3HJQA

Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
total genus 67
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3hjqA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3hjqA02
2BUUB 3T67A 3PCKA 4WHRF 1EO2B 3PCHM 1EOCB 2BUZA 2BUTA 1YKOA 3PCIM 3PCJA 3HJQA 3PCIA 2BUQA 3PCJM 3MI5A 2BUMA 1EO9A 3MI5M 3HJ8A 2BUYB 3PCGM 4WHQB 3MV6M 3PCFM 1YKLA 2BV0B 3PCLM 1DLTA 1YKNB 3PCCA 1EOCA 1YKMA 3MV6A 3PCFA 2BUTB 2BUXB 3I4YA 3T63A 3PCNM 3LKTM 3T63M 2BUYA 3PCDM 3HGIA 3N9TA 3PCNA 4WHQA 3LKTA 4WHOB 3I51A 1YKPA 1YKKB 2BURA 3PCAM 3MI1M 3HHYA 3HHXA 2XSRA 2BUWB 2BUUA 4WHSA 3PCMA 3PCMM 4ILVA 3TH1A 3PCBM 3MV4M 4WHRA 3HJSA 3MFLA 1YKOB 3LXVM 1YKPB 2BURB 3PCHA 5TD3A 2BUQB 1EO9B 3MV4A 1EOAB 3MFLM 2BV0A 4WHSB 3T67M 4WHPB 1EO2A 1DLMA 3PCKM 3HKPA 3LXVA 2BUZB 3PCLA 3O6JA 4WHRB 2XSVA 4WHPD 4WHSD 2BUVB 4ILTA 1YKMB 3PCDA 3PCCM 1YKLB 3PCEA 3PCGA 1TMXA 1YKNA 3PCEM 4WHOA 1S9AA 1EOAA 1EOBA 1YKKA 2XSUA 4WHPA 2BUWA 2PCDA 3PCAA 3I4VA 3O32A 2BUXA 3O5UA 1DMHA 2BUVA 2BOYA 3MI1A 3LMXM 3O6RA 3LMXA 1DLQA 2AZQA 2BUMB 2PCDM 3PCBA 4WHOD 1EOBB
chains in the Genus database with same CATH superfamily
2LHGA 2LWXA 4B3RM 3QAUA 4A3VB 1AUAA 2R45A 1NY5A 4DR6M 3E4RA 1N33M 4WHRF 3GLIA 3SFZA 1EOCB 2DAKA 1ORYB 3AOEC 2XEPA 4B7GA 1TF0B 3PCJA 2FOIC 1MU5A 4DV7M 4ITQA 2BUQA 3MI5A 3NBXX 1CUKA 3KS8A 2C96A 2LVQD 1ZMWA 3MI5M 3LCVB 4LF7M 1R7RA 1XXHB 2HWJA 4XBOA 4LJAA 1YKLA 2BV0B 3FE3A 4OW0A 4DR4M 1JB0F 2Z4SA 1IBKM 2J7OA 2R62A 5FTKA 3UGJA 2BJVA 3U6DA 2O25A 3K1JA 5C1BA 2DAEA 2LVPC 1D2NA 1GLNA 3PCCA 2DI0A 1TH4A 2Z7JA 4MGYE 3J7BA 3R9XB 2K0BX 5ITXA 3AFHA 1YSYA 3KW6A 3AOGA 2BUTB 2BUXB 2X8AA 3KOXE 4YHHM 1HNZM 2CRUA 3VKGA 3I4YA 2F5SA 3ILKA 4LG2A 2X49A 2UXBM 1GJSA 1J5EM 3PCNA 3PCDM 3B9PA 1QANA 3QYBA 4WHQA 3TL4X 2QSFX 2R0IA 4NC6A 2FNAA 3RGPA 3PNVA 5EXXA 1XNQM 3MI1M 2O5RA 2HCBA 2Q2EB 1H6UA 4AKHA 3CGWA 4R3DA 1VEJA 1DO2A 2CEAA 4RKUF 5IREB 4L8RC 4LJ6A 2VF8A 4GMQA 3JR5A 2BUUA 4XGIA 4OU7A 4FVMA 2APLA 4B3SM 4JI7M 3PCMM 4W5WA 3A46A 3PCBM 3SAUA 3MV4M 3B7ZA 4WHRA 4L15A 2FFJA 4LF5M 3JR4A 2A5YB 3MFLA 2FH0A 4IIWA 2OPFA 4OX9M 2LBCA 2ZBKB 3GPYA 3E46A 4IBDA 1OAIA 2XGNA 3KP0E 3PCHA 1VG5A 4DBGB 3GLHE 3UZUA 3U60B 1EO9B 1Z5CA 3MV4A 1GO5A 3MK6A 1EOAB 1E9RA 2M60A 2WSCF 1NV8A 3KOWE 4Z6YA 4WHSB 4WHPB 2KNVA 1HT2E 2DAGA 3CF0A 3OTOM 1QZMA 2FS1A 2XSZD 4PT5A 3O6JA 3CF6E 2XSVA 4WHPD 1W5SA 1WHCA 2CHGA 2L09A 2CV0A 4R7GA 3AJIB 1E9SA 4LZJA 5DNYA 2HHHM 1YKMB 3GRVA 2D7GA 2R18A 4YY3M 3PCDA 2CFOA 4PD2A 4JI8M 3W68A 4MGZE 3GLGA 3DA1A 3MMPA 1YKNA 4P16A 3LMMA 3H4JA 3PCEM 3LVVA 4JI5M 2BNKA 2CUZA 1UFZA 2MR9A 2DAMA 3HZJA 1YKKA 5FSWA 5DYIA 2MROB 3K2LA 4WURA 1HT1E 2R6FA 3I4VA 4FW9A 4AI6A 2YQZA 1C7YA 3QYEA 4I81A 4Z8XA 4LRSA 1YLAA 1NVMA 1IBMM 1G59A 1DMHA 2BOYA 1OAOC 2EUCA 2KA6B 5C18A 1XC8A 3MHVC 2HAKA 4IBFA 2XH9A 4R71A 2UUCM 3GLFA 1R4GA 1TR8A 1WJ7A 3VDPA 2BUMB 4L4UA 3DOAA 2DWNA 4WHOD 3SAWA 3K92A 3FTDA 4L6V6 1YUBA 5JI2E 3U6OA 4GKJM 3D8LA 4NSRA 2JZ0A 3A98B 1W5TA 4GIPA 3U61A 4AKIA 4AQYM 1HNWM 2DVWB 2DKLA 3KXEC 4QOZC 2KRUA 3SC3A 3BXWA 3AL0C 1PM5A 1IXSB 1HNXM 1HQCA 4GEWA 4PCZA 4PDGA 2CHQA 3HJQA 4GH9A 1HQYE 4NXMM 3FYCA 3PCIA 3NWLA 1L2CA 4NSOB 1J09A 1PRBA 4X62M 3TE6A 3HJ8A 3GO8A 5KPTA 1VDDA 1FJGM 3MV6M 3PCFM 3PCLM 1NO1A 2DHRA 1DLTA 4RNAA 4GHAA 4JI3M 4EIWA 1NHGC 1T6OA 4BBAA 3EIHA 2ZAMA 1NJFA 3SASA 4JN6A 2JA2A 1IY2A 4FWGA 4PDIA 1FNNA 1N75A 1G41A 2G3QA 5EP3A 1IY0A 3F92A 4L78A 4LGYA 3ZC7B 3UMMA 1OTRA 2G8LA 1OQYA 4REZA 4X66M 4Y28F 3FD9A 1PJSA 2VIIA 1EIJA 3TPZA 2BUYA 1E94E 3T15A 4JI4M 3N9TA 4QNMA 1JR3D 3HU2A 1V33A 3FYDA 3I51A 4OVZA 1YKPA 2ERCA 1OKSA 4F2LA 2LVNC 2E5LM 2XSRA 2BUWB 2KZSA 3E9SA 1XXHE 1DV0A 4HEOA 3W0LB 1R5LA 1TGUA 4DV1M 1Z5BA 1IN8A 4K0KM 2BJWA 4Q7JA 7CATA 4ZPXA 1K82A 4JI0M 3A42A 3HJSA 1J7KA 3L29A 3UJNA 1LV7A 1TH3A 3LCUA 3SHFA 2F5OA 2XFTA 2QBYB 2P5TA 2RRUA 1IY1A 3IG5A 1OJLA 1GL6A 2QPAA 3FTCA 2QP9X 3ZCBB 2BURB 3LXVM 2BUQB 4CISA 3KS4A 3FKEA 1N32M 3KSJA 4G4RA 2DNAA 2OOAA 2BV0A 1Q39A 3T67M 4G4NA 1EO2A 3GRRA 1GABA 4LJ8A 3VDUA 1KFVA 1NJGA 2BUZB 1DGGA 4DR3M 3KFUG 1VQ1A 4S12A 3SYLA 3SARA 3HWSA 4FCVA 4LF8M 2R4EA 1G4AE 1TDHA 2B3TA 3CF2A 3SBJA 1IN5A 4BB9A 3U6QA 1TMXA 1S3SA 3TQSA 3L27A 1WR1B 1S9AA 3HHZA 3TWMA 2L2DA 1PGYA 2XSUA 1VDLA 2HL7A 1XMOM 4X64M 1IM2A 1SXJA 1KYIA 2AHMA 3C3EA 1L2DA 2Z4RA 4KT0F 3V76A 3GQ5A 3T1HM 1ZMVA 1PJJA 4LF4M 4IJFA 