCD M;  1QAO A;  3JAM S;  1PJJ A;  1K82 A;  3PCC M;  3K8Z A;  2BUZ B;  4FW9 A;  1GAB A;  3W68 A;  3KFU G;  5DFL A;  1HR0 M;  1OIP A;  4P17 A;  5EXT A;  3B7Q A;  3FUX A;  1KYI A;  3GLF A;  4JXJ A;  2BUU A;  4LF6 M;  3T38 A;  1EOC B;  3SBJ A;  4IJF A;  1IXS A;  5A2Q S;  2UU9 M;  3PCI M;  3E9S A;  1MU5 A;  4X64 M;  4B3M M;  4CIZ A;  2JWS A;  1TDZ A;  4WHQ B;  1NV9 A;  4QOS A;  2XEP A;  4DV0 M;  3VKG A;  3A98 B;  3LCU A;  1HT1 E;  4GEW A;  1Z59 A;  4XGI A;  2FNA A;  5FLX S;  4JI8 M;  4WHO B;  1XXH B;  4MB7 A;  1F4I A;  3KOZ E;  5C1B A;  1DO2 A;  2H5X A;  3L28 A;  4LF4 M;  1HQC A;  5EXX A;  3PCM A;  2R45 A;  2NQ8 C;  4B7H A;  2ZAM A;  1XMO M;  1G3I A;  1UFZ A;  3T63 A;  4LRS A;  1L1Z A;  4DV5 M;  4GC5 A;  1IN6 A;  3U6D A;  2C9C A;  3DA1 A;  1VDD A;  1Q3C A;  2OQ4 A;  1GJS A;  2BUM A;  2VDB B;  3F92 A;  4WW0 A;  3VLF B;  2XSZ A;  3I04 M;  2DWM A;  4L6V 6;  2DWL A;  1HNW M;  2CV0 A;  1XNR M;  2BUZ A;  2LHC A;  3HHY A;  2QPA A;  4JI5 M;  3PCJ M;  4MGH A;  3PCN M;  1MJG M;  2G8L A;  1EOC A;  3PCE M;  1JR3 D;  3FTC A;  3HHX A;  4MGK E;  3KOX E;  3MV6 A;  1YKP B;  5EQT A;  1E9S A;  2FOI C;  2R6F A;  1YSY A;  2KZS A;  1EE8 A;  2R62 A;  4AG6 A;  2DHR A;  3V76 A;  3HHZ A;  1C7Y A;  3SAT A;  3FYC A;  3HGI A;  5FSW A;  3SYL A;  3KSX A;  4JI2 M;  2CRU A;  2B3T A;  2RGO A;  4MM3 B;  1JB0 F;  2EKF A;  4B3T M;  3VK8 A;  3MK6 A;  4LF7 M;  4CIS A;  4NRW A;  4WHO A;  1XXH A;  2WSC F;  4GIT A;  2F5S A;  3AL0 C;  4R7G A;  3U6O A;  2OO9 A;  3D8B A;  3RGS A;  5IT9 S;  1YLA A;  3SAR A;  3SAS A;  1Q02 A;  1DMH A;  3CTW B;  4JI6 M;  3TWL A;  3K9P A;  1GL6 A;  3LMX A;  2BJV A;  2DAI A;  1Q39 A;  4FWG A;  2CWB A;  1DGG A;  2AHM A;  2D7G A;  2Z4S A;  3B9P A;  1YKN B;  5GKN A;  4IIW A;  3SHF A;  2BV0 A;  1G4A E;  2Z7J A;  3B74 A;  2BUX A;  4Z8X A;  3PCA A;  1N36 M;  2DZO B;  3PCH A;  1XWI A;  3PCL M;  3TWM A;  1NNU C;  3HY5 A;  3Q8X A;  4IJE A;  2VQE M;  2N35 A;  4KLN A;  1WHC A;  3H4M A;  1YKP A;  1K3X A;  1W5T A;  3AOG A;  4NSO B;  2EA0 A;  4IBG A;  3L25 A;  2UXB M;  2BUR B;  1QUT A;  3AOE A;  3GRR A;  