4P17A

Crystal structure of the chlamydomonas flagellar rabgap tbc domain.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
301
structure length
288
Chain Sequence
VHDLYGFPIQEDERRSCDVNAEREVPLWQHYIEKDKLPSNETKLKEMIRKGVPPTLRNWVWMETSGANKKKAGHAANYYSIMVKAGEESQYKKDIETDSTHTFPDHPWLSSPDGRAALCRVLQAYSVHNERVGYVRAMNTIVGLMLVALNRNEEAAFWLLAALVEDILYPGTYSRMRALDELIGTKLPRLQQHFQAIDFDISMLATDWYLCLFSVSLPSETVMRTWDSLFYEGPKILFRVALAMLKIYEDNMLRVGDAGELLMRMRNAAATMHQRDVLMATAFDHIGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords RabGAP/TBC protein
publication title Crystal structure of a Chlamydomonas reinhardtii flagellar RabGAP TBC-domain at 1.8 angstrom resolution.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 110
structure length 288
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4p17A02
3QYBA 4P17A 2QQ8A 3HZJA 3QYEA 4NC6A
chains in the Genus database with same CATH superfamily
2DWMA 3ZH9B 5BPVA 1JQJC 1IXSA 4D80A 2VF7A 4GITA 3HZJA 2JA2A 1Z5CA 3T38A 5FTLA 1EE8A 1OJLA 3I4VA 3TQSA 4AKHA 5EP2A 2LBCA 3U6EA 3L28A 3U5ZA 2RGOA 4DV1M 2F4VM 1L1TA 1PRBA 1IN5A 2Y0QA 3B89A 1MN3A 4LJ8A 2R62A 5EXPA 1N75A 4AZFA 4D81A 4JI1M 1T6OA 4JI7M 2D7HA 1QDRA 3GPPA 1HNWM 3FD9A 1EIJA 5EXXA 4Y28F 1IM2A 3QYEA 3GRRA 5BR8M 2Z8YM 4G4NA 3U6MA 1XXHA 4K0KM 5ITRA 2ZM6M 1Z5BA 1JR3D 1G3IA 4DR2M 2OOAA 1FNNA 2Y21A 2WZJA 3C9PA 3LQQA 2WSCF 4X66M 2JY5A 2L09A 5FTNA 2DXIA 3KDSE 1SXJC 1QVRA 3KOYE 2KZSA 3VKGA 1GJTA 2ZAOA 2LTUA 1IY0A 2CHGA 4QNRA 2HKJA 3I4YA 4LGYA 5E6JA 4AG6A 3GLFA 3U5ZB 3FE3A 3QWLA 1Q39A 3GLHE 2FNAA 2BJVA 1PGYA 3BBZA 2DWZB 2KRKA 4M9XA 5EP1A 1YLAA 4NOOB 3SMSA 2LVPC 4JI4M 2YFQA 1XXHB 3B7ZA 5C18A 1NVMA 4MGIE 1G8PA 4I4LA 3U6CA 4GKJM 1MX0A 1QUTA 3RFWA 1FJGM 1X37A 1GLNA 2FH0A 1IQPA 3KOWE 4FCVA 2K0BX 2Y20A 3A42A 5ITXA 1CUKA 3HU2A 3VDUA 3ZC7B 2VQFM 3LMMA 2FOIC 3GPUA 3FUWA 2E5LM 3SATA 3C58A 3OTOM 4PD2A 3GLFB 1G4AE 1ZMUA 2CFOA 2KW0A 4Q7JA 3VDPA 4NL4H 5H37D 3HKPA 3SASA 4MGHA 5KQ8A 2Z3XA 2NQ8C 1F4IA 1HJPA 4AQYM 4XBOA 4L8RC 4LF5M 2DAIA 4DR6M 1VEGA 2O01F 2UXDM 3SC3A 3RE8A 2LH0A 2R4EA 5DNYA 4LFBM 2LVOC 3J7BA 2W82A 3KS4A 4QNMA 3UK6A 4DV4M 3U61A 