4P17A

Crystal structure of the chlamydomonas flagellar rabgap tbc domain.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
301
structure length
288
Chain Sequence
VHDLYGFPIQEDERRSCDVNAEREVPLWQHYIEKDKLPSNETKLKEMIRKGVPPTLRNWVWMETSGANKKKAGHAANYYSIMVKAGEESQYKKDIETDSTHTFPDHPWLSSPDGRAALCRVLQAYSVHNERVGYVRAMNTIVGLMLVALNRNEEAAFWLLAALVEDILYPGTYSRMRALDELIGTKLPRLQQHFQAIDFDISMLATDWYLCLFSVSLPSETVMRTWDSLFYEGPKILFRVALAMLKIYEDNMLRVGDAGELLMRMRNAAATMHQRDVLMATAFDHIGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Chlamydomonas reinhardtii flagellar RabGAP TBC-domain at 1.8 angstrom resolution.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Unknown function
molecule keywords RabGAP/TBC protein
total genus 110
structure length 288
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4p17A02
3QYBA 4NC6A 4P17A 3HZJA 2QQ8A 3QYEA
chains in the Genus database with same CATH superfamily
1QAQA 1TH4A 2ZANA 2VQFM 3J27B 3C58A 3U6LA 2XZUA 3DA1A 4LFBM 3WHKA 3VDUA 3SYLA 3KP0E 1IFYA 2JZ0A 1TTEA 1JR3D 3KS8A 5KO3A 4EIWA 4GH9A 1NNJA 4OW0A 1HT1E 3QYBA 1JR3E 4P17A 3W68A 5L8RF 2CHVA 1OIZA 3FTCA 4LF5M 5DYIA 4WURA 2CWBA 1Y8GA 4IJEA 1I4WA 1ZV1A 4LRSA 1FJGM 4NSOB 4FVMA 2UXDM 3RFWA 5IWAM 1R2ZA 3FTEA 3SBJA 4I8OA 2H5XA 4FWGA 4AZFA 2G8LA 4D80A 1E32A 3W0FA 5BPVA 3SMSA 3M0EA 3NWLA 4G3OA 1TR8A 3CTWB 2YQZA 2LBCA 5ITTA 2G3QA 3GRUA 1PGYA 4NSRA 4P16A 4LJ5A 4CISA 2YR0A 3QWLA 4RNAA 4K0KM 3I4YA 4LY6A 2D7GA 1QZMA 2CE7A 1PJSA 1OQYA 2MR9A 4MGYE 4PDGA 3RGPA 3GLHB 4NOOB 1NV9A 3IECA 3VFDA 1IBLM 2Z7JA 1XMQM 4CJ6A 2QBYB 4RKUF 4JN6A 2XFTA 1MN3A 4D81A 2KXEA 4DR6M 3U6CA 1N78A 2KRKA 4G4RA 3FYCA 3J7AS 1ZAEA 4DR1M 5EXSA 4HL4A 4LF8M 2KNZA 1HQYE 3E9SA 4GKJM 1L8QA 2ERCA 2JA2A 2JNHA 3GLFA 1C1KA 2FOIC 2J7OA 3QAUA 1HNXM 4Y28F 2XLJA 2VF7A 3HJ8A 1IXZA 4KT0F 1XC8A 1XNQM 2DZNB 4DV1M 4GHLA 1WXQA 4F1IA 4DV3M 2JY8A 2CV0A 2ZBKB 2WZJA 3LQRA 3T6PA 1R5LA 5C1BA 3SHFA 1T43A 4YY3M 4IBKA 3FYDA 2FFJA 1YLAA 4L78A 1ZMWA 1SXJC 2LH0A 3GQ4A 3A46A 3DFZA 3K9OA 1G41A 1QUTA 1YSYA 1L1ZA 1T6OA 3W67A 5GKNA 3T1YM 4AKGA 1E9SA 2OQ4A 1MJGM 1EE8A 2DI0A 4ZPXA 2MROB 4LRTA 5F3WA 1DO2A 4JI3M 