4P17A

Crystal structure of the chlamydomonas flagellar rabgap tbc domain.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
301
structure length
288
Chain Sequence
b'VHDLYGFPIQEDERRSCDVNAEREVPLWQHYIEKDKLPSNETKLKEMIRKGVPPTLRNWVWMETSGANKKKAGHAANYYSIMVKAGEESQYKKDIETDSTHTFPDHPWLSSPDGRAALCRVLQAYSVHNERVGYVRAMNTIVGLMLVALNRNEEAAFWLLAALVEDILYPGTYSRMRALDELIGTKLPRLQQHFQAIDFDISMLATDWYLCLFSVSLPSETVMRTWDSLFYEGPKILFRVALAMLKIYEDNMLRVGDAGELLMRMRNAAATMHQRDVLMATAFDHIGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RabGAP/TBC protein
publication title Crystal structure of a Chlamydomonas reinhardtii flagellar RabGAP TBC-domain at 1.8 angstrom resolution.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Unknown function
total genus 110
structure length 288
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.270 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 putative rabgap domain of human tbc1 domain family member 14 like domains 4p17A02
3QYBA 4NC6A 3QYEA 4P17A 3HZJA 2QQ8A
chains in the Genus database with same CATH superfamily
2Y0QA 3T38A 4DV0M 2ZM6M 2F5QA 1N36M 4AI6A 4Z8XA 2DWNA 2Z3XA 1IY2A 3GRRA 2DAEA 2OOBA 3L29A 1NSFA 2QHOB 4GKJM 3J2PB 3TPZA 3GLFB 4LRSA 4IJEA 3MMPA 2JWSA 4DV2M 4I8OA 4OVZB 1QUTA 2ZAMA 3RE8A 4LRTA 2JXNA 4R3DA 2QBYA 4FWDA 1V92A 4LF5M 3HGIA 3KOXE 1DO0A 1OAOC 3J7AS 3LW5F 4MGZE 3TQSA 1N33M 3TWMA 2LHCA 4D81A 3C9PA 2DZLA 1XB2B 1Z6TA 2Y0TA 4M0DA 3GRYA 1Q02A 2BJVA 5LMUM 3VKGA 1SXJE 2QCUA 4KLNA 5ITQA 4QNMA 3I4YA 5DNYA 4IBGA 4B7GA 3K92A 4M9SA 5FLXS 1UM8A 4L8RC 1IN5A 1VEKA 3GQ5A 2O01F 2D7GA 2JZ0A 1W5SA 4JI7M 1XC8A 1T43A 1NY5A 1T6OA 1QAMA 1DGGA 5KQ8A 1K3WA 3U6LA 1FJGM 4LJ5A 5ITXE 3KOYE 2O5RA 4S12A 1NNJA 5KPZA 1ZMWA 4WURA 2F5SA 1D0KA 2EA0A 1R6BX 2JY7A 2XF3A 3LCVB 1SXJC 1PJSA 2H1RA 2F4VM 1MX0A 1IM2A 3CTWB 4IBBA 4L6V6 4NSOB 3IG8A 1G4AE 4RF1A 2J7NA 4DR6M 2BJWA 1K82A 2DVWB 2XLJA 3FD9A 4DV4M 3B9PA 4BB9A 3U6OA 3VK8A 4ANRA 2DZOB 4DV3M 1OFHA 3WHLA 2HAKA 2C98A 3HJSA 1PJQA 3M7GA 2VQFM 3TL4X 3A46A 2LHGA 3PFIA 1IXSB 3NWLA 2MH8A 4DR5M 2UXBM 3R9XB 5ITUA 1QAQA 3D8BA 3QYBA 3Q8XA 4MGYE 3GPYA 1IBKM 4LF8M 1Z5AA 4UN2B 