3GRYA

Crystal structure of the complex between s-adenosyl methionine and methanocaldococcus jannaschi dim1.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
263
Chain Sequence
QCFLIDKNFVNKAVESANLTKDDVVLEIGLGKGILTEELAKNAKKVYVIEIDKSLEPYANKLKELYNNIEIIWGDALKVDLNKLDFNKVVANLPYQISSPITFKLIKRGFDLAVLMYQYEFAKRMVAAAGTKDYGRLSVAVQSRADVEIVAKVPPSAFYPKPKVYSAIVKIKPNKGKYHIENENFFDDFLRAIFQHRNKSVRKALIDSSKELNYNKDEMKKILEDFLNTNSEIKNLINEKVFKLSVKDIVNLSNEFYRFLQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethyladenosine transferase
publication title Binding of adenosine-based ligands to the MjDim1 rRNA methyltransferase: implications for reaction mechanism and drug design.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 89
structure length 263
sequence length 263
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00398 RrnaAD Ribosomal RNA adenine dimethylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.100 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3gryA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3gryA01
5HIIA 1L3IA 2FPOA 1N7JA 1R6AA 3BUSA 4HH4A 3UJBA 3UJDA 5LQAA 3SSOA 2NP6A 3L8DA 1JQ3A 5HIKA 3MAGA 1KXZA 2QE6A 3SR4A 4BLWA 1JSXA 3HA5A 2QRVB 2P3QA 2ZVJA 3NVMB 3HP7A 2ONZA 4DCGA 3PTAA 1YFLA 1X1AA 1NV9A 2FRXA 2DPMA 4E2YA 4GC9A 4FGZA 4RVFA 3UJ6A 5FULA 1AQJA 2AS0A 5E9WA 5DPMA 1L3CA 1YZ3A 1JQDA 2H1RA 2ZIFA 2VDUE 3C3YA 3GO4A 3I58A 4QVGA 3UWPA 3QV2A 5E1DA 1YFJA 2PXCA 4C04A 1EQAA 2GH1A 3V8VA 4X1OA 2PSSA 2AN3A 3BZBA 3CVOA 3DOUA 2P7HA 3GRZA 3HCDA 4E33A 2BM9A 1Q0SA 1D2CA 3MCTA 3NWBA 5K0FA 2UYHA 1JG3A 4PCAA 2ZCJA 2UYOA 1IM8A 2ZZMA 8MHTA 9MHTA 4RTNA 1WY7A 2OKCA 3SXJA 5ICFA 2ZIGA 5EC8A 1MHTA 5E8RA 2CWWA 1M6YA 3HVHA 3TM4A 5T67A 4DQ0A 4RTOA 2AOUB 3SM3A 1RI2A 4RX1A 3G8BA 5GWXA 1VP3A 4R6XA 5DM2A 2FYTA 3DR5A 1ZHFA 3AXSA 4YMHA 3DXZA 3FYCA 5MHTA 1UFKA 2G72A 3FPHA 3FUXA 1FP1D 4H0NA 2OY0A 4E32A 3NW9A 5EMMA 2IP2A 3GRUA 5K0BA 3KR9A 2BR3A 1P39A 2HWKA 3P2EA 5EKXA 2AVDA 3NDIA 5ERGB 4AZTA 3TR6A 2O05A 3GDHA 4ZTBA 3DH0A 1DUSA 2AZTA 3HCEA 5GOZA 1Z3CA 3ELWA 5EIFA 5HIJA 3KQSA 1EAMA 3ELYA 4GF5A 1BOOA 5HFJA 1VQ1A 4YMGA 5EPEA 1G38A 3M70A 3UBTA 4XCXA 1F3LA 5FQOA 3EMBA 3EEOA 4FT2A 1INLA 1ZGJA 2PWYA 3MHTA 5HEKA 4E2WA 1VBFA 5GIOE 2JH8A 1YZHA 2PLWA 4Y30A 2Z6QA 2CL5A 5EMKA 5CCXA 2I6GA 2YR0A 4GOLD 5F2NA 4IKPA 4L7VA 3OFJA 5FADA 1F38A 1JG2A 2HV9A 5EHIA 4DKJA 3R9XB 3DUWA 5DM0A 4Z2YA 1FPQA 2EX4A 2QRVA 4YV2A 3HVIA 1EG2A 3SSMA 2ZSUA 1WXWA 3M4XA 1X1BA 3QOWA 4CKBA 4GQBA 3OU6A 1BC5A 3I5UA 5CVEA 5EGSA 5LQUA 2NNWB 4KW7A 4PYMA 5LQJA 3NDJA 5IH3A 3ELDA 4PIMA 4C07A 3G7UA 3T7SA 3O7WA 3PS9A 1R00A 5DXAA 4YV0A 4JXJA 3KPYA 1H1DA 1WG8A 3BKXA 3FRHA 3I53A 3I9FA 5K0LA 4PNEA 2ZIEA 5DXJA 3IYLW 3R0QA 4KDRA 3P71T 4KWCA 3Q7EA 3LDUA 1DCTA 2WA1A 4A6EA 3GGDA 3ER9A 5B1SA 5GM1A 3UJAA 3P2IA 3ER8A 4GC5A 2AOUA 4XUDA 2P7IA 4LWPA 2B2CA 2YXDA 1BHJA 3CJQA 2XBMA 1JG4A 3DMFA 2HR1A 2P1DA 3PFHA 2C7OA 2GAFA 2JG3A 1ZGAA 3E05A 5K05A 5FQNA 2AOXA 3G2PA 4QVKA 4HTFB 2ZTHA 2GLUA 3FUTA 2VP3A 3JWHA 2O07A 3VC2A 1N7IA 4F86A 3E7PA 2IBTA 4KIGA 3JWJA 2AOVA 3PVCA 1RJGA 1IY9A 3BWYA 3ID6C 3PT9A 4DZRA 1BKYA 3KPWA 3UA4A 2CMHA 4ER3A 2ONYA 3NWEA 5DM4A 4EKIA 3M6UA 3BXOA 1PJZA 3ORHA 4E30A 3CJRA 4V0QA 2G70A 5IKMA 1T43A 3HA7A 3FPJA 4PYIA 3FUUA 2NYUA 3CKKA 4IV8A 3PX2A 4QTTB 1NW5A 3TOSA 1SUIA 1WS6A 2E5WA 1R8XA 3KQWA 5DWQA 2XVMA 4MTLA 3VYWA 3LDFA 3OE5A 4RYLA 5CVJA 4E31A 4ER0A 2AOTB 1JG1A 2ADMA 1KP9A 2G8NA 1EIZA 2Y1XA 4RTSA 3I64A 1YF3A 3THSA 2PJDA 3NTVA 5T6BA 1EJ6A 3A26A 5DTQA 3SVZA 3BGVA 2GS9A 1XDSA 3TQSA 3FTEA 3RW9A 4F85A 4ATNA 1NW8A 3T7RA 1O9HA 1QZZA 2XYQA 3KPJA 3OZTA 4RTPA 3KU1A 4PYNA 5DLYA 1N2XA 4A6DA 4POOA 3LECA 2F8LA 3EPPA 2G1PA 1RI4A 3B3GA 3EEYA 4PYQA 3OFKA 3LPMA 4CXMA 2KW5A 1NW7A 2IGTA 1QAMA 2BZGA 1JTEA 2OZVA 5K01A 5CM2Z 5KVAA 4RWZA 3LGAA 1JSZA 4QDKA 1L9KA 3P9IA 5EEGA 5FA8A 3MQ2A 4EKGA 3FUWA 5E9JA 5CIYA 5FWAA 2B3TA 4GOOD 3LKZA 4GEKA 2C7RA 1RI1A 4DA4A 4HTFA 2GPYA 2ZBRA 5DRTA 2FK8A 3BWCA 1P91A 3UZUA 2IPXA 3PB3A 3FYDA 3B5IA 4M7RA 2ORED 1B42A 3MTEA 2YX1A 3S68A 5C1IA 1I1NA 1D2HA 5K0CA 1P1CA 3P9CA 3SX0A 2ERCA 2ZZKA 2OYRA 2C7PA 3MCZA 1SQGA 3HNRA 2G71A 3MERA 4PWYA 3G8AA 4FSDA 2N47A 5KYGA 3M6WA 5JUWA 5U4XA 1YUBA 4FS8A 3KHKA 3A7EA 3DXYA 1QANA 1L1EA 3BWBA 1IXKA 3FUVA 1KPIA 1OR8A 1RJDA 3LKDA 3MGGA 2IIPA 3EMDA 3B7PA 3RIEA 5KS2A 1SUSA 1ORHA 2V74B 3IHTA 3FTDA 2PXXA 1KHHA 1KIAA 2AN4A 2NXNA 2AOTA 3EVGA 4KRGA 4BLVA 2AR0A 3DXXA 5CVDA 5F2KA 1I9GA 2OB1A 3CCFA 3GJYA 2B25A 3OE4A 4OX9Y 3FRIA 1L3BA 5CVVA 5BW4A 2OO3A 3LCCA 5F2OA 3K6RA 3FPFA 4AUKA 5ICGA 3NVKI 4FSXA 4DF3A 2PBFA 3G2MA 2NXCA 1Y8CA 4FP9A 5DTMA 4F84A 3U81A 4EVIA 3EGEA 1VLMA 2EJUA 4HC4A 3TKAA 1VIDA 5K0JA 3P2KA 4E70A 1QYRA 3D2LA 3HTXA 1ZG3A 3HEMA 1SVUA 1VP9A 3NJRA 3FPGA 5DSTA 4R6WA 4X41A 3T7TA 2EFJA 4U7TB 3AXTA 5FUBA 2FCAA 1AQIA 3GRRA 2JHCA 2Y1WA 3EGIA 2IH4A 2O06A 4CTJA 3HA3A 2OBFA 5GM2A 1TW2A 3LHDA 5GINE 4LG1A 2P3OA 5EMJA 1VL5A 5GIPE 5GP1A 5BW5A 3ANXA 3DULA 5T64A 1O9GA 5EMLA 4RTQA 5HOQA 3M6XA 5FHRA 2AVNA 5ICEA 4GBED 5CD1A 3LCUA 4RVDA 4ER7A 1ORIA 1VE3A 2LD4A 3EGVA 3O31A 5DT2A 4UOEA 3GNLA 2ZBPA 4YUWA 3UFBA 1TPYA 4ER6A 4GUAA 3CC8A 5DM1A 1R74A 3P8ZA 