4P17A

Crystal structure of the chlamydomonas flagellar rabgap tbc domain.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
301
structure length
288
Chain Sequence
VHDLYGFPIQEDERRSCDVNAEREVPLWQHYIEKDKLPSNETKLKEMIRKGVPPTLRNWVWMETSGANKKKAGHAANYYSIMVKAGEESQYKKDIETDSTHTFPDHPWLSSPDGRAALCRVLQAYSVHNERVGYVRAMNTIVGLMLVALNRNEEAAFWLLAALVEDILYPGTYSRMRALDELIGTKLPRLQQHFQAIDFDISMLATDWYLCLFSVSLPSETVMRTWDSLFYEGPKILFRVALAMLKIYEDNMLRVGDAGELLMRMRNAAATMHQRDVLMATAFDHIGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RabGAP/TBC protein
publication title Crystal structure of a Chlamydomonas reinhardtii flagellar RabGAP TBC-domain at 1.8 angstrom resolution.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Unknown function
total genus 110
structure length 288
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4p17A02
4P17A 3HZJA 3QYEA 3QYBA 4NC6A 2QQ8A
chains in the Genus database with same CATH superfamily
3U6SA 2HL7A 2JZ0A 3U6PA 2RRUA 1MU5A 5FTNA 4NXNM 1J7KA 4DV7M 3RGSA 1Q3CA 1P3QQ 4LZZA 4MM3B 1GJSA 3GPXA 1GL7A 1QAQA 3ZCBB 1PJQA 4DUZM 4A3VB 2JNHA 3B74A 2XZFA 1GL6A 2F5NA 3DZDA 5DNYA 2XEPA 3U6QA 2O5RA 1YLAA 2DHRA 4NSOB 3L25A 1HQYE 4FW9A 3PFIA 2V1CA 3HU3A 3FYCA 4M9XA 3MHVC 2LNHC 2W82A 3SHFA 5FTKA 3V76A 4GITA 1IN8A 1XNQM 3SASA 3HU2A 1L1TA 4B3RM 4JI1M 4LG2A 4IBCA 2FE8A 1KYIA 2EJSA 4WURA 2YR0A 3FUVA 4AG5A 4IIWA 4JI4M 2ZBKB 3UJNA 1JQJC 3SMPA 1I94M 1TDHA 5FSWA 1PJSA 1IBMM 1K82A 4CIZA 5EJCA 2C5RA 3FUUA 4JI6M 4LJ7A 3FKEA 4GC9A 4QHSA 4GKKM 4LGMA 1DGBA 3AV0A 4IJEA 4MH0E 2F5SA 3HJ8A 2AHMA 3KS8A 3SYKA 1PRBA 4B08A 3GLHA 1G41A 3I04M 4FWGA 3T6PA 5JI2E 2DAEA 1IXZA 2DZNB 3J27B 4IBKA 4LF5M 3EIEA 2JA2A 3KOYE 1OQYA 3SMSA 2R44A 3B7QA 2DKLA 3SHGB 8CATA 2QCUA 4LF4M 1IY2A 2LVAA 2CV1A 1J09A 3GQ5A 4LF8M 1SXJD 3KP0E 2C9CA 3KP1E 3U6LA 1PJTA 4XBOA 4DR7M 2QHOB 2L7HA 1L2CA 1IXRC 2UUBM 2G8LA 1R4GA 3BOSA 3F92A 2CRUA 3THGA 3GLIE 4NC6A 2JY8A 3BBZA 3FUWA 2V6ZM 1VDDA 4DV5M 1XNRM 1AUAA 5C1BA 3GRRA 2DAMA 3DOAA 5IZ7D 3FTFA 4GHLA 1GJTA 1QQWA 2I7NA 2L6OA 3A42A 1EE8A 4PDGA 4DR3M 3SATA 4CISA 3J80S 3J7BA 5IWAM 1G4AE 4AZFA 3HY5A 1C1KA 1W5TA 4BB9A 