3GRYA

Crystal structure of the complex between s-adenosyl methionine and methanocaldococcus jannaschi dim1.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
263
Chain Sequence
b'QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
molecule tags Transferase
source organism Methanocaldococcus jannaschii
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
total genus 89
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3gryA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gryA01
3A4TA 5D1HA 2IBTA 3BKXA 2NNWB 1RJFA 2Q41A 1VPTA 1EG2A 2P1DA 3FUVA 4PNEA 3MERA 4X61A 3UA4A 4HTFB 3FTEA 5GP1A 3EEYA 3PFGA 4EVIA 3I53A 3UJ9A 4HRAA 2P7HA 2ZBPA 3LL7A 1QANA 2ZVJA 5E8JA 1DCTA 2NP6A 2ZZMA 3VYWA 2ERCA 1JSZA 2E5WA 2OB2A 4ER0A 4F84A 1KYWA 3NVKI 4P7FA 4X63A 4CXMA 2JJQA 3HCDA 4BP1A 5KVAA 5EPEA 4YMGA 3FTDA 4AZSA 2BR3A 4GOND 4JXJA 1IM8A 4FT2A 4OA8A 3BKWA 4U7PB 5DM0A 1V39A 3EEOA 3I58A 2EFJA 2OBFA 3G2OA 2IFTA 4MTLA 3TM5A 5K0CA 5DTQA 4CKEA 1SUSA 3ELDA 5GOZA 1EJ0A 1R18A 4ER6A 3GXOA 4F85A 4RSRA 4B17A 1UFKA 2Y1WA 3TPZA 2P40A 5EEGA 3KQVA 5EEHA 2FHPA 3GJYA 3UBTA 3EVGA 4LG1A 1UIRA 2PX2A 3T7TA 4QTTB 1P1CA 3EPPA 1P39A 1NW3A 5FHQA 3KPWA 2ZBRA 2XYVA 3WSTA 3MCTA 2AZTA 4KDRA 5BW4A 4E31A 2XYQA 4UOEA 2O57A 4FSDA 1NV9A 5K0GA 3B7PA 3OE4A 3OCJA 4RX1A 4MHTA 4RYLA 4BLUA 2OXTA 2IBSA 3ANXA 1RI2A 3DMHA 3LDUA 1O9HA 2V7EA 3R24A 4BY9E 2WA2A 1MJFA 2AOWA 2CWWA 3UJ8A 5DPMA 5CM2Z 3HCFA 3RODA 2NYUA 2QY6A 1JQEA 2AOVA 4L7VA 4GOLD 1KP9A 2FPOA 3HCBA 2IIPA 2VDWA 3UA3A 3OU7A 2PKWA 4QDJA 1JSXA 5DTRA 2CMGA 2AOXA 2OPBA 2VZ9A 5E1DA 3UJDA 3B3FA 3I9FA 3KQTA 2KW5A 5FULA 3L8DA 3A27A 2YX1A 3FRIA 3IYLW 1PJZA 2YXLA 4C07A 2XYRA 3UJ7A 3KR9A 3IV6A 3MTIA 1ORIA 5EGSA 4DQ0A 1AQJA 2ZIEA 4GBED 3TM4A 1Q0SA 1UWVA 4KIFA 2PSSA 3KQPA 5LQRA 2Z6AA 2V74B 3P9IA 2YR0A 4RV9A 3R6TA 3GRVA 1TPYA 4IKPA 5E1OA 5ICFA 3VC1A 5G02A 4A6DA 2CL5A 2PBFA 4GQBA 4DZRA 5LR6A 2PVCA 4AZWA 3DP7A 3FZGA 3X0DA 4E2WA 3P71T 1VIDA 3T7SA 1YF3A 2JG3A 1I4WA 2WA1A 3B3GA 2G71A 4OQDA 4RTQA 3MHTA 2HMYB 3KQYA 2P8JA 2VDVE 4PYLA 1F3LA 4AZVA 10MHA 3M6WA 1IY9A 1L3CA 3EGIA 2PT9A 3G88A 3RIEA 2XBMA 3HA3A 2GAFA 3HEMA 2BM9A 4KWCA 3LX6A 2O0LA 4PONA 4X1OA 1RI3A 5EZQA 4QDKA 3SSMA 3M6XA 4DF3A 5IKMA 3SVZA 2OZVA 4M37A 4GOOD 1N2XA 1O9GA 1VE3A 4E2ZA 2XVAA 1FP2A 1M6EX 7MHTA 3CC8A 3HCEA 3LPMA 4RVDA 5EMMA 3S68A 2PV0A 3AY0A 3TOSA 3CJTA 3EGVA 3A25A 2AN4A 3KR1A 3NVMB 3M33A 5T6BA 1NE2A 1IXKA 5DM4A 3TFWA 3KQWA 4DCGA 3BUSA 1KPIA 3DXXA 3HA5A 4OQEA 1NW8A 1D2GA 1XVAA 1Z3CA 2B3TA 3M6UA 3QV2A 3DMGA 4HGZA 3R0QA 4YV0A 5DLYA 2F8LA 3SXJA 3HVJA 4EKIA 1SG9A 5CVEA 1EJ6A 1JQ3A 4P7GA 3SM3A 4IV8A 1BC5A 3GO4A 1G38A 2ZULA 3KQOA 1YUBA 3LCUA 2G1PA 1XDUA 2HNKA 3OZRA 3PS9A 3O4FA 4YV2A 2IP2A 3K6RA 4DMGA 3KQMA 1NW7A 3HVHA 2FK7A 3CJQA 4QTUB 4WVLA 2C7PA 3HTXA 4RVFA 1P1BA 2LD4A 5LQJA 2OYRA 3QOXA 4FZVA 3T0IA 3LKDA 1L3IA 4Y30A 1I1NA 1D2CA 4M36A 4BP3A 2EJTA 3AXSA 3PT9A 3KQSA 1FJXA 1KHHA 5C1IA 3EVBA 3O7WA 5FQNA 1I9GA 3CVOA 1VQ1A 4GC9A 3P9KA 3ER9A 5DX8A 5K8VA 4OBXA 1G8SA 4OA5A 2YQZA 5HIJA 2UYOA 2GB4A 2AOTB 2AVNA 3ERCA 5JUWA 2O05A 4HG2A 4C06A 2A14A 1ZKDA 2O06A 3KU1A 4V0RA 2YTZA 2BR4A 2ZIFA 3BXOA 3C3YA 2HTEA 2IDJA 4GEKA 3GNLA 3AXTA 2GA9A 1RI5A 2P3QA 2YXEA 3O31A 1L9KA 3I5UA 3REOA 1JTEA 4IV0A 5M5BA 4KIGA 4DM3A 4ER3A 3LDFA 2HR1A 4YUVA 3BWYA 2JH8A 1VP3A 1R74A 4XUEA 2I62A 4PCLA 2H00A 4PYOA 4FGZA 3VSEA 2EG5A 3TKAA 3DMFA 3EVDA 4DKJA 1NBHA 3AJDA 4PYIA 5DM2A 4ER7A 4PINA 1H1DA 4RTOA 4E32A 2G72A 3MCZA 3D2LA 3MTEA 1L1EA 1G60A 1WG8A 1G55A 3MGGA 2R3SA 1KIAA 2JHCA 3HVIA 3ID6C 3OZSA 5DSXA 2ZZKA 5DWQA 5K0LA 3GDHA 1YFJA 3BWCA 3AWIA 2AR0A 5CCXA 4YMHA 4BLWA 1YZ3A 3PFHA 4RWZA 2PWPA 2CKDA 2PJDA 3FUXA 3IHTA 5CUQA 4KRGA 3B5IA 5T67A 4DCMA 4E2XA 1QAMA 5U4XA 2UYCA 1RJEA 3EVEA 5DRYA 3P2IA 4FR0A 5FHRA 4X60A 1M6YA 2P3OA 3DXYA 2ZZNA 2ZSUA 3V97A 4QPPA 3DUWA 2AOTA 5H02A 3BGIA 1KPHA 2YUIA 5LSAA 3LKZA 1P91A 4RTPA 4FP9A 4H0NA 4M7RA 3GRRA 1EQAA 5HEKA 1XDZA 5LQKA 3GU3A 4GOMD 5E2AA 5K05A 5B1SA 2AOUA 3GRYA 2R6ZA 3HVKA 5CVDA 2I7CA 2PXXA 2AVDA 1FBNA 2UYQA 1VBFA 2AN3A 1G6Q1 4NECA 4R05A 3OFJA 3VC2A 5K0FA 2QRVA 2PGXA 1YZHA 3ER8A 2GS9A 5HIIA 3GIWA 4HGYA 5E9JA 4M38A 3C6KA 2AS0A 5DTMA 4DA4A 3THSA 1KYZA 2Z6QA 5K01A 3G5TA 1BKYA 3PB3A 4KVZA 3E23A 5GIOE 5CCBA 2PY6A 2QM3A 2ZIGA 2GH1A 3DH0A 3KPVA 3R9XB 1JG4A 4QQKA 2PX5A 3SGLA 3ELYA 1ZG3A 4AZTA 1YB2A 3JWHA 5EHIA 3EVFA 5T64A 3IEIA 1DUSA 3M6VA 4E70A 5E1BA 3GCZA 2PX8A 2FK8A 3FUUA 1XTPA 3LHDA 3EVZA 5C9ZA 2PX4A 3OPNA 4OBWA 3M4XA 5GM2A 3G8BA 5MHTA 5ICCA 3GRUA 3ELUA 1SKMA 3C6MA 5EVJA 2PLWA 2WK1A 2JH9A 3TKYA 2EX4A 1RJDA 5EKXA 2BZGA 3K0BA 4E2YA 4P7KA 4ATNA 1OR8A 2UZ4A 1NKVA 1NW5A 5DT2A 2OO3A 3FTFA 1B42A 2PXAA 3OU6A 3Q7EA 4PYKA 5F2NA 2P41A 1YFLA 2Z6UA 3C3PA 3RW9A 1BOOA 1AQIA 3FPGA 3KPUA 3PX2A 1RJGA 4PGHA 4R6XA 3CJRA 3SMQA 2GPYA 3UJCA 1VLMA 2K4MA 2P35A 3G5LA 4R8RA 5EMLA 5FA8A 5K03A 5LQNA 5DSTA 3G8AA 4HH4A 3DR5A 5LQAA 2P3LA 4PWYA 3U81A 2C7QA 5HILA 4YUXA 5CIYA 1R6AA 5KQRA 2H11A 4KDCA 4YUWA 1X1DA 2DPMA 3PVCA 2HWKA 2ZWAA 3Q87B 4WXHA 5BP7A 4HSGA 4G56A 1KPGA 5DX1A 1FPQA 2VS1A 3CCFA 4C04A 1ORHA 5EG5A 4ER5A 2BM8A 