3PCA M;  2DKL A;  1L8Q A;  1I4W A;  2OOB A;  3WHK A;  3UZU A;  2UUC M;  4GHL A;  1IBL M;  4S12 A;  1QQW A;  4QOZ C;  2CHQ A;  2R46 A;  1HT2 E;  2FS1 A;  2W82 A;  3ZH9 B;  4DBG B;  2KEB A;  2QZ4 A;  3FE3 A;  3VK7 A;  4OX9 M;  1G71 A;  5ITY A;  3FTD A;  2XFT A;  4IBF A;  1V33 A;  1TTE A;  2KNV A;  2LXE A;  3BXW A;  2DWZ B;  3T6P A;  1EIJ A;  1YKN A;  4YY3 M;  2LVO C;  3JR5 A;  2I7N A;  4WHS D;  1V92 A;  4Q7J A;  2YFQ A;  1L1T A;  2M60 A;  2JZ0 A;  4IBJ A;  5E26 A;  4KOD A;  2DAE A;  4B7F A;  1TR8 A;  5EXS A;  1VEG A;  5JI2 E;  4JI4 M;  1OIZ A;  1PGY A;  2F5Q A;  1HNZ M;  2KRU A;  4DUZ M;  2V6Z M;  1EOB B;  1A5T A;  4WHS B;  2BUR A;  2GNO A;  1QZM A;  3MI1 A;  3GO8 A;  5JI3 E;  1GLN A;  3AFH A;  4DV1 M;  3U5Z B;  1R2Y A;  2KDL A;  1BVS A;  1EO2 B;  1NY5 A;  1N78 A;  3LXV M;  3M6A A;  4QHT A;  3QAU A;  1DLM A;  1E32 A;  4RNA A;  1PJS A;  4I8O A;  1UM8 A;  2JY8 A;  3L27 A;  4LZZ A;  1V34 A;  4OVZ A;  3U6L A;  3KS8 A;  2KA6 B;  1R5L A;  3KW6 A;  4LY6 A;  4DV7 M;  3PCD A;  3FRH A;  3FRI A;  3KOW E;  3K2L A;  1XNQ M;  1YKL B;  2BJW A;  2KXE A;  2OOA A;  2QNJ A;  2ERC A;  3NWL A;  5BR8 M;  4NXM M;  1NJF A;  1QUS A;  3MJ5 A;  3PVS A;  4PT5 A;  1L2C A;  3BBZ A;  3PCF M;  5KQ8 A;  3J7B A;  1D0L A;  3J27 B;  4FWD A;  3U6E A;  2JA2 A;  3U6Q A;  1WXQ A;  3A46 A;  3HU2 A;  1ZQ9 A;  3C9P A;  2XF3 A;  3J81 S;  1TGU A;  1JQJ C;  1GL7 A;  2JY6 B;  2VII A;  3E46 A;  3KP1 E;  3GQ3 A;  3K92 A;  2C5R A;  3PCI A;  1WR1 B;  1TH3 A;  4REZ A;  1R4G A;  3ILK A;  2BUQ B;  1AIP C;  3LVV A;  1DGH B;  5ITT A;  1EOB A;  2AZQ A;  4ANR A;  4WHS A;  4JI0 M;  4IBD A;  2YQZ A;  3UJN A;  1VEK A;  4ITQ A;  1KSF X;  2DZL A;  3U5Z A;  1EO2 A;  4CGY B;  2BUV B;  4WHO D;  2LWX A;  4IBI A;  1IBM M;  3M0E A;  2R0I A;  5EP4 A;  4DR2 M;  5KO3 A;  1ZAE A;  3D8L A;  2UUA M;  1R2Z A;  1GKI A;  2M5Z A;  3TWK A;  3DFZ A;  3FKE A;  4ZPX A;  4AG5 A;  4G4Q A;  2CHV A;  2CP8 A;  4I81 A;  4NL4 H;  3E4R A;  1SXJ E;  1IY0 A;  3A45 A;  4LJ8 A;  1YKL A;  2XSV A;  3PCB M;  3GP1 A;  3GRU A;  2E5L M;  2F5P A;  3KOY E;  3QYE A;  4WHR