1OTRA 3KXEC 3GLFE 1XMOM 3LQQA 1ZAEA 2LBCA 1QZMA 1SXJC 3TL4X 1IM2A 1OKSA 1XB2B 2EKKA 1D0MA 2C9OA 1Z5BA 3LVVA 2MJ5B 5ITUA 3U6DA 2DAKA 1R6BX 2JWSA 2EUCA 3GP1A 2LHCA 1BVSA 4LJ9A 3QWLA 3K9PA 1WHCA 3KSXA 4I5SA 3HHZA 2R65A 4JXJA 1D0LA 1AIPC 4L4UA 2I7PA 2VF7A 2Z7JA 3GLHB 2ZTCA 4AQYM 2KZUA 4OX9M 3E46A 3HHWA 4NOOB 3SBJA 1TH3A 3K2LA 4AG6A 1HNWM 2L2DA 4KHPM 2JUJA 1K3XA 5KO3A 1L1ZA 4NXMM 3FUTA 2ZAOA 5EXSA 1QDRA 5DYIA 1VEJA 4LFAM 3MJ5A 1XHBA 4L15A 1JR3D 3E21A 4GH9A 3HZJA 1TH4A 3T1YM 1YE9A 3H4JA 1TTEA 2L4FA 4IBDA 4ITQA 4L16A 1TR8A 3C3DA 2C96A 1LTMA 3M6AA 2R6FA 4KT0F 4DBGB 4CJ6A 3GLIA 2DNAA 4G3OA 1G3IA 5H37D 2LH0A 2VDBB 1HJPA 4X65M 3AOEC 4FWDA 1IN6A 2GNOA 5GKNA 1E94E 4D81A 4II7A 1QANA 1X37A 1N75A 3I4VA 4AKGA 4F1IA 1GABA 4L78A 5FTLA 3J7AS 3HWSA 3I01M 4I4LA 2F5OA 1C7YA 1ZMWA 4AW4A 3U6MA 5DYGA 2EO2A 1IXSA 3UK6A 2JY6B 1IN5A 2Y21A 2DWNA 1QAMA 4IJFA 5EXXA 4GEWA 3L29A 1T43A 1XXHE 2BWBA 4FVMA 3U61A 3D8LA 4AKHA 5KQDA 4LF6M 2NQ8C 1G59A 2QP9X 3TWMA 5FTJA 4B7GA 4R71A 1NNJA 1I4WA 4PT5A 2Y0QA 2ZANA 4LZJA 4F2LA 2OQ4A 2EA0A 3SAVA 2XH9A 3QAUA 5BPVA 2JY7A 1HR0M 4GIPA 3KVWA 2KNAA 3RGPA 2X4AA 4QNMA 3M0EA 4JI3M 5ITXA 4LJAA 5KPZA 3LCUA 3T38A 1ZV1A 2KW0A 3SYLA 5C18A 4DUYM 3MMPA 4FCTA 2CHVA 4OW0A 3K8ZA 1VG5A 2MR9A 5FTMA 2P5TA 3GLIB 1Q39A 2KEBA 2DZLA 4DR2M 1R5LA 3VKHA 4WW0A 2M60A 2KA6B 2JP7A 5EP1A 3AJIB 3DA1A 4GHAA 3KSJA 1N77A 2EKFA 2J7OA 1E32A 4IBIA 3CF6E 1WGNA 2CV2A 1NHGC 2D7HA 2DENA 4QHTA 2BJWA 1OAIA 2KRKA 2KDLA 2ZTDA 3HJSA 4R7GA 1Z59A 2HWJA 3W0LB 3LVWA 1IBLM 1IXSB 3QYEA 1IY0A 5IREB 2UXCM 2GQFA 1NNUC 4IBBA 2R4EA 3A98B 2L09A 3NBXX 5DFLA 1HNZM 2X49A 5E26A 1XXHA 3GRVA 4D82A 4DV6M 4DV4M 3HHXA 1PJIA 2K9DA 1QUSA 2YNMD 1QUTA 3KOXE 5EQTA 4LRTA 3U61B 2DWZB 4KLNA 3DFZA 1L8QA 2RGHA 4I81A 3B7NA 2HCBA 1GLNA 3I4YA 2UU9M 1Z6TA 2CP8A 1L2DA 2MH8A 1WR1B 3AFHA 2QPAA 4MGYE 1NY5A 4RF0A 2F5PA 3UMMA 1IQPA 2DAGA 1WGLA 3HU1A 4JI5M 4GMQA 3FYDA 4I8OA 4YY3M 3JR4A 4M0WA 3CF0A 1QYRA 1XC8A 2XSZD 3NBIA 4FWHA 4B3SM 4M0DA 4JI0M 1VQ1A 2KRUA 4Q7JA 2APLA 2KHHA 1IFYA 3EIHA 2FOIC 2L7IA 1CUKA 4LF9M 2VQFM 2VF8A 4JI8M 2KZSA 1LV7A 3RFWA 3E9SA 4KODA 2LVPC 2YFQA 2DWMA 4B7HA 