1N34M 2KRKA 2KZUA 4MGKE 4DUZM 1NNUC 1OIPA 1GVNA 3AOEA 3GLFA 2CFOA 1RU3A 2I7PA 4DBGB 4NRWA 4KHPM 2FH0A 2HL7A 2LVOC 3MHVC 3ZH9B 2CE7A 1DGHB 2AHMA 2L7IA 1V34A 5EP3A 4FWGA 3B74A 1IY1A 1HQCA 3FTDA 3MK6A 1XMQM 2F5PA 3GQ4A 4NRVA 4Y28F 1NV9A 3K9OA 3GLIB 2V1UA 1JR3A 3SFZA 1Z5BA 5KPRA 2ZAOA 3AJIB 1G59A 4Z6YA 1QUSA 4AKGA 3FUVA 3M0EA 2R65A 2QQ8A 3U6PA 3KFUG 2R18A 2WZJA 2EKKA 3SC3A 4LF7M 3PXGA 1PJTA 5EXSA 2FS1A 3JAMS 2JY6B 2DHYA 1IN6A 2LWXA 3BXWA 3GLIE 2DENA 3HHWA 2E5LM 2FOIC 2QZ4A 1GO5A 4AW4A 3L25A 2OQ4A 4DV7M 2MJ5B 2R6FA 4GC9A 1R2ZA 1HNXM 4DV6M 3BBZA 1XWIA 1T3TA 1L1TA 2R0IA 2ZTDA 3DA1A 3IHPA 1G71A 2HWJA 4D82A 1J09A 1G3IA 4GHLA 3E4RA 1D2NA 1YSYA 1IBLM 3GLHE 2CP8A 1HR0M 1QDRA 1DGBA 1CUKA 1E32A 4FW9A 2NQ8C 1TDHA 3AV0A 3J80S 3I01M 1KSFX 1TDZA 1H6UA 1V33A 5KPTA 4FCWA 4F1IA 1L8QA 3KS4A 3SAVA 3HZJA 4MM3B 2L6OA 1IXSA 2ZANA 1IY0A 3T15A 3U5ZA 1KYIA 4WP2A 1EE8A 1SXJB 3KOZE 3KP0E 3HWSA 4FD2A 4LFAM 4JI5M 2DWMA 1NJGA 2CWBA 4RF0A 2UXDM 5DYGA 5EJCA 1J5EM 3NBXX 2EJSA 2DAIA 2FNAA 1EFUB 4OX9M 1N32M 2MGWA 1PGYA 2QSFX 3SBJA 1Y8GA 2Q2EB 3TWKA 4HLQA 2JP7A 2YFQA 2GNOA 4PDGA 4GIPA 5LMNM 3LQQA 4JI0M 2QPAA 1C1KA 3FRHA 5JI3E 2KXEA 1DGHA 3T1YM 3EIHA 1IBMM 1PM5A 4LJ6A 2APLA 2P5TA 3THGA 3VLFB 2Y21A 3GP1A 1BVSA 4P17A 3KP1E 1VDLA 1TGUA 1JB0F 2KNAA 3FRIA 4Q7JA 1LV7A 5EXTA 3VDPA 2I7NA 5ITRA 4NC6A 1HT1E 4KODA 2CV1A 2Z8YM 4HL4A 4LF9M 1IFYA 3SYLA 1G41A 3CF6E 3U61B 4M9ZA 4IBDA 2R4JA 4RNAA 3W68A 3SARA 4GEWA 3A42A 3SMPA 2KHHA 3FUWA 2OOAA 3C3EA 1ORYB 4KT0F 3FE3A 4QNRA 4G4QA 2LXEA 3BOSA 4MH0E 1QYRA 3KS8A 2CHQA 3RFWA 3VFDA 1XXHE 2OO9A 2XGNA 1TH3A 4OU7A 1D0LA 1L2DA 2C96A 3U6DA 3L27A 4XGIA 3W0LB 3GLGE 3HU1A 2RGOA 3R8FA 2FE8A 2M5ZA 1Q39A 4PDIA 3UJNA 4P16A 1EIJA 4MGHA 1P3QQ 4B3MM 3KSJA 4JI4M 4QOSA 4NOOB 1KFVA 4LF6M 1F4IA 3KW6A 2DAMA 4GRIA 2CV0A 2YQZA 1N77A 1GKIA 2CRUA 2LBCA 3B89A 3HU3A 4IBFA 5IZ7D 3SATA 3NBIA 1QANA 1NHGC 1E94E 1SXJD 3IG5A 5KO3A 2ZTCA 4LJ9A 4I5SA 4L78A 4QHTA 3PNYA 5FTJA 4DR7M 3QWLA 2QNJA 5EP2A 4NSRA 4GHAA 1XNRM 1G8PA 2WSFF 3K9PA 1IXRC 2HKJA 1SXJA 4YY3M 3U60B 2JUJA 4CISA 2QP9X 4OVZA 3GPXA 1GL6A 1GABA 4AG6A 3ILKA 3KSXA 3GPPA 5C1BA 3M6AA 4RKUF 5EQTA 2KRUA 