3PFIA

2.7 angstrom resolution crystal structure of a probable holliday junction dna helicase (ruvb) from campylobacter jejuni subsp. jejuni nctc 11168 in complex with adenosine-5'-diphosphate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
301
Chain Sequence
LRPSNFDGYIGQESIKKNLNVFIAAAKKRNECLDHILFSGPAGLGKTTLANIISYEMSANIKTTAAPMIEKSGDLAAILTNLSEGDILFIDEIHRLSPAIEEVLYPAMEDYRLAQTIKIDLPKFTLIGATTRAGMLSNPLRDRFGMQFRLEFYKDSELALILQKAALKLNKTCEEKAALEIAKRSRSTPRIALRLLKRVRDFADVNDEEIITEKRANEALNSLGVNELGFDAMDLRYLELLTAAKQKPIGLASIAAALSEDENTIEDVIEPYLLANGYIERTAKGRIASAKSYSALKLNYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.7 Angstrom resolution crystal structure of a probable holliday junction DNA helicase (ruvB) from Campylobacter jejuni subsp. jejuni NCTC 11168 in complex with adenosine-5'-diphosphate
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Hydrolase
molecule keywords Holliday junction ATP-dependent DNA helicase ruvB
total genus 86
structure length 301
sequence length 310
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05491 RuvB_C RuvB C-terminal winged helix domain
A PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain
A PF17864 AAA_lid_4 RuvB AAA lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3pfiA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3pfiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pfiA01
4MRPA 3SBDA 4Z54A 2CW0F 2JRTA 2Z3YA 4R2HA 5G3ZA 2L54A 2VODA 4JBAA 3QJYA 1HEIA 4JK1X 4A0YA 3H3UA 1OIVA 2RV8A 2E87A 3KB2A 4OI1A 2GEDA 5KDOA 2WWYA 2KJQA 2O52A 1UB9A 5LB4A 4OIPF 3TGNA 1Z05A 2B21A 1YLFA 2REXB 1K5DA 1I1SA 2QM3A 1W1WA 1GAJA 2N1BA 2ZYWX 1NG9A 2QENA 3NXSA 4CEIA 3SDZA 3FHZA 3WP0A 4I98B 1P5ZB 2OQRA 5FB2A 1T4GA 4Q01A 4UJ5A 4JVNA 4XWAA 3UANA 5CK5A 1BI3A 3T5XA 1IM2A 2HS5A 4Z1MD 1DAFA 4HLQB 221PA 2TDXA 3LBNA 3RC8A 2H09A 1QVAA 2PZGA 1L4YA 1G4UR 2RKHA 1P72A 1SVWA 1NMXA 3QKUA 4GMDA 4FCWA 5FR2A 3DM5A 1NVMA 1XGSA 4TYWA 3L2CA 2FNPA 1KI6B 5IT5A 1VCOA 1W7AA 3VOEA 1E9FA 3TBKA 4ZI2A 5EE5B 1XDSA 2B0LA 2EFCB 3I8SA 2CJWB 5E7MA 2F9MA 2JJ1A 3B9QA 4UXJA 4D26A 4D25A 3R60A 5LHGA 3R9XA 1FTNA 2XOKA 1KDRA 3TO7A 2X77A 3TUIC 3AVUA 5L3SA 4RS8A 2OFOA 3N2IA 4DHEA 2XJ9A 3QPHA 1CS4C 3REFA 3J81k 3WNCA 3DPLC 1MO3A 3IO5A 4HLUC 4LOAA 1LJ9A 1CEEA 1W5TA 1NSTA 1W4BA 3M8FA 1R7JA 1KIMA 2QG6A 3C8UA 5HKKA 1JQJC 2E1NA 4I02A 2VBCA 5LGNA 4JLAA 4DSUA 1FSEA 3F23A 2ZI5A 2OG2A 3EIEA 3D0SA 2Q3MA 4PC6A 4PHFA 1WBBA 4Q9HA 1R0WA 4G6DA 1W0KD 2Q21A 3ZMDA 1Q1BA 5TY0A 3TUJC 3GLGE 3VLFB 2FEMA 1BOAA 4ZYEA 3MG9A 5P21A 4BE7B 5JWOA 2EFEB 4M21A 1SHZA 3VHXA 4EJSB 3BB1A 2CFXA 3OE7D 2M5WA 1H8ED 4DCSA 4RGRA 3WXMA 4CEJA 4N9IA 2GWHA 1Q12A 4Q7MB 2A5DA 1ZUHA 2MSCB 2FBIA 2IPQX 3PCRB 4GYGA 4Q7LA 4B47A 4AIHA 3AUYA 3CF2A 2QSYA 2R44A 1N5LA 2GXAA 3BY6A 4FWHA 2QTHA 121PA 3P27A 1CTQA 3JSOA 2AXPA 3C41J 4IDNA 4KITB 2ONJA 4HUQB 1Q1HA 1JE8A 1R6BX 2OA4A 2HXYA 2ZRJA 4JLOA 2J0SA 3V7SA 4Q7KA 4UVBA 1RRPA 3FX3A 3OEHA 4LYFA 4C0JA 2QQBA 3WYGA 1FWZA 1ZG1A 4GNKA 4C4PA 3ULQB 2M1BA 1XCVA 3MZHA 4OIOF 1JJVA 2P5LC 2M45A 3IHUA 2LF8A 3QEOA 4FW9A 5H1YA 3BFVA 5ICGA 4BZXA 4TV7A 1Z0KA 2PMHA 2VL7A 4GBMA 2OXRA 2GA2A 5KOYA 2A5FA 1G17A 3DPUA 2I1QA 1E2MA 1G3QA 4FCVA 5JFRA 1VHTA 1MRNA 5BYKA 2L4AA 4HZIA 3C7JA 4HX8A 1A7JA 1KDOA 2J87A 4U5XA 3TQFA 3KJIA 4CEJB 3LAPA 1G3YA 1HKQA 4DSNA 4PAMA 4LLNA 1XCGB 4LCBA 2OQGA 2CWEA 2EWWA 2ZREA 2ZI4A 1KSFX 1KA8A 2QPTA 2BCGY 1T38A 4V0ME 2FE3A 1FL9A 1R8QA 2GCPA 2GXSA 1KI1A 5B30A 1KK1A 1WBDA 2D3WA 3AP1A 2HYDA 3OIYA 2W6JA 3CNNA 2FE4A 4OK5A 4W5HA 3V8JA 1GRRA 1WE2A 1FPQA 5LBQA 2VA8A 4RFSA 3I4PA 1Z6YA 3TKLA 1T8UA 3UKDA 4AKGA 3KLOA 2H17A 1AGRA 3FXQA 2C2HA 1EH7A 3M9AA 4AIKA 1EG7A 2OLKA 3VU9A 3ZN0A 3W6OA 4ZCIA 4AYXA 4WWCA 5AJWA 3I72A 3FDIA 2UZIR 1U5TC 1KAOA 5CVVA 2XOKD 4PQRA 3ZZUA 3IIKA 5H6RA 1J8MF 1YQTA 3H0KA 2P6RA 3U2RA 5L3VA 3FFAA 3SR0A 2VOPA 1J75A 5KNCA 3GLIB 1R22A 2VP2A 2O0YA 1Z28A 4DCUA 4G1UC 4F92B 1P7CA 5FI0B 2IF0A 2QA5A 3CLOA 1II8B 4JLKA 4Q4JA 4HDUA 1PP8F 2FEOA 2CBZA 2XEXA 1PZNA 3ASYA 2GZWA 1V5WA 1X37A 5A0FA 2DFLA 2XAUA 4FMBB 4N0EA 3R20A 4MGZR 2P6UA 3CUEF 2G9WA 2BGCA 3CRRA 4FD2A 2ZNYA 3K1PA 5ELXA 4OJQA 2GESA 1N25A 4RY2A 5F64A 4PHGA 1PLKA 4OHYA 4WCGA 1DAKA 1NMZA 4ESHA 1O3YA 3TSZA 4P31A 2O8FB 2J5PA 4XLPF 1U2RA 4ZDKA 3CZQA 1E4YA 2CMKA 3KZ1E 4LFUA 1KYZA 3CBQA 1OMIA 2Z0MA 3ZP5A 4F93B 1BC8C 2VOOA 2R6DA 2DFIA 1NVVQ 3MCZA 5A2QZ 2GAOA 4D6PA 4EPXA 4BXUA 4RAYA 3KP6A 5FFZA 1NN5A 1IZ1A 2WBLC 5HCNA 1VG0B 3T34A 1VYVA 2FU4A 4LG0B 2XSZD 4S35A 4OJKA 2G7UA 4G94A 1XTQA 1SFUA 4P0TA 1NMYA 2AR7A 2EFDB 3MSXA 1T91A 5DI3B 5FOUA 1RNLA 4JKIA 1XDUA 2GTPA 2OU2A 4HV6A 1OLOA 2QROA 4CVNA 1OPXA 2DW4A 4JYBA 1XX6A 1BYUA 2BC9A 2WJYA 4MYCA 4DLWA 2CYYA 2O8EB 3PENA 2PBRA 1B4AA 1F2UA 3NKVA 2ZI3A 3OF5A 4HLXA 4I4LA 4GOJA 1US8A 2NTYC 4MQVA 4NONA 4OHXA 4DVGA 4BYYA 1EWRA 1SKQA 1TU4A 3NG1A 4E09A 5K5RA 2AKYA 4B71A 3A1UA 2P5SA 4I7HA 2AFIE 2QQEA 3QOPA 4YMSA 2Q9CA 2DPDA 1ZG3A 1E2GA 3A1TA 4TMKA 4QKQA 3G3ZA 1L7VC 2W6IA 2W6JD 1XSVA 3E5UA 5BMZA 1NVVR 2BKUA 1BIBA 1JHFA 2EFWA 2NO7A 3E70C 4FMCB 4LUCA 4O2LA 4WZ6A 4YG2F 1GNQA 1SHKA 2DTRA 5JHUA 2JEOA 2W0SA 3BIFA 5TVKA 4HYEA 2QNRA 4DEXA 5BN3A 1N6OA 2WAYA 1ZM7A 1EFTA 2JLQA 