10MHA 2I62A 3SMQA 3ERCA 4QQNA 4XUEA 1RJEA 4U7PB 4ER5A 4C4AA 4PYJA 3WSTA 5E2BA 5K0NA 1AV6A 1TW3A 4RTLA 3GRYA 2V7EA 4PYLA 2ZFUA 3REOA 2I9KA 3HVJA 1FBNA 1G8AA 2BH2A 2YXLA 5E8JA 1M6EX 4LECA 4OA5A 4PYKA 3CBGA 1V39A 3TKYA 5CCBA 3M33A 4HRAA 3FZGA 2EG5A 3G89A 3KR1A 4GOMD 2B9EA 2PT6A 4OQEA 2IFTA 1NKVA 3AWIA 2R3SA 5DTRA 1KYWA 3KQTA 1SKMA 4BP1A 1XCJA 2YXEA 3EVAA 2P41A 5EEHA 2IH5A 1XTPA 2C7QA 3K0BA 4C03A 3EVFA 3IEIA 3R24A 4C06A 4CKCA 1QAOA 2YTZA 3E23A 3G88A 3H2BA 2ZBQA 4O29A 5ICCA 4HGZA 2PT9A 4YV1A 2DULA 4XUCA 2K4MA 4PGGA 3TRKA 4P7KA 1JR4A 2XVAA 3OU7A 2VDVE 4ISCA 4EMSA 2O57A 1FJXA 1HNNA 2ZLBA 4KVZA 2XYRA 3FTFA 3TM5A 5G02A 3EVZA 1U2ZA 1AF7A 3KQVA 1ZQ9A 3TFWA 3TLJA 1XXLA 2FHPA 4M37A 3JWGA 1XJ5A 3C6KA 3G5LA 3QOXA 4HGYA 4M38A 5C9ZA 5LR6A 3LBYA 4PINA 1XCLA 5HZMA 3LCVB 2H00A 3ELUA 4MIKA 5D1NA 4BP3A 4OA8A 1KR5A 3A25A 4PGHA 5K0GA 2BM8A 2IDKA 2PVCA 2IDJA 3UJ9A 5LQKA 3LX6A 4QDJA 4EQZA 4K6MA 2NP7A 2ZWAA 2NXJA 2P35A 2VZ9A 4RTRA 1R8YA 5HIMA 2Z6UA 1NBIA 2VS1A 4OBWA 3KQMA 3OZSA 3UJ8A 5KQSA 3B89A 2Q41A 3SGLA 2HNKA 3GWZA 1WZNA 2B78A 4DCMA 2OPBA 3DP7A 1WXXA 4RV9A 4X63A 3G2QA 4PONA 5FA5A 2YUIA 3UJCA 3X0DA 1VPTA 3CJTA 5FTWA 3DMGA 5E1BA 3AY0A 4P7JA 5EKUA 3VSEA 2OB2A 3RODA 4BLUA 3LL7A 5DX8A 2BR5A 2QY6A 2ESRA 1X1DA 1XVAA 3DTNA 4R8RA 5DX0A 4YUXA 3C3PA 3HCFA 3PX3A 2XYVA 3A27A 3LBFA 2GB4A 1SG9A 4IWNA 2PGXA 4AZVA 4RTMA 3B3FA 5LSAA 5K03A 5E1OA 2P3LA 3NMUF 2UZ4A 3KQPA 3KR0A 3KQOA 4RVHA 2IH2A 3FTCA 1NV8A 3HCBA 4WXHA 5EG5A 1O54A 4RTJA 3EVCA 3LDGA 5K09A 2O0LA 3LSTA 3BWMA 3HVKA 4C08A 3IV6A 1NW3A 1G6Q1 2YVLA 3KKZA 3Q87B 3C6MA 3R6TA 2IBSA 1M0EA 2P40A 5DX1A 3EVBA 1R18A 3HCAA 4KIFA 2GA9A 3OZRA 3GXOA 5EOVA 3E8SA 3GRVA 5JR3A 5M5BA 3KQYA 5K8VA 1DL5A 4P58A 3A7DA 2AOWA 1RI5A 4B17A 2ZZNA 1UWVA 2H11A 2PX2A 3OCJA 3BT7A 2QM3A 5K0EA 4CKEA 2ZULA 2I7CA 2JHAA 5EIWA 1QAQA 3F4KA 4Y2HA 3A4TA 2PX8A 1G55A 4FT4A 2HTEA 4P7GA 3T0IA 2UYQA 2JHPA 4QPNA 2JH9A 1RJFA 4HG2A 4IV0A 4FR0A 3DLCA 4MWZA 2OXTA 1D2GA 4P7FA 2CMGA 4EK9A 3G2OA 5LQNA 5KQRA 3P9NA 2WA2A 3SSNA 3DLIA 4G56A 5BXYA 1I4WA 3THRA 4WVLA 3BGIA 5E2AA 5LQCA 5EZQA 4R8SA 1RI3A 4X60A 3HM2A 4LWOA 4RTKA 5CUQA 4YUYA 1G60A 3BKWA 3EVDA 1NT2A 3OU2A 2NXEA 1X1CA 4QPPA 1G8SA 1NW6A 5C0OE 4R05A 1JTFA 2EJTA 1SQFA 5EVJA 4RSRA 2PV0A 1XDUA 3JWIA 3KPVA 3OPNA 4AZSA 1Q0TA 4QQKA 5D1HA 3KPUA 3P97A 2WK1A 3TMAA 4MHTA 2PKWA 3AJDA 4C05A 3ME5A 3G5TA 1YB2A 4FZVA 3UJ7A 4CWAA 3V97A 3UA3A 2ZWVA 1JQEA 5HILA 2R6ZA 5EZSA 4AX8A 2Z6AA 1XDZA 7MHTA 3DMHA 3GU3A 2A14A 5P8WA 4DM3A 1NBHA 3PLAE 3MTIA 3GCZA 3HCCA 2QYOA 1MJFA 2AN5A 2CKDA 3EVEA 4E2XA 4M36A 5FWDA 3B3JA 4RVGA 5LQRA 5H02A 2P8JA 3KQQA 2VDWA 1ZKDA 4YUVA 4CTKA 5BP7A 1UIRA 4MQ4A 4PYOA 1X19A 2PX4A 5DSXA 4PIPA 5E1MA 4DMGA 1HMYA 4AZWA 2PXAA 4V0RA 1P1BA 1KYZA 3FPEA 2UYCA 2ZW9A 4HSGA 4NECA 3R3HA 2HMYB 2BR4A 4QTUB 4OQDA 3PFGA 5DRYA 2FK7A 2PY6A 4E2ZA 1PRYA 3KR2A 5FCDA 1FP2A 2JJQA 4PCLA 4BY9E 1KPGA 3MB5A 4OBXA 3VC1A 1EJ0A 3O4FA 3TPZA 3M6VA 5CVUA 4YUZA 5FHQA 2PX5A 3CGGA 5EQJB 3BGDA 1NE2A 4GOND 2PWPA 2YQZA 4KDCA 5E9QA 1KPHA 3C0KA 3P9KA 4X61A 3GIWA 5EHGA
chains in the Genus database with same CATH superfamily
3N2LA 2AKYA 1KC3A 4PE5B 1Z2NX 1LQ2A 2A8YA 3VR3A 4GMHA 1I1HA 1Y6GA 1ISJA 2HREA 5DPMA 1NX6A 4OAQA 2WF9A 1NXOA 1XKTA 2Z5LA 3AU9A 4RTOA 4LHXA 1I94M 1WCIA 5KOHA 2OGTA 3W8DA 2OCXA 1LDEA 3DA8A 2PVSA 3BHJA 3BRQA 3AK4A 4I14A 4MW4A 1I01A 4B34A 4YAIA 1ZGGA 5GIOE 4ZEWA 1CVIA 4LYJA 3BA6A 3ZNOA 4Q1AA 2WT9A 1N1MA 3JZIA 5CAEA 4CM3A 4RWEA 1E5VA 1Q6ZA 3A58B 4MQ6A 2N42A 3DWFA 4N0PA 3R44A 3I04A 5H70A 4BU0A 1BS2A 2V6JA 1C4KA 1OT5A 4FZ3A 3VC2A 3I34X 4KXVA 2A9JA 4KUEA 1C8KA 4E1VA 1ESMA 1A9QA 2HA4A 1FTWA 3GD7A 4Q6BA 4ETWA 1QPZA 1A4XA 3PFWO 3LL4A 1FQWA 1Y9AA 3JQ9C 1NF2A 3QHAA 1FTQA 2C9OA 2P8SA 2IY8A 4KQIA 3S99A 3CIFA 3K4PA 5TQVA 4GITA 3TNFA 3WNDA 2QK4A 4GM4A 1IB0A 3NHJA 1FJGM 5K7SA 5AW3A 5A7FA 1AGPA 4HXFB 3M8KA 4JVOA 1QVAA 3HB9A 4LJRA 1X1EA 2ZBGA 1AY0A 3MWLA 1EFCA 3WLNA 4G5HA 2X4DA 1U1DA 2RHBA 2XIQA 1AUVA 5F2KA 3HCWA 4PT5A 3PVSA 3J7AS 3UK1A 5C52B 2QV7A 4PSDA 2QZ4A 5A9RA 3HBFA 4AROA 2HYIC 4ZOAA 4U7HA 4FB4A 3UYKA 4UNIA 2E4XA 3ORSA 1JFVA 2OBFA 1R16A 3QFSA 3OM8A 5DNCA 3KB6A 4CEIA 2VAMA 3P8ZA 4Z9AA 4JN6A 2L7HA 1RADA 1M72A 1GTSA 2ZRDA 1GPDG 2MTBA 1WPXA 1HRKA 2G17A 4IOMA 1IZ9A 4XARA 1YQ9A 3KQTA 2ZBKB 3NV9A 2YTZA 1GG2A 4O29A 3IEMA 3WY9A 1M8KA 1YWGO 4RHCA 5IT5A 3ZU4A 2QQ8A 2O57A 4ZJYA 3RQIA 1NC3A 2FP4B 2I2CA 2WD7B 1SPXA 1PK9A 1I80A 2TSYB 3EOBI 3MTGA 2ASEA 3D5TA 4IYJA 1U0LA 1A27A 1J1ZA 2VCHA 3TGWA 3R6WA 2WHQA 3G2QA 1QIHA 4DABA 2PMEA 1GRQA 4GKKB 3DTVD 3HCBA 4JLMA 2JAPA 2BJVA 1FEZA 1NQTA 3FPKA 4BPBA 4GZLA 3W5JA 2P65A 5E7QA 2AJDA 3T3DA 1JALA 1XEAA 1P72A 4BP8A 3QM1A 3BT7A 1YU9A 1B6SA 1U0HC 3GQVA 2VJLA 4C7VA 2J9ZB 4RFSB 4X64M 4ZYWA 3NR2A 1ODTC 1M1XB 2ZYHA 1CD5A 1DCKA 3IAAA 1DC3A 4WGGA 2Z8YM 1OTXA 3UOWA 2ZRKA 3STHA 1CRWG 4AX8A 5JDCA 3I5MA 2UUBM 2GAAA 2AYZA 3DVLA 4IRUB 1M83A 2A84A 1KS2A 2XI4A 3UQZA 1D6JA 3KFUG 1X19A 4MB2A 4EGQA 1C3OB 2JJQA 2DHCA 3VH1A 1PHRA 2PAFA 2QXTA 3TWOA 1OC4A 2PWPA 1WMBA 3FH0A 3IMCA 3GROA 4BNVA 1JEQA 1M1YA 4DCGA 3DLAA 1NV9A 1THTA 3MBKA 1OAOC 4PM4A 1RRMA 3BE8A 3EGDA 5KYXB 2GEFA 3FZYA 4UAJA 5JEDA 5BO5A 1GQOA 1R0RE 2WRZA 