3Q8XA 1Z5AA 3KDSE 2O25A 4Z8XA 1MN3A 3FTDA 3GQ4A 5ITQA 1N34M 4XK8F 3GLGE 4QOZC 1SXJE 3MK6A 3TPZA 2DI0A 1T3TA 2QQ8A 4G4OA 1N32M 2RKOA 3W0FA 2XZUA 1E9SA 1Q02A 4BBAA 2KNZA 3NWLA 2X8AA 2DVWB 4OU7A 3GPUA 4LY6A 3AOGA 2LHGA 5ITTA 4LF7M 3R9XB 2UUCM 2N35A 2HAKA 4G4QA 2UXBM 4JYAM 2OOAA 1OFIA 4MGKE 3GPYA 2WSFF 2DAIA 1ORYB 3QYBA 1NO1A 5L8RF 2K0BX 4JI7M 4REZA 1NV8A 2LVQD 3IECA 4CHTB 5BR8M 1DV0A 1UFZA 3JAMS 3VK8A 1XXHB 2CE7A 2JXNA 4TUWA 4LFCM 4GRIA 2BJVA 1G71A 4NL4H 1TH2A 1WJ7A 3L27A 1D0KA 1NV9A 1PM5A 4MB7A 1DGHA 3TWLA 3R8FA 1MJGM 1VEGA 4R3DA 3VDPA 3W68A 2G3QA 4P17A 3L2AA 4OVZA 2C98A 3HX3A 2R45A 4LJ5A 2R18A 3M7GA 4UN2B 5EXPA 3GLFA 5A2QS 4DR5M 3D8BA 2Z4RA 1VDLA 3HGIA 4JV5M 2WZJA 4IBFA 1IY1A 1IBKM 2JY5A 4Z6YA 3WHLA 4G4RA 1HT1E 2FH0A 1TDZA 4M9SA 4X66M 4DV3M 2XLJA 1KSFX 2Y0TA 2M5ZA 4MGIE 1T6OA 4MGHA 2HHHM 3AL0C 2DZOB 3GLGA 1SXJA 3TQSA 5KPRA 1JR3E 1QDTA 2FFJA 4FD2A 1OIPA 1ZMVA 3U6OA 2Z8YM 1ZMUA 2LVOC 3FTCA 4LJ8A 3FRIA 3PNYA 4PD2A 3KFUG 2KNVA 2HKJA 5E6JA 4YHHM 2QBYA 5LMUM 3U6EA 4JN6A 3SC3A 1OAOC 2D7EA 4NSRA 3TE6A 3GRYA 3C58A 3U6CA 1QZEA 2F5QA 3W67A 3A45A 4HL4A 2BNKA 3E4RA 3T15A 1IN4A 2YQZA 4NRWA 1KFVA 2LVNC 2J7NA 4B3TM 1YUBA 1NHWC 1DO0A 2XSZA 4W5WA 1F4IA 3UGJA 1R2ZA 1DO2A 4LFBM 3WHKA 2DHYA 2QENA 3C9PA 1NJGA 2MROB 1VEKA 2R4JA 1ZQ9A 1XMQM 1Z5CA 1A5TA 3LCVB 3BXWA 4LJ6A 3JR5A 4K0KM 3PVSA 1DGFA 3K1JA 1DGHB 5EP4A 2ZAMA 5EP2A 2CWBA 4DV0M 1V34A 3KW6A 1HQCA 2C99A 4AI6A 2WSCF 1NY6A 5ITYA 4B3MM 2L4EA 3U60A 4BLCA 1NVMA 4OVZB 1QVRA 3AKZA 3FD9A 4DR6M 3AOEA 2R0IA 2CFOA 4HLQA 3GLFB 2D7GA 2XF3A 4B7FA 3HHYA 4Y28F 3ZQJA 4DR1M 4QOSA 4QNRA 4RF1A 1V92A 4PDIA 3LW5F 2FNAA 4DV1M 4MGZE 2QNJA 4RKUF 3ZC7B 2OOBA 1GKIA 3J2PB 3VLFB 1FJGM 1JR3A 4LJ4A 2Q2EB 3GLGB 1SXJB 4RNAA 1IN7A 1NJFA 5EP3A 4LRSA 3I51A 3PXGA 3J81S 3ILKA 1NSFA 3UZUA 2DXIA 4S12A 3GPPA 3KOWE 3HJQA 2Y20A 4PCZA 3VKGA 3IG5A 4P16A 5EXTA 1DGGA 1OFHA 2K47A 1OJLA 1EFUB 2QBYB 1UM8A 1PJJA 1GO5A 3KOZE 1S3SA 2XFSA 2QSFX 2XGNA 2VQEM 2K6BA 1SG9A 3FRHA 3OTOM 2R46A 2J5YA 1J5EM 4L8RC 2ERCA 2E5LM 3CF2A 3A46A 3FUXA 3CTWB 3VDUA 1Y8GA 1L2BA 2F4VM 3RE8A 3U5ZA 3FE3A 2OO9A 4D80A 1Q3BA 2V1UA 2KXEA 2XFTA 