4HEOA 2O5RA 1E94E 1OKSA 1VEKA 3T1HM 4B3MM 1UFZA 4FCTA 2HAKA 4B7HA 4CJ6A 4DV2M 5ITQA 4S12A 3NBXX 2CP8A 4R3DA 2R65A 4B7GA 4LF4M 1T3TA 1QYRA 4NSOB 4LF9M 3T6PA 1W5SA 1HR0M 1DGBA 3B74A 3L2AA 4HLQA 4OU7A 1IBKM 2UXCM 3SHFA 4LGMA 3WHLA 3SMPA 1ZAEA 2XF3A 3AFHA 3PXGA 2OQ4A 1DO2A 2XSZD 3Q8GA 3KXEC 2C9OA 3K1JA 2ZBKB 5KPTA 3B7QA 1UM8A 2UXBM 3J27B 3THGA 2CRUA 1I94M 2KXEA 4GEWA 3C3EA 2J5YA 2MR9A 4QHSA 3DFZA 4B3RM 2I7PA 2LXEA 4MB7A 1SXJE 2KA6B 5IZ7D 3GLGB 3DA1A 3L29A 3VLFB 4FCWA 4DV0M 1KSFX 3JR4A 1ZV1A 4LRSA 3GPYA 2RGHA 4DUYM 2CWBA 1XC8A 3IECA 1XWIA 4WURA 1J5EM 1WIVA 1NHWC 2DZLA 2Y0TA 4LCBA 3FRIA 1R7RA 4LRTA 4MGKE 1GL7A 4WP2A 1YUBA 2HHHM 2ZANA 4NRWA 2R44A 2O25A 1TR8A 2F5SA 1IFYA 4YY3M 3TWMA 1IN4A 1VEJA 2V1UA 2ZAMA 2C99A 5LMUM 2L7HA 2Q2EB 2DZOB 2UUCM 2OPFA 4ITQA 3HGIA 2GQFA 1MJGM 2M60A 4DV7M 3U6LA 3LW5F 4LJ6A 3A98B 2ZTCA 5ITTA 4JI3M 3HX3A 1PJSA 4NXMM 3IHPA 3K9OA 4KLNA 4YHHM 3QYBA 4KODA 3BOSA 2QENA 2BJWA 1L2CA 3LCUA 1NJGA 4MM3B 3U6OA 5FTMA 1VDLA 4HL4A 1T43A 4JXJA 2QQ8A 4KT0F 1PJQA 4REZA 4LFAM 2JZ1A 3SAUA 3E4RA 3R9XB 3J2PB 3MHVC 4FWDA 1OAIA 2UUAM 3ZQJA 4L78A 2VQEM 1TDHA 1WXQA 1GKIA 3RGPA 3LVWA 1DGHA 3K92A 3JR5A 5FTJA 3GLIA 1C7YA 2L4FA 2JY6B 4I8OA 4EIWA 4FW9A 1JB0F 1L1ZA 2Z4RA 2LWXA 2R0IA 5IWAM 1XXHE 1OQYA 4B3TM 4JI6M 2F5NA 2L6OA 3E9SA 2EO2A 4LF6M 1NSFA 5JI2E 4JI5M 2YQZA 4IJEA 1GABA 3TWKA 1NNUC 2CEAA 3PNYA 3W67A 5JI3E 2QBYA 3AOEA 1ORYB 4GC5A 3GLFE 2AHMA 3SFZA 3HHXA 4LJ7A 2J7NA 4JYAM 1DGHB 4PDGA 4CISA 1D0MA 1H6UA 1QAQA 2HL7A 2Z7JA 4IBKA 3GLIB 1N34M 3U6PA 3CGWA 3EIHA 3SBJA 3FKEA 2CUZA 1K3XA 4F2LA 1DV0A 1SXJD 1N77A 2QNJA 1NO1A 2F5PA 3KS8A 3I01M 1P3QQ 2X49A 3GO8A 3VKHA 4LFCM 2QP9X 2QSFX 1J7KA 3KFUG 4GH9A 3UMMA 2V6ZM 3M7GA 3PVSA 3TE6A 3TWLA 3E46A 2MH8A 4NXNM 2H1RA 5ITXE 2QBYB 4JI8M 1C1KA 3HY5A 1D0KA 4JV5M 4FWHA 3DOAA 1RU3A 4IBJA 4JI0M 2FE8A 1IN6A 4B3SM 5FSWA 1QANA 2HWJA 5KPZA 1XNRM 2OOBA 3I04M 4L6V6 2JUJA 4DV6M 4X64M 1E32A 3NBIA 1IY2A 4P17A 1TH4A 2QZ4A 5EJCA 1I4WA 1V34A 2FFJA 3PNVA 3HJ8A 1NV9A 1QQWA 2VF8A 2VDBB 1TF0B 3AV0A 4QOSA 3FTCA 3LQRA 2DKLA 3GLGA 3W68A 1IN8A 2D7GA 4G3OA 1D2NA 3LCVB 3TPZA 3M6AA 3QAUA 1WHCA 