1E2IA 1IOZA 2WTBA 2YFHA 2FYTA 1G66A 1KTIA 2CHEA 5C1BA 1QK4A 1H2YA 4GDMA 2D5IA 4WOBA 2B1RA 2R6R1 1CUDA 4IIEA 3FFWA 3QUAA 1CZNA 2EF0A 3UAOA 2GAIA 2CJWB 3A9RA 3EXIA 3UUEA 4XA8A 1Z38A 4JXJA 2V7BA 2OC9A 3KDSE 5J58A 5EJ5A 5JDIC 1MHPA 4IJQA 2Q6VA 2Q5JA 2QVBA 2FS1A 2HC9A 1SHLA 4QQ8A 4C6TB 4DV0M 4ID9A 2W8BA 4N0DA 1YC2A 4YTEA 1JV2B 2A4KA 3I8SA 4NHOA 3MLAA 4JL8A 2CVZA 4Q1BA 2IU3A 3INNA 1NG1A 1EINA 4YT2A 3KNZA 3CV3A 3X2EA 1DJMA 1CUFA 2UUCM 1REQA 1ZVKA 4E5DA 2CXSA 4TYMA 1XWFA 4PYQA 4MDYA 2FW8A 2I6UA 2JCSA 1GXSA 3HB5X 1FDTA 2FWPA 3AOGA 2NUPB 3FFAA 1X2BA 3CLVA 4QVIA 1P9WA 4BOYA 1AKTA 5LXTA 1E2HA 3F5DA 1WDWB 1I2DA 4K6KA 4V0OA 1GPUA 1NJ8A 4P82A 3TIXB 4U8GA 1DTEA 1EK6A 3RANA 1LSOA 2CCKA 1KY5A 1E3DA 1T1EA 5C18A 2EKPA 4EVIA 3LXUX 1U7HA 3HYRA 1ZLYA 4CMIA 1Z0ZA 1QG6A 5JMPA 3FCYA 1W0JA 1II8B 1IRIA 4MULA 2Q5QA 5EMJA 1ZM3A 2ZUFA 3QNUA 2QRZA 1YS6A 5CLGA 5CD1A 3O31A 1FYXA 1KOFA 1JB1A 1WMFA 1U8XX 1YHYA 3ELBA 3ABQB 2VRCA 1UXOA 4OMFG 4BXOA 3PJFA 2BC9A 5CIQA 3S2IA 4E7PA 2RGBA 4C03A 1YDGA 2XXAB 5EUCA 1ENOA 4J6EA 4W9RA 4WDRA 1ZBQA 3A4NA 4PXYA 1VCHA 5FX2A 4ZU1X 3I01M 3MIZA 4A26A 2PVCA 1WBDA 1JDUA 1JMYA 3QELA 4N5NA 1OA0A 4L08A 1YB7A 2O1SA 1T25A 2Q99A 3CJTA 4DUPA 3GUUA 1SRRA 2GTPA 4INJA 4E5UA 3IXLA 5G53C 4DCTA 4BLUA 1KKMA 2J3HA 3O2SB 2WTNA 4GBGA 3ZGXA 4DSZA 5EG5A 3OIGA 3R6DA 1W2GA 4X20B 3W1WA 1R5JA 3UATA 3W6PA 2OGUA 2C2ZA 3P2MA 4UFOA 4X1IB 4BKUA 4JKYA 3KQLA 3QXGA 4N12A 1I6KA 3AESA 2JIPA 4YAFA 1AVTA 4R2HA 1P7YA 2PRYA 4TKLA 3U9TA 1HKUA 3E9ZA 1N2BA 4RMNA 3N8DA 3D64A 2FETA 4K9MA 4HX9A 2HLPA 4C5CA 4GLLA 5HCNA 2AMLA 2XKBA 5T4BA 1MJFA 3MWEA 1BYIA 2HIAA 4M36A 4MQ4A 4PYOA 3LC0A 1E7YA 4H7FA 4AZWA 4V0RA 4PPQA 4DAOA 2QG9A 4AMBA 3WJAA 1QM5A 4F1WA 3D54D 1CNMA 4PG5A 3GPIA 1IY0A 1ZNXA 4KO2S 1RYNA 2V96A 1T5TA 3LYAA 1WMEA 3RSQA 4DNFA 2HSDA 5HS4A 2M2IA 3ZWQA 3EQ6A 5BSEA 2Q6KA 4Z7QB 3LMMA 1BD3A 4BQPA 1P0QA 1NPTO 3Q9SA 3NGLA 3O4VA 2JLZA 1ND6A 5SY4A 4EBFA 2X14A 1KO5A 2VTKA 1JJFA 1ZMOA 4FQ5A 1EP1B 4PLYA 2AW3A 1HLGA 1KO8A 3SYRA 4JL6A 2PWYA 2QN3A 4Z53A 4WBNF 1PIWA 3DV0B 4IG9A 4CM4A 2GYWA 4ZTZB 1NBMA 3DDSA 5E4TA 3I53A 4Q39A 2EKZA 2WA1A 3DZKA 3HFRA 3CXRA 3SZOA 2FLVA 2YWGA 3FCSB 2CDCA 1BHO1 1LI4A 4KBGA 4AYXA 2VYND 3LHSA 3O1HB 4QREA 4UOZA 2ZE6A 2V7TA 2QTLA 3MRVA 3UHFA 4REZA 4TLMB 3ETJA 4OG2A 2VH1A 1Y3AA 2FNAA 4LSGA 3KEMA 3M6IA 2GA8A 3LY8A 3SIWA 4IKEA 1QOPB 4JI8B 4TGLA 1XDBA 4PGMA 2AG6A 3OZTA 3INRA 5AKKA 4UM9B 4JVMA 2PSFA 2HADA 4JT8A 3DOIA 3ND7A 5FNZA 4KX3A 1T3LA 4QUJA 3K0SA 2BEUA 3CEAA 3HKCB 5E4FA 3LKZA 4EMUA 4DVGA 4O59O 9ATCA 1Z2PX 2BKUA 4AKIA 5A2QS 3WRXA 1XBTA 4CL3A 2WFAA 5TY0A 4NNJA 1F6DA 3LPNA 1OMOA 1QDTA 4OK3A 4E5VA 4QOJA 2D0DA 1N8TA 1ZUWA 4DPLA 2NXCA 5C3UA 5DTMA 3EGEA 4CGYB 1P0PA 3U4AA 1RHMA 4INAA 4W8HA 1JIXA 3F1KA 2QLTA 3TIFA 3HRKA 5CDSA 2P1ZA 3A10A 3K16A 1RIIA 1AN9A 2QLFA 1MJNA 1G8GA 4Q4DA 5IPFA 1IE3A 4R7TA 2JA1A 3P52A 4TWJA 3RVDA 4B46A 4UCXA 2XEPA 1ZK3A 3Q5DA 2ZR9A 4JIMA 3QKTA 4M8KA 3EVFA 3U5TA 3G13A 2PT9A 2EOAA 4MMYB 4OJTA 2W2OA 1XLUA 2Q1UA 2R4EA 2YCBA 4DBGB 3QENA 1JDJA 1F0PA 1ZD9A 3GJ0A 1KY3A 4Q1CA 3OLXA 4A1FA 1O3YA 2L0XA 3W5DA 3PHIA 1NNSA 4DHEA 2IYPA 1SKYE 1IB6A 4H27A 4X7BA 2MT9A 5AYVA 2WU0A 3D8SA 3N07A 1VLLA 2ZRQA 2Z3VA 4WA7A 4XGRA 3U44B 3H86A 3OEWA 4U2DA 3RRYA 1GGFA 3RU9A 1PEDA 2HU8A 3QEAZ 4G84A 1HNXB 1OXXK 1USIA 2PX8A 4QU8A 2HTEA 4PCVA 5ED4A 2L69A 2EYUA 2XDAA 1L7QA 1E1LA 3ZUGA 3I09A 2HBRA 5JLJA 3WQRA 4JJEA 2R6JA 3H6GA 5EJFA 1F7UA 5AVOA 3BSWA 1YTUA 2VHVA 1SKQA 4JYAB 5L6MB 5FLXA 3COJA 3ONFA 1DLJA 2RCNA 3THWB 4PYRA 4JQZA 1I2CA 2NZ2A 3WLRA 3EWNA 4MLCA 4QYIA 4MDEA 2Y0EA 2C20A 3PE4A 5DGCA 3KLMX 2CL0X 3CE6A 2R5WA 1PR9A 2PX5A 4MKIA 2JUJA 3KZCA 5IC4A 2GYVA 4INZA 3GNTA 4Q01A 1L1QA 1OWMA 1JQ3A 3L26A 2WPNA 4JR0A 4TLLB 1NHWC 4MPTA 1DOZA 3IBFA 4E2YA 4DEYA 2VDUE 3REGA 1GKUB 3RROA 4QT0A 1Q50A 1GU1A 3NOVA 3A1UA 4HWGA 2QMHA 3FCUB 1K0UA 2J3EA 3CUKA 1P1FA 3NBKA 2ZRFA 1UFKA 3L9XA 3DHEA 4QE3A 2KZSA 1W75A 1N3IA 1IHUA 2D8MA 5C5EA 1VBFA 1NUAA 5C8XA 3E3AA 3LCMA 5AVYA 3VNUA 3DAPA 621PA 4R71A 3MGKA 3W9SA 3PCTA 4CG3A 5EJEA 5AM4A 3DLPX 4BDTA 3DMYA 5B1SA 5HFNA 2E18A 2APLA 4CCWA 5H0IA 4EGAA 3OE7A 4YCBA 4NL4H 5JH7B 3ZTYA 1XJ0A 1CQWA 4YJFB 4INOA 2WVAA 2OECA 5AUPB 4Q3KA 3W4KA 3WHKA 3KL2A 3TX6A 3VDQA 3VOAA 3EIQA 2H29A 1K63A 1UKAA 4ZWNA 1ZCJA 3SX2A 3DVAB 2I99A 5EJ7A 3LOUA 4MV7A 3ZGVA 4I5IA 3ESBA 3VPGA 3QEKA 5JJCA 1UAAA 1KI6B 1XHBA 3X1JA 2FZWA 4CQNA 2OO7A 4DV1M 4KE6A 3W2IA 2EFYA 1M2OA 4EHLA 1U9IC 3KT3A 4TMFA 1LPAB 2R7AA 3F6SA 4GXNA 4XWKA 1RR6A 2OB1A 1AQNA 4IQ8A 3F7NA 1ORDA 5FYDA 2HXYA 3D8HA 2OO9A 2YBEA 4TKUB 1LDNA 4I99A 3W9YA 1X74A 4R6WA 1FQJA 3G0HA 3OETA 3SYMA 4V0SA 2ZDQA 5MFZA 1K8QA 3STWA 1XZGA 4K3UA 2OFFA 1QGUB 1Q2XA 4RW0A 2DXIA 1CR6A 2ZUCA 2WYVA 3RBVA 1JMKC 2IEGA 1XZPA 3AEUA 5LZ2A 2VWQA 2BFBA 3RYIB 1AQ6A 4OFBA 2JIZD 3WL7A 1VTKA 1DIGA 2YZMA 2O2ZA 1FFWA 2FUEA 3WMEA 3TKYA 3RKRA 5I8WA 4QXPA 1GGHA 3ZV4A 3AHIA 1KEUA 4MARA 2BV3A 4QUEA 1UXIA 1F7VA 1ISHA 4XUCA 4BNYA 4WERA 3OF3A 5I4IA 4JLKA 3RSHA 2YFQA 2RJNA 2WJYA 2EQBA 4M9QA 1YVPA 2HCBA 2V8BA 4GO1A 2EEPA 2NP7A 5DGHA 1UT8A 2QRJA 3SXUA 3HV2A 2VLIA 3JYQA 2HEGA 5D5HA 5JWHA 5L7TA 1X8XA 1WXXA 3Q7TA 4Q4LA 3EEBA 3ZW8A 4RLFA 4BN4A 3WGZA 