2Y20A 5EQTA 4LY6A 4JV5M 2EJSA 3MI1A 2LXEA 1N77A 1EFUB 2JY5A 2JUJA 3O6RA 1Q3CA 2ZANA 4IJEA 3B7NA 1DLQA 4KHPM 2LH0A 2DWLA 2H5XA 4IBEA 4M9ZA 5ITXE 2PCDM 2UU9M 3C9PA 1QUSA 4KO8A 1OFIA 3PCBA 2UXCM 2KZUA 4D82A 1C1KA 4RF0A 1EOBB 2MJ5B 1T43A 4F1IA 2Z3XA 1HR0M 5F3WA 2Y21A 4GHLA 3T67A 1DGHA 5EJCA 5LMUM 3PCKA 5IT9S 3AV0A 3GPXA 3U5ZB 2DZNB 3GRUA 3HHWA 1IXZA 2ZM6M 4B3TM 2K47A 4BLCA 3J2PB 2YR0A 4MM3B 3U6MA 2QZ4A 1BVSA 2JP7A 1DGFA 5IZ7D 1IXRC 2D7HA 3MJ5A 1N36M 1YKOA 1XWIA 2BUTA 3PCIM 1XHBA 3T1YM 1XB2B 1IQPA 1NNUC 1XMQM 1Q02A 3FRHA 4WHQB 2LNHC 3J7AS 2KHHA 1MJGM 8CATA 2EA0A 2C5RA 5ITRA 2QENA 4CJ6A 2DENA 1YKNB 1LTMA 3SAVA 2QQ8A 3VK8A 1V92A 2CP8A 4LJ7A 4DV0M 2UXDM 3Q8GA 4II7A 4AZFA 2CHVA 4FWDA 3C58A 4DV4M 4LGMA 2V1UA 1EOCA 4G4QA 2WZJA 2XFSA 3HX3A 5FTNA 2Y0QA 2JY8A 1ZV1A 2J7NA 1QAQA 3FUVA 3W0FA 4DV5M 2BWBA 2KNZA 2KRKA 2DZOB 2LHCA 4KODA 3TWLA 3GLHB 3M7GA 4LCBA 1QUTA 4KLNA 4IBBA 4G4OA 2FE8A 3W67A 1PJIA 4WHOB 4FWHA 4I8OA 1HJPA 1XXHA 2L7IA 5GKNA 2F5QA 3LKTA 3PCAM 4IBCA 4DV6M 2DXIA 1QVRA 3GLFB 1L1ZA 3HHYA 1MN3A 2WSFF 4WW0A 4CHTB 3GQ4A 1D0LA 2XF3A 1IFYA 4MGKE 4JI2M 4D80A 4AKGA 1PJTA 3T63M 4B08A 2C9OA 3FUTA 3U6CA 1Z6TA 3H4MA 1JQJC 4WHSA 3CTWB 3LQQA 1TDZA 3PCMA 4M0WA 2EKFA 4ILVA 2XSZA 4GC9A 4IBJA 1QQWA 2DWZB 3DFZA 5E26A 3AKZA 4GRIA 1SXJE 4FD2A 3J80S 1IXSA 3C3DA 1SXJC 4G6ZA 1Y8GA 2XLJA 2K6BA 3LW5F 1Z5AA 3B74A 3U6SA 2ZAOA 4DR2M 3D8BA 4XK8F 4CIZA 1Q3BA 2R65A 2F5PA 4D81A 2KEBA 4I4LA 2ZTCA 2JWSA 4X65M 3U6LA 1N34M 3EIEA 5BR8M 3GLIB 3SMPA 5JI3E 3SMSA 2R4JA 3Q8XA 3I01M 5FLXS 1DGBA 4IBIA 3PCLA 4WHRB 4DR1M 1IN4A 1OIZA 3K9PA 3GLGE 4WHSD 3E21A 4ILTA 4MGIE 1JR3E 1T3TA 4LJ4A 5ITTA 2MH8A 3BBZA 1OFHA 1SXJD 2RGOA 5EP2A 5E6JA 1DO0A 1YKLB 4JXJA 3PCEA 2DAIA 4DR5M 2KNAA 2VDBB 1R2YA 3SATA 2LVAA 3WHKA 2JXNA 2RKOA 1EOAA 3L26A 1IBLM 3IG8A 2QNJA 5ITUA 3FUXA 1D0MA 2GQFA 3RGSA 5ITYA 3HU1A 1IN7A 4WHPA 4NRVA 4QOSA 2CV2A 2BUWA 2OQ4A 2HKJA 3GQ3A 3PCAA 2BUXA 3PFIA 1OIPA 3O5UA 2JNHA 2UUAM 4M9SA 2BUVA 2WSEF 2VF7A 2OOBA 2J5YA 2O01F 1QZEA 1VEKA 2MGWA 3ZH9B 3RE8A 2YFQA 3PNYA 5EP1A 2BUVB 1L8QA 5FTLA 3GPUA 2QCUA 2AZQA 3GLGB 4MH0E 5DFLA 5EP4A 3L25A 1I94M 2L4EA 4DR7M 3KOZE 2XZFA 2X4AA 1L2BA 2BUUB 1WXQA 2KW0A 1QDRA 2R44A 3THGA 1P3QQ 3VLFB 2K9DA 4LFCM 3AOEA 1N78A 5KPRA 3T38A 3WHLA 1Z59A 3HY5A 1EO2B 5A2QS 4M0DA 1WIVA 3PCHM 1G3IA 1GKIA 1QDTA 3FRIA 1NSFA 3GRYA 3L2AA 5FTJA 4AG5A 2RGHA 2BUZA 1D0KA 4IBKA 5H37D 1ZQ9A 3J27B 3GLFE 3U60A 2BUMA 4LJ5A 3PCJM 3BOSA 1EO9A 1QAOA 1ZMUA 2D7EA 4DUZM 2BUYB 3J81S 3PCGM 2GNOA 2KDLA 3PVSA 4HL4A 4AG6A 4LF9M 3LVWA 5KQ8A 4LJ9A 1R2ZA 4UN2B 4ANRA 2KXEA 2W82A 1GJTA 4LFBM 4LZZA 1IN6A 4P17A 4GITA 4B7HA 4DUYM 1QAMA 4NL4H 4RF1A 3GP1A 5EXTA 1SXJB 5ITQA 1YKMA 3MV6A 3FUWA 3PCFA 3K8ZA 2H1RA 1MX0A 1GVNA 4JYAM 3I04M 3A45A 2CE7A 2N35A 4LFAM 3PCNM 3T63A 3LKTM 3HGIA 2QBYA 4L16A 1ZAEA 1YE9A 2V6ZM 4FCTA 5L8RF 1YKKB 2BURA 1NV9A 3VKHA 2JY6B 3GLIE 1GL7A 3HHXA 3HU3A 3DZDA 3T6PA 5LMNM 2EO2A 3FUUA 4JI1M 2DZLA 4QNRA 4I5SA 3K9OA 1TTEA 2R46A 2V1CA 4QHSA 3PCGA 1DGHB 4NOOB 2G5GX 1NY6A 2VQFM 3SHGB 1G8PA 2EKKA 3B7QA 1F4IA 1G71A 3TH1A 3IHPA 1SG9A 1KSFX 2OO9A 1L1TA 2ZTDA 3B89A 3GPPA 4FCWA 1NNJA 3U6EA 1YKOB 4G3OA 1YKPB 4OVZB 3ZQJA 5KPZA 3U61B 2DHYA 5TD3A 3KSXA 2C9CA 2UUBM 1EE8A 3KDSE 4MB7A 3VK7A 1R6BX 3MFLM 4B7FA 2NQ8C 4QHTA 3KOYE 1V34A 1DLMA 3PCKM 3HKPA 2I7PA 3U6PA 1K3XA 4HLQA 1XNRM 1TH2A 2LTUA 4LRTA 5IWAM 3LXVA 2CV1A 4GC5A 2LVOC 3RFWA 5KO3A 1AIPC 3QWLA 1VEGA 3LQRA 1E32A 2L4FA 2XZUA 1WGNA 4M9XA 3PCCM 1WGLA 4NXNM 3M0EA 4CGYB 2F5NA 3SYKA 2JZ1A 3GLHA 5EXPA 2YNMD 3TWKA 5EXSA 3NBIA 3VFDA 4AW4A 1JR3A 2QHOB 4B3MM 4WHOA 4LF6M 3UK6A 1EOBA 3FTFA 4GKKM 2VQEM 2BWEA 3KVWA 1RU3A 2JY7A 1A5TA 2M5ZA 5FTMA 5KQDA 2PCDA 4IBGA 1I4WA 3O32A 4NRWA 3M6AA 3U5ZA 1K3WA 2F4VM 2I7NA 5DYGA 3FTEA 1QYRA 2C99A 2DWMA 1PJQA 1NHWC 3KP1E 3PXGA 2C98A 2L7HA 2Y0TA 4WP2A 3R8FA 3JAMS 3LMXM 5BPVA 4TUWA 1X37A 1UM8A 4DV2M 3IECA 4MGHA 4JI6M 3LMXA 3L28A 2CWBA 2L6OA 2Z8YM 4DV3M
chains in the Genus database with same CATH topology