4K0KM 4TUWA 4GITA 4X66M 4FCTA 1QAOA 4KO8A 2KZSA 1AUAA 2YR0A 1WIVA 1VEJA 1MU5A 2LVPC 2Z7JA 3Q8GA 4GH9A 5DYIA 4DR3M 5F3WA 4LY6A 2B3TA 2QBYB 1YLAA 3KXEC 3GO8A 3U6CA 1N78A 1ZV1A 1GJTA 2Z4SA 3C3DA 3KVWA 4G6ZA 5ITXA 1PJIA 4DR1M 4JI6M 1QQWA 1TTEA 2C9CA 3T1HM 1TF0B 3CF2A 4NL4H 1IN4A 3TWLA 4XK8F 1GL7A 3CGWA 3A98B 2CUZA 3D8LA 1DO2A 2YNMD 3DFZA 3GLHB 3W0FA 3FKEA 4REZA 3L26A 2UXCM 3FTEA 2WSEF 4EIWA 2C5RA 4LGYA 3U61A 5GKNA 2L7HA 3LQRA 1Z59A 4XBOA 2ZBKB 4LCBA 1HJPA 5JI2E 3RGSA 3J7BA 3HHZA 3HHYA 4QOZC 3TE6A 2RRUA 4B08A 4G4NA 3EIEA 2RKOA 4I4LA 2K0BX 4JI3M 3HX3A 2R44A 3SHFA 7CATA 5FSWA 1XNQM 4LFBM 3IECA 4CGYB 2OPFA 2DAKA 2W82A 3U6EA 2FFJA 2LTUA 4IBKA 4DR2M 4IBCA 4IBEA 1MN3A 3AOGA 3HHXA 3QYEA 1WXQA 3LVVA 4AKHA 2VDBB 4LZZA 4F2LA 2L4FA 3AFHA 3U6QA 2XZUA 3AL0C 4JYAM 2DNAA 2X49A 3FUTA 4FWHA 2K47A 4IIWA 3GRVA 3ZQJA 1R7RA 2KW0A 3FYCA 5FTLA 1HQYE 2JA2A 2KEBA 2DWZB 5IREB 4GKKM 3LMMA 4L4UA 2DI0A 2XSZD 5E26A 2LVAA 5C18A 3PNVA 2BWBA 4LJ8A 4PT5A 4BBAA 3UK6A 1OQYA 4G3OA 3W67A 4LG2A 2VF7A 2LVQD 1IN8A 1NVMA 1E9SA 1WHCA 4LJ4A 2V1CA 2Y20A 1VQ1A 4IBJA 3JR4A 3RGPA 1W5TA 3GPUA 4W5WA 4JI8M 3ZCBB 3SMSA 4ZPXA 4R71A 1WGLA 2LH0A 5E6JA 1QZMA 1WJ7A 4JXJA 2CV2A 3J81S 2A5YB 3U6SA 2UU9M 3UMMA 3C58A 1NJFA 2R45A 4DV5M 2XH9A 2Z4RA 1Z5CA 3I4VA 4CIZA 1OAIA 4G4RA 4BLCA 2DXIA 3GQ3A 3GLIA 4G4OA 3SAUA 3B7ZA 3VK7A 2L09A 3LVWA 1TH4A 3PVSA 2UUCM 2JY5A 1GLNA 1XXHB 2L4EA 1I4WA 2DKLA 4B7HA 1DV0A 4IBIA 4CJ6A 5H37D 1OKSA 4QHSA 2X8AA 3GLGB 5IT9S 3HJ8A 3GLFE 3H4MA 5ITTA 1Q3BA 2R46A 2X4AA 2ERCA 4WW0A 3SHGB 2GQFA 4JI1M 4DR4M 3GLHA 3B7QA 3U6MA 1OIZA 1MJGM 1OJLA 2D7HA 3DZDA 2EO2A 4A3VB 4DUYM 1ZMUA 2EUCA 5BPVA 1JQJC 3VDUA 1R2YA 2HCBA 5A2QS 3JR5A 5EP4A 2DZNB 2J5YA 3H4JA 4GC5A 3V76A 4FVMA 4LJAA 4IJFA 1PJJA 4M0WA 1JR3E 2LVNC 1WR1B 3HKPA 5BR8M 3SASA 2CHVA 2R4EA 4X62M 3FUXA 3B7NA 1NY6A 4GMQA 1J7KA 2C9OA 4D80A 1R5LA 1LTMA 3WHKA 3AOEC 2DAGA 3GRUA 1N75A 3E9SA 3LCUA 2XZFA 3SAWA 1ZQ9A 2M60A 2F5NA 2BNKA 1L2CA 4MB7A 1FNNA 3E46A 4OW0A 3CF0A 1VG5A 1VEGA 2BWEA 4NXMM 1HNZM 1L1ZA 1TH2A 2XEPA 4CHTB 2KNVA 2HHHM 3VKHA 2N35A 2RGHA 2QENA 2G5GX 4JN6A 1QDTA 4M9XA 1E9RA 1IQPA 1XHBA 3QAUA 1YUBA 2J7OA 