3GRYA

Crystal structure of the complex between s-adenosyl methionine and methanocaldococcus jannaschi dim1.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
263
Chain Sequence
b'QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 89
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3gryA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gryA01
1BHJA 5K01A 4RWZA 2OB1A 5DTRA 2OKCA 3K6RA 3C0KA 1NV9A 2GB4A 4QQNA 3SSNA 5ICCA 5JR3A 4PYQA 2AOUA 3KPYA 5ICFA 4E2ZA 1D2GA 2A14A 3SSOA 3F4KA 2PX8A 1FBNA 4AZVA 2WA2A 5GIOE 3H2BA 5DM2A 3T0IA 3TR6A 2G70A 2YXDA 1YFLA 3OFJA 3THRA 2NNWB 4PGHA 3DMFA 5HILA 2VDWA 2YR0A 4E30A 4YV0A 2Z6AA 9MHTA 3PVCA 1M6YA 3KQQA 1G38A 4RV9A 2PT9A 3MERA 10MHA 3DR5A 1KIAA 1R74A 5DM4A 1NBIA 3I58A 2R3SA 2JHCA 5GM1A 1KPIA 2HR1A 3OU2A 3M6XA 3P2KA 1F38A 2O06A 3E8SA 1Q0TA 5CVVA 2GH1A 3NTVA 5E8JA 4C06A 5EKXA 2AVDA 4FP9A 1EAMA 4XUCA 5DX8A 3PTAA 3OZRA 3KQMA 1NV8A 2VDVE 3GJYA 4YUWA 5K0JA 1JG4A 4P7JA 3G88A 2ZFUA 5HIIA 5K0CA 4DKJA 4LECA 2OBFA 3EVEA 3G7UA 3GGDA 3HP7A 3ELDA 3KQOA 5DXJA 2QY6A 2I62A 3FPGA 3HNRA 3LDUA 4QQKA 5ICEA 5FHQA 1KHHA 2DULA 3P2IA 1L3IA 1G60A 1O9GA 1UFKA 2EJUA 3KR0A 4PGGA 1Q0SA 4HTFB 3QV2A 1NT2A 2BH2A 3UFBA 1G55A 5BXYA 3LL7A 2XVMA 3LHDA 2OYRA 2OO3A 1ZGAA 3UA4A 3VC1A 4X41A 2P40A 3CBGA 1KR5A 1MJFA 2HNKA 5KQRA 1I4WA 4AZSA 4OBWA 2PBFA 2PWYA 3P9CA 4FSDA 4IKPA 4OQEA 4L7VA 5F2OA 2IGTA 1SKMA 2KW5A 3DOUA 4Z2YA 2NYUA 4BLUA 2OY0A 2V7EA 3CJQA 3EVGA 3R24A 4O29A 5HIMA 2AN5A 3UJDA 3NVKI 5EZQA 2UYQA 1O54A 3NDIA 5DRTA 2AOXA 1G6Q1 1UIRA 4RVHA 5K0FA 1RJDA 2ZCJA 1JTFA 3OPNA 5DSTA 4XCXA 4HTFA 1V39A 4CXMA 2Y1WA 1YZ3A 5LQKA 4C05A 3PLAE 3OE4A 4IV8A 4H0NA 3X0DA 2DPMA 3SM3A 3BKXA 3TKYA 1KXZA 1DUSA 3EVCA 4ER5A 3GRYA 2P1DA 2GPYA 4EKGA 3FUTA 3FTEA 1QZZA 1NW3A 3UJ8A 2O57A 3GRUA 1FP2A 1L9KA 5B1SA 4V0QA 2QM3A 3E05A 5FULA 4YUVA 3TFWA 4RVDA 2PT6A 3RIEA 3KR2A 4LG1A 2G8NA 3FUVA 3G2PA 4NECA 1U2ZA 1ZKDA 3VSEA 3AWIA 5EIWA 5ICGA 2QYOA 5GWXA 4EKIA 3JWIA 3FTCA 5FHRA 5LQRA 4C03A 1DL5A 2IIPA 3G89A 3BWMA 2FK8A 5EHIA 2ZZMA 4DMGA 1EJ6A 1M6EX 1R6AA 1JTEA 1X1CA 5GIPE 1X1BA 5E9QA 4M37A 2Z6UA 1INLA 3CCFA 3EPPA 3GU3A 5EC8A 2PLWA 4EVIA 4PIPA 1YFJA 3DP7A 2WK1A 3FRIA 2PX5A 3SX0A 4EMSA 3BXOA 8MHTA 1JG1A 2ZZNA 3LCCA 3EMDA 4E2YA 3ME5A 5K8VA 4GBED 2EG5A 4WVLA 4GF5A 1DCTA 3R9XB 3EVDA 3QOWA 2XYQA 2BR4A 4C08A 1L1EA 3R6TA 3G2QA 3KPWA 2B25A 3BKWA 3DXXA 5E1MA 5DT2A 5H02A 3EEOA 2I9KA 4M7RA 4ZTBA 2AN3A 2HTEA 2P7HA 1H1DA 5DWQA 2H1RA 5CVUA 2PXXA 1O9HA 3CJRA 2YTZA 4RYLA 1VL5A 2FK7A 3IHTA 1AV6A 5EQJB 1PRYA 2BR3A 3HCDA 3DUWA 1QYRA 4PONA 1KP9A 2AOWA 4GOMD 4OX9Y 1R00A 1VQ1A 3EGEA 5IH3A 4E2XA 3HA7A 4FSXA 2ZBPA 3P8ZA 5EPEA 3EVFA 4E70A 2C7PA 3TQSA 3MGGA 1ZQ9A 2GAFA 1YZHA 3M33A 3TM5A 3IEIA 2OXTA 4EK9A 4R05A 5T64A 3FUXA 4LWPA 3UWPA 2GS9A 5F2KA 2CKDA 4YUZA 3ANXA 2H00A 4HGYA 5EIFA 5F2NA 1R8XA 2P35A 2CMHA 3GRRA 3G2MA 1EIZA 3I9FA 3SSMA 3GCZA 1MHTA 3HTXA 2JHAA 4U7PB 1BKYA 2NXJA 3DLIA 2BR5A 2EX4A 4KWCA 2XBMA 5DM0A 3BWCA 3FTFA 4ER6A 4U7TB 4HH4A 1X1DA 4PYMA 4X60A 5GOZA 3PB3A 3IYLW 5GM2A 3SXJA 1P1BA 3FPFA 5CVJA 4Y2HA 2AZTA 3V97A 3D2LA 3MB5A 3M6WA 3G8AA 4XUDA 4CKBA 2C7QA 3PS9A 5C0OE 1AQIA 2PGXA 3E23A 3ER9A 1VLMA 5IKMA 5D1NA 1IXKA 1ORIA 3C6MA 4YUXA 2CWWA 2V74B 4V0RA 3HVHA 4YUYA 3KQTA 2B78A 2FPOA 3OFKA 1SQGA 4HGZA 2NXEA 1P1CA 1RJFA 4QVKA 2EFJA 2GLUA 1AF7A 4PYJA 2WA1A 4DCMA 3HCBA 2GA9A 1RJEA 3T7SA 1AQJA 4CTJA 3ELYA 2LD4A 3KQPA 4RX1A 3UBTA 4BY9E 1WG8A 5G02A 1WS6A 1SUSA 2PJDA 2I6GA 5DXAA 4GC5A 3A25A 2AOVA 5HFJA 2YX1A 1RI1A 3EVZA 3TKAA 4ER3A 1I1NA 2ZBQA 3I5UA 1XXLA 3B7PA 3MCZA 4PIMA 1N7IA 2P41A 4GUAA 5K0BA 1M0EA 4PNEA 3P9IA 5KQSA 3G2OA 1B42A 5MHTA 1KPGA 1UWVA 1RI4A 2F8LA 4HSGA 2PVCA 5U4XA 1FPQA 1SVUA 3GO4A 3OZTA 4BP1A 2UYOA 4YV2A 3LX6A 4X1OA 3KQWA 3EVAA 2IP2A 5EMJA 4PYKA 2ERCA 2IPXA 2QE6A 4PCLA 3P9KA 4DM3A 2ONYA 3G5LA 3HA3A 2AVNA 1X19A 3PFGA 2BZGA 3A26A 3RODA 4E31A 3GDHA 3B3FA 2PSSA 5T6BA 5K0GA 5FWDA 3NMUF 4RTKA 2P3OA 3FYCA 2IBSA 3OU7A 1XCLA 3LECA 5E1OA 2XYVA 1NW6A 3GRZA 5JUWA 5K09A 3AY0A 5KYGA 1G8AA 2E5WA 2VP3A 3ID6C 3P97A 4QDJA 4RVFA 2ZULA 5EGSA 5FUBA 5DTQA 5BW5A 5CIYA 3FTDA 1F3LA 1G8SA 4F86A 2IH2A 3KR1A 4IWNA 1YB2A 2JJQA 2H11A 3C6KA 4QTUB 5DLYA 3UJ7A 4LWOA 2QRVB 3DMGA 5T67A 4KIGA 1NKVA 1ORHA 4PYNA 4P7GA 4C4AA 4POOA 5KS2A 5EEGA 1BOOA 1KPHA 1XTPA 1TPYA 1VPTA 5CM2Z 4OQDA 4F84A 1L3BA 2UYHA 2P3LA 4M38A 3U81A 5EKUA 5DX0A 4CKCA 2Y1XA 4MQ4A 3V8VA 3NWEA 1XVAA 2FCAA 2XYRA 4IV0A 2IBTA 3HCFA 5D1HA 3CGGA 4GOLD 1YF3A 5EMKA 3KQVA 3REOA 3M6VA 5LQAA 3VC2A 5DRYA 3Q7EA 2PXCA 3KPUA 3PT9A 3O7WA 4A6DA 3LDGA 2NP6A 2UYCA 5HIKA 3I64A 2NXNA 4GC9A 3FYDA 1Z3CA 4R8SA 3BGIA 2QRVA 4CTKA 1RI2A 3ELWA 3BZBA 4R6XA 4K6MA 3LKZA 4E2WA 3FUUA 1JQDA 2P3QA 5K03A 2CL5A 3K0BA 3DH0A 3IV6A 2OZVA 5EHGA 3MHTA 3FPJA 3OE5A 4ATNA 4BP3A 4CWAA 5K05A 1XDSA 5EMLA 4JXJA 4X61A 4GOOD 4KRGA 3P2EA 1X1AA 3BUSA 4OA8A 1TW2A 3RW9A 1SUIA 3B5IA 5E1DA 4QVGA 1KYWA 3C3PA 3O4FA 5FQNA 2G1PA 1BC5A 2Q41A 4QPNA 1RJGA 1D2CA 2FRXA 4P7KA 3TM4A 4DA4A 3SR4A 3A7EA 4Y30A 2AS0A 3NWBA 5K0LA 4AX8A 4HRAA 5E9WA 3FPEA 3OU6A 3KR9A 1QANA 2IDKA 1VE3A 2EJTA 