1SXJC 2KKOA 3R9IA 4W5JA 3NWJA 2VXZA 3EC2A 4MUAA 2V3CC 2PZFA 2JIZA 5EZ6B 4KFUA 4YMUA 2FGJA 4CZ2A 2Z43A 3F8BA 2NAZA 2VHTA 3QKSB 4JJZA 4MGKR 2LCFA 4BFVA 1RRCA 4C0KA 1D8JA 3ZLJA 3UMSA 1KI9A 5KSYA 2A3RA 2WTEA 2IYWA 2G83A 3CKLA 5TMPA 3U1DA 1U5TB 4KFCA 2HGCA 3R0JA 1DARA 4IDOA 4KJZA 4TMXA 3K69A 4HDVA 1IXCA 3LX8A 3GFIA 1WMSA 1ZC3A 3IEVA 1YR9A 2J7PA 1NF3A 5EUMA 5K8IA 2VSXA 5TDHA 1XJQA 2RAPA 3CM0A 2STWA 5FUVA 4B09A 3HTUA 1E17A 1KY2A 1JB1A 1DAIA 1OXXK 3A36A 4BLPA 4QBHA 2HJGA 1XXHB 1O3QA 4JLDA 3CO6C 1OSNA 5DHAA 1EH6A 5E1XA 5EE3A 3GVAA 3SS8A 3RS3A 4M1OA 1JNYA 1E9BA 3BAFA 2VBXA 2Y48A 5EQTA 3R6SA 2VSFA 3LRPA 3PUYA 1OB2A 2IS6A 4MH0R 1KO4A 2EW1A 2XZPA 1J9IA 1Z5ZA 4ITRC 4JVLA 4RZUA 2FU5C 3T8RA 2J41A 3IKVA 4D81A 5LEKA 4KA4A 2W2TA 2JATA 4IHTA 1A2BA 1WCV1 3F0TA 4NYJR 3KZZA 5FBWB 3SQXA 3EC1A 4LSGA 5DO9A 1PUJA 2RGNC 1SVKA 3CUQC 4JLBA 4KSBA 3GLGA 5ILSA 1E9CA 2GVDC 4WZAE 4WX9A 1G16A 3THXA 5JI6A 2H92A 2YX4A 4X8HA 5E3HA 3VKHA 3LXXA 5KSPA 2D7DA 1N0UA 5GVSA 1SD4A 1TUIA 4CHUA 2V6CA 2JJ2A 3X1DA 4QRHA 6Q21A 2H18A 3EETA 2ZROA 3MCAA 4B32A 4HAUA 3GF2A 4URXR 2VSOA 3PVSA 3OOPA 3CRQA 5JEDA 1AKEA 2VBZA 4BLRA 4H1UA 3EIQA 2DWQA 2LWIA 3VR5A 3PEYA 2IS1A 2GAAA 2ESNA 2GF0A 3SBEA 1OW3B 1B9NA 1BI2A 2F55A 1MABB 3RKXA 1D8KA 5FL7D 1YO5C 3GEZA 1XXHE 1BMFA 1VG8A 3PJRA 2JLVA 2UZKA 2BIFA 4YDSA 1E2NA 1F2TB 2FOKA 3UMRA 1QHXA 1QZMA 4KI0A 1VTKA 2L01A 1C9KA 1XTRA 1T6SA 2WWXA 2GA8A 2PZEA 1OJLA 3F5FA 2J1LA 4AD9A 1FYKA 3KDSE 1XD2B 2P2LA 3THXB 3N97A 4KNYA 3TIFA 2UWMA 1P9WA 3KKNA 3UXMA 5LRRA 1UJ2A 3ZZTA 2Z6VA 3LAWA 1TU3A 1G8FA 1XZQA 2ODBA 4A1FA 5D3MA 2ZKZA 4K2EA 1T39A 1W0JA 3E6CC 4TSFD 5IT9K 4V0NA 1W36B 3K9NA 2YYZA 2FEZA 4JN6A 1FY7A 3RLFA 1GKUB 1LW7A 3AH8A 1FX7A 4PC7A 5IK2D 3I4LA 3IQXA 5L3GA 4XD7A 1A04A 4EPRA 3RYTC 4BPBA 1Z06A 1ZD1A 3KXIA 4BRUA 3PITA 1S29A 3SZTA 2WWHA 3DOFA 4Q18A 2V9VA 1TTYA 4B35A 5FPYA 3TJZA 2IYYA 4LB6B 3MUFA 3HR7A 1G21E 1RZ4A 1M6NA 1OPCA 5C4GB 1XBTA 1XRJA 4YMWA 1CF7B 1K6OA 2C98A 3DXJF 3EPLA 2EA2A 2Z5UA 4LRTA 3Q9SA 3TOAA 2QE7A 3OAAD 4HV5A 1FZQA 2AX4A 4L5BA 2IWHA 5D4SA 1KKLA 1OIWA 2AKAB 3GJ7A 4JLNA 1QG2A 5LLQA 521PA 5SZHB 2A69F 1E6CA 3AGPA 3T5GA 5BPDA 3GEEA 3AKDA 3I0TA 4WK8F 5FLXZ 4FINA 5B64A 3T1TA 3KQHA 4YXWA 4AY2A 2J0QA 3LFUA 1MR3F 1E9EA 3HSEA 5DE3A 3SQNA 2ZJBA 4P9FA 1GILA 1Z29A 4TWZA 1G18A 2QUZA 1MKMA 2IJLA 2A9KA 3HHHA 2PT5A 3K9HA 4ON0A 1ZC4A 3J81Z 1YRBA 2FFQA 2WZQA 1W48A 4Q5SF 1Z0DA 3I3SR 4PPNA 3EPHA 3F72A 5ED4A 1IQPA 2IYLD 3DKVA 3TK1A 3HYRA 3QNUA 5F9HA 4NZYA 4JLJA 4OBEA 1C1YA 2HT6A 2OO7A 2WWFA 4CF7A 2A5JA 2ZI9A 2CL0X 3BS4A 1KK0A 1K8RA 1Y63A 2BEJA 3D5LA 2R9VA 1OIXA 4OK3A 4CEHB 1MJBA 4ARZA 1FC3A 3B1ZA 4O2RA 1F4KA 4K46A 5D8KB 1XCBA 4KU4A 3RSOA 2FBKA 3ECOA 4R7ZA 5HLIA 821PA 5CYOA 3W8RA 4FX0A 2IS2A 5L3FA 3IWFA 1XWIA 3CX6A 2EJRA 4KXFB 2NPFA 4CYDA 3WRYC 4XWOA 4WXDA 1NKTA 1QHHB 5FL7A 1F60A 1G3SA 4M6YA 3W6KB 1G6OA 2OCPA 4E70A 2VHUA 3WY9A 2OAZA 4DDWA 3IUYA 1R5GA 4ENJA 4S2EA 2ZU0C 5CITA 1RC8A 3H4MA 5DI3A 1F5TA 3EQLF 5AIQA 4HAWA 5TARA 4ACBA 4LV6A 1OFIA 4PAOA 4CO8A 2QP9X 3F8CA 3ZS8A 3GJ4A 5L3SB 1GOTA 3GLIE 3L8YA 2YWEA 1XTSA 3VODA 2UXXA 2BWJA 5ILUA 4TSFA 4ABYA 5FLXK 4LJYA 2Z9OA 3FM3A 3DO6A 1SMTA 5E8GA 2FQ3A 3OFND 2HEIA 1RI7A 1FMLA 3FMPB 5IK2A 3V00A 2ZJAA 3N70A 1FBQA 4V0MA 3MZYA 1UKVY 2HCJB 1FP6A 4LHVA 2CCGA 2WIBA 1STZA 3J81K 1GP2A 2FOLA 2MSDB 2VQSA 1G41A 1N6NA 1KYIA 3AF3A 1USSA 4IHQA 4JVMA 2HKXA 4AVPA 1FZPB 3CR8A 3BPVA 1I4DD 1DBSA 1Q44A 4N0DA 4DLSA 2ODNA 1B59A 3SHFA 2F43A 3PEUA 1XPUA 2XNDD 1MD0A 4JLVA 5FUYA 2EVWX 2IYVA 2PCLA 4US1R 3B1YA 2NO9A 1NJGA 3L9FA 1NLYA 4F7WA 5DN6D 2ZRMA 2WWWA 5EE9A 4E5UA 3CJNA 1CJTC 3KP2A 1J8YF 1X8JA 1YZUA 1ZRHA 1OH8A 4QBFA 3V4FA 2RQPA 1NN3A 3EZFA 4ZPXA 3QI2A 4C2UA 2IS4A 4FX4A 1FOEB 3AF0A 2VE8A 1OXUA 2W2VA 4IOMA 4YXWD 3ZMSA 2OBMA 3C5CA 4ZI3A 1Z0JA 2KWIA 5HOOA 4KICA 1B1BA 2DZOB 2EFOA 2JLRA 2BEOA 1SMYF 3D7MA 2GHIA 1WQ1R 3P1JA 2IBMA 1E1QD 4DCVA 4ZV4A 3WGIA 5BN4A 3WHLA 4TYQA 1J90A 4JJKA 2PJZA 4CEIB 2KIFA 3AVQA 4QGFA 1Z9CA 3RPUA 3OEEA 5HCIA 4W9MC 4ESFA 2NS0A 4XOIA 2XAHA 5D3MB 2BBYA 3F6VA 2FNAA 5CJPA 2QZ4A 3CH4B 3IWZA 2ADUA 2V79A 4WIAA 3TQCA 2WICA 1ESNA 3KP4A 2UVQA 3H86A 3WNDA 2B8TA 5FPKA 3MAJA 1OYWA 1J2JA 4OMZA 4OHZA 4EQ6A 1WRBA 4ESBA 5DD4A 1VTNC 1NY6A 3RAPR 4ZO4A 2IYUA 4BQAA 1ZINA 4BUJA 2IYTA 3CPHA 1G7TA 3QU3A 1FBUA 4LJ7A 1WI9A 4LD5A 2CO5A 1W7PD 3JZMA 1KQ9A 4I81A 1C4OA 3EIHA 1VPLA 2K5UA 3FMIA 3AUXA 4NMMA 3M0EA 1COWA 3GEHA 3IC7A 4IOKA 3GLGB 4MEXF 4RD0A 4LRWA 4UHTA 4MNUA 4N0BA 2JT1A 1DPUA 1II9A 1LB1B 2XAGA 1FUKA 1LY1A 1E69A 3KL4A 1ZVQA 4QHTA 3W6JB 3K09C 2LKCA 3KX2A 3F8FA 4NH0A 5AR1A 3JVUA 4Q9LA 4FT8A 1ZG5A 2XZOA 2D45A 4M1WA 4RD2A 5JRZA 5DV5A 1DAMA 2ZJYA 5ICFA 1O3SA 1QZZA 1R36A 3MJRA 1ZJ6A 3AEZA 8OHMA 4G6QA 1UFMA 1G7CA 3FVQA 4A15A 2W58A 4XVRA 2VRWA 1ZAOA 3BK7A 1OH6A 4HB3A 3AKYA 3IBYA 3K0AB 1XXHA 2JPCA 4KFRA 2XROA 3QPVA 5BN5A 1QPMA 1CGPA 3VKGA 4C0BA 4UV8A 3U6BA 3EPKA 4JZKA 3QBVA 4FWGA 2P5VA 5FR1A 3VR1A 3H3ZA 1CULC 2Y8EA 1EESA 2ZFWA 2RNJA 4KYIB 3N4MA 1U81A 4Z1MA 4LJ4A 2HYIC 3JAMK 4NYJQ 3BFXA 1IN4A 2DAOA 1XMAA 4ZIRB 3DMDA 3TW8B 5FTLA 4IRHA 1MDMA 5LHIA 2BMEA 4A6XA 2J0UB 4EJWA 4DIDA 5AUPB 1YS7A 1TF2A 4M22A 1U90A 2FPLA 2IK8A 1E2JA 5JBQA 4MDFA 4PR0A 1ZNYA 4NYMQ 