1R4GA 3CF6E 3GLGE 1G41A 4RKUF 1OTRA 1ZMVA 4IIWA 4R71A 4AG5A 1N78A 1XB2B 1R5LA 3A45A 3VK7A 4AKIA 5DFLA 1J09A 2G3QA 3LVVA 2X8AA 4W5WA 3ILKA 4UN2B 2OO9A 2Z4SA 3FUUA 1A5TA 2DAGA 1XNQM 2DI0A 2UUBM 5FTKA 1JR3A 2MROB 3L27A 2J7OA 1QZMA 2BWBA 1WGNA 5FLXS 2DAKA 2DWNA 2V1CA 1AIPC 3AOEC 2C98A 3FYDA 4IBEA 3L25A 4LJ9A 2JNHA 3D8BA 3L26A 1R2ZA 2KNAA 2R4JA 5EXSA 4LJAA 2DAEA 1YE9A 2DNAA 4DR5M 2CHVA 3B9PA 3KOXE 4QHTA 4RF1A 3KSJA 3U6SA 3I51A 2JY8A 4WW0A 3FRHA 3Q8XA 4FWGA 3D8LA 4DR7M 5ITUA 1AUAA 3AL0C 4IBBA 2XEPA 3SAVA 1OIPA 2DVWB 2LHCA 3FTFA 3VFDA 3J7AS 4CIZA 1DGFA 4RF0A 2DAMA 4TUWA 2P5TA 3AOGA 1E9RA 4DR4M 4JI2M 2KNZA 1QDTA 2I7NA 3JAMS 5DYIA 3U6QA 3CF0A 4LF7M 5GKNA 4KO8A 5KQDA 2CV1A 2EUCA 7CATA 1XMOM 1PM5A 2QPAA 3H4MA 1GL6A 5E26A 4L16A 1OIZA 2HCBA 5LMNM 4BB9A 1YSYA 3KSXA 1K82A 1QUSA 1XHBA 2G5GX 5DYGA 1LTMA 2JY7A 5IREB 4G4OA 5F3WA 1N33M 4NSRA 4BLCA 2BNKA 4LJ5A 4M9SA 2R6FA 1N36M 3SYKA 4FD2A 1VDDA 4GHAA 2DHRA 4LZJA 4IJFA 2KEBA 3UZUA 4CGYB 1EFUB 2A5YB 1IXRC 2X4AA 3K8ZA 5C1BA 1Z6TA 3GQ3A 1Y8GA 5EQTA 3DZDA 3GLIE 4L4UA 3AKZA 2F5OA 3RGSA 4I81A 4OW0A 2DENA 1D0LA 1HQCA 1WJ7A 1L2DA 3R8FA 3FTDA 5L8RF 2CV0A 2XSZA 2GNOA 2JXNA 1TTEA 3MJ5A 4KHPM 4DUZM 2YR0A 1R6BX 1KFVA 3H4JA 2K47A 3UGJA 1VQ1A 2XGNA 2DHYA 4IBCA 1L2BA 1WGLA 3U6DA 1K3WA 2WSFF 3C3DA 2MJ5B 2R18A 5EXTA 5A2QS 4AKGA 2QCUA 4DV3M 2ZTDA 3AJIB 4I5SA 2ERCA 2XZUA 4B7FA 2R45A 4PCZA 2L7IA 3T15A 2APLA 2LNHC 3KVWA 3NWLA 1IXSB 1WR1B 3SYLA 3HJSA 4DBGB 3J81S 1ZMWA 3SHGB 2QHOB 1HNXM 4D82A 4LZZA 2LVQD 2KRUA 4B08A 2C5RA 3EIEA 1G71A 1NNJA 4PT5A 3FTEA 1IY1A 1OAOC 3GLHA 4MH0E 1IN7A 1OFHA 1LV7A 2K6BA 3PFIA 3FYCA 4LY6A 1SG9A 2LHGA 3WHKA 3HHYA 4DV5M 4P16A 2DZNB 4A3VB 1PJTA 1TGUA 4MGYE 1QAMA 2M5ZA 3SARA 3KP1E 1GO5A 3BXWA 4LF8M 1IXZA 4PDIA 1OFIA 3HWSA 1E9SA 4GMQA 5IT9S 1GVNA 3SAWA 3FUXA 3K2LA 2JP7A 1W5TA 2L4EA 3U60A 3F92A 3IG8A 2EJSA 1DGGA 3GLHB 4II7A 4GHLA 1KYIA 2KZUA 1BVSA 4Z8XA 1PJJA 1S3SA 2XH9A 3MK6A 3HJQA 4ZPXA 2C9CA 5EP4A 4LG2A 3VK8A 2RKOA 5EP3A 1G59A 3GRVA 4IBDA 4M0DA 2EKKA 2KDLA 3W0LB 4XK8F 3HHZA 2JWSA 2L2DA 4FVMA 3K9PA 4G6ZA 3TL4X 3HHWA 2XLJA 3IG5A 3GPXA 4DR1M 1Q3CA 4OVZA 2B3TA 