4P17A

Crystal structure of the chlamydomonas flagellar rabgap tbc domain.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
301
structure length
288
Chain Sequence
VHDLYGFPIQEDERRSCDVNAEREVPLWQHYIEKDKLPSNETKLKEMIRKGVPPTLRNWVWMETSGANKKKAGHAANYYSIMVKAGEESQYKKDIETDSTHTFPDHPWLSSPDGRAALCRVLQAYSVHNERVGYVRAMNTIVGLMLVALNRNEEAAFWLLAALVEDILYPGTYSRMRALDELIGTKLPRLQQHFQAIDFDISMLATDWYLCLFSVSLPSETVMRTWDSLFYEGPKILFRVALAMLKIYEDNMLRVGDAGELLMRMRNAAATMHQRDVLMATAFDHIGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Chlamydomonas reinhardtii flagellar RabGAP TBC-domain at 1.8 angstrom resolution.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Unknown function
molecule keywords RabGAP/TBC protein
total genus 110
structure length 288
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4p17A02
3HZJA 4NC6A 2QQ8A 3QYBA 3QYEA 4P17A
chains in the Genus database with same CATH superfamily
3C3DA 5EQTA 1XB2B 1R7RA 3IG5A 2OOAA 1IY0A 1SXJA 4LF4M 3TL4X 3VKHA 3EIHA 1V92A 1YLAA 4MGYE 2APLA 5KQDA 4LF9M 4AKIA 4DV7M 3GLIA 2DVWB 3GLGA 3WHLA 4L6V6 1VG5A 5KPZA 3CF6E 1PJTA 3AOGA 1VEJA 3AJIB 3HX3A 3LCVB 4LRSA 1R6BX 3UGJA 1V34A 1NV8A 3KS4A 2DXIA 1HT2E 3GP1A 3PNVA 2V6ZM 1Z5AA 4M0DA 5IWAM 1RU3A 2I7NA 3ZC7B 2EA0A 1SXJB 1S3SA 3B7QA 4DV1M 1HJPA 3GRVA 1X37A 1GJTA 1PGYA 2CHQA 1K3XA 3HHZA 3PNYA 2C99A 3D8LA 1R4GA 1TDHA 3GO8A 4AKHA 4I5SA 5FSWA 2D7GA 1VDDA 3HJQA 2O5RA 3SYKA 1IXZA 4REZA 4LF5M 3K8ZA 3K2LA 5IZ7D 2CV2A 2F4VM 1G71A 4GIPA 3LW5F 1PM5A 2UUCM 3U61A 2DAIA 2J7NA 3FYDA 4I4LA 2G5GX 5EP2A 2LVQD 5FTNA 1QVRA 1Q3CA 1L1TA 3FE3A 5BPVA 3DFZA 2Q2EB 4FD2A 2XZUA 1JQJC 2DZNB 2KXEA 4RF0A 3GRUA 2A5YB 5DYGA 5JI3E 4S12A 2H5XA 4W5WA 1N33M 3IHPA 1L1ZA 2JWSA 5EXPA 3H4MA 2C9CA 1SXJD 3BBZA 3I51A 5FLXS 2DWLA 3T1HM 4WURA 3GQ5A 1OFHA 1NHWC 1D0KA 3TWKA 4JI1M 2UXDM 1G41A 1Z59A 4IBEA 1WXQA 5FTMA 1QAQA 2BJVA 4FWDA 4DV2M 4FVMA 2WSEF 4NSRA 4AW4A 2QHOB 1NJFA 1LV7A 4X65M 3A45A 1TH3A 2KDLA 4LGMA 4LGYA 1JB0F 3M7GA 3L29A 3W0FA 2X49A 2LVAA 2Y0TA 1CUKA 4JYAM 1OAOC 3GLGB 1OAIA 2D7EA 3J80S 1XXHA 1IN7A 3PXGA 2QBYA 5LMUM 4LFCM 1FJGM 3JAMS 1MX0A 2CEAA 2JY8A 3KSXA 3GPYA 