4P17A

Crystal structure of the chlamydomonas flagellar rabgap tbc domain.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
301
structure length
288
Chain Sequence
b'VHDLYGFPIQEDERRSCDVNAEREVPLWQHYIEKDKLPSNETKLKEMIRKGVPPTLRNWVWMETSGANKKKAGHAANYYSIMVKAGEESQYKKDIETDSTHTFPDHPWLSSPDGRAALCRVLQAYSVHNERVGYVRAMNTIVGLMLVALNRNEEAAFWLLAALVEDILYPGTYSRMRALDELIGTKLPRLQQHFQAIDFDISMLATDWYLCLFSVSLPSETVMRTWDSLFYEGPKILFRVALAMLKIYEDNMLRVGDAGELLMRMRNAAATMHQRDVLMATAFDHIGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RabGAP/TBC protein
publication title Crystal structure of a Chlamydomonas reinhardtii flagellar RabGAP TBC-domain at 1.8 angstrom resolution.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Unknown function
total genus 110
structure length 288
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4p17A02
3QYEA 4NC6A 2QQ8A 3HZJA 3QYBA 4P17A
chains in the Genus database with same CATH superfamily
1K3XA 2X8AA 4WURA 5EP3A 1C1KA 3H4JA 1OFHA 4F2LA 2ZM6M 2QSFX 2KNVA 1R5LA 1D2NA 1J7KA 2JXNA 3CF2A 1Z59A 4QHTA 3AV0A 4OU7A 3FTCA 5EP1A 4NXNM 3KP0E 4GKKM 1I4WA 5DYGA 3U60A 4D82A 3JR4A 1ZAEA 1HJPA 2UU9M 2DWMA 1SXJC 2KHHA 4RF1A 1N78A 3T38A 7CATA 1G3IA 5BPVA 4B3MM 1KSFX 3K2LA 1SXJE 1PJJA 5H37D 2RRUA 3GLGB 2D7HA 3W0LB 2JNHA 2BWBA 2J7NA 4G4RA 4JI2M 3KOYE 4KO8A 3KOXE 3DZDA 1NHGC 2ERCA 3SATA 3AFHA 4Q7JA 5C1BA 1L8QA 3J81S 4LG2A 1TGUA 4GHLA 3CF0A 4M9XA 3V76A 1QAMA 2NQ8C 4IJFA 1MX0A 2GNOA 2C9OA 2CRUA 3VFDA 1FNNA 4W5WA 2QQ8A 3K8ZA 3I4VA 1DGGA 1H6UA 2VF7A 1HNZM 1JR3D 4LF7M 3U6OA 1IFYA 1Z5BA 3J7BA 1Q02A 1XMOM 1QANA 3IECA 3U6DA 2WZJA 1N36M 1GL7A 1Y8GA 3UZUA 4KLNA 3AKZA 1HNWM 1V34A 3FD9A 2HL7A 3LMMA 4AG6A 1T3TA 3T6PA 3TPZA 3U5ZA 2JZ1A 4OVZB 3FUWA 4FW9A 1LV7A 2KW0A 2F5PA 1VDLA 1XXHB 3B7ZA 1MJGM 3PNYA 2WSEF 4P17A 2L4EA 3SC3A 3TL4X 2K0BX 2I7PA 1TDHA 5ITQA 4JV5M 2JY6B 4Y28F 4LF9M 3LVVA 4DUZM 1DO2A 2EJSA 1DGBA 1C7YA 2F5QA 4QNRA 2CHGA 2EA0A 3KVWA 3BOSA 1J5EM 4GIPA 3AOEA 3LQRA 1GJSA 4DV7M 5FTJA 3GLIB 2HWJA 2XZFA 4M9SA 4UN2B 4CJ6A 1SXJD 2VDBB 3FTFA 1NY5A 4LFCM 4REZA 1OFIA 2BJVA 1DGHB 1EE8A 1Z5AA 2FS1A 4X64M 1QVRA 4G3OA 5ITYA 