A;  3R9X B;  2R4E A;  2EUC A;  4UN2 B;  3PCJ A;  3TE6 A;  3RFW A;  4F2L A;  3MI5 M;  2DHY A;  3PCN A;  1CUK A;  1OJL A;  2QCU A;  2HKJ A;  3KP0 E;  3O6J A;  1WJ7 A;  3PCE A;  1N75 A;  2XSR A;  2F4V M;  2DAG A;  1D2N A;  2X49 A;  1DV0 A;  4L16 A;  1XMQ M;  1S9A A;  2BUQ A;  2HL7 A;  2CEA A;  1NHW C;  2BUX B;  4FCW A;  1QVR A;  1DGH A;  2HCB A;  1D0M A;  4MH0 E;  4B08 A;  3FUT A;  4L8R C;  4GH9 A;  5EP3 A;  2BV0 B;  3RE8 A;  4QHS A;  3UK6 A;  3W0F A;  3E21 A;  4LG2 A;  2F5O A;  2BUV A;  3B89 A;  4LGM A;  4LGY A;  7CAT A;  5TD3 A;  3C58 A;  5ITU A;  4LF9 M;  2Y21 A;  3C3D A;  4LF5 M;  4AKH A;  1VG5 A;  4RF1 A;  2X4A A;  4GKJ M;  4LJ4 A;  2LVP C;  2ZTD A;  2QEN A;  4AW4 A;  2R4J A;  2ZAN A;  1K3W A;  2J7O A;  3FTE A;  5LMU M;  2FE8 A;  1FJG M;  1IXZ A;  2RRU A;  5KPR A;  2XFS A;  3T1H M;  2QBY B;  2JXN A;  4YHH M;  2BUM B;  3PCL A;  5LMN M;  3LW5 F;  3VDP A;  1OFI A;  3NBI A;  1S3S A;  2XSU A;  3HWS A;  3L2A A;  3DOA A;  4GIP A;  2XZU A;  2HHH M;  4R71 A;  2DWN A;  4PDI A;  2PCD M;  1Z5C A;  3B7N A;  3I51 A;  4LFC M;  5F3W A;  1YKK B;  4HL4 A;  2O5R A;  4NC6 A;  3AJI B;  3LQR A;  3U6P A;  3PCK A;  1ZMW A;  4ILV A;  2C96 A;  1IQP A;  2LNH C;  1TDH A;  3FYD A;  3PFI A;  4L15 A;  4L78 A;  4PDG A;  4FCT A;  2BOY A;  2QQ8 A;  1L2B A;  1PJT A;  4MGY E;  1D0K A;  3AKZ A;  5IRE B;  3PCK M;  1L2D A;  3PXG A;  3SC3 A;  4LRT A;  2APL A;  3R8F A;  1IXR C;  3LKT A;  1ZMU A;  4DR4 M;  3ZQJ A;  3HU1 A;  3GLI B;  2QBY A;  4PD2 A;  1EO9 B;  2KRK A;  3GLH B;  4OVZ B;  2CV1 A;  1IY1 A;  2YNM D;  3N9T A;  1JR3 E;  1TH2 A;  1QDR A;  1X37 A;  2L4F A;  2CHG A;  3C3E A;  4M0D A;  4LZJ A;  4AZF A;  3KDS E;  1TMX A;  2G3Q A;  3MFL M;  1Q3B A;  1PJQ A;  1LV7 A;  3HZJ A;  5C18 A;  4HLQ A;  2VQF M;  4OW0 A;  4BLC A;  2L7I A;  3LKT M;  1G41 A;  2UXC M;  3O32 A;  2Y0T A;  2DVW B;  1IN8 A;  2RGH A;  1YKK A;  2EJS A;  3VDU A;  3GLI E;  5DYI A;  2Y0Q A;  1E9R A;  2QHO B;  3LXV A;  3GLH E;  4D80 A;  5EP2 A;  5DYG A;  1NVM A;  3GLG B;  2X8A A;  4B3R M;  2Q2E B; 
#chains in the Genus database with same CATH homology