2LWXA 4B3RM 3QAUA 4A3VB 2R45A 1NY5A 4DR6M 3E4RA 1N33M 4WHRF 3GLIA 3SFZA 1EOCB 1ORYB 3AOEC 2XEPA 4B7GA 3PCJA 2FOIC 1MU5A 4DV7M 4ITQA 2BUQA 3MI5A 3KS8A 2C96A 3MI5M 4LF7M 1R7RA 1XXHB 4XBOA 4LJAA 1YKLA 2BV0B 4OW0A 4DR4M 2Z4SA 1IBKM 2J7OA 2R62A 5FTKA 3UGJA 2BJVA 3U6DA 5C1BA 3K1JA 2UUBM 1D2NA 1GLNA 3PCCA 2Z7JA 1TH4A 4MGYE 3R9XB 3J7BA 5ITXA 3AFHA 1YSYA 3KW6A 3AOGA 2BUTB 2BUXB 2X8AA 3KOXE 4YHHM 1HNZM 3VKGA 3I4YA 2F5SA 3ILKA 4LG2A 2X49A 2UXBM 1J5EM 3PCNA 3PCDM 3B9PA 1QANA 4WHQA 3TL4X 2FNAA 3RGPA 3PNVA 5EXXA 1XNQM 3MI1M 2O5RA 2HCBA 2Q2EB 1H6UA 4AKHA 4R3DA 1DO2A 2CEAA 5IREB 4L8RC 2BUUA 4LJ6A 4GMQA 3JR5A 4XGIA 4OU7A 4FVMA 4B3SM 4JI7M 3PCMM 4W5WA 3A46A 3PCBM 3SAUA 3MV4M 4WHRA 4L15A 2FFJA 4LF5M 3JR4A 2A5YB 3MFLA 4IIWA 2OPFA 4OX9M 2ZBKB 3GPYA 4IBDA 2XGNA 3KP0E 3PCHA 3U60B 3UZUA 1EO9B 1Z5CA 3MV4A 3MK6A 1EOAB 1E9RA 2M60A 3KOWE 4Z6YA 4WHSB 4WHPB 1HT2E 3CF0A 3OTOM 1QZMA 2XSZD 4PT5A 3O6JA 3CF6E 2XSVA 4WHPD 1W5SA 2CHGA 2CV0A 2L09A 2BUVB 4R7GA 3AJIB 1E9SA 4LZJA 5DNYA 2HHHM 1YKMB 3GRVA 2D7GA 2R18A 4YY3M 3PCDA 2CFOA 4PD2A 4JI8M 4MGZE 3GLGA 3DA1A 1YKNA 4P16A 3LMMA 3PCEM 3LVVA 4JI5M 2BNKA 2CUZA 1YKKA 5FSWA 5DYIA 3K2LA 4WURA 1HT1E 3I4VA 4FW9A 4AI6A 2YQZA 4I81A 4Z8XA 4LRSA 1IBMM 1NVMA 1DMHA 1G59A 2BOYA 2EUCA 2KA6B 5C18A 1XC8A 3MHVC 4IBFA 2XH9A 2UUCM 3GLFA 2BUMB 3VDPA 4L4UA 3DOAA 2DWNA 4WHOD 3SAWA 3K92A 3FTDA 5JI2E 1YUBA 3U6OA 4GKJM 4AKIA 3D8LA 4NSRA 3A98B 4GIPA 1W5TA 3U61A 4AQYM 1HNWM 2DVWB 3KXEC 4QOZC 2KRUA 3SC3A 3AL0C 1PM5A 1IXSB 1HNXM 1HQCA 4PCZA 4PDGA 2CHQA 4GH9A 3HJQA 1HQYE 4NXMM 3FYCA 3PCIA 3NWLA 1L2CA 4NSOB 1J09A 4X62M 3TE6A 3HJ8A 3GO8A 5KPTA 1VDDA 1FJGM 3MV6M 3PCFM 3PCLM 2DHRA 1DLTA 4RNAA 4GHAA 4JI3M 4EIWA 1NHGC 4BBAA 3EIHA 2ZAMA 1NJFA 3SASA 4JN6A 2JA2A 1IY2A 4FWGA 4PDIA 1FNNA 1N75A 1G41A 3UMMA 5EP3A 1IY0A 4L78A 4LGYA 3ZC7B 2G8LA 4REZA 4X66M 3FD9A 2VIIA 2BUYA 3TPZA 1E94E 3T15A 4JI4M 3N9TA 4QNMA 1JR3D 3HU2A 3I51A 3FYDA 1YKPA 4OVZA 2ERCA 2XSRA 2E5LM 2BUWB 2KZSA 3E9SA 3W0LB 1TGUA 4DV1M 1Z5BA 1IN8A 4K0KM 2BJWA 7CATA 4ZPXA 1K82A 4JI0M 3A42A 3HJSA 1J7KA 3L29A 3UJNA 1LV7A 1TH3A 3SHFA 2F5OA 2XFTA 2QBYB 2P5TA 3IG5A 1IY1A 1OJLA 1GL6A 2QPAA 3FTCA 2QP9X 3ZCBB 2BURB 3LXVM 2BUQB 4CISA 3KS4A 3FKEA 1N32M 3KSJA 4G4RA 2BV0A 1Q39A 3T67M 4G4NA 1EO2A 3GRRA 4LJ8A 3VDUA 1KFVA 1NJGA 2BUZB 1DGGA 4DR3M 3KFUG 4S12A 3SYLA 3SARA 3HWSA 4FCVA 4LF8M 2R4EA 1G4AE 1TDHA 3CF2A 3SBJA 1IN5A 4BB9A 3U6QA 1TMXA 1S3SA 3TQSA 3L27A 1S9AA 3HHZA 3TWMA 2XSUA 2HL7A 1XMOM 4X64M 1IM2A 1SXJA 1KYIA 2AHMA 1L2DA 2Z4RA 3GQ5A 3T1HM 1PJJA 4LF4M 4IJFA 2Y20A 5EQTA 4LY6A 4JV5M 3MI1A 2LXEA 1N77A 3O6RA 1Q3CA 2ZANA 4IJEA 1DLQA 4KHPM 2LH0A 2DWLA 4IBEA 4M9ZA 5ITXE 2PCDM 2UU9M 4KO8A 3PCBA 1OFIA 2UXCM 2KZUA 4D82A 1C1KA 4RF0A 1EOBB 1HR0M 2Z3XA 4GHLA 5F3WA 2Y21A 3T67A 1DGHA 5EJCA 5LMUM 3PCKA 5IT9S 3AV0A 3GPXA 3U5ZB 2DZNB 3GRUA 3HHWA 1IXZA 2ZM6M 4B3TM 2K47A 4BLCA 3J2PB 2YR0A 4MM3B 3U6MA 2QZ4A 1DGFA 5IZ7D 1IXRC 2D7HA 3MJ5A 1N36M 1YKOA 1XWIA 2BUTA 3PCIM 1XHBA 3T1YM 1IQPA 1NNUC 1XMQM 4WHQB 2LNHC 3J7AS 8CATA 2EA0A 2C5RA 5ITRA 2QENA 1YKNB 3SAVA 3VK8A 4DV0M 4LJ7A 2UXDM 4II7A 4AZFA 2CHVA 4FWDA 3C58A 4DV4M 4LGMA 2V1UA 1EOCA 4G4QA 2XFSA 5FTNA 2Y0QA 3W0FA 2J7NA 3FUVA 1QAQA 4DV5M 2KRKA 2DZOB 4KODA 3TWLA 3GLHB 3M7GA 4LCBA 4KLNA 4IBBA 4G4OA 2FE8A 1PJIA 4WHOB 3T63M 4FWHA 4I8OA 2F5QA 1XXHA 2L7IA 5GKNA 3LKTA 3PCAM 4IBCA 4DV6M 2DXIA 1QVRA 3GLFB 1L1ZA 3HHYA 4WW0A 4CHTB 3GQ4A 2XF3A 4MGKE 4JI2M 4D80A 4AKGA 4B08A 2C9OA 3FUTA 3U6CA 3H4MA 1Z6TA 1JQJC 4WHSA 3CTWB 3LQQA 1TDZA 3PCMA 4M0WA 4ILVA 2XSZA 4GC9A 4IBJA 1QQWA 2DWZB 3DFZA 5E26A 3AKZA 4GRIA 1SXJE 4FD2A 3J80S 1SXJC 4G6ZA 2XLJA 1Z5AA 3U6SA 2ZAOA 4DR2M 3D8BA 1Q3BA 2R65A 2F5PA 4D81A 2KEBA 4I4LA 4X65M 3U6LA 1N34M 3EIEA 5BR8M 3GLIB 3SMPA 5JI3E 3SMSA 2R4JA 3Q8XA 5FLXS 1DGBA 4IBIA 3PCLA 4WHRB 4DR1M 1IN4A 4WHSD 4ILTA 4MGIE 5ITTA 1T3TA 4LJ4A 1OFHA 1SXJD 2RGOA 5EP2A 5E6JA 1DO0A 1YKLB 4JXJA 3PCEA 4DR5M 1R2YA 3SATA 3WHKA 2RKOA 1EOAA 3L26A 1IBLM 3IG8A 5ITUA 3FUXA 3RGSA 5ITYA 4WHPA 3HU1A 1IN7A 4NRVA 4QOSA 2CV2A 2BUWA 2OQ4A 2HKJA 3GQ3A 3PCAA 2BUXA 3PFIA 3O5UA 2UUAM 4M9SA 2BUVA 3ZH9B 3RE8A 2YFQA 3PNYA 5EP1A 1L8QA 5FTLA 3GPUA 2QCUA 2AZQA 3GLGB 4MH0E 5EP4A 3L25A 1I94M 4DR7M 3KOZE 2XZFA 2X4AA 1L2BA 2BUUB 1WXQA 2KW0A 3THGA 3VLFB 4LFCM 1N78A 3AOEA 5KPRA 3T38A 3WHLA 1Z59A 1EO2B 5A2QS 4M0DA 3PCHM 1G3IA 1GKIA 3GRYA 1NSFA 3L2AA 5FTJA 4AG5A 2RGHA 2BUZA 4IBKA 5H37D 1ZQ9A 3J27B 3PCJM 3U60A 2BUMA 4LJ5A 3BOSA 1EO9A 1QAOA 2D7EA 4DUZM 2BUYB 3J81S 3PCGM 3PVSA 4HL4A 4AG6A 4LF9M 3LVWA 5KQ8A 4LJ9A 1R2ZA 2KXEA 2W82A 4LFBM 4LZZA 1IN6A 4GITA 4B7HA 4DUYM 1QAMA 4NL4H 4RF1A 3GP1A 5EXTA 1SXJB 5ITQA 1YKMA 3MV6A 