2LVAA 3ILKA 4IJEA 3HHYA 1NNJA 2CV1A 3D8BA 2XSZD 3H4MA 4DV5M 1ZMVA 3VDUA 4AKIA 3GRRA 3Q8GA 4L8RC 3B9PA 3QYBA 2OQ4A 1W5SA 1N34M 1QYRA 2R45A 1W5TA 3HX3A 4DV0M 2H1RA 1K82A 3BBZA 3TWMA 3HZJA 5FTKA 1YSYA 3BXWA 1OAOC 3M0EA 4ZPXA 4L15A 2KDLA 2L7IA 3A42A 3C58A 1UM8A 3R8FA 3AOGA 3I51A 4MGZE 3GLHB 3B7QA 4B7GA 2RGHA 3E4RA 4GC9A 4L78A 5KO3A 5ITTA 4JI1M 2JA2A 2R46A 2N35A 2B3TA 2LH0A 3EIHA 2H5XA 1HQCA 2KNAA 1GO5A 3W0FA 3KS4A 2F5SA 1NSFA 3HHZA 3RFWA 3HU1A 3CTWB 2C96A 3U61A 1HNXM 1P3QQ 5KPRA 1QZEA 2O5RA 2KEBA 2LVQD 2Q2EB 2VF8A 2ZAMA 4LRSA 1D0LA 4DR1M 1PJQA 4GH9A 1NJGA 1VG5A 4IBGA 5FTMA 3SYLA 2VIIA 3LCUA 1XB2B 3FUVA 4IBCA 3THGA 5IT9S 3K92A 4P16A 5A2QS 3LQQA 1TH3A 1VEJA 4AW4A 2VQEM 3ZC7B 4DR6M 3ZQJA 2CHQA 3A98B 3SAUA 1IBKM 2XFTA 4B3TM 4KHPM 3SFZA 4R71A 4A3VB 2EKKA 1Q3BA 1TF0B 2MROB 2JP7A 2HKJA 3KXEC 4YHHM 2DWZB 1IQPA 2BWEA 4IBFA 2DAIA 4LGMA 2C98A 3M7GA 2FOIC 4JYAM 2LBCA 1AIPC 1ZV1A 2KA6B 1KYIA 3DA1A 4LJAA 1PGYA 2KNZA 2JY7A 5LMNM 1X37A 1SXJB 4DR2M 2O25A 4B3RM 4WP2A 3D8LA 3FUXA 1R2YA 1VQ1A 2CV2A 2QBYB 1J09A 4PDIA 3VK7A 3W68A 4K0KM 2LTUA 4JI3M 1GKIA 1E9RA 2XFSA 4R7GA 2F4VM 1WGLA 3KS8A 2MJ5B 2MGWA 2RGOA 4EIWA 2AHMA 1L2DA 5L8RF 1WXQA 2UUBM 4AKHA 3HJQA 1K3WA 2YR0A 4LGYA 2QP9X 4AZFA 1VDDA 1I94M 1IN4A 5DFLA 1NHWC 4IBBA 4XGIA 2V6ZM 2QZ4A 2R62A 3FUTA 3FRHA 4I4LA 1QAQA 5EXPA 3L28A 5DNYA 4CGYB 2EO2A 3RGPA 1NY6A 3SMPA 4B7FA 1GL6A 4I81A 4G6ZA 1BVSA 3LVWA 4JI4M 4IBIA 2UXBM 1WR1B 2EKFA 2DENA 3GP1A 3R9XB 2FFJA 4LZZA 3WHKA 3A46A 2DWLA 3SAVA 4NRWA 2R4JA 2CV0A 2D7GA 3AOEC 2XZUA 2CUZA 4Z8XA 2QPAA 2YFQA 3K9PA 1AUAA 2DZNB 2C9CA 2FE8A 5IREB 3TWLA 1IN8A 4GHAA 3VKHA 1HT2E 4QHSA 2ZTDA 4I8OA 1QZMA 3HGIA 3FRIA 2LXEA 1F4IA 3NWLA 5ITRA 1V33A 1DO0A 2Z8YM 3GRVA 4DUYM 3HU3A 1CUKA 2C5RA 3K9OA 2L2DA 1Q39A 5BR8M 1L2BA 1HT1E 1IBLM 4L16A 5EXXA 3HU2A 3GPUA 2MH8A 4CIZA 4QNMA 1YUBA 4II7A 1S3SA 2DVWB 2JUJA 2ZTCA 4LFBM 3FUUA 4IBKA 1L2CA 4YY3M 2DZOB 1PJSA 2R18A 2J7OA 4LCBA 1G71A 4DBGB 4DR5M 3K1JA 1T43A 1T6OA 3KP1E 2OOAA 3QWLA 3J7AS 2DNAA 2WSFF 2K47A 3VK8A 1R7RA 1V92A 1QQWA 1IXZA 1NV9A 2XH9A 3VKGA 1WJ7A 3MJ5A 4HLQA 1IY0A 4MGIE 4BB9A 2Y0TA 5EXTA 2BJWA 3KFUG 