2OPBA 3PFHA 3LDFA 2I7CA 4R8RA 3BT7A 5LQCA 5LSAA 4BLVA 1SG9A 3R3HA 3SVZA 5HEKA 3ER8A 1SQFA 3EMBA 3O31A 4DZRA 1ZGJA 5EMMA 2YUIA 3PX2A 2AR0A 3UJBA 4HG2A 3MQ2A 3OZSA 2PXAA 5E2AA 3SGLA 1PJZA 1JQ3A 3ORHA 5DTMA 2JH8A 3T7RA 5CCBA 3LBYA 5CUQA 1IM8A 3FRHA 3KPJA 1QAMA 1EQAA 3MTEA 2CMGA 2VDUE 5E8RA 3ELUA 5FA5A 3A7DA 1NW8A 2ZSUA 5P8WA 1XJ5A 5ERGB 5FADA 4WXHA 2P8JA 1ZHFA 3B3GA 4KDCA 2ZBRA 4ER0A 2K4MA 3FPHA 3A27A 4C07A 4RTRA 4AZTA 3LGAA 4OBXA 1YUBA 4CKEA 3HEMA 3LKDA 4FR0A 3LSTA 1HMYA 4C04A 2B3TA 5EZSA 3BGVA 1OR8A 3HA5A 2ZW9A 3EGVA 1NBHA 3P71T 3P9NA 5LR6A 4P7FA 4AZWA 4GOND 1FP1D 4ER7A 2N47A 4YMGA 4KDRA 3T7TA 2OB2A 2PX4A 3KQYA 4P58A 3GXOA 3UJCA 2YVLA 3DLCA 3CKKA 5EEHA 1VP9A 3KPVA 2P7IA 4FGZA 3GIWA 3HCCA 1IY9A 2G71A 3QOXA 4MIKA 3HVJA 4RVGA 5GINE 2HMYB 4YV1A 2IFTA 3BGDA 1VP3A 3C3YA 3UJ9A 4MWZA 2IH5A 1D2HA 3E7PA 1WY7A 3EGIA 3UJAA 5BW4A 3GRVA 3DXZA 1NW5A 3LCVB 3KKZA 4E32A 4MHTA 2JHPA 4PCAA 2UZ4A 3GWZA 3PX3A 4XUEA 4G56A 5FCDA 1WXWA 2O0LA 2R6ZA 3DXYA 2AOTB 3B89A 1JG2A 1RI3A 1P39A 2VS1A 3LPMA 4KW7A 1JG3A 3HVKA 3NDJA 1JQEA 4DCGA 3I53A 5HOQA 1QAQA 5FQOA 1QAOA 5EG5A 3A4TA 4KVZA 3M6UA 3JWGA 5M5BA 1EG2A 4FS8A 2ZVJA 2ADMA 3CJTA 2HV9A 3M70A 5E1BA 3TMAA 5CD1A 4M36A 3ERCA 1I9GA 4RSRA 3S68A 2YQZA 1KYZA 3MTIA 2YXEA 5CVEA 2ZIGA 2HWKA 5DPMA 5EOVA 5FWAA 2NP7A 3AXSA 4X63A 1R8YA 2ONZA 3HCEA 2IH4A 1XDUA 2ZIFA 4KIFA 5C9ZA 3FUWA 2IDJA 3NJRA 1Y8CA 3JWJA 5KVAA 5DSXA 3THSA 5HZMA 3G8BA 4GEKA 3JWHA 4EQZA 1R18A 2AOTA 1N2XA 4B17A 5EVJA 1RI5A 2PWPA 3FZGA 1N7JA 5CVDA 4PINA 2PKWA 4RTJA 3UJ6A 3KHKA 2ESRA 1JSZA 1WZNA 4RTLA 2ZWVA 4FT4A 4F85A 3CVOA 4FZVA 1VIDA 5LQJA 2JH9A 5CCXA 4RTPA 3DULA 2PY6A 2ZTHA 5C1IA 1XDZA 1EJ0A 2NXCA 3NVMB 1JSXA 5BP7A 2C7RA 5E9JA 5E2BA 3LCUA 4RTNA 1ZG3A 2FHPA 3TOSA 2PX2A 4BLWA 3B3JA 5FTWA 1P91A 2B2CA 3BWBA 3CC8A 3AJDA 3OCJA 3BWYA 2B9EA 4HC4A 4GQBA 1WXXA 1NE2A 4DQ0A 7MHTA 3MCTA 4RTSA 4RTOA 3M4XA 1HNNA 3UZUA 1T43A 3Q87B 5K0EA 3GNLA 1FJXA 3MAGA 4PYOA 3TLJA 2AN4A 2VZ9A 2ORED 2ZZKA 2JG3A 3HM2A 4PYIA 5GP1A 3G5TA 4UOEA 3NW9A 3VYWA 2BM9A 5HIJA 5K0NA 1L3CA 3DMHA 5FA8A 2FYTA 3KQSA 3L8DA 4OA5A 2AOUB 4QPPA 5DX1A 3LBFA 3UA3A 4A6EA 5LQUA 4RTMA 4R6WA 2ZLBA 5LQNA 2BM8A 2ZWAA 2Z6QA 3EEYA 2O07A 1JR4A 1XCJA 3DTNA 4QTTB 3SMQA 2O05A 2PV0A 4RTQA 4PYLA 4PWYA 3HVIA 1VBFA 2ZIEA 4FT2A 2C7OA 4QDKA 3KU1A 5DM1A 2XVAA 2YXLA 3EVBA 3WSTA 4YMHA 4AUKA 4DF3A 3HCAA 4MTLA 1NW7A 3TPZA 2G72A 4E33A 4ISCA 1TW3A 3TRKA 3AXTA 3R0QA
chains in the Genus database with same CATH superfamily
5KTPA 2BT4A 2V0NA 3KKQA 1YL6A 2V6IA 3KYBA 3RUIA 1J8QA 4NG5A 2ZG6A 3GJTA 3IQWA 1RPZA 4H60A 1QORA 7ADHA 1IQ0A 5KTRA 2VPIA 1EAMA 2ZRIA 4GNKA 5JW6A 3O9MA 2DFPA 2JFQA 4GLFA 2GEKA 5ICEA 2R8PA 4EUSA 2Z09A 3CW2A 3UXYA 4W5NA 4L8GA 4XWAA 3MMZA 5CX1B 3TLBA 3R0VA 2V7EA 1KH1A 2XT0A 4H6PA 2P6PA 4AJ2A 2NPFA 1O95A 3TBHA 2H08A 1A2KC 3BM5A 2W6JA 3E05A 1N9GB 4FR2A 3KAPA 3TLKA 3D64A 1Q7EA 1S96A 4BKRA 2X0FA 4PO9A 5TJHA 4A2CA 1P75A 1I7PA 4FUTA 2OBLA 1EUDB 3DOIA 1PTJC 2JLAA 5CA1A 2X5XA 5LFAA 1HC7A 4BNDA 3KZNA 2H4JA 5K3OA 1TUGA 4Z3KA 3LXMA 4BEVA 2IDZA 3SQOA 4GP9A 1TT7A 8OHMA 3DV0A 4NU6A 3E9RA 1KY5A 1RS0A 1XNHA 4GPZA 4QLOA 3BXPA 3VUEA 4U2EA 4LGCA 5IAKA 5D3MA 4C30A 2XBMA 2ZUDA 4A8JA 1Q7GA 3SHQA 3KZCA 4FPXA 3NETA 4K7JA 1LPSA 3CSUA 3D2LA 1XMQB 3GYBA 3QXXA 5EIHA 4EHIA 3UT6A 3ROQA 3KQKA 1MV8A 4OU4A 1YU6A 1CS0B 2L7IA 4UCWA 3IRUA 3WGHA 4CDGA 4GLJA 4MIEA 1FDUA 3S1AB 2ODAA 1YZQA 1P2UA 2PVCA 5KOIA 4RPIA 1QRRA 2Y77A 4IQ4A 4J2TA 4XE5A 3AM4A 3KD3A 3OKFA 2Q99A 1RP7A 3OU7A 3DZHA 3I2YX 4LHSA 4S0XA 2MR9A 3NBMA 2FFBA 3GGGA 3ZE1B 1U0BB 3C6KA 2GN0A 2OV4A 3CH6A 4KQ9A 5AP9A 2UYHA 4WK2B 2P3LA 3R7SA 1YBVA 1WR8A 3ZVNA 4ZKEA 3F46A 1UANA 5HDBB 4KAJA 5CB6A 3EX7C 2YWJA 4Y2JA 3U13A 1NN5A 3K1TA 1Z3CA 4X1KA 1EVKA 4OHOA 1DMRA 1CVRA 3DF9A 3GNQA 3E5MA 3SXPA 4EB6A 2G9QA 3SLRA 1EP9A 3HHEA 3JAKB 2FWRA 3KJNA 3H4IA 1WW8A 3KT6A 2ZTDA 2W58A 3LDFA 4MH0E 1CEXA 2YHUA 5LBIA 4CEHB 1PSZA 3DQPA 3MQ2A 4TXJA 3Q7PA 3A58B 3A1TA 3MIIA 3EF0A 1R66A 1KSFX 4E1VA 3VSCA 4P7FA 3HBLA 5B64A 3H2GA 2C4HA 4UEWA 4JBLA 4PT5A 4FLFA 1APBA 2XUQA 1OYOA 4W1PA 1EXVA 2WFMA 1JKJB 3P9ZA 4M0UA 4PCAA 3RTAA 3AEKB 1KK2A 4QWMA 3UWKA 2PRZA 1OWOA 1RQLA 1QDLB 3PCTA 4ALNA 3FDZB 4IDEA 3MTIA 2WJWA 3SZOA 4WV3A 5E7IA 3GK3A 4CRWB 2XOKD 5CJPA 3D6AA 5KVAA 1CY6A 3JWHA 2BLNA 521PA 4HDRA 5HUHA 1Q19A 3BCUA 3K9HA 2Y9MB 3SR3A 2A3RA 1R88A 3N8IA 1FSZA 1D09A 5AKGA 2DE0X 1Z9BA 3CUYA 1Y4ZA 1I2CA 1OZAA 5JD6A 1GGNA 1A5BB 4LJLA 3M7IA 4IFBA 3VR5H 4UDOA 3G8YA 4O2AB 3N76A 1S5PA 3A11A 2GGSA 2NU9B 2PT5A 3C58A 2H65A 1BHJA 3FSJX 3D0OA 3CF6R 4K9DA 3ZW7A 3IP8A 1IEQA 1QP4A 4ES6A 4LFBM 4YV0A 2Q5OA 4FLMA 2Q2NA 4PX5A 5EESA 2PL9A 2R3SA 2FH0A 3MN1A 5DF1A 2ZRPA 3ZW9A 1LDGA 1QR2A 4KVGA 3UK2A 4YLGA 4P81A 1QH1B 5EWLA 1C81A 4OVKA 2Q0QA 4DVJA 1NMYA 1FZQA 1VG1A 3R6GA 4BUZA 3WRXC 3CNOA 4LFCB 4DM7A 1T3HA 4HWOA 1FP4A 1JLSA 2JFZA 1W8IA 1G6Q1 1ZVQA 2NQ2C 1KIFA 3FYSA 2H1VA 1E2KA 1CJMA 5AVKA 3LC2O 5ITTA 4J16C 3V8PA 2CE2X 1ODCA 4PZPA 5DULA 5AOBA 5DIFA 3GPIA 3AL2A 3ZNNA 1ONNA 3F49S 4EOGA 4HB0A 2RJNA 4KU4A 3L8CA 4TT8A 1P6XA 1H5QA 5CLQA 1FXWF 2HO4A 2IXBA 