3KSJA 1K82A 4WP2A 4LJ9A 3L2AA 3F92A 4IBDA 4XBOA 3LMMA 4DV4M 4JI6M 5KO3A 2FOIC 4TUWA 2DAEA 4QNRA 4NRVA 2F5PA 2P5TA 1ZAEA 4B7HA 1VDLA 4M9ZA 2Z4RA 2QCUA 2UXBM 1HR0M 4Q7JA 3GRYA 3KP0E 4PT5A 2N35A 2BJWA 4GC9A 1QANA 5JI2E 2EO2A 1WR1B 2KRKA 3GLFA 2ERCA 2C5RA 1D0LA 5E6JA 3SC3A 5GKNA 2R6FA 1V33A 2JXNA 1R2ZA 2JY6B 4WW0A 1TTEA 4IIWA 4YHHM 5FTLA 3SBJA 1IXRC 3T38A 2RKOA 1GKIA 4Z6YA 1PJSA 3H4JA 4KO8A 4AZFA 3I4YA 4LJ7A 1UFZA 3B9PA 3HU2A 1JR3E 5KPTA 4DR6M 3EIEA 1XHBA 1N36M 3FUTA 1XC8A 2WSFF 4LG2A 3LVVA 5ITRA 4L78A 4EIWA 3L26A 2XGNA 4DV0M 1I94M 2Y21A 5LMNM 1PJQA 1VEGA 4MGZE 4AKGA 2CV0A 4LCBA 2QQ8A 2CRUA 2GNOA 1IBMM 2DZOB 1F4IA 2CUZA 2LHCA 4II7A 2JY7A 2L4EA 2M60A 3KXEC 3U6EA 2UUBM 1ZMUA 3A46A 2UUAM 4DR1M 1QYRA 1YSYA 5DYIA 1IN8A 2FH0A 5ITXE 2XSZA 3JR5A 3E21A 1E32A 3ZCBB 3SFZA 3HHXA 5C1BA 1GL7A 1GVNA 2XLJA 4B3MM 1IN6A 5F3WA 2R45A 3RGSA 1JR3A 1QAOA 2H1RA 2HWJA 3MJ5A 4JI7M 4HLQA 4FWGA 1OFIA 3SHGB 3DZDA 4RKUF 1N34M 4JI5M 3U5ZA 4RNAA 1J09A 3HHYA 3I01M 1SG9A 2XZFA 3C58A 3NWLA 3L28A 4DR2M 4OU7A 5KQ8A 2F5SA 4GEWA 2VF8A 2UU9M 3NBXX 4PDGA 2DAGA 3GPXA 3IG8A 3VFDA 1VQ1A 1G8PA 3U6DA 2ZTDA 1G59A 4NXMM 4OVZA 1G4AE 3SAUA 3KOWE 1I4WA 2R44A 2LTUA 4X64M 4OX9M 4G3OA 3M6AA 3HY5A 4MM3B 2MGWA 1SXJC 1N77A 1H6UA 1OIPA 2EJSA 2LVPC 1C7YA 2CHGA 4LY6A 1A5TA 1DGGA 3FTEA 1AIPC 1EIJA 3AFHA 1NNJA 5EXXA 3GLIE 4QHTA 3SYLA 1HQYE 2Z4SA 3GLIB 2AHMA 1XXHE 1NV9A 3TQSA 1DGHB 4JI0M 2DI0A 1SXJE 2L6OA 4PCZA 3CTWB 4AI6A 3D8BA 3PVSA 4DUZM 5EP4A 5ITXA 3FD9A 2DAKA 3TWMA 4B3TM 4AG6A 3CF0A 1WIVA 3E4RA 2HCBA 2BWBA 3U61B 4JI8M 1IY2A 2I7PA 2ZAMA 4FCTA 2O01F 4LJ8A 4B3RM 3GRRA 1UM8A 3FUVA 4OW0A 3GLFE 3GPPA 4K0KM 3HU3A 4F1IA 1NNUC 2HKJA 2M5ZA 1IBLM 2BWEA 3KS8A 1E9RA 1DGHA 2JUJA 4JN6A 4F2LA 1IQPA 4JI2M 4MH0E 2E5LM 3QYEA 4ZPXA 2DZLA 1XWIA 2R18A 4LJ6A 2LBCA 3SAVA 2YFQA 5EJCA 3R8FA 3VKGA 4L4UA 2HL7A 4LFBM 3T15A 4MGHA 4ITQA 4QOZC 3U6MA 1R5LA 2FNAA 4GITA 2LH0A 3LQQA 3FUXA 4R3DA 2OOBA 4P16A 1TH2A 1IXSB 4AG5A 4BLCA 4GKJM 4G4OA 2O25A 4OVZB 1QQWA 2XEPA 4MGKE 5EXTA 3RE8A 4CJ6A 3W0LB 1L8QA 2X4AA 1NSFA 4IJFA 4NOOB 5EP1A 3TWLA 3J2PB 1NHGC 3KOZE 4FCWA 2LWXA 3HZJA 3T1YM 3NBIA 