5JI2E 2DKLA 1AUAA 1XB2B 2WSEF 3E4RA 4QNRA 1DGBA 5E6JA 5FLXS 1N75A 5EJCA 3GPYA 2JP7A 4B3SM 1WHCA 4PD2A 3HWSA 2G5GX 3I01M 4LG2A 3MK6A 3AV0A 5ITRA 1OAIA 3SAWA 1J7KA 2JWSA 1HNZM 5EP2A 1QAOA 4A3VB 1TF0B 1Z59A 2LNHC 4KO8A 2F4VM 4QHTA 2HCBA 3GRYA 2O5RA 1G59A 2BNKA 2BWEA 4ANRA 4FWHA 5EXPA 3JR4A 3DOAA 1DGGA 4QOSA 1RU3A 4I4LA 1GJTA 3H4JA 2F5NA 2DWNA 2NQ8C 3ZQJA 2CV2A 4LJ6A 3KFUG 3HHYA 1Q39A 2JY7A 2QHOB 2VQEM 4GRIA 5LMUM 3U60A 1I94M 2JUJA 1SG9A 1QAMA 5DYGA 3AL0C 1IXSA 2JXNA 1R6BX 3ILKA 3VDPA 5C18A 5FTNA 1EIJA 2D7EA 1K3XA 3CF2A 3KOWE 4LGMA 1GL6A 1VQ1A 3HU2A 4IIWA 2DAEA 1W5SA 4IBIA 4L16A 4JI5M 4JI0M 5ITUA 3U6DA 4LJ4A 4DUYM 4REZA 4W5WA 1N33M 1IQPA 1OKSA 3AKZA 1VEJA 2B3TA 1GVNA 2CFOA 3UJNA 2GQFA 3GQ5A 2VIIA 4GEWA 2Y21A 3UGJA 4LF4M 4RF0A 1G3IA 2UUBM 2R62A 1V92A 2YFQA 4LJ9A 3QYEA 4LZZA 3GQ3A 2L6OA 1IM2A 3U5ZA 2Y0TA 2MJ5B 2ZTCA 1OIPA 1IN8A 2K6BA 3GPXA 2RRUA 3H4MA 3GP1A 2KZSA 2XFSA 4DV6M 2OOAA 2UXBM 4L15A 4G4OA 4JI1M 3K8ZA 2L7IA 1CUKA 2DAMA 3V76A 3SHGB 1N34M 2JY5A 3KW6A 2M60A 3U6QA 4IBFA 4RF1A 3R8FA 3J7BA 3GLGA 5DFLA 3F92A 3JAMS 1JR3A 4IBDA 2A5YB 3L25A 4NRWA 1L2BA 2F5SA 3GRRA 2QENA 3LMMA 3GPUA 2HAKA 4F2LA 1VDLA 1J09A 3I51A 3L27A 3IG8A 3FUVA 4MGZE 3PNYA 3B89A 1GABA 5E26A 1SXJB 2JZ1A 2KA6B 2R6FA 3AOGA 1OFIA 3W0LB 2CV1A 4LF9M 1PM5A 2HHHM 4IBJA 1ZQ9A 2C96A 3B74A 4CGYB 2XF3A 1NSFA 2VF8A 2J7NA 3K92A 2I7PA 3GO8A 1Z5CA 4M9XA 2EJSA 4DR4M 3FUTA 4FD2A 1L2DA 3AFHA 3EIEA 2OO9A 1DGHA 1IY1A 3L2AA 4UN2B 5JI3E 5KPZA 2AHMA 4LF6M 1HQCA 1NO1A 5FTKA 2DWMA 2FH0A 5LMNM 2Z4SA 1D0MA 1E94E 3HY5A 3THGA 1IBKM 4II7A 3SMPA 4L8RC 1Z5AA 1EFUB 1UM8A 1WIVA 1XXHA 2R46A 4Z8XA 4LFCM 2O25A 3EIHA 2DZLA 2ZAOA 5EP3A 3U6EA 4JI8M 3KS4A 1NY6A 1TGUA 2J5YA 2DAIA 1IN5A 4LFAM 3TQSA 2XEPA 3PNVA 3U60B 2L7HA 3KSJA 3BBZA 4CHTB 5KQDA 3TWMA 3T1HM 2EKFA 1A5TA 3FUWA 2LVNC 2KEBA 3SATA 2RKOA 4I5SA 4BLCA 2L2DA 1N77A 2HWJA 2K9DA 2QZ4A 2LHGA 4DV7M 3UMMA 2I7NA 3VK7A 1N32M 2C98A 4CIZA 3JR5A 1NHWC 2YNMD 1PJQA 1NV8A 4B3TM 5FTLA 4R71A 3IHPA 1QUSA 3B9PA 1J5EM 4DUZM 4WW0A 3J2PB 2O01F 2R44A 3C9PA 3L29A 2DENA 3DZDA 4S12A 1SXJE 1IY0A 4AG5A 2V6ZM 3LCUA 3GPPA 3GLIA 5IREB 3BOSA 