2WVJA 1Y5RA 3V8MA 4MYCA 4L5CA 4KQMA 3ZWDA 3OC0A 3RRBA 2BKXA 5AJWA 1DEHA 5TMPA 2WF5A 2W00A 2QLBA 4HDNA 5AI8A 1SU8A 3GLIA 1UK9A 5BSGA 1GKYA 3Q98A 1KK1A 1AE1A 1C4XA 1SM4A 3CLTD 1RW4A 5JAHA 1YC5A 4JB8A 3DXFA 3BE4A 2JI8A 2FEWB 4YJ2A 1RLOA 4C0KA 1FTYA 1UBUS 1JTVA 1XDWA 4OK6A 3PQFA 1JW9B 1WJGA 3A3YA 1ZJ6A 4M8KA 3VJMA 1I1NA 4FC6A 5I5GA 4ZT2A 5KQSA 1ZX1A 3NV7A 3E22B 4BNYA 2R1UA 3W0LB 2BZGA 4QX6A 1EBUA 3L7MA 4BTEA 5FT9A 5FUBA 3AB7A 3PUWA 2KQUA 4P53A 1J6UA 4B8YA 1WCV1 1PEDA 2VTDA 3BJMA 5JNUA 5E6JA 3TQTA 2R68A 5I5EA 4MW2A 3L7IA 4X1YB 5ICSA 1LJLA 5LZ9A 4LQCA 4I19A 3ZH2A 2B34A 3JQ6A 3GZJA 3NGXA 4IGFA 4LG2A 5H0IA 2GEJA 2RBGA 1L1QA 3WBBA 2QNRA 2QN2A 3OOYA 1V92A 4B2PA 4YP6A 5CHYA 1PNOA 3RYTC 1CUXA 2YUIA 2NPOA 4JEHA 4CCSA 5E2AA 4JYZA 2EATA 2XFTA 5IDQA 5DNWA 3PKZA 2QTVB 4IF6A 2Q3BA 2KLHA 5CNKA 3H2HA 5KJ6A 3FYHA 2C2KA 5HRUA 2I9PA 3HXOA 1TUEA 2OZKA 4NARA 3TTSA 3BRWD 4ALKA 4B5LA 4WURA 2KPOA 4IILA 2CMKA 5G40A 2F1JA 4W1RA 4KW7A 4H16A 2F43B 1UJ4A 4UE6A 2AW3A 4L5AA 1TYBE 4ZZ3A 3KXIA 1XA0A 3GLGE 1Y8ZA 3TLCA 3OZIA 2ZTHA 4XX1A 3WLMA 6AT1A 4QDZA 3BRQA 3KYJB 3K9GA 4JYCA 3WO1A 2XECA 2WZDA 3MGBA 2ZRAA 4UHKA 4DCUA 2IXFA 2L17A 1PK7A 3AR3A 3LBFA 4BB6A 1DGBA 3RUDA 1S3SA 4JC8A 3QXSA 4TKMA 1XCJA 2BBWA 3JQGB 2A0XA 3WLNA 2VK1A 2V7WA 4GQIA 4YFYA 5EE0A 1M0TA 1M2WA 3AEQB 1ULBA 3BFVA 4OP2A 2RAPA 2VA8A 4FGLA 1JE1A 2PLNA 5KB3A 4LC9A 4DC0A 4WCFC 1TCBA 5KJCA 1IL0A 3VR4H 2FPSA 3TCXB 1HZZA 1AB6A 4ZOCA 3IJ5A 5BW6B 4UTNA 3HEBA 2WR8A 4TTIA 2C96A 4JC0A 1VZ3A 1HWYA 4I2NA 2QBYB 1AV7A 1HLGA 1PVOA 2OPHA 1AUOA 2XHEA 3VKWA 1AUQA 3QMWA 5EJGA 3ZKWA 3GRPA 2I4RA 3FOZA 4O2AF 4MYRA 3ZWVA 1JWBB 3LAWA 2ECFA 4X93A 1WEHA 4MI1A 4P3OA 3AV3A 1UH5A 4YRQA 2IS2A 2VJLA 2RONA 1F1JA 2LBPA 1U7ZA 2O1SA 2IEYA 1B3RA 5HDQA 4A36A 4JOQA 2J5XA 4X66B 4DLSA 5AVZA 3ZH9B 1SXJB 4ZCQA 3DYBA 4QPCA 4KT0F 1ZXLA 1DO8A 4JIGA 3AIIA 1Z0AA 1X7XA 4OB6A 5EQJB 3KHSA 3ONEA 1ZMUA 3NKVA 3L9XA 4D8VA 5D5HA 3IEIA 4WXYB 1E3EA 4LX8A 5PGMA 3VH4A 3NJ4A 2IOFA 3I6YA 3GUZA 1QZXA 2EIHA 4LS3A 3EA5A 4MQEA 4XTRA 2W5UA 3ETGA 1X1DA 1IXYA 5JWRA 4WFJA 2ZUVA 1OWNA 4BVFA 3AEUA 4MVJE 5IKMA 5DASA 1PFQA 2EKLA 4PYJA 3VFDA 2YNMD 2QHXA 2UVDA 3R6LA 3ZBUA 4B32A 1VECA 3MT8A 1GADO 2D62A 2VPXA 3NP9A 2IZ5A 5JXJA 5DNDA 4Q6BA 4IZIA 2ZRJA 3V76A 4LWQA 4OXQA 2IYYA 5AK5A 4WESA 3F9IA 1RRPA 5CNIA 5JCJD 4CMIA 5EEGA 2P9TA 4DHEA 2XYRA 1TE2A 3NRJA 2X5NA 1OOEA 5ECGC 2GTPA 4MVJH 4J91A 4EW6A 3MWDB 1XUOA 2LVBA 3ZQKA 3ZHSA 3Q0EA 2XWPA 5AVVA 3MTQA 4WW0A 5C8DA 1YQDA 4NFLA 4A3VB 4EF6A 3I8SA 1PJQA 1XX6A 2R4JA 3G02A 4LJAA 3UT5B 3SFTA 3RAPR 3LVWA 2EJTA 5BQ3A 3BT7A 1JQJC 4FZJA 1BZYA 4IUDS 1V2HE 5E6SA 1WUKS 1NMSA 3WO0A 1B0ZA 2J31A 2LV8A 3A6ZA 3RSHA 1PQ4A 4XDYA 4ESHA 3AVVA 3DQZA 2IP4A 3UK0A 2K0BX 4JP5A 4OM7A 2ZJYA 3V9PA 5CU7A 1ZHOA 1ZIDA 3LY5A 1U8TA 4C2AA 4KQXA 5EXXA 3OFNA 1N1DA 3GA7A 4XWWA 4I5EA 3OZBA 4PV7A 3VGJA 1YI8A 2V0GA 1JEJA 2OCPA 2R66A 4CIYA 2WSCF 3A70A 4PF1A 3IPAA 1Y8CA 1Q0RA 4NZOA 4NVRA 1F8UA 1PJCA 3D81A 2B7LA 4B17A 1QF9A 3DHEA 3O90A 1Q1GA 5EMHA 1VIMA 1QDRA 3BWXA 1EWTA 4X7MA 2V45A 4ZJYA 2OGSA 3H9JA 3LZ6A 5IVKA 1HNNA 1SZDA 2OR3A 5BN5A 3WZLA 2NUBA 4KLCA 3ESBA 2DPGA 5J4YA 2UVPB 2ZAOA 4D26A 1T9GS 4RLHA 3T35A 3ZOZA 2YXLA 2CNNA 4UTZA 3SOPA 3ESCA 1V7PC 1C9YA 5EXPA 4X1IA 1ZMWA 1L7VC 5K3FB 2H0QA 2AFHA 1ULZA 1ZOSA 4IS3A 5IAOA 3EIWA 2Z0MA 1LJUA 3V1NA 3L84A 2ZB2A 3PI6A 3CKLA 2YOFA 3NT4A 3SX2A 2JCYA 3FCCA 3W3ZB 5BORA 1MDFA 3OZRA 4MWSA 1VHTA 3NWJA 4WY2A 1N5RA 4GKKM 1SUEA 3SWWA 3KG2A 1FLVA 1P4RA 4GBJA 3TDKA 5HPYB 3V2GA 1IBCA 4O29A 3HO1A 1G3MA 2B0CA 4ENQA 4QUJA 1ZJ5A 1D6JA 4A1FA 3SBDA 3K1AA 2ZPTX 2GK7A 3M81A 1R8QA 3X43A 3U7FB 1JFLA 1LY1A 2C1ZA 4HBGA 4K9PA 2F62A 4IM7A 4EKIA 2UUCB 4PRKA 1M6EX 1Y6QA 3IQEA 4PY2A 3VSBA 1VMEA 1PUXA 2PX5A 4L5BA 4J90A 1SKYB 2XKBA 4YHBA 4E5DA 4JI3M 1G3QA 3T34A 2K6BA 3H5NA 1JP7A 1FTNA 2V6JA 1HDCA 1DC8A 3P2MA 4D7AA 1BG6A 1N33M 2SCUB 4DV4M 3INRA 3WK5A 2ILTA 3D59A 4O2RA 1RE0A 4NX2A 2C59A 2Y1KA 3EBOA 3SE0A 1BCSB 5CDSA 4EIWA 1V16A 3A1EA 2VHWA 5KI6A 5FFFA 1H22A 4JH0A 2BYTA 1QOZA 3EIUA 1AQJA 2VKQA 1IM2A 4FFVA 1JVNA 1FC0A 3DWEX 1WVIA 2G0NA 3E0QA 3F98A 4DM3A 1GXSB 2GEDA 2VFAA 4XIGS 3SKYA 1RFLA 4YDQA 3Q3CA 4G0MA 1BXKA 2IH2A 1G8SA 3F6SA 3CB4A 3B5EA 4IWNA 1ID1A 4IDFA 5DLEA 3DMTC 4WINA 3IPRA 4PAMA 4DA6A 4KMMA 3CW9A 2J0UB 1U81A 1UFQA 5JANA 4BP8A 3LIPA 4IR7A 5A4IS 4ZIRB 3QU5A 2PZKA 1DDIA 3N58A 1C41A 1NDUA 3ITEA 1PJ2A 1WA5A 4YRNA 1U6JA 3QTBA 2P6MA 5L45A 4DB2A 5LBTA 4JLVA 1KFVA 2I1QA 1SG9A 2GM3A 3G0IA 1QHNA 1IJKA 2OD7A 2VAVA 2ORIA 3FDJA 2OHVA 2P2SA 2PS0A 1U2GA 2H1CA 3MCUA 2B4QA 3LBYA 4QPDA 4NBWA 4YX9A 3NM5A 3KFXA 1A9RA 2ZSUA 3NFYA 3PNLA 3VZCA 4ANRA 3TL6A 3QKRB 2JATA 3L1IA 4M98A 1X92A 2ZJ0A 3K9LA 1NW9B 2XAUA 5BQFA 3T6KA 1HI9A 5F73A 2I67A 4EO4A 2YZKA 3ASZA 1K0FA 5CT9A 3U60B 2N75A 4DCGA 4ND3A 4PZ0A 3QELB 3JWGA 4G1CA 2WSSD 4MW5A 3SHWA 2GJ9A 2NZJA 4H6XA 2GZSA 1ACMA 3EZ7A 2ID7A 5DYIA 3N75A 1SCDA 4PTZA 5A04A 4N41A 2I80A 1U1CA 1IXSB 3GQBB 3LQ2A 3BL8A 1F7VA 3R9IA 2Q5IA 2ZYSA 4RAQA 4QULA 1AC5A 3RC1A 2B9EA 3V1MA 4IIGA 2R97A 4FWGA 1PZEA 1FEZA 1O97D 2BM9A 3MWEA 3NHPA 4WK6A 5K0NA 