3FUVA 3GP1A 1JR3E 3KW6A 2RRUA 4CHTB 3GRYA 3U60B 3V76A 1TH2A 1ZQ9A 2KNVA 3B7NA 4DR3M 4RNAA 1GJSA 5KPRA 1DO0A 4JN6A 4G4RA 1MU5A 5ITYA 3FUTA 2C96A 1TH3A 1QAOA 4X62M 1HT2E 3UJNA 2CHQA 4GC9A 3E21A 1TDZA 1V92A 1Z5AA 1Q02A 1Q3BA 3KP0E 2G8LA 2UU9M 2D7EA 4AI6A 1NY6A 4Z6YA 3HU1A 2CE7A 3GQ4A 3U61B 4MGZE 2R46A 1NY5A 2WSEF 4OVZB 1NJFA 2MGWA 1SXJA 2FS1A 3J80S 2YNMD 3W0FA 4M0WA 4LJ4A 4F1IA 2LVAA 2EA0A 1IBLM 3GRUA 4BBAA 2VIIA 4GRIA 1QZEA 3CTWB 4L15A 4ANRA 2KHHA 4AW4A 4NC6A 5KO3A 1IBMM 1V33A 4IBGA 1XMQM 3ZCBB 4NRVA 3KOZE 4XGIA 4R7GA 4G4QA 3A46A 3T1YM 1HQYE 2XFSA 1HNZM 1VG5A 2CV2A 2EKFA 3CF2A 4OX9M 1NHGC 2XZFA 1NV8A 2BWEA 2K9DA 2XFTA 3HU3A 4GKKM 4X65M 1SXJB 4M9ZA 1Z59A 2LVNC 3MMPA 1R2YA 4QOZC 1N32M 4IBIA 4GIPA 3GQ5A 2H5XA 2F5QA 1PJIA 1L8QA 4IBFA 2N35A 8CATA 3M0EA 2DWLA 2JZ0A 1HT1E
chains in the Genus database with same CATH topology
3QYBA 4P17A 2QQ8A 3HZJA 3QYEA 4NC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYB A;  4P17 A;  2QQ8 A;  3HZJ A;  3QYE A;  4NC6 A; 
#chains in the Genus database with same CATH topology
 2DWM A;  3ZH9 B;  5BPV A;  1JQJ C;  1IXS A;  4D80 A;  2VF7 A;  4GIT A;  3HZJ A;  2JA2 A;  1Z5C A;  3T38 A;  5FTL A;  1EE8 A;  1OJL A;  3I4V A;  3TQS A;  4AKH A;  5EP2 A;  2LBC A;  3U6E A;  3L28 A;  3U5Z A;  2RGO A;  4DV1 M;  2F4V M;  1L1T A;  1PRB A;  1IN5 A;  2Y0Q A;  3B89 A;  1MN3 A;  4LJ8 A;  2R62 A;  5EXP A;  1N75 A;  4AZF A;  4D81 A;  4JI1 M;  1T6O A;  4JI7 M;  2D7H A;  1QDR A;  3GPP A;  1HNW M;  3FD9 A;  1EIJ A;  5EXX A;  4Y28 F;  1IM2 A;  3QYE A;  3GRR A;  5BR8 M;  2Z8Y M;  4G4N A;  3U6M A;  1XXH A;  4K0K M;  5ITR A;  2ZM6 M;  1Z5B A;  1JR3 D;  1G3I A;  4DR2 M;  2OOA A;  1FNN A;  2Y21 A;  2WZJ A;  3C9P A;  3LQQ A;  2WSC F;  4X66 M;  2JY5 A;  2L09 A;  5FTN A;  2DXI A;  3KDS E;  1SXJ C;  1QVR A;  3KOY E;  2KZS A;  3VKG A;  1GJT A;  2ZAO A;  2LTU A;  1IY0 A;  2CHG A;  4QNR A;  2HKJ A;  3I4Y A;  4LGY A;  5E6J A;  4AG6 A;  3GLF A;  3U5Z B;  3FE3 A;  3QWL A;  1Q39 A;  3GLH E;  2FNA A;  2BJV A;  1PGY A;  3BBZ A;  2DWZ B;  2KRK A;  4M9X A;  5EP1 A;  1YLA A;  4NOO B;  3SMS A;  2LVP C;  4JI4 