3LGAA 3EVCA 1EIZA 3JWGA 5FQOA 2IH4A 5DXJA 5EC8A 3SR4A 3TRKA 3CKKA 5FUBA 3FUTA 2B9EA 2HV9A 3E05A 2QRVB 5FTWA 1R8YA 3DOUA 3E7PA 3UZUA 5F2KA 2OY0A 4PYNA 3TLJA 5CVUA 1SVUA 3NWEA 4PYQA 5EIWA 1JTFA 5FCDA 5FADA 3TQSA 3ME5A 2AN5A 3KPJA 4Z2YA 2PXCA 3PX3A 5EIFA 1X19A 3FTCA 4HTFA 4RVHA 3A7DA 3UJBA 4QQNA 2FCAA 4U7TB 3UFBA 3B89A 3NMUF 3F4KA 4KW7A 2G8NA 3V8VA 1DL5A 3KR2A 1NV8A 4XUCA 3BZBA 4PCAA 3HP7A 5HOQA 5KQSA 5LQCA 2EJUA 3CGGA 1JQDA 1F38A 4C03A 3UWPA 5F2OA 5KYGA 4GC5A 4LWPA 2ZFUA 3DLCA 1L3BA 2NXNA 3A26A 4V0QA 5CVJA 4F86A 4GF5A 1BHJA 3PTAA 4PIMA 3FYCA 3THRA 3JWIA 1WZNA 3ELWA 1KR5A 1NT2A 5E9WA 1WS6A 3BGDA 2CMHA 3G2MA 3G2QA 5EMJA 1X1CA 1O54A 1QAQA 1SQFA 4XCXA 4MQ4A 1ZHFA 2IGTA 1NBIA 3NW9A 3SSNA 1NW6A 4O29A 1TW3A 1ZGAA 5HFJA 4K6MA 4Y2HA 3ORHA 4FT4A 1SQGA 2ZTHA 4E30A 2IH5A 3OU2A 5FWDA 1G8AA 1QAOA 3FPEA 4RTNA 4P58A 3A7EA 2N47A 1X1BA 1ZQ9A 2QYOA 4ZTBA 1QYRA 2P7IA 4AX8A 3LDGA 3FPJA 2VP3A 3P2KA 5E8RA 1D2HA 5DM1A 3BWBA 1KXZA 3HNRA 3LECA 3MAGA 2NXJA 4PGGA 4X41A 3GGDA 4A6EA 4CWAA 4PYJA 3KPYA 4P7JA 5CVVA 5EHGA 1XXLA 4RTJA 3P97A 3DXZA 4R8SA 1VL5A 2ADMA 3G7UA 5K0EA 5K0BA 5IH3A 2XVMA 3KKZA 3EVAA 2B25A 3UJAA 5E2BA 4YUZA 2ESRA 3DULA 3LBYA 3JWJA 2FYTA 1VP9A 1INLA 5EZSA 1N7JA 1XJ5A 4POOA 5K09A 3LCVB 9MHTA 5GIPE 5GM1A 3FUWA 3LCCA 8MHTA 2OB1A 4C05A 2O07A 4PYMA 3CBGA 3TMAA 4GUAA 5FA5A 1AF7A 3HCCA 4EMSA 2BR5A 1XCLA 4PIPA 3FYDA 1JG2A 2H1RA 3GRZA 3NDJA 5BW5A 1AV6A 3EGEA 4RTMA 2NP7A 3EMBA 2UYHA 4RTLA 4ISCA 2FRXA 3KQQA 5CD1A 4CKCA 3H2BA 2DULA 1XDSA 3NWBA 4FSXA 1ZGJA 1N7IA 3SX0A 4BLVA 2GLUA 1RI4A 2B2CA 3FPFA 3HA7A 4MWZA 5ERGB 5HIKA 1WXXA 5DX0A 5EQJB 4RTRA 2YVLA 3I64A 2BH2A 1JR4A 3PLAE 2ONZA 2ZWVA 5D1NA 2IH2A 5P8WA 4EK9A 3P9CA 3BWMA 2YXDA 1T43A 3OZTA 3LBFA 3R3HA 1MHTA 2Y1XA 4OX9Y 3E8SA 5HIMA 4YUYA 1M0EA 5E9QA 2I6GA 3G89A 3M70A 4EQZA 2ORED 3SSOA 5ICEA 4RTKA 3FPHA 1Q0TA 5JR3A 3MB5A 2IDKA 1WXWA 3EMDA 3FRHA 2AOUB 1R00A 1X1AA 4C4AA 1XCJA 5K0NA 4AUKA 1QZZA 3MQ2A 3KR0A 3NDIA 1FP1D 5E1MA 2QE6A 1EAMA 2IPXA 2ZBQA 3T7RA 4CTKA 5GINE 1RI1A 4E33A 1Y8CA 2VDUE 2PWYA 1U2ZA 1JG3A 2OKCA 2B78A 1HNNA 4LECA 3DTNA 1TW2A 5HZMA 2C7RA 3B3JA 4C08A 5C0OE 4XUDA 5LQUA 4QPNA 3P9NA 3C0KA 3QOWA 4IWNA 4RTSA 2NXCA 4RVGA 4YV1A 2NXEA 5K0JA 1SUIA 5EOVA 3KHKA 2ZCJA 5KS2A 2JHPA 3HM2A 3UJ6A 5EMKA 3TR6A 3NJRA 1HMYA 2JHAA 2ZLBA 2ONYA 3GWZA 3NTVA 4FS8A 3HCAA 4LWOA 5FWAA 4CTJA 2I9KA 3BGVA 1PRYA 3DLIA 4HC4A 2PT6A 5EKUA 3P8ZA 5ICGA 3BT7A 2G70A 3LSTA 3OE5A 4R6WA 4CKBA 2C7OA 5BXYA 5GWXA 1WY7A 1JG1A 4MIKA 3G2PA 3OFKA 5DRTA 5DXAA 4EKGA 1R8XA 3P2EA 4QVKA 4QVGA 2ZW9A
chains in the Genus database with same CATH superfamily
3VVBA 1RC1A 1SUAA 1XQ6A 1YFKA 2Q41A 2J3JA 1EG2A 4H1HA 2QMOA 4PAGA 3THYB 5JC8A 3FTEA 3DYBA 1VJDA 1R4MA 3TE7A 2AG5A 1HZJA 2P9GA 1YWGO 2XITA 4IICA 4M1WA 4HDNB 4QXQA 4R98A 5COAA 3JD0A 1NOKA 2ADFA 2JNWA 3FUCA 3UW1A 2E87A 1Y5LA 3Q85A 3KUUA 3A28A 4OH7A 4P7FA 2DVMA 1PBNA 3HCDA 3QBVA 2GPTA 1K0FA 1J97A 2E7ZA 3VFDA 3OA0A 3U3RA 4AZSA 4BBAA 4COKA 5JZSA 2VXOA 3SVLA 1R4NB 3O93A 1NKTA 3HYLA 2QHOB 3RBAA 1BD4A 2C2GA 1ZS9A 4PLZA 4TQAA 3DO8A 3BD9A 3B74A 1TJNA 1V41E 5IFLA 1TUBA 1Z88A 2O0HA 5EKDA 3ICEA 2CY0A 4G0WA 2B69A 2QYTA 5EZYA 3JD3A 3GWGA 2NZWA 3ABOB 3IV7A 2C54A 2QF7A 3WV4A 5ELLA 4JR2A 4PZZA 2IBSA 1E0SA 2NZXA 1LRLA 1GNQA 1ZW1A 2PX2A 4NAVA 3THWA 1T1IA 4CM5A 4B09A 3EXEA 5IBQA 1XDWA 2QX6A 4XOIA 1KGDA 2OV1A 1TU0A 1OYOA 3VX3A 4JHLA 3WSTA 2WAYA 3V2HA 2JL1A 4E31A 2VDOB 2UXBB 1QGOA 4BO9A 4KNWA 4AAYA 4BXOA 1H0KA 1Z13A 1DO8A 4RGQA 4A5SA 3BWEA 4P5EA 2BFCA 5ECDA 4UDYX 1JLRA 2ZRLA 3IMEA 5FB3A 1RI2A 2OFXA 3BPSA 4UHCA 1W25A 4HNQA 4ECEA 1JDZA 2GCOB 4PQEA 4I1OA 1X6VA 5HNKA 2CHVA 5BOSB 4PO8A 3KDSE 3HCFA 3WFJA 1Q3HA 5KYWA 2I78A 3KVWA 4GOXA 4MEJA 1FU8A 1NDUA 4UAUA 5JMPA 3NGMA 3R0ZA 2NW6A 5ETJA 3AM4A 4OVZA 1I13A 1E9BA 1JAZA 3ND6A 4JC5A 3ZBPA 2O3TA 1KIMA 3GAMA 4TTRA 5FOSA 1I7SB 2ZUBA 4MVYA 4B35A 4WXPA 5KYYB 3TOXA 1XA0A 2PCLA 4FFNA 1EUCB 2HHLA 3FFWA 4KPUB 2RCNA 4CQMB 1NNJA 4EB8A 1GGFA 3D3QA 1HYBA 3ZIUA 5JCJD 5HQJA 2O5CA 1ECJA 4HQOA 4MHOA 1NXVA 2Q6LA 3PV0A 1UWVA 3IEXA 3NAQA 5B3JA 5LBIA 5JNVA 1NAIA 4H17A 3SR3A 2EGUA 4WLEA 3GDWA 1YRQA 2C9OA 2OGZA 3MWFA 5ICMA 2YR0A 2VBIA 1JDNA 5G02A 3DS8A 3PA6A 4JOSA 2F67A 4MV7A 2D62A 2AWNA 3FZGA 2XUQA 3F9CA 4U2EA 3WK7A 2RGOA 1W47A 2WA1A 3HZZA 4J0CA 4Q6BA 5GADl 4H7JA 1ZOSA 2VKTA 1PAUA 1V3VA 3AF3A 4EUKA 5FF9A 1NUAA 1PK8A 3DUFB 1CTQA 3GUZA 2ZAIA 4AZVA 2BEWA 1NLUA 3OX1A 3LX6A 5D3KA 2O0LA 2VDKB 4O2BF 4LJRA 3AB3A 3RUIA 1NY6A 2ID4A 3O8BA 1XAIA 4ZYXA 4EGAA 4V1CI 1PK7A 2PBZA 2VDRB 1Q1ZA 3KZNA 2W2KA 3MOSA 1OD6A 3DVSX 4RDHA 3LRTA 4LXGA 3UHOA 1CV2A 1RYDA 2GRJA 4BB5A 1TO6A 2AUNA 2AN4A 1LSUA 1IK4A 4CM3A 4F21A 1EGVB 2ILTA 1EWQA 1O2DA 2VA8A 3IOMA 3MMXA 2PKRA 2X40A 4FYWA 3S4YA 3NOXA 4PIVA 1N5KA 3FY4A 5HUHA 4YV0A 5DO9A 1RACA 4CQMA 2NWQA 5JAOA 1MX5A 1T2UA 2EGHA 5BW8A 4X66B 3UB4A 3Q12A 1WEHA 1YS1X 3H2ZA 4IV8A 4OU4A 3LY7A 1NBMA 3C98A 5IBCA 3VQTA 3PS9A 5L7YA 4X24A 3WV5A 5DE3A 3ZY5A 2A5FA 1LPBB 3KOWE 3IT0A 3U6QA 5JQWA 5HP4A 3FNFA 5CH8A 4WVLA 1W9HA 3NNSA 1P17A 1C1KA 3OPQA 3UWKA 3DVAA 4C0AC 4D9JA 3R23A 4ZIRA 1NVWQ 2ACVA 1IIBA 