4YRPA 5A0VA 3O8QB 3FWYA 4RPJA 2HUPA 2A7XA 4RU1A 2WJ6A 3K94A 4TTRA 4P5PA 5EJGA 4D9MA 2OCLA 5JZBA 2J07A 3K5IA 2X19A 1XAIA 3W5BA 4EYKA 1PSWA 4RK7A 1CKEA 4RQTA 5K0EA 4FFVA 1TM2A 1J5EB 3ZCUA 3E9RA 4JI1M 4RY0A 4UC0A 1A5BB 1AS0A 4G26A 4D9CA 4NCNA 3I1IA 2EJTA 1UKVY 1OI3A 3IA7A 3N8GA 3EFHA 2PKWA 3DQZA 1E7RA 3IJRA 4LPKA 4RKRA 2XUHA 4WHMA 1Y1LA 1MO4A 3IQIX 1XIVA 3BEOA 4GOJA 2JPDA 1QQ7A 3X3HA 4DLVA 3JZFA 4G4QA 4W4TA 3DMPA 4OXYA 1ZJWA 3P9KA 5AUNB 2QJWA 1ZEMA 1TLFA 2JGKA 5IK2D 4HQOA 3KS8A 4ZMBA 4BNZA 4EY5A 1YOVB 1YZ3A 1Z88A 1R6UA 2C4WA 3E35A 1RS0A 3GIDA 4MX8A 3NWBA 4YFYA 4BHTA 5CLQA 2ZPAA 2XPCA 1ZRNA 1E92A 4PG7A 3PENA 4MQLA 1E2LA 3FPHA 2P5YA 4A0GA 5AKJA 2KEBA 3INTA 3GEEA 9LDTA 4KV7A 3UAZA 2R8EA 3L4SO 3O4IA 5A2GA 5DTJA 4OU5A 2GKSA 4UM5A 1GZHB 1RJ9B 4CKBA 3V8EA 1O1YA 2FPMA 1GADO 2W6QA 3VZCA 2GN2A 4OXQA 1QB7A 5FR2A 1O6ZA 4OSOA 5B12A 2C54A 1Y7IA 2BFOA 4OL9A 5FFFA 2IBTA 3L1IA 4K0KB 5MFPA 4DR4B 1T4CB 2KDLA 2C98A 1KI3A 3ZBUA 2FPPB 4DDHA 3FDXA 1QX4A 1C2YA 5C2JB 3L2OB 1VMIA 1SC9A 3BB4A 2BFMA 3RVSA 4F9EA 4RYLA 3QLJA 4MV6A 3AB7A 3NCHA 1ZIXA 1Z56C 4DLTA 4JL5A 1RE1A 5DLYA 3JAKB 1I6LA 2P27A 4MVJE 1JPNA 3I8OA 4UEQA 5DM60 4IO0A 1LFDB 4LRTB 5KQLA 3G2KA 1WVMA 3KOXE 4MKHA 1IH8A 3DFMA 3J81A 1R5BA 3IL2A 2PPLA 4EL0A 4Y0AA 2RMKA 3D2AA 3M6WA 4C0KA 1E3QA 3KZVA 2Q5CA 3QXXA 1ZU5A 3A6HA 2G7ZA 2BBWA 1PU2A 2WDZA 2N9UA 5JDCC 4DF3A 4CETA 4DW8A 1Q1BA 4IGIA 4S0XA 4XM2A 4LYGA 1NSYA 3KOUA 1RAFA 4X24A 1ABFA 3HA3A 3AZPA 2C5BA 4X7RA 3H3JA 3LUDA 4ALNA 4ZVQA 2H2GA 2RONA 3QVWA 4ER7A 5K4GA 4AI6A 4HAOA 1O94D 1SK9A 3EIUA 3WLKX 5BQPA 2O2DA 1JIUA 1THMA 3THGA 4ZZIA 3OTGA 1YDFA 1FS4A 2UUOA 1C7IA 3WYDA 2P91A 2H31A 3FE2A 1Z4MA 3TG8A 2VP9A 1D1SA 2ERYA 3C3KA 5TXGA 1N9KA 1XCLA 2PBRA 2CDRA 5K0GA 3O84A 3WHPA 1J8FA 1OXSC 3L0OA 2AXNA 3U3XA 2KBEA 3LHIA 2RK4A 4DGQA 3UJCA 3KOYE 1RHRA 1NWCA 2G0AA 4U7WA 5E6RA 1K0FA 2PUWA 3U4QB 2PZ8A 2WMYA 2IPOA 1GAWA 1H4TA 4ZT5A 3SR3A 3VTFA 3OIFA 4IBIA 1GL9B 2POCA 5E2IA 5AJZA 4Y2VA 2AOWA 4HYQA 4FU0A 4FEGA 1NVXQ 1T1SA 5FV7A 4EJFA 1TCVA 2JHPA 2F4VB 1WKBA 1AMUA 4GZ6A 4CLXA 2BFDB 3AKDA 3E9EA 3V4LA 3BGIA 4JR1A 5EJ2A 1NWHA 1DKPA 4R31A 3AJAA 2NZXA 1CZOA 1B16A 1J20A 1LBQA 3DBRA 5F7JA 3VU9A 5D1HA 5ECGC 4FNOA 4ERXA 3P9SA 4LRSB 3LVBA 4BVHA 4UEKA 1HDGO 1WXEA 4GLJA 2DY1A 3B9QA 1D2NA 1U0EA 4P0PB 3N39C 5JSFA 1PRYA 4EQ6A 2AZXA 2PWAA 1XZIA 1SVMA 4PS1A 4QOSA 2E4ZA 2QSYA 1JA9A 2H07A 3W05A 3DCIA 2DPMA 4FUQA 1ZMBA 2PSHA 2IVZA 3U9SA 2L18A 5DLDA 1D2CA 9MHTA 1DWOA 3N0WA 1T2DA 5I9NA 1ZCBA 3SKVA 3ZZTA 3KFXA 4ITRC 4KLZA 1B8NA 4CT5A 5ERGB 2PTGA 1XQ9A 1UKZA 4RJKA 1YNOA 4JV5M 3R3VA 4HO1X 5K1ZA 1UH5A 1K5HA 3K7EA 4WI1A 3AHHA 1FRNA 4H4DA 4UE3S 4JYBA 1WLYA 5ALRA 4EF5A 3H4MA 2XGNA 1RXIA 1PQYA 2D7HA 3RGPA 4WZ6A 3GJ3A 5JNWA 2CK3D 3LYLA 5FEMA 1PBTA 2CLOB 1BFUA 2DM6A 3N2EA 2ECQA 4NXNB 5A5GA 3SZMA 3RTGA 4QVKA 2MSDB 4RBNA 4DMUB 4REQB 4IKOA 2I4NA 2GJ9A 2J5YA 2WHXA 5EJ4A 2XWSA 1NI3A 2CGEA 4F85A 3REQA 5P21A 1FFCA 5TS2A 2OL4A 1VKJA 4KXLA 1NW7A 2QNRA 3BBPA 3CUUA 4JI3B 1OZFA 2QD3A 2JEZA 1PFKA 3NBUA 4RETA 4V2IA 2FK8A 3KJZA 3PUKA 1MNAA 4CYMA 3PXCX 1HE1C 1P4RA 2O2IA 1D5CA 3VC3A 1OXTA 5CTAA 2EFEB 3P94A 1BE1A 3C5VA 4BO9A 2XMBA 2WJJA 1Z25A 4AUKA 1Z0SA 3MRTA 5GZ6A 2IV2X 3KBOA 5DHFA 3AJRA 3AKZA 1W581 2JATA 3FPGA 5FTNA 2ZGVA 5LBUA 1ST3A 2BSXA 2IC5A 4R1PA 5GP1A 3DULA 4NS4A 3U60B 2Y2UA 4HFMA 5HIAA 3P9PA 4FYJA 1PTKA 3T4EA 3EAFA 4R40A 4ER6A 1XZKA 4XUEA 1R64A 4JEUA 3RTEA 1PR2A 4XE5A 1O5TA 4EGCB 5CU7A 1Z6QA 5LP6B 2LKDA 2TMYA 4MV9A 1R50A 3KQUA 3OEEA 5JZOA 4B84A 1XN4A 3CSDA 2FPSA 1OROA 4RNAA 1DC7A 1CUSA 1NUSA 1AURA 4DRYA 4MGEA 2HKJA 5IUJC 2JGDA 3BDIA 4YNBA 4Q9HA 1VIVA 2J85A 5HE8A 4Y67A 3PKJA 1RQ2A 4Z9FA 4ZKDA 1JHOA 4B3DA 2Q8NA 3GCXA 4W7IA 4MVJD 2ZEJA 4MB6A 5ALZA 1A2BA 1GCIA 4F7WA 4HY3A 4NABA 4PWZA 1B8VA 2JJ8A 3EPLA 1XVLA 2O7NA 4MWSA 2GB4A 2I6QA 5IC5A 2VR1A 1R5OA 3LY5A 4F5ZA 4GVPA 2VK4A 2CUTA 4YJ2A 3MRXA 4X1KB 2F5PA 3C3CA 2H11A 2PLNA 2JCVA 3WWCA 3M1LA 2J67A 3WIOA 1TMYA 3QP9A 2UYQA 4O6VA 2YV5A 3TE7A 5HDQA 3HKBB 4J3FA 2IYLD 3CF0A 1JVNA 3IHPA 1HQDA 1N8KA 2Y1GA 4DR3B 5ELXA 3ML1A 2O0KA 3FTNA 1Z8DA 5A4IS 4LZOA 2XDYA 1GV1A 2ZXFA 3Q3IA 1KETA 1GSIA 3EH2A 4YJDA 4O0MA 3ZYCA 1NNJA 4JLOA 4MQEB 3WRXC 1ZRSA 4RF4A 4P22A 4XD2A 4CIVA 3T3IA 4GBMA 1XDGA 1UDRA 3O03A 4YV7A 2VTVA 4J8PA 3CG0A 1N8NA 3FWHA 3NRJA 3QYJA 1LKZA 3HYSA 3SFTA 2B4TO 1PZMA 4RA6B 1MB0A 2RBEA 3VR1A 4XCQA 4G1CA 1M6VB 1UPAA 4UM9D 5TMDA 3K6KA 4M1OA 1NJ6A 1J8DA 4DLLA 2HK9A 3IHLA 4MCIA 3F5SA 1GCAA 4FE3A 5I9TA 3HKEB 3K05A 4HVTA 3D4LA 1MP0A 3W0LB 4NH4A 3ZXXA 5LXTF 4XCXA 3OOHA 2JY8A 3G7NA 3T9EA 4MYTA 1KC1A 4HGPA 2I2WA 4N3CA 3SQLA 5KMGB 2QP4A 4IKPA 3OFJA 1E3TA 1ZM7A 4LMAA 3PDIA 3R9XB 4YWHA 4ZCLA 5L3ZA 2H7CA 4DL9A 2WFZA 5D3MA 4RVNA 1XU7A 1KO7A 3TIGA 4HSEA 4DG5A 3FPCA 3PXAA 1N34B 5AKIA 4QTZA 2C03A 1U0FA 5J9FA 4EUSA 1KORA 4C30A 5CXUA 5IKOA 5SY6A 3T7KA 1BHJA 5F4BA 3C7AA 2BEWA 1ILEA 1MJGM 3UKDA 1GKLA 1C0LA 4DV7B 4L78A 4PD2A 3OCYA 4B47A 1ENYA 3PHGA 2ILVA 1MAHA 3FX2A 3KG2A 1E5DA 4B5LA 4FHEA 3ZIDA 3NHWA 4H16A 4LK2A 1QLWA 2QUKA 4CF6A 3U7GA 2YBDA 4F11A 4TV8A 4YRLA 2BDEA 2AZMA 4WRRA 1JI3A 2A3RA 2RJOA 1JBKA 5KHAA 5CW2A 3UGQA 3WWYA 2JJ2A 1CRPA 1QGED 1U6JA 3I8XA 