3FUWA 3PCFA 3K8ZA 2H1RA 1MX0A 1GVNA 4JYAM 3T63A 3A45A 2CE7A 3PCNM 4LFAM 3LKTM 3HGIA 2QBYA 4L16A 1ZAEA 1YE9A 2V6ZM 4FCTA 1YKKB 2BURA 3VKHA 1GL7A 3HHXA 3HU3A 3DZDA 5LMNM 2EO2A 3FUUA 4JI1M 4QNRA 4I5SA 2R46A 2V1CA 4QHSA 1DGHB 4NOOB 2G5GX 1NY6A 2VQFM 3SHGB 1G8PA 3TH1A 1KSFX 1L1TA 3GPPA 4FCWA 1NNJA 3U6EA 1YKOB 1YKPB 4OVZB 5KPZA 3U61B 5TD3A 3KSXA 2C9CA 1EE8A 3KDSE 4MB7A 3VK7A 1R6BX 3MFLM 4B7FA 2NQ8C 4QHTA 3KOYE 1DLMA 3PCKM 3HKPA 2I7PA 3U6PA 1K3XA 4HLQA 1XNRM 1TH2A 4LRTA 5IWAM 3LXVA 2CV1A 4GC5A 3RFWA 5KO3A 3QWLA 3LQRA 1E32A 2XZUA 4M9XA 3PCCM 4NXNM 3M0EA 4CGYB 2F5NA 3SYKA 3GLHA 5EXPA 2YNMD 3TWKA 5EXSA 3NBIA 3VFDA 4AW4A 1JR3A 4B3MM 3PCGA 4WHOA 4LF6M 3UK6A 1EOBA 3FTFA 4GKKM 2VQEM 3KVWA 2M5ZA 5FTMA 5KQDA 2PCDA 4IBGA 1I4WA 3O32A 4NRWA 3M6AA 3U5ZA 1K3WA 2F4VM 2I7NA 5DYGA 3FTEA 1QYRA 2C99A 2DWMA 1NHWC 3KP1E 3PXGA 2C98A 2L7HA 2Y0TA 3R8FA 3JAMS 3LMXM 5BPVA 4TUWA 1X37A 1UM8A 4DV2M 4MGHA 4JI6M 3LMXA 3L28A 2L6OA 4DV3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUU B;  3T67 A;  3PCK A;  4WHR F;  1EO2 B;  3PCH M;  1EOC B;  2BUZ A;  2BUT A;  1YKO A;  3PCI M;  3PCJ A;  3HJQ A;  3PCI A;  2BUQ A;  3PCJ M;  3MI5 A;  2BUM A;  1EO9 A;  3MI5 M;  3HJ8 A;  2BUY B;  3PCG M;  4WHQ B;  3MV6 M;  3PCF M;  1YKL A;  2BV0 B;  3PCL M;  1DLT A;  1YKN B;  3PCC A;  1EOC A;  1YKM A;  3MV6 A;  3PCF A;  2BUT B;  2BUX B;  3I4Y A;  3T63 A;  3PCN M;  3LKT M;  3T63 M;  2BUY A;  3PCD M;  3HGI A;  3N9T A;  3PCN A;  4WHQ A;  3LKT A;  4WHO B;  3I51 A;  1YKP A;  1YKK B;  2BUR A;  3PCA M;  3MI1 M;  3HHY A;  3HHX A;  2XSR A;  2BUW B;  2BUU A;  4WHS A;  3PCM A;  3PCM M;  4ILV A;  3TH1 A;  3PCB M;  3MV4 M;  4WHR A;  3HJS A;  3MFL A;  1YKO B;  3LXV M;  1YKP B;  2BUR B;  3PCH A;  5TD3 A;  2BUQ B;  1EO9 B;  3MV4 A;  1EOA B;  3MFL M;  2BV0 A;  4WHS B;  3T67 M;  4WHP B;  1EO2 A;  1DLM A;  3PCK M;  3HKP A;  3LXV A;  2BUZ B;  3PCL A;  3O6J A;  4WHR B;  2XSV A;  4WHP D;  4WHS D;  2BUV B;  4ILT A;  1YKM B;  3PCD A;  3PCC M;  1YKL B;  3PCE A;  3PCG A;  1TMX A;  1YKN A;  3PCE M;  4WHO A;  1S9A A;  1EOA A;  1EOB A;  1YKK A;  2XSU A;  4WHP A;  2BUW A;  2PCD A;  3PCA A;  3I4V A;  3O32 A;  2BUX A;  3O5U A;  1DMH A;  2BUV A;  2BOY A;  3MI1 A;  3LMX M;  3O6R A;  3LMX A;  1DLQ A;  2AZQ A;  2BUM B;  2PCD M;  3PCB A;  4WHO D;  1EOB B; 
#chains in the Genus database with same CATH topology
 2LHG A;  2LWX A;  4B3R M;  3QAU A;  4A3V B;  1AUA A;  2R45 A;  1NY5 A;  4DR6 M;  3E4R A;  1N33 M;  4WHR F;  3GLI A;  3SFZ A;  1EOC B;  2DAK A;  1ORY B;  3AOE C;  2XEP A;  4B7G A;  1TF0 B;  3PCJ A;  2FOI C;  1MU5 A;  4DV7 M;  4ITQ A;  2BUQ A;  3MI5 A;  3NBX X;  1CUK A;  3KS8 A;  2C96 A;  2LVQ D;  1ZMW A;  3MI5 M;  3LCV B;  4LF7 M;  1R7R A;  1XXH B;  2HWJ A;  4XBO A;  4LJA A;  1YKL A;  2BV0 B;  3FE3 A;  4OW0 A;  4DR4 M;  1JB0 F;  2Z4S A;  1IBK M;  2J7O A;  2R62 A;  5FTK A;  3UGJ A;  2BJV A;  3U6D A;  2O25 A;  3K1J A;  5C1B A;  2DAE A;  2LVP C;  1D2N A;  1GLN A;  3PCC A;  2DI0 A;  1TH4 A;  2Z7J A;  4MGY E;  3J7B A;  3R9X B;  2K0B X;  5ITX A;  3AFH A;  1YSY A;  3KW6 A;  3AOG A;  2BUT B;  2BUX B;  2X8A A;  3KOX E;  4YHH M;  1HNZ M;  2CRU A;  3VKG A;  3I4Y A;  2F5S A;  3ILK A;  4LG2 A;  2X49 A;  2UXB M;  1GJS A;  1J5E M;  3PCN A;  3PCD M;  3B9P A;  1QAN A;  3QYB A;  4WHQ A;  3TL4 X;  2QSF X;  2R0I A;  4NC6 A;  2FNA A;  3RGP A;  3PNV A;  5EXX A;  1XNQ M;  3MI1 M;  2O5R A;  2HCB A;  2Q2E B;  1H6U A;  4AKH A;  3CGW A;  4R3D A;  1VEJ A;  1DO2 A;  2CEA A;  4RKU F;  5IRE B;  4L8R C;  4LJ6 A;  2VF8 A;  4GMQ A;  3JR5 A;  2BUU A;  4XGI A;  4OU7 A;  4FVM A;  2APL A;  4B3S M;  4JI7 M;  3PCM M;  4W5W A;  3A46 A;  3PCB M;  3SAU A;  3MV4 M;  3B7Z A;  4WHR A;  4L15 A;  2FFJ A;  4LF5 M;  3JR4 A;  2A5Y B;  3MFL A;  2FH0 A;  4IIW A;  2OPF A;  4OX9 M;  2LBC A;  2ZBK B;  3GPY A;  3E46 A;  4IBD A;  1OAI A;  2XGN A;  3KP0 E;  3PCH A;  1VG5 A;  4DBG B;  3GLH E;  3UZU A;  3U60 B;  1EO9 B;  1Z5C A;  3MV4 A;  1GO5 A;  3MK6 A;  1EOA B;  1E9R A;  2M60 A;  2WSC F;  1NV8 A;  3KOW E;  4Z6Y A;  4WHS B;  4WHP B;  2KNV A;  1HT2 E;  2DAG A;  3CF0 A;  3OTO M;  1QZM A;  2FS1 A;  2XSZ D;  4PT5 A;  3O6J A;  3CF6 E;  2XSV A;  4WHP D;  1W5S A;  1WHC A;  2CHG A;  2L09 A;  2CV0 A;  4R7G A;  3AJI B;  1E9S A;  4LZJ A;  5DNY A;  2HHH M;  1YKM