2K6BA 1WHCA 2R62A 2EUCA 2XFSA 2KEBA 3BOSA 2MR9A 2ZTCA 1DO2A 2QNJA 4I8OA 1NY6A 8CATA 3TPZA 3J7BA 3GQ3A 4CHTB 1GL6A 4JI4M 1OIZA 2DWNA 2MROB 3AV0A 4L16A 2V1UA 4B7GA 5EXSA 1QDTA 1DGBA 2R4EA 3E9SA 3GLGE 7CATA 3W67A 3U60B 1TR8A 2RGOA 2DHYA 4IJEA 2JZ0A 5IREB 3V76A 4LF7M 4L15A 4QOSA 1C1KA 3C3EA 2L7HA 1ZQ9A 3U6QA 3VDPA 3RGPA 4LF8M 3KOXE 4YY3M 1GO5A 1K3WA 4Z8XA 3GLHE 3SMSA 2UXCM 3U6CA 3QYBA 4R7GA 1PRBA 2XSZD 1Q02A 3FTFA 3GLHB 3U6OA 3SARA 2DWZB 3J7AS 4R71A 1NJGA 1BVSA 4IBKA 5FTKA 1EFUB 3BXWA 1L2DA 2KNVA 1WGLA 1IXSA 1Z6TA 3ZQJA 5L8RF 1ZMWA 5ITQA 2F5OA 3R9XB 4GHLA 2QENA 4NC6A 2F5NA 4LJ4A 3HJ8A 1XXHB 2QBYB 3FUWA 3W68A 2CHVA 3SHFA 1HNZM 1KSFX 4HL4A 4NRWA 4FWHA 5E26A 3VLFB 3WHKA 1G3IA 3FUUA 4IBJA 2ZM6M 3KFUG 4DR7M 1LTMA 1P3QQ 4GKKM 3SASA 2KZUA 2DNAA 2MH8A 2YQZA 2R0IA 3B89A 2Y0QA 4NSOB 1TDZA 4B7FA 2LVNC 2K47A 2J5YA 2QSFX 2G8LA 4PDIA 4IBIA 4LFAM 4KLNA 2JY5A 2MJ5B 3K1JA 2LHGA 3JR4A 1QUSA 4I81A 2LVOC 5ITYA 1MJGM 3VK7A 5H37D 2Z3XA 3AOEA 5IT9S 2EKKA 3FYCA 3GLFB 4KT0F 4XK8F 2DHRA 4JI3M 1W5SA 2L7IA 4RF1A 1E9SA 1NVMA 1QDRA 2VQFM 1XNRM 2V1CA 2VQEM 1Y8GA 1EE8A 1OTRA 1XMQM 3DA1A 2KRUA 2R65A 2F5QA 2KW0A 3Q8XA 4LZZA 4JV5M 4DR5M 4LF6M 2VF7A 3U60A 1ZV1A 1E94E 2L2DA 3HWSA 3OTOM 3I4VA 2CV1A 3MHVC 4LRTA 4D82A 2RRUA 4X62M 3HJSA 4PD2A 1DGFA 2FE8A 2HHHM 1IFYA 4G6ZA 4D80A 3KP1E 1OJLA 3HGIA 5EP3A 1KFVA 4IBGA 3FKEA 1NO1A 2KZSA 2FFJA 3GLHA 4DV3M 2XFTA 3ZH9B 1OKSA 2LXEA 2WZJA 3A98B 3AOEC 4LZJA 1J7KA 1Z5CA 2OO9A 2WSCF 4MGIE 1WJ7A 3FTCA 3HU1A 4D81A 3SMPA 2KA6B 3B7ZA 5C18A 1QZEA 2OQ4A 2W82A 2C96A 2R46A 3B7NA 2XF3A 1GJSA 2NQ8C 4LJ5A 4Y28F 4BBAA 2KNZA 4KHPM 1JR3D 3TE6A 4GRIA 2CP8A 4DBGB 3L27A 3FRHA 4IBFA 3CF2A 5FTJA 1HT1E 3B74A 1YE9A 2ZANA 4DUYM 2LNHC 3AL0C 2GQFA 3RFWA 4G4RA 2DAMA 1N32M 3K9OA 4LJAA 4BB9A 2DWMA 4B3SM 1IBKM 2G3QA 5KPRA 2B3TA 2JZ1A 3L25A 1HNXM 2C98A 1KYIA 4FCVA 2EKFA 1D2NA 5DNYA 2YR0A 3FTDA 3HKPA 3VK8A 3UK6A 2DENA 2K0BX 4A3VB 3AKZA 4GH9A 2X8AA 3GQ4A 3IECA 3E46A 1HQCA 3SATA 2KNAA 3UMMA 1HNWM 3I04M 3FRIA 2VIIA 5ITTA 1W5TA 2YNMD 3A42A 2J7OA 2L09A 2Z7JA 3MMPA 3DOAA 4DR4M 3PFIA 1T6OA 1IY1A 2CWBA 2ZAOA 2L4FA 4L8RC 2DKLA 1Z5BA 