3MQFA 3PR2B 3HZHA 2O8DA 3K9HA 2D54A 3RUDA 2H8KA 2VNJA 1X7ZA 2AK2A 3FUVA 1ZONA 1MA0A 3ZWWA 1JI0A 3IDQA 1DV1A 1YB6A 4LZZA 3QEMA 2JCGA 1VHWA 2QTCA 4EATA 4I8OA 3TOVA 2BBSA 3G0CA 1SXJB 2MYPA 1P8JA 4X45A 3K5HA 2IDZA 4JI7B 2IYYA 3A6FA 1ZP6A 3GPCA 3P2YA 3PHLA 3VM6A 4PXSA 4FWTA 2XB9A 4MGKE 2VNAA 3LKBA 1E2JA 1FTNA 3NHFA 3G02A 2FN4A 3JQBA 4OHVA 2P9ZA 3BMOA 5C7OO 4QFCA 2RAUA 5L3QA 5BNIA 5CYOA 1ODFA 4FOLA 3RVJA 4FDLA 1A7KA 2X1MA 3EZLA 3GBPA 1H69A 1EFPB 2A78A 3R24A 2HF9A 2ZBQA 1HC7A 2V54A 4JBHA 1ZOOA 4NENA 1R66A 3OCVA 3TFWA 4RMIA 1BKSB 5C9ZA 2G82A 3GPBA 2UZ1B 5DK6A 4IZIA 4K86A 4EQZA 4MVWA 2VZ9A 1P18A 5CA1B 1N6PA 5E3IA 1EFKA 3DBOB 1NR1A 4AMGA 2X9LA 2P2ZA 3WL6A 4XLZA 4RTJA 3I4YA 4WVFA 3F74A 4ENUA 4HNSA 1FQKA 2QORA 4ERNA 2VYVA 1J42A 1RJWA 1GILA 3LY7A 1Z6YA 2ADOA 3RJ5A 1HNWM 5CRIA 2CMGA 1J4AA 4TL6A 4IEFB 5CR9A 1NI5A 2Z1NA 3LLUA 2N3ZA 4FEYA 5C0OE 4H3VA 3EHEA 3PEWA 4YRJA 4LX8A 2GM3A 1V3QE 4EG5A 4KSYA 2R47A 2E4VA 2P9FA 4XWTA 4KO1S 3T7AA 3K15A 3CNQS 3R8CA 2CCJA 2JY6B 1V3UA 3CF6R 1GZVA 4MPJA 2ZKLA 2C5RA 3ASUA 4I9NA 1PNQA 3IT1A 3EA5A 3L8YA 5KTMA 1KWGA 3LDAA 1H05A 8OHMA 1TIPA 1NLFA 5DCWA 2X1VA 1DAPA 1SKYB 3KE8A 3SF8A 1Q77A 4C3OB 2ZCJA 1BTOA 4RZ2A 2X23A 2GN9A 4DYVA 5DH9A 1YRHA 3PJRA 3MOIA 1VE6A 4KBYA 3FUXA 4K2AA 2QMZA 3TR6A 2V7QA 4QSHA 4ZTBA 3IQZA 4F5WA 3DE6X 4TVBA 2VNKA 2XR1A 4C7OB 3JYNA 4LKOA 2RC5A 3SHVA 2AEEA 4YAKA 2JGLA 2IEYA 1SCJA 3ZTTA 5L8VA 3CHYA 4GE3A 3JY6A 1VI6A 5FOTA 2XUKA 2GILA 3KKNA 3FYHA 2KNAA 2NNWB 1R37A 3MWKA 3LE8A 4LDQA 3I2YX 3UK7A 3ZPXA 2F6RA 4LRUA 3SE0A 2GUGA 1S96A 5JS1A 3GLGA 1ZC4A 3M6FA 4GOKA 3Q7IA 3KJQA 1J5XA 3DE7X 4WY8A 3CFYA 3WQQA 4MV4A 2UVDA 2RK6A 2Q0HA 3IP1A 3L7DA 3HWSA 2XAAA 3QNMA 4U6SA 3ITEA 2J3KA 1UPUA 2ZJ0A 4MGZR 3RI3A 2G1UA 1BVSA 2KX7A 1N2XA 1PJ8A 5FSWA 1HL7A 3PPIA 3UHAA 1RAGA 3BL6A 1ACLA 3M5DA 2R1TA 3T1YB 2P2DA 2HUNA 1GPMA 4IDHA 2SICE 3JQDA 5CYPA 1MDBA 3EQ8A 4K28A 1QS0B 3OFND 3LA8A 1HDYA 4K2HA 4OI0A 2R25B 2IHZA 2ZS7A 3L0BA 1VC2A 1O7JA 5EN4A 1JDNA 5KYTA 1AKWA 1JDBB 2HFJA 1N36B 2JGAA 3NVKI 3SYTA 1SIUA 2GI4A 5CT9A 3RGGA 2ZIUB 2HMVA 5A62A 5DSTA 1TUBB 3KLBA 4DANA 1AQIA 3WKBA 1SFRA 4B31A 3HKDB 2C2OA 4TT3D 5BPHA 2PX0A 3TRFA 1TEHA 4JD5A 3WA6A 1KFVA 2HJGA 3H99A 3HG7A 5L3SA 3HO1A 1IATA 1XK7A 3I0MA 1EFUA 1IJKA 4JP8A 5D84A 2ZE7A 3H9EO 3NKFA 5ULLA 2R3SA 2YOHA 4C7JA 2YXEA 4DKXA 4ZYZA 3E23A 3NTUA 3JALA 4WASA 2V5AA 1Q1EA 1QQTA 1LA2A 1W87A 3HJNA 3R76A 1X80B 1JHXA 3HU3A 3FZNA 2Z95A 3BDAA 4FZ5A 5H3CA 4DMRA 1FNBA 2YY7A 3OF5A 1OZGA 3CF4A 3IBCA 1Q15A 2XYVA 3LBFA 2BSQA 3F71A 3P45A 3R41A 1ZAYA 2CSXA 4G1EB 1SKUA 2JZOA 3BWMA 3FKEA 4IL5A 3B7NA 2Y2VA 4FWBA 4ZC8A 1GNQA 3AINA 1OXMA 1H9AA 1DRUA 2JBHA 4ZVTA 1D03A 3T1VA 1E62A 3CH7A 4K81B 1F5NA 2VHYA 3LCRA 3CUYA 5GJCA 5L45A 1Z5WA 1DSSG 4XYBA 4Z8XA 5B1IA 1H8EA 2FPRA 2N75A 4KMMA 3CG4A 5LYJA 3LT2A 5JU6A 4TWBA 1IWOA 1TUGA 3B9BA 4A03A 4OQLA 4QOIA 2V3CC 3KXLA 2JLBA 3L46A 4DR1M 4W5OA 5LB2A 2HXSA 4GE0A 2IV3A 1N92A 4ZZ2A 1QZ3A 3ISJA 2C7BA 3HCOA 3UKJA 1WR8A 1RCUA 1E2PA 3ETHA 2WKRA 3D2CA 4P81A 1X37A 1WY7A 4M8IA 2A35A 5JE8A 5EWJB 1NLYA 4AN4A 3ZGNA 3P4YA 2VPYA 3EEIA 2IEBA 1DTWB 1M2VB 2VI5A 2VSNA 3AXSA 4I5FA 4JJ6A 1EH5A 3ZE7A 1IJEA 1UKCA 3MSXA 3PQ7A 2G5PA 2W2QA 2VXCA 2VF7A 5F73A 2A59A 1ML3A 4DCCA 5AVXA 5IJ0A 3E46A 3A4LA 3F6RA 3MINB 2QZZA 2J9XB 2QTTA 4U9UA 4BFUA 2BT4A 3BTSA 2W6OA 2ZUVA 1U2GA 5A4AA 3ZLJA 1WW2A 1ZK2A 4BKQA 4TM8A 4BX2A 2V0NA 4JI5M 4JI0B 5EIBC 3INGA 2X0IA 4BBJA 3LPLA 3BH0A 2TMKA 1ZXBA 5TEWA 1JSCA 3FUUA 4ZQFA 1XAGA 1WLSA 2MSCB 5BMOA 2IQIA 3PXGA 3W1VA 4WKNA 2M60A 5JXJA 5C7LO 4N4AA 1TA9A 1I7SB 3OFKA 4CUJA 2C1ZA 1U3WA 3VDUA 4HAUA 2G5TA 1BA2A 3T5PA 2BPOA 5BSFA 1EB9A 4EAQA 3JAMS 3PDCA 5FBHA 3FTQA 1VLJA 1CS0A 3OMLA 2AXPA 4QPZA 4EG1A 2W98A 5HZKA 5T41A 1PFYA 4PZEA 3GP3A 2PFKA 1M7HA 4B79A 3PNMA 3ITDA 4S05A 4M98A 4L6V6 4YREA 3G0BA 4EUHA 3ZG6A 1W8DA 1AUAA 2JKVA 3BMCB 4F84A 3LYUA 2V58A 4KN5A 3EC2A 3IKMB 3BS4A 3RARA 1DKRA 1YGYA 1VSQA 2QD5A 4W5WA 2QTMA 2WSSA 2HL7A 4F96A 1WCXA 4MQUA 3TCKA 1X14A 1U1GA 1GJSA 1FDSA 3LHKA 1WD7A 1E0SA 1IBCA 4DV6B 5F1OA 3GL9A 4XIFA 3KR1A 1NHGA 4IRXA 2VLBA 2BFCB 2CY0A 2J41A 2VP4A 3WWZA 1ONPA 4NC6A 2DUWA 2VUHB 4KPGA 1H9CA 3ZBTA 2XZUA 2LPMA 4EYQA 3PIDA 1A97A 4JGGA 3OF2A 2WQ7A 3UHPA 5D1NA 5CYFA 1L9XA 5AM1A 2CLFB 3OTOM 1QVVA 2ZT8A 2Y05A 2C4VA 1NRJB 3DCJA 4BO0A 3VNRA 3DTTA 3A6LA 3ZJ5A 3TRHA 3R77A 4MGHA 5JVDA 3NYIA 3PDWA 4ZI7B 2Y93A 1YS9A 2Z58A 3ZUPA 2X77A 4G4JA 3B3FA 3RE8A 3JATA 3FJ1A 1UMKA 2AMYA 3QBDA 2X1LA 1N78A 1KAOA 2A30A 1H2BA 2IV7A 3HCAA 3OZRA 1B6RA 1M34A 1CV2A 1P81A 3VVLA 5CFPA 2QN8A 3DLCA 2NUTA 3RSZA 1AC5A 3FBTA 4NK4A 4GLBA 1C30A 4AG3A 1SXJE 1YR3A 4AKSA 5DIFA 1S2GA 4Q4CA 3RVLA 4CI0B 3IKJA 1UEXC 1Z74A 1ZJ5A 1S8FA 1GPYA 4BMNA 4H4EA 2QPAA 5C7YA 4XB6B 5SICE 4HD8A 1XWWA 1W9HA 5BNTA 3AR6A 5J4YA 1MC4A 3FPEA 2DR3A 2JCXA 2Y21A 3I45A 1V47A 3E9QA 5CVUA 4PZ9A 4ZI5A 2J3MA 3F6YA 1ZISA 4HHEA 3SMPA 3SJ7A 1NMQA 1YFLA 2IYQA 5HXAA 1RHJA 3U6LA 4EX6A 3UWPA 1EUYA 4YMSA 2O0MA 4NE9A 1FFAA 2JGRA 2AN3A 3V8PA 2HMSA 4GEGA 5K0FA 1TO6A 1CY1A 5J59A 3Q6IA 1JILA 3WBFA 4KL8S 4JOQA 4FMDB 2UZ0A 1EGAA 5AJVB 4JHLA 5FFMA 3V80A 5EHIA 1TVKA 3HZZA 1O0BA 2WUVA 2ZJZA 1V9CA 4UPVA 1ZQ1A 5JC8A 3LC7O 