3RHTA 3RYIB 1G20B 2HX1A 5TPWB 2E85A 3I52A 3R3XA 4D8UA 4QU5A 1IUPA 1R0RE 4N8SA 1SBIA 4QUAA 3V3TA 3BGWA 3VHXB 2VJQA 1J33A 3NBYC 4BNLA 5AW3A 3K9OA 3D6VA 5I6DA 2J6HA 5CJ2A 4CM9D 2FOIA 3P5SA 2P9CA 2I7PA 1SM4A 3IAEA 1I9GA 3A4LA 1GQOA 3RREA 5BR1A 3ER9A 3EASA 1K6XA 2CDNA 1KETA 2IPOA 4L9RA 1J2UA 5I7AA 1EFKA 1G8SA 1PX2A 1G5QA 3N05A 4GYWA 4Q6WA 4LVNA 1GXSB 1LXCA 1OYYA 1TA0A 1TYEB 2A1TR 2ZYTX 3A46A 4PQFA 2FFAA 3OVMA 1IJKA 2J9ZB 4K5QA 3WYAA 4YQYA 4Y2TA 5IZ4A 2VWQA 1O6GA 5J43A 5CHEA 2H07A 1SXGA 1K7XB 1WBJB 1L9KA 2HGZA 4Q3LA 1ODFA 3O4IA 1UBTS 4WGGA 3VU0A 4P1ZA 1WR1B 1UBCA 2VTDA 4V2IA 4KIGA 2OYSA 4H59A 3TX6A 4QJ4A 5JASA 3HUDA 1LTMA 1XAJA 3PNQA 2VXBA 4D98A 2XEDA 4C3UA 4RNAA 4TQGA 4GWGA 2QCUA 2P91A 1EK5A 3SN6A 2XZLA 1U7ZA 3HFRA 1RYNA 1WUKS 4U8HA 3RS0A 3T9FA 3QU4A 4PN3A 4LOKA 2X13A 1OLSB 1UMDB 1UQUA 3S1LA 4M8NE 4JI2B 1N34M 1GY8A 3D0QA 3NPMA 1RWNA 4GICA 4PNHA 5A9TA 4BN4A 2COEA 2HIAA 1I80A 1E1NA 5HUQA 1JHQA 1ISJA 4HQRA 1S9HA 3D8UA 1PM5A 2WAAA 3I6MA 3OLCX 3OOSA 4FD2A 1G8KA 2ZYSA 4PSUA 3BREA 3QSGA 3IAM6 4P3OA 3LBIA 2Q3MA 3D7MA 4AXXA 3QITA 5JATA 3ESXA 4BUCA 4P35A 3HSYA 1DBQA 1S4QA 3HU5A 3RIGA 3UOAB 3ZHOA 4NDZA 4AICA 4IMPA 5SZHB 2BFEA 5FV4A 1JH9A 5JYBA 5KSOA 1PG2A 2HU8A 4LJLA 1XRMA 3BGOS 3P2IA 1NI4B 3EGDB 5TMPA 1A4XA 1QB7A 3PKIA 1WMDA 2YIVX 3IP1A 1RSZA 5HBRA 4YMSA 1XRRA 2YRWA 1CS0A 1N1MA 2O8EA 3J2PB 1XDZA 2C4NA 2D1SA 3IUBA 2OD9A 3L26A 2AMYA 4GOMD 4MS3B 5E2AA 1WDLA 3LUPA 1ZEJA 3QPBA 1L7OA 3B51X 4ZU3A 1UWLA 1G6Q1 2IUFA 1TZBA 4LF5M 2ZYIA 1ZHHA 2IXEA 3JYPA 4FKBA 4HDKB 3VYVA 5J4LA 4G6ZA 1ZR2A 2AXEA 5FA6A 3T7KA 4I55F 3IESA 3H65A 3FCOA 1FYXA 1PX0A 3MHVC 4I8XA 3RHZA 2EDCA 3K1YA 1DWOA 3DQZA 3MWLA 4G0MA 1ZJ4A 3OBIA 1T0IA 1MUUA 4QGBA 3U4CA 1CQZA 4MMXB 3S1SA 3WGIA 1JG4A 4WT7A 5E7QA 3ZXIA 3OQ1A 4F2WA 2OM2A 1BVYF 1CJBA 2D0PB 2OSBA 4BVAA 4CKZA 3D3NA 3OECA 1QRRA 4ETIA 4ND8B 2PN1A 2YICA 3IO5A 5T64A 3AINA 2F90A 4ZRMA 5BSRA 4XASA 4IGKA 3JQRA 1U0RA 4QFDA 1QFYA 3N8HA 3OLXA 4J3JA 1EJBA 5BOSA 5LN1A 4OBWA 1VG5A 1ESNA 3MBKA 1OWNA 4MS1B 1OKKD 1SVMA 1I14A 4WH0A 1LLUA 4PFQA 4KN8A 1AB6A 5E3HA 2CFCA 1TTTA 3VHQA 3B38A 3CZ4A 3B9BA 4J29A 3R3WA 5IHPA 3WGMA 4YMVA 1XNJA 5KEIA 2O01F 4ZEVA 1Y1PA 3UJCA 3ZEIA 4BKQA 5BSGA 1YK0A 3NS7A 1JUDA 1PDVA 2FUCA 2B35A 2RGBA 1CP3A 3EXHC 4M8LA 5LQNA 5I4BA 1Z2PX 1M34A 4DIOA 2ZANA 3AEUB 1IVNA 3AUFA 4KSYA 4CCYB 5AW7A 1SCAA 4DC0A 2AKAB 2M2IA 2DEUA 3I30X 4TS1A 2Z8ZA 3V1KA 3LX8A 4AO7A 5CA0F 5EG5A 2FN3A 3WXBA 4CL2A 4O08A 4N65A 2G6TA 3GAAA 3DLTA 4L3OA 1DWPA 1EIZA 3JWGA 3JWPA 3QFHA 1LPPA 1ZH2A 4LVUA 1BQEA 4DMFA 5DCUA 1L8QA 4UNQA 1SELA 2X3FA 4QUHA 5FTWA 1K3WA 2WD7B 2BBWA 1GGKA 4K8OA 4RJKA 1Q95A 3GJSA 2L7HA 2VP5A 4PYNA 4AU1A 3KQNA 1JTFA 1R8JA 3ZV4A 2YY5A 1PR0A 2Z2ZA 4YVFA 4DEXA 3OUZA 4N9WA 3JZIA 5FWNA 4GNKA 3VR4D 3KPJA 1N2CE 4Z2YA 2FH5B 5E4TA 4B76A 1TJ4A 4FMBB 2O14A 4B3XA 4MVJF 2I33A 2C00A 3K92A 2FCAA 1RLTA 1MC8A 2LHCA 1Z0SA 3D9QX 1Y42X 1W4BA 2OBLA 3GVCA 3N59A 4DV5B 2PUVA 1FF9A 4MDHA 1WVGA 1JEOA 1BEEA 4B43A 1N2BA 1E6WA 1PNQA 1QMPA 2AZ4A 3AT1A 3KYDB 5I9SA 3RFWA 4KWIA 4BJ6A 5KYGA 1GTSA 1KRWA 2I7VA 3A26A 4V0QA 5D3ZA 5IN4A 3GPBA 4Y0VA 2HF9A 2P5TA 2XJ4A 2WJPA 4K9DA 4HUTA 4MKRA 2JIMA 2JFZA 1IEWA 4UMFA 3EXAA 3L4BA 1TDHA 2X4IA 3ASVA 3NHRA 5HS6A 3MMSA 2DAIA 3AL2A 4MV0A 5L53A 4KN6A 3NPAA 5B1DA 1Q83A 3ETHA 1PEDA 2DLNA 1FSSA 3TD2A 3STYA 1LV8A 5IWCA 1V0JA 2R65A 2CLSA 3S3TA 1TM1E 1SKYE 4HMOA 3HKBB 3L8EA 5DP1A 1C4KA 1G8GA 3I5MA 3ORHA 3I28A 1SQGA 3FMIA 2R1TA 4YPVA 3E5RA 1XZAA 4PG8A 2GXAA 4Z9BA 4W5QA 1ZCJA 2XTNA 4IXNA 1MZPA 3Q8MA 4LKOA 1DC3A 4LC1A 4ZT3A 1FVFA 2CDBA 4QPJC 2XCOA 4KX5A 3VKUA 3RVPA 1XF1A 2YV4A 3IKJA 3AR2A 2AFVA 4Q34A 1GPYA 1YZGA 4M3NA 2XNJA 1F3OA 3F7TA 1RRKA 3VDUA 4JMLA 1OREA 1QKKA 5K0EA 2R44A 2AWOA 1DX6A 2WKPA 2SKCA 4KBYA 3S55A 3PHHA 3AERB 5BORA 1KZHA 2QRKA 1N7JA 1ENZA 1Z0KA 3KWMA 4UPDA 5I51A 3BWVA 4AF8A 1KMHA 2I99A 2JK1A 5GM1A 5KX5A 1SU4A 3LT4A 5JHGB 2BYTA 3L6EA 3AOEC 3GZNA 2I4MA 2R8BA 4UTPA 1M5RA 5BRAA 3UFXA 2EG9A 2Z43A 3TLXA 1ADJA 3SF8A 3RYHA 3C1TA 3FOBA 1GA4A 4RK7A 4JEMA 4PSVA 2YMPA 1KFBB 1ZAKA 4OLFA 4CGYA 1E4YA 3DTYA 3V8MA 4TN5A 2RRUA 5B3AA 5TQVA 4A2PA 1FEZA 5JZVA 3GMIA 3KQQA 3MJSA 5DP2A 5CBKA 2BGGA 1L2BA 4OD0A 3PC7A 3G0IA 1HORA 3HZJA 2R1ZA 4MAFA 4RHFA 4BV3A 4AKGA 4C0SA 3ZTWA 4I99A 3GH3A 1GLVA 1NR7A 1R0XA 1E7WA 2DBZA 5BUSA 1WXXA 3PJDA 4MQBA 3U6EA 2LVNC 3IMFA 2BMVA 1EJ2A 2CLKB 4RE6A 1TO2E 3T7AA 4EB0A 5TARA 1C50A 3L43A 4KQIA 2YXDA 4JLUA 2NPOA 3WIBA 3HJGA 3TVDA 1ICIA 1LQ2A 3PQCA 2FPPA 3LO5A 3DMTC 5L6LB 5E9QA 1X3SA 3ND9A 1KEZA 3FPHA 3MW8A 5AHKA 3OZAA 4IG4A 3WFIA 4EG4A 3UANA 4E03A 4LJKA 4UASA 4RH3A 5KOIA 1DAKA 2N75A 4WFKA 1VLHA 5ENVA 3K0HA 2QE6A 4DV0B 1UT5A 4S1OA 1ARZA 4LY3A 1HZZC 4PC3A 3STHA 1I33A 4KKXB 5H3LA 2B9VA 3PWTA 4B80A 3HWX1 3ILXA 1PEAA 4QXRA 3D0OA 1A96A 1HNNA 1PHPA 2RHRA 2GZ3A 2XOKA 1R16A 2LR0A 3DMTA 3X1MA 2V3VA 1WUJS 2YV2A 3F97A 1X7GA 3RTCA 3EH1A 3H4VA 4H08A 4NNOA 1A1SA 1CHNA 1NN0A 1O6ZA 3B1VA 2ZXEA 3AV0B 3MNFA 4MYUA 5ALLA 4YI5A 3G2LA 2JK0A 1AS0A 4K3VA 4QPNA 3ZE6A 3G0CA 5EJ2A 3DL2A 3R3JA 2OMEA 1TCCA 4HDAA 4XR4A 3HO6A 4AN0A 4R01A 4F4JA 1NFFA 5GQSA 3HKPA 