3C9PA 3THGA 5DFLA 3KW6A 4M0WA 4P17A 1J5EM 1FNNA 1Q3BA 3M0EA 4QHSA 2RGHA 4MB7A 2HAKA 1MU5A 3K9PA 1DV0A 1GABA 2K9DA 4DV6M 3T6PA 1IN5A 1IN4A 3U5ZB 3U6LA 3UJNA 1QAMA 4AQYM 2VDBB 4NXNM 1L2BA 1N78A 3LVWA 2D7HA 4CGYB 2CE7A 1MN3A 1YUBA 2JNHA 3J81S 2JA2A 1ORYB 3Q8GA 4CIZA 4GHAA 1QUTA 1WGNA 3J27B 4X66M 4KODA 4UN2B 3KVWA 1OQYA 4M9XA 3UZUA 2BNKA 2Y20A 4NL4H 1T3TA 1T43A 4JXJA 1DO0A 1QZMA 4B08A 3U6PA 1Q39A 1TH4A 4DV5M 4HEOA 4GMQA 5A2QS 3ILKA 2QP9X 2FS1A 3LQRA 3CGWA 2CFOA 4FW9A 2QPAA 4M9SA 4G4NA 4CISA 4IBCA 3QAUA 1TF0B 4GC5A 4QNMA 3U6SA 4DR3M 1PJIA 3KDSE 3SAWA 4G4QA 3KOYE 1NY5A 3K92A 3QWLA 3HHWA 3MK6A 4ANRA 2XH9A 3VDUA 5ITUA 1D0MA 2ZBKB 2OPFA 1TGUA 4XGIA 1N75A 1ZMVA 3GPUA 1AUAA 1XMOM 1PJJA 1XNQM 2KHHA 2Z8YM 3LCUA 2C9OA 1VEKA 4IBBA 2R4JA 1GLNA 2QZ4A 1R2YA 5BR8M 2JP7A 1L2CA 1IM2A
chains in the Genus database with same CATH topology
3HZJA 4NC6A 2QQ8A 3QYBA 3QYEA 4P17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HZJ A;  4NC6 A;  2QQ8 A;  3QYB A;  3QYE A;  4P17 A; 
#chains in the Genus database with same CATH topology
 3C3D A;  5EQT A;  1XB2 B;  1R7R A;  3IG5 A;  2OOA A;  1IY0 A;  1SXJ A;  4LF4 M;  3TL4 X;  3VKH A;  3EIH A;  1V92 A;  1YLA A;  4MGY E;  2APL A;  5KQD A;  4LF9 M;  4AKI A;  4DV7 M;  3GLI A;  2DVW B;  3GLG A;  3WHL A;  4L6V 6;  1VG5 A;  5KPZ A;  3CF6 E;  1PJT A;  3AOG A;  1VEJ A;  3AJI B;  3HX3 A;  3LCV B;  4LRS A;  1R6B X;  3UGJ A;  1V34 A;  1NV8 A;  3KS4 A;  2DXI A;  1HT2 E;  3GP1 A;  3PNV A;  2V6Z M;  1Z5A A;  4M0D A;  5IWA M;  1RU3 A;  2I7N A;  3ZC7 B;  2EA0 A;  1SXJ B;  1S3S A;  3B7Q A;  4DV1 M;  1HJP A;  3GRV A;  1X37 A;  1GJT A;  1PGY A;  2CHQ A;  1K3X A;  3HHZ A;  3PNY A;  2C99 A;  3D8L A;  1R4G A;  1TDH A;  3GO8 A;  4AKH A;  4I5S A;  5FSW A;  2D7G A;  1VDD A;  3HJQ A;  2O5R A;  3SYK A;  1IXZ A;  4REZ A;  4LF5 M;  3K8Z A;  3K2L A;  5IZ7 D;  2CV2 A;  2F4V M;  1G71 A;  4GIP A;  3LW5 F;  1PM5 A;  2UUC M;  3U61 A;  2DAI A;  2J7N A;  3FYD A;  4I4L A;  2G5G X;  5EP2 A;  2LVQ D;  5FTN A;  1QVR A;  1Q3C A;  1L1T A;  3FE3 A;  5BPV A;  3DFZ A;  2Q2E B;  4FD2 A;  2XZU A;  1JQJ C;  2DZN B;  2KXE