3T1OA 5F3WA 4G1UC 1GPAA 2XYHA 3QKIA 2LBPA 2WG1A 4LG2A 2XE7A 1TJPB 4JOCA 2YASA 3RC9A 1O6FA 1UBSB 3QVSA 1VYVA 1D4AA 1NF3A 2UUAB 4BE7B 5K6AA 3QFHA 3ZCVA 2H2AA 4DZRA 3FOCA 4EKIA 2P6RA 3TRDA 5FH9A 1VPLA 3HA7A 3CWQA 1R6XA 2Q0QA 4F92B 1UEJA 2DQ4A 1B76A 4CDNA 3ZQJA 2UXDB 4XM0A 3X1XA 4Q4HA 3G82C 4EL5A 5ALQA 3V32A 2KW5A 2AFHE 3GDOA 1N33M 5A9SA 4BJHB 4BL5A 4OHFA 1Z73A 1EX6A 4O3MA 4D96A 4OOEA 4FCVA 3CT6A 3TTXA 2A1IA 1GZ5A 4E08A 2X49A 2OHJA 5KS2A 4R1TA 3EVGA 2WYHA 5CVDA 2XNCA 3WSVA 1DGGA 2W71A 1KJQA 4PZZA 3ZLBA 1T3SA 3ICPA 4N7JA 1MCZA 1WCV1 2W8ZA 3L02A 4GXQA 3YASA 5JI3E 3T95A 5ISMA 2IH4A 4UM8B 3V55A 1KH3A 3OD1A 1ST2A 1K2WA 1G6KA 3DKIA 3VSAA 1IPEA 2E4AA 2ZIAA 1BKDR 1O87A 4LOJA 4OL0A 5AHRA 3QKRA 4LECA 4WZBA 4IIJA 3K2EA 2FR8A 3SJUA 2X4AA 1T9DA 3WMGA 1I9CA 4PGGA 4M99A 2VDVE 3DGEC 1YAHA 4IILA 5C32A 1FC0A 1TI7A 5FOXA 4X65B 3DO8A 2H4JA 4V0LA 3QE9Y 4Z8YA 4G3XA 3DDNA 1OUMA 1Y37A 4IINA 1DGQA 3IA2A 4OK6A 2IU0A 3B89A 2R97A 3QPCA 2EC5A 5IM5A 3ZCTA 1UMCA 4DDVA 5FI0B 4RKFA 4TS1A 4MK4A 3ODPA 4C89A 3JAWA 1Z5BA 3O91A 1T6ZA 5LSAA 2NO5A 4FN4A 2WHYA 2DPXA 4MVJH 1F2TA 4OJKA 4NFYA 1RQ7A 1SU8A 1TMOA 5BR4A 2GERA 1MAUA 2G09A 3PC4A 4LZNA 4YT4A 2QN6A 4NXMB 1BCSA 1XQ6A 4Z9YA 2VQSA 4EFDA 2IOQA 5KQGA 3TS1A 1J0DA 4XJVA 1HFEL 3JS5A 4BO3A 3WGNA 4ASUA 1XRMA 4MW5A 3VDPA 2GSDA 1NW6A 2WSEF 2XKJE 3IQGX 2ADFA 5DNWA 2IXAA 3KPUA 3BMQB 3IIJA 2EZTA 4QKQA 4QDOA 1F17A 1PYDA 1NI4B 2FRVA 3VHLB 4FFRA 2ZM5A 4KR9A 4YUVA 1GDDA 3UV7A 4AWBA 3DKRA 3EG5A 4AJLA 2CFRA 2PZFA 3C0KA 2B34A 3RNLA 1WA5A 4YPFA 2AGVA 1H66A 3E53A 2ZVJA 2WWXA 1UPCA 3C3JA 4RC9A 2XF8A 3S5JA 2GXSA 4OCZA 2VO1A 2VJYA 4XIGS 4X54A 2VQFB 3KOZA 1YRLA 3QOFA 1DEKA 1O57A 5AMXA 3TXXA 1VLZA 1ZA1A 1DZIA 3WNCA 2F43A 5AHOA 2NU9B 2NLOA 2Q3LA 1Z0DA 3PNSA 3JQBC 4JKOA 1HPLA 1Q0PA 3C24A 5GOZA 4KPYA 1EQUA 4JLWA 3J7BA 1BRMA 1OE0A 3DR3A 4H6XA 4KK4A 2HT1A 2KWIA 4PG4A 3UY4A 4ODIA 4DA0A 3IDAA 4BO2A 1X1SA 3WK9A 5EJIA 4QJ5A 5GGYA 1G2PA 3NUQA 2XOKD 5CPBA 4IXTA 1C14A 1N2CE 4V38A 1KMHB 1R0WA 2XDQA 3IERA 1DCTA 4B2IA 4P1ZA 4QICA 5JD4A 3ER8A 3RUHA 1DAKA 1SXJD 3U4CA 1IIBA 4W99A 1JR6A 1IY9A 5FTJA 3S4YA 1RXEA 3O3CA 1CHNA 3QKSB 3CZRA 1E4VA 1XZMA 4ZZ0A 1MQAA 1Y80A 1M67A 3MB8A 1YACA 2MMGA 3CM0A 2WM9B 3FGZA 1SQ0A 3IAUA 3RC3A 1E8DA 5DTQA 1NUHA 1UC8A 5JWRA 4Z51A 3VQTA 3AKYA 1GR1A 4Q3DA 2JD1A 4F4CA 3G79A 1UPFA 5KWSA 3ASYA 2APJA 2KLBA 1E59A 3WICA 1NVMB 4K88A 5CPFA 4GPD1 3KL4A 1J22A 3FYDA 1BG6A 2O3TA 5JALA 3EVTA 1ZVJA 5K0CA 3NORA 3TDNA 2GCOB 1L1EA 1WZ2A 1KJYA 1RD4A 4GS5A 1QIDA 5I5GA 4HDRB 2C83A 3EZ9A 4NZZA 4O1IA 2PMBA 4B85A 3OO1A 4CVNA 4YJ2F 4RULA 1MB3A 3NBAA 5JHHB 4QO7A 1E79A 4QM6A 3LK6A 3W5AA 1PTJA 3I39X 5H16A 4NHEA 3QUCA 1DINA 2CVHA 2XCIA 1WF3A 2A57A 1CCWA 3TW6A 4OREX 3ZQKA 2NUAA 2BH2A 3ACDA 2Y68A 3EG9A 5CCBA 2Q50A 2PSJA 2C3PA 1N4AA 2RAVA 1XTJA 2QZPA 2WAMA 3MTJA 3L0CA 1WKVA 3CN7A 4QGFA 3SD7A 2I7VA 1M6WA 4CR8A 1SCUB 4G65A 5JSYA 3QYBA 5IAJA 4UVHA 2CLIB 3WIBA 2EBHX 4TRNA 1CX9B 2DI0A 3BWDD 2OZEA 2VP2A 1YRQA 4F2PA 3GHYA 5KDDA 5IJ9B 3UB4A 5E1BA 2QGNA 3HGQA 3LL7A 2H1HA 4KXFB 3NHLA 2R0IA 2W2XA 1YDMA 1M2JA 3ZK9A 2YXPX 4HB0A 4B80A 2ZREA 3F6BX 1ZJYA 5K20A 4QG3A 4CKCB 3HVRA 2F3SA 1K9SA 3FYSA 4HGNA 1U81A 3EWSA 4Q7JA 4KG7A 4L95C 4DUGA 2A9PA 4E5PA 1O97D 3MGAA 5EQTA 5TC4A 1RC1A 4BWGA 3VTAA 4TROA 4GYWA 4X60A 4RTKA 5F23A 3B51X 4ZRNA 5IUNC 1QH8B 2NN3C 2P75A 1F9EA 3AJDA 2IWRA 3OX2A 2W9XA 3CZQA 3H0KA 2UAGA 3VNSA 7MHTA 2I34A 2IYEA 3EYWA 2RHMA 4MRMA 4N8DA 3K1AA 2J30A 3JASB 3HB1A 3ZY6A 2Y8EA 4M88A 1C1XA 3P0EA 5FCDA 1G5QA 1P7ZA 1SAYA 4PSAA 3GB9A 1O0CA 4YHHM 3T8YA 4EF6A 1GYQA 3UM9A 2FEPA 2VPWA 2JNHA 4MUBA 5HTOA 3MMNA 1AHIA 3OCXA 1K6EA 2XTNA 1Z0JA 3J81k 4TV8F 2RHHA 2I4MA 2AOUB 2VWPA 3JVIA 1PFGA 2ZUSA 1ZESA 1P29A 4QX6A 1RZRD 4BNXA 4PPGA 4JP3A 3GLHA 1ZNQO 1O96B 4RMJA 5SV2A 1HT1E 4K5QA 4YGYA 2AMVA 4JI4M 5I3ZA 2FSGA 1T0JB 1A9SA 4OQNA 3HWWA 2RGYA 3PTLA 3WGHA 2W6ID 4WEQA 2WP0A 4V02A 2BM1A 1AGNA 2IHKA 2NT3A 3HJGA 5HQ3A 3L7NA 3HB0A 2P1DA 4KITB 4X90A 1T9AA 1N7IA 1CF2O 2CDNA 2QU7A 4DRXB 2QVGA 2GARA 1Q3BA 3TZBA 5FBVB 4V0QA 2YHIA 5IKMA 4MR7A 4PFQA 1NW5A 5JJKA 1DKUA 2O3SA 3THSA 4KXYA 5L7WA 1IBLB 3HJTA 4DLNA 4OB7A 3ZY5A 4PGFA 3RASA 3EPPA 3IT3A 1R3UA 1Z8HA 3I6IA 3EB9A 3TI9A 4CXMA 4CEJB 5ITSA 1A2OA 1P73A 5HGJA 4BNFA 2AN9A 221PA 2J3LA 4LCBA 2Y3IA 1JPJA 1DFGA 3H4IA 5ER6A 1OX4A 3PUYA 1TCUA 3CLSC 3G1WA 1SU4A 4D44A 1Q3CA 4OXXA 2FPGA 4DLUA 4PZ0A 4ZOBA 5IKEA 1SK8A 1UDXA 3FTDA 2P77A 3DUFB 4QTXA 5A3RA 4O1MA 3ZX4A 3MUOA 3KTAB 4AJ4A 4MRRA 1FJHA 3NJRA 4PAOA 2ZIWB 4YFVA 1K08A 4EVQA 2PM8A 4PCZA 1E3WB 4IX1A 3A6PC 2A9QA 4I0WB 5JSKA 4DJ5X 3DG9A 3RWMB 4L4SA 1E7SA 2Q9CA 2WYWA 5IARA 3RT1A 4YJ3A 4U7PB 4LOIA 3BXGA 3EXFB 4D97A 4E2FA 3FLAA 3NYRA 4KFUA 2EG5A 4MI3A 3T06B 4YWJA 2W2PA 5ITZA 1YHZA 2H08A 1RLOA 1NF8A 2W2KA 1LJ8A 4G5XA 2VZ8A 2DFKB 3QVVA 2YHUA 2HFKA 4FHGA 4RXTA 2I1QA 1TPZA 2Y1KA 2GD6A 2XUGA 1GR0A 3B6JA 1GO5A 3KHTA 3QWLA 2OZLB 2P35A 2OP1A 4P54A 3TRIA 3LUJA 1DJNA 4ZYYA 2Q7XA 2D4HA 4F6RA 3V6LA 1U2GC 2NYAA 3V7FA 2H59A 1LRKA 4C29A 2YVQA 3V4RA 4US1R 4X66B 3HVKA 3MJVA 4DUYB 2VEDA 1AMNA 1UDCA 1OLXB 3COZA 5DX1A 1VEJA 3HDVA 4R2XA 3H2IA 4PLZA 1LK5A 2PX2A 3OCJA 3K2LA 1UBLS 2PKCA 4DQLA 1U8FO 1V11A 