 3T67 A;  3KSJ A;  3LVW A;  1ORY B;  2BUT B;  2CE7 A;  5FTM A;  3U6C A;  1Z5B A;  2V1C A;  1H6U A;  2Y20 A;  1XHB A;  2Z4R A;  4IBC A;  2XZF A;  3PCF A;  3A42 A;  1EO9 A;  1IBK M;  3GLI A;  3PCG M;  5H37 D;  5IZ7 D;  3KVW A;  4M0W A;  3SFZ A;  3GLH A;  3PNV A;  4D82 A;  3T67 M;  3EIE A;  3LMM A;  5E6J A;  3CF2 A;  4EIW A;  3O5U A;  2J7N A;  2R65 A;  1EOA B;  4WHR B;  1QAN A;  4QNR A;  1Z6T A;  1SXJ D;  3U61 B;  2CFO A;  2QP9 X;  1NHG C;  2UXD M;  4X62 M;  1NY6 A;  3LQQ A;  3HJQ A;  2BUW B;  1N77 A;  3SAV A;  4II7 A;  4FWH A;  3UMM A;  4G6Z A;  1N32 M;  3MV4 M;  2CUZ A;  4JI3 M;  2V1U A;  4M9Z A;  1R7R A;  4FCV A;  4LJ7 A;  3GLG A;  1I94 M;  1SXJ B;  3HKP A;  4BB9 A;  5DNY A;  2L09 A;  3U60 A;  3TQS A;  4LCB A;  1DGB A;  3PCB A;  3FUW A;  2BUT A;  4GC9 A;  5BPV A;  2D7E A;  4DR6 M;  3OTO M;  5IWA M;  3U6S A;  2XLJ A;  4G4R A;  4LJA A;  3MI5 A;  2R18 A;  4G4O A;  4NSR A;  3IG8 A;  4R3D A;  4M9S A;  4IBB A;  3ZCB B;  1EOA A;  3HU3 A;  1TH4 A;  2ZAO A;  3U61 A;  1NNJ A;  1OFH A;  4X65 M;  4WHP B;  1IM2 A;  1C1K A;  3O6R A;  1J09 A;  2BUW A;  2KW0 A;  1YE9 A;  3RGP A;  1N34 M;  3TL4 X;  8CAT A;  3AOE C;  1YKO B;  4Z6Y A;  5ITQ A;  1SXJ A;  3FD9 A;  4IBE A;  4X66 M;  3GQ4 A;  2ZM6 M;  4DV6 M;  4G4N A;  3WHL A;  1G8P A;  3J7A S;  3SMP A;  2H1R A;  3SYK A;  3HHW A;  4LF8 M;  1N33 M;  3J2P B;  3FUU A;  4DV3 M;  4JI7 M;  4KO8 A;  4B3S M;  3MHV C;  4LJ5 A;  3T15 A;  4I4L A;  5EP1 A;  4BBA A;  3GRV A;  2XH9 A;  1G59 A;  5ITX E;  5FTJ A;  4OU7 A;  4P16 A;  4AKI A;  1DLT A;  4NXN M;  3GPP A;  4LJ6 A;  5KQD A;  3T1Y M;  4DR7 M;  4PCZ A;  2PCD A;  1HNX M;  4M9X A;  3PCM M;  2DXI A;  2Z3X A;  4WHP A;  3T63 M;  3HJ8 A;  3FTF A;  4DV4 M;  2YR0 A;  4GKK M;  1NSF A;  3W0L B;  5ITX A;  1YKO A;  1MX0 A;  3KXE C;  3L26 A;  3CF0 A;  1IN7 A;  4WHQ A;  4I5S A;  3QWL A;  3VKH A;  2K47 A;  5FTN A;  3GPX A;  4XBO A;  4JYA M;  1Z5A A;  2C98 A;  4JN6 A;  4RF0 A;  1GVN A;  3MV6 M;  2FFJ A;  2XGN A;  3SMS A;  3GQ5 A;  4DR5 M;  1PM5 A;  4K0K M;  4AKG A;  3MFL A;  4D81 A;  4FVM A;  3U6M A;  4FD2 