3A05A 3TUIC 1MLDA 4J6FA 5JCOC 3V1TC 3HU2A 3BYZA 4KVAA 5H3HA 4BCCA 1YQ9A 1CHDA 4DBLC 5DTIA 4KXLA 4XJXA 4ZA2A 3ZGLA 5KYXB 1JWLA 1H0RA 1NVDA 3LSTA 3AIMA 5I3ZA 3PEVA 5BXYA 4UBJA 1JG1A 4J1SA 4EKGA 3WL7A 1JBEA 4C7MA 1D6JA 2JGDB 4PNPA 2NAFA 4D41A 3C9PA 2PD6A 4YCMA 1EIWA 2XDYA 2QSYA 4QTXA 2IPNA 4F4DA 2J9FA 3HSKA 3OF5A 1OXSC 3U60B 3BXEA 1XIVA 3JRNA 3MINA 4KL8S 4RMIA 4REZA 2JLAA 3B48A 1TK9A 3QPCA 4M0MA 3D64A 4RY8A 2IYRA 5TY0A 3TZLA 1N7GA 5E8JA 3DBHB 3SBDA 16PKA 3GCDA 4L4SA 3RARA 2PZ8A 1N6LA 1H65A 2IBMA 5B30A 3GPUA 3ONNA 1L9XA 5EPEA 4MINA 2CZGA 2WWGA 4YMGA 5KVAA 3ZLJA 3ZKAA 3F0TA 5K3AA 1EGQA 2ZUCA 4FYPA 2XAAA 4G5QA 2EFJA 3ZGXA 5JAMA 4Z99A 2C1ZA 3FHJA 4B2YA 3KDPA 4L57A 4RABA 4HWPA 1EJ0A 1MC4A 2C92A 2FSUA 3AESA 1BWSA 3BQNB 3E03A 1SIOA 4RSRA 1K7CA 2PMDA 3IAS6 5JIBA 4X65M 4M8SA 3BCRA 4RELA 4NOOB 3NGLA 4H4CA 4M7WA 1FDIA 8ABPA 1W9MA 3PGJA 4FPXA 1UIRA 4MH0R 1IXRC 3T7TA 5L51A 3DWIA 4MMYB 1MDFA 1P39A 2FWPA 1EFRD 3S2YA 4BATA 2EF0A 2B7CA 1MTOA 3KT3A 4S3MA 3V55A 3KJHA 1Q14A 5BW4A 2ZWOA 1MENA 2IPAB 2J59A 1QF6A 4ALLA 2BTEA 4B40A 3EC1A 4JUBA 3Q3HA 1T1EA 1RRGA 3GJXC 4MMZB 4CLOB 4ZTUB 2VT7A 1TMOA 4RJIA 5B3LA 5KJCA 1CP2A 1RRFA 2CXSA 3LL4A 4MJ3A 1FUKA 3TSOA 5CDFE 1YUNA 4IQ8A 3W2GA 2V6MA 1V5GA 3MHTA 1SO8A 1NX9A 2NYUA 3I9OA 3W8NA 3C58A 1OX4B 4B4VA 5B1HA 5CB4A 5JWOA 3U4DA 3ZDZB 1AK9A 2PO5A 2YZ2A 5CNJA 4Z9FA 3TZ6A 3WE7A 4Q1AA 3HHZA 1PQ4A 2JI9A 3MWDA 1C7YA 3E2IA 3OU7A 5DTRA 1CIVA 1RHRA 1QHYA 2Y0EA 1ZA2A 5B2EA 1GYQA 4TM7A 1GG2A 3AR4A 1NTOA 1ZCFA 3HJQA 2UXDM 1YRWA 2WJ3A 3P19A 4XX0B 3II6X 2QR5A 1ZRNA 3DAGA 3TTUA 3E4DA 3FD9A 1TQHA 3IV6A 3JZFA 3PDIB 3PJFA 4IRXA 5CJPA 5HK8A 4NARA 2PSJA 4AF6A 4BX8A 2PSSA 2AD5A 1LNSA 3NM5A 4H15A 3VGPA 3H0CA 2HLHA 1W581 2C5SA 2UZ1A 2VJOA 2JI4A 2IHKA 2PQ0A 3DVLA 5KUTA 4M46A 3TW6A 5K3EA 1TEVA 4AZWA 2IYSA 5BR8B 2NAPA 3O4RA 1W48A 1K7SN 4LNHA 4TLDA 3T7SA 1OZ0A 4Q47A 4BAUA 3ZVRA 3EB9A 3SP1A 4DVGA 3PXXA 3T1TA 4PBTA 3RADC 4CM1A 4CEHB 2J9YB 3QVGA 2HJWA 5D8DA 4J03A 1WXIA 1NFQA 2DKFA 3FDZA 1E1LA 1L3CA 1J42A 3L7KA 4WIAA 4BECA 4UNRA 1K9SA 3RHSA 3AX6A 5DGCA 5F2EA 1DUVG 5JBNA 1LPSA 4YX9A 3DEKA 4PLGA 5JJBA 3FD8A 3LP5A 3SSMA 3AEKA 3VK8A 1SQ5A 3FMVA 3RSFA 4M37A 5TE9A 2Q8PA 4GOOD 4FI3C 3SZOA 4LXQA 4GEWA 1FTNA 4INJA 4R7TA 2BP7A 4E5NA 4UHDA 3BX1A 1YS4A 5JE8A 2QPAA 3S68A 4EVRA 5F9HA 5J4VA 2JLZA 2HD4A 3A25A 1DBSA 4L8WB 4EDHA 1DZ3A 2PX0A 3FPKA 4RYDA 1VE6A 5C32A 1L7AA 3TLYA 3WGGA 3CRMA 2OR3A 1XVAA 2EUCA 5KPDA 3GOQA 3N0WA 4FHCA 2QLLA 4EI7A 1JQAA 5DLYA 3PRHA 1H94A 4H6VA 4U39A 1SG9A 1O94D 3K2LA 1EJ6A 1JQ3A 2ZT7A 4UQLA 1OWLA 2RGNC 3F90A 4P7GA 4URFA 2OM6A 4YQEA 2EP8A 4LTNA 2RKOA 2JIZD 3FVTA 2YINC 1YVDA 3CF4G 3N5CA 5ADVA 2QTBA 4LF7M 4IIWA 4PLVA 3ZW8A 1T8YA 5HJEA 1LZKA 4FEYA 2IHYA 3THGA 2QRLA 2JLSA 3CJQA 5ABPA 1RAAA 1AE1A 8OHMA 4Z4FA 3L6OO 4P0PB 3ETEA 2VNJA 1P1BA 2Q21A 3RBVA 4CHGA 5KJFA 3MT8A 5FJIA 3TW8A 3AVPA 3MUNA 4OMCA 4D8VA 4FZVA 1N6OA 2VR1A 2ZCVA 1MB3A 1JB1A 2LW7A 5J4HA 1JXMA 2RHGB 3QEKA 4WJZA 4IFEA 3URKA 1IPHA 2NT4A 4WOPA 4BIMA 1J2RA 1QNLA 2X77A 1RP7A 2A4MA 3U17A 5AHOA 1FUEA 4ENTA 4L15A 2HADA 3TEMA 5DYIA 4EG7A 1O94A 4UNPA 1ADYA 1ANKA 1KZ9A 1PUXA 1RC8A 3EIFA 5DI3B 2BZSA 4GX5A 2FPUA 3QMWA 2ZE7A 4CE6A 2XCUA 3VDPA 4QL3A 1XNRB 2Z3XA 1LKZA 3ZOKA 4URZR 2ZIFA 3TUZC 2HTEA 3M83A 3BAZA 3HEBA 3ILYA 1J07A 1N33M 2BISA 3IECA 4HDSB 4DA6A 4DV1B 3U3DA 3FSJX 3NEJA 4EUSA 3A10A 4ZOLF 2P6RA 4MW5A 1UOPA 3QXSA 5LIPA 4MP8A 1H69A 1L4FA 3HRKA 3A6HA 1HV8A 3WIVA 2M6SA 2EG5A 4OXQA 3MCAA 1RWMA 4L9SA 2WY2D 1JYSA 1HT0A 1KZ4A 2ZJ2A 5EP4A 1XELA 3ZLUA 5FLEX 2XVXA 4AJ4A 2DAKA 4ANRA 2V1UA 2FZ5A 2G28A 2OXCA 3D2LA 3OCZA 4FR2A 4GPTA 5EXDA 1MJ5A 2JLQA 1W35A 2GHTA 1IUNA 3ISVA 4JL6A 1G71A 3ZQJA 1H22A 2B6NA 2VJKA 1KE2A 4AK9A 4CMEA 2FV8A 2HHHB 3WYDA 2A0XA 1E3JA 5IC5A 4M1OA 5KJ6A 4HPXB 1KY3A 3OUTA 2XMQA 4QDOA 5EHXA 5A2GA 2Y92A 3CCBA 1Q3TA 3JALB 4O4IF 1JA9A 3PFHA 4CG0A 5L45A 1N5OX 4DUYB 1RIIA 3RR2A 4I4IA 1YQDA 1UDCA 1H23A 1QAMA 5REQA 1IVYA 4EPTA 3OQNA 1E0AA 4WXEA 4CMJA 1QYIA 1TE2A 2WV7A 3FA2A 4XJSA 3E1GA 4P9NA 2MSEB 3IX7A 3PFBA 1TQDA 3PYMA 4PVDA 3VA7A 1XYYA 4FZJA 1YS7A 2C9MA 3O26A 3PDWA 1L7QA 1NUQA 3K0FA 4N5IX 4TTQA 1P6UA 3GRRA 3AWDA 5K0SA 1OTHA 4B74A 5LMUM 4JD5A 1MF7A 4AWAA 4ESOA 5HRAA 2WSFF 3J7AS 5HFNA 3GP3A 5TT0A 3A3YA 3IIJA 5AM3A 1WD5A 3DM5A 2AVDA 2KX7A 3JQ7A 1J4AA 3LGSA 4IJKA 3PEFA 2QN6A 3ASUA 3C41J 1QQBA 2JY6B 2GS9A 4LJ8A 4HGYA 1A88A 1XZBA 1QIMA 3A4NA 1NN5A 2ORIA 2C8KA 1YUMA 2ZU0C 3EGCA 3GV0A 2PSDA 2P30A 1H4SA 5CCBA 3FHTA 1QX4A 1Z35A 1R2QA 4JP1A 4MUNA 3QVJA 4QOEA 3VPBA 4TV9A 3M6MD 4JI7M 2Z56A 3BMOA 7ABPA 1Q91A 3I09A 1XAGA 1MFPA 1NBAA 2WJHA 3FETA 4J7AA 3CLRD 2VFAA 5JZ9A 1MABB 1WO8A 4DEVA 1J5EB 3EVFA 1GTJ1 2QIOA 4COOA 3I5XA 1UXGA 4PC7A 4C6TA 3LF1A 5EE3A 5DU2A 1I36A 4IDBA 3ZHSA 2HXGA 3OD5A 4L22A 3W5IA 2R48A 1E8DA 2YBDA 1VCNA 2ZB7A 3N6VA 2FRDA 2PLWA 3OZ7A 3R41A 4OHXA 4AY4A 2OCYC 5F5LA 3EQ7A 2P65A 1YS6A 5SY4A 2QMZA 2V7TA 5B3KA 1WCYA 2CFSA 4TXJA 1DVRA 3PGLA 3FTFA 1W49A 3JQ8B 5FR2A 3TZHA 3VR2A 4DGQA 2IY9A 2QJTA 9LDTA 4BN5A 3DMDA 1ZMXA 4DIBA 5DIFA 1KU0A 3TK1A 1G9SA 1AK2A 3AKYA 1VLMA 2FVXA 3IRUA 2CUKA 