3Q8XA 2Y20A 1G59A 1NNUC 2DAGA 2M60A 4GEWA 4CHTB 3RE8A 1QDTA 2R65A 1QUSA 3LW5F 4JI7M 4LJ4A 2DKLA 2M5ZA 2J5YA 3DFZA 3CF6E 3PNVA 5IZ7D 2X49A 3C9PA 3I01M 1XWIA 3LCVB 5KQ8A 3GLFE 3GPXA 1ZQ9A 3GQ5A 3NBXX 1JQJC 5ITXA 1XHBA 3U6PA 1XC8A 3U6LA 3U60B 8CATA 3KDSE 3UJNA 3U6QA 3CGWA 2FNAA 3U6CA 3IHPA 2XGNA 3TE6A 4DR3M 2A5YB 4LJ8A 4RF0A 3GRYA 4AQYM 3FYCA 4GRIA 1GABA 1TH4A 2Z4RA 1Q3CA 2LWXA 1QUTA 3SASA 1IY2A 3E9SA 1G4AE 2VQFM 4G4QA 5KPTA 2UXCM 2LNHC 3ZCBB 5F3WA 2XEPA 4OVZA 1PJTA 2OOBA 1G41A 4JN6A 3GLFA 1IN6A 1XMQM 2XF3A 2HCBA 2DAEA 2YQZA 2DXIA 2V1CA 1EFUB 1E94E 4JI6M 3MK6A 2CP8A 3J80S 1N77A 4DV6M 2W82A 2ZAOA 4Z6YA 2UUAM 2DHYA 2YNMD 2L09A 2DWNA 2JZ0A 4LJ7A 3PXGA 3GLIA 1HR0M 2CEAA 2K9DA 3IG8A 4FCWA 5KPZA 3PFIA 4X65M 3OTOM 1L1TA 1E32A 4NRVA 3U5ZB 1DGHA 1OJLA 3TWKA 3QAUA 4GC5A 1Z5CA 1OIZA 2R44A 4PT5A 2QCUA 2BNKA 3GPPA 4OW0A 4M9ZA 1NO1A 2KZSA 2L6OA 1XNRM 1TH2A 3SAWA 3ZH9B 1JR3E 5EXSA 3E46A 1PRBA 1SG9A 5DYIA 3HWSA 5FTLA 3GQ4A 4B3SM 4X66M 2C99A 1D0MA 2O01F 3SMSA 4R3DA 1OIPA 5FSWA 4RKUF 4X62M 4LF5M 1IXSA 4TUWA 1ORYB 1QDRA 2WSCF 3GLHA 3SHGB 3T1YM 3L2AA 1IN7A 1TR8A 2Z3XA 3HHWA 3C3DA 4LF6M 3FE3A 4AG5A 5E6JA 3T1HM 4FVMA 1YLAA 2JY5A 4BBAA 1ZMUA 3IG5A 1ZMWA 3L26A 3GPYA 4LJ6A 4LY6A 5EJCA 1JR3A 4B7HA 3JR5A 4IBEA 3FTDA 2P5TA 2LVOC 2KXEA 4ITQA 1GJTA 3GRUA 1XNQM 2LVNC 5LMUM 3L27A 4LJ9A 2QNJA 2KRUA 1MN3A 2E5LM 3U6SA 3W67A 4NSOB 2D7EA 4L4UA 2APLA 3PVSA 1TDZA 2LVPC 2QHOB 3QYEA 4B08A 3MHVC 2R4EA 1GLNA 4NSRA 4MGHA 1IBMM 4GKJM 3B89A 3E21A 4GMQA 4WW0A 2K6BA 2QENA 4GITA 4MH0E 1IN5A 4JI0M 3RGSA 2HAKA 4PCZA 3UGJA 4DR7M 1VEGA 4DV1M 3J27B 3VLFB 4MB7A 3U61B 4FCTA 2FH0A 4LFAM 1RU3A 1SXJA 2JY8A 3KSXA 3GLGE 4I5SA 2ZANA 3EIEA 4LRTA 4MGKE 1KFVA 1JB0F 5ITUA 2QBYA 5JI2E 1FJGM 3C3EA 1WGNA 3WHLA 4F1IA 3JAMS 4NXMM 3FTEA 1MU5A 1Z6TA 3TQSA 2MR9A 2XSZA 5ITXE 2KRKA 3GLFB 4M0DA 3U6MA 5E26A 4NL4H 3SARA 4QOSA 2GQFA 3HY5A 1EIJA 5FTNA 1N32M 1R2ZA 4G4NA 1LTMA 4IBDA 3L29A 1DGFA 4HEOA 3UK6A 4QOZC 4AKGA 3GLGA 2G3QA 2HHHM 1OQYA 2Y0QA 2ZBKB 3HJ8A 3F92A 4FCVA 4MM3B 2CE7A 4LF8M 4DR4M 1UFZA 1GVNA 1XXHE 1YE9A 2I7NA 3GO8A 2F5OA 4DV4M 3FYDA 1WIVA 2JWSA 3B7NA 1IY1A 