A;  1T3T A;  1YKM B;  4TUW A;  3KS4 A;  3AV0 A;  2L6O A;  2LH0 A;  4B7G A;  1R6B X;  4CHT B;  4NOO B;  3BOS A;  5EXP A;  4A3V B;  2OPF A;  2CV2 A;  2ZBK B;  4DV2 M;  3GRY A;  3GPU A;  4JI1 M;  2EO2 A;  1DO0 A;  3LMX M;  1FNN A;  4NRV A;  1HQY E;  4MGZ E;  3TPZ A;  2A5Y B;  1NJG A;  1E94 E;  1W5S A;  4WUR A;  1IN5 A;  2BUY B;  3PCH M;  4LFB M;  5ITR A;  3PCG A;  2C9O A;  4MGI E;  1JR3 A;  5EJC A;  3J80 S;  2D7H A;  3SHG B;  3IG5 A;  3U60 B;  4L4U A;  2RKO A;  3CF6 E;  4QNM A;  4DR3 M;  1YKM A;  1DGF A;  1J5E M;  3TH1 A;  3PNY A;  2KZU A;  4WHR F;  4IBK A;  3K1J A;  4KHP M;  1YUB A;  3SAU A;  3DZD A;  1QAQ A;  4GMQ A;  4DUY M;  3MV4 A;  2L7H A;  4GHA A;  2I7P A;  1SXJ C;  5KPZ A;  3GPY A;  3THG A;  5KPT A;  4LFA M;  1J7K A;  2P5T A;  3HJS A;  1DLQ A;  1QYR A;  3UGJ A;  4LJ9 A;  2C99 A;  3ZC7 B;  4DR1 M;  3GLF B;  4AQY M;  2BUU B;  4W5W A;  5FTK A;  4AI6 A;  2G5G X;  4GRI A;  2BUY A;  1IXS B;  5FTL A;  1KFV A;  3M7G A;  3I4V A;  2BNK A;  1QAM A;  4ILT A;  1IY2 A;  3MI1 M;  3L29 A;  3VFD A;  3FUV A;  3EIH A;  4JV5 M;  3I4Y A;  2XSZ D;  1PJI A;  3JR4 A;  4WHP D;  1IN4 A;  3SAW A;  2F5N A;  2UUB M;  2DZN B;  3PCD M;  1QAO A;  3JAM S;  1PJJ A;  1K82 A;  3PCC M;  3K8Z A;  2BUZ B;  4FW9 A;  3KFU G;  1HR0 M;  5EXT A;  3FUX A;  1KYI A;  3GLF A;  4JXJ A;  2BUU A;  4LF6 M;  3T38 A;  1EOC B;  3SBJ A;  4IJF A;  2UU9 M;  5A2Q S;  3PCI M;  3E9S A;  1MU5 A;  4X64 M;  4B3M M;  4WHQ B;  1TDZ A;  4QOS A;  2XEP A;  4DV0 M;  3VKG A;  3A98 B;  1HT1 E;  1Z59 A;  4XGI A;  2FNA A;  5FLX S;  4JI8 M;  4WHO B;  1XXH B;  4MB7 A;  3KOZ E;  5C1B A;  1DO2 A;  3L28 A;  4LF4 M;  1HQC A;  5EXX A;  3PCM A;  2R45 A;  2NQ8 C;  4B7H A;  2ZAM A;  1XMO M;  1G3I A;  3T63 A;  4LRS A;  1L1Z A;  4DV5 M;  4GC5 A;  1IN6 A;  3U6D A;  2C9C A;  3DA1 A;  1VDD A;  1Q3C A;  2OQ4 A;  3VLF B;  2BV0 B;  4WW0 A;  2DWL A;  2XSZ A;  2DWM A;  1HNW M;  2BUZ A;  1XNR M;  2CV0 A;  3HHY A;  2QPA A;  4JI5 M;  3PCJ M;  4MGH A;  3PCN M;  2G8L A;  1EOC A;  3PCE M;  1JR3 D;  3FTC A;  3HHX A;  4MGK E;  3KOX E;  3MV6 A;  1YKP B;  5EQT A;  1E9S