B;  3GRV A;  2D7G A;  2R18 A;  4YY3 M;  3PCD A;  2CFO A;  4PD2 A;  4JI8 M;  3W68 A;  4MGZ E;  3GLG A;  3DA1 A;  3MMP A;  1YKN A;  4P16 A;  3LMM A;  3H4J A;  3PCE M;  3LVV A;  4JI5 M;  2BNK A;  2CUZ A;  1UFZ A;  2MR9 A;  2DAM A;  3HZJ A;  1YKK A;  5FSW A;  5DYI A;  2MRO B;  3K2L A;  4WUR A;  1HT1 E;  2R6F A;  3I4V A;  4FW9 A;  4AI6 A;  2YQZ A;  1C7Y A;  3QYE A;  4I81 A;  4Z8X A;  4LRS A;  1YLA A;  1NVM A;  1IBM M;  1G59 A;  1DMH A;  2BOY A;  1OAO C;  2EUC A;  2KA6 B;  5C18 A;  1XC8 A;  3MHV C;  2HAK A;  4IBF A;  2XH9 A;  4R71 A;  2UUC M;  3GLF A;  1R4G A;  1TR8 A;  1WJ7 A;  3VDP A;  2BUM B;  4L4U A;  3DOA A;  2DWN A;  4WHO D;  3SAW A;  3K92 A;  3FTD A;  4L6V 6;  1YUB A;  5JI2 E;  3U6O A;  4GKJ M;  3D8L A;  4NSR A;  2JZ0 A;  3A98 B;  1W5T A;  4GIP A;  3U61 A;  4AKI A;  4AQY M;  1HNW M;  2DVW B;  2DKL A;  3KXE C;  4QOZ C;  2KRU A;  3SC3 A;  3BXW A;  3AL0 C;  1PM5 A;  1IXS B;  1HNX M;  1HQC A;  4GEW A;  4PCZ A;  4PDG A;  2CHQ A;  3HJQ A;  4GH9 A;  1HQY E;  4NXM M;  3FYC A;  3PCI A;  3NWL A;  1L2C A;  4NSO B;  1J09 A;  1PRB A;  4X62 M;  3TE6 A;  3HJ8 A;  3GO8 A;  5KPT A;  1VDD A;  1FJG M;  3MV6 M;  3PCF M;  3PCL M;  1NO1 A;  2DHR A;  1DLT A;  4RNA A;  4GHA A;  4JI3 M;  4EIW A;  1NHG C;  1T6O A;  4BBA A;  3EIH A;  2ZAM A;  1NJF A;  3SAS A;  4JN6 A;  2JA2 A;  1IY2 A;  4FWG A;  4PDI A;  1FNN A;  1N75 A;  1G41 A;  2G3Q A;  5EP3 A;  1IY0 A;  3F92 A;  4L78 A;  4LGY A;  3ZC7 B;  3UMM A;  1OTR A;  2G8L A;  1OQY A;  4REZ A;  4X66 M;  4Y28 F;  3FD9 A;  1PJS A;  2VII A;  1EIJ A;  3TPZ A;  2BUY A;  1E94 E;  3T15 A;  4JI4 M;  3N9T A;  4QNM A;  1JR3 D;  3HU2 A;  1V33 A;  3FYD A;  3I51 A;  4OVZ A;  1YKP A;  2ERC A;  1OKS A;  4F2L A;  2LVN C;  2E5L M;  2XSR A;  2BUW B;  2KZS A;  3E9S A;  1XXH E;  1DV0 A;  4HEO A;  3W0L B;  1R5L A;  1TGU A;  4DV1 M;  1Z5B A;  1IN8 A;  4K0K M;  2BJW A;  4Q7J A;  7CAT A;  4ZPX A;  1K82 A;  4JI0 M;  3A42 A;  3HJS A;  1J7K A;  3L29 A;  3UJN A;  1LV7 A;  1TH3 A;  3LCU A;  3SHF A;  2F5O A;  2XFT A;  2QBY B;  2P5T A;  2RRU A;  1IY1 A;  3IG5 A;  1OJL A;  1GL6 A;  2QPA A;  3FTC A;  2QP9 X;  3ZCB B;  2BUR B;  3LXV M;  2BUQ B;  4CIS A;  3KS4 A;  3FKE A;  1N32 M;  3KSJ A;  4G4R A;  2DNA A;  2OOA A;  2BV0 A;  1Q39 A;  3T67 M;  4G4N A;  1EO2 A;  3GRR A;  1GAB A;  4LJ8 A;  3VDU A;  1KFV A;  1NJG A;  2BUZ B;  1DGG A;  4DR3 M;  3KFU G;  1VQ1 A;  4S12 A;  3SYL A;  3SAR A;  3HWS A;  4FCV A;  4LF8 M;  2R4E A;  1G4A E;  1TDH A;  2B3T A;  3CF2 A;  3SBJ A;  1IN5 A;  4BB9 A;  3U6Q A;  1TMX A;  1S3S A;  3TQS A;  3L27 A;  1WR1 B;  1S9A A;  3HHZ A;  3TWM A;  2L2D A;  1PGY A;  2XSU A;  1VDL A;  2HL7 A;  1XMO M;  4X64 M;  1IM2 A;  1SXJ A;  1KYI A;  2AHM A;  3C3E A;  1L2D A;  2Z4R A;  4KT0 F;  3V76 A;  3GQ5 A;  3T1H M;  1ZMV A;  1PJJ A;  4LF4 M;  4IJF A;  2Y20 A;  5EQT A;  4LY6 A;  4JV5 M;  2EJS A;  3MI1 A;  2LXE A;  1N77 A;  1EFU B;  2JY5 A;  2JUJ A;  3O6R A;  1Q3C A;  2ZAN A;  4IJE A;  3B7N A;  1DLQ A;  4KHP M;  2LH0 A;  2DWL A;  2H5X A;  4IBE A;  4M9Z A;  5ITX E;  2PCD M;  2UU9 M;  3C9P A;  1QUS A;  4KO8 A;  1OFI A;  3PCB A;  2UXC M;  2KZU A;  4D82 A;  1C1K A;  4RF0 A;  1EOB B;  2MJ5 B;  1T43 A;  4F1I A;  2Z3X A;  1HR0 M;  5F3W A;  2Y21 A;  4GHL A;  3T67 A;  1DGH A;  5EJC A;  5LMU M;  3PCK A;  5IT9 S;  3AV0 A;  3GPX A;  3U5Z B;  2DZN B;  3GRU A;  3HHW A;  1IXZ A;  2ZM6 M;  4B3T M;  2K47 A;  4BLC A;  3J2P B;  2YR0 A;  4MM3 B;  3U6M A;  2QZ4 A;  1BVS A;  2JP7 A;  1DGF A;  5IZ7 D;  1IXR C;  2D7H A;  3MJ5 A;  1N36 M;  1YKO A;  1XWI A;  2BUT A;  3PCI M;  1XHB A;  3T1Y M;  1XB2 B;  1IQP A;  1NNU C;  1XMQ M;  1Q02 A;  3FRH A;  4WHQ B;  2LNH C;  3J7A S;  2KHH A;  1MJG M;  8CAT A;  2EA0 A;  2C5R A;  5ITR A;  2QEN A;  4CJ6 A;  2DEN A;  1YKN B;  1LTM A;  3SAV A;  2QQ8 A;  3VK8 A;  1V92 A;  2CP8 A;  4LJ7 A;  4DV0 M;  2UXD M;  3Q8G A;  4II7 A;  4AZF A;  2CHV A;  4FWD A;  3C58 A;  4DV4 M;  4LGM A;  2V1U A;  1EOC A;  4G4Q A;  2WZJ A;  2XFS A;  3HX3 A;  5FTN A;  2Y0Q A;  2JY8 A;  1ZV1 A;  2J7N A;  1QAQ A;  3FUV A;  3W0F A;  4DV5 M;  2BWB A;  2KNZ A;  2KRK A;  2DZO B;  2LHC A;  4KOD A;  3TWL A;  3GLH B;  3M7G A;  4LCB A;  1QUT A;  4KLN A;  4IBB A;  4G4O A;  2FE8 A;  3W67 A;  1PJI A;  4WHO B;  4FWH A;  4I8O A;  1HJP A;  1XXH A;  2L7I A;  