M;  2YFQ A;  1XXH B;  3B7Z A;  5C18 A;  1NVM A;  4MGI E;  1G8P A;  4I4L A;  3U6C A;  4GKJ M;  1MX0 A;  1QUT A;  3RFW A;  1FJG M;  1X37 A;  1GLN A;  2FH0 A;  1IQP A;  3KOW E;  4FCV A;  2K0B X;  2Y20 A;  3A42 A;  5ITX A;  1CUK A;  3HU2 A;  3VDU A;  3ZC7 B;  2VQF M;  3LMM A;  2FOI C;  3GPU A;  3FUW A;  2E5L M;  3SAT A;  3C58 A;  3OTO M;  4PD2 A;  3GLF B;  1G4A E;  1ZMU A;  2CFO A;  2KW0 A;  4Q7J A;  3VDP A;  4NL4 H;  5H37 D;  3HKP A;  3SAS A;  4MGH A;  5KQ8 A;  2Z3X A;  2NQ8 C;  1F4I A;  1HJP A;  4AQY M;  4XBO A;  4L8R C;  4LF5 M;  2DAI A;  4DR6 M;  1VEG A;  2O01 F;  2UXD M;  3SC3 A;  3RE8 A;  2LH0 A;  2R4E A;  5DNY A;  4LFB M;  2LVO C;  3J7B A;  2W82 A;  3KS4 A;  4QNM A;  3UK6 A;  4DV4 M;  3U61 A;  4HEO A;  2O5R A;  1E94 E;  1OKS A;  1VEK A;  3T1H M;  4B3M M;  1UFZ A;  4FCT A;  2HAK A;  4B7H A;  4CJ6 A;  4DV2 M;  5ITQ A;  4S12 A;  3NBX X;  2CP8 A;  4R3D A;  2R65 A;  4B7G A;  4LF4 M;  1T3T A;  1QYR A;  4NSO B;  4LF9 M;  3T6P A;  1W5S A;  1HR0 M;  1DGB A;  3B74 A;  3L2A A;  4HLQ A;  4OU7 A;  1IBK M;  2UXC M;  3SHF A;  4LGM A;  3WHL A;  3SMP A;  1ZAE A;  2XF3 A;  3AFH A;  3PXG A;  2OQ4 A;  1DO2 A;  2XSZ D;  3Q8G A;  3KXE C;  2C9O A;  3K1J A;  2ZBK B;  5KPT A;  3B7Q A;  1UM8 A;  2UXB M;  3J27 B;  3THG A;  2CRU A;  1I94 M;  2KXE A;  4GEW A;  3C3E A;  2J5Y A;  2MR9 A;  4QHS A;  3DFZ A;  4B3R M;  2I7P A;  2LXE A;  4MB7 A;  1SXJ E;  2KA6 B;  5IZ7 D;  3GLG B;  3DA1 A;  3L29 A;  3VLF B;  4FCW A;  4DV0 M;  1KSF X;  3JR4 A;  1ZV1 A;  4LRS A;  3GPY A;  2RGH A;  4DUY M;  2CWB A;  1XC8 A;  3IEC A;  1XWI A;  4WUR A;  1J5E M;  1WIV A;  1NHW C;  2DZL A;  2Y0T A;  4LCB A;  3FRI A;  1R7R A;  4LRT A;  4MGK E;  1GL7 A;  4WP2 A;  1YUB A;  2HHH M;  2ZAN A;  4NRW A;  2R44 A;  2O25 A;  1TR8 A;  2F5S A;  1IFY A;  4YY3 M;  3TWM A;  1IN4 A;  1VEJ A;  2V1U A;  2ZAM A;  2C99 A;  5LMU M;  2L7H A;  2Q2E B;  2DZO B;  2UUC M;  2OPF A;  4ITQ A;  3HGI A;  2GQF A;  1MJG M;  2M60 A;  4DV7 M;  3U6L A;  3LW5 F;  4LJ6 A;  3A98 B;  2ZTC A;  5ITT A;  4JI3 M;  3HX3 A;  1PJS A;  4NXM M;  3IHP A;  3K9O A;  4KLN A;  4YHH M;  3QYB A;  