4JXJA 1L1ZA 4NOOB 2F5NA 2L4FA 2DAKA 1HQYE 1VEKA 2CHVA 2X4AA 2UXDM 2R6FA 2KZUA 2Z7JA 2DAMA 3DOAA 3AJIB 4RNAA 1OTRA 4AI6A 4DV3M 3GLIE 3MMPA 2G8LA 3KW6A 4G4OA 3I4YA 1PJIA 1IXSB 3L25A 1D0KA 1QAOA 3I04M 3A45A 4IBJA 3VDPA 4MGYE 3M6AA 5C18A 5IWAM 5FLXS 4JI8M 3J2PB 4IIWA 2DZLA 1R6BX 3KSJA 5EP4A 4ANRA 2OPFA 2OO9A 3KOWE 4FD2A 2UUCM 3HJSA 1N75A 1OAIA 1XXHA 3SYKA 1R4GA 2CWBA 1E9SA 1NV8A 3HKPA 1NJFA 2Z4SA 4XBOA 1PM5A 2R0IA 4PDGA 1OKSA 3HHXA 4NC6A 3GQ3A 1IXRC 4S12A 4LF4M 3KOZE 2LHCA 5EP2A 1A5TA 2DHRA 3NBIA 2LHGA 3UMMA 5GKNA 2CFOA 2G5GX 4XK8F 4BLCA 5KQDA 4CISA 1G8PA 4LZJA 3GLHE 3U6EA 5JI3E 4D81A 2L7HA 3SHFA 4D80A 1N33M 5EQTA 4KODA 4JI5M 4L6V6 2DI0A 2Y21A 1TTEA 1IM2A 4LJ5A 4M0WA 2V1UA 2EUCA 4FWGA 3T15A 4DV2M 3FKEA 3AL0C 4FWDA 2RKOA 1NVMA 3B74A 4FWHA 4OX9M 4PD2A 4KT0F 2XLJA 4HL4A 1WHCA 3SBJA 1DV0A
chains in the Genus database with same CATH topology
3QYEA 4NC6A 2QQ8A 3HZJA 3QYBA 4P17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYE A;  4NC6 A;  2QQ8 A;  3HZJ A;  3QYB A;  4P17 A; 
#chains in the Genus database with same CATH topology
 1K3X A;  2X8A A;  4WUR A;  5EP3 A;  1C1K A;  3H4J A;  1OFH A;  4F2L A;  2ZM6 M;  2QSF X;  2KNV A;  1R5L A;  1D2N A;  1J7K A;  2JXN A;  3CF2 A;  1Z59 A;  4QHT A;  3AV0 A;  4OU7 A;  3FTC A;  5EP1 A;  4NXN M;  3KP0 E;  4GKK M;  1I4W A;  5DYG A;  3U60 A;  4D82 A;  3JR4 A;  1ZAE A;  1HJP A;  2UU9 M;  2DWM A;  1SXJ C;  2KHH A;  4RF1 A;  1N78 A;  3T38 A;  7CAT A;  1G3I A;  5BPV A;  4B3M M;  1KSF X;  3K2L A;  1SXJ E;  1PJJ A;  5H37 D;  2RRU A;  3GLG B;  2D7H A;  3W0L B;  2JNH A;  2BWB A;  2J7N A;  4G4R A;  4JI2 M;  3KOY E;  4KO8 A;  3KOX E;  3DZD A;  1NHG C;  2ERC A;  3SAT A;  3AFH A;  4Q7J A;  5C1B A;  1L8Q A;  3J81 S;  4LG2 A;  1TGU A;  4GHL A;  3CF0 A;  4M9X A;  3V76 A;  1QAM A;  2NQ8 C;  4IJF A;  1MX0 A;  2GNO A;  2C9O A;  2CRU A;  3VFD A;  1FNN A;  4W5W A;  2QQ8 A;  3K8Z A;  3I4V A;  1DGG A;  1H6U A;  2VF7 A;  1HNZ M;  1JR3 D;  4LF7 M;  3U6O A;  1IFY A;  1Z5B A;  3J7B A;  1Q02 A;  1XMO M;  1QAN A;  3IEC A;  3U6D A;  2WZJ A;  1N36 M;  1GL7 A;  1Y8G A;  3UZU A;  4KLN A;  3AKZ A;  