5GKN A;  2F5Q A;  3LKT A;  3PCA M;  4IBC A;  4DV6 M;  2DXI A;  1QVR A;  3GLF B;  1L1Z A;  3HHY A;  1MN3 A;  2WSF F;  4WW0 A;  4CHT B;  3GQ4 A;  1D0L A;  2XF3 A;  1IFY A;  4MGK E;  4JI2 M;  4D80 A;  4AKG A;  1PJT A;  3T63 M;  4B08 A;  2C9O A;  3FUT A;  3U6C A;  1Z6T A;  3H4M A;  1JQJ C;  4WHS A;  3CTW B;  3LQQ A;  1TDZ A;  3PCM A;  4M0W A;  2EKF A;  4ILV A;  2XSZ A;  4GC9 A;  4IBJ A;  1QQW A;  2DWZ B;  3DFZ A;  5E26 A;  3AKZ A;  4GRI A;  1SXJ E;  4FD2 A;  3J80 S;  1IXS A;  3C3D A;  1SXJ C;  4G6Z A;  1Y8G A;  2XLJ A;  2K6B A;  3LW5 F;  1Z5A A;  3B74 A;  3U6S A;  2ZAO A;  4DR2 M;  3D8B A;  4XK8 F;  4CIZ A;  1Q3B A;  2R65 A;  2F5P A;  4D81 A;  2KEB A;  4I4L A;  2ZTC A;  2JWS A;  4X65 M;  3U6L A;  1N34 M;  3EIE A;  5BR8 M;  3GLI B;  3SMP A;  5JI3 E;  3SMS A;  2R4J A;  3Q8X A;  3I01 M;  5FLX S;  1DGB A;  4IBI A;  3PCL A;  4WHR B;  4DR1 M;  1IN4 A;  1OIZ A;  3K9P A;  3GLG E;  4WHS D;  3E21 A;  4ILT A;  4MGI E;  1JR3 E;  1T3T A;  4LJ4 A;  5ITT A;  2MH8 A;  3BBZ A;  1OFH A;  1SXJ D;  2RGO A;  5EP2 A;  5E6J A;  1DO0 A;  1YKL B;  4JXJ A;  3PCE A;  2DAI A;  4DR5 M;  2KNA A;  2VDB B;  1R2Y A;  3SAT A;  2LVA A;  3WHK A;  2JXN A;  2RKO A;  1EOA A;  3L26 A;  1IBL M;  3IG8 A;  2QNJ A;  5ITU A;  3FUX A;  1D0M A;  2GQF A;  3RGS A;  5ITY A;  3HU1 A;  1IN7 A;  4WHP A;  4NRV A;  4QOS A;  2CV2 A;  2BUW A;  2OQ4 A;  2HKJ A;  3GQ3 A;  3PCA A;  2BUX A;  3PFI A;  1OIP A;  3O5U A;  2JNH A;  2UUA M;  4M9S A;  2BUV A;  2WSE F;  2VF7 A;  2OOB A;  2J5Y A;  2O01 F;  1QZE A;  1VEK A;  2MGW A;  3ZH9 B;  3RE8 A;  2YFQ A;  3PNY A;  5EP1 A;  2BUV B;  1L8Q A;  5FTL A;  3GPU A;  2QCU A;  2AZQ A;  3GLG B;  4MH0 E;  5DFL A;  5EP4 A;  3L25 A;  1I94 M;  2L4E A;  4DR7 M;  3KOZ E;  2XZF A;  2X4A A;  1L2B A;  2BUU B;  1WXQ A;  2KW0 A;  1QDR A;  2R44 A;  3THG A;  1P3Q Q;  3VLF B;  2K9D A;  4LFC M;  3AOE A;  1N78 A;  5KPR A;  3T38 A;  3WHL A;  1Z59 A;  3HY5 A;  1EO2 B;  5A2Q S;  4M0D A;  1WIV A;  3PCH M;  1G3I A;  1GKI A;  1QDT A;  3FRI A;  1NSF A;  3GRY A;  3L2A A;  5FTJ A;  4AG5 A;  2RGH A;  2BUZ A;  1D0K A;  4IBK A;  5H37 D;  1ZQ9 A;  3J27 B;  3GLF E;  3U60 A;  2BUM A;  4LJ5 A;  3PCJ M;  3BOS A;  1EO9 A;  1QAO A;  1ZMU A;  2D7E A;  4DUZ M;  2BUY B;  3J81 S;  3PCG M;  2GNO A;  2KDL A;  3PVS A;  4HL4 A;  4AG6 A;  4LF9 M;  3LVW A;  5KQ8 A;  4LJ9 A;  1R2Z A;  4UN2 B;  4ANR A;  2KXE A;  2W82 A;  1GJT A;  4LFB M;  4LZZ A;  1IN6 A;  4P17 A;  4GIT A;  4B7H A;  4DUY M;  1QAM A;  4NL4 H;  4RF1 A;  3GP1 A;  5EXT A;  1SXJ B;  5ITQ A;  1YKM A;  3MV6 A;  3FUW A;  3PCF A;  3K8Z A;  2H1R A;  1MX0 A;  1GVN A;  4JYA M;  3I04 M;  3A45 A;  2CE7 A;  2N35 A;  4LFA M;  3PCN M;  3T63 A;  3LKT M;  3HGI A;  2QBY A;  4L16 A;  1ZAE A;  1YE9 A;  2V6Z M;  4FCT A;  5L8R F;  1YKK B;  2BUR A;  1NV9 A;  3VKH A;  2JY6 B;  3GLI E;  1GL7 A;  3HHX A;  3HU3 A;  3DZD A;  3T6P A;  5LMN M;  2EO2 A;  3FUU A;  4JI1 M;  2DZL A;  4QNR A;  4I5S A;  3K9O A;  1TTE A;  2R46 A;  2V1C A;  4QHS A;  3PCG A;  1DGH B;  4NOO B;  2G5G X;  1NY6 A;  2VQF M;  3SHG B;  1G8P A;  2EKK A;  3B7Q A;  1F4I A;  1G71 A;  3TH1 A;  3IHP A;  1SG9 A;  1KSF X;  2OO9 A;  1L1T A;  2ZTD A;  3B89 A;  3GPP A;  4FCW A;  1NNJ A;  3U6E A;  1YKO B;  4G3O A;  1YKP B;  4OVZ B;  3ZQJ A;  5KPZ A;  3U61 B;  2DHY A;  5TD3 A;  3KSX A;  2C9C A;  2UUB M;  1EE8 A;  3KDS E;  4MB7 A;  3VK7 A;  1R6B X;  3MFL M;  4B7F A;  2NQ8 C;  4QHT A;  3KOY E;  1V34 A;  1DLM A;  3PCK M;  3HKP A;  2I7P A;  3U6P A;  1K3X A;  4HLQ A;  1XNR M;  1TH2 A;  2LTU A;  4LRT A;  5IWA M;  3LXV A;  2CV1 A;  4GC5 A;  2LVO C;  3RFW A;  5KO3 A;  1AIP C;  3QWL A;  1VEG A;  3LQR A;  1E32 A;  2L4F A;  2XZU A;  1WGN A;  4M9X A;  3PCC M;  1WGL A;  4NXN M;  3M0E A;  4CGY B;  2F5N A;  3SYK A;  2JZ1 A;  3GLH A;  5EXP A;  2YNM D;  3TWK A;  5EXS A;  3NBI A;  3VFD A;  4AW4 A;  1JR3 A;  2QHO B;  4B3M M;  4WHO A;  4LF6 M;  3UK6 A;  1EOB A;  3FTF A;  4GKK M;  2VQE M;  2BWE A;  3KVW A;  1RU3 A;  2JY7 A;  1A5T A;  2M5Z A;  5FTM A;  5KQD A;  2PCD A;  4IBG A;  1I4W A;  3O32 A;  4NRW A;  3M6A A;  3U5Z A;  1K3W A;  2F4V M;  2I7N A;  5DYG A;  3FTE A;  1QYR A;  2C99 A;  2DWM A;  1PJQ A;  1NHW C;  3KP1 E;  3PXG A;  2C98 A;  2L7H A;  2Y0T A;  4WP2 A;  3R8F A;  3JAM S;  3LMX M;  5BPV A;  4TUW A;  1X37 A;  1UM8 A;  4DV2 M;  3IEC A;  4MGH A;  4JI6 M;  3LMX A;  3L28 A;  2CWB A;  2L6O A;  2Z8Y M;  4DV3 M; 