1T5IA 5TXGA 1YKSA 2VE9A 1CJMA 1HBXG 3OESA 1ZUNB 4HUTA 2XNSA 3KFVA 3KW6A 4H0EA 4L4UA 3K9GA 1R58A 3GFLA 3CNLA 1KAGA 4BHPA 4DQ2A 2F5CA 4ZH4F 2GWRA 5CYVA 1J7KA 1W44A 3NEUA 4A0FA 3HRUA 2ASEA 4NHJA 4JL8A 2ZRBA 3S2WA 4OI4A 3GWZA 2BBSA 4RFVA 3NC1C 4EJUA 3U9GA 2RGGA 4W7SA 4R1HA 2O03A 3K1MA 1E2DA 5HDKA 1D2NA 1XTIA 5ILVA 1TW3A 2DVWB 4HX7A 2GCNA 2YVUA 3A4LA 1W0KA 3IEUA 2RGEA 3Q9LA 4RCZA 2OCYC 2VP6A 2WAXA 2ORWA 3FMRA 3DV8A 3CR7A 1E0AA 1IRGA 1RE0A 1G8PA 3H84A 3WMEA 1TQ6A 1MT0A 5ERIA 1FSHA 1VECA 3NHAA 3QF4B 4R71A 2CEAA 1AGPA 4BHCA 4L18B 1UDWA 4QOSA 4Q1BA 3TO9A 4ON9A 1BM9A 1SVLA 2MC3A 5A2QK 1B0UA 4OHWA 1P4XA 2O5VA 5FL3A 3K0CC 4FN5A 3BJOA 4IRUB 5M04A 1ONVA 5L3DA 4HF2A 1QGPA 3RJPA 3HUGA 2DWOA 2QPOA 4PSAA 2VBYA 1T0JB 2AK3A 3I71A 3BB3A 1ZW6A 5FD5A 3Q7PA 4E03A 2FGKA 2O8DA 5LRSA 1ZCBA 3RS7A 3L7WA 3HU1A 1LDDA 2JGNA 4A92A 3RPQA 1G9XA 2HYGD 3SZPA 3B1XA 3BD9A 3CX8A 2O8BB 5JVTA 1DDNA 5K8LA 1AJEA 3W8NA 4O0MA 2IF2A 4XRFA 3IPXA 1D9XA 1Z6AA 5FTJA 3QG1A 1UF9A 2PX3A 5JJLA 2DK5A 5BXQC 1SZPA 2JTVA 2PBIA 1KSJA 2DYKA 2QQ9A 4OIRF 3HTSB 4ZYDA 1CIPA 1PUIA 4YIFA 3C18A 1S8FA 4RD3A 2FA5A 2BMFA 2O0JA 3CUQB 4MKFA 4IJAA 4LBYA 1AQYA 3BWDD 3AGQA 4TYYA 3K70D 5F1RA 5JS7A 1EFHA 5HR5A 1KI3A 3V7CA 1M1YE 2F1RA 2VP4A 4PAQA 3T1VA 4LJZF 2EFHB 1GM5A 4R79A 2REBA 4TTPA 4DJTA 3A37A 1JQLB 3EYYA 2ZJ2A 2YC4C 2IW5A 4MQBA 3SZRA 4A6EA 1KI8A 3P4XA 1IRFA 4DCTA 5AUNB 5JMTA 3B73A 2DPXA 1NVWQ 5HPYB 3EZ2A 2FSIA 4B3CA 1CF4A 5E18F 5E8IA 4ESVA 3NRVA 4PQYA 3ZN1A 3LXRA 3OIVA 5CB8A 2HJVA 1FT9A 5HZHA 3FOZA 3EZ6A 4Y13A 2BBOA 4B3BA 2OUKA 1E4VA 2WSMA 721PA 5KNDA 5FTKA 1KMHA 1FYLA 2OM2A 1S3SA 1CR1A 1L4UA 3LH5A 2EA4A 3U2QA 2BJWA 2PLRA 2ZS9A 3ADCA 1KO5A 4GZMA 3E5HA 4QHYA 1PUEE 3HSFA 4CYMA 3DMNA 2FPKA 1J99A 1M34E 2K86A 1MKYA 2XB4A 4IF4A 2OE2A 4G5OA 1GXPA 4M0LA 5DI9A 3GD7A 1MO6A 2WJJA 1XTJA 3ND9A 5KHOC 4IOLA 3W34A 4B48A 1BO6A 3AVPA 1R5OA 3B2EA 2ESHA 1OFHA 3HSRA 1FP1D 5EEGA 2A6EF 3ROUA 1W36D 1LDKB 3ECHA 4ASUA 5CDFE 2ACJA 4Q4AB 1TQ2A 3T61A 4KIGA 1OXSC 2WJHA 2IX3A 1Z2CA 2KSQA 5DYIA 2IA2A 3FZVA 4LMYA 3F8NA 1UBFA 3C16C 4LV5B 2IWRA 4FWTA 1ZCAA 2F7SA 1IY0A 2ATVA 3AF4A 3PQCA 3PUZA 4M53A 2FSWA 1GITA 2BMDA 5J5CA 4MTDA 1YS6A 3SJBA 3WE2A 4HLDA 1GIAA 3F21A 2FA9A 2DO7A 2QMEA 2H94A 2F5DA 3GUDA 2E1RA 3B8HA 3LW7A 5H20A 1ZRCA 1RVDA 3RANA 2IEYA 3BE4A 5FBLB 5UKDA 3TKYA 2GCOB 5EXTA 1W4AA 1Z6GA 1F1ZA 1RPZA 4XBFA 3QXSA 3L2OB 1UDXA 5CVUA 2UKDA 1YG2A 3LA3A 5KU1A 1ZM4A 3DKPA 3TAHA 1R5HA 3E5QA 4LJ9A 3B02A 1RYHA 2QMHA 2YINC 3W3ZB 5CYPA 3ADBA 4LHZA 2UXNA 2EV6A 1HH4A 4I1VA 6PAXA 1U9IA 3I92A 1WB9A 2W00A 1IF1A 1DEKA 2Y75A 4DNCA 2NOAA 2VP9A 3GJ3A 2KJCA 4RZXA 3QKRA 4G0NA 3KEQA 3WTSC 3E6BA 2D4HA 1UBCA 1IY1A 2E7WA 1IAQA 3FF5A 3BWGA 4RAZA 4HQEA 2XIGA 4U7BA 4KIBA 3QOFA 4Q66C 2ZR9A 4HAYA 1NLZA 1EFRA 3CRVA 4XVUA 4EGYA 2ISYA 3KLNA 5H6QA 1LS6A 1KU2A 2IW3A 4TLEA 3QSYA 4WVFA 2REOA 2W6ID 3ZYCA 2HDCA 4A2PA 2RGAA 1ZGJA 3WTTC 1JALA 5JJIA 3ERED 1NIJA 3ND8A 3SC3A 2QQAA 3GW2A 2C04A 3NH6A 4FMCF 4HYYA 3T8TA 2PMUA 3Q85A 1MV5A 5FOVA 3L0IB 2A5YB 2QMOA 4MUBA 4KVAA 5FUWA 3CF6R 3EUHA 3CO7C 2ONKA 1T3LA 2QL6A 2JIZD 4PGGA 3LVQE 4CRWB 4D4MA 4F4IA 4B6EA 3X1XA 1S96A 3RTRA 2M30A 1Z6TA 2MLKA 1E0JA 1S1CA 2VHQA 4QFMA 3VQTA 1R5NA 4OMYA 4L9TA 1GL7A 5DCMA 3WTUC 3P9KA 1CR4A 1IW7F 1Q0UA 4D4KA 4AIIA 1NBMD 4HB0A 1U94A 5HVQC 4D0PA 1G8HA 3BJIC 1OFUX 2J7PD 3QF7A 1HE8B 3KZYA 2F1JA 3GJ5A 2WJVA 1WWXA 5KSZA 4BZQA 3AVYA 2K4BA 5E4FA 1UKYA 1ZNZA 2BVNA 2IYZA 5FBRB 3SI7A 2MSEB 4TT3D 4C9BA 4JS0A 5CLSA 4KCGA 2HOEA 3KQUA 1RIFA 1XB4A 2HV8A 3BP8A 1XP8A 2IA0A 1AZSC 1TMKA 4L9NA 2ZE5A 1XCPA 3P32A 4BWYA 2MMCA 2QAGC 3PR1A 2VEDA 5JS8A 1LB2A 2WM9B 4IJMA 2VF7A 5LD2B 3B13B 2O0KA 2ZR0A 4A0XA 4IKEA 4RD6A 4OK6A 3TE6A 1IJEA 1NRJB 2IXEA 3CB4A 3KKMA 3H92A 2FSFA 3MWKA 4UXIA 2E9SA 2GVZC 3UMFA 1BMFD 3RRZA 4JMPA 5D8LB 3VU9B 3ICEA 1OYIA 2G1KA 1CR0A 1IXSB 3GYHX 4GP6A 4L9WA 3L8ZA 3GZ6A 4LJAA 1R1UA 1ZP6A 2N42A 3IIMA 4AWXA 3G0HA 3BROA 5C2JB 4B43A 2CE2X 4DDVA 1BJAA 1KHTA 2W24A 4PSVA 3RVBA 3VNVA 1J0RA 2QM8A 3U3MA 2XTNA 3GFOA 3KTAB 4MYHA 3VFZA 4M9SA 1P60A 3VTKA 1SD6A 1Z07A 3T1BA 2ZEJA 3I59A 2NO1A 4I01A 3VX3A 1UADA 3NVAA 3WYAA 2CXXA 3EA5A 3HOSA 4IW3B 3VMFA 2B92A 2PLFA 2WSSD 4HB4A 5JEEA 2MMGA 1DTSA 2GXUA 5EEHA 3AF1A 1FYMA 1SQ5A 4UNRA 3R9WA 4XLNF 1V43A 3FGNA 2JLSA 1FBSA 5EJEA 1DPRA 4A6DA 5D6FA 4QLCU 4WXRA 4DC9A 4MEYF 1HUQA 4NHOA 2JASA 2ZRDA 4P4SA 4B74A 3HU2A 2G1JA 5KO2A 1SFXA 4JBYA 4CXFA 1TF7A 5L3CA 5C46F 3TGPA 2PX0A 2EB7A 3RS4A 5F3WB 4LI0A 4RD4A 1QDEA 5AJXA 1ANKA 3BH6A 1ESMA 2OEPA 2JJ8A 2QORA 1ZM2A 2H16A 2H7VA 1AKYA 4G8XA 4P33A 2L02A 4O25A 1E3MA 5JR3A 4ZCLA 3EG5A 3THOA 2FN4A 3IO3A 3RRNA 1TNTA 4IVRA 3ABTA 4LHXA 4DEYA 3FXRA 2A30A 3CWQA 1FLIA 5FOSA 5CB6A 4M9XA 2QQ0A 4KN4X 4K81B 4CT5A 4B73A 2GJ9A 1I6XA 2XKPA 1JEDA 3KETA 4LBVA 2YOGA 4ZDIA 2QM7A 2WV0A 2B7BA 2XHKA 1Z83A 2ZRGA 3AQ4A 2VC1A 3EARA 2GEUA 3MJHA 3QQ5A 4Q9KA 4M8NE 5KK1A 3LLMA 2QBYA 4PO8A 4EFLA 2NG1A 3PQJA 2P5TB 4QGGA 2ECKA 2ZYUX 4YFXF 1QF9A 2ZRCA 4QBIA 1ZREA 1OYYA 2FMLA 2C8VA 4NU0A 4ZIRA 3GFJA 4KUMA 1HKTA 2QE7D 3OAAA 4PANA 4MTEA 1EGAA 2ZJOA 3B1VA 3PEWA 4D4JA 1E9RA 1Z47A 2QSZA 1IXZA 4MGRA 4EJOA 2PCJA 4D0GA 621PA 1OR7A 2K27A 3AAFA 2I1VB 5J8CA 1IN5A 1HTWA 3OHMA 1Z6XA 2D1VA 1LF0A 