3PFIA

2.7 angstrom resolution crystal structure of a probable holliday junction dna helicase (ruvb) from campylobacter jejuni subsp. jejuni nctc 11168 in complex with adenosine-5'-diphosphate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
301
Chain Sequence
LRPSNFDGYIGQESIKKNLNVFIAAAKKRNECLDHILFSGPAGLGKTTLANIISYEMSANIKTTAAPMIEKSGDLAAILTNLSEGDILFIDEIHRLSPAIEEVLYPAMEDYRLAQTIKIDLPKFTLIGATTRAGMLSNPLRDRFGMQFRLEFYKDSELALILQKAALKLNKTCEEKAALEIAKRSRSTPRIALRLLKRVRDFADVNDEEIITEKRANEALNSLGVNELGFDAMDLRYLELLTAAKQKPIGLASIAAALSEDENTIEDVIEPYLLANGYIERTAKGRIASAKSYSALKLNYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvB
publication title 2.7 Angstrom resolution crystal structure of a probable holliday junction DNA helicase (ruvB) from Campylobacter jejuni subsp. jejuni NCTC 11168 in complex with adenosine-5'-diphosphate
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Hydrolase
total genus 86
structure length 301
sequence length 310
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05491 RuvB_C RuvB C-terminal winged helix domain
A PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain
A PF17864 AAA_lid_4 RuvB AAA lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3pfiA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3pfiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pfiA01
4TYYA 3S2WA 4BUJA 1G7TA 4OIPF 4DLSA 5D4RA 1GKYA 2J59A 2Q8KA 2FU4A 4PFSA 2QGNA 3PEUA 4GOXA 4M9XA 3J81k 3E5XA 3WGGA 2BCGY 3BFKA 1G7SA 1Z29A 3SU8A 1BH2A 1AZSC 2PI0A 1NI3A 4HYEA 3QVUA 1RJ9B 1FPMA 4B75A 2GJSA 4M9ZA 4NHOA 3UMSA 1T0FA 3IKTA 3CUOA 2ZJOA 2ZE5A 2D4HA 6PAXA 2JZYA 2F7SA 1PUIA 2OESA 2OAP1 3QXSA 1HEIA 1VCOA 4UJ3A 5E8GA 4P9FA 2QMHA 4YXWA 4LK1F 1ODDA 1KU7A 4MA4A 3LVQE 3AKCA 3SHFA 2GAUA 1GNQA 1VTKA 2QAGC 1X1SA 3GLIE 1JAHA 1L0OC 1YS7A 1D9ZA 3OEHA 4H0EA 2OU2A 3B5JA 1ZG5A 3GX4X 1UADA 2KIMA 3UMRA 2R6DA 3VR5A 3I8XA 4P4SB 3HJNA 1VHTA 2RNJA 4B3CA 3QPUA 4I09A 4RCYA 3LW7A 3K9GA 4AYWA 3LWNA 4RGSA 2BGCA 2UXXA 4LGMA 3E6BA 1FYMA 4DLRA 3HU1A 3OE7D 4BZXA 1Z5ZA 