#chains in the Genus database with same CATH homology
 2LWX A;  4B3R M;  3QAU A;  4A3V B;  2R45 A;  1NY5 A;  4DR6 M;  3E4R A;  1N33 M;  4WHR F;  3GLI A;  3SFZ A;  1EOC B;  1ORY B;  3AOE C;  2XEP A;  4B7G A;  3PCJ A;  2FOI C;  1MU5 A;  4DV7 M;  4ITQ A;  2BUQ A;  3MI5 A;  3KS8 A;  2C96 A;  3MI5 M;  4LF7 M;  1R7R A;  1XXH B;  4XBO A;  4LJA A;  1YKL A;  2BV0 B;  4OW0 A;  4DR4 M;  2Z4S A;  1IBK M;  2J7O A;  2R62 A;  5FTK A;  3UGJ A;  2BJV A;  3U6D A;  5C1B A;  3K1J A;  2UUB M;  1D2N A;  1GLN A;  3PCC A;  2Z7J A;  1TH4 A;  4MGY E;  3R9X B;  3J7B A;  5ITX A;  3AFH A;  1YSY A;  3KW6 A;  3AOG A;  2BUT B;  2BUX B;  2X8A A;  3KOX E;  4YHH M;  1HNZ M;  3VKG A;  3I4Y A;  2F5S A;  3ILK A;  4LG2 A;  2X49 A;  2UXB M;  1J5E M;  3PCN A;  3PCD M;  3B9P A;  1QAN A;  4WHQ A;  3TL4 X;  2FNA A;  3RGP A;  3PNV A;  5EXX A;  1XNQ M;  3MI1 M;  2O5R A;  2HCB A;  2Q2E B;  1H6U A;  4AKH A;  4R3D A;  1DO2 A;  2CEA A;  5IRE B;  4L8R C;  2BUU A;  4LJ6 A;  4GMQ A;  3JR5 A;  4XGI A;  4OU7 A;  4FVM A;  4B3S M;  4JI7 M;  3PCM M;  4W5W A;  3A46 A;  3PCB M;  3SAU A;  3MV4 M;  4WHR A;  4L15 A;  2FFJ A;  4LF5 M;  3JR4 A;  2A5Y B;  3MFL A;  4IIW A;  2OPF A;  4OX9 M;  2ZBK B;  3GPY A;  4IBD A;  2XGN A;  3KP0 E;  3PCH A;  3U60 B;  3UZU A;  1EO9 B;  1Z5C A;  3MV4 A;  3MK6 A;  1EOA B;  1E9R A;  2M60 A;  3KOW E;  4Z6Y A;  4WHS B;  4WHP B;  1HT2 E;  3CF0 A;  3OTO M;  1QZM A;  2XSZ D;  4PT5 A;  3O6J A;  3CF6 E;  2XSV A;  4WHP D;  1W5S A;  2CHG A;  2CV0 A;  2L09 A;  2BUV B;  4R7G A;  3AJI B;  1E9S A;  4LZJ A;  5DNY A;  2HHH M;  1YKM B;  3GRV A;  2D7G A;  2R18 A;  4YY3 M;  3PCD A;  2CFO A;  4PD2 A;  4JI8 M;  4MGZ E;  3GLG A;  3DA1 A;  1YKN A;  4P16 A;  3LMM A;  3PCE M;  3LVV A;  4JI5 M;  2BNK A;  2CUZ A;  1YKK A;  5FSW A;  5DYI A;  3K2L A;  4WUR A;  1HT1 E;  3I4V A;  4FW9 A;  4AI6 A;  2YQZ A;  4I81 A;  4Z8X A;  4LRS A;  1IBM M;  1NVM A;  1DMH A;  1G59 A;  2BOY A;  2EUC A;  2KA6 B;  5C18 A;  1XC8 A;  3MHV C;  4IBF A;  2XH9 A;  2UUC M;  3GLF A;  2BUM B;  3VDP A;  4L4U A;  3DOA A;  2DWN A;  4WHO D;  3SAW A;  3K92 A;  3FTD A;  5JI2 E;  1YUB A;  3U6O A;  4GKJ M;  4AKI A;  3D8L A;  4NSR A;  3A98 B;  4GIP A;  1W5T A;  3U61 A;  4AQY M;  1HNW M;  2DVW B;  3KXE C;  4QOZ C;  2KRU A;  3SC3 A;  3AL0 C;  1PM5 A;  1IXS B;  1HNX M;  1HQC A;  4PCZ A;  4PDG A;  2CHQ A;  4GH9 A;  3HJQ A;  1HQY E;  4NXM M;  3FYC A;  3PCI A;  3NWL A;  1L2C A;  4NSO B;  1J09 A;  4X62 M;  3TE6 A;  3HJ8 A;  3GO8 A;  5KPT A;  1VDD A;  1FJG M;  3MV6 M;  3PCF M;  3PCL M;  2DHR A;  1DLT A;  4RNA A;  4GHA A;  4JI3 M;  4EIW A;  1NHG C;  4BBA A;  3EIH A;  2ZAM A;  1NJF A;  3SAS A;  4JN6 A;  2JA2 A;  1IY2 A;  4FWG A;  4PDI A;  1FNN A;  1N75 A;  1G41 A;  3UMM A;  5EP3 A;  1IY0 A;  4L78 A;  4LGY A;  3ZC7 B;  2G8L A;  4REZ A;  4X66 M;  3FD9 A;  2VII A;  2BUY A;  3TPZ A;  1E94 E;  3T15 A;  4JI4 M;  3N9T A;  4QNM A;  1JR3 D;  3HU2 A;  3I51 A;  3FYD A;  1YKP A;  4OVZ A;  2ERC A;  2XSR A;  2E5L M;  2BUW B;  2KZS A;  3E9S A;  3W0L B;  1TGU A;  4DV1 M;  1Z5B A;  1IN8 A;  4K0K M;  2BJW A;  7CAT A;  4ZPX A;  1K82 A;  4JI0 M;  3A42 A;  3HJS A;  1J7K A;  3L29 A;  3UJN A;  1LV7 A;  1TH3 A;  3SHF A;  2F5O A;  2XFT A;  2QBY B;  2P5T A;  3IG5 A;  1IY1 A;  1OJL A;  1GL6 A;  2QPA A;  3FTC A;  2QP9 X;  3ZCB B;  2BUR B;  3LXV M;  2BUQ B;  4CIS A;  3KS4 A;  3FKE A;  1N32 M;  3KSJ A;  4G4R A;  2BV0 A;  1Q39 A;  3T67 M;  4G4N A;  1EO2 A;  3GRR A;  4LJ8 A;  3VDU A;  1KFV A;  1NJG A;  2BUZ B;  1DGG A;  4DR3 M;  3KFU G;  4S12 A;  3SYL A;  3SAR A;  3HWS A;  4FCV A;  4LF8 M;  2R4E A;  1G4A E;  1TDH A;  3CF2 A;  3SBJ A;  1IN5 A;  4BB9 A;  3U6Q A;  1TMX A;  1S3S A;  3TQS A;  3L27 A;  1S9A A;  3HHZ A;  3TWM A;  2XSU A;  2HL7 A;  1XMO M;  4X64 M;  1IM2 A;  1SXJ A;  1KYI A;  2AHM A;  1L2D A;  2Z4R A;  3GQ5 A;  3T1H M;  1PJJ A;  4LF4 M;  4IJF A;  2Y20 A;  5EQT A;  4LY6 A;  4JV5 M;  3MI1 A;  2LXE A;  1N77 A;  3O6R A;  1Q3C A;  2ZAN A;  4IJE A;  1DLQ A;  4KHP M;  2LH0 A;  2DWL A;  4IBE A;  4M9Z A;  5ITX E;  2PCD M;  2UU9 M;  4KO8 A;  3PCB A;  1OFI A;  2UXC M;  2KZU A;  4D82 A;  1C1K A;  4RF0 A;  1EOB B;  1HR0 M;  2Z3X A;  4GHL A;  5F3W A;  