2FSHA 5FUXA 2QRNA 3TR5A 2H6CA 4IVNA 4NYIQ 1WXQA 4A82A 4KDPA 4O3MA 3RS2A 1REPC 2W85A 3U4QA 1NHAA 1VIYA 4JT4A 4BAYA 5HS7A 1AM4D 1NP6A 3LBHA 3WNBA 3AB3A 4IDHA 4NCNA 2R65A 3NQOA 1E1RD 1NSFA 4U00A 2RKOA 3IHLA 5ANRB 2GK6A 2O8XA 5JWRA 2MLGA 5L8VA 4PQFA 2PEZA 5F6FA 2MH9A 1KY3A 3OFNA 2W0MA 2P6TA 1LNWA 2ZE7A 3SNHA 2KIMA 1P75A 3VKWA 3QUSA 4Y0VA 4Y15A 4LV8B 4C30A 2DLLA 3BZ6A 4G5RA 3ZQ6A 2IEZA 1UPTA 2J46A 1YW9A 1N6KA 3WE3A 2NZ8A 1M8PA 3C3WA 3TUZC 3VEPA 2ZE8A 3CF0A 1SD7A 1WA5A 2FJUA 1CLUA 5HDGA 3KQLA 4RSGA 3SYNA 4RKEA 2ZCWA 2QY9A 3IPYA 1PP7U 3ONWA 1UKEA 3AVTA 4AC9A 2WKQA 3I58A 4O5VA 3HPRA 4Q47A 3FHCB 3PEVA 2GILA 1G3WA 1W2GA 4DT1A 3LVRE 2P8TA 3GP8A 1R1VA 5HS9A 2C99A 1E9DA 4MGYR 2DPUA 5JSZB 2VT3A 3BDDA 3ZQ7A 1MJ9A 2RDPA 4HAZA 3LFKA 2GF9A 4A3VB 2ZSBA 2G3YA 2FDCA 4Q4LA 1X3SA 4LHYA 4QXAA 2ZSFA 1U8RA 4ZDJA 4FMDB 3LSTA 4LJ5A 5HKKD 3TQNA 4JKYA 2ZYTX 1JR6A 5ICCA 1GUAA 1L2TA 2HF9A 5EXXA 4LY6A 1QHIA 3QAHA 3MFKA 1B6AA 2KBFA 1OHHD 4L16A 1Q20A 2QN6A 5FH9A 3U7GA 1YR6A 1E79D 3WBJA 2PL3A 5AUQA 2IUTA 2C9CA 3QENA 4WOPA 2QLZA 2OLJA 1QHNA 1GL9B 5AK0A 3CLVA 3NEYA 2R6FA 3A8TA 4A0HA 3LWFA 3V8KA 3ML6A 4XSHA 1XMSA 3DZDA 5FOTA 4RGUA 3TDUC 4OL0A 1JI0A 5DN6A 2VP5A 2A07F 4XSXF 1HE1C 1HY3A 4Z51A 2JLXA 1G8GA 1JXMA 3HU3A 1BH2A 2GJKA 3D31A 1YTYA 4HB2A 3U3JA 4WXCA 1S7AA 1T5LA 2ZRNA 2F6RA 4PPQA 5SZIA 5CJ9A 1JR3E 1KSHA 2R7FA 1GG2A 3SOPA 1COWD 1HURA 1ON1A 2GQQA 4KSCA 2BM1A 2FZ4A 4M73A 2MBFA 4DUGD 4PGHA 3TMKA 3OEHD 1YIOA 4Y17A 3VB2A 1U98A 1X8LA 5EE1A 3W90A 3OEED 4A8JA 4BLQA 4BFYA 3MWLA 1S3GA 5E95A 4TN1A 1PLJA 1XEXA 3FWEA 4KHZA 2PH1A 3L43A 2QP3A 4PPFA 2HQRA 4A0ZA 2Z4SA 3KP5A 2P0EA 2QAGB 1IJFA 1VKJA 2YWFA 5B57C 4HBLA 2OBLA 1M74A 4HW0A 1P4WA 4B2PA 4BFWA 3SU8A 2D2EA 4GSYA 3J80Z 2IT1A 2QAGA 3B6EA 4NPHA 1BS1A 5IRCD 1UBEA 3DL0A 1XD8A 1E9SA 3GXOA 2WPDD 5J6XA 3T1QA 4WA7A 3SFVA 1TF5A 2PMDA 4YLGA 5BW8A 5LD2C 5KPDA 4OQMA 4HF0A 5LGUA 1A2KC 2DFTA 4X8OA 4AYTA 5JHHB 2F9LA 2GKSA 1NKSA 3RKWA 2O6GE 4JQFA 2H1LA 1XCMA 3RRMA 1GFIA 3COAC 4YFKF 3H1TA 4P9UA 5HE9A 2ZSEA 1NNEA 4LC1A 4A36A 2C6YA 2Q9AA 3OIUA 4M1SA 1IUYA 3U44B 1TPZA 3T15A 3A1WA 4TL7A 1CP2A 2WC2A 2OD5A 4KN7X 1N5KA 3AF2A 4AKHA 1MRSA 2DFNA 1ODFA 2AK2A 1E94E 3DQVC 3A1SA 4M1YA 5J4VA 5KTYA 5DNYB 2X19A 4OQNA 4AYWA 3O2PE 2UZ3A 3DEUA 1GVNB 4BLSA 2XRNA 1US8B 4HQMA 4DLYA 3BOSA 2ZQ5A 3KTAA 4HDQB 4DLTA 3E2IA 4P96A 4TMZA 1QNTA 4KO8A 3K09A 3CPJB 4HLUA 1BBYA 4V0KA 1W4MA 4EGZA 1VIAA 2BKEA 4WAUA 2D2WA 1NN0A 1G5RA 3QKSA 2YWHA 3KQNA 4FWIB 4MRNA 4G01B 2GETA 2YNMA 1R8SA 4FHTA 3RWMB 5TV2A 3TVDA 4XWKA 4J0QA 2HKOA 1KKMA 4YIIA 3QPTA 1KK3A 2V54A 3M1IA 5H8WA 3R4KA 2ZS7A 3L82B 3U7FB 4RJLA 2ETHA 3K1JA 1KQ8A 1GWNA 1D8TA 1K6MA 2C9YA 2ZSDA 1QBKC 2VP0A 1G3MA 4Q4HB 2EYQA 1IY2A 4GZLA 1V4RA 2OZEA 2VC0A 4TQUS 1KI6A 2R6GA 2Q0OA 2V1UA 4B8XA 1S0UA 4NYIR 3FMQA 5C4MA 4A6PA 4G7ZF 3ZZ0A 2PMKA 3QPWA 3EX7C 3MWJA 2Q8KA 2RN7A 4V02A 4PPGA 3ZD6A 1EV7A 1TQPA 4UVAA 3AP2A 5FFXA 4B75A 3K0EA 1X1RA 4U7DA 3L0SA 4TYNA 2BM0A 4ILEA 2GEVA 1VHLA 5FD6A 3QU6A 3O8BA 3KJHA 1T6NA 5AUOB 3T12A 2C78A 3LV8A 3TSOA 3RYPA 4URVR 4AD8A 2KIUA 2N46A 2ZI6A 1JJ7A 3F8MA 2XGJA 3U4QB 1H9GA 1P2TA 5HLGA 3DHWC 3I64A 2ISZA 3D8BA 1X1SA 2IYXA 3WMGA 3V8LA 4C0QC 3LA6A 4EM0B 4WZBE 2LKPA 5CVIA 4TQ9A 5KYKA 2PLYA 1HT2E 1I5ZA 1H0MA 1VMAA 2YOFA 1QG4A 5C1BA 3IRRA 2CCKA 2P6NA 4FMDF 1OH7A 3ZD7A 2YHSA 4NCKA 2CCJA 4EJSC 4A0GA 1G5PA 2K02A 1JEEA 1K7AA 5K8UA 4Q1AA 3E6MA 5CVJA 2CNWD 2NGRA 4DLZA 3KJEA 2DT5A 4P55A 1SVOA 1U99A 3KP7A 2AHOA 1DADA 4Q19A 3TVTA 2GA1A 4F91B 1Z0FA 2W84A 4HX4A 4U0VA 1II8A 4RGSA 1KI7A 1LNZA 4Q4JB 4PC2A 2C5LA 3N2EA 1IN8A 4GPTA 5HZKA 4A2WA 1IBRA 4JBXA 4LBZA 1N6PA 421PA 1RFLA 4U88A 3WTVC 5DSZA 4YMTA 2V1DA 1OKRA 1E0KA 1TL7C 2FFBA 2ZUDA 4UNSA 4C0AC 3AVWA 2RGNA 5G40A 4M9ZA 4KBFA 1QHHA 2ZRKA 1VG9B 1UFQA 4HF1A 2IVMA 2FMYA 3TOBA 2CL6X 2PEYA 4GYIA 3A1VA 4HDOB 4UNPA 1YYVA 1XEFA 1QZYA 1Z91A 4B3GA 3J80K 5IF9A 1W46A 5D4RA 3MRSA 3IIJA 3QXXA 5DCMB 4LLGF 4KV9A 2Z4RA 4O6JA 1LEAA 2A3SA 2G77B 1PLLA 2YWGA 4KODA 1FX0B 3IHWA 3KUDA 2XKOA 3VR3A 4DLXA 3BPXA 4G7OF 3RNLA 4D80A 1XMKA 3E3VA 1GXQA 2LKDA 3K2ZA 3BBPA 3K0CA 1U0HC 3WBKA 5IHPA 3GPLA 4D4LA 3RKYA 1KU7A 1KJYA 5J47A 1KOFA 4KFTA 5IT3A 4K8OA 4D2IA 1B9MA 2GXBA 1WKMA 2CG4A 4G5SA 2F3TA 2ZUBA 3GLFE 3R0AA 4ENNA 2I3BA 3D3QA 4HEJA 2H8KA 2VN2A 3G82C 1YFHA 3A4MA 3X1YA 4ARZB 4CICA 1XN7A 5BS6A 2ZRLA 3ETLA 3KUCA 4B3XA 2QGZA 1AS0A 2VF8A 5B58C 3AKCA 5AIPA 3LLUA 4IOJA 1PJRA 2B6HA 5CK4A 1TQ4A 2OFWA 3LX5A 1ZYUA 3I5XA 1SXJE 4HLCA 1S1MA 4DIEA 3K1NA 4GGGA 2PT7A 4OI0A 4R2IA 1Q1QA 3GEIA 1G6NA 5KDDA 4I99A 4UNQA 2ZJ5A 3I53A 3QKRB 3SJAA 3RABA 1GDDA 1L0OC 3IDQA 1EH8A 2A61A 2IUSA 5KPJA 3MD0A 1SULA 1P92A 3B7GA 4LDJA 1UAAA 1BIAA 2OT3B 3CX7A 1LS1A 2JLZA 5D6EA 2LNBA 1ZARA 2QUFA 5AONA 2WJGA 4R98A 3RHFA 4ASUD 5FTMA 1HXDA 3ISPA 3R61A 1A1VA 1E2QA 3QVVA 4B76A 4LYHA 1USTA 4Q1FA 2FFAA 3U61B 1Q1ZA 1G3IA 4RGXA 1GL6A 3FYHA 1FFHA 2IP2A 1YZLA 1Z8FA 2K4JA 4Q1EA 4B34A 4ZKDA 1ZN2A 5JRJA 2CNWA 4YC7A 4RZ3A 4TLAA 2O0HA 2ZPTX 4QGAA 3K70B 4AIJA 2V8OA 3BB4A 2XGXA 3ZDQA 1L8QA 3KP3A 1N5IA 4ZZDA 1P4SA 1XF9A 2QI9C 1B23P 4HZUB 1BN5A 2R6AA 2VH5R 1XEWX 3I32A 1I2MA 3T35A 4DZZA 5JI3E 4HAMA 4EM1A 1VCNA 5AJVB 4EV0A 3QP5A 4FWDA 1TAGA 2XITA 3CONA 1Q3HA 