3Q6MA 3SHOA 5C1DA 1DRWA 1KMMA 3IE2A 5DSTA 2FDCA 2OO9A 1E2KA 3DW3X 4A0GA 3U6KA 4NPAA 2IZ0A 5HILA 2KPOA 3ADOA 4Z7NB 1NJSA 2UU9B 4DV4B 3C6YA 1A2QA 2AFIA 4CUZA 2QT1A 5DX1A 2ZTSA 1B14A 4LMAA 2JRCA 4C04A 1EVJA 2PFKA 4EHIA 3SSAA 1Z4OA 4MYSA 1A9XB 2AN1A 2X19A 3EG9A 5IW8A 1OGIA 3RS2A 2FLKA 3GFVA 4RENA 3ZWQA 4HAZA 2QRVB 3EGXA 3R75A 4IWYA 3UG7A 3E7PA 5IVHA 2DR2A 1LNZA 3GP1A 3KKKA 3OIVA 5DN9A 5CVUA 2Y1EA 4RA6A 4NEGA 1BOFA 4A03A 5K51A 2ETVA 5AM4A 1H9BA 3L0ZA 1Z83A 4WKBA 5DHFA 2F4NA 1KEUA 4AZ0A 4FM9A 4RVHA 1LWOA 1LVUA 1R4MB 1Z3IX 2EJVA 3IBTA 4R1OA 4U7TB 5DK4A 5T5QA 1F4VA 3W5DA 3EEQA 3F8WA 1VMKA 1K6EA 1I3NA 3EAGA 3KR2A 4RK6A 2HHJA 3TNDA 1K8YB 2C5RA 1EB9A 1XZIA 1MW9X 3ANLA 4BMPB 4BWGA 4N7MA 1W7AA 1RRVA 1DJLA 5HWSA 1YXMA 4LYDA 3RFFA 3TRIA 3LC1O 3ZGOA 2WUGA 4KMRA 2YS7A 1JGTA 5JROA 5JWRA 4RKUF 1KAOA 4LXHA 4PIMA 2PD4A 3FZYA 2B4KA 4L5JA 3U2QA 1PWHA 3ELWA 4KLCA 1WDMA 1VG0B 2A5JA 3CSUA 4OJYA 1CUAA 3SZLA 1EVIA 4KO2S 3SYTA 1WS6A 1J49A 5CFZA 1XZDA 1HH4A 3C6ZA 4ZO9A 3UQYS 1NRXA 3CWCA 1H6UA 4WINA 2DFLA 4O2AA 2P0YA 1ORDA 4XCXA 2LDBA 1G7SA 4MVJP 4TKZA 5AXCA 2QUBA 4CIXA 1NBIA 1ZHOA 1TLLA 3SKVA 3ZHUA 2BRUA 2GM5A 2ZSDA 4NBSA 5HBGA 4QFBA 5U9CA 4GXTA 4JXXA 4QREA 3LFHA 3E8XA 3FYUB 4N5DA 4MQMA 1DOZA 2BIFA 4JI3M 5E6UB 2JCYA 4Z0PA 3QI2A 3O21A 1U3FA 5JTTA 1VE7A 1T4DA 4N0DA 1X1BA 3SX4A 1E94E 5IUNC 4YCNA 1P7ZA 4L07A 1E3WA 1F2TB 2FX3A 3W6UA 3LDGA 4MKIA 3X43A 1WV1A 3BWBA 3WMFA 3HNRA 4X41A 3E6AA 3NBFA 4WL0A 2J3LA 5KHOC 3DEHA 4MLPA 5A03A 2VTEA 3HJFA 1U2DA 1XMXA 1MVLA 1FDWA 2PUEA 4IOMA 7CATA 2O6LA 3CUWA 3EFOB 1AOXA 4Z3KA 5BUZA 3FWZA 3I2HA 3Q7RA 1MR3F 1YD7A 3LBYA 1LTHR 3FZEA 1S2LA 4INOA 2FR8A 1YZKA 1X0VA 1IOZA 4N40A 3GHYA 5EIBD 5K09A 2F9FA 3PUVA 3A6JA 5DNWA 2B0JA 2W22A 2GX6A 3X1JA 2BRUC 4C05A 1TVCA 3E7DA 4UNIA 1A5ZA 1HNXM 1EEHA 3CTPA 4DLBA 4EJFA 4NPHA 4Q7QA 3KFLA 4B6JA 3CM0A 4KBGA 4ZCQA 2H1RA 3GRZA 3CW9A 4QRHA 2IYQA 2GK4A 1DNPA 4S2EA 4LDQA 1JLLB 1MO4A 4YAIA 2UYHA 2O8CB 1HYHA 4F4FA 3I45A 1E3SA 3NWBA 2XWQA 4EMTA 1VG9B 4DSUA 3DQQA 4FYYA 1UJ5A 3AG6A 1FL9A 4RKYA 4ZOQI 2ZRCA 1N5MA 1EGMB 1POWA 1EFAA 3F71A 3IVXA 1HMPA 2V54A 2HREA 4YAGA 1Z6YA 5DLPA 4E21A 5LPNA 5KPTA 2WFMA 1OFGA 1RQPA 4QODA 3HJNA 1RZRA 3G9TA 1CUDA 1EHIA 4GWLA 1K86A 2VT2A 3AY3A 1GAJA 2XGSA 1XSEA 4AT1A 1SBQA 1E63A 4DADA 1BN7A 5EMNA 5DHRA 5HIMA 1E1RA 1NBOA 2BMWA 1OIWA 4OK5A 2M1ZA 4PANA 1ZBDA 4NBRA 2VH5R 5DYWA 1TAUA 4UAJA 5ADHA 4IEFB 3JCZA 1H9AA 1N5RA 3G8DA 4DV0M 4FYJA 5LOVF 2XPCA 5EWJA 4EFNA 2I54A 4KTVE 1Y8ZA 2OXEA 1DOHA 5A3RA 4N9QA 3F46A 1IFYA 1TTPB 1H3NA 4YCJA 1QF7A 3FFBA 3VNQA 3WKAA 1T1SA 2AX3A 1HX7A 3ZG6A 3ICOA 2CJYA 2Q4RA 3IHKA 1RI1A 3PUJA 4B33A 1GAEO 3R09A 1Y8CA 3V6LA 5E3JA 2PWYA 2QNBA 3H2YA 2CXNA 3HY4A 3Q3CA 4XYLA 5HTOA 1SRRA 3FYSA 3OEEA 1TKRA 4F91B 1K66A 1TW2A 3U0VA 3F78A 4M9QA 1GUDA 2OGSA 2VL7A 2REQA 2PA3A 3D3EA 4MB2A 4YBZA 4D3FA 4BJ1A 4DV1M 4P93A 4Y2RA 5LA6A 5L4LA 1YT5A 4E5VA 5LQUA 4LRSA 2I65A 3CNEA 3OP1A 2BDEA 1K92A 4RFLA 4TL6A 5JCXA 2E18A 4JI8B 2NXCA 2H17A 4OMDA 4GQIA 2GXQA 4EOGA 5K0JA 4BDSA 5IJ9A 5JYEA 2YWJA 4LRQA 2ZJ5A 3O1HB 3NASA 4LUCA 5F23A 5BW6B 1LF5A 4FS8A 4CTJA 2CZQA 1W73A 2EYUA 2KWIA 3FGNA 3RV3A 4ZI7F 5I7EA 2I9KA 2F3UA 1NVVQ 2NN3C 4G67A 2PSHA 4XQCA 4UEQA 4HC4A 1E4EA 2X41A 1M2NA 4K9RA 4BNZA 2NSLA 4HHEA 3MK6A 1GZHB 3QTLA 4R6WA 2GCEA 1KDOA 3LVRE 4JLBA 5TS2A 1WY7A 5CA0B 1SCBA 4E15A 1PUIA 2WPDD 1EA5A 2OCBA 2Y93A 1CWUA 4I5DA 4ES6A 3TDKA 4ZHSA 3J81k 2NNWB 4TV9F 4W1SA 5DV9A 3ZWXA 3WHKA 4R5HA 5FPSA 3RYCB 1M74A 2EKZA 1MHPA 2CLEB 1CB0A 4MQFB 1A77A 4ZQFA 2RARA 4ZEXA 4ABYA 3H5TA 2J1LA 4I5EA 2Z5LA 2IKSA 4D8TA 3GGGA 4UTOA 2ZVQX 1UZNA 2W6ZA 2W2XA 4OQXA 2WTMA 1WCIB 2O7SA 4JP8A 4Q3AA 2V4UA 3BH6A 2LVOC 3AILA 1Q02A 1TJ5A 3BIWA 1N0UA 4B32A 4EM6A 2HRDA 5B12A 4B3SB 4CVNA 2AFIE 4JBGA 1UBSB 2A3NA 4LHEA 1N5DA 4A7PA 4GOND 4DCVA 2DPXA 1Q7RA 5JPIA 3BKWA 4OCZA 5K6TA 4KHPM 1VYVA 1Y63A 5I7VA 2FJPA 4KLZA 4B6RA 1HYQA 3D31A 4F11A 3F6CA 1ESZA 1SUSA 4HVAA 5DT9A 5FIUA 2QZ4A 1Y48E 1TF2A 2I67A 4ER6A 4WK4B 1JDPA 1UFKA 3FDXA 2Y1WA 3SYNA 4YACA 2WPDA 821PA 4JUFA 2GBLA 4IYJA 2FHPA 3GJYA 3KZMA 1LLQA 3VYRB 1IOVA 4LG1A 5SICE 1ZX1A 1E3WB 2PAAA 2ZJ7A 3WJ1A 3H2IA 4JCOA 5ALQA 5CFRA 3SNHA 2FPIA 2Q5IA 2RI1A 2ZWIA 3A1TA 3U49A 1RM4A 4G5OA 2G08A 3X44A 1X2EA 2V8OA 4CG1A 3NT4A 5AKJA 3SBOA 1BE6A 2NSYA 2DWNA 3WL3A 5E4FA 5JG7A 3U7RA 1XZGA 5FO1A 1XOIA 5A5FA 1EEXB 3NOOA 4IDPA 3OHMA 3N86A 1EX7A 3MJFA 3R24A 1KKUA 2P9BA 3R6DA 5EJ6A 3C3DA 1RZ3A 1LU9A 2DFTA 3AUTA 4I4TF 2GAOA 2X8JB 4LYJA 1UK9A 4L3VA 2DSNA 2KZSA 4HWKA 4RKWA 5EJIA 2AOVA 1KP9A 1PGJA 1X7YB 2NU6B 4HGPA 1ZN8A 3M7IA 5C5IA 4RV4A 2OXFA 2UUBB 3PNMA 2EIHA 1URPA 1W59A 2QJRA 3FNGA 4X90A 2VCHA 3UJDA 1YZTA 3L8DA 4BTLA 4DV6B 1JKFA 3CLSC 4OYHA 3R0JA 2JFVA 2I4NA 3IDFA 3HR7A 5BMVA 1EFVB 4QARA 2BLNA 4J75A 4N18A 4C3VA 5LP6A 3ETGA 4FOLA 2R0IA 2D0DA 3WLKX 1AQJA 2H1WA 1L8OA 4AI6A 1R8QA 4C0KA 2H4ZA 3ONVA 2XY4A 4DJTA 5AW8A 1LQUA 3NHMA 5LQRA 3S27A 3AERA 2PR2A 2QI9C 3PGXA 5FPQA 1TIKA 5C8VA 3OCUA 2MWMA 1SC6A 1X70A 3AEYA 5JEEA 3OIGA 1S2GA 5I7WA 1VDDA 1TADA 3DP7A 1RE0A 5CP8A 4G4OA 1QGUA 4KR0A 1C0EA 3AU8A 1ECPA 4KO8A 2G71A 2QN9A 