3U5ZB 2KA6B 4JV5M 3SYKA 1L2BA 4LF4M 8CATA 1NHWC 1NV8A 1OTRA 4MGIE 2LNHC 1QVRA 3UGJA 4LFCM 3I04M 1HT2E 2V6ZM 5ITYA 4AZFA 3E21A 2XFSA 3FTCA 1NO1A 3HY5A 3FUUA 3J27B 2KDLA 1A5TA 2C99A 2K9DA 3UZUA 2D7EA 1X37A 3K1JA 3MJ5A 1YE9A 5IWAM 4I81A 5EXXA 3K2LA 4B3TM 3FYDA 4B7FA 1DGFA 1OFIA 1QZEA 4FCVA 4L16A 1GJSA 2DHRA 1IXZA 1S3SA 1JR3D 1XXHA 3I51A 1I94M 2G8LA 2G3QA 2VQEM 2WSCF 5FTNA 3GLGA 3HU2A 4LJ7A 2DWLA 4X65M 1PRBA 3K8ZA 1VDDA 4II7A 1HNWM 2XFTA 1K3XA 4LZJA 4B3SM 2JY8A 2VF8A 3F92A 2UUAM 5KQDA 4PD2A 1Q3CA 4AQYM 5L8RF 4DV1M 4ITQA 4B3RM 4PCZA 4AKIA 5FTMA 3ZC7B 1R4GA 4HEOA 2EKFA 4LGMA 1XMOM 2JNHA 2F5OA 5DFLA 3L28A 2O25A 1C7YA 2CHGA 2H5XA 1TR8A 2CEAA 3AKZA 3T6PA 4R7GA 3OTOM 1D0MA 2R62A 3KDSE 1UFZA 5EXPA 2KNZA 2VIIA 2UUBM 4AG5A 2MR9A 3FTFA 2K6BA 1WGNA 1ZMVA 3DOAA 3HJQA 2JZ1A 4NXNM 4YHHM 1IN7A 4X64M 2XSZA 4L15A 1SG9A 4JI2M 1AIPC 2L2DA 2MROB 3U60A 1ZAEA 3L2AA 3A45A 3KOWE 5FTKA 5EP1A
chains in the Genus database with same CATH topology
3QYBA 4NC6A 3QYEA 4P17A 3HZJA 2QQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYB A;  4NC6 A;  3QYE A;  4P17 A;  3HZJ A;  2QQ8 A; 
#chains in the Genus database with same CATH topology
 2Y0Q A;  3T38 A;  4DV0 M;  2ZM6 M;  2F5Q A;  1N36 M;  4AI6 A;  4Z8X A;  2DWN A;  2Z3X A;  1IY2 A;  3GRR A;  2DAE A;  2OOB A;  3L29 A;  1NSF A;  2QHO B;  4GKJ M;  3J2P B;  3TPZ A;  3GLF B;  4LRS A;  4IJE A;  3MMP A;  2JWS A;  4DV2 M;  4I8O A;  4OVZ B;  1QUT A;  2ZAM A;  3RE8 A;  4LRT A;  2JXN A;  4R3D A;  2QBY A;  4FWD A;  1V92 A;  4LF5 M;  3HGI A;  3KOX E;  1DO0 A;  1OAO C;  3J7A S;  3LW5 F;  4MGZ E;  3TQS A;  1N33 M;  3TWM A;  2LHC A;  4D81 A;  3C9P A;  2DZL A;  1XB2 B;  1Z6T A;  2Y0T A;  4M0D A;  3GRY A;  1Q02 A;  2BJV A;  5LMU M;  3VKG A;  1SXJ E;  2QCU A;  4KLN A;  5ITQ A;  4QNM A;  3I4Y A;  5DNY A;  4IBG A;  4B7G A;  3K92 A;  4M9S A;  5FLX S;  1UM8 A;  4L8R C;  1IN5 A;  1VEK A;  3GQ5 A;  2O01 F;  2D7G A;  2JZ0 A;  1W5S A;  4JI7 M;  1XC8 A;  1T43 A;  1NY5 A;  1T6O A;  1QAM A;  1DGG A;  5KQ8 A;  1K3W A;  3U6L A;  1FJG M;  4LJ5 A;  5ITX E;  3KOY E;  2O5R A;  4S12 A;  1NNJ A;  5KPZ A;  1ZMW A;  4WUR A;  2F5S