3L8DA 3CHYA 3MWGA 3WRWA 2BM8A 3OCVA 1PU2A 2GJAA 1SVMA 4M1TA 2AYZA 2ZU0C 2G72A 3A3OA 4DPMA 3IUEA 1Q91A 1VPWA 1V25A 5K01A 1UK7A 3UUWA 5BSMA 4LI3X 2HM7A 9MHTA 1IBSA 4C88A 5A7FA 1RTTA 3A6PC 1KPIA 1CUFA 3DAYA 3H8SA 3WWOA 3HJUA 1XZCA 3IE0A 3KSJA 2A5FA 2QT9A 4ZARA 4FWBA 3HBMA 1TZ2A 3OCXA 4KPEC 1BGXT 2C58A 4TVKA 2QL5A 3CX7A 3E21A 2F3RA 5FX2A 4YWJA 2WTNA 1Z38A 4YVFA 5JNTA 3RYCB 1WMEA 4EZEA 4K2AA 3ZZ1A 3F67A 2P9EA 5E3JA 1XNJA 1FQWA 2OSBA 4Q4AA 3OFVA 4I2VA 4Q82A 3E35A 3X0DA 4CV3A 4P80A 3EVCA 2R65A 3AFOA 2H1LA 4B3MM 1N34B 4PRZA 4DSOA 3ZBTA 2J30A 2HA5A 3OMLA 1DL5A 4L8YA 1X6VA 1OPXA 2ZBGA 2HMSA 4HN9A 4AQYM 2UUBM 2IK8A 4D56A 3IAS6 2C5HA 3JQAB 1HTBA 4GMKA 4PQFA 2O01F 2ZZNA 4TLLB 4EARA 3SF0A 4QJ4A 5IZCA 3PQ5A 2N3ZA 3V46A 5ILOA 3PR1A 2GEVA 1HDGO 2HYIC 3BXFA 2AN3A 4RJLA 2XCTB 4E6EA 3UMBA 2BV3A 3BH0A 2AOWA 4OX9Y 2IZOA 1XZPA 2ZSFA 1VPVA 4C22A 3KQHA 3C8UA 4BGDA 3B6KA 2C97A 4B4OA 4BGUA 4G8BA 1KAGA 2HQ1A 2YWFA 3HCWA 3ADCA 1ONBA 1V3VA 2QJRA 1DGGA 3C5EA 2W70A 2W22A 1GZDA 1XC8A 4AK9A 1AS2A 3DDSA 4JBIA 5IYZB 2CWWA 5LYJA 3IVRA 1DBIA 4WE3A 1QJCA 5ER6A 1NXWA 2FOLA 4UMDA 2ZWPA 3OZFA 3VDMA 4TS1A 1C7FA 2X6TA 1KEVA 1N9ZA 2A88A 2CCJA 5MHTA 2Y1LA 4QHYA 3GEMA 2Q07A 3GGSA 4HNRA 3C7KA 1KC3A 2CUNA 4ND5A 2R87A 2G0TA 4L4YA 2VJAA 1Z4IA 4P7GA 1Y3HA 4C7JA 4DMRA 2VF7A 3KLOA 3W2EA 3VQTA 4YRIA 2Z83A 4FBLA 2JNWA 2NP6A 1JEYB 5DGIA 4S12A 5T4HA 4IF4A 4YROA 2VDBB 2V1UA 3DH0A 3IV6A 2OZVA 3ABOB 1SVWA 2BEWB 1KVQA 4IEEA 4TGLA 1IZ7A 1KS2A 4IXWA 3WKCA 3KDPA 2G9VA 4K9SA 4Z54A 5LNK6 3IKJA 3V42A 4NWIA 2J9RA 2JEOA 3BD8A 4Y28F 3IJPA 4FFNA 1K7FB 1VC2A 4DLXA 1RRMA 1U28C 5FPKA 2H2AA 2BFAA 3GJ7A 4RMGA 3KSAC 2RBEA 4RMJA 4HWPA 3TO5A 4C04A 4ZVOA 1KI8A 2EP7A 3CFYA 3SMVA 2GZ1A 3NT5A 4KDEA 3W9YA 1OROA 5LYYA 4R68A 1P2TA 3A3NA 4YV1A 4KMSA 2VTVA 2KRKA 1D2HA 3QE3A 1LUAA 2XSZD 2Q5LA 4AJJA 3TKLA 4XDHA 2A9KA 4WZBA 1WVGA 3GT4A 3BX1A 3RT9A 4MS1A 3VDNB 4ZV9A 1TYEB 1MB3A 3VKFA 1SUBA 3VSDA 4HR7A 4Q15A 2JZOA 1VSVA 1ABBA 1RKQA 4HNTA 1Q84A 4N3GA 4HC4A 2GETA 4FMDB 3CXRA 5DI3A 1UAGA 4DDUA 3G5TA 1SXJD 4PX9A 5BWMA 1ZONA 2OV6A 3WOVA 2MSKA 3STXA 3BTOA 3QSYA 3PXDA 4BVJA 5AXAA 5IEJA 1XHEA 4DWOA 2GHTA 2BFBB 3H5VA 3PHJA 3V1YA 3R0XA 2FP4A 4YAGA 4DMUB 4Q4DA 2KBEA 1O0CA 5AO9A 5G0WA 3B6MA 1RU3A 3N05A 1F14A 1F5NA 2QWXA 4QAJA 3AJRA 4D57A 1OIXA 3FAKA 2QTFA 3A4VA 2C5AA 2OAGA 4AO6A 3KKMA 1RT9A 4DLPA 4S1WA 4MYUA 5AK0A 2KXEA 2YIVX 3DOAA 4BFLA 3L1UA 4ZU1X 1R5JA 1Y4AE 3B1WA 4BNTA 1C7ZA 3IOBA 4C0BA 4OATA 1U02A 5JS7A 5CVCA 2WZJA 2BI4A 3IDSA 1KEKA 4Y0AA 4X6XA 4ZI7F 3BOSA 5AYVA 3OIYA 2Z30A 1QGOA 3BRSA 4BJ6A 2AG0A 2PKYX 3FOAA 3BHMA 3BXHA 2FK8A 1I3LA 4DMGA 3RJ5A 2POQX 1Y7TA 2FX2A 1N57A 1LWOA 4R9UC 4LGYA 3V7UA 1QF6A 1GYRA 4JWTA 4BO0A 1UBRS 2BFEA 2JFYA 3P0JA 4KRXA 2B25A 4ZDJA 3GJ3A 4F12A 3R4VA 4M53A 3QFRA 1SXGA 4H31A 4AKHA 4NY1A 2E37A 5DHSA 5A3JA 2YINC 1IUOA 2VVTA 3A14A 1P9WA 3G3EA 2ZBPA 1LTHR 2HK8A 3ODGA 4R05A 3PQ6A 5JZMA 1UP6A 3D43A 3A28A 3OF3A 2OD9A 1FRZA 3HDGA 3KXLA 1P1BA 1WP4A 1OV6A 3DYIA 4RM2A 2QI9F 1GPUA 1CY2A 4NR0A 3UOAB 3ZWBA 3CH5A 2E7ZA 4HGZA 4WCDA 3EEQA 1P7VA 3NBUA 2WA1A 5D01A 4RD2A 4OHRA 1FRFS 1T3ZA 1XTRA 3NLLA 3L77A 4I36A 1V1JA 4DA9A 1OD6A 1XU7A 4UAUA 2WVHA 3ECSA 1ZSNA 3OIWA 1EMDA 3JZDA 5CFPA 2QIPA 4OYYA 3LYUA 4PZCA 5DTQA 1N1EA 5FTJA 3HC7A 3SIPA 3C74A 2WMOB 2WJZB 2BKLA 3GQ5A 3TZKA 5C7OO 2I55A 2FCAA 1U2PA 1OXTA 3RK4A 3NOXA 421PA 2PXHA 1MPXA 4YYZA 1SY7A 2HWWA 3CEAA 3A6FA 1W75A 1U7UA 2P3QA 1LLCA 3GVPA 2JJ1D 2DVWB 2CLSA 2QTGA 5BSRA 2V4MA 2IV3A 1CFZA 2BI8A 5IYZF 2O7RA 3E1SA 5CDUA 1NBAA 1YCDA 5F52A 4AY5A 2ZJ5A 2GN6A 3UWSA 1CF2O 2HIGA 4GSKA 2W4IA 5FA5A 4KXYA 2QPLA 4FC7A 5THKA 4Q9KA 4F5YA 3X1KA 4L51A 1C5KA 3UKOA 2XNDD 1SIBE 1LK7A 3K4PA 1VP9A 2AZDA 3PNVA 4PG4A 3RSFA 4ZVKA 2XA9A 1EAYA 1E18A 2BHSA 5K0TA 1SXHA 1YIAA 2CFRA 4AYTA 1CRPA 4KVZA 3M6UA 3OEHD 1YXMA 2ACEA 1IN5A 2FF7A 1I2BA 1T9HA 3ZX4A 4D3ZA 2B5VA 2JJ2D 4H3VA 3T1TA 4K1XA 3G68A 3V8NA 1VDDA 1QG4A 4KQJA 4MV3A 3UCEA 1LW6E 3MUOA 4FN5A 3FSEA 4MRVA 4B6FA 4LF4B 1HR0B 3S2IA 4LYDA 2GD1O 2BFFA 5FUMA 2ZBFA 3BWEA 2Z2KA 1YULA 4DLTA 4MQLA 4LWZA 2CHVA 5TC4A 3QVMA 4Z86A 2AEFA 5B3AA 5F7JA 2G0AA 3UW3A 2D1RA 1FFXA 4B5KA 4MGYE 2BM1A 1QLHA 2REQA 3ZDDA 5BN3A 3IP6A 5G4KB 4BJ3A 4DTCA 4QODA 3LWNA 5FOWA 2VQ6A 1OGIA 4XGRA 1CY7A 2FSSA 4WOPA 2JGLA 1NQWA 1DV0A 3STYA 2VDLB 1BO6A 1ZJJA 4NYJR 3LOUA 1WZCA 3GUUA 1X13A 5IDYA 2QTBA 4OBWA 4OU5A 2Z7JA 4XYBA 4NXMB 1V4VA 1PWXA 2W7TA 3NONA 3H99A 4DAEA 4ZI3A 1RNLA 3COZA 1BIFA 3PF8A 1HETA 3N59A 1NHWC 3IQDB 3GW8A 1F5SA 3I4CA 4GOXA 2Q4OA 3U62A 3JW8A 1Y1SA 1T4CB 3NT2A 1MO6A 3O2NA 4GI7A 4CFYA 3TOXA 4R9RA 4ZZ0A 1YB5A 1R6UA 2QAJA 2GXQA 4JASB 1JG1A 5HK8A 3QOWA 1DKLA 1IHDA 2GVZC 1DOAA 4EP1A 1CQWA 3K9OA 3IP1A 3Q7IA 1UQUA 4Z4HA 4FILA 4MUKA 4L4ZA 3HKBA 1TK2A 1RJ9B 2CMHA 3A1SA 4ZCSA 2OHIA 3QXGA 3OWOA 3U7GA 4R2LA 1Y1QA 2NZVG 3DLPX 3WWCA 5FFMA 4K81B 3LCJA 1EX7A 1Z8DA 4D9KA 3SJUA 3V1KA 2F4NA 1P2SA 8ADHA 3M6AA 3C6MA 3PG5A 3BWVA 3HVHA 4JKYA 1PFUA 2FUKA 4J0JA 4PLFA 1JLKA 2LD4A 2PMBA 5HMLA 2CNLA 7YASA 4ER3A 2VNKA 1XRJA 2ENWA 5EMJA 5B37A 1GG5A 3PWSA 4TTPA 2NMVA 4I8DA 4W1SA 2ZULA 