4EFNA 3CH5A 2VLIA 3EPJA 1MH1A 1GRNA 3DZ8A 5TB5A 4BRWA 3BXZA 4Z2YA 3RDPA 2P65A 3CWZA 3GLHB 1E32A 1AK2A 1CKEA 2DWPA 1ZHFA 4AWXB 3FKQA 3U60B 3LQRA 3N5CA 4ZDWA 3KFXA 5J4LA 2V4ZA 5DIFA 3SHWA 4US2R 2HF8A 4AI6A 2Q9BA 1SXJD 3GO5A 2EFQA 1QHYA 1G4DA 2M8EA 5L3BA 3IQWA 3M6AA 4ENMA 2JPBA 3TW4A 4DLVA 1P6XA 2FH5B 3X1ZA 2EV5A 3L09A 2EWVA 4BQSA 4QM7A 4B44A 4DXAA 3FKSD 2WKPA 2Q6TA 5FPSA 3SN6A 4I0BA 3CUQA 2O8DB 1VCIA 1ZRDA 3PUWA 2ANCA 4LK2A 3WMFA 3GQBA 1K79A 4N9HA 2JAQA 4LHWA 5GJVC 4GT1A 2IT0A 3QY0A 1RW4A 2JDIA 2BCJQ 5LB2A 4GFDA 1WDTA 5E17F 2BEKA 1XJ0A 4JT2A 1SXJB 3NHBA 1R2QA 2FX3A 1OH5A 3REGA 2O8BA 5EUQB 2AN9A 2AFHE 1DAEA 4KAXA 3EASA 2HFHA 3IKTA 1ZIOA 4RFSB 3I5YA 3GCGA 5IDVA 2E7XA 2MD5A 1KJZA 2GBLC 1IN6A 4G7HF 2COMA 4M71A 3IKJA 3EYIA 2HTJA 2YR2A 4LJ6A 2BE5F 5EP1A 4F7ZA 4ZYHA 1F48A 4Q4HA 3MGCA 1P2VA 2I4IA 1N0WA 4GCVA 2QWWA 1PV4A 3KKPA 4Z8XA 4ZYGA 4ACAA 2CHQA 1S9DA 5GVRA 3LA2A 1D5VA 2Z5FA 4A4DA 3LQQA 5TRDA 3PUVA 4OQXA 3W5JA 1IHUA 1RRGA 4Q21A 1DELA 3QEJA 5GJWC 1R4AA 5KVRA 3M1EA 2CLSA 2FZLA 4KLNA 2ZUCA 3KXLA 4KYUA 3ZS9A 2QEQA 2VPPA 3Q3JB 2V6JA 2OILA 3ADKA 5K5OA 3BRWD 4NCJA 4LJ8A 2P7VB 4RCYA 1MJAA 1XEXB 1DO0A 1XSDA 3VR4A 4G5GA 1O87A 1DG3A 1VCMA 1P2SA 1XMVA 2VYFA 1KJWA 1D9ZA 1LVGA 1W2HA 4X8LA 3HJNA 2AD5A 4M2LA 3V4RA 2ZI7A 1KDTA 3AP3A 3CZPA 1E2FA 4RB1A 1SKYE 2Q3FA 3I5UA 3FMFA 3WHKA 3HRTA 5F2EA 4PHTA 4E07A 3AVOA 4PC1A 3K0LA 5DUIA 2ATXA 3CNOA 4BFTA 2IXGA 3BOQA 2BOVA 4F38A 1BIFA 4JBWA 3WTXC 1DAGA 1A4RA 2B8WA 3SXYA 1VDZA 2J9RA 4FIDA 1SXJA 4NCIA 2WOJA 1IXRC 2J45A 1C1KA 3JTHA 2OHFA 5BOXA 1Q1EA 4NE2A 1WRJA 4UJ3A 2BBWA 3WP1B 2O3FA 1G8YA 1ZD9A 3QP6A 2DHRA 5K5QA 3FFBA 5GADl 2O8EA 2K7LA 2P4WA 5K1YA 2RB4A 4Q02A 4BH9A 4I2OA 2WOOA 2OCAA 1FNNA 4A9AA 2GJ8A 4PSKA 1T3HA 1MO5A 3ZIAD 3QXHA 2ZNZA 4Q03A 4QC2A 3M4YA 1U3EM 4ETSA 2OZUA 2KJBA 4Q9JA 3T5DA 2BMJA 1G7RA 4C3ZA 1BKDR 2CSOA 4IDPA 3MQ0A 4BASA 1DO2A 2ZBKA 5E1WA 1I1GA 2JSCA 5EXSA 1S9HA 2JDID 2OBNA 3Q8XB 4GDFA 3A4NA 5DUKA 2A6HF 4NBSA 2H5EA 2AWOA 3BJ6A 3P20A 4TL6A 3FTQA 4US0R 5DH9A 5EE0A 3BH7A 4OU0A 3HDTA 4G9YA 2KE5A 4RZ2A 5DISB 4H1VA 5JLJA 1JECA 1R0XA 1LVAA 3MWYW 3K8YA 2QZ8A 4DSOA 3ZVLA 2X0LA 4URYR 1T9HA 4M72A 2HZTA 1U78A 3U7EB 1N6LA 1T3SA 3C4JA 3M7GA 3ZQJA 2QRZA 2OBPA 3K9LA 2CGPA 1Z22A 4UQOA 2FFHA 3LW8A 4I1OA 1W7PB 4IVQA 5H70A 2RC4A 3OIWA 1HSTA 1KDPA 2VTKA 4CW7A 1U0JA 1O3TA 5KDLA 2PFBA 3KE2A 1EX7A 1U8AA 3AV0B 4EVIA 3QXCA 2YU3A 1O57A 5L3RA 4U0WA 4BHBA 1U8ZA 1G20E 4EPTA 1E1RA 1W5SA 4JLPA 4IVPA 4MYTA 4V0OA 4UXHA 4BZPA 4ERNA 4WW0A 4KFSA 4C2TA 4Q00A 1A5TA 1F5NA 2FMXA 1J2XA 2QT1A 3LY5A 2O8FA 1M7HA 3HRMA 2CK3D 2G0TA 4ZCMA 1D6JA 1M2OB 1Z7UA 1ZIPA 2VBWA 1ZU5A 1W47A 2CLDX 2R2AA 4TL8A 4IRGA 4PZJA 3HWSA 1JR3A 3C1DA 1X8KA 1NY5A 2X4HA 1SVSA 1YZKA 3AJIB 3FPAA 2V7QA 4LYJA 1W7PA 4ESJA 2DFKB 3GLFB 4XH9B 4BGDA 4C7OB 4HZUA 2IA1A 1ZM9A 2D62A 1WQ2A 3IL2A 5DLQC 3R8FA 2XASA 3VHLB 2BJVA 1JXSA 2HEOA 3GFPA 4POAA 4AK9A 3P9IA 3GLIA 5EP3A 4L5JA 1EXMA 1Q57A 1Z3IX 2GJSA 1MO4A 4A8JC 2X1VA 2DWZB 2EYUA 4KVGA 3B60A 3C14C 1G3RA 2Y0MA 1AS2A 1AS3A 4OQFA 3RWOA 3RDIA 5LGTA 3F22A 1ZRFA 1FNMA 1NN1A 1XNJA 2IHYA 4N1AA 3MLEA 1ZYRF 3B1WA 1I27A 2WIAA 4RKFA 4HA8A 3GLXA 5EP2A 1UEJA 1D5CA 2YX7A 4LGWA 1SGWA 2DR3A 5LPNA 4WXPA 2NNYA 4GO1A 3QRFF 2ZIAA 4UUVA 3NDPA 4MQ9F 2D74A 4XD7D 3UPUA 2WJIA 2RHDA 2PQ8A 3ZIAA 1N2CE 2W2XA 3LDAA 1E79A 1XD7A 2XAFA 1KU3A 2ZXUA 4UV9A 5J4HA 3RS0A 2DB3A 3SFZA 3LAJA 1XPOA 2OV2A 4II7A 5FOXA 2R7DA 2NZJA 4EUNA 2C96A 2GJAA 1IN7A 1KK2A 4I1SA 4NYMR 4PZLA 4BNCA 4RD1A 5JHGB 1R23A 5DYMA 4EJVA 3NBFA 2JZYA 4A0RA 1FW6A 2GRJA 4N3NA 5KNBA 1E9AA 4EPYA 1XSXA 4M74A 2OSBA 1GKIA 4TYPA 1T98A 1X86B 1J5YA 2F3RA 1KI4A 4DUGA 1RZ3A 2J59A 1GZSA 4TZ6A 3Q5DA 4PFSA 5E7IA 4LLLA 3V4GA 2DK8A 3HIFA 3MEXA 3GJXC 4IRIA 3DP7A 1XGOA 3MAAC 3I62A 2GBLA 1FX0A 4ENKA 2NNNA 2ZMEB 2QTVB 4BFSA 1W49A 2YZ2A 3CRMA 4I09A 2VIIA 2F1HA 4CIDA 4MKGA 2H57A 5LHHA 2ANBA 1UCRA 1S2MA 3W6PA 4D0LB 1VYUA 1MDMB 4M1KA 4EJTA 1MGTA 1FQKA 2ZRAA 1D2MA 2WPDA 4TLBA 3UG7A 2RGVA 3ADDA 1KI2A 2D06A 2GNOA 1AOYA 1Z6RA 3HOTA 2CJWA 2GZDA 3O47A 4P32A 2CHGA 5JCPA 4BECA 3WGHA 4U0YA 1YVDA 4PTLA 3S1AA 2Q3HA 4D0NA 1GSIA 3VFDA 4JL5A 3PG5A 1OF1A 1RJ9B 2G9NA 3ZGXA 2FF4A 4HAVA 1CRQA 3I8XA 4PZYA 5CLQA 3GFTA 4WBSA 3VR2A 2OXCA 2ZU6A 1T2KA 4PO9A 2FXAA 3B78A 2Q0HA 4F4JA 1K78B 2J5XA 1OFTA 2BHRA 3LO5A 4LC0A 1Z1DA 1YZTA 3E5XA 4PDKA 2HLDA 4B3DA 1CBUA 1Q21A 1JAHA 1E2HA 4LX0A 1I2DA 1N0VC 1SFEA 3F6OA 3VNUA 4Z8YA 2IRFG 3WG9A 1LQ1A 3ELKA 4MRRA 1BYIA 4V03A 3TLXA 2FWRA 1JGSA 3WRXC 1ZMXA 4CZZA 3F8TA 1XPRA 1S3JA 4IEIA 4L8GA 1UBGA 1W4CA 3K9TA 3QE0A 3KXKA 2F43B 1R0ZA 1Z08A 1LTQA 2FPMA 5J4YA 3MHVC 1CF7A 2ELHA 3ZMTA 1F2UB 3U6KA 1GNRA 2AWNA 4B33A 3VR6A 4KBGA 1U6GA 2XNDA 2ZETA 4BEBA 4MHGA 3H2YA 1G64A 4IXAA 4OI2A 3GMTA 4QGHA 1AZTA 1ONBA 3TO6A 2QT0A 4DKXA 4RB0A 5GJCA 1H65A 1U2WA 2V1XA 1U8YA 2P3SA 2FG5A 1EFCA 3FMSA 1G1MA 1YE8A 2FV8A 4FI3C 4XSGA 1ZLJA 2WWIA 3O6BB 2X2FA 4PC3A 5IT9Z 5A5GA 3FHTA 1XD9A 3ZVRA 1KQ0A 1YRAA 4M1TA 2Z33A 2WHXA 1Y0UA 5JWHA 1HQYE 3GJ6A 4B2LA 1CRPA 5DD8A 1QZXA 2A7QA 2Q2EA 2V9PA 3PUXA 2P7CB 2QPAA 3FM5A 2JCSA 3ZMZA 2SHKA 5DCFA 5D5XB 4JLMA 4LPKA 5BQ5A 3ZMUA 1K5GA 1JPNA 2GAUA 4WF2A 2ZRHA 3W5IA 1GHCA 5HS8A 1BI0A 2OZ6A 5HLHA 2J5OA 1EX6A 