A;  1D0K A;  2EA0 A;  1R6B X;  2JY7 A;  2XF3 A;  3LCV B;  1SXJ C;  1PJS A;  2H1R A;  2F4V M;  1MX0 A;  1IM2 A;  3CTW B;  4IBB A;  4L6V 6;  4NSO B;  3IG8 A;  1G4A E;  4RF1 A;  2J7N A;  4DR6 M;  2BJW A;  1K82 A;  2DVW B;  2XLJ A;  3FD9 A;  4DV4 M;  3B9P A;  4BB9 A;  3U6O A;  3VK8 A;  4ANR A;  2DZO B;  4DV3 M;  1OFH A;  3WHL A;  2HAK A;  2C98 A;  3HJS A;  1PJQ A;  3M7G A;  2VQF M;  3TL4 X;  3A46 A;  2LHG A;  3PFI A;  1IXS B;  3NWL A;  2MH8 A;  4DR5 M;  2UXB M;  3R9X B;  5ITU A;  1QAQ A;  3D8B A;  3QYB A;  3Q8X A;  4MGY E;  3GPY A;  1IBK M;  4LF8 M;  1Z5A A;  4UN2 B;  1N34 M;  2KRK A;  2KZU A;  4MGK E;  4DUZ M;  1NNU C;  1OIP A;  1GVN A;  3AOE A;  3GLF A;  2CFO A;  1RU3 A;  2I7P A;  4DBG B;  4NRW A;  4KHP M;  2FH0 A;  2HL7 A;  2LVO C;  3MHV C;  3ZH9 B;  2CE7 A;  1DGH B;  2AHM A;  2L7I A;  1V34 A;  5EP3 A;  4FWG A;  3B74 A;  1IY1 A;  1HQC A;  3FTD A;  3MK6 A;  1XMQ M;  2F5P A;  3GQ4 A;  4NRV A;  4Y28 F;  1NV9 A;  3K9O A;  3GLI B;  2V1U A;  1JR3 A;  3SFZ A;  1Z5B A;  5KPR A;  2ZAO A;  3AJI B;  1G59 A;  4Z6Y A;  1QUS A;  4AKG A;  3FUV A;  3M0E A;  2R65 A;  2QQ8 A;  3U6P A;  3KFU G;  2R18 A;  2WZJ A;  2EKK A;  3SC3 A;  4LF7 M;  3PXG A;  1PJT A;  5EXS A;  2FS1 A;  3JAM S;  2JY6 B;  2DHY A;  1IN6 A;  2LWX A;  3BXW A;  3GLI E;  2DEN A;  3HHW A;  2E5L M;  2FOI C;  2QZ4 A;  1GO5 A;  4AW4 A;  3L25 A;  2OQ4 A;  4DV7 M;  2MJ5 B;  2R6F A;  4GC9 A;  1R2Z A;  1HNX M;  4DV6 M;  3BBZ A;  1XWI A;  1T3T A;  1L1T A;  2R0I A;  2ZTD A;  3DA1 A;  3IHP A;  1G71 A;  2HWJ A;  4D82 A;  1J09 A;  1G3I A;  4GHL A;  3E4R A;  1D2N A;  1YSY A;  1IBL M;  3GLH E;  2CP8 A;  1HR0 M;  1QDR A;  1DGB A;  1CUK A;  1E32 A;  4FW9 A;  2NQ8 C;  1TDH A;  3AV0 A;  3J80 S;  3I01 M;  1KSF X;  1TDZ A;  1H6U A;  1V33 A;  5KPT A;  4FCW A;  4F1I A;  1L8Q A;  3KS4 A;  3SAV A;  3HZJ A;  4MM3 B;  2L6O A;  1IXS A;  2ZAN A;  1IY0 A;  3T15 A;  3U5Z A;  1KYI A;  4WP2 A;  1EE8 A;  1SXJ B;  3KOZ E;  3KP0 E;  3HWS A;  4FD2 A;  4LFA M;  4JI5 M;  2DWM A;  1NJG A;  2CWB A;  4RF0 A;  2UXD M;  5DYG A;  5EJC A;  1J5E M;  3NBX X;  2EJS A;  2DAI A;  2FNA A;  1EFU B;  4OX9 M;  1N32 