4HXFB 4RHYA 1C8KA 4PSKA 4HNUA 1K27A 3T35A 2DETA 4EJ2A 4JI5B 2UUCM 3OURA 2OAP1 1IXZA 10MHA 3M6WA 1NYRA 2RFLA 5AHWA 5IG2A 3HA3A 3G13A 4YAEA 3G59A 5DNYB 2J3EA 5ALRA 3GLTA 3ZDYB 2O19A 4NR0A 3SVZA 3SBXA 1BG6A 3AESB 4E2ZA 4M0PA 4K9QA 5E4YA 5C5CA 2GN2A 1E2UA 4GXRA 4GSLA 1B16A 5ISMA 3RT9A 1RHMA 1HNZB 1ZQ1A 2PL3A 5K2MA 3C8ZA 3K0SA 2HSJA 4YT4A 3C4VA 7YASA 3OG9A 4MJXA 4OHOA 5DM4A 3KQWA 4LJ5A 2JZOA 3VPXA 3DXXA 4EA8A 2WSSA 4MGIE 2G67A 5THKA 1YQWA 3HJSA 1DXQA 1YL5A 4DUZM 1YBFA 2AHRA 5E26A 3KFXA 4ZOCA 5SV2A 3EDCA 1R5BA 4DV7B 3PX7A 4Z49A 2I4LA 4NE2A 3KLOA 5CH3A 4QKQA 5J23A 1BC5A 3BRCA 1J06A 3B7GA 3DGEC 3ESYA 3O2SB 4YI3A 3X2SA 1D6NA 2QQFA 4CQJA 1YUBA 4HLQA 8ADHA 2JHGA 4K9MA 4TWIA 5IK2A 2B4TO 2CF5A 3LBAA 4O8CA 1LFDB 4PHGA 1SRQA 4TLLB 4WY2A 4JUIA 2HKIA 2R66A 3S2UA 1CVIA 3PGA1 2LD4A 3NR2A 3JVVA 4Z4IA 4TKVA 3TIIA 3V34A 4MWCA 5H9WA 3PD0A 4QU0A 3CG4A 5KYXA 1E9AA 3U26A 1N32B 1QVVA 4YRNA 5EIOA 4KWHA 4A92A 1QIJA 1KMQA 1V11B 1YR7A 2M60A 3KTOA 1KI2A 1QDUA 1DTSA 1C7FA 2HA7A 2J8ZA 2WMNB 3LPAA 4POAA 2UUCB 5I4CA 3Q9NA 5FP0A 1IVSA 4Q3KA 4I3HA 1RQ2A 1KJYA 2WJVA 5JFGA 1CUCA 2QE7A 2HHHM 3H5LA 3EGWA 1WW8A 5AJUA 4PE5B 4CFSA 4EA7A 3JSAA 1GT91 1OAIA 2FEMA 3EZFA 2AA3A 1DTWB 3C3YA 1KZYC 1T6ZA 1WRBA 2ATEA 4EP1A 3Q7SA 3V6MA 2R6DA 3KKNA 4G23A 4XYEA 2FXVA 3BSYA 2R11A 1SVOA 3HCPA 3IALA 4YRZA 5IJ0A 3M4YA 1XZNA 4WZBB 4MQLA 1PGPA 2G7ZA 3LWNA 3QEMB 5A6SB 3FYUA 2ZI3A 4EJ6A 2ZQZA 2CJWA 2YVKA 3HY6A 2EX1A 3DVAB 2OZEA 1G16A 2ABWA 2R1TB 2VK2A 3K30A 2OV6A 4ZYWA 1VRVA 3DYIA 2DTEA 1VPWA 1TNDA 2XCLA 2Z5FA 1MORA 3DP9A 3V2IA 5SZJA 4LAFA 4AJ1A 4HLCA 4LJSA 1Z4IA 1TQ8A 1XALA 1NIPA 2HDHA 1M10A 3OHPA 2EBHX 1XZEA 4QJ5A 3UGKA 5BVHB 3MUFA 3F3YA 3I4FA 5IZCC 1Z5OA 4HYQA 1GLNA 1VFPA 4ZCTA 2XODA 3NQ41 4EI8A 1CPYA 1T5IA 2ZJ3A 3GFSA 2QM0A 2UXCM 2NVBA 4INZA 3GRAA 2QSUA 2VJCA 4DRXB 3I62A 1NJ6A 3CVYA 3AF0A 3F5QA 3GW8A 4ND3A 4F2GA 2GSWA 1PL8A 5TF0A 1KXJA 5NLLA 2B5VA 5KTNA 1T8RA 4V0ME 4RGVA 5FHRA 3D7LA 1EVQA 2BUAA 4MEBA 4DF3A 2QY9A 3CLSD 4HNAA 4XWYA 1WZUA 2ZSUA 3QFFA 1OUMA 3CEAA 1LB1B 4IHJB 1JALA 1ZM9A 4MDYA 1KPHA 4DA8A 4EHBA 1YE8A 1XJ0A 3GEDA 2CDRA 5CFPA 1RQLA 1XEXA 4FP9A 4H0NA 4UM9D 4BMNA 3QNWA 1UJ6A 1W0CA 2AQ8A 3PHCA 1EMDA 4RIFA 2XX3A 5CVDA 1LPMA 1JU4A 1U8FO 3ENVA 3PCTA 5M29A 1QP0A 3RJ9A 4ZCLA 1VBFA 4GI7A 3EVNA 4OH1A 2XUPA 4NECA 1VLZA 3WKDA 4N1AA 1N32M 2J0SA 4X1YB 5EWMA 2RK6A 3EXIB 1B15A 4O59O 1QUTA 2QAGB 4YRQA 2MTBA 2HRBA 2TMYA 2Z6QA 5AI8A 2Y8EA 1BKYA 1NVMB 3E23A 3GD7A 3L0IB 3I05A 5DI9A 3GYGA 3WNDA 2XEPA 1O9BA 2IPLA 2NQ8C 4HEHA 1XVUA 4HWRA 5K8LA 1I3KA 1OB2A 5IN5A 1DIOB 4XVQA 2DHRA 3AEUA 1OAAA 1SIBE 1Z4KA 3CLKA 2V7BA 4RIIA 3FTPA 5TV2A 3PRYA 2I1VB 2R8ZA 5JNUA 4M53A 3IGFA 2REBA 2JIRA 1H2XA 4HNRA 4WOKA 3EDYA 4A2WA 3MMZA 1ZCBA 4E70A 3KHUA 4A6XA 2AW5A 4CN8A 1TEZA 1BDIA 3O9ZA 4IV5A 3USCS 4FWTA 4F56A 1KIFA 4ASUA 1ZIPA 4TS9A 1G7RA 2F7SA 1S2OA 4M9ZA 1L5ZA 1M2VA 2PT5A 2WK1A 4TRNA 4Y6RA 2WRZA 5IUKC 2NU9B 4EI2A 1QCDA 3DL0A 4GL2A 3REQA 3IKVA 3D4IA 4LRWA 4XD7D 2X49A 1NKVA 4UMVA 5FOXA 3X1ZA 4DR4B 3I0ZA 1XTUA 1JFLA 4QU8A 4U3JA 2P41A 2IC5A 1UKCA 4GAEA 5LA6F 3FX2A 3PGKA 4OSEA 1JSCA 4R6XA 4EZIA 2JFQA 1EVLA 2W93A 1BDMA 2AQIA 2WEKA 3J81S 3ACCA 5JECA 4DRYA 4FWHA 2IYAA 4KIWA 1EM8B 3RRYA 3KT0A 5CURA 5KCZA 2Q2WA 5GAJA 5F64A 1XWIA 2I2AA 3QLUA 3V7FA 1A9PA 2VNKA 4HRVA 2JCXA 1U7OA 1X1DA 3DUFA 3G7SA 2EFYA 4KDCA 3W5UA 1Y3DE 4C2BA 1CNFA 3HZHA 2CYBA 3WK5A 1FPQA 1NVMA 4QOZC 4MV3A 1IBLB 1ENOA 4X8MA 4G1BA 3WNZA 2VWHA 3KB1A 3P2YA 4K9LA 1BMTA 4YRJA 1N2CB 3OT1A 4KO3S 1JA0A 4DLRA 4EY7A 4ZHQA 3QFTA 3P9RA 1GV1A 2K6GA 1OIVA 2F55A 4GDFA 2JIBA 2HV9A 1VJ0A 2WPNA 2X0RA 3T38A 4HDKA 3IP7A 4UDXX 4BQOA 2I80A 3K1AA 1AHHA 2KYRA 4IIUA 2J45A 2JWSA 2M32A 1V7QA 2Q1WA 2QDKA 2E1RA 4FYVA 1Q6YA 4XD7A 3ZHCA 4PN7A 1BCRA 3LZ6A 2K7FA 4CEHA 2OEPA 3DFMA 3PFFA 5IWAB 1R4ZA 1Y9EA 3U3JA 5EQFA 1IM5A 5EIFA 4YJ2F 3D5TA 2PJRA 2BFFA 2WFZA 3A7DA 4M9XA 4QGGA 4Q4JB 3B89A 4XFJA 3ESAA 2JLWA 4Q00A 4AMUA 1G6HA 1QH1B 3AONB 4ED9A 1II8B 2C5AA 2P2GA 4Q05A 5GMOA 1NXPA 1WPQA 2J4CA 2Y66A 4KEAA 3TQTA 4UOZA 5AUPB 5LQCA 3HCOA 3M6LA 1EBFA 4G97A 2LXEA 4JI4M 4LWPA 3IQIX 5LYJF 2HDWA 1G41A 3PTAA 1LBEA 3VZCA 3W3AH 3CPSA 1EFHA 1FSGA 1N2JA 1VI5A 1ADBA 3SYRA 4RPGA 4XGNA 3O8LA 5I5EA 4OQNA 3Q3IA 4MUBA 4TTIA 4F92B 1V45E 1MT3A 2A86A 1G2PA 2GEJA 3I1JA 4WKCA 5I9TA 2NIPA 3UUGA 2WOJA 2FZ4A 3UH0A 2DZOB 1NJ8A 2JRLA 4YXWA 1U2QA 2NU9A 2O8NA 2ZBEA 4GE3A 1X7HA 4QSHA 3PSHA 3MTQA 1OH7A 2WSYB 2W8BA 4QOGA 4CF4A 5CG1A 3OTGA 2KNVA 3I6QA 3N2NA 2ZTHA 3AB7A 1EVKA 1U5BB 3CONA 1ZV1A 2XNCA 2YC2C 3CU5A 5CIWA 5ALMA 1YMVA 4BC0A 2C7GA 4EHNA 4KNVA 4BLCA 4ZU1X 2B21A 4AQ7A 3U6LA 1PV1A 2GPSA 3NT5A 3VH3A 4U2FA 1RFLA 1HDOA 2POCA 2WJAA 3K9GA 6REQA 2VP3A 3D3KA 3JAKA 3P2KA 1D2HA 1KJNA 2DH6A 4L0CA 1X39A 1JR3E 3WZLA 3HG7A 4GRIA 3L8MA 1RHJA 3SYMA 4M87A 4KOEC 3X1DA 2V7VA 4CDMA 3Q8LA 3IXMA 2O2YA 4ZHQF 4HP8A 1YRHA 2F3TA 2I6SA 1W0KD 5E2BA 4KQ2A 4REQA 4C4XA 1FIUA 5EZSA 3ZKWA 1XJ5A 2GT1A 4POOA 3STVA 4XFDA 1KAQA 1YJQA 1SK9A 3VTFA 3KLNA 3J80A 4C7VA 2RONA 1WU7A 1BA3A 3A1VA 2P90A 4C0JA 4P34A 3GT7A 4TGLA 1HRDA 3WNVA 4TZKA 3O6VA 2OV3A 1JKJA 1SH7A 2HMSA 