A;  4RF0 A;  3GRU A;  2A5Y B;  5DYG A;  5JI3 E;  4S12 A;  2H5X A;  4W5W A;  1N33 M;  3IHP A;  1L1Z A;  2JWS A;  5EXP A;  3H4M A;  2C9C A;  1SXJ D;  3BBZ A;  3I51 A;  5FLX S;  2DWL A;  3T1H M;  4WUR A;  3GQ5 A;  1OFH A;  1NHW C;  1D0K A;  3TWK A;  4JI1 M;  2UXD M;  1G41 A;  1Z59 A;  4IBE A;  1WXQ A;  5FTM A;  1QAQ A;  2BJV A;  4FWD A;  4DV2 M;  4FVM A;  2WSE F;  4NSR A;  4AW4 A;  2QHO B;  1NJF A;  1LV7 A;  4X65 M;  3A45 A;  1TH3 A;  2KDL A;  4LGM A;  4LGY A;  1JB0 F;  3M7G A;  3L29 A;  3W0F A;  2X49 A;  2LVA A;  2Y0T A;  1CUK A;  4JYA M;  1OAO C;  3GLG B;  1OAI A;  2D7E A;  3J80 S;  1XXH A;  1IN7 A;  3PXG A;  2QBY A;  5LMU M;  4LFC M;  1FJG M;  3JAM S;  1MX0 A;  2CEA A;  2JY8 A;  3KSX A;  3GPY A;  3KSJ A;  1K82 A;  4WP2 A;  4LJ9 A;  3L2A A;  3F92 A;  4IBD A;  4XBO A;  3LMM A;  4DV4 M;  4JI6 M;  5KO3 A;  2FOI C;  4TUW A;  2DAE A;  4QNR A;  4NRV A;  2F5P A;  2P5T A;  1ZAE A;  4B7H A;  1VDL A;  4M9Z A;  2Z4R A;  2QCU A;  2UXB M;  1HR0 M;  4Q7J A;  3GRY A;  3KP0 E;  4PT5 A;  2N35 A;  2BJW A;  4GC9 A;  1QAN A;  5JI2 E;  2EO2 A;  1WR1 B;  2KRK A;  3GLF A;  2ERC A;  2C5R A;  1D0L A;  5E6J A;  3SC3 A;  5GKN A;  2R6F A;  1V33 A;  2JXN A;  1R2Z A;  2JY6 B;  4WW0 A;  1TTE A;  4IIW A;  4YHH M;  5FTL A;  3SBJ A;  1IXR C;  3T38 A;  2RKO A;  1GKI A;  4Z6Y A;  1PJS A;  3H4J A;  4KO8 A;  4AZF A;  3I4Y A;  4LJ7 A;  1UFZ A;  3B9P A;  3HU2 A;  1JR3 E;  5KPT A;  4DR6 M;  3EIE A;  1XHB A;  1N36 M;  3FUT A;  1XC8 A;  2WSF F;  4LG2 A;  3LVV A;  5ITR A;  4L78 A;  4EIW A;  3L26 A;  2XGN A;  4DV0 M;  1I94 M;  2Y21 A;  5LMN M;  1PJQ A;  1VEG A;  4MGZ E;  4AKG A;  2CV0 A;  4LCB A;  2QQ8 A;  2CRU A;  2GNO A;  1IBM M;  2DZO B;  1F4I A;  2CUZ A;  2LHC A;  4II7 A;  2JY7 A;  2L4E A;  2M60 A;  3KXE C;  3U6E A;  2UUB M;  1ZMU A;  3A46 A;  2UUA M;  4DR1 M;  1QYR A;  1YSY A;  5DYI A;  1IN8 A;  2FH0 A;  5ITX E;  2XSZ A;  3JR5 A;  3E21 A;  1E32 A;  3ZCB B;  3SFZ A;  3HHX A;  5C1B A;  1GL7 A;  1GVN A;  2XLJ A;  4B3M M;  1IN6 A;  5F3W A;  2R45 A;  3RGS A;  1JR3 A;  1QAO A;  2H1R A;  2HWJ A;  3MJ5 A;  4JI7 M;  4HLQ A;  4FWG A;  