1HNW M;  1V34 A;  3FD9 A;  2HL7 A;  3LMM A;  4AG6 A;  1T3T A;  3T6P A;  3TPZ A;  3U5Z A;  2JZ1 A;  4OVZ B;  3FUW A;  4FW9 A;  1LV7 A;  2KW0 A;  2F5P A;  1VDL A;  1XXH B;  3B7Z A;  1MJG M;  3PNY A;  2WSE F;  4P17 A;  2L4E A;  3SC3 A;  3TL4 X;  2K0B X;  2I7P A;  1TDH A;  5ITQ A;  4JV5 M;  2JY6 B;  4Y28 F;  4LF9 M;  3LVV A;  4DUZ M;  1DO2 A;  2EJS A;  1DGB A;  1C7Y A;  2F5Q A;  4QNR A;  2CHG A;  2EA0 A;  3KVW A;  3BOS A;  1J5E M;  4GIP A;  3AOE A;  3LQR A;  1GJS A;  4DV7 M;  5FTJ A;  3GLI B;  2HWJ A;  2XZF A;  4M9S A;  4UN2 B;  4CJ6 A;  1SXJ D;  2VDB B;  3FTF A;  1NY5 A;  4LFC M;  4REZ A;  1OFI A;  2BJV A;  1DGH B;  1EE8 A;  1Z5A A;  2FS1 A;  4X64 M;  1QVR A;  4G3O A;  5ITY A;  2LVA A;  3ILK A;  4IJE A;  3HHY A;  1NNJ A;  2CV1 A;  3D8B A;  2XSZ D;  3H4M A;  4DV5 M;  1ZMV A;  3VDU A;  4AKI A;  3GRR A;  3Q8G A;  4L8R C;  3B9P A;  3QYB A;  2OQ4 A;  1W5S A;  1N34 M;  1QYR A;  2R45 A;  1W5T A;  3HX3 A;  4DV0 M;  2H1R A;  1K82 A;  3BBZ A;  3TWM A;  3HZJ A;  5FTK A;  1YSY A;  3BXW A;  1OAO C;  3M0E A;  4ZPX A;  4L15 A;  2KDL A;  2L7I A;  3A42 A;  3C58 A;  1UM8 A;  3R8F A;  3AOG A;  3I51 A;  4MGZ E;  3GLH B;  3B7Q A;  4B7G A;  2RGH A;  3E4R A;  4GC9 A;  4L78 A;  5KO3 A;  5ITT A;  4JI1 M;  2JA2 A;  2R46 A;  2N35 A;  2B3T A;  2LH0 A;  3EIH A;  2H5X A;  1HQC A;  2KNA A;  1GO5 A;  3W0F A;  3KS4 A;  2F5S A;  1NSF A;  3HHZ A;  3RFW A;  3HU1 A;  3CTW B;  2C96 A;  3U61 A;  1HNX M;  1P3Q Q;  5KPR A;  1QZE A;  2O5R A;  2KEB A;  2LVQ D;  2Q2E B;  2VF8 A;  2ZAM A;  4LRS A;  1D0L A;  4DR1 M;  1PJQ A;  4GH9 A;  1NJG A;  1VG5 A;  4IBG A;  5FTM A;  3SYL A;  2VII A;  3LCU A;  1XB2 B;  3FUV A;  4IBC A;  3THG A;  5IT9 S;  3K92 A;  4P16 A;  5A2Q S;  3LQQ A;  1TH3 A;  1VEJ A;  4AW4 A;  2VQE M;  3ZC7 B;  4DR6 M;  3ZQJ A;  2CHQ A;  3A98 B;  3SAU A;  1IBK M;  2XFT A;  4B3T M;  4KHP M;  3SFZ A;  4R71 A;  4A3V B;  2EKK A;  1Q3B A;  1TF0 B;  2MRO B;  2JP7 A;  2HKJ A;  3KXE C;  4YHH M;  2DWZ B;  1IQP A;  2BWE A;  4IBF A;  2DAI A;  4LGM A;  2C98 A;  3M7G A;  2FOI C;  4JYA M;  2LBC A;  1AIP C;  1ZV1 A;  2KA6 B;  1KYI A;  3DA1 A;  