4DV3M 2Q0HA 4PIPA 1JG2A 1HF3A 2A9JA 3ICWA 4KG7A 5KOHB 4OYYA 1X80A 1P5HA 3K2BA 2E49A 3AUUA 4U7GA 3LOPA 1IMOA 1NW4A 3S2FA 4C7OB 1I6MA 2IUEA 5LQMA 1CUBA 1ZGJA 1OQYA 2DGDA 1U1FA 2OWDA 1H0HA 1K0UA 3TL3A 1XNQM 5ECYA 4HN9A 5EQJB 3TRHA 3IDSA 3I64A 3TUJC 2BH2A 5K20A 2ZS7A 4CPDA 2ZWVA 1U9CA 3A9CA 4KH1A 5LLTA 3ZDCA 1JPVA 4LZNA 1ZN7A 4Q16A 2XMBA 3FVWA 3OZVA 4AJOA 3NWLA 2QD4A 4L4UA 1ZRHA 3DOOA 2Y1XA 3LBFA 3WQSB 2HMAA 1HLDA 4BNXA 1TH4A 4OX9Y 1YJ8A 2C9YA 1GADO 2BP7B 1Z9BA 3L01A 4K0RA 2YJZA 4BFVA 1AUOA 1QWSA 3VYSB 1G21B 1Z5NA 2D6FA 2I3AA 1E79A 1RWQA 2QTHA 3OJFA 2JFWA 2IDKA 2FE1A 3EMDA 4JI4B 1WLSA 2ZE5A 1T3SA 1RCTE 1IXSB 5EZ6B 2YOFA 4Q9NA 3EA4A 4R40A 2J46A 3ZW7A 1EE2A 3NFYA 3E4CA 3D6TB 5FKJA 3D6JA 3MT7A 3R5TA 3ECCA 3I2KA 3T1VA 5H70A 3OTIA 1CUFA 5KNBH 4PC1A 1JXQA 1SXJD 1OFVA 3DL7A 1Q0PA 2ZYVX 1PJ4A 1A9YA 2QTNA 1UH5A 3EZYA 4DSOA 1Y7LA 3A98B 1E2FA 4IH1A 3HN7A 3Q0IA 2H7VA 1CE8B 3GJRA 1E98A 5EIHA 4DNOA 3MZ0A 3VX4A 1Q92A 5CCEA 3OZCA 1N36B 4P5DA 5CIYA 4YCBA 4YFVA 3OFSA 4KE9A 4QYXA 5BSKA 2IW3A 4HF7A 4YV1A 4DLTA 1SUIA 1E77A 5HYVA 2OHJA 4EEXA 3HFGA 2ZBUA 3GGPA 3LYAA 3P9YA 3GWZA 3JQBC 4GFDA 4BGVA 3DDCA 4EFMA 2XCIA 4I4NA 4G2TA 3REFA 1H8ED 1TCAA 3OEHA 4PSAA 2I4OA 4XSGA 4MTCA 4L85A 4ZAXA 2OBMA 3ROZA 2YMMA 4AN1A 4EHHA 4ZI2A 5HW0A 1AVTA 4UATA 1XZMA 1YRAA 4R2MA 5JD3A 5J58A 1UR5A 2BFNA 2YCBA 2WSMA 4O2BB 8ATCA 5KTSA 4B3RM 3BL5A 2C78A 2D5CA 2OAEA 2WICA 4UVDA 1KDPA 4D9GA 2CMKA 1W6UA 2OBNA 2VBGA 1GTMA 2GDJA 3NC0C 4AFNA 9LDBA 3JAWA 2JEZA 3LLCA 2RB4A 5ITXE 4X61A 5GP1A 5TQ0A 3UA4A 4F46A 5F52A 3EHEA 3MJDA 3FPBA 4LE0A 1DUIA 3LVFO 2VQ6A 2EKFA 4CLOA 5DB4A 3GDFA 1CVRA 4M9UA 4M89A 2ZZMA 2Z04A 4ER0A 3NVKI 3TIXB 1GRQA 2JZNA 2WZQA 3AH8A 4I9UA 4EF6A 5AI6A 4ZQBA 3IKLA 2FPLA 1WM1A 4PY2A 4QTZA 5IAEA 5I9MA 3S28A 3UTCA 1DQRA 5DTQA 4F3CA 3SNKA 3WLSA 1BHSA 3ELDA 2P9FA 4I9NA 1CKEA 1YBAA 1ZMRA 3HXPA 1KEEA 3R9IA 3CLUD 3ZNNA 3GFPA 5TQ2B 3IEPA 3KQVA 4K6GA 4ZQHA 5DW3A 4IXDA 5AMXA 2XUGA 3AHJA 1QHXA 2B1GA 3A9SA 3RVDA 1EAYA 1V7CA 4HB4A 3RFTA 4IJUA 4GHAA 1BVHA 3VHRA 1I4EB 4KK4A 2C3MA 1X9IA 1LH0A 2JDIA 1UZUA 1HNWB 1KKLA 2XYVA 4XOUA 1GGJA 2O57A 2A1UA 3T7CA 4B85A 4F93B 1JQBA 4ARZA 5KINB 1V43A 4EW2A 4JOCA 1RAFA 3THYA 1UEXC 1ZH8A 4BJ3A 2C2KA 2WA2A 1XQVA 3M3DA 1OV4A 3L0BA 2HCFA 2J9GA 2W2TA 2IE0A 1ORTA 1SCJA 4AYWA 4V1CB 5L8VA 3RROA 5JAIA 4C5BA 4S1VA 2C9CA 2IIPA 3GF4A 1QNFA 2GEKA 3RSGA 4WECA 5EJAA 3OPXA 3HRHA 4B3IA 3HJ8A 2AFHE 1U1DA 3K31A 1BXGA 3LPNA 3QA9A 4C2UA 1PIWA 3ZTYA 2W6CX 4G36A 1ZIDA 1P5RA 1B0UA 2XYRA 3ILSA 3UJ7A 4YMLA 2WVGA 3U0BA 1M6VA 1X7XB 2GZRA 1F8UA 3MTIA 1ORIA 3N2LA 5BVGB 1TEXA 2EGGA 4OHPA 4E4YA 5JBQA 2HO4A 1ML3A 2HSDA 4NC6A 1EM6A 2C94A 3EG5A 1YZFA 1JIXA 4KQEA 2G09A 3EH2A 4QC2A 2GF0A 5AIBA 2VPYA 4DR5B 3HCRA 1WEKA 4G0OA 5CIQA 3DFFA 2JANA 2FTKE 3O8CA 3CH7A 4TROA 4UMDA 4LF4B 1Y6ZA 4GYYA 1NBMD 4HWTA 3U7HB 3H2KA 3AIOA 2X9LA 3WWEA 5K5EA 4AJIA 4ARBA 2GAFA 2JFUA 4V03A 3RHFA 3KXIA 1PF7E 1TGVA 1LW7A 2C4HA 4PRZA 2GK6A 3TRDA 3KAKA 3EHDA 3DBLB 5ITZA 4MPJA 4UPVA 1ZY2A 2R46A 2D8MA 2WSEF 3E9RA 3EPRA 4WKGA 2B92A 5IT0A 3I6BA 4BGIA 1R6DA 3GELA 2FUEA 3B36A 1JBQA 2QG4A 3GY0A 4NRWA 3N2GA 3W6ZA 4OKSA 4EG1A 4YJ2A 3VOAA 4IJ5A 2B3TA 4MDEA 5KX5F 4PXAA 1NF9A 1RYEA 1M1YB 1P2TA 2WW8A 4EYKA 5JANA 2O1WA 2AYZA 1OWPA 2XV1A 2XKBA 5CVEA 1IDN1 3B9PA 2QR2A 1PEYA 2GCIA 4NZMA 5KKAA 4B3MB 4BS9A 3FGOA 4HLDA 2ZULA 2XNKA 3R5FA 4K88A 4B08A 4GMHA 1E3IA 3T9EA 4ABTA 3ZD6A 5F3DA 2FPMA 5EI5A 3AF1A 4DGSA 4QTUB 3M1LA 1TM7E 2P5UA 4IFBA 3IUYA 1G6OA 3DV0B 3MFQA 1U3UA 4ZV7A 1A9RA 2G88A 2GVNA 4AJNA 4WACA 2Y1KA 1PGNA 3AF2A 4BUZA 1D2CA 1Q44A 3UG6A 1PW7A 3W9YA 5LMNB 3QF4A 3GLIA 2Q4TA 5DHQA 1Y8QA 2I2FA 2FX2A 1U0FA 2GN6A 3BIOA 3OM0A 2CZCA 3MRSA 2RGUA 4DLUA 5KU7A 2ZREA 1VQ1A 3CZ5A 3X1XA 5JRZA 3CPHA 1GPAA 3G17A 4C87A 2GFIA 2WU0A 5DTEA 4UKDA 4Q9JA 3HV0A 1X7WB 5HIJA 3COSA 2O0MA 2AOTB 4EX6A 3K6SB 3GQBB 2AZXA 1SOUA 4HG2A 1IRXA 1SQ6A 4MKHA 1QK5A 4Q66C 3G0BA 4FN5A 2FZKA 2ODBA 5B6IA 2OHXA 2CUNA 1MB0A 2P6MA 3I1IA 1ZEMA 4JB3A 1B6SA 4KFSA 2VHUA 1SAYA 2WFAA 4GMFA 4A3SA 4BQFA 1TRHA 1GNVA 3KBBA 4TZTA 5JVDF 3QAUA 4D0RA 2RGWA 3PR1A 3CZ9A 4RUKA 4NBVA 4X6UA 2FSPA 3C7DB 4FGZA 3W67A 4OU5A 5FUWA 3HKEA 4MLCA 1LV7A 2R96A 4JWTA 4G0VA 2VYVA 4PSCA 2J3KA 4F5DA 3SDSA 3AJDA 3LH5A 3CCCA 4XZ3A 5EUBA 3TLBA 5BRJA 1IBMB 3ZPXA 4RVOA 1HC7A 2FSFA 3BMCA 4ACBA 1U0BB 5A0VA 3TOVA 2CUTA 3NB0A 2DY1A 4BRZA 4ZJUA 2B8JA 3OZSA 4MUGA 4RL4A 3RVQA 5AW1A 3NIBA 1AN9A 2D7EA 3I4LA 4JLSA 2EKQA 2AR0A 2DPHA 1QDLB 2MOKA 3K35A 4JNKA 4TLEA 4YMHA 5KHAA 1UJ4A 2HFKA 1SU8A 2DJIA 4IBDA 2AI1A 2PJDA 2WU3A 3EZ6A 3L07A 3SLGA 4JQZA 1PQPA 4DCMA 2RK3A 4DIUA 1HYEA 2GLTA 2VPPA 3IPLA 1T6YA 1RYFA 2HXSA 3BEDA 3GFGA 1WPRA 4HXEB 1YB1A 2ZITA 3BXZA 4HJXA 4QJBA 3T54A 1JIVA 4GKKB 1G8YA 2NSDA 2ZE8A 4LBZA 4ALKA 2PWAA 4YREA 1USGA 1EDEA 4A8TA 4PLCA 1HSZA 2NU6A 3LV8A 2X22A 1O94C 1VPDA 2JI7A 5U4QA 1EQAA 3RJMA 3K1ZA 2WIJA 4LYGA 1FNBA 1JN0A 2BL4A 2XH9A 4MLDA 4MWOA 3F6YA 2AMJA 1OXBB 1UMBB 1XDDA 1BIFA 5CW2A 3FCSB 1EUZA 4F3RA 4YRGA 5KMGB 4DIDA 5A7GA 1KMCA 3R6LA 2W6NA 1N5IA 1QTRA 4M1QA 2RHOA 2AS0A 3M2PA 3C6XA 3NTUA 3OA2A 2BHTA 4H6WA 