2Z99A 5JHUA 1SAXA 3T06B 4WXDA 4HLUA 2EQBA 221PA 2D7CA 1KYWA 4IDQA 3KCCA 1PP7U 2WAXA 3EC2A 2OFXA 5ANRB 5SZJA 4DRZA 4JLNA 2REXB 4BGDA 3WXMA 2XV4S 3GFLA 3HHGA 1KSHA 2KI5A 1GAJA 3K0FB 3L0SA 3LD9A 5DE3A 2KRFA 5J4VA 2FPMA 1XD7A 4BLRA 2IT0A 3BGWA 4JSTA 4Q9LA 4F38A 5K8LA 1XFAA 2VT2A 4BHBA 2DQLA 4QHSA 3M8EA 4CGZA 1NMXA 4G5SA 3NQOA 4I1VA 4DEXA 3QKUA 3PEWA 2O8EA 2WV0A 4XWAA 3V7SA 2DWOA 4RAZA 3HRTA 1K78A 1XB4A 3HP1A 4LYAA 4DLXA 5KO2A 4MEYF 1LV7A 2A78A 2QROA 1XTQA 3FDIA 3T35A 2V9PA 4HLQB 4TZ6A 1IJFA 2CHVA 2AWNA 3GLIB 4DUGA 2H6BA 1M6NA 4XD7A 4B3GA 3RDIA 4PZZA 4C9BA 1HT1E 1XSDA 4IOMA 5HDGA 2BMEA 3I59B 1T8UA 2GKSA 4URWR 3TO7A 5AUOB 4X8LA 3EARA 1W36D 2ZE7A 4N9HA 3RS7A 3U7FB 2B7BA 4PQRA 3MEXA 1M2OB 2O61A 2FOLA 2ZJYA 4EFMA 5IRCD 3BXZA 5HKKD 3U3MA 1N5IA 1YZGA 4E5UA 2JLZA 5EP2A 4DDWA 4ASNA 4ZYHA 1NHAA 4TYQA 3RRNA 2HEIA 5K8UA 3AVYA 3MWLA 2VP0A 4Q1CA 4UJ5A 2GVDC 3AAFA 1ELOA 5D8KB 2QORA 4LYFA 3VU9B 4EQ6A 1S7OA 2VP9A 1XJCA 1P2UA 4KSCA 2W0SA 1KKLA 1AOYA 4AIKA 5L3VA 1E2PA 4O6JA 4KA4A 1FQJA 1I2DA 3C7KA 2Q3FA 3GD7A 5DI3A 5K8IA 1KJYA 1AGRA 4IDNA 4QRHA 3VKGA 3OV8A 1XD8A 4L5BA 3CO7C 1E0KA 4M6YA 5H6QA 2A69F 3HRUA 1H65A 2IJLA 1NY5A 2ZSEA 3A36A 4ZPXA 3Q72A 4UNRA 4URVR 1YW9A 4MTDA 1NLYA 4PHGA 3SXYA 1YZUA 1KU3A 4OIRF 4YLGA 5DH9A 1WKMA 5F2EA 1XDSA 2ONKA 3VFDA 4HA8A 3LQRA 2D3WA 3IRRA 4L0YB 2IYSA 1Z28A 4FWDA 1JPJA 3R8FA 3KJEA 3K1PA 4OHXA 3X1YA 1GL9B 1NVUQ 4PGGA 4HB2A 1I27A 2Q9CA 1KSFX 4OMYA 3RABA 3EPHA 2XEXA 5KU1A 4CEHB 2HWVA 4V03A 1K5DA 4DQ2A 2NS0A 4BFYA 4KU4A 2C8VA 4NYMQ 5HVQC 3AJIB 2TDXA 1QF9A 1GL7A 3GLGE 1CEEA 3GWZA 3J81K 1MO6A 4A0HA 1TEXA 4IF4A 1J5YA 4M4SA 2F5FA 2KIFA 1WSUA 1FUKA 2IHYA 4TSFA 4BLTA 3I5XA 3F8MA 4RD4A 1WXQA 2HTSA 2QMOA 2XITA 1US8B 2OZUA 3GJ8A 4PSKA 3RYTC 1WP9A 4P32A 2FRHA 3R9IA 4A0GA 2DFIA 2X1VA 5D5VB 1MO3A 1D8JA 1PUJA 4QHYA 1P72A 3ZMUA 4DDUA 4ZV4A 5JFGA 5KSOA 1EFTA 1R6BX 2ATXA 3TW4A 3O8CA 4DVGA 4RB0A 3C41J 1BC8C 4UHTA 2HF8A 5UKDA 3BPXA 4KJZA 3D5LA 2OSBA 3B60A 3KKQA 4R2HA 3J80K 5DN6D 4JKIA 4Q7MB 2GWHA 5BMZA 3ZDQA 4ENMA 2XJ9A 2WSSD 4B6FA 1BM9A 3ABTA 1GM5A 