M;  2MGW A;  1PGY A;  2QSF X;  3SBJ A;  1Y8G A;  2Q2E B;  3TWK A;  4HLQ A;  2JP7 A;  2YFQ A;  2GNO A;  4PDG A;  4GIP A;  5LMN M;  3LQQ A;  4JI0 M;  2QPA A;  1C1K A;  3FRH A;  5JI3 E;  2KXE A;  1DGH A;  3T1Y M;  3EIH A;  1IBM M;  1PM5 A;  4LJ6 A;  2APL A;  2P5T A;  3THG A;  3VLF B;  2Y21 A;  3GP1 A;  1BVS A;  4P17 A;  3KP1 E;  1VDL A;  1TGU A;  1JB0 F;  2KNA A;  3FRI A;  4Q7J A;  1LV7 A;  5EXT A;  3VDP A;  2I7N A;  5ITR A;  4NC6 A;  1HT1 E;  4KOD A;  2CV1 A;  2Z8Y M;  4HL4 A;  4LF9 M;  1IFY A;  3SYL A;  1G41 A;  3CF6 E;  3U61 B;  4M9Z A;  4IBD A;  2R4J A;  4RNA A;  3W68 A;  3SAR A;  4GEW A;  3A42 A;  3SMP A;  2KHH A;  3FUW A;  2OOA A;  3C3E A;  1ORY B;  4KT0 F;  3FE3 A;  4QNR A;  4G4Q A;  2LXE A;  3BOS A;  4MH0 E;  1QYR A;  3KS8 A;  2CHQ A;  3RFW A;  3VFD A;  1XXH E;  2OO9 A;  2XGN A;  1TH3 A;  4OU7 A;  1D0L A;  1L2D A;  2C96 A;  3U6D A;  3L27 A;  4XGI A;  3W0L B;  3GLG E;  3HU1 A;  2RGO A;  3R8F A;  2FE8 A;  2M5Z A;  1Q39 A;  4PDI A;  3UJN A;  4P16 A;  1EIJ A;  4MGH A;  1P3Q Q;  4B3M M;  3KSJ A;  4JI4 M;  4QOS A;  4NOO B;  1KFV A;  4LF6 M;  1F4I A;  3KW6 A;  2DAM A;  4GRI A;  2CV0 A;  2YQZ A;  1N77 A;  1GKI A;  2CRU A;  2LBC A;  3B89 A;  3HU3 A;  4IBF A;  5IZ7 D;  3SAT A;  3NBI A;  1QAN A;  1NHG C;  1E94 E;  1SXJ D;  3IG5 A;  5KO3 A;  2ZTC A;  4LJ9 A;  4I5S A;  4L78 A;  4QHT A;  3PNY A;  5FTJ A;  4DR7 M;  3QWL A;  2QNJ A;  5EP2 A;  4NSR A;  4GHA A;  1XNR M;  1G8P A;  2WSF F;  3K9P A;  1IXR C;  2HKJ A;  1SXJ A;  4YY3 M;  3U60 B;  2JUJ A;  4CIS A;  2QP9 X;  4OVZ A;  3GPX A;  1GL6 A;  1GAB A;  4AG6 A;  3ILK A;  3KSX A;  3GPP A;  5C1B A;  3M6A A;  4RKU F;  5EQT A;  2KRU A;  4K0K M;  4TUW A;  4GIT A;  4X66 M;  4FCT A;  1QAO A;  4KO8 A;  2KZS A;  1AUA A;  2YR0 A;  1WIV A;  1VEJ A;  1MU5 A;  2LVP C;  2Z7J A;  3Q8G A;  4GH9 A;  5DYI A;  4DR3 M;  5F3W A;  4LY6 A;  2B3T A;  2QBY B;  1YLA A;  3KXE C;  3GO8 A;  3U6C A;  1N78 A;  1ZV1 A;  1GJT A;  2Z4S A;  3C3D A;  3KVW A;  4G6Z A;  5ITX A;  1PJI A;  4DR1 M;  4JI6 M;  1QQW A;  1TTE A;  2C9C A;  3T1H M;  1TF0 B;  3CF2 A;  4NL4 H;  1IN4 A;  3TWL A;  4XK8 F;  1GL7 A;  3CGW