1I4TD 1OT3A 1XMJA 2ORIA 1P62B 2P67A 4MYUA 3TSWA 5J4KA 1C0WA 1E2LA 2CVFA 4UVCA 2G6BA 4Q48A 2ZR7A 1TQMA 3PQKA 5LBIA 2NYXA 3EXAA 4OINF 2CDNA 1RYFA 1KGSA 3ZJYA 3BERA 4WXHA 3ZVMA 1UM8A 1O7LA 5ICEA 2QP4A 3EWAA 5G41A 2V55B 2XVCA 1XTKA 3I1FA 2ZSAA 4ZKEA 4A2QA 1R7RA 5L3EA 5FBQB 4EPWA 4MKHA 4MDEA 2OAQ1 2HCBA 2YV5A 1TQDA 3RRYA 2DZNB 4BFXA 4A2UA 1YZGA 1NVUQ 4LYAA 3FMOB 3VAAA 3TH5A 4EKDA 5K8TA 1II0A 2VT2A 4CDGA 1RKBA 4MKIA 5JECA 2A78A 2XTMA 2EFGA 3QIAA 4XJXA 1Z2AA 3THYB 2XXAB 1D3YA 1AWCA 3I54A 4HOBA 1U5TA 2GCOA 2ZJ8A 2ERXA 3BGWA 2EFPA 2CHVA 2HWVA 4GOKA 2FRHA 4IPAA 4Q5IA 3IRQA 2VONA 3W9YA 1U0LA 2HLDD 3G5UA 3RI4A 1XFAA 4URZR 1KU9A 1P3JA 1QHGA 4BFUA 2DQRA 3ECCA 1JAIA 3NEJA 2R3SA 2ZAOA 3FXUA 4JSYA 3AKEA 4QL3A 3RSLA 1Q22A 1R10A 3UIEA 1CR2A 5FI1B 5FGMA 2FSGA 2HDNB 2NIPA 1P61B 2WMNB 4OQLA 2QGNA 5G3YA 2ZVQX 1DE0A 1TX4B 2R8RA 3DF8A 3LA7A 1IAWA 1E2XA 1GKYA 2AD1A 4OOIA 1G6HA 4MRSA 4KT5C 5JJKA 2ZM5A 2IYQA 2DI3A 2CVHA 2PJPA 2RGDA 1JXOA 1E2KA 2XTZA 4TTRA 2HUPA 3KQKA 4G5QA 4Q7JB 3Q5EA 3PIRA 2WTUA 2ERYA 2KRFA 2ZVPX 5H68A 2BBTA 1QVRA 4S05A 1YW8A 1DAHA 5CIWA 1J59A 1XB2A 2PJRA 4KIFA 1KNQA 3QG5A 1MOZA 3U7HB 1E2IA 1NIPA 1HT1E 2XSZA 1FQJA 3OZXA 1JPJA 4EQQA 3E1SA 4PO1A 4DT1B 3QPUA 4XTCS 2DQLA 1I4LD 3BC1A 5BWMA 4L15A 3BJAA 1E2PA 1XGNA 1OE0A 1P9NA 2HXSA 1PDNC 4DRZA 2DU9A 1R5BA 1P4AA 1WF3A 1SAXA 1DP7P 4QM6A 2ZXJA 3QVUA 1E98A 1P2FA 1PVOA 2XB2A 4YONB 1CU1A 3GJ0A 1TNSA 4UXNA 4L0YB 2M87A 3IGFA 4TT3A 1L3LA 4QBGB 3OV8A 3ZMVA 1LF5A 4JL6A 4EAQA 4M6XA 3WTYC 1KYWA 3Q5FA 1W4RA 1TQIA 3W3AA 4EM2A 3NC0C 5F9FA 2ZRPA 3R7WB 2HT1A 4A5NA 2O8CB 4KYWA 1QBJA 1GNPA 1YZQA 4DSTA 5KSOA 4IXMA 4DLUA 5EXPA 2P6SA 2ZO4A 1RIOH 5FOWA 3R7WA 1OB5A 4GL2A 1FUUA 3J7AO 1DVRA 4Q1DA 1G5TA 2NMVA 3V7RA 2QU8A 4B3FX 3FWYA 1SKYB 1ULYA 1NBME 4QNMA 1HSJA 4GITA 3SJZA 1XMIA 2TMKA 5G53C 5FBVB 3HR8A 1F6BA 4M4SA 3ZPLA 3NTUA 3Q7QA 4QG7A 5DHFA 3E6DA 1YQAA 4IDQA 3X2SA 1KMHB 3U5ZB 3K70C 1TEVA 4HLYA 2J7KA 1E2EA 2NRAC 1QQIA 2Z83A 3EZ7A 5DGXA 2ZJZA 3FHOA 3GLHE 1VG1A 1CJVC 1HV8A 1X6VA 1RUOA 1GRQA 1YZNA 2O8CA 3MFYA 1QO0D 1YHNA 4HAXA 4C0SA 5DDGA 2XAJA 2B7CA 1P73A 4URUR 4C7OA 1ZU4A 2W57A 3FE2A 3BH0A 3PFIA 1UKZA 4CGZA 4QJ4A 2EU8A 5LEJA 4RVCA 1MABA 1E0SA 1NG1A 3TNFA 4DDTA 4GI7A 5J8FA 1OXTA 4B2IA 4UNNA 3RS5A 1DG1G 2RGXA 1HW2A 5BPIA 1FOKA 3S1AB 3AM1A 5HTKA 4LB5A 2A2ZA 1R00A 1KZ7B 1ON2A 1QHSA 2JA1A 1CJKC 3LNCA 4NDZA 4R8HA 4QNRA 3D6TB 4MRVA 3JTGA 5F98A 2L3DA 1F2TA 1AA9A 4P3YA 3C15C 1F9NA 1K78A 4IEEA 2G0NA 3JSPA 2L0XA 5CLLA 1XZPA 1ZH5A 1XEWY 3IILA 3KKOA 4LPSA 1ZGAA 4GXOA 2CQKA 4S04A 1TADA 3UWKA 1Q3TA 1O7FA 1NI3A 2QAJA 2ZITA 1KZGB 3EA0A 4HATA 1TW2A 1P9RA 3DOEA 3MMPA 4F4CA 1LEBA 3U44A 5D5WB 4TTQA 4YDHB 1UEIA 3B9PA 2ZRIA 2NO6A 5L3QA 4IHSA 1V3FA 1GTVA 3B82A 2DBYA 1ZBDA 2J0UA 2F2EA 4IFEA 4P4UA 1FMJA 4TLDA 2F5EA 4MGIR 2BV3A 5JZVA 3TRFA 4A8JB 5TJJA 3FKSA 4NQWA 3V9PA 1ZD8A 2DY1A 5CVRA 1Z0AA 1ETUA 3EW9A 3TR0A 4H9GA 3K0SA 2RVCA 2A5GA 4HUQA 2ORVA 1OV4A 4TL9A 1HKSA 1YJ5A 4JVSB 1KO8A 1VYTA 1HA3A 1ZUIA 4V0LA 1ZLKA 5HE8A 4TMTA 3HP1A 3X1WA 2DCUA 4EPVA 2IA5A 4E22A 2KRKA 5D5UB 1TNDA 1T0HB 1LDJA 4TZ0A 1T0FA 5DEQA 1Z63A 1E99A 1KSGA 4DBLC 2JLYA 1ZM3A 1DS6A 2XXAA 1IONA 3AVXA 4KMUX 1FP2A 2HQNA 4L9JA 2ODEA 1EFUA 4IFBA 1G4AE 5A4JA 4TLCA 4LGMA 1TUEA 4TMVA 3WU1B 3EZ9A 2ZRFA 4EIWA 5C18A 5L3QB 4MA4A 4I0AA 3T0YA 3UK6A 1N6RA 2WVJA 4MITA 2P5KA 2X2EA 2IHBA 3LBIA 2BDTA 3EDPA 2WWGA 2RH5A 2V6IA 2ZE6A 4URWR 4FCTA 2ZMEA 2R6CA 4I1UA 4XVQA 3U3RA 2IYRA 2LDUA 3WTZA 4ZZLA 2JJ2D 1ODDA 4CT4B 2IUUA 5D5VB 3I59B 3REOA 1J70A 2MH2A 4NB5A 1M7BA 2WV9A 5BYJA 4EFMA 2NQ2C 4M9QA 3EAQA 2RGBA 3JVVA 3PXGA 3SYKA 3CPEA 1YW7A 1TBXA 1S8NA 1JHHA 3KJGA 2PI0A 3JZAA 3NIBA 3TAUA 1Z0IA 2RCNA 2ZTSA 3CW2A 3QKTA 1G3UA 2W83A 5JSZA 1OKKD 3UG6A 4Q1CA 1EK0A 2WKRA 3FB4A 3C5HA 2XUBA 2AS5F 1EFRD 1N6HA 4AKIA 1S4QA 4DB4A 3AVVA 4NCHA 2VO1A 4B6FA 4GMXA 3BORA 4AG6A 5GJBA 4QWQA 5CIQA 3RC3A 1H8HA 2FBHA 3ABUA 1RUNA 5FTNA 5HDNA 4LG0A 1CXZA 1ZNWA 3DPTA 3IBGA 3KKQA 4JYCA 2EFNA 3KB1A 4LRSA 1G7SA 4NTZA 2C9OA 2LF7A 3KEOA 3DKWA 4QJ3A 2GXQA 2WMOB 1AQUA 3I61A 2XV4S 3SQWA 4P4SB 5JI2E 1DUXC 1DOAA 1G291 3NBXX 2EV0A 4A12A 5CDFA 3WYFA 3ASZA 1NLFA 1OXVA 2G88A 3F3YA 5EP4A 4BEJA 3QXJA 3RYRA 3E97A 1U9IC 2YC2C 3GFMA 4DB2A 1GVJA 3KCCA 5CM8B 4TQAA 1HW1A 4ASNA 1KMQA 1KO7A 4Q9IA 3T06B 3NBYC 1R1TA 1W0JD 1WSUA 2PG4A 4LK0F 2C77A 4XIGS 2HTSA 2MA3A 3HYIA 1KO1A 3HPQA 1CJUC 1NBMA 2JLWA 1N3BA 5SZJA 3W6NA 1SD5A 2KB0A 2KBEA 1XJCA 4M1MA 5D3QA 4EQ6B 4LK1F 3PV0A 1AIPA 1E96A 5JCZA 3F3XA 3VX4A 1Y3AA 3L0OA 1OHHA 1FP7A 3GJ8A 4IXNA 3U3OA 3JW4A 5AJYA 3HRSA 3BFKA 3NBZC 4AKEA 3WU0A 4OIQF 2QYOA 3HYTA 1BC7C 1G19A 3HHGA 2HYFA 3P7NA 3WODF 1NL3A 1EWQA 5E1ZB 2F1IA 2XX3A 3U3KA 2CK3A 2OAP1 4EMSA 5CJ2A 4LBWA 3QBTA 5E20A 4HI0E 1YU9A 5AJZA 3DEFA 2JLUA 2EWNA 2BV6A 2HR3A 4PXAA 3EWSA 2V7QD 1N5JA 1UHWA 2KI5A 5SZKB 4PHHA 3ZVNA 2AL7A 4DCNA 4KMFA 3RIRA 3DM9B 1S6LA 3WTWC 1RJ9A 4GP7A 4TMWA 2XZLA 2W25A 1KNXA 3K0FB 4YQFA 2GK7A 3GLHA 1XGMA 4G3XA 4LWZA 4DDUA 3JAMZ 1TTTA 5JFGA 1IOZA 2QVOA 4L5IA 3DDCA 1BI1A 3LWNA 2ODWA 2AXNA 4DWJA 3LD9A 3A6PC 2H27A 1ZAKA 4XTRA 4GRAA 2EK5A 1F3OA 3CUOA 4AURA 4PZZA 4KLZA 3SYLA 4LZZA 1XU4A 2CLCX 4P5OA 2YPRA 5BQTA 5CM9C 1MZBA 2XAQA 2OESA 1OKKA 4CEHA 2WSSA 