4LJA A;  1PGY A;  2KNZ A;  2JY7 A;  5LMN M;  1X37 A;  1SXJ B;  4DR2 M;  2O25 A;  4B3R M;  4WP2 A;  3D8L A;  3FUX A;  1R2Y A;  1VQ1 A;  2CV2 A;  2QBY B;  1J09 A;  4PDI A;  3VK7 A;  3W68 A;  4K0K M;  2LTU A;  4JI3 M;  1GKI A;  1E9R A;  2XFS A;  4R7G A;  2F4V M;  1WGL A;  3KS8 A;  2MJ5 B;  2MGW A;  2RGO A;  4EIW A;  2AHM A;  1L2D A;  5L8R F;  1WXQ A;  2UUB M;  4AKH A;  3HJQ A;  1K3W A;  2YR0 A;  4LGY A;  2QP9 X;  4AZF A;  1VDD A;  1I94 M;  1IN4 A;  5DFL A;  1NHW C;  4IBB A;  4XGI A;  2V6Z M;  2QZ4 A;  2R62 A;  3FUT A;  3FRH A;  4I4L A;  1QAQ A;  5EXP A;  3L28 A;  5DNY A;  4CGY B;  2EO2 A;  3RGP A;  1NY6 A;  3SMP A;  4B7F A;  1GL6 A;  4I81 A;  4G6Z A;  1BVS A;  3LVW A;  4JI4 M;  4IBI A;  2UXB M;  1WR1 B;  2EKF A;  2DEN A;  3GP1 A;  3R9X B;  2FFJ A;  4LZZ A;  3WHK A;  3A46 A;  2DWL A;  3SAV A;  4NRW A;  2R4J A;  2CV0 A;  2D7G A;  3AOE C;  2XZU A;  2CUZ A;  4Z8X A;  2QPA A;  2YFQ A;  3K9P A;  1AUA A;  2DZN B;  2C9C A;  2FE8 A;  5IRE B;  3TWL A;  1IN8 A;  4GHA A;  3VKH A;  1HT2 E;  4QHS A;  2ZTD A;  4I8O A;  1QZM A;  3HGI A;  3FRI A;  2LXE A;  1F4I A;  3NWL A;  5ITR A;  1V33 A;  1DO0 A;  2Z8Y M;  3GRV A;  4DUY M;  3HU3 A;  1CUK A;  2C5R A;  3K9O A;  2L2D A;  1Q39 A;  5BR8 M;  1L2B A;  1HT1 E;  1IBL M;  4L16 A;  5EXX A;  3HU2 A;  3GPU A;  2MH8 A;  4CIZ A;  4QNM A;  1YUB A;  4II7 A;  1S3S A;  2DVW B;  2JUJ A;  2ZTC A;  4LFB M;  3FUU A;  4IBK A;  1L2C A;  4YY3 M;  2DZO B;  1PJS A;  2R18 A;  2J7O A;  4LCB A;  1G71 A;  4DBG B;  4DR5 M;  3K1J A;  1T43 A;  1T6O A;  3KP1 E;  2OOA A;  3QWL A;  3J7A S;  2DNA A;  2WSF F;  2K47 A;  3VK8 A;  1R7R A;  1V92 A;  1QQW A;  1IXZ A;  1NV9 A;  2XH9 A;  3VKG A;  1WJ7 A;  3MJ5 A;  4HLQ A;  1IY0 A;  4MGI E;  4BB9 A;  2Y0T A;  5EXT A;  2BJW A;  3KFU G;  3Q8X A;  2Y20 A;  1G59 A;  1NNU C;  2DAG A;  2M60 A;  4GEW A;  4CHT B;  3RE8 A;  1QDT A;  2R65 A;  1QUS A;  3LW5 F;  4JI7 M;  4LJ4 A;  2DKL A;  2M5Z A;  2J5Y A;  3DFZ A;  3CF6 E;  3PNV A;  5IZ7 D;  2X49 A;  3C9P A;  3I01 M;  1XWI A;  3LCV B;  5KQ8 A;  3GLF E;  3GPX A;  1ZQ9 A;  3GQ5 A;  3NBX X;  1JQJ C;  5ITX A;  1XHB A;  3U6P