2K47A 4DV2M 4NC6A 2RGHA 4KODA 2QSFX 4X64M 1Q3CA 4GHAA 4IBEA 2MGWA 3KOXE 4DR7M 2GNOA 4JYAM 2KW0A 3HX3A 1WGNA 3KSXA 4OVZB 1QZEA 4MGHA 3UK6A 3KVWA 4QOZC 1IN7A 4R7GA 3RGSA 1E9RA 1ORYB 3B7ZA 2F5QA 1V34A 2ZTDA 4IJFA 3E21A 4FCTA 2DWLA 1HJPA 1SXJD 4YHHM 1IBMM 3BXWA 1AIPC 4DR2M 4B7GA 4DV0M 3FD9A 2OOBA 2X8AA 3PVSA 1IN4A 4FCVA 1XXHE 2XGNA 3HKPA 3GLIB 4JV5M 1G4AE 2DZOB 3A42A 3U6PA 4HEOA 2E5LM 3LVVA 2L09A 2Z4RA 1C7YA 1KSFX 3SARA 4OU7A 1MU5A 3HHXA 3CF0A 3B7NA 3AOEC 4OX9M 4MB7A 5EXXA 4DR5M 2P5TA 2Q2EB 3FUXA 3KP1E 2CEAA 5A2QS 2ZM6M 3T38A 4M0WA 5BR8M 1FNNA 2LHCA 2L4EA 4NRVA 1OJLA 1LTMA 4QHSA 1R4GA 2R45A 3U6OA 3VLFB 3C3DA 3FTDA 1KFVA 1QYRA 3IG5A 4LZJA 3TE6A 1TDHA 2XSZD 1WJ7A 4JXJA 3U6SA 4LF7M 4GKKM 3I04M 4FWDA 4IBCA 2QQ8A 2V1CA 4M9SA 4X66M 2C5RA 1XNRM 2MH8A 1VDDA 2Y0QA 3A98B 2LVPC 1GL7A 1L2CA 1W5TA 2CHQA 4JI2M 1IXSB 1QVRA 3FKEA 3HU3A 3FUUA 2DAGA 2C9CA 4GITA 3MMPA 5ITXA 3TL4X 5KPTA 1GLNA 4JI4M 4R3DA 1PJTA 1JB0F 1QDTA 1QANA 5KPRA 1YUBA 5IT9S 2LXEA 2Z3XA 1QDRA 3FRHA 4NXMM 4KHPM 2LVQD 1DGHB 1Z6TA 3I4VA 1VEGA 1IXRC 1KYIA 1OTRA 3AOEA 4FW9A 3SAUA 1HNWM 2QBYA 4ITQA 1IY2A 2BJWA 2VDBB 1Q3BA 5FTJA 3WHLA 3GLGE 3B7QA 3L28A 4XGIA 4D82A 3HHZA 3MHVC 3HZJA 1HT2E 1R2YA 4LGYA 1YE9A 1NJFA 4JI6M 3VKHA 4PT5A 4MGIE 1F4IA 3GLIE 1XXHB 1SXJA 1VEKA 2KNVA 1D0KA 1GKIA 1WGLA 2WSFF 3KXEC 5EQTA 5ITYA 2X49A 2LWXA 4BB9A 2EKKA 3AJIB 2QPAA 4AW4A 1PRBA 2DWZB 2DXIA 1PJIA 4XBOA 3E46A 3HU1A 2OPFA 3CGWA 2W82A 1H6UA 1TH2A 1Q02A 8CATA 3FTFA 1V33A 3GLGB 4FCWA 1Z5BA 3GRVA 4AKHA 3GLHE 3T15A 1BVSA 2KDLA 3M7GA 3J80S 2CHGA 3M6AA 2BWBA 3LVWA 2R65A 3TWKA 2Y20A 4DBGB 4NL4H 1OAOC 1DV0A 1DO0A 2HKJA 3SYKA 2XH9A 4IBGA 2R18A 3PXGA 7CATA 2UU9M 3HGIA 1DGFA 4QNMA 3A45A 3K9PA 3LW5F 3UZUA 2WSCF 3U5ZB 2EA0A 2N35A 3HJSA 2R4EA 4NXNM 3C3EA 1D2NA 3LCVB 1MX0A 4GC5A 1ZMVA 4AQYM 1VG5A 3HJQA 3VK8A 4Q7JA 3D8LA 3U61B 2JY6B 5EXTA 5H37D 2EO2A 2RGOA 2X4AA 4B08A 5EP4A 3GLFB 4B3RM 2QCUA 2Z8YM 4I81A 2D7HA 3CF6E 3J81S 2DHYA 1S3SA 2C9OA 2LVOC 1X37A 2XZFA 4JI7M 2UXCM 1NHGC 3ZC7B 4X62M 2R4JA 2QP9X 4GIPA 3KOYE 2EUCA 1N36M 2QNJA 3K2LA 2FE8A 4PCZA 1JQJC 5KQ8A 2KNAA 2LVAA 4LJ7A 4B7HA 1OFHA 