2JZ1A 2DWLA 3CGWA 1WIVA 7CATA 4DV2M 4IBGA 3B9PA 2WSEF 2MGWA 3K9OA 4IBEA 3L26A 2FS1A 2LXEA 3GO8A 3U60B 3LMMA 3B89A 1D2NA 4HEOA 4XGIA 1N36M 4FCWA 4NRVA 1V33A 4LGYA 2CUZA 5FLXS 3C3EA 3SAUA 4KO8A 2OPFA 5KPTA 4DR4M 2CHQA 1QAOA 2LTUA 4GC5A 1XWIA 1R2YA 2CV0A 2QZ4A 4CGYB 5ITRA 3L28A 5LMNM 2Z3XA 3SARA 3Q8GA 4EIWA 3FTEA 1N78A 2R62A 4WP2A 1MX0A 3PNVA 3IG8A 3ZH9B 5F3WA 1YSYA 3GRUA 1E9RA 1H6UA 2O01F 4LCBA 4G4NA 2RGOA 2UXDM 3IHPA 3VFDA 4X64M 2Z4SA 2G5GX 1FNNA 3VK7A 5JI3E 4AKIA 1GVNA 1WXQA 3LQRA 3H4MA 2CEAA 2ZM6M 3SAWA 2CHGA 2LWXA 5ITXE 1RU3A 1OIZA 3HKPA 4M9ZA 1N33M 3GQ3A 1HT2E 1G8PA 3KS4A 1PGYA 3K92A 3TWKA 3SFZA 5IT9S 4ANRA 4JI2M 3B7ZA 1W5SA 2H5XA 3T1HM 1JB0F 5KQ8A 1HNXM 2BWEA 1R7RA 1TGUA 4ZPXA 4GKJM 3U5ZB 4G6ZA 2UUAM 1TF0B 1EIJA 3GLHE 2H1RA 4FCVA 2A5YB 2B3TA 4IBJA 4X62M 4L6V6 1K3WA 2VIIA
chains in the Genus database with same CATH topology
4P17A 3HZJA 3QYEA 3QYBA 4NC6A 2QQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P17 A;  3HZJ A;  3QYE A;  3QYB A;  4NC6 A;  2QQ8 A; 
#chains in the Genus database with same CATH topology
 3U6S A;  2HL7 A;  2JZ0 A;  3U6P A;  2RRU A;  1MU5 A;  5FTN A;  4NXN M;  1J7K A;  4DV7 M;  3RGS A;  1Q3C A;  1P3Q Q;  4LZZ A;  4MM3 B;  1GJS A;  3GPX A;  1GL7 A;  1QAQ A;  3ZCB B;  1PJQ A;  4DUZ M;  4A3V B;  2JNH A;  3B74 A;  2XZF A;  1GL6 A;  2F5N A;  3DZD A;  5DNY A;  2XEP A;  3U6Q A;  2O5R A;  1YLA A;  2DHR A;  4NSO B;  3L25 A;  1HQY E;  4FW9 A;  3PFI A;  2V1C A;  3HU3 A;  3FYC A;  4M9X A;  3MHV C;  2LNH C;  2W82 A;  3SHF A;  5FTK A;  3V76 A;  4GIT A;  1IN8 A;  1XNQ M;  3SAS A;  3HU2 A;  1L1T A;  4B3R M;  4JI1 M;  4LG2 A;  4IBC A;  2FE8 A;  1KYI A;  2EJS A;  4WUR A;  2YR0 A;  3FUV A;  4AG5 A;  4IIW A;  4JI4 M;  2ZBK B;  3UJN A;  1JQJ C;  3SMP A;  1I94 M;  1TDH A;  5FSW A;  1PJS A;  1IBM M;  1K82 A;  4CIZ A;  5EJC A;  2C5R A;  3FUU A;  4JI6 M;  4LJ7 A;  3FKE A;  4GC9 A;  4QHS A;  4GKK M;  4LGM A;  1DGB A;  3AV0 A;  4IJE A;  4MH0 E;  2F5S A;  3HJ8 A;  2AHM A;  3KS8 A;  3SYK A;  1PRB A;  4B08 A;  3GLH A;  1G41 A;  3I04 M;  4FWG A;  3T6P A;  5JI2 E;  2DAE A;  1IXZ A;  2DZN B;  