A;  1XC8 A;  3U6L A;  3U60 B;  8CAT A;  3KDS E;  3UJN A;  3U6Q A;  3CGW A;  2FNA A;  3U6C A;  3IHP A;  2XGN A;  3TE6 A;  4DR3 M;  2A5Y B;  4LJ8 A;  4RF0 A;  3GRY A;  4AQY M;  3FYC A;  4GRI A;  1GAB A;  1TH4 A;  2Z4R A;  1Q3C A;  2LWX A;  1QUT A;  3SAS A;  1IY2 A;  3E9S A;  1G4A E;  2VQF M;  4G4Q A;  5KPT A;  2UXC M;  2LNH C;  3ZCB B;  5F3W A;  2XEP A;  4OVZ A;  1PJT A;  2OOB A;  1G41 A;  4JN6 A;  3GLF A;  1IN6 A;  1XMQ M;  2XF3 A;  2HCB A;  2DAE A;  2YQZ A;  2DXI A;  2V1C A;  1EFU B;  1E94 E;  4JI6 M;  3MK6 A;  2CP8 A;  3J80 S;  1N77 A;  4DV6 M;  2W82 A;  2ZAO A;  4Z6Y A;  2UUA M;  2DHY A;  2YNM D;  2L09 A;  2DWN A;  2JZ0 A;  4LJ7 A;  3PXG A;  3GLI A;  1HR0 M;  2CEA A;  2K9D A;  3IG8 A;  4FCW A;  5KPZ A;  3PFI A;  4X65 M;  3OTO M;  1L1T A;  1E32 A;  4NRV A;  3U5Z B;  1DGH A;  1OJL A;  3TWK A;  3QAU A;  4GC5 A;  1Z5C A;  1OIZ A;  2R44 A;  4PT5 A;  2QCU A;  2BNK A;  3GPP A;  4OW0 A;  4M9Z A;  1NO1 A;  2KZS A;  2L6O A;  1XNR M;  1TH2 A;  3SAW A;  3ZH9 B;  1JR3 E;  5EXS A;  3E46 A;  1PRB A;  1SG9 A;  5DYI A;  3HWS A;  5FTL A;  3GQ4 A;  4B3S M;  4X66 M;  2C99 A;  1D0M A;  2O01 F;  3SMS A;  4R3D A;  1OIP A;  5FSW A;  4RKU F;  4X62 M;  4LF5 M;  1IXS A;  4TUW A;  1ORY B;  1QDR A;  2WSC F;  3GLH A;  3SHG B;  3T1Y M;  3L2A A;  1IN7 A;  1TR8 A;  2Z3X A;  3HHW A;  3C3D A;  4LF6 M;  3FE3 A;  4AG5 A;  5E6J A;  3T1H M;  4FVM A;  1YLA A;  2JY5 A;  4BBA A;  1ZMU A;  3IG5 A;  1ZMW A;  3L26 A;  3GPY A;  4LJ6 A;  4LY6 A;  5EJC A;  1JR3 A;  4B7H A;  3JR5 A;  4IBE A;  3FTD A;  2P5T A;  2LVO C;  2KXE A;  4ITQ A;  1GJT A;  3GRU A;  1XNQ M;  2LVN C;  5LMU M;  3L27 A;  4LJ9 A;  2QNJ A;  2KRU A;  1MN3 A;  2E5L M;  3U6S A;  3W67 A;  4NSO B;  2D7E A;  4L4U A;  2APL A;  3PVS A;  1TDZ A;  2LVP C;  2QHO B;  3QYE A;  4B08 A;  3MHV C;  2R4E A;  1GLN A;  4NSR A;  4MGH A;  1IBM M;  4GKJ M;  3B89 A;  3E21 A;  4GMQ A;  4WW0 A;  2K6B A;  2QEN A;  4GIT A;  4MH0 E;  1IN5 A;  4JI0 M;  3RGS A;  2HAK A;  4PCZ A;  3UGJ A;  4DR7 M;  1VEG A;  4DV1 M;  3J27 B;  3VLF B;  4MB7 A;  3U61 B;  4FCT A;  2FH0 A;  4LFA M;  1RU3 A;  1SXJ A;  2JY8 