3T1OA 1YR8A 1ZNXA 2C03A 1SVMA 2YOHA 4DLRA 1JR3D 2PEXA 1D2EA 5FFMA 3DVLA 4OHVA 3CTAA 4OYHA 2X8AA 2AXLA 3WGGA 2ZAMA 2CL7X 1FTSA 2IL1A 1WP9A 2NO0A 2J0VA 1H8HD 1N6IA 3P4YA 4A5MA 2F5FA 5FPTA 4U02A 3G73A 2O61A 3QF4A 4OKSA 2ZANA 2G7HA 3P9CA 5B2ZA 2GDJA 3CDHA 3MWMA 1UHMA 2NPIA 3O8DA 3KFWX 4QHSA 1HYQA 3NH9A 2LSOA 1HQCA 3SE0A 2QBYB 3M8EA 3K53A 4L0ZB 2OFXA 4HSEA 3UATA 1TLHB 2C95A 4BFZA 4C0LA 2IXFA 2JJ1D 3O3KA 3O8CA 2E1CA 1BOFA 3O8RA 3THWB 2RHMA 2GXGA 4QJ5A 2PN6A 3R8CA 4Q4AA 1W36C 2Z99A 2OCBA 4YMVA 1KTVA 3THWA 3THYA 3CIOA 1KGDA 5E7JA 2J3EA 2GZHA 1LFDB 2QMUA 2QTFA 2VHJA 5FO5A 5KUTA 2R62A 4GOXA 1M7GA 4L9VA 5LDDC 3K0AA 2YJTD 2ZYVX 2GIVA 1YR7A 2D2FA 4P4TA 2L4MA 1H9TA 4X8MA 4BLOA 2IYSA 4NL4H 4XSZF 4AG5A 2YKGA 5AWFC 4FXPA 4NKRA 4R9UC 4C0HA 3NDBB 1FPMA 1XDBA 1NJFA 4Q4ZF 1G3TA 2YSRA 3L00A 3OE7A 4JSTA 1H8EA 1TEXA 4JIMA 4UKDA 3TDZC 5FPHA 2XJ4A 2V6ZM 4PX9A 1DPFA 2IC5A 3CO5A 3ZH9B 1AN0A 4PCQA 3DFGA 2D7CA 3L0PA 3SJCA 4YFNF 2A68F 1SVIA 2CE7A 1HW5A 3GZ5A 1X3UA 2RGCA 2RMKA 1LV7A 1O3RA 4HZFA 2VHCA 3B85A 1NVXQ 3K0FA 3ICQB 3Q9VA 2FF7A 3SEAA 2GZAA 4RB2C 4RB3C 1ELOA 2H6BA 4BLTA 5J40A 4EDHA 3C7KA 1XD2A 4W5WA 2EQBA 5EZ5A 4D82A 4UNOA 1A82A 1QRAA 4NP6A 4L9SA 3UWOA 4HDCA 1JBKA 3B5JA 3GLFA 1E1QA 4Y0AA 5DYGA 1P6RA 1RRFA 2ZS8A 1P2UA 3A58B 2STTA 1R0YA 3P26A 2BYVE 1S7OA 2DBBA 3GX4X 1T8TA 3Q72A 3CRW1 3I73A 2D1HA 4EJSA
chains in the Genus database with same CATH superfamily
1MVLA 2O3JA 2O2GA 5HF9A 1JQ5A 1QGZA 2REXB 1I1SA 3EOAI 3HGQA 1FVOA 4E2YA 3H5WA 4Z1MD 3UGKA 4ADSG 1NQUA 2YS9A 1SUCA 2ZJPF 4HGNA 2QJRA 1NVMA 3JARB 4IV8A 4DCMA 4QPDA 1LVUA 5AI8A 3G9UA 5E7MA 1VJGA 5LHGA 4J03A 4RS8A 5K51A 2VATA 1PQYA 3DPLC 1MO3A 1RQGA 1YV9A 3CMMA 3F73A 1W5TA 4R54A 1EDOA 3IP7A 3ESWB 1ZZEA 5BWOA 4KEAA 1FFSA 3Q7IA 3VHXA 4IMJB 4B3TM 4EABA 2GWHA 2L42A 4OU5A 2XFSA 3AUYA 3SHVA 3CZ4A 3L7BA 3A1FA 3UN1A 2HXYA 4C0JA 3NT2A 1A6QA 2A94A 4NS4A 5KOYA 1T3TA 1YXMA 1LPQA 2FETA 2WJWA 4WCDA 3N0WA 1KSFX 2QPTA 5COBA 3AP1A 3CNNA 4P82A 3I4PA 5G1PA 2C2HA 2VJCA 1EG7A 2H3EA 4WWCA 2PGNA 2HM7A 2WJ4A 1T5HX 4F92B 5FV7A 3P9RA 1PZNA 3KKLA 3IC5A 4FD2A 3GTMJ 3AR9A 4RHXA 5ELXA 4OJQA 4RY2A 2XVMA 4PHGA 4OHYA 1J25A 1U2RA 4FDVA 4KV7A 2CMKA 3RVLA 1OMIA 3HM2A 3ZP5A 4LW8A 1HL3A 2JD0A 5FWYA 4D6PA 4DCNA 2G7UA 1SFUA 2VNSA 1TWHJ 1VRWA 4PZEA 4J76A 1XDUA 4B2YA 4REOA 3MJ5A 2GCGA 4JYBA 4OL9A 4V2GA 4I4LA 3NBKA 3SF0A 1ZFNA 5K5RA 1V71A 3TTWA 4OWRB 1ZG3A 2WDPA 3H36A 5CNKA 3CMAI 1KDVA 2E5NA 1S2NA 1KXZA 2YJGA 2WAYA 1QU3A 4MVJM 4YH1A 4MUAA 2P9QA 2PZFA 3BD7A 3L2WA 3L92A 1QGDA 4RA6A 4MAAA 4MV7A 1KI9A 1IWPB 3JASB 4P7KA 1IXCA 1ZSYA 1P80A 3K05A 1B8NA 4YCDA 3KPJA 1MFZA 3ND6A 4H7KA 1OWOA 1Z5ZA 4ZEMA 3CX3A 1TA4A 4NYJR 5FBWB 3K8OE 2X9NA 3GLGA 1I1HA 3FPEA 1HRKA 5HUJA 2ZIFA 5J1YA 2W2LD 4BLRA 1IVYA 1H2BA 3EJ6A 3PNTA 4A27A 3IUBA 3L6BA 1DGGA 3CBGA 4HVLA 2GA8A 3DLTA 2J1LA 4N0MA 2X0JA 1DDGA 1UQTA 1U9ZA 2B2XA 1FFAA 1XZQA 5LLDA 4NXNB 3IE1A 1FY7A 1KFJB 4N49A 3H6GA 4PG8A 1WQ4A 1WCIA 1Y33E 3NT5A 2BR3A 2UVPB 4YMWA 1CF7B 2PWYA 3EPLA 4LRTA 4TZKA 2K47A 2CNKA 5FLXZ 4FINA 4YXWA 5DE3A 4DYVA 1KOGA 4MUFA 3WK8A 1Z7WA 4N8EA 3LCCA 3MQ4A 4ZI7F 2EIKH 2A5JA 1Y1RA 1AU9A 1X0XA 4EHHA 5DEIA 1S5PA 1DQZA 5DYTA 4O2RA 1F4KA 5TQ0B 2VWQA 2X1MA 3ECOA 4CLDA 3GEGA 2XAAA 3HZJA 5AIQA 3T3NA 1TKCA 4TWIA 2YWEA 2O0MA 4GH5A 1VQ5I 3MJDA 1Z35A 4LJYA 4EKNB 1RI7A 1TUBB 2HCJB 4NBLA 1V55H 3QP9A 4JVMA 3GMEA 1Q44A 2C59A 1O8CA 3OLZA 1MD0A 5FUYA 1X77A 3H3JA 1NLYA 3O9MA 4EHDA 1NQ5A 1OH8A 3V4FA 2RQPA 4MRMB 4IHKA 3HG7A 3ZMSA 2K7ZA 5HOOA 4WHMA 1WQ1R 4HGRA 2IPMA 2WT4A 1Z9CA 3CZAA 1LPSA 2ME6A 4WIAA 4P5PA 2Y4NA 4MVXA 5TSDA 2IYUA 2GN2A 2ZWPA 1G7TA 3FPSA 3UT0A 3BXXA 1QKIA 1C4OA 1F8FA 2XAGA 4AS3A 4NH0A 1RRKA 2UUOA 4CWAA 5ICFA 3MLAA 4E2WA 1YCFA 3ONDA 3FPHA 3PC8C 3R3YA 1OLXB 2EBHX 2ZFWA 5I48A 3VZSA 1E7RA 2HYIC 3T3MB 2J0UB 4JYMA 1IAVA 1AG9A 4BU0A 1VJTA 4ZPJA 3H5LA 3M9WA 3ZCOA 2DULA 5DK6A 1RBYA 2F1OA 5BNIA 1OZHA 3ZKWA 1IWOA 2MC3A 1XAJA 4OHWA 2FN3A 4OD0A 5FL3A 4R2MA 4IRUB 1ONVA 1PFQA 4H7HA 2WIFA 4GMHA 2BM9A 2EPFA 3QYFA 3W8NA 1Z6AA 5LP6C 3LECA 3UM9A 3HTSB 4DSAA 3Q8GA 1ONPA 4MEBA 3EPRA 4MUYA 1MMFB 3H4VA 1EFHA 1KEUA 1SOAA 5CM2Z 3ZI7A 4RWZA 4RMNA 5EG0B 2M0CA 1RESA 3AB8A 3EZ6A 4G67A 2AOWA 2VCYA 4B6JA 2DA1A 1CR1A 3GAZA 3RNOA 2YV4A 3A6LA 1DGFA 2R7OA 1Z4JA 4CYMA 2K86A 4A8PA 2WJJA 3FJ1A 3E4CA 4B48A 3J7YJ 2ESHA 3OZEA 2HA5A 4Q4AB 1L5NA 1N5OX 4FXOA 4C4OA 2X51A 4ZOCA 4MHOA 1XYVA 4PYKA 2FA9A 2DPHA 2Y1GA 1PR4A 1TCVA 3FVRA 4FQ5A 1HNNA 5AKYA 3RD5A 3O1IC 3MHPA 1FFDA 2UU9M 2Q3LA 2YVKA 4G0NA 2BMVA 5E6RA 4B79A 2R7ZJ 4NDNE 3BWGA 4PLVA 4U7BA 4GZ6A 4HAYA 3DFMA 3QSYA 4A2PA 1ZGJA 1JALA 4F6RA 1NK2P 4FMCF 5LZ8A 2POCA 4MUBA 4F4IA 1FTQA 5KS2A 1ZJJA 3X43A 2KDLA 3GJTA 1GL7A 5DCMA 1IW7F 1JFVA 2R8XA 4J3NA 2PR2A 1U94A 3IS3A 5AJUA 3KZYA 1E18A 3GJ5A 3RUFA 3I28A 1NNI1 3AVYA 2K4BA 1PGYA 3LUGA 3AUSA 3ZJ5A 1VKZA 1GXSA 4IJMA 2DWLA 2HPZA 1JQ3A 1YJXA 1LJ8A 4FDLA 5JXIA 3CB4A 3RYHA 3UMFA 3H9JA 2Y0EA 3GRAA 4H2DA 1CR0A 2JFVA 4L9WA 1TYCA 3G0HA 4P2BA 5IZ4A 2BAGA 1KHTA 3DHNA 1AKHA 2V74B 3KTAB 5HLTA 4P4NA 3OYLA 5JEEA 4CUJA 3R9WA 1OLUA 5I4KA 1JH8A 1V41E 2JASA 3DC2A 1NXWA 1ISGA 2TSYB 5AJXA 3OQNA 3BH6A 2QORA 4DW6A 2H7VA 1ZIXA 4FYWA 1BE1A 2XNCA 2CXSA 4J3FA 1TMGE 2FY8A 1IUPA 