3HYTA 1P9WA 2X77A 4F4JA 3G73A 1G3SA 5J4KA 1TQIA 1Q1EA 2LWIA 2DBYA 4LYJA 1E9DA 2A9KA 1QZMA 4ZZDA 5P21A 2Z4SA 1U0JA 4C3ZA 1OIXA 2X0LA 4P33A 2HEOA 1NL3A 2EV0A 2F3RA 3D31A 2JIZA 3V4RA 2C77A 3KJHA 3NXSA 4RFSB 4DHEA 2FE4A 3W6OA 5K5QA 1KI7A 1Z0DA 4IPAA 2WPDA 3ZQ6A 3ZLJA 4II7A 2VO1A 2VBCA 2Q3HA 2QP9X 1TF5A 4HAYA 3GLGB 1P2SA 1SGWA 1MO5A 4LJ8A 2F5DA 2QQBA 1XD2A 2VHTA 1NVVQ 2ZBKA 4ENNA 3TUJC 5JEDA 1VYTA 1LDJA 3Q85A 3L00A 4US2R 2OFOA 4ILEA 4NYJR 4AIHA 1II0A 2VC0A 1Z0IA 1G18A 5BS6A 4FHTA 1G5RA 4R9UC 4M6XA 1VPLA 1U90A 4ON0A 1N6HA 4EPYA 1W7AA 4KIFA 3I3SR 3RRYA 4BE7B 4PPGA 3WNCA 1F6BA 1W4RA 1YR7A 3HU2A 4P4UA 3C7JA 1SXJC 4IRGA 4B47A 2QSZA 3IPYA 4KUMA 1AQUA 4MKGA 3KQUA 3C18A 3OAAD 2ZSBA 3KTAA 3EPLA 3NG1A 1FP1D 2WHXA 1EH6A 3T8RA 4NYIR 1Q3TA 3EPJA 4ASUD 3U4QB 2J1LA 3Q7PA 5D3MB 3K70D 2J5PA 3A6PC 3O6BB 1CR0A 5EP1A 4EJTA 2IA1A 2Z43A 2COMA 4G7ZF 2PEXA 5L3FA 1ZRFA 5AR1A 4BRUA 4OHVA 3LO5A 2CGPA 3IILA 4ETSA 1R36A 1OT3A 3MJHA 2B0LA 1FBSA 2F9MA 3GLFA 3TOBA 2ELHA 1E2JA 2A6EF 5LB2A 3V7RA 2NQ2C 4LJAA 1USSA 2FN4A 3GEEA 1E1QD 1ZUNB 1KK1A 4OHWA 1QHIA 5HS8A 2XTNA 1WQ1R 4Q7KA 3RS2A 4Q4HA 2W57A 4A0FA 5LPNA 4NU0A 1HTWA 3WTTC 5AONA 1N0VC 5IHPA 3C3WA 2JLUA 2VF8A 5HDNA 2E1RA 4AYTA 3REFA 2O0KA 1JPNA 1Q22A 5G40A 3SFZA 2XASA 2XAGA 4IOJA 1GNRA 4PDKA 4CHUA 4A2WA 1GP2A 5HE8A 5AUPB 1QRAA 3GQBA 3FHTA 1Q0UA 3NC0C 4CW7A 1KJZA 2ZU0C 3X1XA 4Q02A 1UDXA 2ACJA 3V4FA 3CZPA 4IRUB 1E0AA 4HB4A 5ILSA 1Q3HA 4QJ5A 3BPVA 5ICFA 2C95A 2XKPA 4QC2A 1CBUA 1HSTA 2N42A 4TTQA 5FTKA 3A1UA 3HU3A 1TLHB 3E5QA 1JJVA 4MYCA 1BIAA 4EGZA 1TNTA 4OQMA 5GADl 1G64A 2G77B 4B74A 2FF4A 1FQKA 3KKPA 2BKEA 3B02A 1CLUA 2QSYA 1LB1B 2ODNA 1MJ9A 1YU9A 3GJ4A 1YW7A 3EZFA 2ERXA 1FBUA 4PHTA 3ZZ0A 5J47A 2QTFA 2ADUA 1V3FA 1H9GA 2JLQA 3WGHA 4Z51A 2HR3A 1OH6A 3EDPA 3UWKA 4KICA 1R2QA 3IC7A 1A4RA 4WXRA 2OE2A 2ZM5A 2CQKA 3LA3A 1II8B 4DCNA 5B64A 1W49A 2M45A 5FUXA 1GIAA 4Z54A 2MLKA 1BI3A 1HYQA 1NF3A 1R0YA 2PBRA 4FN5A 4TTPA 1S3SA 1LDDA 2H8KA 2J7PD 3Q9LA 4YXWD 1AGPA 3FVQA 5KDOA 5L3QB 1G6OA 3FE2A 1XTKA 4UNPA 4M72A 4P96A 1KO5A 2PZEA 3KFXA 1DAIA 