3J27 B;  4IBK A;  4LF5 M;  3EIE A;  2JA2 A;  3KOY E;  1OQY A;  3SMS A;  2R44 A;  3B7Q A;  2DKL A;  3SHG B;  8CAT A;  2QCU A;  4LF4 M;  1IY2 A;  2LVA A;  2CV1 A;  1J09 A;  3GQ5 A;  4LF8 M;  1SXJ D;  3KP0 E;  2C9C A;  3KP1 E;  3U6L A;  1PJT A;  4XBO A;  4DR7 M;  2QHO B;  2L7H A;  1L2C A;  1IXR C;  2UUB M;  2G8L A;  1R4G A;  3BOS A;  3F92 A;  2CRU A;  3THG A;  3GLI E;  4NC6 A;  2JY8 A;  3BBZ A;  3FUW A;  2V6Z M;  1VDD A;  4DV5 M;  1XNR M;  1AUA A;  5C1B A;  3GRR A;  2DAM A;  3DOA A;  5IZ7 D;  3FTF A;  4GHL A;  1GJT A;  1QQW A;  2I7N A;  2L6O A;  3A42 A;  1EE8 A;  4PDG A;  4DR3 M;  3SAT A;  4CIS A;  3J80 S;  3J7B A;  5IWA M;  1G4A E;  4AZF A;  3HY5 A;  1C1K A;  1W5T A;  4BB9 A;  1OTR A;  3KXE C;  3GLF E;  1XMO M;  3LQQ A;  1ZAE A;  2LBC A;  1QZM A;  1SXJ C;  3TL4 X;  1IM2 A;  1OKS A;  1XB2 B;  2EKK A;  1D0M A;  2C9O A;  1Z5B A;  3LVV A;  2MJ5 B;  5ITU A;  3U6D A;  2DAK A;  1R6B X;  2JWS A;  2EUC A;  3GP1 A;  2LHC A;  1BVS A;  4LJ9 A;  3QWL A;  3K9P A;  1WHC A;  3KSX A;  4I5S A;  3HHZ A;  2R65 A;  4JXJ A;  1D0L A;  1AIP C;  4L4U A;  2I7P A;  2VF7 A;  2Z7J A;  3GLH B;  2ZTC A;  4AQY M;  2KZU A;  4OX9 M;  3E46 A;  3HHW A;  4NOO B;  3SBJ A;  1TH3 A;  3K2L A;  4AG6 A;  1HNW M;  2L2D A;  4KHP M;  2JUJ A;  1K3X A;  5KO3 A;  1L1Z A;  4NXM M;  3FUT A;  2ZAO A;  5EXS A;  1QDR A;  5DYI A;  1VEJ A;  4LFA M;  3MJ5 A;  1XHB A;  4L15 A;  1JR3 D;  3E21 A;  4GH9 A;  3HZJ A;  1TH4 A;  3T1Y M;  1YE9 A;  3H4J A;  1TTE A;  2L4F A;  4IBD A;  4ITQ A;  4L16 A;  1TR8 A;  3C3D A;  2C96 A;  1LTM A;  3M6A A;  2R6F A;  4KT0 F;  4DBG B;  4CJ6 A;  3GLI A;  2DNA A;  4G3O A;  1G3I A;  5H37 D;  2LH0 A;  2VDB B;  1HJP A;  4X65 M;  3AOE C;  4FWD A;  1IN6 A;  2GNO A;  5GKN A;  1E94 E;  4D81 A;  4II7 A;  1QAN A;  1X37 A;  1N75 A;  3I4V A;  4AKG A;  4F1I A;  1GAB A;  4L78 A;  5FTL A;  3J7A S;  3HWS A;  3I01 M;  4I4L A;  2F5O A;  1C7Y A;  1ZMW A;  4AW4 A;  3U6M A;  5DYG A;  2EO2 A;  1IXS A;  3UK6 A;  2JY6 B;  1IN5 A;  2Y21 A;  2DWN A;  1QAM A;  4IJF A;  5EXX A;  4GEW A;  3L29 A;  1T43 A;  1XXH E;  2BWB A;  4FVM A;  3U61 A;  3D8L A;  