A;  3A98 B;  2CUZ A;  3D8L A;  1DO2 A;  2YNM D;  3DFZ A;  3GLH B;  3W0F A;  3FKE A;  4REZ A;  3L26 A;  2UXC M;  3FTE A;  2WSE F;  4EIW A;  2C5R A;  4LGY A;  3U61 A;  5GKN A;  2L7H A;  3LQR A;  1Z59 A;  4XBO A;  2ZBK B;  4LCB A;  1HJP A;  5JI2 E;  3RGS A;  3J7B A;  3HHZ A;  3HHY A;  4QOZ C;  3TE6 A;  2RRU A;  4B08 A;  4G4N A;  3EIE A;  2RKO A;  4I4L A;  2K0B X;  4JI3 M;  3HX3 A;  2R44 A;  3SHF A;  7CAT A;  5FSW A;  1XNQ M;  4LFB M;  3IEC A;  4CGY B;  2OPF A;  2DAK A;  2W82 A;  3U6E A;  2FFJ A;  2LTU A;  4IBK A;  4DR2 M;  4IBC A;  4IBE A;  1MN3 A;  3AOG A;  3HHX A;  3QYE A;  1WXQ A;  3LVV A;  4AKH A;  2VDB B;  4LZZ A;  4F2L A;  2L4F A;  3AFH A;  3U6Q A;  2XZU A;  3AL0 C;  4JYA M;  2DNA A;  2X49 A;  3FUT A;  4FWH A;  2K47 A;  4IIW A;  3GRV A;  3ZQJ A;  1R7R A;  2KW0 A;  3FYC A;  5FTL A;  1HQY E;  2JA2 A;  2KEB A;  2DWZ B;  5IRE B;  4GKK M;  3LMM A;  4L4U A;  2DI0 A;  2XSZ D;  5E26 A;  2LVA A;  5C18 A;  3PNV A;  2BWB A;  4LJ8 A;  4PT5 A;  4BBA A;  3UK6 A;  1OQY A;  4G3O A;  3W67 A;  4LG2 A;  2VF7 A;  2LVQ D;  1IN8 A;  1NVM A;  1E9S A;  1WHC A;  4LJ4 A;  2V1C A;  2Y20 A;  1VQ1 A;  4IBJ A;  3JR4 A;  3RGP A;  1W5T A;  3GPU A;  4W5W A;  4JI8 M;  3ZCB B;  3SMS A;  4ZPX A;  4R71 A;  1WGL A;  2LH0 A;  5E6J A;  1QZM A;  1WJ7 A;  4JXJ A;  2CV2 A;  3J81 S;  2A5Y B;  3U6S A;  2UU9 M;  3UMM A;  3C58 A;  1NJF A;  2R45 A;  4DV5 M;  2XH9 A;  2Z4R A;  1Z5C A;  3I4V A;  4CIZ A;  1OAI A;  4G4R A;  4BLC A;  2DXI A;  3GQ3 A;  3GLI A;  4G4O A;  3SAU A;  3B7Z A;  3VK7 A;  2L09 A;  3LVW A;  1TH4 A;  3PVS A;  2UUC M;  2JY5 A;  1GLN A;  1XXH B;  2L4E A;  1I4W A;  2DKL A;  4B7H A;  1DV0 A;  4IBI A;  4CJ6 A;  5H37 D;  1OKS A;  4QHS A;  2X8A A;  3GLG B;  5IT9 S;  3HJ8 A;  3GLF E;  3H4M A;  5ITT A;  1Q3B A;  2R46 A;  2X4A A;  2ERC A;  4WW0 A;  3SHG B;  2GQF A;  4JI1 M;  4DR4 M;  3GLH A;  3B7Q A;  3U6M A;  1OIZ A;  1MJG M;  1OJL A;  2D7H A;  3DZD A;  2EO2 A;  4A3V B;  4DUY M;  1ZMU A;  2EUC A;  5BPV A;  1JQJ C;  3VDU A;  1R2Y A;  2HCB A;  5A2Q S;  3JR5 A;  5EP4 A;  2DZN B;  2J5Y A;  3H4J A;  4GC5 A;  3V76 A;  4FVM A;  4LJA A;  4IJF A;  1PJJ A;  4M0W A;  1JR3 E;  2LVN C;  1WR1 B;  3HKP A;  5BR8 M;  3SAS A;  2CHV A;  2R4E A;  4X62 M;  3FUX A;  3B7N A;  1NY6 A;  4GMQ A;  1J7K A;  2C9O A;  4D80 A;  1R5L A;  1LTM A;  3WHK A;  3AOE C;  2DAG A;  3GRU A;  1N75 A;  3E9S A;  3LCU A;  2XZF A;  3SAW A;  1ZQ9 A;  2M60 A;  2F5N A;  2BNK A;  1L2C A;  4MB7 A;  1FNN A;  3E46 A;  4OW0 A;  3CF0 A;  1VG5 A;  1VEG A;  2BWE A;  4NXM M;  1HNZ M;  1L1Z A;  1TH2 A;  2XEP A;  4CHT B;  2KNV A;  2HHH M;  3VKH A;  2N35 A;  2RGH A;  2QEN A;  2G5G X;  4JN6 A;  1QDT A;  4M9X A;  1E9R A;  1IQP A;  1XHB A;  3QAU A;  1YUB A;  2J7O A;  3U5Z B;  2KA6 B;  4JV5 M;  3SYK A;  1L2B A;  4LF4 M;  8CAT A;  1NHW C;  1NV8 A;  1OTR A;  4MGI E;  2LNH C;  1QVR A;  3UGJ A;  4LFC M;  3I04 M;  1HT2 E;  2V6Z M;  5ITY A;  4AZF A;  3E21 A;  2XFS A;  3FTC A;  1NO1 A;  3HY5 A;  3FUU A;  3J27 B;  2KDL A;  1A5T A;  2C99 A;  2K9D A;  3UZU A;  2D7E A;  1X37 A;  3K1J A;  3MJ5 A;  1YE9 A;  5IWA M;  4I81 A;  5EXX A;  3K2L A;  4B3T M;  3FYD A;  4B7F A;  1DGF A;  1OFI A;  1QZE A;  4FCV A;  4L16 A;  1GJS A;  2DHR A;  1IXZ A;  1S3S A;  1JR3 D;  1XXH A;  3I51 A;  1I94 M;  2G8L A;  2G3Q A;  2VQE M;  2WSC F;  5FTN A;  3GLG A;  3HU2 A;  4LJ7 A;  2DWL A;  4X65 M;  1PRB A;  3K8Z A;  1VDD A;  4II7 A;  1HNW M;  2XFT A;  1K3X A;  4LZJ A;  4B3S M;  2JY8 A;  2VF8 A;  3F92 A;  2UUA M;  5KQD A;  4PD2 A;  1Q3C A;  4AQY M;  5L8R F;  4DV1 M;  4ITQ A;  4B3R M;  4PCZ A;  4AKI A;  5FTM A;  3ZC7 B;  1R4G A;  4HEO A;  2EKF A;  4LGM A;  1XMO M;  2JNH A;  2F5O A;  5DFL A;  3L28 A;  2O25 A;  1C7Y A;  2CHG A;  2H5X A;  1TR8 A;  2CEA A;  3AKZ A;  3T6P A;  4R7G A;  3OTO M;  1D0M A;  2R62 A;  3KDS E;  1UFZ A;  5EXP A;  2KNZ A;  2VII A;  2UUB M;  4AG5 A;  2MR9 A;  3FTF A;  2K6B A;  1WGN A;  1ZMV A;  3DOA A;  3HJQ A;  2JZ1 A;  4NXN M;  4YHH M;  1IN7 A;  4X64 M;  2XSZ A;  4L15 A;  1SG9 A;  4JI2 M;  1AIP C;  2L2D A;  2MRO B;  3U60 A;  1ZAE A;  3L2A A;  3A45 A;  3KOW E;  5FTK A;  5EP1 A; 
#chains in the Genus database with same CATH homology
 3QYB A;  4NC6 A;  3QYE A;  4P17 A;  3HZJ A;  2QQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...