1KAOA 5DLYA 1XNQM 3W5JA 5A6VA 4NJEB 4CCYA 1CUCA 5CM2Z 2VP5A 2FW0A 2WV7A 3LA6A 1PM5A 3REOA 2WOOA 2M60A 2O48X 3FY4A 1KNXA 4WQMA 4KPYA 4MVYA 1QOPB 4AF8A 1J39A 1IPHA 1BJKA 2BI7A 1A8QA 3U3OA 1R9GA 1WSBA 1NNEA 4JCCA 4MVJP 4AX8A 4LV8B 3FPEA 2Q1XA 2VP9A 2PUJA 4OHCA 5LQCA 3T3HA 1C50A 2VOEA 2P4HX 1JNYA 5JDCA 3GLIE 3B70A 2C4WA 5KOHA 6REQA 1RM0A 1H2BA 2ZU6A 5IF9A 4MW0A 1CY4A 2QW1A 1Z2NX 4EY8A 4M9XA 4DQLA 2B1IA 1L7PA 1JB1A 4RVGA 2HMYB 4OQZA 3MGCA 3UJAA 4HLUC 3J7BA 2WILA 4WADA 1LJ8A 1YACA 2WJYA 1AKQA 1JG3A 2YWCA 4IWXA 3CQ9A 1LBEA 2VPTA 3OJLA 4OXNA 4X3PA 3AK4A 5MN6A 3AF5A 1XTBA 1YOVB 2LRHA 1T2VA 2ONZA 1K9VF 4GGMX 3QXHA 2WU1A 3DE0X 3I5AA 3FZGA 2EKBA 3C6QA 3O3NB 5AVSA 3O2JA 4D74A 2O20A 1YSYA 5BN4B 1YSCA 3KKLA 3B6EA 1P91A 2WZCA 5IUNC 3JQAD 5ALRA 5E0OA 4MA0A 3ZI0A 3QLVA 3ZCVA 4PYRA 5U1PA 3VPDA 2ZZKA 3NW9A 1DEAA 4X62M 3PVZA 2I2DA 4QU9A 2G63A 1NQVA 1U7PA 1JR2A 2WIKA 4HNHA 1JL3A 4RQBA 2IU4A 3F47A 1QV9A 2DZLA 3CVXA 2AMLA 1ACLA 5DTRA 7ABPA 3FPKA 2C7VA 3FTQA 4I3FA 2RK3A 5IWAB 1D0MA 1IFXA 3EEIA 3PVCA 2FWAA 3R8CA 3VZPA 5MN4A 1Q1EA 4IDGA 1H4TA 2XTAA 1BA2A 1V41E 4MARA 1AK9A 2I3AA 4DRZA 1ICIA 4ON9A 2QL7A 4D6PA 4YAEA 5BMVF 4L0MA 1RKXA 3L0PA 1RXCA 3ZV5A 2PA3A 3U5ZB 3FJYA 2KS6A 3NVKI 4JZKA 1TKRA 2ZYTX 3BIFA 2AOXA 2WNHA 3AHHA 4KTVE 3G6KA 3BXGA 3ZVLA 1E1QA 3PTZA 4Z6YA 2ZDGA 4IIUA 4DCSA 2WT8A 4JUAA 5ES3A 4LIPD 3GT0A 3TQIA 1Z6ZA 4EY5A 1HG0A 2VHVA 4C03A 3ISVA 1JTEA 4IY1A 4Q39A 4ACBA 3UKJA 3ILYA 1PT9A 4PIPA 4WLNA 4G24A 5BQXA 4OYLA 1RC8A 4RGYA 3PNPA 3EIHA 1YB7A 1GSIA 4WSOA 4ARBA 5ED4A 4GXTA 1H93A 2KBFA 5DHTA 2BAGA 4PS0A 3QVTA 1I6WA 2E4YA 2BMFA 4XIYA 2R7KA 3VZRA 4V03A 1CC1S 2JDID 1Y4SA 2YL2A 3IUNA 2YMLA 5FR2A 1DJOA 4LY0A 3HB4X 3VKGA 1H2XA 4KXVA 5TARA 3K71B 4HX5A 3NBKA 4HWTA 4D5GA 5F77A 3JV7A 4RL4A 1NWCA 3NIFB 2WP8J 3DVLA 2O5VA 4WWHA 3ORRA 1RAAA 3WDMA 4KRFA 1X3SA 4RQTA 1JEEA 1BDIA 1KK0A 1WKBA 4JVSB 4JI6B 3PR2B 2ZBQA 1G7SA 3MTBA 2CB0A 2IXEA 1WKCA 1XEXB 4AW4A 3P9KA 1UP7A 2PMKA 2F4VM 5JJLA 4KO1S 2E5WA 3UJHA 2C2WA 1EU1A 3E3NA 4RNCA 1SZPA 3TWOA 1XNRB 1W4AA 4DQKA 5FTMA 2ICAA 3MMNA 3O4JA 4W9MC 2Y0DA 3ADKA 3CA8A 1YD7A 1D2MA 3KQVA 3RUAA 9GPBA 3WWDA 2BFOA 5EP1A 2A94A 1GFIA 3U44A 2WOJA 5HQJA 1X80B 3CEPB 3H1BA 2RB4A 4R6XA 4M88A 1YR8A 4IIHA 5IBCA 4WD3A 1LU9A 1DEXA 2YWXA 1D2CA 4KAXA 2HXYA 5KJEA 3T61A 5B3JC 2NNLD 4GE0A 3RWOA 1D0LA 2YIMA 2QD3A 3T7RA 2ZIZA 2EUCA 1XRRA 4E7PA 1ODIA 3I0ZA 1UF9A 4BCCA 2PZMA 4JL5A 4DUYM 4P38A 2V7TA 1EJ2A 3ESZA 2RHOA 3T9DA 3AI7A 2UUAM 1FL9A 1YZUA 3AV0B 3ZGOA 4FQ8A 3W79A 3S2ZA 3ILSA 2NV6A 4BNHA 2IH5A 2DG2A 5BW4A 4H7EA 1T8TA 2ECOA 2Z4TA 1S8OA 4X5OA 3F5MA 1XFAA 1HT2E 3OPVA 2FWBA 3FZNA 3VYTB 5SICE 1J8FA 1QFJA 5CVEA 4K6FA 3IJEB 3WBKA 4ND6A 3CLVA 5MF6A 1SO8A 4KI0A 2AUTA 4Y2QA 1XDZA 1A8HA 2BDEA 3AKZA 4KSCA 2W6CX 1FFEA 4C89A 1FP7A 2DKLA 5F64A 4RJJA 1KDOA 3NHRA 1E8MA 3GUCA 1XVVA 1DMSA 4Q3EA 3AJ8A 4GU5A 4Y2GA 1YQTA 2FLKA 1ABEA 4UVDA 4RACA 1UPFA 1QUTA 2CNWA 1NM5A 3I6MA 2JFVA 1XA4A 2XW6A 3LRPA 2GB4A 3SSNA 5DIZA 1GYPA 1KP2A 4AZVA 4P2BA 1JBEA 2A30A 4P9NA 2Z6AA 4DMMA 5CM8B 2P0YA 3N28A 2ATIA 4MRMB 4LSGA 3K31A 5LU9A 1ECBA 1Q0TA 4IOMA 4OJTA 4NHOA 2B21A 5K0CA 2OBFA 3G13A 3ZZ0A 4F3NA 3QE0A 4CDRA 2BMJA 2KSQA 4DBZA 1GAXA 1UFKA 4GZMA 4BBPA 2JLUA 5DJ5A 4YACA 1KBQA 2Z2ZA 1YE9A 2P5TA 1TO6A 4G4OA 2QYHA 1Z5VA 4MV9A 5F1YA 5FPSA 1GCOA 3URKA 3HB7A 2F5OA 4CM4B 1TYDE 3A2MA 1LSOA 1C14A 3GEPA 1TXGA 4EHLA 3KZOA 5TGZA 2GM5A 3F3MA 2GAAA 4B6PA 3VNQA 2ZJZA 3NRBA 2YN4A 4YRTA 3J7AC 3UICA 3RAGA 4BWGA 5CNJA 3W5IA 3MRVA 4FHFA 3FM9A 3DXXA 2J48A 3F6EX 4BLQA 1J0BA 2QTZA 3GZ4A 2BMDA 4NCXA 1GR0A 3AG6A 1GDTA 4FD3A 4G0OA 1MB0A 1T2DA 2VBCA 1F0PA 1CB7A 3KYCB 3T52A 2GF2A 2MT9A 5F2NA 2AFHE 1KEUA 2ORVA 1RLIA 4ZEMA 2UZIR 3EIQA 1KY3A 1QG0A 1H66A 2HK7A 5EMNA 1KVRA 2EU8A 4XWGA 1U6KA 3G0OA 1ILEA 1AQ6A 1T4MA 2IYSA 3EUWA 2JKVA 1WOMA 1D6NA 3IHKA 2WM8A 2RDMA 3I45A 1LSJA 1JVBA 3DVAB 1JHMA 3OI7A 2G1PA 5EJ6A 1E8DA 4WL0A 4R69A 4NYMQ 5HXAA 4G81A 2JKZA 4HZIA 3TRHA 5C1DA 2OQIA 4RTMA 1O08A 4V38A 2WY2D 3TW8A 4ETIA 2CLCX 3M9WA 4Z9BA 1EX1A 2WMNB 4XAQA 1WB9A 2AZ4A 3NFRA 1T36B 1U2SA 4BO8A 2VXYA 4KUGA 1QDUA 3BGIA 1I7QB 1D7AA 3FKJA 2W8BB 3U4IA 4ZRMA 5LA6B 3ON5A 3O91A 4XJVA 3UB2A 1Q2UA 2UU9M 4UTPA 1XI2A 4BNGA 2D0OB 4Q3BA 1PAUA 3LT0A 4Q1AA 1J8YF 1EE2A 3QBDA 4NJMB 1H94A 1XD9A 4LRYA 2DQ4A 2DJ5A 1UXGA 1G9XA 5T8KA 2QZPA 3R5HA 3GLRA 4WMLA 3SG0A 4MQUA 4BCBA 2C84A 1PF7E 3D7MA 3T5AA 4BRSA 5ITYA 3FD8A 5K99A 5B7GA 1O58A 1NNI1 3P0HA 3PNOA 1UBJS 5GINE 4D98A 2BOVA 5DW0A 1IVYA 5EJ8A 3L4SO 3WX0A 1I10A 1RWOA 3PC4A 1ZI8A 2ZUSA 4PSCA 5B30A 3P9YA 3AXSA 3SDBA 4TMTA 4B35A 4AJ9A 1KERA 3VDQA 2FFJA 5AVJA 3TLXA 4WCFB 4DJDC 3OX4A 5TGDA 4DANA 4FFLA 3RSGA 1B8NA 1QGDA 1U0NA 2HMVA 3FFBA 3ZHTA 4F11A 4F93B 3OD1A 5EKDA 3VISA 2AKYA 4DDVA 1SBYA 4QZVA 1R12A 2CXQA 1YIOA 1JQKA 1M2JA 1FTQA 1QWOA 3H9BA 4L27A 1U7HA 1Q39A 1CY1A 4YDRA 5HF9A 3D1VA 5WRFA 1DFGA 1G8YA 1VYTA 4CM7A 3FNRA 4TYMA 1EWKA 3Q5DA 2O5RA 3D8RA 2B1RA 3GLHE 1FRQA 3GFQA 4D3XA 3P2KA 5GPBA 2JGFA 4LY9A 3HXLA 4DR6B 3IDZA 3X1DA 4U7WA 3TSYA 1DAPA 1XO1A 2O7QA 4AJIA 2LHGA 1Q0SA 5LWHA 2YYYA 1C9KA 2B36A 