A;  2FOI C;  1YSY A;  2KZS A;  1EE8 A;  2R62 A;  4AG6 A;  2DHR A;  3HHZ A;  3SAT A;  3FYC A;  3HGI A;  5FSW A;  3SYL A;  3KSX A;  4JI2 M;  4B3T M;  2RGO A;  4MM3 B;  3VK8 A;  3MK6 A;  4LF7 M;  4CIS A;  4NRW A;  4WHO A;  1XXH A;  4GIT A;  2F5S A;  3AL0 C;  4R7G A;  3U6O A;  3RGS A;  3D8B A;  5IT9 S;  3SAR A;  3SAS A;  1DMH A;  3CTW B;  4JI6 M;  3TWL A;  1GL6 A;  3LMX A;  2BJV A;  1Q39 A;  4FWG A;  2Z4S A;  1DGG A;  2AHM A;  2D7G A;  3B9P A;  1YKN B;  5GKN A;  4IIW A;  3SHF A;  2BV0 A;  1G4A E;  2Z7J A;  2BUX A;  4Z8X A;  3PCA A;  1N36 M;  2DZO B;  3PCH A;  1XWI A;  3PCL M;  3TWM A;  1NNU C;  3Q8X A;  4IJE A;  2VQE M;  4KLN A;  3H4M A;  1YKP A;  1K3X A;  1W5T A;  3AOG A;  4NSO B;  2EA0 A;  4IBG A;  3L25 A;  2UXB M;  2BUR B;  3AOE A;  3GRR A;  3PCA M;  1L8Q A;  1I4W A;  3WHK A;  3UZU A;  2UUC M;  4GHL A;  1IBL M;  4S12 A;  1QQW A;  4QOZ C;  2CHQ A;  2R46 A;  1HT2 E;  2W82 A;  3ZH9 B;  2KEB A;  2QZ4 A;  3VK7 A;  4OX9 M;  5ITY A;  3FTD A;  2XFT A;  4IBF A;  2LXE A;  1YKN A;  2DWZ B;  4YY3 M;  3JR5 A;  2I7N A;  4WHS D;  2YFQ A;  1L1T A;  2M60 A;  5E26 A;  4IBJ A;  4KOD A;  4B7F A;  5EXS A;  5JI2 E;  4JI4 M;  2F5Q A;  1HNZ M;  2KRU A;  4DUZ M;  2V6Z M;  1EOB B;  4WHS B;  2BUR A;  1QZM A;  3MI1 A;  3GO8 A;  5JI3 E;  1GLN A;  3AFH A;  4DV1 M;  3U5Z B;  1EO2 B;  3LXV M;  1NY5 A;  1N78 A;  3M6A A;  4QHT A;  3QAU A;  1DLM A;  1E32 A;  4RNA A;  4I8O A;  1UM8 A;  3L27 A;  4LZZ A;  3U6L A;  4OVZ A;  3KS8 A;  2KA6 B;  3KW6 A;  4LY6 A;  4DV7 M;  3PCD A;  3KOW E;  3K2L A;  1XNQ M;  1YKL B;  2BJW A;  2KXE A;  3NWL A;  5BR8 M;  2ERC A;  4NXM M;  3PCC A;  1NJF A;  3MJ5 A;  3PVS A;  4PT5 A;  3PCF M;  1L2C A;  5KQ8 A;  3J7B A;  3J27 B;  4FWD A;  3U6E A;  2JA2 A;  3U6Q A;  1WXQ A;  3A46 A;  3HU2 A;  1ZQ9 A;  2XF3 A;  3J81 S;  1TGU A;  1JQJ C;  1GL7 A;  3GQ3 A;  2VII A;  3KP1 E;  3K92 A;  2C5R A;  3PCI A;  1TH3 A;  4REZ A;  2BUQ B;  3ILK A;  3LVV A;  1DGH B;  5ITT A;  1EOB A;  2AZQ A;  4WHS A;  4JI0 M;  4IBD A;  2YQZ A;  3UJN A;  2BUV B;  4ITQ A;  1KSF X;  3U5Z A;  1EO2 A;  4CGY B;  4WHO D;  