3FE3A 1GJSA 1NJGA 3R9XB 3GLHA 2HL7A 1TDZA 3SAVA 1R7RA 2F5PA 3SFZA 4IBBA 4L6V6 4LJAA 1XHBA 1IN6A 2C99A 2DNAA 2DAKA 3TPZA 3L26A 2L4FA 2DVWB 4HLQA 4XK8F 2KZUA 1QQWA 3NBIA 2K0BX 2KHHA 4KLNA 2KRUA 5IZ7D 4B3MM 2ZAMA 4B7FA 4X65M 2H1RA 1GO5A 1L1TA 5ITQA 3Q8GA 3PFIA 1K82A 1XWIA 1XMOM 5FTMA 4MGKE 3U61A 1PJJA 1G71A 2F5OA 4MM3B 2FS1A 5DNYA 3U6MA 2CRUA 1NVMA 1WR1B 3Q8XA 2APLA 4PDIA 1NY5A 4AKIA 1P3QQ 2CUZA 3KOZE 5EP1A 2UUCM 2FNAA 3GLFE 4M9ZA 2R0IA 3SASA 4AI6A 4L4UA 1LV7A 4OVZA 1D0LA 3KDSE 3SC3A 4TUWA 4G4QA 3NBXX 4LJ8A 4DV5M 3LQQA 3HHWA 4LCBA 4BBAA 3MJ5A 2DHRA 4GC9A 1HR0M 4GMQA 3VKGA 2XSZA 2UUAM 4Z6YA 2M5ZA 2V1UA 2CP8A 3K1JA 4M0DA 1T3TA 5FSWA 1ZMUA 4MH0E 3ZH9B 1K3WA 3FRIA 3TWLA 1UFZA 3ZCBB 3D8BA 1NNUC 4G6ZA 2LTUA 4AG6A 3OTOM 1TH3A 3RE8A 5ITXE 4DR3M 4WP2A 2BJVA 4DV4M 1G8PA 4G4NA
chains in the Genus database with same CATH topology
3QYBA 4NC6A 4P17A 3HZJA 2QQ8A 3QYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYB A;  4NC6 A;  4P17 A;  3HZJ A;  2QQ8 A;  3QYE A; 
#chains in the Genus database with same CATH topology
 1QAQ A;  1TH4 A;  2ZAN A;  2VQF M;  3J27 B;  3C58 A;  3U6L A;  2XZU A;  3DA1 A;  4LFB M;  3WHK A;  3VDU A;  3SYL A;  3KP0 E;  1IFY A;  2JZ0 A;  1TTE A;  1JR3 D;  3KS8 A;  5KO3 A;  4EIW A;  4GH9 A;  1NNJ A;  4OW0 A;  1HT1 E;  3QYB A;  1JR3 E;  4P17 A;  3W68 A;  5L8R F;  2CHV A;  1OIZ A;  3FTC A;  4LF5 M;  5DYI A;  4WUR A;  2CWB A;  1Y8G A;  4IJE A;  1I4W A;  1ZV1 A;  4LRS A;  1FJG M;  4NSO B;  4FVM A;  2UXD M;  3RFW A;  5IWA M;  1R2Z A;  3FTE A;  3SBJ A;  4I8O A;  2H5X A;  4FWG A;  4AZF A;  2G8L A;  4D80 A;  1E32 A;  3W0F A;  5BPV A;  3SMS A;  3M0E A;  3NWL A;  4G3O A;  1TR8 A;  3CTW B;  2YQZ A;  2LBC A;  5ITT A;  2G3Q A;  3GRU A;  1PGY A;  4NSR A;  4P16 A;  4LJ5 A;  4CIS A;  2YR0 A;  3QWL A;  4RNA A;  4K0K M;  3I4Y A;  4LY6 A;  2D7G A;  1QZM A;  2CE7 A;  1PJS A;  1OQY A;  2MR9 A;  4MGY E;  4PDG A;  3RGP A;  3GLH B;  4NOO B;  1NV9 A;  3IEC A;  3VFD A;  1IBL M;  2Z7J A;  1XMQ M;  4CJ6 A;  2QBY B;  4RKU F;  4JN6 A;  2XFT A;  1MN3 A;  4D81 A;  2KXE A;  4DR6 M;  3U6C A;  1N78 A;  2KRK A;  4G4R