1OFI A;  3SHG B;  3DZD A;  4RKU F;  1N34 M;  4JI5 M;  3U5Z A;  4RNA A;  1J09 A;  3HHY A;  3I01 M;  1SG9 A;  2XZF A;  3C58 A;  3NWL A;  3L28 A;  4DR2 M;  4OU7 A;  5KQ8 A;  2F5S A;  4GEW A;  2VF8 A;  2UU9 M;  3NBX X;  4PDG A;  2DAG A;  3GPX A;  3IG8 A;  3VFD A;  1VQ1 A;  1G8P A;  3U6D A;  2ZTD A;  1G59 A;  4NXM M;  4OVZ A;  1G4A E;  3SAU A;  3KOW E;  1I4W A;  2R44 A;  2LTU A;  4X64 M;  4OX9 M;  4G3O A;  3M6A A;  3HY5 A;  4MM3 B;  2MGW A;  1SXJ C;  1N77 A;  1H6U A;  1OIP A;  2EJS A;  2LVP C;  1C7Y A;  2CHG A;  4LY6 A;  1A5T A;  1DGG A;  3FTE A;  1AIP C;  1EIJ A;  3AFH A;  1NNJ A;  5EXX A;  3GLI E;  4QHT A;  3SYL A;  1HQY E;  2Z4S A;  3GLI B;  2AHM A;  1XXH E;  1NV9 A;  3TQS A;  1DGH B;  4JI0 M;  2DI0 A;  1SXJ E;  2L6O A;  4PCZ A;  3CTW B;  4AI6 A;  3D8B A;  3PVS A;  4DUZ M;  5EP4 A;  5ITX A;  3FD9 A;  2DAK A;  3TWM A;  4B3T M;  4AG6 A;  3CF0 A;  1WIV A;  3E4R A;  2HCB A;  2BWB A;  3U61 B;  4JI8 M;  1IY2 A;  2I7P A;  2ZAM A;  4FCT A;  2O01 F;  4LJ8 A;  4B3R M;  3GRR A;  1UM8 A;  3FUV A;  4OW0 A;  3GLF E;  3GPP A;  4K0K M;  3HU3 A;  4F1I A;  1NNU C;  2HKJ A;  2M5Z A;  1IBL M;  2BWE A;  3KS8 A;  1E9R A;  1DGH A;  2JUJ A;  4JN6 A;  4F2L A;  1IQP A;  4JI2 M;  4MH0 E;  2E5L M;  3QYE A;  4ZPX A;  2DZL A;  1XWI A;  2R18 A;  4LJ6 A;  2LBC A;  3SAV A;  2YFQ A;  5EJC A;  3R8F A;  3VKG A;  4L4U A;  2HL7 A;  4LFB M;  3T15 A;  4MGH A;  4ITQ A;  4QOZ C;  3U6M A;  1R5L A;  2FNA A;  4GIT A;  2LH0 A;  3LQQ A;  3FUX A;  4R3D A;  2OOB A;  4P16 A;  1TH2 A;  1IXS B;  4AG5 A;  4BLC A;  4GKJ M;  4G4O A;  2O25 A;  4OVZ B;  1QQW A;  2XEP A;  4MGK E;  5EXT A;  3RE8 A;  4CJ6 A;  3W0L B;  1L8Q A;  2X4A A;  1NSF A;  4IJF A;  4NOO B;  5EP1 A;  3TWL A;  3J2P B;  1NHG C;  3KOZ E;  4FCW A;  2LWX A;  3HZJ A;  3T1Y M;  3NBI A;  2K6B A;  1WHC A;  2R62 A;  2EUC A;  2XFS A;  2KEB A;  3BOS A;  2MR9 A;  2ZTC A;  1DO2 A;  2QNJ A;  4I8O A;  1NY6 A;  8CAT A;  3TPZ A;  3J7B A;  3GQ3 A;  4CHT B;  1GL6 A;  4JI4 M;  1OIZ A;  2DWN A;  2MRO B;  3AV0 A;  4L16 A;  2V1U A;  4B7G A;  5EXS A;  1QDT A;  1DGB A;  2R4E A;  3E9S A;  3GLG E;  7CAT A;  