4KOD A;  3BOS A;  2QEN A;  2BJW A;  1L2C A;  3LCU A;  1NJG A;  4MM3 B;  3U6O A;  5FTM A;  1VDL A;  4HL4 A;  1T43 A;  4JXJ A;  2QQ8 A;  4KT0 F;  1PJQ A;  4REZ A;  4LFA M;  2JZ1 A;  3SAU A;  3E4R A;  3R9X B;  3J2P B;  3MHV C;  4FWD A;  1OAI A;  2UUA M;  3ZQJ A;  4L78 A;  2VQE M;  1TDH A;  1WXQ A;  1GKI A;  3RGP A;  3LVW A;  1DGH A;  3K92 A;  3JR5 A;  5FTJ A;  3GLI A;  1C7Y A;  2L4F A;  2JY6 B;  4I8O A;  4EIW A;  4FW9 A;  1JB0 F;  1L1Z A;  2Z4R A;  2LWX A;  2R0I A;  5IWA M;  1XXH E;  1OQY A;  4B3T M;  4JI6 M;  2F5N A;  2L6O A;  3E9S A;  2EO2 A;  4LF6 M;  1NSF A;  5JI2 E;  4JI5 M;  2YQZ A;  4IJE A;  1GAB A;  3TWK A;  1NNU C;  2CEA A;  3PNY A;  3W67 A;  5JI3 E;  2QBY A;  3AOE A;  1ORY B;  4GC5 A;  3GLF E;  2AHM A;  3SFZ A;  3HHX A;  4LJ7 A;  2J7N A;  4JYA M;  1DGH B;  4PDG A;  4CIS A;  1D0M A;  1H6U A;  1QAQ A;  2HL7 A;  2Z7J A;  4IBK A;  3GLI B;  1N34 M;  3U6P A;  3CGW A;  3EIH A;  3SBJ A;  3FKE A;  2CUZ A;  1K3X A;  4F2L A;  1DV0 A;  1SXJ D;  1N77 A;  2QNJ A;  1NO1 A;  2F5P A;  3KS8 A;  3I01 M;  1P3Q Q;  2X49 A;  3GO8 A;  3VKH A;  4LFC M;  2QP9 X;  2QSF X;  1J7K A;  3KFU G;  4GH9 A;  3UMM A;  2V6Z M;  3M7G A;  3PVS A;  3TE6 A;  3TWL A;  3E46 A;  2MH8 A;  4NXN M;  2H1R A;  5ITX E;  2QBY B;  4JI8 M;  1C1K A;  3HY5 A;  1D0K A;  4JV5 M;  4FWH A;  3DOA A;  1RU3 A;  4IBJ A;  4JI0 M;  2FE8 A;  1IN6 A;  4B3S M;  5FSW A;  1QAN A;  2HWJ A;  5KPZ A;  1XNR M;  2OOB A;  3I04 M;  4L6V 6;  2JUJ A;  4DV6 M;  4X64 M;  1E32 A;  3NBI A;  1IY2 A;  4P17 A;  1TH4 A;  2QZ4 A;  5EJC A;  1I4W A;  1V34 A;  2FFJ A;  3PNV A;  3HJ8 A;  1NV9 A;  1QQW A;  2VF8 A;  2VDB B;  1TF0 B;  3AV0 A;  4QOS A;  3FTC A;  3LQR A;  2DKL A;  3GLG A;  3W68 A;  1IN8 A;  2D7G A;  4G3O A;  1D2N A;  3LCV B;  3TPZ A;  3M6A A;  3QAU A;  1WHC A;  1R4G A;  3CF6 E;  3GLG E;  1G41 A;  4RKU F;  1OTR A;  1ZMV A;  4IIW A;  4R71 A;  4AG5 A;  1N78 A;  1XB2 B;  1R5L A;  3A45 A;  3VK7 A;  4AKI A;  5DFL A;  1J09 A;  2G3Q A;  3LVV A;  2X8A A;  4W5W A;  3ILK A;  4UN2 B;  2OO9 A;  2Z4S A;  3FUU A;  1A5T A;  2DAG A;  1XNQ M;  2DI0 A;  2UUB M;  5FTK A;  1JR3 A;  2MRO B;  3L27 A;  2J7O A;  1QZM A;  2BWB A;  1WGN A;  5FLX S;  2DAK A;  2DWN A;  2V1C A;  1AIP C;  3AOE C;  2C98 A;  3FYD A;  4IBE A;  3L25 A;  4LJ9 A;  2JNH A;  3D8B A;  3L26 A;  1R2Z A;  2KNA A;  2R4J A;  5EXS A;  4LJA A;  2DAE A;  1YE9 A;  2DNA A;  4DR5 M;  2CHV A;  3B9P A;  3KOX E;  4QHT A;  4RF1 A;  3KSJ A;  3U6S A;  3I51 A;  2JY8 A;  4WW0 A;  3FRH A;  3Q8X A;  4FWG A;  3D8L A;  4DR7 M;  5ITU A;  1AUA A;  3AL0 C;  4IBB A;  2XEP A;  3SAV A;  1OIP A;  2DVW B;  2LHC A;  3FTF A;  3VFD A;  3J7A S;  4CIZ A;  1DGF A;  4RF0 A;  2DAM A;  4TUW A;  2P5T A;  3AOG A;  1E9R A;  4DR4 M;  4JI2 M;  2KNZ A;  1QDT A;  2I7N A;  3JAM S;  5DYI A;  3U6Q A;  3CF0 A;  4LF7 M;  5GKN A;  4KO8 A;  5KQD A;  2CV1 A;  2EUC A;  7CAT A;  1XMO M;  1PM5 A;  2QPA A;  3H4M A;  1GL6 A;  5E26 A;  4L16 A;  1OIZ A;  2HCB A;  5LMN M;  4BB9 A;  1YSY A;  3KSX A;  1K82 A;  1QUS A;  1XHB A;  2G5G X;  5DYG A;  1LTM A;  2JY7 A;  5IRE B;  4G4O A;  5F3W A;  1N33 M;  4NSR A;  4BLC A;  2BNK A;  4LJ5 A;  4M9S A;  2R6F A;  1N36 M;  3SYK A;  4FD2 A;  1VDD A;  4GHA A;  2DHR A;  4LZJ A;  4IJF A;  2KEB A;  3UZU A;  4CGY B;  1EFU B;  2A5Y B;  1IXR C;  2X4A A;  3K8Z A;  5C1B A;  1Z6T A;  3GQ3 A;  1Y8G A;  5EQT A;  3DZD A;  3GLI E;  4L4U A;  3AKZ A;  2F5O A;  3RGS A;  4I81 A;  4OW0 A;  2DEN A;  1D0L A;  1HQC A;  1WJ7 A;  1L2D A;  3R8F A;  3FTD A;  5L8R F;  2CV0 A;  2XSZ A;  2GNO A;  2JXN A;  1TTE A;  3MJ5 A;  4KHP M;  4DUZ M;  2YR0 A;  1R6B X;  1KFV A;  3H4J A;  2K47 A;  3UGJ A;  1VQ1 A;  2XGN A;  2DHY A;  4IBC A;  1L2B A;  1WGL A;  3U6D A;  1K3W A;  2WSF F;  3C3D A;  2MJ5 B;  2R18 A;  5EXT A;  5A2Q S;  4AKG A;  2QCU A;  4DV3 M;  2ZTD A;  3AJI B;  4I5S A;  2ERC A;  2XZU A;  4B7F A;  2R45 A;  4PCZ A;  2L7I A;  3T15 A;  2APL A;  2LNH C;  3KVW A;  3NWL A;  1IXS B;  1WR1 B;  3SYL A;  3HJS A;  4DBG B;  3J81 S;  1ZMW A;  3SHG B;  2QHO B;  1HNX M;  4D82 A;  4LZZ A;  2LVQ D;  2KRU A;  4B08 A;  2C5R A;  3EIE A;  1G71 A;  1NNJ A;  4PT5 A;  3FTE A;  1IY1 A;  1OAO C;  3GLH A;  4MH0 E;  1IN7 A;  1OFH A;  1LV7 A;  2K6B A;  3PFI A;  3FYC A;  4LY6 A;  1SG9 A;  