4AKH A;  5KQD A;  4LF6 M;  2NQ8 C;  1G59 A;  2QP9 X;  3TWM A;  5FTJ A;  4B7G A;  4R71 A;  1NNJ A;  1I4W A;  4PT5 A;  2Y0Q A;  2ZAN A;  4LZJ A;  4F2L A;  2OQ4 A;  2EA0 A;  3SAV A;  2XH9 A;  3QAU A;  5BPV A;  2JY7 A;  1HR0 M;  4GIP A;  3KVW A;  2KNA A;  3RGP A;  2X4A A;  4QNM A;  3M0E A;  4JI3 M;  5ITX A;  4LJA A;  5KPZ A;  3LCU A;  3T38 A;  1ZV1 A;  2KW0 A;  3SYL A;  5C18 A;  4DUY M;  3MMP A;  4FCT A;  2CHV A;  4OW0 A;  3K8Z A;  1VG5 A;  2MR9 A;  5FTM A;  2P5T A;  3GLI B;  1Q39 A;  2KEB A;  2DZL A;  4DR2 M;  1R5L A;  3VKH A;  4WW0 A;  2M60 A;  2KA6 B;  2JP7 A;  5EP1 A;  3AJI B;  3DA1 A;  4GHA A;  3KSJ A;  1N77 A;  2EKF A;  2J7O A;  1E32 A;  4IBI A;  3CF6 E;  1WGN A;  2CV2 A;  1NHG C;  2D7H A;  2DEN A;  4QHT A;  2BJW A;  1OAI A;  2KRK A;  2KDL A;  2ZTD A;  3HJS A;  4R7G A;  1Z59 A;  2HWJ A;  3W0L B;  3LVW A;  1IBL M;  1IXS B;  3QYE A;  1IY0 A;  5IRE B;  2UXC M;  2GQF A;  1NNU C;  4IBB A;  2R4E A;  3A98 B;  2L09 A;  3NBX X;  5DFL A;  1HNZ M;  2X49 A;  5E26 A;  1XXH A;  3GRV A;  4D82 A;  4DV6 M;  4DV4 M;  3HHX A;  1PJI A;  2K9D A;  1QUS A;  2YNM D;  1QUT A;  3KOX E;  5EQT A;  4LRT A;  3U61 B;  2DWZ B;  4KLN A;  3DFZ A;  1L8Q A;  2RGH A;  4I81 A;  3B7N A;  2HCB A;  1GLN A;  3I4Y A;  2UU9 M;  1Z6T A;  2CP8 A;  1L2D A;  2MH8 A;  1WR1 B;  3AFH A;  2QPA A;  4MGY E;  1NY5 A;  4RF0 A;  2F5P A;  3UMM A;  1IQP A;  2DAG A;  1WGL A;  3HU1 A;  4JI5 M;  4GMQ A;  3FYD A;  4I8O A;  4YY3 M;  3JR4 A;  4M0W A;  3CF0 A;  1QYR A;  1XC8 A;  2XSZ D;  3NBI A;  4FWH A;  4B3S M;  4M0D A;  4JI0 M;  1VQ1 A;  2KRU A;  4Q7J A;  2APL A;  2KHH A;  1IFY A;  3EIH A;  2FOI C;  2L7I A;  1CUK A;  4LF9 M;  2VQF M;  2VF8 A;  4JI8 M;  2KZS A;  1LV7 A;  3RFW A;  3E9S A;  4KOD A;  2LVP C;  2YFQ A;  2DWM A;  4B7H A;  3Q8X A;  1Z5A A;  3KDS E;  2O25 A;  4Z8X A;  1MN3 A;  3FTD A;  3GQ4 A;  5ITQ A;  1N34 M;  4XK8 F;  3GLG E;  4QOZ C;  1SXJ E;  3MK6 A;  3TPZ A;  2DI0 A;  1T3T A;  2QQ8 A;  4G4O A;  1N32 M;  2RKO A;  3W0F A;  2XZU A;  1E9S A;  1Q02 A;  4BBA A;  2KNZ A;  3NWL A;  2X8A A;  2DVW B;  4OU7 A;  3GPU A;  4LY6 A;  3AOG A;  2LHG A;  5ITT