A;  3FYC A;  3J7A S;  1ZAE A;  4DR1 M;  5EXS A;  4HL4 A;  4LF8 M;  2KNZ A;  1HQY E;  3E9S A;  4GKJ M;  1L8Q A;  2ERC A;  2JA2 A;  2JNH A;  3GLF A;  1C1K A;  2FOI C;  2J7O A;  3QAU A;  1HNX M;  4Y28 F;  2XLJ A;  2VF7 A;  3HJ8 A;  1IXZ A;  4KT0 F;  1XC8 A;  1XNQ M;  2DZN B;  4DV1 M;  4GHL A;  1WXQ A;  4F1I A;  4DV3 M;  2JY8 A;  2CV0 A;  2ZBK B;  2WZJ A;  3LQR A;  3T6P A;  1R5L A;  5C1B A;  3SHF A;  1T43 A;  4YY3 M;  4IBK A;  3FYD A;  2FFJ A;  1YLA A;  4L78 A;  1ZMW A;  1SXJ C;  2LH0 A;  3GQ4 A;  3A46 A;  3DFZ A;  3K9O A;  1G41 A;  1QUT A;  1YSY A;  1L1Z A;  1T6O A;  3W67 A;  5GKN A;  3T1Y M;  4AKG A;  1E9S A;  2OQ4 A;  1MJG M;  1EE8 A;  2DI0 A;  4ZPX A;  2MRO B;  4LRT A;  5F3W A;  1DO2 A;  4JI3 M;  5JI2 E;  2DKL A;  1AUA A;  1XB2 B;  2WSE F;  3E4R A;  4QNR A;  1DGB A;  5E6J A;  5FLX S;  1N75 A;  5EJC A;  3GPY A;  2JP7 A;  4B3S M;  1WHC A;  4PD2 A;  3HWS A;  2G5G X;  3I01 M;  4LG2 A;  3MK6 A;  3AV0 A;  5ITR A;  1OAI A;  3SAW A;  1J7K A;  2JWS A;  1HNZ M;  5EP2 A;  1QAO A;  4A3V B;  1TF0 B;  1Z59 A;  2LNH C;  4KO8 A;  2F4V M;  4QHT A;  2HCB A;  3GRY A;  2O5R A;  1G59 A;  2BNK A;  2BWE A;  4ANR A;  4FWH A;  5EXP A;  3JR4 A;  3DOA A;  1DGG A;  4QOS A;  1RU3 A;  4I4L A;  1GJT A;  3H4J A;  2F5N A;  2DWN A;  2NQ8 C;  3ZQJ A;  2CV2 A;  4LJ6 A;  3KFU G;  3HHY A;  1Q39 A;  2JY7 A;  2QHO B;  2VQE M;  4GRI A;  5LMU M;  3U60 A;  1I94 M;  2JUJ A;  1SG9 A;  1QAM A;  5DYG A;  3AL0 C;  1IXS A;  2JXN A;  1R6B X;  3ILK A;  3VDP A;  5C18 A;  5FTN A;  1EIJ A;  2D7E A;  1K3X A;  3CF2 A;  3KOW E;  4LGM A;  1GL6 A;  1VQ1 A;  3HU2 A;  4IIW A;  2DAE A;  1W5S A;  4IBI A;  4L16 A;  4JI5 M;  4JI0 M;  5ITU A;  3U6D A;  4LJ4 A;  4DUY M;  4REZ A;  4W5W A;  1N33 M;  1IQP A;  1OKS A;  3AKZ A;  1VEJ A;  2B3T A;  1GVN A;  2CFO A;  3UJN A;  2GQF A;  3GQ5 A;  2VII A;  4GEW A;  2Y21 A;  3UGJ A;  4LF4 M;  4RF0 A;  1G3I A;  2UUB M;  2R62 A;  1V92 A;  2YFQ A;  4LJ9 A;  3QYE A;  4LZZ A;  3GQ3 A;  2L6O A;  1IM2 A;  3U5Z A;  2Y0T A;  2MJ5 B;  2ZTC A;  1OIP A;  1IN8 A;  2K6B A;  3GPX A;  2RRU A;  3H4M A;  3GP1 A;  2KZS A;  2XFS A;  4DV6 M;  2OOA A;  2UXB M;  4L15 A;  4G4O A;  4JI1 M;  3K8Z A;  2L7I A;  1CUK A;  2DAM A;  3V76 A;  3SHG B;  1N34 M;  2JY5 A;  3KW6 A;  2M60 A;  3U6Q A;  4IBF A;  4RF1 A;  3R8F A;  3J7B A;  3GLG A;  5DFL A;  3F92 A;  3JAM S;  1JR3 A;  4IBD A;  2A5Y B;  3L25 A;  4NRW A;  1L2B A;  2F5S A;  3GRR A;  2QEN A;  3LMM A;  3GPU A;  2HAK A;  4F2L A;  1VDL A;  1J09 A;  3I51 A;  3L27 A;  3IG8 A;  3FUV A;  4MGZ E;  3PNY A;  3B89 A;  1GAB A;  5E26 A;  1SXJ B;  2JZ1 A;  2KA6 B;  2R6F A;  3AOG A;  1OFI A;  3W0L B;  2CV1 A;  4LF9 M;  1PM5 A;  2HHH M;  4IBJ A;  1ZQ9 A;  2C96 A;  3B74 A;  4CGY B;  2XF3 A;  1NSF A;  2VF8 A;  2J7N A;  3K92 A;  2I7P A;  3GO8 A;  1Z5C A;  4M9X A;  2EJS A;  4DR4 M;  3FUT A;  4FD2 A;  1L2D A;  3AFH A;  3EIE A;  2OO9 A;  1DGH A;  1IY1 A;  3L2A A;  4UN2 B;  5JI3 E;  5KPZ A;  2AHM A;  4LF6 M;  1HQC A;  1NO1 A;  5FTK A;  2DWM A;  2FH0 A;  5LMN M;  2Z4S A;  1D0M A;  1E94 E;  3HY5 A;  3THG A;  1IBK M;  4II7 A;  3SMP A;  4L8R C;  1Z5A A;  1EFU B;  1UM8 A;  1WIV A;  1XXH A;  2R46 A;  4Z8X A;  4LFC M;  2O25 A;  3EIH A;  2DZL A;  2ZAO A;  5EP3 A;  3U6E A;  4JI8 M;  3KS4 A;  1NY6 A;  1TGU A;  2J5Y A;  2DAI A;  1IN5 A;  4LFA M;  3TQS A;  2XEP A;  3PNV A;  3U60 B;  2L7H A;  3KSJ A;  3BBZ A;  4CHT B;  5KQD A;  3TWM A;  3T1H M;  2EKF A;  1A5T A;  3FUW A;  2LVN C;  2KEB A;  3SAT A;  2RKO A;  4I5S A;  4BLC A;  2L2D A;  1N77 A;  2HWJ A;  2K9D A;  2QZ4 A;  2LHG A;  4DV7 M;  3UMM A;  2I7N A;  3VK7 A;  1N32 M;  2C98 A;  4CIZ A;  3JR5 A;  1NHW C;  2YNM D;  1PJQ A;  1NV8 A;  4B3T M;  5FTL A;  4R71 A;  3IHP A;  1QUS A;  3B9P A;  1J5E M;  4DUZ M;  4WW0 A;  3J2P B;  2O01 F;  2R44 A;  3C9P A;  3L29 A;  2DEN A;  3DZD A;  4S12 A;  1SXJ E;  1IY0 A;  4AG5 A;  2V6Z M;  3LCU A;  3GPP A;  3GLI A;  5IRE B;  3BOS A;  2K47 A;  4DV2 M;  4NC6 A;  2RGH A;  4KOD A;  2QSF X;  4X64 M;  1Q3C A;  4GHA A;  4IBE A;  2MGW A;  3KOX E;  4DR7 M;  2GNO A;  4JYA M;  2KW0 A;  3HX3 A;  1WGN A;  3KSX A;  4OVZ B;  1QZE A;  4MGH A;  3UK6 A;  3KVW A;  4QOZ C;  1IN7 A;  4R7G A;  3RGS A;  1E9R A;  1ORY B;  3B7Z A;  2F5Q A;  1V34 A;  2ZTD A;  