3W67 A;  3U60 B;  1TR8 A;  2RGO A;  2DHY A;  4IJE A;  2JZ0 A;  5IRE B;  3V76 A;  4LF7 M;  4L15 A;  4QOS A;  1C1K A;  3C3E A;  2L7H A;  1ZQ9 A;  3U6Q A;  3VDP A;  3RGP A;  4LF8 M;  3KOX E;  4YY3 M;  1GO5 A;  1K3W A;  4Z8X A;  3GLH E;  3SMS A;  2UXC M;  3U6C A;  3QYB A;  4R7G A;  1PRB A;  2XSZ D;  1Q02 A;  3FTF A;  3GLH B;  3U6O A;  3SAR A;  2DWZ B;  3J7A S;  4R71 A;  1NJG A;  1BVS A;  4IBK A;  5FTK A;  1EFU B;  3BXW A;  1L2D A;  2KNV A;  1WGL A;  1IXS A;  1Z6T A;  3ZQJ A;  5L8R F;  1ZMW A;  5ITQ A;  2F5O A;  3R9X B;  4GHL A;  2QEN A;  4NC6 A;  2F5N A;  4LJ4 A;  3HJ8 A;  1XXH B;  2QBY B;  3FUW A;  3W68 A;  2CHV A;  3SHF A;  1HNZ M;  1KSF X;  4HL4 A;  4NRW A;  4FWH A;  5E26 A;  3VLF B;  3WHK A;  1G3I A;  3FUU A;  4IBJ A;  2ZM6 M;  3KFU G;  4DR7 M;  1LTM A;  1P3Q Q;  4GKK M;  3SAS A;  2KZU A;  2DNA A;  2MH8 A;  2YQZ A;  2R0I A;  3B89 A;  2Y0Q A;  4NSO B;  1TDZ A;  4B7F A;  2LVN C;  2K47 A;  2J5Y A;  2QSF X;  2G8L A;  4PDI A;  4IBI A;  4LFA M;  4KLN A;  2JY5 A;  2MJ5 B;  3K1J A;  2LHG A;  3JR4 A;  1QUS A;  4I81 A;  2LVO C;  5ITY A;  1MJG M;  3VK7 A;  5H37 D;  2Z3X A;  3AOE A;  5IT9 S;  2EKK A;  3FYC A;  3GLF B;  4KT0 F;  4XK8 F;  2DHR A;  4JI3 M;  1W5S A;  2L7I A;  4RF1 A;  1E9S A;  1NVM A;  1QDR A;  2VQF M;  1XNR M;  2V1C A;  2VQE M;  1Y8G A;  1EE8 A;  1OTR A;  1XMQ M;  3DA1 A;  2KRU A;  2R65 A;  2F5Q A;  2KW0 A;  3Q8X A;  4LZZ A;  4JV5 M;  4DR5 M;  4LF6 M;  2VF7 A;  3U60 A;  1ZV1 A;  1E94 E;  2L2D A;  3HWS A;  3OTO M;  3I4V A;  2CV1 A;  3MHV C;  4LRT A;  4D82 A;  2RRU A;  4X62 M;  3HJS A;  4PD2 A;  1DGF A;  2FE8 A;  2HHH M;  1IFY A;  4G6Z A;  4D80 A;  3KP1 E;  1OJL A;  3HGI A;  5EP3 A;  1KFV A;  4IBG A;  3FKE A;  1NO1 A;  2KZS A;  2FFJ A;  3GLH A;  4DV3 M;  2XFT A;  3ZH9 B;  1OKS A;  2LXE A;  2WZJ A;  3A98 B;  3AOE C;  4LZJ A;  1J7K A;  1Z5C A;  2OO9 A;  2WSC F;  4MGI E;  1WJ7 A;  3FTC A;  3HU1 A;  4D81 A;  3SMP A;  2KA6 B;  3B7Z A;  5C18 A;  1QZE A;  2OQ4 A;  2W82 A;  2C96 A;  2R46 A;  3B7N A;  2XF3 A;  1GJS A;  2NQ8 C;  4LJ5 A;  4Y28 F;  4BBA A;  2KNZ A;  4KHP M;  1JR3 D;  3TE6 A;  4GRI A;  