2LWX A;  4IBI A;  1IBM M;  3M0E A;  5EP4 A;  4DR2 M;  5KO3 A;  1ZAE A;  3D8L A;  2UUA M;  1R2Z A;  1GKI A;  2M5Z A;  3TWK A;  3DFZ A;  3FKE A;  4ZPX A;  4AG5 A;  4G4Q A;  2CHV A;  4I81 A;  4NL4 H;  3E4R A;  1SXJ E;  1IY0 A;  3A45 A;  4LJ8 A;  1YKL A;  2XSV A;  3PCB M;  3GP1 A;  3GRU A;  2E5L M;  2F5P A;  3KOY E;  4WHR A;  3R9X B;  2R4E A;  2EUC A;  3PCJ A;  3TE6 A;  3RFW A;  3MI5 M;  3PCN A;  1OJL A;  2QCU A;  2HKJ A;  3KP0 E;  3O6J A;  3PCE A;  1N75 A;  2XSR A;  2F4V M;  1D2N A;  2X49 A;  4L16 A;  1XMQ M;  1S9A A;  2BUQ A;  2HL7 A;  2CEA A;  1NHW C;  2BUX B;  4FCW A;  1QVR A;  1DGH A;  2HCB A;  4MH0 E;  4B08 A;  3FUT A;  4L8R C;  4GH9 A;  5EP3 A;  3RE8 A;  4QHS A;  3UK6 A;  3W0F A;  4LG2 A;  2BUV A;  2F5O A;  4LGM A;  4LGY A;  7CAT A;  5TD3 A;  3C58 A;  5ITU A;  4LF9 M;  2Y21 A;  4LF5 M;  4AKH A;  4RF1 A;  2X4A A;  4GKJ M;  4LJ4 A;  2QEN A;  4AW4 A;  2R4J A;  2ZAN A;  1K3W A;  2J7O A;  3FTE A;  5LMU M;  2FE8 A;  1FJG M;  1IXZ A;  2QBY B;  5KPR A;  2XFS A;  3T1H M;  4YHH M;  2BUM B;  3PCL A;  5LMN M;  3VDP A;  1OFI A;  3NBI A;  1S3S A;  2XSU A;  3HWS A;  3L2A A;  3DOA A;  4GIP A;  2XZU A;  2HHH M;  2DWN A;  4PDI A;  2PCD M;  1Z5C A;  3I51 A;  4LFC M;  5F3W A;  1YKK B;  4HL4 A;  2O5R A;  3U6P A;  3AJI B;  3LQR A;  3PCK A;  4ILV A;  2C96 A;  1IQP A;  2LNH C;  1TDH A;  3FYD A;  3PFI A;  4L15 A;  4L78 A;  4PDG A;  4FCT A;  2BOY A;  1L2B A;  4MGY E;  3AKZ A;  5IRE B;  3PCK M;  1L2D A;  3PXG A;  3SC3 A;  4LRT A;  3R8F A;  1IXR C;  3LKT A;  4DR4 M;  1EO9 B;  3HU1 A;  3GLI B;  2QBY A;  4PD2 A;  2KRK A;  3GLH B;  4OVZ B;  2CV1 A;  1IY1 A;  2YNM D;  3N9T A;  1TH2 A;  1X37 A;  4M0D A;  4LZJ A;  2CHG A;  4AZF A;  2BUM A;  3MFL M;  3KDS E;  1TMX A;  1Q3B A;  2VQF M;  1LV7 A;  1XC8 A;  5C18 A;  4HLQ A;  1R2Y A;  4OW0 A;  4BLC A;  2L7I A;  3LKT M;  1G41 A;  2UXC M;  3O32 A;  2Y0T A;  2DVW B;  1IN8 A;  2RGH A;  1YKK A;  3VDU A;  5DYI A;  2Y0Q A;  1E9R A;  3LXV A;  4D80 A;  5EP2 A;  5DYG A;  1NVM A;  3GLG B;  2X8A A;  4B3R M;  2Q2E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...