1Q95A 4OHXA 4TXNA 4F4IA 5LZ7A 4REMA 1BVYF 3PEUA 1ZCAA 4CJXA 1W2WB 3UUGA 4XCXA 5A6SA 4Z8YA 1LQTA 1N6KA 2RGHA 1ZNWA 3ZGYA 4FYHA 2EFYA 1OTXA 2IE8A 1L1FA 1U4SA 4QBKA 1OXMA 1ARZA 2VQEB 2JGKA 1XJ0A 2XX3A 4CEIB 4GVPA 2VSQA 4OUDB 2YIJA 1PUJA 1QHFA 1W44A 4B46A 1QRSA 2GZ3A 1XV5A 3RBXA 4BQEA 4CUZA 3VR2A 4BNJA 1HDXA 1R00A 2Q0HA 2O4CA 2HEIA 2DR3A 3DE2X 5FI0B 4FJ2A 3E9EA 4A92A 5KWVA 1SH7A 4C4SA 2W2XA 5D6OA 3MGAA 4RIFA 1LA2A 4KP7A 1DTSA 5DTJA 2CNKA 4XWKA 2WSEF 1VMDA 4HQ0A 4FYPA 2I1VB 2OEPA 1KOLA 1T8RA 2AN1A 4KO2S 1M2FA 4ANFA 4BFUA 3QKWA 2X9NA 3CH4B 4KFTA 3K6SB 3CN9A 3PK0A 5JPIA 5I51A 3NG1A 2VQSA 4OK3A 1Q77A 3GVIA 3WL5A 4LKOA 4I50B 4AICA 1FDTA 2FOIA 4GAEA 1BE6A 5KS2A 1CNEA 1BX0A 1U8FO 1XZJA 2OLEA 1XZ8A 2XA2A 3C98A 1P4HA 3QLEA 1NVGA 2OWEA 3AO0B 1RQ2A 2UXCB 1A4RA 4UJ5A 2PUWA 4BVKA 4FKBA 3K0CC 1BMTA 3SC6A 3ZCBB 4CL2A 2D7HA 5BUQA 4FGWA 5IC6A 3FJOA 2D13A 2PJZA 3WP1B 3FPLA 3V7FA 2UZ0A 4WECA 3EE6A 1Z2PX 3I9MA 2JGEA 2Q2OA 4MI3A 1FJGB 1TQ2A 4Q9JA 3LSYA 2A5JA 5AH0A 1XHFA 3GDGA 3RABA 3U7EB 1AKVA 2QDXA 1JIQA 1EHCA 1OX4B 4BZQA 3BGVA 4PAWA 4L8RC 4DXAA 1UM9A 6NULA 3WLEA 1Y0BA 2D5AA 1B4DA 4GVXA 4A26A 1CFJA 2V3CC 3CEMA 3GNSA 1IY9A 4MS3A 1WGLA 3IQFA 3LZCA 1V1MB 2CBGA 5F9FA 5E1BA 2FZEA 4X90A 1BKDR 4MDEA 2IH4A 1LV8A 1E9CA 5LA6F 5I7UA 3WK4A 5KTOA 1TCVA 5J1TB 2NG1A 1R18A 2IXGA 2PWPA 2VHTA 1DC5A 3GJ0A 4AF7A 2KW0A 2FEMA 3CUTA 2JH9A 3WV5A 4KSBA 1FA9A 1C7IA 1N2GA 3OKCA 3ICWA 1H85A 3ROEA 3BEDA 4RF5A 4GDFA 3E8MA 1KVUA 2JGRA 4UOEA 2WU0A 3KB6A 1YJBA 5JRZA 5ALTA 5JROA 3ZE2B 2APLA 3EEYA 2HBZA 4F4JA 4U2GA 1QRAA 3PPXA 3K0SA 4PR0A 3GJZA 1ZK1A 2L42A 4Y2UA 5ER9A 1CD5A 1ZMBA 2HMUA 3EZ6A 2ZDQA 3R8FA 3G23A 2RI1A 1H6BA 1WF6A 3LL4A 3L05A 3TZQA 2B8NA 1S01A 3HHZA 1H9BA 1RHMA 5A3QA 4EO7A 4YWHA 2W11A 2XZUA 4YHHM 1UDRA 4HATA 1GFZA 1MABA 3Q5EA 2CFSA 4EHBA 1FUEA 1L0BA 1RMQA 2QY6A 4C1BA 3QEBZ 3O8OA 2OXCA 4TPKA 5BURA 4UD6A 4EZIA 1X7YB 5L7YA 3KS4A 5IM5A 3WYEA 4IHAA 4NFYA 1PZNA 2YHSA 3K1JA 2K2WA 1HKHA 4P3PA 1KKMA 3R23A 1YIDA 1YASA 4WZBE 1DIOB 1ZXBA 3TZCA 1NOKA 2RHCA 2Q4RA 3VNBA 2ZSAA 4RPHA 3HXMA 2VO1A 3R3JA 3WGIA 2F9MA 2XNSA 5AVOA 4BUJA 1E9AA 5AXDA 3IVCA 2O8BB 4IFIA 3CTWB 5KYUB 1VBNA 1Y5MA 2GNAA 3AR7A 4HHEA 5JJBA 1SKUA 3PNYA 4URUR 2XGNA 2VQDA 3FWZA 5EJFA 2PQ6A 2Q7OE 2AKAB 5KQGA 5JU6A 4WRRA 4RYLA 1VL5A 1NRXA 4AKEA 3DA8A 2P4UA 5KNCA 5FTLA 4F8JA 3HFGA 3ISJA 1M2GA 1SC4A 3MYRA 1WQ1R 3IQGX 3AY7A 4JMPA 2VNIA 4HN2A 4M21A 1XVUA 1GCGA 2FEXA 2JCSA 4ZRDA 1EFAA 3JPWA 3MWFA 3PUYA 2R6FA 3FCYA 5LUAA 4DV6B 4N3CA 3LPCA 2CLOB 3FPFA 2AN9A 3M4YA 1UL1X 2FUG1 3LMKA 1ANKA 3I2GA 5I7AA 5TT0A 4AP5A 1GTRA 3OZUA 5DVZA 2D0PB 4UCFA 3OZGA 4ZVMA 4BAGA 3O8RA 3FE2A 2O54A 1CUAA 5T41A 2WC1A 1L8QA 4KFUA 4PYKA 2IPXA 1IPEA 1Q5PA 1JILA 1TD9A 2MHCA 2DT8A 3NDPA 3QNUA 2ZROA 1G4HA 4AM8A 4EG4A 1KEEA 3CWQA 3SEFA 4NV0A 2JZNA 4JIMA 4ESOA 1SBQA 2IL1A 2NXNA 1NU6A 2OESA 4OMFG 5AJTA 5CFQA 4I66A 2OD2A 3OLVA 4LFAB 1KYWA 3S2UA 1PR5A 1HORA 4KSYA 1DAFA 4YASA 4ZJPA 4CM8A 2JCBA 4LV5B 1P7ZA 2R8XA 1N3IA 4HV4A 1VGRA 1UMBB 1UT6A 1XDGA 4LOHA 2NSYA 2XOXA 3OPYA 1GG2A 2FW6A 3QQ5A 3FIJA 5FWNA 1TEZA 5I7WA 1N0IA 1NBHA 4I50F 3JTMA 1GPYA 2WJGA 1XEWY 2FEAA 1UZNA 2ODWA 4B3BA 5IDWA 5I9BA 3B1FA 1QF7A 4XUEA 3U6QA 4PRLA 4BRUA 1P39A 4CR7A 3HVKA 3U3KA 2CJYA 2DPYA 2VHXA 4OVZA 3ITKA 3TTXA 4EKEA 4EA7A 5J43A 2X1MA 4UUMA 3ENWA 3N07A 2FA9A 3AEYA 2Y1EA 2AEEA 5IUJC 2HD4A 2WHEA 3KSBC 4O02B 4HVTA 4GLBA 4RTNA 1FYWA 1MNQA 2WUDA 4EENA 2FMIA 4L72A 3DMHA 3AKEA 2WDZA 4O8ZA 3BFXA 2HRZA 2J6CA 1OH5A 5TMBA 3ZHVA 3WSTA 3QVGB 4NXNB 3AERB 2E87A 5JC1A 2G67A 2JAXA 2J3DA 4Y9SA 4NH0A 2EDAA 5K6RA 1I24A 4BLTA 2JEZA 3TVYA 2WWWA 4EHKA 3G7NA 4RV9A 1OTRA 3DR5A 4HYQA 3THYB 2E21A 1COZA 2Q3FA 4HDMB 2DWOA 2GKSA 2C78A 4G9BA 3MHVC 3LD9A 5A5GA 3CN7A 4KIJA 3GGDA 4PFSA 1ORRA 1E4EB 2RHMA 1G5HA 3OBBA 3EPLA 5DXJA 5CX4A 4ISBA 1PR0A 3AUXA 5BV0A 4Q7QA 3MTAA 5KSYA 4JLOA 3DBVO 3V5NA 3IAAA 4R3UC 4YRCA 4JK3A 4BLUA 3LPDA 3R24A 3BBZA 4JEIA 3BFJA 3HZZA 1TB4A 3I05A 4BVHA 3D8SA 4JYBA 4E7OA 2K7ZA 2J6BA 1L9KA 4RKWA 2H2FA 2G8NA 3VPBA 2CLIB 3TJMA 2Q9AA 1HFEL 1BVRA 4NOKA 3I37X 2EO2A 1E6MA 1KA9H 1Q0LA 3NAQA 1KDTA 4EMSA 1TFRA 3ZYCA 3DC2A 4XOUA 1XAGA 1ZFNA 3DBRB 1T3GA 1T4DA 5CT8A 3BK7A 4DC9A 3TQRA 2PXXA 4U9HS 2YTZA 3E8XA 3MEQA 1N5IA 3CLHA 1AV6A 1Z4PX 1XQWA 2NZXA 4KKVA 3TFQA 2W6MA 2FRDA 2HNBA 3R9XA 1UPCA 2GD0A 1LQ2A 3PFBA 2QSFX 4Y0NA 4YC7A 3G2MA 3PQ3A 4B0PA 3KVYA 1W30A 2ZI5A 4QRHA 1AKRA 3FYTA 4L50A 1ISHA 3IBCA 4CL3A 4Q19A 1YMUA 4H7IA 4EM6A 5D1NA 5LJIA 3NHAA 1MIHA 4DR2M 1ZY2A 1PK8A 2OHHA 4NRWA 3MTDA 1FUYB 4KPUB 3MW8A 2HSDA 4D9BA 5AUPB 3GEDA 2QTMA 2C0QA 2C4TA 4IIXA 1WR1B 5KO2A 4QOFA 3THWB 4QYSA 4FYJA 1A77A 2V9PA 5CJJA 3BREA 1TU3A 3RRYA 4FHZA 3TAUA 4E14A 3SHFA 3B20A 1T5TA 1Q0HA 2IYLD 1THMA 3UC5A 3O7WA 2Y68A 1HE5A 1SBZA 4CTKA 4FWHA 4UOQA 5G53C 1VEJA 1FFGA 1JT2A 1Y9DA 3VO9A 3BXWA 1VJTA 1X7ZB 3BMNB 4X61A 4CIDA 2I3BA 5AW5A 1ZH2A 5MFZA 4JGIA 4BRZA 3RVPA 1IBRA 2ET6A 4ZJUA 5FOVA 5DHRA 5GQSA 2HAKA 1OKSA 1E4YA 2A4MA 3F0TA 3DHVA 4HAXA 2O2HA 3N8NA 4MI6A 3T3OA 1XJ5A 2IQ5A 2GFHA 1GJTA 2BFMA 3B2EA 3W5CA 2PZLA 1X42A 5GJBA 4JSRA 