3B1KA 4KMSA 3HZOA 3PC2A 4NBRA 3WGLA 2IEDA 3M3HA 3VJRA 3I9NA 3PEVA 1JLHA 4ZCPA 3P9RA 1P80A 1IJFA 4CTOA 5T4EA 3KXIA 4JUBA 1EM8A 4LMBA 1GN9A 3SBOA 1HETA 4JP1A 1C2TA 4L85A 4M9UA 4XIYA 1VL2A 3EVEA 3FOWA 4BO1A 3PD1A 1G8JA 5F7OA 2XTAA 4JGBA 2IHBA 1YXMA 2DUUA 3OCUA 2LP4Y 3V46A 1XRNA 4AJ1A 2ZUWA 1EFDN 4H1VA 1X0VA 3E8MA 1V6CA 1RQRA 4DSAA 2WZDA 5I7HA 1YIDA 1L3CA 4CM8B 3CU5A 2REOA 2ZXUA 2B1JA 4XPIA 4HTAA 3BL5A 5ICFA 2PEYA 2LE0A 3GPLA 2A9FA 1KEKA 1GO2A 5K0SA 2I7PA 4KAXA 3K0FB 1DQRA 1MAAA 4JJAA 3JD3A 1A8IA 3VR5H 5K8LA 1U7DA 2E3JA 1TE2A 3H83A 3VBEA 2D3TA 4K9KA 1EG2A 1SOMA 5C5IA 2ZT7A 3OU6A 5KVCA 2NV6A 1L5ZA 1J6UA 2J3IA 2LTAA 3KPYA 5JS2A 3R7SA 2IPMA 1WXDA 4KWCA 1X77A 4DOMA 3TGLA 4LF8B 2R1VB 3MBIA 2B2CA 1LTHR 4OXRA 4ETNA 3GEDA 4RKUF 4RQBA 4XJSA 4S1WA 2ZQZA 3DPSA 1BKYA 5J2TB 1KAMA 4B45A 5DHUA 1GDHA 4DA7A 2GJ4A 3AR8A 1R8XA 1V25A 2NSLA 2EKFA 5BY2A 5LD2C 4ALIA 2WTAA 4D3ZA 2ZCUA 3TSOA 3PD0A 3K9QO 1K89A 4U5XA 2NTYC 1XDWA 3PHCA 4CMBA 4LI3X 3JVEA 4TOIA 4MKZA 2MR6A 4NJEA 4R2LA 1O5OA 1N3LA 3JX9A 4QEDA 1LDMA 2YFKA 4NAUA 2BEVA 3IEVA 5KTSA 3E81A 5JMOA 2Q49A 3WYGA 4NG5A 3A1WA 4IH4A 1CJSA 2DAGA 1LCIA 4A2PA 2BFFB 3LX5A 3GGSA 4BP9A 4QUBA 2RGGA 2P30A 5F78A 5U4XA 1XZCA 2ZRBA 1OIPA 1EFVB 1CS4C 1PO7A 1CNEA 3FDZB 1NYRA 2QRMA 3IVMA 4JOSA 1QB8A 1SA0A 1QYCA 3CZ9A 3PNOA 5FPHA 1KOJA 1SHUX 2NG1A 3E18A 2V55B 3H9BA 3KOWE 3JCZA 1L5HA 4C2TA 2A7QA 4UEWA 1MU5A 4MGIR 4B7UA 3ZVLA 1QO7A 4NY1A 3FW1A 2CBGA 4IJVA 3A11A 1NRWA 4AJEA 4M8NE 1P6QA 2YJ5A 1HT0A 4HDSB 3FSRA 4PQGA 2O8EA 4X44A 1VBMA 4U6NA 3DOJA 3H7AA 1Z5VA 4BGIA 1Z0AA 2GN4A 4WJKB 3IKVA 1ABEA 4AF7A 2Z8YA 2CXQA 2ZYTX 5LYJF 3EGOA 4CKEB 3BF7A 3RYHB 3DO6A 3VJLA 4L0MA 1SVOA 3C8HA 2GPBA 3EE6A 4YA6A 3U7IA 4J2OA 4LXXA 1G19A 4KC0A 3DE3X 3BB1A 3L1VA 3F8TA 5J4HA 1YB4A 2VAXA 1LPPA 2BFNA 5KPRA 4RQAA 5HYVA 5CCEA 3ZE8A 3WGMA 2HHJA 2JDIA 1KI2A 5K6AC 3NG1A 2A86A 2RD2A 1JEYA 2WD8A 1Y3HA 1GAXA 3SAVA 2HTFA 4D26A 4G24A 5TQ2A 1ULHA 3ECCA 3UK6A 1T8SA 1IXRC 3FLBA 3QK7A 4YI3A 3MJHA 1YR8A 1P4AA 2OAEA 4OHZA 1E6EA 2Q5IA 3G17A 3UKOA 2H0RA 3O8OB 4HNAA 2ZWVA 4IAOA 4H17A 3GCZA 2OV4A 4IGKA 5EINA 3ZGOA 1XCGB 5FWDA 5HCUA 2VF5X 4EY3A 4MUYA 4AD8A 3QXHA 3R3HA 1WU7A 3S29A 3WJ2A 1VHQA 3E22A 2O54A 4Y6OA 2X8JB 5GONA 3Q2IA 1ISSA 1G4HA 1ZMXA 3GQBB 2YMQA 1PFQA 1XQVA 5ENVA 1Y6ZA 1QP4A 2C2KA 1OH5A 1PN3A 4IBOA 1U2QA 1ODKA 4RD0A 5IJAA 5G0VA 3IG8A 3S70A 1GPNA 5DDIP 3OTHA 5BQXA 1Z35A 4Q47A 5HJ5A 3DH0A 3GPPA 5BSVA 1A2QA 1X7XB 1M5UA 4CFSA 1YIAA 3IIMA 4G25A 2HIHA 1UOOA 3N0XA 1X1BA 1MT0A 4P2BA 3NONA 3BMNA 5EGSA 1V5IA 4KWEA 4R7GA 3T7SA 1QF7A 3BAFA 1NQOA 1W6RA 2IXFA 2D2XA 2ABWA 2HA6A 1XQYA 1H4SA 4JZKA 5HPYB 3A2KA 4URFA 1TAGA 5GV8A 5H81A 2F3QA 1X9GA 2JLAA 2J7PA 4LE1A 2GLUA 4R3DA 3NT2A 1G5PA 1Z4LA 1KHTA 2CMHA 4EHNA 1VMDA 4DQKA 3ER6A 2WF7A 4C0LA 1QE3A 4IV5A 5CT4A 3LDFA 3O5AA 5DMHA 4TKVB 3EHDA 3I64A 3SDZA 3GT4A 4UFNA 3NTOA 3AKCA 1NW8A 4FMPA 4IHJA 3UAYA 1IQ0A 3DDHA 3ETDA 4IJFA 2QLMA 5A6SB 2QYHA 1V7CA 4RZIA 2I4OA 1I3CA 2YC4C 3I76A 3JQGA 2VL7A 3NNNA 1GG8A 3RUIA 4D4KA 2P2CA 1UKEA 3G8AA 4WIAA 3I83A 3KHKA 2D0IA 3I01A 2E5LM 4EYGA 5M7EA 4M60A 1R12A 2NXNA 5ITXE 1WW3A 5JVDF 3RT7A 4D42A 4R68A 1RHKA 2JGFA 2WMDA 2A67A 4LZWA 2BELA 3CTPA 4Z2AA 1FXWA 3DWIA 1QVRA 5IFKA 4PHTA 2O2XA 1WZEA 3DDZX 2QSZA 2J9RA 4MUEA 2UXCM 3GFBA 1PS0A 3KYDB 4U8HA 1RWBA 3FUCA 2OLEA 2HV8A 3JPYA 3GF4A 2HF7A 2W2MA 3JD1A 2D7EA 1QJ4A 2YHBA 3R9WA 3CLTC 1PG0A 3IAM1 4CZ2A 4OA5A 2Y9MB 4D1YA 1FP4B 4YN3A 1FVFA 5AH0A 1GGNA 3V8MA 1AOXA 2XUFA 4NWIA 1FK8A 2QPTA 2K4MA 4I1RA 1R1DA 3GVIA 1QDEA 4IGEA 3L04A 2H2IA 3GRFA 2JI8A 4L27A 2AFHB 4PINA 1NUPA 3AY3A 2Q27A 2GCPA 1NLMA 2AD5A 1H2RS 4J0QA 3EGCA 1I0LA 3A28A 3L0IB 3JR4A 3VR4H 4MVCA 3OKPA 5LMZA 4R0NA 1JECA 4WLVA 4BO5A 2I29A 4PGAA 2WTMA 2R60A 3U13A 4D56A 3J80S 1ZNWA 4UTPA 1OF1A 1FL9A 4WOJA 3GT0A 4PG8A 4K05A 1N0HA 1LF0A 1M0EA 3F9CA 5EWMA 4Z5XA 4YRKA 5HRCA 1QF9A 4MLZA 3ZE6A 2QCUA 2HHCA 5CXXA 2FXVA 3OUUA 4FONA 2BEKA 2MJ5B 3OZAA 3D31A 5I6DA 4EI2A 7AT1A 1R3DA 5AUQA 3A6GA 2F5SA 1X7YB 1NZDA 2XGGA 2OGWA 2H9IA 3EF3A 2AFRA 4I4TA 3NDRA 2YNMD 2JB9A 3PQCA 1RWQA 4X7MA 1G3RA 3GCDA 3Q2OA 1OIXA 3IQXA 3Q9NA 2PL9A 1UMBA 2OAGA 2Y0CA 3TL3A 5EHGA 4L2IA 2IUFA 3BSYA 2NZYA 4BMYA 4O1HA 3Q9UA 5E3JA 4CGZA 1T13A 4BVAA 4N3BA 3QV2A 1NJSA 2AFVA 2PXCA 1JDSA 4F6CA 4Z4HA 2ROQA 1MBZA 1NX9A 1SG6A 5ESRA 5E9AA 1PTJC 5F12A 3NBMA 1PJRA 1Z59A 4DQDA 1BA3A 1V1MA 5KC8A 1KEVA 1ZH2A 1MG0A 2WSIA 2FOLA 3T3MB 1LSSA 3KLPX 5IP5A 3U49A 3ITKA 1S02A 1LTQA 3L41A 1SQ6A 3V1NA 3KV1A 4Q24A 5E95A 4HNRA 3TZKA 2XMRA 5C4MA 1AHNA 3ZIAA 1BWQA 2EFDB 3WGIA 1NAIA 2J4DA 3D3EA 3DV2A 4AP6A 4RHUA 3E05A 1EK1A 2IYUA 1TKRA 2X9GA 1C7YA 4RD1A 4OU4A 3H05A 3ORHA 2P2GA 4RFLA 4J75A 3LO5A 5IT9S 4B3CA 2NPFA 1VJ1A 3NIBA 4IWYA 3WL5A 1AT1A 5DI9A 4TRJA 2QUAA 4ER0A 1M0WA 3H75A 4IIJF 3WB1A 5C51B 3ESYA 2O4CA 1HJPA 1IN4A 4EB6A 3TIIA 2BD0A 4MKRA 1EVYA 3T5MA 2OCKA 1HE4A 1H6DA 1TVEA 1XF9A 2GK4A 4HNQA 5I4BA 4FFLA 1VMAA 1D0SA 2XXBA 3S68A 4QFBA 1AM4D 1RYYA 3MCZA 1PS9A 4ZT4A 2HWUA 2DHDA 5JT1A 1NBEA 1B0AA 3WDMA 3PC7A 2ES4A 2IGBA 5K3OA 2X58A 3FYTA 4KQGA 1QO0A 5JCOA 1I10A 1SUDA 1MABA 2HA7A 3THYB 1XO1A 2KHZA 3ORYA 4EITA 3BD8A 1SQ5A 2HQRA 1ORYB 2CD7A 1ZN7A 5DJ5A 