4B73A 2ZRGA 1TZJA 2WY7Q 2VNHA 3PQJA 2A05A 1RYYA 4LF9B 2P78A 1ZREA 2QE7D 3ZTTA 4I50A 1IXZA 4YT2A 3QVKA 2DTEA 3OHMA 1H1TA 4EGAA 3HFJA 1VIYA 1X94A 4KZKA 1XN4A 2ZKIA 1NSFA 2V26A 1OAOC 4U4AA 3RG2A 2RI1A 3PFWO 1O5IA 3RSNA 3GRFA 2WP0A 5CFMA 1TPYA 1B00A 3KQLA 2F6CA 4RK7A 1W59A 1UKEA 5CXSA 3AVTA 4EUKA 3WAKA 3FVWA 1T2AA 1I3LA 2P8TA 3B2NA 5JSZB 4BO9A 4W5RA 4A0QA 4OFWA 1KY5A 4X1YA 3DTVA 3O8QB 4Z9YA 5JZSA 3FXMA 4L16A 2XLBA 3CHYA 2GHRA 3A3PA 3TIGA 4WOPA 3LWFA 2OHIA 5BV8A 2D5LA 3TDUC 5F7XA 5E3IA 3TZ6A 5DN6A 3L1UA 4Z51A 4WNAB 3HU3A 1BH2A 3RHZA 3U3JA 3BZWA 3GFFA 5INTA 1KPIA 3OIGA 2IU0A 2YIDA 3W90A 3CDLA 3UICA 2KT0A 3CCVI 4AZTA 5KPRA 4B2PA 5FTWA 4UB8C 4WA7A 4UHKA 1FUYB 2PMDA 3LCRA 4YIHA 1PYGA 3RJ9A 1M34A 2F9LA 2H1LA 2XKBA 3W4KA 4E6PA 2FN7A 4XLFA 2JGRA 3SIPA 3UEOA 3L7IA 1IUYA 1UDCA 1DIRA 1TPZA 3MCWA 1U3CA 3DQVC 4AYWA 3ANMA 5BUSA 1QNTA 3K09A 4EGZA 4J7AA 1NN0A 3WZLA 1WEKA 3NKLA 2PR7A 1QR2A 5FA8A 1KK3A 1FNSA 2YN4A 1CB7A 2HVQA 4ER5A 3RYCA 4C07A 4RJLA 5JHFA 1NZJA 5HSGA 5K0ZA 1LC0A 3MWJA 2GM3A 1VSQA 5AI9A 3IAM6 1DWUA 3RBAA 4Q15A 4MB0A 2DFHA 2Y1OA 1HLPA 2CCKA 1OH7A 4NQZA 1K4TA 3CUUA 1Z7BA 1C7EA 3MK31 2PUBA 4HS9A 4XGQA 3HB4X 3AHJA 5JZBA 4UMVA 1IBRA 1RWPA 2Q6IA 1TL7C 3BM5A 4M9ZA 1QHHA 1HETA 2WIJA 4S1WA 5DCMB 1WUKS 3EVDA 2WYHA 1KS9A 4DLXA 2AJBA 1BQ3A 1GZDA 4XWYA 4YAWA 2AI2A 1U0HC 4D4LA 2OG1A 5K0FA 4IHXA 2R7VA 2H8KA 1WW3A 2CDCA 3R0XA 4XORA 1CJBA 1P7ZA 3EXHB 3IDZA 3PXEA 3K1NA 4D9GA 1G6NA 3E9QA 4I99A 5ESRA 2GNPA 3O9VA 2A61A 2IUSA 3GAMA 3C6MA 4F56A 1ZW1A 3Q0EA 1TK2A 4KXXA 4Y18A 3QVVA 2Y21A 2X4LA 3WLFA 1L5VA 1USTA 4L57A 3AFGA 2JJYA 2ENUA 2QQGA 1UOEA 2ZPTX 1VSVA 1H1LA 1L8QA 2HCTA 1UG2A 2R6AA 3EVEA 1KU0A 4IRXA 1AKHB 1SM4A 5EA2A 1I94B 1SXJD 5B7GA 5K7FA 1FB5A 4CL0A 2FH5B 5EWLB 2EV5A 2Y69H 2GIZA 3CUQA 1U0EA 1K79A 4O4IF 2EZLA 2CUTA 3NPAA 3ACCA 4YJ3A 5LB2A 3V8EA 5E17F 2BEKA 4Z0HO 3GCWA 3NHBA 1MENA 5FV4A 5CA0F 4RFSB 2HFHA 1PYDA 2KDZA 5GPCA 1GD1O 2QWWA 5P8WA 3WL3A 4XLZA 3K0HA 1D5VA 3FETA 5DTEA 1FYFA 3T5BA 1TE2A 4P5DA 2ID9A 4PLZA 2ACKA 2Y99A 1L6RA 4EARA 4LYYA 5A3VA 1IZYA 3IQZA 2JIOA 2G5GX 1KDTA 3N2GB 3SX0A 3HRTA 4QUAA 4HMPA 2CUFA 2J9RA 1F0KA 1IXRC 4LMAA 1QYRA 4F9FA 4LFAM 3FFBA 3HWWA 3TBIA 2CNDA 4ZOLB 5BR4A 4L8WB 1SKBA 4XK8F 2JJ7A 2PH3A 3WNVA 1FTGA 2ZBKA 2OBNA 1F1BA 2FK8A 1HFJA 2A6HF 2AWOA 5E4JA 5DISB 2R1UA 3RFXA 3NHSA 4BJ5C 3EEFA 3LW8A 1O3TA 1R8JA 4EVIA 3JRAA 1IULA 4MKZA 1BA5A 4MPTA 1M7HA 2G0TA 1M2OB 4MO2A 3OYCA 1F0YA 4EEFG 2Q7DA 3K20A 3NBQA 3OZSA 2CLEB 4BGDA 4LXYA 2X5KO 1D2HA 4AY5A 2X0RA 4AK9A 2MINA 2AXEA 1MO4A 2DWZB 2H08A 4MRAA 3E0QA 4D7NA 1V3TA 1KJNA 4OV6B 1Y8QA 1I3NA 2QLTA 3GLXA 1D5CA 5EWMB 3MEQA 3II6X 4UUVA 4XD7D 4MQ9F 4JJEA 2WB4A 1XDZA 2V98A 2FQWA 5KOHA 2FWPA 4IO9F 1IIRA 1ABFA 4J0FA 5F5LA 4NYMR 1IDYA 2BFFA 2OJED 4PYOA 4U2DA 5DFLA 1E3HA 2VYCA 4DMCA 2AO9A 4RK0A 4ZZIA 4EELA 3QLUC 1UP7A 3U1BA 4BFSA 2IV3A 2YZ2A 3QLEA 2W8ZA 1UBLS 3S99A 1N36B 4X95A 3T1HM 3HRKA 1Z6RA 2X13A 4P32A 3UMGA 1PZGA 1RAEA 3JQGA 3ROFA 4BECA 3OLYA 4U0YA 4KLAA 5BMVA 2ZZMA 5JDIA 10MHA 3UAYA 3QUTA 5CLQA 4MS1B 5F2KA 5KVQA 3CFYA 2BHRA 2XE7A 3H11A 3QMMA 5JQGF 4AZFA 4HN2A 4NNOA 1NBIA 4MRRA 1UT8A 1XPRA 4QTUB 3A2NA 1S3JA 4HDNA 4IEIA 1TTPB 5EMLA 2FPMA 2I55A 5D5QA 2B5WA 3E58A 1TA9A 1JX6A 3U7JA 4AU1A 3TO6A 1Y89A 5ALOA 2NZ2A 5KKAA 1EWKA 5LOVB 4LOHA 1WKCA 2QJTA 3IA7A 1EJ6A 2H2DA 4DMUB 2VHVA 1BI0A 1I4TD 2A9PA 4GXRA 2P67A 4DADA 1E2LA 1M5RA 3DULA 4M37A 1MX3A 1QTIA 3AQIA 2BXYA 4A2QA 3N2GA 3PPVA 3QFTA 3FMOB 2PJRB 2QSUA 3K8QA 1V6CA 1FSSA 4D8TA 2GCOA 4ETMA 4DV4B 2QXUA 2C8LA 4MWCA 4KPEC 1JAIA 1YHYA 2MYPA 1J9ZA 2BZSA 5AHOA 3ZGOA 4HWGA 5E38A 2CS3A 2L69A 5KJ1A 3VPHA 5T8KC 2FOXA 2IHTA 4KN5A 5IP7J 1IDN1 4BN5A 4OX9B 2AQFA 2HR1A 4CIXA 1XN1A 4ZAYA 4NABA 1QVRA 1J9EA 1DAHA 3QFFA 3HEAA 2JA6J 3OZXA 1JPJA 2XLCA 3ZCQA 1I9GA 1YDFA 4I9HA 3M9XA 2XB2A 1LSSA 3GPIA 4UXNA 2NSHA 4LCEA 3IXQA 1JLHA 4BE1A 3FLBA 5M3MJ 1PBNA 5KYUB 2JGJA 4E4YA 2IELA 3HY3A 1HSJA 4MV0A 4OP2A 4N54A 1OI4A 2ZK7A 3U5ZB 4RELA 5A62A 1QQIA 3A32A 1CJVC 2O8CA 1UMCB 2OCDA 1LBHA 4B4DA 5CG1A 1IXYA 2HN9A 3RQSA 3WYCA 3S1AB 3HXOA 4KP7A 2QDKA 1BD4A 1PEDA 4PLTA 3KKOA 2CQKA 2L9VA 4HATA 1WJDA 1P9RA 3O4VA 3HKCA 3U44A 4TTQA 2ZT7A 1V3FA 5K5EA 4P4UA 5FCDA 2BV3A 4JP3A 4LWOA 1ZD8A 4HUQA 2Q2VA 4TL9A 1KO8A 3WLEA 5KX5A 1U0GA 2H1OA 1EHCA 2AMFA 1XHLA 4L75A 2IH2A 4LY0A 1Z21A 1EFUA 1TYEB 1ZJYA 3ZNOA 3UK6A 2WVJA 3RJTA 3ENWA 4CNQA 4M9QA 2QX7A 5D5HA 5TEVA 1U80A 2ZTSA 3ZY4A 3ZR8X 1NVMB 3FG9A 2XUBA 3D54D 4RAOA 1QYDA 4ZOQI 2QVLA 3QOXA 4QJ3A 1H5NA 4LRSA 3F71A 3KVOA 1U0NA 5AVXA 3Q11A 1SCBA 5I4BA 3QXJA 5EY5B 2H8RA 3LQ4A 5CM8B 4IO0A 1KMQA 2BISA 3K9FC 1H6DA 4LOKA 3R7SA 1NBMA 5DN9A 3EGDB 4Y33A 3W6NA 3AR8A 1JIKA 1V16A 3O3OB 5ER9A 2YFYA 1RBMA 4PYNA 2B30A 2JS7A 3WGTA 1BRTA 2E5LM 3U3KA 3NYIA 3BXHA 2EWNA 1GG8A 4TMWA 1QYWA 5AKIA 4RTJA 2P40A 4DWJA 1S5LC 1YJAA 2FSVA 3R8XA 4P5OA 3WI7A 4OQQA 4CHTA 2P3QA 4BJ1A 1SOWA 2L2QA 4INPA 4FDUA 4OHVA 2VRBA 1E1LA 2F5FA 2GPAA 3QF4A 3LWZA 2NVOA 3U39A 2B9EA 5IASA 1RXYA 3PGVA 2R92J 5LM3A 4NZMA 4LG3A 1T29A 3D5QA 3CGGA 1C1HA 3SC2B 2OCBA 3UK7A 3OA0A 5JH7B 3BSSA 1H69A 3KKKA 4BX2A 2MSWA 4BQPA 2X6WA 2CWBA 1P0MA 1BAPA 2VUIB 3OE7A 3ESZA 1UPCA 3L0PA 3ZH9B 2D7CA 2IYFA 3R3WA 4NFYA 1Q7TA