3G9ZA 1BAPA 3UJCA 1E7MA 4N5DA 2VDKB 4YAWA 5IAGA 3OQIA 1VKOA 3GWZA 3DXYA 2PGOA 2DU8A 1RWWA 2YXBA 4JELA 4WERA 5C8ZA 4TUYB 4XXHA 5IAJA 3DPSA 2CXHA 3P2OA 1D6SA 5EOVA 1Z4KA 2J5YA 5TRTA 1MA0A 1N32M 4PGAA 2FW8A 1UC4B 1G63A 1D8TA 2C7RA 2XCUA 3IPCA 4BQQA 4PLPA 1Z6AA 3B74A 2HUPA 2CVQA 4KQCA 5AWFC 1YS9A 4YJKA 1RM4A 2IUUA 2Y1CA 1ZGGA 4K40A 2Q3CA 4MMXB 1RM3A 2XZDA 5AW6A 1WABA 1FMFA 1JEDA 3UAYA 4GH9A 3HKEA 4EQ6A 2PX8A 4X8MA 3LE8A 2C82A 3DGFC 2YXDA 1IBMM 1QJ4A 2ZSHA 4XVCA 5DCWA 4LGVA 1YNSA 3LYAA 2UKDA 1MQ8B 4GOJA 3AQIA 1T0BA 2F5PA 3SBXA 1TZCA 3WDKA 4QNMA 2HZBA 4ZMBA 2R7LA 4OKNA 2XV1A 3ZCSA 1IZ9A 3LK7A 4UEQA 1L6RA 3J27B 4Y2YA 2NOAA 1EX6A 2PU7A 4IXMA 4X41A 3VC1A 1GYQA 1HNZM 4H4DA 3VU3A 2YFYA 3ZJUA 3EQ7A 1NI4A 4O4IA 4KHPB 1K0UA 4HTFA 5CLGA 3EQ8A 5JYBA 2LTUA 2QJFA 3ZTWA 3OC6A 1QCDA 1GRCA 4YCCA 4BNXA 3IO3A 2XYHA 5CCEA 5A9RA 2X22A 4G4QA 2WYWA 1S3IA 4DBLC 3JR7A 1OA1A 4Z0NA 2YS7A 4BE9A 1Y8AA 4I5GA 4J49A 1GTSA 5K3CA 5ITZB 3C3XA 4EGSA 3A1UA 4TMYA 1T1IA 4RDIA 2P7HA 3ZK8A 1Q6ZA 1CJBA 5IHXA 1P0PA 1QYVA 4GOMD 3HJNA 4UNQA 1WRBA 3HA7A 2VBGA 2J0QA 2WAOA 4K6CA 4B7FA 4QOJA 5KVSA 4MX8A 4G8DA 3HJTA 1RVV1 3GRAA 4FCCA 5EJ9A 2GF9A 1BEUB 2DY1A 1C7YA 3BJRA 4A27A 1ZNYA 1K6IA 3HCBA 2DENA 5I9SA 2A78A 3D0RA 5ALSA 2N0SA 5I7HA 5DB4A 5FYQA 4EBBA 1US8B 3S3TA 4PCVA 4IRUB 2YV4A 1JR3D 4BX0A 1MVLA 3SYMA 2H5LA 3JRXA 2ONYA 2IUYA 2QBYA 13PKA 1QFSA 4NOMA 2NZ2A 2JY6B 2DH6A 2BGIA 5CIYA 1Y8QB 5HZKA 3N0XA 2HRQA 2W2PA 1VCNA 4AYXA 4RORA 4UU0A 5BQPA 2LDXA 4YDHB 1MW8X 1UPAA 4DIFA 4EJFA 1RSZA 3VC2A 3UK6A 4TV9B 2Q5JA 4BNZA 4LJKA 1UR5A 4RF2A 2XWQA 4JI0B 4LOAA 2QE7A 1JQDA 5BXQC 1DJNA 5CYPA 3CG4A 1H2EA 5KYYA 3LF2A 1RBZA 3W9SA 3WA6A 5JWOA 4XGNA 1XBTA 1GPDG 4XGQA 3NWBA 3HUDA 2WTBA 2PG3A 3UMJA 2Q3LA 1JT9A 4HEA6 2GPSA 1Y1KE 2H29A 1ZGJA 2PL1A 2WM3A 2BEVA 2J5BA 1ZH0A 2ST1A 4UM7A 3G7SA 1PX0A 1XQ6A 1TJ3A 1Z5CA 3A6KA 1TT5A 4JLAA 3ZDQA 2LW7A 1CUIA 1WDWB 3FCSB 3IXQA 3JD2A 5CFRA 1SKQA 3L4JA 1Z2OX 1L4FA 3WWZA 1CQIB 4X00A 1N2BA 1GGMA 3PGVA 2O3QA 4KO4S 3HB1A 2P5SA 1TYCA 2XQVA 4TQGA 3VR6A 4BFVA 5IJ0A 1PWYE 5AUQA 1JHYA 4FMDF 4GX5A 2RGYA 4Q16A 4N5HX 3PYMA 4REQA 2HBRA 2NU8B 5C9ZA 2QD4A 4LRTB 4C3VA 2Z43A 1YJ5A 4BJHB 3F9RA 5L3ZA 3L26A 1UBMS 1LVUA 3NVMB 3TLAA 2PSEA 4GHWA 3FNGA 2V8BA 1MIOB 2XKJE 3IEKA 4E3WA 2PDAA 2JLVA 1JEAA 1IOLA 5DBGA 1FQOA 3B7ZA 2ACWA 1GFWA 3FKQA 2W2VA 3VPSA 3WYFA 1W5SA 1ISRA 5K8TA 2I33A 3IBSA 2FR8A 5CHEA 2O19A 2NGRA 1E69A 2X8LA 1ZV1A 1QGUA 3BVPA 3G85A 1KHTA 3J81A 3FETA 1WCWA 3CUUA 4HUTA 1J90A 1ZCJA 4RO0A 3DLAA 1X15A 5KNDA 3EUAA 4UDNA 4M7WA 3AVWA 1OX5A 4JKIA 4MB7A 2PRKA 3NZEA 3W68A 1UZMA 3EY4A 4OM8A 3M5DA 1A4UA 3IIMA 1EK5A 1J0CA 4O6VA 3BB4A 2WZQA 1WXHA 5B1HA 3W8DA 5L8VA 1ZJ4A 2NO5A 3NV9A 3U1TA 3PRJA 3KW6A 3ZIAA 1UODA 1O57A 5HQ3A 4C0XA 3TQFA 1WCIB 2B8TA 4AJPA 5T5QA 5IKEA 4G5OA 3VSEA 1E5XA 1ZKDA 1XCBA 1UIMA 1STOA 2R1ZA 1AUXA 2Q3JA 2FJPA 1GTG1 1INLA 3EVNA 3HDQA 3CCFA 5EKTA 3HVRA 2YW2A 4JZYA 2VYQA 1MB2A 3CZCA 2YOGA 2H2DA 1CUWA 3LBNA 3NAZA 3L18A 5JAOA 4L7QA 1XMXA 4O0LA 1PD1A 2YUTA 8GPBA 5KSOA 1T9AA 3EEOA 3DBHA 4BKQA 3ECCA 1AXEA 3NWOA 4YAJA 5HBRA 1EHIA 2PLAA 4RLFA 4YUAA 3CPJB 3L1KA 5AM0A 4HNGA 4OW0A 4DV3M 4GX2A 4BX9A 3F90A 4MMYB 4ZQHA 4BFZA 3V9AA 4NPAA 3G1WA 4KWCA 5BSTA 5DM0A 5JQWA 5ELXA 4MV0A 2ZUFA 3IYLW 1O4WA 3L04A 1WF3A 2J9GA 2VJOA 1IY2A 2CDAA 5K3BA 3IEUA 4UZSA 1FX1A 2EJVA 2JBWA 2OORA 1TGVA 5REQA 2WUVA 2P2NA 3C3BA 4C4PA 1G8FA 2LHCA 4HPJB 3IPLA 2D06A 3G5AA 1I4DD 4JWKA 5LWQA 2KZSA 5C52B 4B2YA 5KDLA 4Q05A 1G8AA 1VYVA 4YRFA 1F3LA 3KR1A 5DWDA 2H11A 3W6UA 3HYSA 3OEHA 2PGIA 4JQYA 4A10A 3NWEA 4HDQB 3T7DA 3K09C 1VEKA 1ST2A 1K4MA 2PO7A 2IVZA 3B36A 2VZEA 1IEXA 1N36B 3PXAA 1Y7LA 3IE2A 2XZFA 3OPMA 2Q8QA 3U17A 3R8XA 2C7BA 2GAOA 4MWTA 5TMEA 3HH8A 3E7DA 2NV2B 4HWKA 4AU1A 4YONB 2HUNA 5ITSA 2Y05A 4LA4A 3RJMA 2WIAA 3KYDA 1Z35A 4HLNA 3ZEAA 3T7EA 4DABA 2WFLB 4Q34A 3DCNA 4JHLA 1QYXA 4ZA2A 2WEKA 1TF2A 2X0JA 2X86A 4TLMB 2F64A 2CUZA 1GCAA 2VTBB 1YT5A 2ZW9A 3OM1A 5ALPA 4HGRA 1Q3CA 2FPGA 1U1EA 5CLFA 1L7DA 1WBDA 1RACA 1WY7A 4ZO6A 1XB2A 5EY5B 4BLOA 2FPIA 1COWA 4RPKA 1L4GA 1EQUA 4GEWA 5FV4A 3AHDA 1PZHA 2YMQA 4HLDA 4M76B 3Q3JB 3ZGLA 1G291 4HDOB 1ZL0A 2ATVA 2OZEA 2X49A 3TNYA 3W4IA 2H54A 4DGQA 2ZCVA 2Q2VA 3AEZA 3TTWA 4I1IA 2HJ9A 3C3WA 2R62A 3ZV6A 1TK9A 4C6TB 1JSLA 4P6VF 1KTIA 3QX7A 3HUTA 4TYQA 2X5KO 4ENWA 4C78A 2DWNA 4RYDA 4ED9A 3OJOA 3C3DA 3JZIA 4FW8A 3ZN2A 4R9SA 3UIEA 2ZI9A 4WXMA 2X77A 5CIQA 4KWHA 3UTDA 3RKRA 5ICCA 1CJKC 4AUNA 2HWUA 2O2XA 2WLSA 2WA2A 4FD2A 2R5WA 1Z5NA 2YS6A 3E1GA 2QVBA 2FV8A 3R3ZA 5FWXA 1F38A 1C3VA 1DRUA 2WYOA 4JX9A 1T9KA 16PKA 1QIGA 3A6LA 3EEFA 4TS3A 1KYTA 3H17A 5F1PA 1Y6ZA 4QYWA 2FQQA 1JJAA 5BV8A 4IJWA 2BEJA 1TIPA 2JFUA 1DTWA 2W43A 1RC1A 1LPMA 2HCJB 2QRUA 3WLJA 4XW2A 3UF0A 1FFDA 3RKSA 2Y1WA 1MC4A 3MJRA 1OC4A 2QX4A 2OCKA 3K6KA 3SN6A 2OG1A 3B5JA 2IELA 4Q02A 4BMSA 4ZK2A 4NECA 3EFHA 2QR2A 2O8CB 1K8XB 3G89A 1EWYA 3X1XA 1E32A 2OC4A 1V5GA 2Q8PA 1EX9A 1OKKD 3UMVA 4KN5A 3FNQA 3N2KB 3OQPA 1MVOA 2Q9UA 2VWGA 3K0EA 4RANA 3R7WB 3OTIA 4GF5A 4JJEA 3SNKA 3DFKA 4DIUA 2IDMA 3BILA 5DT2A 2R7AA 3V3KA 4HO1X 1QQ7A 