A;  4LF7 M;  3R9X B;  2UUC M;  2N35 A;  2HAK A;  4G4Q A;  2UXB M;  4JYA M;  2OOA A;  1OFI A;  4MGK E;  3GPY A;  2WSF F;  2DAI A;  1ORY B;  3QYB A;  1NO1 A;  5L8R F;  2K0B X;  4JI7 M;  4REZ A;  1NV8 A;  2LVQ D;  3IEC A;  4CHT B;  5BR8 M;  1DV0 A;  1UFZ A;  3JAM S;  3VK8 A;  1XXH B;  2CE7 A;  2JXN A;  4TUW A;  4LFC M;  4GRI A;  2BJV A;  1G71 A;  4NL4 H;  1TH2 A;  1WJ7 A;  3L27 A;  1D0K A;  1NV9 A;  1PM5 A;  4MB7 A;  1DGH A;  3TWL A;  3R8F A;  1MJG M;  1VEG A;  4R3D A;  3VDP A;  3W68 A;  2G3Q A;  4P17 A;  3L2A A;  4OVZ A;  2C98 A;  3HX3 A;  2R45 A;  4LJ5 A;  2R18 A;  3M7G A;  4UN2 B;  5EXP A;  3GLF A;  5A2Q S;  4DR5 M;  3D8B A;  2Z4R A;  1VDL A;  3HGI A;  4JV5 M;  2WZJ A;  4IBF A;  1IY1 A;  1IBK M;  2JY5 A;  4Z6Y A;  3WHL A;  4G4R A;  1HT1 E;  2FH0 A;  1TDZ A;  4M9S A;  4X66 M;  4DV3 M;  2XLJ A;  1KSF X;  2Y0T A;  2M5Z A;  4MGI E;  1T6O A;  4MGH A;  2HHH M;  3AL0 C;  2DZO B;  3GLG A;  1SXJ A;  3TQS A;  5KPR A;  1JR3 E;  1QDT A;  2FFJ A;  4FD2 A;  1OIP A;  1ZMV A;  3U6O A;  2Z8Y M;  1ZMU A;  2LVO C;  3FTC A;  4LJ8 A;  3FRI A;  3PNY A;  4PD2 A;  3KFU G;  2KNV A;  2HKJ A;  5E6J A;  4YHH M;  2QBY A;  5LMU M;  3U6E A;  4JN6 A;  3SC3 A;  1OAO C;  2D7E A;  4NSR A;  3TE6 A;  3GRY A;  3C58 A;  3U6C A;  1QZE A;  2F5Q A;  3W67 A;  3A45 A;  4HL4 A;  2BNK A;  3E4R A;  3T15 A;  1IN4 A;  2YQZ A;  4NRW A;  1KFV A;  2LVN C;  2J7N A;  4B3T M;  1YUB A;  1NHW C;  1DO0 A;  2XSZ A;  4W5W A;  1F4I A;  3UGJ A;  1R2Z A;  1DO2 A;  4LFB M;  3WHK A;  2DHY A;  2QEN A;  3C9P A;  1NJG A;  2MRO B;  1VEK A;  2R4J A;  1ZQ9 A;  1XMQ M;  1Z5C A;  1A5T A;  3LCV B;  3BXW A;  4LJ6 A;  3JR5 A;  4K0K M;  3PVS A;  1DGF A;  3K1J A;  1DGH B;  5EP4 A;  2ZAM A;  5EP2 A;  2CWB A;  4DV0 M;  1V34 A;  3KW6 A;  1HQC A;  2C99 A;  4AI6 A;  2WSC F;  1NY6 A;  5ITY A;  4B3M M;  2L4E A;  3U60 A;  4BLC A;  1NVM A;  4OVZ B;  1QVR A;  3AKZ A;  3FD9 A;  4DR6 M;  3AOE A;  2R0I A;  2CFO A;  4HLQ A;  3GLF B;  2D7G A;  2XF3 A;  4B7F A;  3HHY A;  4Y28 F;  3ZQJ A;  4DR1 M;  4QOS A;  4QNR A;  4RF1 A;  1V92 A;  4PDI A;  3LW5 F;  2FNA A;  4DV1 M;  4MGZ E;  2QNJ A;  4RKU F;  3ZC7 B;  2OOB A;  1GKI A;  3J2P B;  3VLF B;  1FJG M;  1JR3 A;  4LJ4 A;  2Q2E B;  3GLG B;  1SXJ B;  4RNA A;  1IN7 A;  1NJF A;  5EP3 A;  4LRS A;  3I51 A;  3PXG A;  3J81 S;  3ILK A;  1NSF A;  3UZU A;  2DXI A;  4S12 A;  3GPP A;  3KOW E;  3HJQ A;  2Y20 A;  4PCZ A;  3VKG A;  3IG5 A;  4P16 A;  5EXT A;  1DGG A;  1OFH A;  2K47 A;  1OJL A;  1EFU B;  2QBY B;  1UM8 A;  1PJJ A;  1GO5 A;  3KOZ E;  1S3S A;  2XFS A;  2QSF X;  2XGN A;  2VQE M;  2K6B A;  1SG9 A;  3FRH A;  3OTO M;  2R46 A;  2J5Y A;  1J5E M;  4L8R C;  2ERC A;  2E5L M;  3CF2 A;  3A46 A;  3FUX A;  3CTW B;  3VDU A;  1Y8G A;  1L2B A;  2F4V M;  3RE8 A;  3U5Z A;  3FE3 A;  2OO9 A;  4D80 A;  1Q3B A;  2V1U A;  2KXE A;  2XFT A;  2JZ1 A;  2DWL A;  3CGW A;  1WIV A;  7CAT A;  4DV2 M;  4IBG A;  3B9P A;  2WSE F;  2MGW A;  3K9O A;  4IBE A;  3L26 A;  2FS1 A;  2LXE A;  3GO8 A;  3U60 B;  3LMM A;  3B89 A;  1D2N A;  4HEO A;  4XGI A;  1N36 M;  4FCW A;  4NRV A;  1V33 A;  4LGY A;  2CUZ A;  5FLX S;  3C3E A;  3SAU A;  4KO8 A;  2OPF A;  5KPT A;  4DR4 M;  2CHQ A;  1QAO A;  2LTU A;  4GC5 A;  1XWI A;  1R2Y A;  2CV0 A;  2QZ4 A;  4CGY B;  5ITR A;  3L28 A;  5LMN M;  2Z3X A;  3SAR A;  3Q8G A;  4EIW A;  3FTE A;  1N78 A;  2R62 A;  4WP2 A;  1MX0 A;  3PNV A;  3IG8 A;  3ZH9 B;  5F3W A;  1YSY A;  3GRU A;  1E9R A;  1H6U A;  2O01 F;  4LCB A;  4G4N A;  2RGO A;  2UXD M;  3IHP A;  3VFD A;  4X64 M;  2Z4S A;  2G5G X;  1FNN A;  3VK7 A;  5JI3 E;  4AKI A;  1GVN A;  1WXQ A;  3LQR A;  3H4M A;  2CEA A;  2ZM6 M;  3SAW A;  2CHG A;  2LWX A;  5ITX E;  1RU3 A;  1OIZ A;  3HKP A;  4M9Z A;  1N33 M;  3GQ3 A;  1HT2 E;  1G8P A;  3KS4 A;  1PGY A;  3K92 A;  3TWK A;  3SFZ A;  5IT9 S;  4ANR A;  4JI2 M;  3B7Z A;  1W5S A;  2H5X A;  3T1H M;  1JB0 F;  5KQ8 A;  1HNX M;  2BWE A;  1R7R A;  1TGU A;  4ZPX A;  4GKJ M;  3U5Z B;  4G6Z A;  2UUA M;  1TF0 B;  1EIJ A;  3GLH E;  2H1R A;  4FCV A;  2A5Y B;  2B3T A;  4IBJ A;  4X62 M;  4L6V 6;  1K3W A;  2VII A; 
#chains in the Genus database with same CATH homology
 4P17 A;  3HZJ A;  3QYE A;  3QYB A;  4NC6 A;  2QQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...