4IJF A;  3E21 A;  4FCT A;  2DWL A;  1HJP A;  1SXJ D;  4YHH M;  1IBM M;  3BXW A;  1AIP C;  4DR2 M;  4B7G A;  4DV0 M;  3FD9 A;  2OOB A;  2X8A A;  3PVS A;  1IN4 A;  4FCV A;  1XXH E;  2XGN A;  3HKP A;  3GLI B;  4JV5 M;  1G4A E;  2DZO B;  3A42 A;  3U6P A;  4HEO A;  2E5L M;  3LVV A;  2L09 A;  2Z4R A;  1C7Y A;  1KSF X;  3SAR A;  4OU7 A;  1MU5 A;  3HHX A;  3CF0 A;  3B7N A;  3AOE C;  4OX9 M;  4MB7 A;  5EXX A;  4DR5 M;  2P5T A;  2Q2E B;  3FUX A;  3KP1 E;  2CEA A;  5A2Q S;  2ZM6 M;  3T38 A;  4M0W A;  5BR8 M;  1FNN A;  2LHC A;  2L4E A;  4NRV A;  1OJL A;  1LTM A;  4QHS A;  1R4G A;  2R45 A;  3U6O A;  3VLF B;  3C3D A;  3FTD A;  1KFV A;  1QYR A;  3IG5 A;  4LZJ A;  3TE6 A;  1TDH A;  2XSZ D;  1WJ7 A;  4JXJ A;  3U6S A;  4LF7 M;  4GKK M;  3I04 M;  4FWD A;  4IBC A;  2QQ8 A;  2V1C A;  4M9S A;  4X66 M;  2C5R A;  1XNR M;  2MH8 A;  1VDD A;  2Y0Q A;  3A98 B;  2LVP C;  1GL7 A;  1L2C A;  1W5T A;  2CHQ A;  4JI2 M;  1IXS B;  1QVR A;  3FKE A;  3HU3 A;  3FUU A;  2DAG A;  2C9C A;  4GIT A;  3MMP A;  5ITX A;  3TL4 X;  5KPT A;  1GLN A;  4JI4 M;  4R3D A;  1PJT A;  1JB0 F;  1QDT A;  1QAN A;  5KPR A;  1YUB A;  5IT9 S;  2LXE A;  2Z3X A;  1QDR A;  3FRH A;  4NXM M;  4KHP M;  2LVQ D;  1DGH B;  1Z6T A;  3I4V A;  1VEG A;  1IXR C;  1KYI A;  1OTR A;  3AOE A;  4FW9 A;  3SAU A;  1HNW M;  2QBY A;  4ITQ A;  1IY2 A;  2BJW A;  2VDB B;  1Q3B A;  5FTJ A;  3WHL A;  3GLG E;  3B7Q A;  3L28 A;  4XGI A;  4D82 A;  3HHZ A;  3MHV C;  3HZJ A;  1HT2 E;  1R2Y A;  4LGY A;  1YE9 A;  1NJF A;  4JI6 M;  3VKH A;  4PT5 A;  4MGI E;  1F4I A;  3GLI E;  1XXH B;  1SXJ A;  1VEK A;  2KNV A;  1D0K A;  1GKI A;  1WGL A;  2WSF F;  3KXE C;  5EQT A;  5ITY A;  2X49 A;  2LWX A;  4BB9 A;  2EKK A;  3AJI B;  2QPA A;  4AW4 A;  1PRB A;  2DWZ B;  2DXI A;  1PJI A;  4XBO A;  3E46 A;  3HU1 A;  2OPF A;  3CGW A;  2W82 A;  1H6U A;  1TH2 A;  1Q02 A;  8CAT A;  3FTF A;  1V33 A;  3GLG B;  4FCW A;  1Z5B A;  3GRV A;  4AKH A;  3GLH E;  3T15 A;  1BVS A;  2KDL A;  3M7G A;  3J80 S;  2CHG A;  3M6A A;  2BWB A;  3LVW A;  2R65 A;  3TWK A;  2Y20 A;  4DBG B;  4NL4 H;  1OAO C;  1DV0 A;  1DO0 A;  2HKJ A;  