3T3IA 2DX7A 3BD6A 4BFTA 2FK7A 3TZBA 2YFQA 3CUKA 5DLDA 3UQZA 4ZI7A 4B2IA 5KPRA 4ZHSA 5KWIA 5FUQA 4MZXA 5EWMA 3EXAA 4DR3M 4HWRA 3UYKA 1C4WA 4ASUD 1M34B 4TLAA 2Y21A 1LK5A 5CVJA 4A0GA 1JQ5A 1IOWA 3M6WA 1PR1A 3NIGB 2C7QA 1PFYA 3RNLA 2H1FA 5EE9A 5I7EA 4WBXC 1XZAA 2LVOC 5JOQA 4B87A 3INYA 4HMOA 2XT6A 3KC2A 2E89A 3EN0A 2VJMA 3AP3A 1QRTA 2I5PO 3HNPA 1M74A 4IIJA 4EHNA 1GZ3A 5K3AA 4S1OA 3GDHA 4NBVA 1W19A 4BV3A 4B6GA 3HADA 4EBFA 2XD4A 1XFDA 4JROA 4BKUA 1Y37A 1R7RA 4ZAYA 3FZEA 1ECJA 3EC2A 4NEHB 4RXUA 2CHEA 3COYA 2B8EA 2ZSBA 2BFDB 2HL6A 4B3TB 3CX4A 2YOHA 4II7A 3Q3EA 3PC6A 3FPJA 1JN0A 2E5LM 5EHXA 5HNKA 1YMQA 1J33A 3DOFA 2R8RA 1Q1NA 4XJSA 3T1QA 4RJTA 3KT8A 1OT5A 5LMCA 1G42A 4CKEB 2G6BA 2VQFB 4IIWA 3L02A 3QPVA 3X2EA 1R50A 3BFPA 2C0CA 1GT6A 1R8JA 3HMQA 3GMIA 5CCBA 3BB3A 4LZZA 1V1RA 4MROA 4ZT5A 2CEAA 4K3VA 2ZBRA 5C18A 3I4YA 3LKDA 4ZOBA 4DS3A 3MJSA 2FN4A 3P0EA 4XQ0A 3I12A 5JZOA 3TEFA 1F9AA 3NTUA 4CEJB 1G7RA 5BVGA 1IHPA 3QLTA 2QOEA 3ENVA 3W8FA 5JYDA 4D6XA 3CIFA 1SK9A 2DF8A 4RY8A 1XIVA 1HE8B 4ZVSA 5BWOA 4V1CA 4JSTA 1EK0A 3OUTA 3H5AA 2VSFA 2OYCA 1QYIA 3AJIB 2AMVA 4UEKA 4ZN6A 3O92A 1POWA 4Z1OA 1ZIOA 2EBHX 4PE5B 1PD0A 3OMXA 4QUGA 1I1QB 4MUJA 9LDBA 1VA4A 1XCGB 4TSRA 3E4RA 5C3MA 5I8PA 3E53A 2WPNA 2ESRA 3T5MA 1Q3BA 3W1EA 1ZI6A 2X23A 4L07A 3EIFA 2WDPA 3RPEA 3T7AA 2X76A 1NNUC 3F7OA 4E5SA 2BONA 2CXPA 2XF8A 1BOFA 3RVMA 2O07A 1HV8A 3U16A 2H92A 1CUZA 3HVIA 1KORA 4Q00A 5SY9A 3L4BA 1GRNA 1PV2A 3W06A 3P7MA 3I1FA 3GGOA 3X2SA 3MINA 1KBZA 5M34A 3BJEA 4CT0A 3R5TA 2W83A 4BXOA 2AG8A 1YQWA 2Z5GA 2ZIVB 2EKQA 1AMOA 1UBNA 4S3MA 3GVHA 3D3EA 2PWBA 2VN8A 4O08A 5CVVA 1NMXA 1TPZA 4EJSA 2QQ5A 4UVIA 4WKCA 3HP7A 1VG5A 1VL0A 2QM0A 3B1YA 3WGGA 3QWLA 2BTOA 3L0YA 3EWAA 1ZMXA 3RIGA 2NUPA 5FEMA 3BSWA 3LTEA 5K0ZA 1ZVVA 1P1RA 4AY2A 4G84A 1TH2A 4QA9A 4YXWD 4DLWA 5E4YA 4YRSA 5MDHA 5EINA 2AHOA 2GSDA 4U5XA 3RVOA 4IMPA 4HNSA 3RGPA 2DPMA 3FGOA 4UUQA 3FTEA 1Z4QA 1SA0B 4U7JA 1FP2A 3LBHA 3U4QB 3V80A 1M2VA 1IZZA 2QU7A 2OXFA 1MO3A 1QLWA 1J22A 1KSJA 2RG1A 2HQSA 4UATA 2OBBA 1LRLA 1QG2A 2M9MA 4MITA 2Z6UA 1Z7EA 4INPA 3WIDA 4PEVA 3OJEA 1NXQA 2XOKA 3HGMA 3DBLA 5C5IA 1J8DA 1DBRA 5HGJA 2EKDA 4ITQA 2I9KA 4KNYA 4U8GA 3EH2A 3N2NA 1R0SA 1U5CA 3UAXA 1ZUIA 3LV8A 4Q1CA 1K88A 4L0QA 4YJHB 1UZLA 2FUNB 3B7WA 3HXKA 1JECA 2O1EA 2DKOA 2BUBA 2Q4BA 4XYLA 3D2AA 2YHIA 3JQ7B 3K9NA 4QLAA 3GV0A 1W52X 3ZNOA 3HDVA 3TNDA 1YR6A 2KX7A 4YQYA 3TDMA 3DV9A 4WBSA 3K0FA 3NEJA 4I46A 1VYHA 4LV6A 1Z7YA 4AY4A 3OZTA 1X19A 3QKTA 4CKCB 2PSSA 3D0KA 1J8VA 3BDVA 5AVQA 2XB9A 2FG5A 4IWYA 1IUPA 4JYAB 4CLOA 4C2UA 4NDZA 1TPYA 3SBOA 3HYTA 4IBKA 2JLSA 4PANA 4I4LA 1Y63A 3WP0A 2E4AA 4NBTA 2PH1A 2C1XA 3K4HA 3UHJA 4JJ4A 4M8LA 1RHQA 1VXOA 2F59A 4UTVA 4J0KA 4N0MA 5FKJA 1JHRA 4AZ0A 5L3SA 1ZZGA 1ZUHA 5AR1A 1WDKA 5ECDA 4IW3B 1BEEA 4TKUB 1K3WA 2VJPA 3FDFA 2IEGA 1GUFA 1XZGA 2P2ZA 1YVRA 5B4UA 3MFYA 3QYPA 4GG1A 1VA5A 2QY9A 5DHUA 1NUSA 4UZEA 4PW0A 2Y0TA 3W9BA 1VDMA 4LPSA 3TBFA 4QRIA 4WGGA 1G6KA 3ZD6A 2ETXA 1G5RA 5K51A 4GUDA 2XGMA 1GRRA 4DRXA 1OR8A 1AZSC 1KMCA 5KSZA 2Z5LA 4PHHA 4D3SA 4EKYA 5J9FA 1K5HA 3QOFA 1KMNA 4IH9A 1USGA 4TMWA 5JNSA 4X71A 2KE5A 5H8WA 2X9LA 2OVFA 1MR3F 5FNZA 1QCZA 2P65A 4L3WA 4CM5A 3AHJA 1TKCA 3A98B 3BWDD 5IULC 1CQZA 3M70A 5KNCH 4V3BA 3AU8A 4CIBA 2P4EA 4UQOA 4M99A 1T2UA 4FIZA 3LOQA 4IEIA 2IYQA 1IY1A 3UFXA 2OXIA 3KTAB 4M9CA 2JHFA 3PLRA 4XWOA 4RTJA 1GQRA 4JQCA 2ZWVA 1FP6A 2OMEA 4XX0B 5J58A 3L8HA 1GARA 1DX4A 2A0WA 4Y6OA 1UKEA 3H4JA 1GLGA 5AT1A 1YS1X 4AJHA 4MEAA 3ZVMA 3U3XA 3L46A 2FSIA 2YFKA 3O38A 3FMVA 4PPYA 1QP7A 2X14A 4UU1A 2CBZA 2QZJA 2AKEA 1OFHA 2QMEA 1YE8A 2C29D 4EG8A 5KOJA 3GGCA 3OP1A 4DMFA 3TIIA 5IC5A 5ALDA 3FPAA 2X6QA 3BQMB 2OHGA 4WUVA 4ETMA 1FX0B 1M2NA 1RWMA 3DDHA 2VT2A 1JA9A 2HA6A 4YAKA 4B75A 2ZRBA 1F8FA 3NYWA 5FDFA 1GU0A 4RPGA 2YJ5A 4ARZA 4ZOEA 4AJ4A 2GJSA 4MULA 2R4EA 3WLPA 1VKHA 3AF0A 3O9ZA 3JVVA 5JASA 1WJ7A 3ZGNA 1XJQA 7AT1A 3REQB 3DMNA 1SOUA 1S1MA 3OE1A 3K8ZA 1N0HA 5KYWB 3L0ZA 4IDQA 4WIAA 5LJLA 4K05A 4Z4IA 4WJLA 3TKYA 3BRWA 1ENPA 4GR5A 1D0VA 3I39X 2PUGA 1TTPB 4I6JA 1KFJB 3H5LA 1XRNA 1ZH4A 5ITQA 2GZ2A 3DCIA 2Y99A 2IYVA 4YPFA 3NBZC 4P3XA 3DE6X 5TE9A 2KMLA 1LH0A 1H1LA 4X64M 5G0UA 5LB2A 5C80A 5BMVA 3D7LA 3VPGA 3EMDA 5C5DA 5D00A 1XDBA 4DZTA 2JGAA 3JAWB 3PR3A 2YRFA 2KEBA 3MSCA 3PQ7A 3G0GA 2DHYA 3HKCB 2XUDA 1BD3A 4DLAA 2D74A 1VQ1A 1JGTA 3NPMA 3JWPA 1XRPA 4KXMA 1F17A 3L7AA 3WLOA 3A9WA 1N7GA 3G1TA 1EFKA 4K9RA 1WZUA 3NC0C 2ZWMA 2Z08A 2DFDA 2KRUA 5ITUA 3H0EA 4FWIB 4UTOA 4DNOA 3F4BA 3ABRB 1F2UA 2F8MA 3IAUA 5PNTA 2CLFB 5JS6A 1ORIA 1E8NA 3QPCA 2J08A 3PEYA 1XZNA 1LVHA 1EWRA 4BQFA 2QPTA 4KYIB 3LUDA 4ZAXA 3QKSA 4PZAA 3IHLA 1F51E 4LXTA 4CN8A 3K9CA 2QPOA 1BH6A 4BMCA 5K3DA 1MEJA 3LX6A 2ERCA 1TM7E 5IXYA 3KUXA 1I5OA 3FWPA 2HFJA 3NKLA 3UXEA 3CMMA 4N0QA 1A2QA 3OIVA 5KOYA 3RJ9A 1SEVA 4RLSA 3TLMA 4C29A 4YT5A 2GD6A 3CRMA 1A50B 3ICOA 3KQLA 4Q6WA 2GZAA 4AY6A 1QQ5A 2XUOA 1P5RA 4JR1A 4DCCA 3E9CA 3FB4A 3ELWA 3MA0A 1WUJS 1T4CA 4GR9A 4ZVNA 1VJRA 3QTTA 1ZSYA 5L9AA 3QKIA 5B2FA 4V39A 1E9FA 4MM3B 5ALHA 5C5CA 3I9KA 3EXIA 3GN1A 1VLVA 5TEWA 1T8PA 1OIVA 2AHMA