1N2CB 3VPAA 3OKAA 3IMFA 3B7QA 3OLVA 2XKKA 1PEKE 3OICA 1VMKA 1JNYA 2F1HA 4KGVA 4GMFA 3LTNC 3JYHA 4D5GA 4XDHA 2OKGA 3G49A 1U6KA 4K9OA 2CNBA 2VTBA 3RC8A 2OCPA 4ZO7A 3G89A 3HJCA 2BGLA 4HRXA 2DOKA 3ZVMA 2JW5A 2P41A 3MMXA 1A96A 3VLFB 1DC5A 5EYPA 1QRAA 4YV1A 5F5NA 1FU4A 4N9QA 1EMDA 3IQFA 2Y1EA 1N1GA 3BGOS 4U02A 1MO3A 2N1BA 4QDJA 3R5FA 4ONEA 3SGLA 1YDWA 1G9SA 4EO4A 1C1KA 4RDCA 5A3SA 1PD1A 3VNQA 3VR5D 2H1WA 2VHEA 1IN5A 5ELMA 2KA6B 2N1MA 4TTQA 4JLVA 4OOFA 1OC2A 4DG8A 2VDWB 3BTUA 5CH8A 1CQJA 3L7JA 2C00A 5D6NA 5LU9A 3OQNA 3PNBA 3B52X 3LQ4A 1M2WA 3BBLA 3DC7A 2JA2A 4R9RA 2ATXA 1N0UA 1YAJA 2JASA 1JUDA 1T3HA 2D1TA 2YIDA 1BDJA 3LLMA 1EQ2A 4TTJA 5J4VA 5JCZA 1UXJA 3WLOA 2XIJA 4NE7A 3D6FA 3OMWA 2O6LA 1TADA 2V4ZA 1PZXA 5J4KA 3TZHA 2WICA 1EDZA 3CZMA 3IESA 3WRYA 3W6ZA 5AW4A 2DWPA 4LCJA 2REQA 3BHMA 5BN3A 2UVQA 1S8NA 4MS4A 2HNBA 4KYIB 4YP6A 2ASVA 3CKLA 1MH1A 4LF5B 1Y8QA 3LIPA 5BOSA 3BM5A 1FZQA 1PGPA 4HBGA 4Q3OA 3I58A 3HU2A 4Q93A 3CF6E 2J5RA 3HXMA 3STYA 4RFVA 1BW9B 2EVWX 4I1SA 2ANBA 5FUVA 4J0DA 4OBEA 4BPRA 3IV7A 5EPEA 4MLDA 4BMDA 1G7SA 3QWHA 4XWYA 4ID3A 3AM1A 1C9EA 2AL7A 3T0FA 4CKYA 4FIDA 2Y92A 1F06A 3MWDA 4E11A 4PYMA 2KHHA 1V2GA 1VJTA 3NBXX 4ANFA 4Q3AA 3UJAA 4W63A 3DMFA 1JIKA 4BNKA 3PQ2A 4ZVPA 3CE9A 1V16A 2J45A 3HABA 2C9DA 5LIPA 1E6MA 3I3OA 3NBQA 4GH5A 2CHGA 3WG9A 5EPOA 1XL1A 3IPYA 3KXPA 4IVQA 5AD1A 2NVUB 4L5JA 1WWKA 3LECA 1UBHS 3MN1A 3IEXA 4A23A 3LCJA 3BZUA 3TUJC 3JRXA 4QFMA 4F1JA 4RGQA 5EHXA 3H1TA 2QI9C 2OK7A 4NMLA 3LWDA 1F9AA 1L4YA 1FFHA 4GEKA 4L4YA 1N4DA 4MGZE 2HRDA 1Q5PA 3RHTA 5TMEA 3HNRA 1GPJA 4L8WB 2EKKA 4N5HX 3L6EA 4BX3A 2RGOA 2ZYRA 3BWBA 4MQBA 1LDBA 4WKCA 1BH6A 3ADPA 4KRGA 4EUEA 5BNFA 4WFJA 1UZLA 1QK3A 5ICGA 3TPCA 4CRWB 3QPVA 3F1LA 2BI7A 2NU7B 3EQZA 2QAGA 4KZKA 2P9EA 3DOFA 3K5WA 1ESZA 3K9CA 4AJPA 5KKNB 1H6CA 5F3RA 5DHTA 1QG4A 5DMXA 2GNAA 3B6ZA 1Z83A 4Y9DA 2J6BA 3AEXA 2G4LA 1SHKA 5KYYA 2QW1A 1XXHE 2AI3A 1X3LA 5AW6A 3PKIA 2AI2A 6ABPA 4WJZA 1NJFA 4EFKA 1NTOA 3TLKA 2XBLA 4I2VA 1UT6A 2P2LA 3I0NA 1G9TA 3VYUB 3DW1X 1U80A 3GJ8A 3ZLUA 2EXXA 3L6OO 1L4FA 4BNGA 2BMJA 2EW2A 1U5BA 3T54A 5ALOA 4WFQA 1GUYA 1VPTA 3D8LA 1PUJA 2CMDA 3BJZA 2WV9A 3PX3A 1XMQM 5H37D 3GLIA 1I4LD 4AZVA 1N6LA 2NU6B 3C3WA 4BFVA 1JDVA 1O54A 4DQUA 3HWX1 2CMFA 3ZQUA 4QBKA 2PV7A 5BQ5A 3NJ8A 4PLTA 2GBCA 1KFCB 3BHIA 4EG8A 4AULA 5CFOA 4EHFA 1FSGA 2NZVG 4X00A 1VHDA 4G9GA 1KK0A 4OFXA 3N0RA 1QQAA 1E98A 1HSOA 4IXMA 4YLEA 2ZYGA 1YS1X 1DEOA 3KP0E 4R05A 4ZOLA 4KRFA 4QHSA 4WA8A 1Z16A 5A0FA 4D46A 3TPFA 3II6X 4JDPA 3RWBA 1SU6A 2B30A 4ZC1A 3AY6A 1SOAA 3UICA 5DSXA 3A9TA 3PC8A 4DCVA 1FLAA 4R1NA 5UKDA 1PD0A 4B74A 3R5XA 2G9VA 3SQNA 4ZP1A 1N7JA 3MM4A 2WTXA 3U7QB 4AN1A 3FNBA 2Q6IA 2XUPA 1CVRA 1GNRA 1L7PA 3JVDA 1XHLA 2JD0A 1ZEJA 3C45A 2F67A 4EEZA 1LW7A 3AOEA 1M5RA 5TR9A 1L5SA 3I42A 2CL7X 1DWPA 3F9IA 3W2TA 4OHWA 1G5RA 1P2GA 2NO6A 1HGXA 2J9FB 3H9GA 4U3JA 1O03A 3U31A 2VRBA 4L6IA 3HCEA 1NVBA 1AU9A 4HAZA 5CDFA 4GKKM 3EMBA 4XDGA 2OOBA 4GIPA 2EX4A 2QRVA 4GKJB 1Z17A 2JGEA 5LYYA 2IUUA 3I9V1 4ZO9A 3A45A 1BC5A 3KD3A 2VUSA 3TOCA 1QHYA 5IM4A 1G2QA 4L15A 3PUIA 2R1UA 3IYLW 2PL1A 1QKKA 3UK0A 5EKTA 4XRRA 4OYHA 3OOEA 1Q95A 2C7OA 1F4LA 4LVUA 1IWBB 5A6VA 4F8YA 3N6RA 3SYNA 4ES6A 1ATZA 4NU8X 1XFAA 5A71A 1EGHA 4UHFA 2C3UA 4DV5M 1ETUA 4A0FA 4YJ3F 5KYUB 1U2RA 1IHXA 4N48A 1E1RD 4TWZA 2PKRA 4CI9A 5BSTA 1VDMA 3CLRC 1T5DX 3U6CA 5FLKA 4HDKA 4Q7EA 4L5IA 1MOQA 2CLDX 1PJJA 3VGPA 3VR4D 2PGLA 3TTSA 1EE8A 2ZUUA 1YQGA 4M0EA 2A5GA 1CERA 4HYEA 2R4TA 2R8PA 1PAUA 4OPMA 1HV8A 5AUOB 3GFSA 4AVYA 1NQVA 1SKAA 2QG4A 3QPDA 1N5MA 4Y2YA 3SFVA 3RIEA 1A69A 5I8ZA 1RFLA 3LCCA 1FUIA 2IY7A 2C3OA 1R7RA 1K86A 4F06A 2A0UA 3D2LA 1L4UA 5TLSA 4KREA 4WNCA 1W4BA 5CXSA 4U7TB 1PJ4A 1AUQA 3T1QA 3U7FB 2XNSA 4C0QC 3I9JA 2EZ4A 4PS0A 4P3OA 1SD1A 1QTQA 1DKMA 4C43A 1ORIA 1XUOA 2QI9F 3LT5A 3EZGA 2VSOA 5LZ4A 4IZOA 3R8FA 3Q41A 3SJZA 1Q21A 1ADCA 4MXDA 1RWVA 5KX5B 3LPDA 1SIBE 1MOPA 1PNOA 3D7LA 4ARUA 1H5QA 4QOFA 4B7ZA 4JU9A 5EJ8A 2VOJA 3O83A 3SC2B 1JU3A 3TINA 1RRVA 4L9SA 2NT4A 1UDWA 4ND8A 1MQSA 4HDMA 2XYRA 1NXVA 2F59A 4G8JA 5CBPB 3I6MA 2BFEA 4TLEA 1HDEA 1NVGA 4NP6A 3K6JA 3FHTA 1E9DA 3LXMA 4OGKA 1WXIA 1OI4A 2QYSA 4KCGA 4B3BA 5U9CA 4F91B 1U7UA 1U98A 4MR8A 5FWYA 2PGXA 4QBIA 5DEIA 2HRCA 5B4UA 3PUWA 4I1VA 2IKSA 4YALA 5LA6B 3GGGA 3GFFA 3UCFA 5NULA 3ZY4A 1D2MA 1RMTA 3NBFA 4PQRA 3AI2A 3IE2A 1JKFA 4B3RB 3D1VA 4R84A 3JTEA 4I19A 4ITUA 5G4KB 3EXG1 3F4KA 1VG5A 3H8WA 1LI7A 4JT4A 3JYLA 3QX9A 1VE7A 2JIQA 1QO9A 7CATA 1P2SA 4Z3DA 1H1LA 4IFBA 3EUAA 1T91A 4H7KA 4FGWA 4ARBA 4G1BA 4BZXA 3KQNA 3L05A 4Y3UA 1OXKB 1J7KA 1IZYA 3ILHA 1Y6QA 4E4TA 3TR0A 1XJCA 3HDQA 1JHDA 4AMUA 1QFJA 2DFLA 1XCBA 3WGGA 3PLAE 1TR8A 3HCCA 4B7HA 3VVMA 5LQRA 5BP7A 1M1NA 3HKPA 5A4FS 1M9NA 3PC6A 5FA8A 4RZXA 1W73A 4C2BA 4DDMA 3PQ3A 4JC0A 3I1YA 1DEAA 2Y76A 3ETEA 4DV3B 3ROQA 1P62B 4Z4QA 1EUCB 4LVCA 2Y0PA 1X6VA 2OO5A 3K2BA 1E66A 1ZSYA 4B7AA 1LVUA 1SQSA 2XSZA 3KUDA 3MT7A 1YCHA 3IOCA 4L8FA 1QOZA 2R8RA 3LLSA 4QXRA 4U1RA 3NT4A 5IBQA 2JFHA 3AM5A 4RX1A 2CNNA 2HSZA 2WJAA 1ZH8A 3G5UA 1UC9A 4AQ7A 1JQ5A 3QQ5A 2J08A 5EGNA 3ELYA 2VSQA 2OAQ1 5AW9A 4YXWD 1YK0A 4CEHB 3EAGA 3IDFA 4NSOB 3GA5A 4OHKA 3JQEA 2FTKE 2VCYA 4NZNA