3SYK A;  2XH9 A;  4IBG A;  2R18 A;  3PXG A;  7CAT A;  2UU9 M;  3HGI A;  1DGF A;  4QNM A;  3A45 A;  3K9P A;  3LW5 F;  3UZU A;  2WSC F;  3U5Z B;  2EA0 A;  2N35 A;  3HJS A;  2R4E A;  4NXN M;  3C3E A;  1D2N A;  3LCV B;  1MX0 A;  4GC5 A;  1ZMV A;  4AQY M;  1VG5 A;  3HJQ A;  3VK8 A;  4Q7J A;  3D8L A;  3U61 B;  2JY6 B;  5EXT A;  5H37 D;  2EO2 A;  2RGO A;  2X4A A;  4B08 A;  5EP4 A;  3GLF B;  4B3R M;  2QCU A;  2Z8Y M;  4I81 A;  2D7H A;  3CF6 E;  3J81 S;  2DHY A;  1S3S A;  2C9O A;  2LVO C;  1X37 A;  2XZF A;  4JI7 M;  2UXC M;  1NHG C;  3ZC7 B;  4X62 M;  2R4J A;  2QP9 X;  4GIP A;  3KOY E;  2EUC A;  1N36 M;  2QNJ A;  3K2L A;  2FE8 A;  4PCZ A;  1JQJ C;  5KQ8 A;  2KNA A;  2LVA A;  4LJ7 A;  4B7H A;  1OFH A;  3FE3 A;  1GJS A;  1NJG A;  3R9X B;  3GLH A;  2HL7 A;  1TDZ A;  3SAV A;  1R7R A;  2F5P A;  3SFZ A;  4IBB A;  4L6V 6;  4LJA A;  1XHB A;  1IN6 A;  2C99 A;  2DNA A;  2DAK A;  3TPZ A;  3L26 A;  2L4F A;  2DVW B;  4HLQ A;  4XK8 F;  2KZU A;  1QQW A;  3NBI A;  2K0B X;  2KHH A;  4KLN A;  2KRU A;  5IZ7 D;  4B3M M;  2ZAM A;  4B7F A;  4X65 M;  2H1R A;  1GO5 A;  1L1T A;  5ITQ A;  3Q8G A;  3PFI A;  1K82 A;  1XWI A;  1XMO M;  5FTM A;  4MGK E;  3U61 A;  1PJJ A;  1G71 A;  2F5O A;  4MM3 B;  2FS1 A;  5DNY A;  3U6M A;  2CRU A;  1NVM A;  1WR1 B;  3Q8X A;  2APL A;  4PDI A;  1NY5 A;  4AKI A;  1P3Q Q;  2CUZ A;  3KOZ E;  5EP1 A;  2UUC M;  2FNA A;  3GLF E;  4M9Z A;  2R0I A;  3SAS A;  4AI6 A;  4L4U A;  1LV7 A;  4OVZ A;  1D0L A;  3KDS E;  3SC3 A;  4TUW A;  4G4Q A;  3NBX X;  4LJ8 A;  4DV5 M;  3LQQ A;  3HHW A;  4LCB A;  4BBA A;  3MJ5 A;  2DHR A;  4GC9 A;  1HR0 M;  4GMQ A;  3VKG A;  2XSZ A;  2UUA M;  4Z6Y A;  2M5Z A;  2V1U A;  2CP8 A;  3K1J A;  4M0D A;  1T3T A;  5FSW A;  1ZMU A;  4MH0 E;  3ZH9 B;  1K3W A;  3FRI A;  3TWL A;  1UFZ A;  3ZCB B;  3D8B A;  1NNU C;  4G6Z A;  2LTU A;  4AG6 A;  3OTO M;  1TH3 A;  3RE8 A;  5ITX E;  4DR3 M;  4WP2 A;  2BJV A;  4DV4 M;  1G8P A;  4G4N A; 
#chains in the Genus database with same CATH homology
 3QYB A;  4NC6 A;  4P17 A;  3HZJ A;  2QQ8 A;  3QYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...