A;  3KSX A;  3GLG E;  4I5S A;  2ZAN A;  3EIE A;  4LRT A;  4MGK E;  1KFV A;  1JB0 F;  5ITU A;  2QBY A;  5JI2 E;  1FJG M;  3C3E A;  1WGN A;  3WHL A;  4F1I A;  3JAM S;  4NXM M;  3FTE A;  1MU5 A;  1Z6T A;  3TQS A;  2MR9 A;  2XSZ A;  5ITX E;  2KRK A;  3GLF B;  4M0D A;  3U6M A;  5E26 A;  4NL4 H;  3SAR A;  4QOS A;  2GQF A;  3HY5 A;  1EIJ A;  5FTN A;  1N32 M;  1R2Z A;  4G4N A;  1LTM A;  4IBD A;  3L29 A;  1DGF A;  4HEO A;  3UK6 A;  4QOZ C;  4AKG A;  3GLG A;  2G3Q A;  2HHH M;  1OQY A;  2Y0Q A;  2ZBK B;  3HJ8 A;  3F92 A;  4FCV A;  4MM3 B;  2CE7 A;  4LF8 M;  4DR4 M;  1UFZ A;  1GVN A;  1XXH E;  1YE9 A;  2I7N A;  3GO8 A;  2F5O A;  4DV4 M;  3FYD A;  1WIV A;  2JWS A;  3B7N A;  1IY1 A;  4JXJ A;  1L1Z A;  4NOO B;  2F5N A;  2L4F A;  2DAK A;  1HQY E;  1VEK A;  2CHV A;  2X4A A;  2UXD M;  2R6F A;  2KZU A;  2Z7J A;  2DAM A;  3DOA A;  3AJI B;  4RNA A;  1OTR A;  4AI6 A;  4DV3 M;  3GLI E;  3MMP A;  2G8L A;  3KW6 A;  4G4O A;  3I4Y A;  1PJI A;  1IXS B;  3L25 A;  1D0K A;  1QAO A;  3I04 M;  3A45 A;  4IBJ A;  3VDP A;  4MGY E;  3M6A A;  5C18 A;  5IWA M;  5FLX S;  4JI8 M;  3J2P B;  4IIW A;  2DZL A;  1R6B X;  3KSJ A;  5EP4 A;  4ANR A;  2OPF A;  2OO9 A;  3KOW E;  4FD2 A;  2UUC M;  3HJS A;  1N75 A;  1OAI A;  1XXH A;  3SYK A;  1R4G A;  2CWB A;  1E9S A;  1NV8 A;  3HKP A;  1NJF A;  2Z4S A;  4XBO A;  1PM5 A;  2R0I A;  4PDG A;  1OKS A;  3HHX A;  4NC6 A;  3GQ3 A;  1IXR C;  4S12 A;  4LF4 M;  3KOZ E;  2LHC A;  5EP2 A;  1A5T A;  2DHR A;  3NBI A;  2LHG A;  3UMM A;  5GKN A;  2CFO A;  2G5G X;  4XK8 F;  4BLC A;  5KQD A;  4CIS A;  1G8P A;  4LZJ A;  3GLH E;  3U6E A;  5JI3 E;  4D81 A;  2L7H A;  3SHF A;  4D80 A;  1N33 M;  5EQT A;  4KOD A;  4JI5 M;  4L6V 6;  2DI0 A;  2Y21 A;  1TTE A;  1IM2 A;  4LJ5 A;  4M0W A;  2V1U A;  2EUC A;  4FWG A;  3T15 A;  4DV2 M;  3FKE A;  3AL0 C;  4FWD A;  2RKO A;  1NVM A;  3B74 A;  4FWH A;  4OX9 M;  4PD2 A;  4KT0 F;  2XLJ A;  4HL4 A;  1WHC A;  3SBJ A;  1DV0 A; 
#chains in the Genus database with same CATH homology
 3QYE A;  4NC6 A;  2QQ8 A;  3HZJ A;  3QYB A;  4P17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...