2LHG A;  3WHK A;  3HHY A;  4DV5 M;  4P16 A;  2DZN B;  4A3V B;  1PJT A;  1TGU A;  4MGY E;  1QAM A;  2M5Z A;  3SAR A;  3KP1 E;  1GO5 A;  3BXW A;  4LF8 M;  1IXZ A;  4PDI A;  1OFI A;  3HWS A;  1E9S A;  4GMQ A;  5IT9 S;  1GVN A;  3SAW A;  3FUX A;  3K2L A;  2JP7 A;  1W5T A;  2L4E A;  3U60 A;  3F92 A;  3IG8 A;  2EJS A;  1DGG A;  3GLH B;  4II7 A;  4GHL A;  1KYI A;  2KZU A;  1BVS A;  4Z8X A;  1PJJ A;  1S3S A;  2XH9 A;  3MK6 A;  3HJQ A;  4ZPX A;  2C9C A;  5EP4 A;  4LG2 A;  3VK8 A;  2RKO A;  5EP3 A;  1G59 A;  3GRV A;  4IBD A;  4M0D A;  2EKK A;  2KDL A;  3W0L B;  4XK8 F;  3HHZ A;  2JWS A;  2L2D A;  4FVM A;  3K9P A;  4G6Z A;  3TL4 X;  3HHW A;  2XLJ A;  3IG5 A;  3GPX A;  4DR1 M;  1Q3C A;  4OVZ A;  2B3T A;  3FUV A;  3GP1 A;  1JR3 E;  3KW6 A;  2RRU A;  4CHT B;  3GRY A;  3U60 B;  3V76 A;  1TH2 A;  1ZQ9 A;  2KNV A;  3B7N A;  4DR3 M;  4RNA A;  1GJS A;  5KPR A;  1DO0 A;  4JN6 A;  4G4R A;  1MU5 A;  5ITY A;  3FUT A;  2C96 A;  1TH3 A;  1QAO A;  4X62 M;  1HT2 E;  3UJN A;  2CHQ A;  4GC9 A;  3E21 A;  1TDZ A;  1V92 A;  1Z5A A;  1Q02 A;  1Q3B A;  3KP0 E;  2G8L A;  2UU9 M;  2D7E A;  4AI6 A;  1NY6 A;  4Z6Y A;  3HU1 A;  2CE7 A;  3GQ4 A;  3U61 B;  4MGZ E;  2R46 A;  1NY5 A;  2WSE F;  4OVZ B;  1NJF A;  2MGW A;  1SXJ A;  2FS1 A;  3J80 S;  2YNM D;  3W0F A;  4M0W A;  4LJ4 A;  4F1I A;  2LVA A;  2EA0 A;  1IBL M;  3GRU A;  4BBA A;  2VII A;  4GRI A;  1QZE A;  3CTW B;  4L15 A;  4ANR A;  2KHH A;  4AW4 A;  4NC6 A;  5KO3 A;  1IBM M;  1V33 A;  4IBG A;  1XMQ M;  3ZCB B;  4NRV A;  3KOZ E;  4XGI A;  4R7G A;  4G4Q A;  3A46 A;  3T1Y M;  1HQY E;  2XFS A;  1HNZ M;  1VG5 A;  2CV2 A;  2EKF A;  3CF2 A;  4OX9 M;  1NHG C;  2XZF A;  1NV8 A;  2BWE A;  2K9D A;  2XFT A;  3HU3 A;  4GKK M;  4X65 M;  1SXJ B;  4M9Z A;  1Z59 A;  2LVN C;  3MMP A;  1R2Y A;  4QOZ C;  1N32 M;  4IBI A;  4GIP A;  3GQ5 A;  2H5X A;  2F5Q A;  1PJI A;  1L8Q A;  4IBF A;  2N35 A;  8CAT A;  3M0E A;  2DWL A;  2JZ0 A;  1HT1 E; 
#chains in the Genus database with same CATH homology
 3QYB A;  4P17 A;  2QQ8 A;  3HZJ A;  3QYE A;  4NC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...