4LZAA 3KELA 1QXSA 2Q7DA 4KVZA 1ONBA 1FS6A 2NO9A 1AT1A 1SWVA 1YKGA 3GUYA 3PPWA 4TYWA 5CM9C 2FMTA 1F12A 2FW1A 2BCEA 1BD3A 1R5LA 2N0SA 3ASZA 3KOOA 1ECLA 3A4YA 4L5AA 1C0PA 3FWYA 2GEFA 3K1TA 3R40A 1ECGA 2YUTA 3ROKA 4Z0HO 2R62A 4IZ6A 4PCVA 4YRSA 3QG1A 3DLPX 2VDWB 5D7NA 4BMSA 4I9GA 2FR1A 5JMTA 3SAWA 4IHJF 4PXSA 1EI9A 2TYSB 3A1UA 2AEEA 2YIDA 2WF6A 4KSCA 3VZSA 3DB2A 4DQUA 1G1MA 2WT9A 1PZMA 1L7NA 3CUVA 3E9NA 3PNKA 4Q39A 3HO1A 3NBXX 1CEYA 3C5VA 2RIRA 5DCWA 3AKDA 2JH9A 2O52A 2EX4A 1QMGA 3PQ4A 4W7HA 1BDJA 2CE7A 1GU7A 1MA3A 1CR0A 1HE8B 2G9ZA 3AFMA 3CVJA 3IDAA 3T5DA 2Z6UA 5CA1F 4O2AB 1KZ6A 1DGFA 1T29A 2VBFA 4XW2A 4HFJA 2V7QD 1J7KA 1QLJA 3OC6A 3MMNA 1YBVA 2CVQA 1NF3A 3E3OA 2WVJA 2QVGA 5DVZA 4GSYA 1PFQA 3UCFA 4PWYA 3WQBA 3L8HA 3NHBA 1KC3A 4GLLA 2IV3A 5KQRA 2KW0A 3OH8A 4YIKA 3BVPA 4Q4CA 1FVXA 1CUUA 4WESB 4ZVTA 2WWVD 3SZGA 5ARBA 5BWNA 1QTNA 3NONA 2N35A 5BR8M 1DC6A 4I6GA 4GPBA 1K6JA 1LSSA 4MUXA 2LZ0A 1DMRA 4UD6A 5E3IA 1WU8A 2B36A 3OESA 2CK3D 3NANA 3LT5A 3CKKA 121PA 3SKXA 2HYIC 2OXIA 5G0TA 3DWEX 1IN6A 3BTOA 3L1UA 3DOUA 4KV9A 1JIUA 3GIDA 2WB4A 3D0KA 3LUDA 3PC6A 4PYQA 3KAJA 4OL9A 3L82B 2WM8A 4XA8A 3UMJA 2BFDB 4B3SM 2H57A 3IAUA 4RXTA 3TCKA 3S8MA 3TDMA 1C1XB 1QO9A 3BE8A 3BIFA 4QQNA 3UJBA 5DNEA 3GVXA 1U2DC 2JJ2A 3EDRA 4C0QC 4KW7A 5CFNA 1S3GA 2G8NA 3D8LA 3FBGA 1L0BA 3VDNB 2II6A 2J3IA 5JD5A 3MGCA 4CEJA 1D8TA 1VYUA 1KK2A 3PHLA 3MJEA 4L5CA 2XE8A 3A45A 3VPAA 2GNPA 4J94A 3AI7A 5I8PA 2HQOA 3OZFA 1PJ8A 1H3FA 2O20A 4GX0A 4HEA6 2NTEA 4NCBA 4ZALA 2WG0A 1E5VA 3IAFA 3ODPA 3W8DA 1GRCA 1S8AA 2CK3A 3U4QA 1CD5A 3NLLA 4DM7A 2OQ4A 3L6UA 2FY8A 2RH8A 1DP4A 5F73A 2QTMA 1PT7A 4JKIA 3JY6A 4YTEA 4ID9A 2BONA 4UM5A 3NHWA 2YXNA 1NYLA 3DONA 2C1XA 4YBRA 1MNAA 1TT5B 3RJZA 1S2DA 1XC7A 4RZHA 4CETA 1ZXBA 3D8BA 1QOQB 2UXBM 2AT1A 1N2GA 2W0MA 1XV5A 3PGMA 4Y2HA 4EO7A 3KSAC 3KQHA 2IH5A 2JJ2D 2V6IA 4EFKA 1E2EA 4Y1RB 4W1PA 2Z83A 2RHCA 3HXTA 1NBWB 4J2OA 1L5GB 2HJ9A 4D9KA 3THWB 3WLMA 1Z4LA 2VPTA 3SC3A 4QDTA 3LCRA 3MT0A 2WZCA 2XMDA 3HNOA 2VP9A 2H1OA 4ETWA 4TXHA 2WJGA 1UANA 1N57A 2IU3A 3G7UA 2Q2OA 7MDHA 5K0BA 4Q37A 5EE5B 4IIVA 3ZWDA 1DIHA 1Y9DA 5LU8A 2P11A 4TPKA 1TAQA 4RMHA 2Y0QA 2YOHA 3RTBA 1QRTA 1YR1A 1GQ2A 2DFDA 2X0IA 5IDWA 1TYAE 2C58A 3PTZA 5HX7A 1QQTA 3T7DA 1NDQA 2JVJA 2G1JA 1IM2A 1IFXA 4YR9A 1B8VA 4IF6A 3SBEA 4WA8A 5K3BA 4DIEA 2BSXA 2VLBA 3SXUB 3C48A 1MNQA 4TS4A 1NR1A 4W63A 5FA5A 3KFUG 5AVVA 1NG9A 3JARA 3FCCA 3EZ2A 1RC0A 1PCXA 3FYDA 3AVOA 5ALPA 2DR3A 4J2HA 1UF9A 2W6OA 4NMHA 5LXTB 1OIPA 1UIMA 4XFKA 5F4ZA 4FWGA 1BX3A 1XDSA 5TPZA 5BYBA 1J21A 3K9HA 1UT6A 3HA7A 5AVTA 2Z9DA 1KEVA 1YS2X 2WI8A 3TQCA 4Y2UA 3H11A 1QX3A 2D1TA 1MBZA 3T3OA 3Q5GA 3GPIA 3U6SA 5LOVB 2O25A 3CXRA 3BWMA 2HU5A 5DDIP 3LLMA 3CH4B 4WK6A 1N3IA 4L9AA 3ER6A 2F5NA 1YB6A 1BFDA 2WE8A 4UZEA 1QHEA 3SHVA 1SIUA 1YDHA 1C14A 3FLBA 1ZVVA 2QU7A 3L8CA 4OI1A 1GTVA 4MQUA 1PDWA 1QYCA 2JKYA 4QLAA 4XJTA 2ZUEA 4BWVA 4UPEA 3A2KA 4HZUB 5AWFC 1D0VA 3K9LA 4G89A 2CEAA 2R1VB 2QYSA 3W6PA 4BCBA 4F12A 3UMFA 1QZZA 2QPLA 1OH8A 5HE8A 1DO2A 1X8LA 4O2BA 4AQDA 3VR6D 2C04A 1ZR4A 2K2QB 3I1FA 4MULA 5CPFA 3WLFA 4IVQA 1EUQA 3TPCA 1VLLA 3JR4A 2RHTA 4MRPA 3ZVLA 5L3QB 4W5JA 1JG3A 3AETB 3IHPA 1WNFA 4QOHA 4H18A 2ZUUA 1TU4A 1QDEA 4KXYA 3RASA 3O4GA 3DZ8A 5L6MB 3AL3A 3F8SA 1B2LA 1M8GA 1UP7A 1E2DA 1GUAA 2EV9A 3CH6A 3P2MA 3ANMA 4RGYA 3WIOA 2FI1A 1FW6A 1KMIY 4A3VB 4UVIA 3PFIA 4JP5A 5BWCA 2EW2A 2BSQA 4DUYM 4GMXA 2BDTA 1U65A 2OQ2A 1DKOA 1UZLA 2A0YA 2QTVA 3CA8A 2BHRA 1P2DA 1QZMA 4PLYA 4RQTA 4ZVMA 2JHPA 3MILA 4OJMX 1GUFA 4MPDA 4P6VF 4EENA 1A0OA 2Q5HA 3ED5A 4LWOA 2BFAA 1DS6A 3MGBA 1H2RS 4OX9M 1CS4C 1N5JA 2O3RA 3ZWNA 2QUHA 4ARAA 3UW3A 1MC5A 3J7TA 2PIAA 1LY1A 3UAYA 3DE0X 3GT4A 5AVJA 5LU9A 3TE6A 1QIIA 1XXHB 3OJEA 4O5OA 4D8XA 4EQ6B 1G64A 5BYKA 1KI6B 3V46A 3EW7A 4WY5A 3TAHA 1FX1A 1K5DA 4IBJA 5E6RB 2BFBB 3HX3A 3UH1A 4PZ9A 1XU9A 2ZRNA 3HHXA 4NYJR 4YGYA 4D56A 4B5KA 1IH8A 1VPTA 4M49A 4F97A 3RAEC 4IUBS 4X94A 4BQNA 2KM1A 2BUCA 3LLSA 3RANA 1EWVA 3LL7A 1NPYA 3MT9A 4DCTA 3WP1B 1MXFA 4ZAFA 4IMJB 4U5QA 4CXMA 3ZBUA 5AK5A 3S81A 1RNLA 2Z1DA 2XGGA 4D99A 2ZB2A 4JXJA 2O0KA 3KHSA 4OA8A 1UPFA 1FRZA 1V39A 2PKCA 3U39A 1UM8A 2X15A 4CBVA 3UT6A 4OAOA 2LNDA 2WFLB 1TF5A 2VYND 3WB0A 3L0DA 1VHLA 3AEKB 3JD1A 3AKZA 1P1KA 2CW5A 4O4LB 5AW9A 3UMRA 4C6HA 3E1KA 5IM5A 4F85A 4E4TA 5IM4F 3UF0A 2WM2A 1HYGA 1N8SA 2XE4A 1JIJA 2O6HA 4D7AA 1U3CA 3GXBA 4YRBA 4N39A 1AA6A 2KZUA 2F9MA 1W5SA 1M1NB 1FNDA 1XK6A 3ACBA 4MX8A 4GUDA 4QTTB 4PR3A 3WWPA 2R7AA 4Z0NA 1DKNA 2QLJA 2XQIA 2ZBRA 3I83A 4OQPA 1PYDA 1X9GA 3C5CA 2G80A 2GZDA 2J3HA 1BW9A 4YJKA 1QS0A 2O2JA 3I9KA 1IJEA 2L19A 2RIPA 3OCJA 5D5PA 1IBKB 3HR8A 1ORRA 5FTJA 3UJPA 4LIPD 5IS2A 2QGFA 1XPRA 1O9HA 2XMGA 3AYXB 5FBZA 3U60A 4ALIA 4JLJA 4I8OA 2JLRA 5J2UB 4RM3A 4Y2PA 5CM2Z 3LGXA 1KKMA 2GEDA 4QELA 4OMUA 2AEMA 2GXSA 4AULA 3AF6A 1TZJA 3QIVA 4K28A 2G17A 4OXIA 2UVPB 1UPUA 1BS9A 2GN1A 2Y4NA 5E1DA 3KKMA 4AJ9A 4UU0A 5L3SB 3H4MA 2JLXA 2ECOA 2O5VA 3FRIA 2JCVA 1EE1A 3E27A 3EZNA 4JKOA 1TA9A 4EQ6A 1LA2A 4D9CA 1KTIA 1GIAA 4IVNA 4ZCMA 4D3XA 1Z45A 2GCGA 1L4LA 5I7OA 4J8PA 4EB3A 1L5HA 1MXHA 2H1IA 2AL7A 3IMGA