2Y21 A;  3T67 A;  1DGH A;  5EJC A;  5LMU M;  3PCK A;  5IT9 S;  3AV0 A;  3GPX A;  3U5Z B;  2DZN B;  3GRU A;  3HHW A;  1IXZ A;  2ZM6 M;  4B3T M;  2K47 A;  4BLC A;  3J2P B;  2YR0 A;  4MM3 B;  3U6M A;  2QZ4 A;  1DGF A;  5IZ7 D;  1IXR C;  2D7H A;  3MJ5 A;  1N36 M;  1YKO A;  1XWI A;  2BUT A;  3PCI M;  1XHB A;  3T1Y M;  1IQP A;  1NNU C;  1XMQ M;  4WHQ B;  2LNH C;  3J7A S;  8CAT A;  2EA0 A;  2C5R A;  5ITR A;  2QEN A;  1YKN B;  3SAV A;  3VK8 A;  4DV0 M;  4LJ7 A;  2UXD M;  4II7 A;  4AZF A;  2CHV A;  4FWD A;  3C58 A;  4DV4 M;  4LGM A;  2V1U A;  1EOC A;  4G4Q A;  2XFS A;  5FTN A;  2Y0Q A;  3W0F A;  2J7N A;  3FUV A;  1QAQ A;  4DV5 M;  2KRK A;  2DZO B;  4KOD A;  3TWL A;  3GLH B;  3M7G A;  4LCB A;  4KLN A;  4IBB A;  4G4O A;  2FE8 A;  1PJI A;  4WHO B;  3T63 M;  4FWH A;  4I8O A;  2F5Q A;  1XXH A;  2L7I A;  5GKN A;  3LKT A;  3PCA M;  4IBC A;  4DV6 M;  2DXI A;  1QVR A;  3GLF B;  1L1Z A;  3HHY A;  4WW0 A;  4CHT B;  3GQ4 A;  2XF3 A;  4MGK E;  4JI2 M;  4D80 A;  4AKG A;  4B08 A;  2C9O A;  3FUT A;  3U6C A;  3H4M A;  1Z6T A;  1JQJ C;  4WHS A;  3CTW B;  3LQQ A;  1TDZ A;  3PCM A;  4M0W A;  4ILV A;  2XSZ A;  4GC9 A;  4IBJ A;  1QQW A;  2DWZ B;  3DFZ A;  5E26 A;  3AKZ A;  4GRI A;  1SXJ E;  4FD2 A;  3J80 S;  1SXJ C;  4G6Z A;  2XLJ A;  1Z5A A;  3U6S A;  2ZAO A;  4DR2 M;  3D8B A;  1Q3B A;  2R65 A;  2F5P A;  4D81 A;  2KEB A;  4I4L A;  4X65 M;  3U6L A;  1N34 M;  3EIE A;  5BR8 M;  3GLI B;  3SMP A;  5JI3 E;  3SMS A;  2R4J A;  3Q8X A;  5FLX S;  1DGB A;  4IBI A;  3PCL A;  4WHR B;  4DR1 M;  1IN4 A;  4WHS D;  4ILT A;  4MGI E;  5ITT A;  1T3T A;  4LJ4 A;  1OFH A;  1SXJ D;  2RGO A;  5EP2 A;  5E6J A;  1DO0 A;  1YKL B;  4JXJ A;  3PCE A;  4DR5 M;  1R2Y A;  3SAT A;  3WHK A;  2RKO A;  1EOA A;  3L26 A;  1IBL M;  3IG8 A;  5ITU A;  3FUX A;  3RGS A;  5ITY A;  4WHP A;  3HU1 A;  1IN7 A;  4NRV A;  4QOS A;  2CV2 A;  2BUW A;  2OQ4 A;  2HKJ A;  3GQ3 A;  3PCA A;  2BUX A;  3PFI A;  3O5U A;  2UUA M;  4M9S A;  2BUV A;  3ZH9 B;  3RE8 A;  2YFQ A;  3PNY A;  5EP1 A;  1L8Q A;  5FTL A;  3GPU A;  2QCU A;  2AZQ A;  3GLG B;  4MH0 E;  5EP4 A;  3L25 A;  1I94 M;  4DR7 M;  3KOZ E;  2XZF A;  2X4A A;  1L2B A;  2BUU B;  1WXQ A;  2KW0 A;  3THG A;  3VLF B;  4LFC M;  1N78 A;  3AOE A;  5KPR A;  3T38 A;  3WHL A;  1Z59 A;  1EO2 B;  5A2Q S;  4M0D A;  3PCH M;  1G3I A;  1GKI A;  3GRY A;  1NSF A;  3L2A A;  5FTJ A;  4AG5 A;  2RGH A;  2BUZ A;  4IBK A;  5H37 D;  1ZQ9 A;  3J27 B;  3PCJ M;  3U60 A;  2BUM A;  4LJ5 A;  3BOS A;  1EO9 A;  1QAO A;  2D7E A;  4DUZ M;  2BUY B;  3J81 S;  3PCG M;  3PVS A;  4HL4 A;  4AG6 A;  4LF9 M;  3LVW A;  5KQ8 A;  4LJ9 A;  1R2Z A;  2KXE A;  2W82 A;  4LFB M;  4LZZ A;  1IN6 A;  4GIT A;  4B7H A;  4DUY M;  1QAM A;  4NL4 H;  4RF1 A;  3GP1 A;  5EXT A;  1SXJ B;  5ITQ A;  1YKM A;  3MV6 A;  3FUW A;  3PCF A;  3K8Z A;  2H1R A;  1MX0 A;  1GVN A;  4JYA M;  3T63 A;  3A45 A;  2CE7 A;  3PCN M;  4LFA M;  3LKT M;  3HGI A;  2QBY A;  4L16 A;  1ZAE A;  1YE9 A;  2V6Z M;  4FCT A;  1YKK B;  2BUR A;  3VKH A;  1GL7 A;  3HHX A;  3HU3 A;  3DZD A;  5LMN M;  2EO2 A;  3FUU A;  4JI1 M;  4QNR A;  4I5S A;  2R46 A;  2V1C A;  4QHS A;  1DGH B;  4NOO B;  2G5G X;  1NY6 A;  2VQF M;  3SHG B;  1G8P A;  3TH1 A;  1KSF X;  1L1T A;  3GPP A;  4FCW A;  1NNJ A;  3U6E A;  1YKO B;  1YKP B;  4OVZ B;  5KPZ A;  3U61 B;  5TD3 A;  3KSX A;  2C9C A;  1EE8 A;  3KDS E;  4MB7 A;  3VK7 A;  1R6B X;  3MFL M;  4B7F A;  2NQ8 C;  4QHT A;  3KOY E;  1DLM A;  3PCK M;  3HKP A;  2I7P A;  3U6P A;  1K3X A;  4HLQ A;  1XNR M;  1TH2 A;  4LRT A;  5IWA M;  3LXV A;  2CV1 A;  4GC5 A;  3RFW A;  5KO3 A;  3QWL A;  3LQR A;  1E32 A;  2XZU A;  4M9X A;  3PCC M;  4NXN M;  3M0E A;  4CGY B;  2F5N A;  3SYK A;  3GLH A;  5EXP A;  2YNM D;  3TWK A;  5EXS A;  3NBI A;  3VFD A;  4AW4 A;  1JR3 A;  4B3M M;  3PCG A;  4WHO A;  4LF6 M;  3UK6 A;  1EOB A;  3FTF A;  4GKK M;  2VQE M;  3KVW A;  2M5Z A;  5FTM A;  5KQD A;  2PCD A;  4IBG A;  1I4W A;  3O32 A;  4NRW A;  3M6A A;  3U5Z A;  1K3W A;  2F4V M;  2I7N A;  5DYG A;  3FTE A;  1QYR A;  2C99 A;  2DWM A;  1NHW C;  3KP1 E;  3PXG A;  2C98 A;  2L7H A;  2Y0T A;  3R8F A;  3JAM S;  3LMX M;  5BPV A;  4TUW A;  1X37 A;  1UM8 A;  4DV2 M;  4MGH A;  4JI6 M;  3LMX A;  3L28 A;  2L6O A;  4DV3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...