2CP8 A;  4DBG B;  3L27 A;  3FRH A;  4IBF A;  3CF2 A;  5FTJ A;  1HT1 E;  3B74 A;  1YE9 A;  2ZAN A;  4DUY M;  2LNH C;  3AL0 C;  2GQF A;  3RFW A;  4G4R A;  2DAM A;  1N32 M;  3K9O A;  4LJA A;  4BB9 A;  2DWM A;  4B3S M;  1IBK M;  2G3Q A;  5KPR A;  2B3T A;  2JZ1 A;  3L25 A;  1HNX M;  2C98 A;  1KYI A;  4FCV A;  2EKF A;  1D2N A;  5DNY A;  2YR0 A;  3FTD A;  3HKP A;  3VK8 A;  3UK6 A;  2DEN A;  2K0B X;  4A3V B;  3AKZ A;  4GH9 A;  2X8A A;  3GQ4 A;  3IEC A;  3E46 A;  1HQC A;  3SAT A;  2KNA A;  3UMM A;  1HNW M;  3I04 M;  3FRI A;  2VII A;  5ITT A;  1W5T A;  2YNM D;  3A42 A;  2J7O A;  2L09 A;  2Z7J A;  3MMP A;  3DOA A;  4DR4 M;  3PFI A;  1T6O A;  1IY1 A;  2CWB A;  2ZAO A;  2L4F A;  4L8R C;  2DKL A;  1Z5B A;  3C9P A;  3THG A;  5DFL A;  3KW6 A;  4M0W A;  4P17 A;  1J5E M;  1FNN A;  1Q3B A;  3M0E A;  4QHS A;  2RGH A;  4MB7 A;  2HAK A;  1MU5 A;  3K9P A;  1DV0 A;  1GAB A;  2K9D A;  4DV6 M;  3T6P A;  1IN5 A;  1IN4 A;  3U5Z B;  3U6L A;  3UJN A;  1QAM A;  4AQY M;  2VDB B;  4NXN M;  1L2B A;  1N78 A;  3LVW A;  2D7H A;  4CGY B;  2CE7 A;  1MN3 A;  1YUB A;  2JNH A;  3J81 S;  2JA2 A;  1ORY B;  3Q8G A;  4CIZ A;  4GHA A;  1QUT A;  1WGN A;  3J27 B;  4X66 M;  4KOD A;  4UN2 B;  3KVW A;  1OQY A;  4M9X A;  3UZU A;  2BNK A;  2Y20 A;  4NL4 H;  1T3T A;  1T43 A;  4JXJ A;  1DO0 A;  1QZM A;  4B08 A;  3U6P A;  1Q39 A;  1TH4 A;  4DV5 M;  4HEO A;  4GMQ A;  5A2Q S;  3ILK A;  2QP9 X;  2FS1 A;  3LQR A;  3CGW A;  2CFO A;  4FW9 A;  2QPA A;  4M9S A;  4G4N A;  4CIS A;  4IBC A;  3QAU A;  1TF0 B;  4GC5 A;  4QNM A;  3U6S A;  4DR3 M;  1PJI A;  3KDS E;  3SAW A;  4G4Q A;  3KOY E;  1NY5 A;  3K92 A;  3QWL A;  3HHW A;  3MK6 A;  4ANR A;  2XH9 A;  3VDU A;  5ITU A;  1D0M A;  2ZBK B;  2OPF A;  1TGU A;  4XGI A;  1N75 A;  1ZMV A;  3GPU A;  1AUA A;  1XMO M;  1PJJ A;  1XNQ M;  2KHH A;  2Z8Y M;  3LCU A;  2C9O A;  1VEK A;  4IBB A;  2R4J A;  1GLN A;  2QZ4 A;  1R2Y A;  5BR8 M;  2JP7 A;  1L2C A;  1IM2 A; 
#chains in the Genus database with same CATH homology
 3HZJ A;  4NC6 A;  2QQ8 A;  3QYB A;  3QYE A;  4P17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...