3OEHD 3QF4A 1SVMA 4QFMA 2ZSFA 4EAQA 4RZ3A 3ZGXA 1ZARA 2P6SA 2KIUA 2EFDB 3JVUA 4ACBA 3KLOA 2CHGA 1KI6B 4PO9A 1ZIPA 3GF2A 5D5XB 2RDPA 4AVPA 2PLYA 2GZAA 2VA8A 5EUMA 2D7DA 5JWHA 2B7CA 3HPQA 4YG2F 4NPHA 4GXOA 3QOPA 2CHQA 4ESJA 1DBSA 2F5EA 1GZSA 2YV5A 3L43A 3TRFA 5HS7A 5K5RA 4M53A 1Y0UA 4LK2A 4NCIA 1EFHA 4MGKR 2XAFA 1ZN2A 4XVQA 5KSYA 4B48A 1R0XA 4A0YA 3QVVA 4BLSA 5DYGA 3SR0A 4OHYA 3QBTA 3A1TA 1JR3E 4WZBE 2NYXA 2P5KA 2QRZA 3GFJA 2GBLA 3H86A 3P4YA 1KO8A 2FEMA 2NPFA 1GHCA 1U8YA 3QXCA 2C5LA 2FZ4A 1U5TC 3SYKA 5EP3A 4I4LA 4NCHA 3OFNA 5FOUA 3GXOA 1H9TA 4L9SA 3W3ZB 2FMLA 3K1NA 2O8DA 4M74A 4BNCA 3W6KB 1NP6A 2X2EA 3AF2A 1X8KA 2OZ6A 4N1AA 4XLPF 4Y0VA 4HAMA 4F91B 2VONA 2PH1A 3CM0A 1QGPA 4Q1DA 1TPZA 3QENA 1TU3A 2DLLA 1T0HB 1X6VA 3EQLF 2CK3A 4GOJA 3H2YA 4P31A 1XF9A 1BOAA 2Y48A 1IAWA 1KMHB 3CIOA 4U5XA 4F92B 4IEEA 3GJ0A 4LJYA 5HCIA 1KY2A 4PPQA 3ZMTA 4TMWA 3MLEA 1XTJA 4XD7D 4C0AC 4DUGD 3RI4A 2Q9AA 1ZCBA 2QT1A 5E7IA 2QYOA 1J59A 1FMJA 4TLDA 1JE8A 4Q7JB 2HTJA 4CIDA 3AQ4A 4M1OA 3Q5DA 2QE7A 1IN6A 1R1TA 3N97A 1R4AA 1FZPB 5E3HA 2XGJA 4A6DA 2IS2A 1G3TA 2CL0X 2V7QA 2OQRA 4QBFA 2BMDA 1E1RA 2HOEA 3N2EA 3FFBA 5TVKA 3WHLA 2ZITA 5JVTA 4EQQA 2P2LA 1KYIA 1HQCA 3BJ6A 1E32A 3SBDA 3ZS9A 2AWOA 3GPLA 2J46A 1Z47A 1FW6A 2VOPA 1FY7A 2BBYA 5H6RA 2FGJA 4BZPA 4S2EA 1RPZA 3CUEF 1F4KA 2JPCA 3AVPA 1GWNA 3GMTA 1MDMB 2FA5A 1D9XA 1DO2A 3KKOA 4URXR 2GAAA 2JDID 2GZDA 2YWGA 4LHVA 1Z2AA 1U94A 2A5JA 1OF1A 1JJ7A 2MH9A 2OILA 4YFKF 3SJZA 4RVCA 3V00A 2Z0MA 4OHZA 1F2TA 2ZI7A 3R6SA 3F5FA 4URUR 3A37A 3B9QA 1HUQA 3MGCA 4JVNA 1SD6A 4OK3A 3VHXA 3KX2A 4ZI2A 4HF0A 2UZ3A 4PC3A 4ESFA 2XRNA 3E6MA 2G88A 3WMEA 4QM7A 2GEUA 1YLFA 4PX9A 2EFOA 4U7BA 3MWKA 1ZHFA 3CO6C 2YNMA 3K69A 4DEYA 1J8MF 2D06A 3MWMA 2G3YA 2GEVA 2RGGA 4C0SA 4YFNF 1S29A 2CG4A 2V4ZA 3D3QA 1HSJA 2R6GA 2LF8A 3U3RA 2OAZA 5J4LA 3G0HA 3QKRB 3A1WA 5IT3A 3AEZA 4HB3A 4XJXA 5B2ZA 4L9JA 4BFZA 1YS6A 3NIBA 1KZGB 1FZQA 2E7WA 2QGZA 1DS6A 2V55B 4TSFD 5KDDA 2PLRA 5CK4A 1HKTA 1R22A 1OSNA 4DT1A 5CITA 1NNEA 2A3RA 1NVMA 1E2MA 2QQ9A 1IJEA 2GXUA 2IA5A 4PHHA 4RZ2A 3U5ZB 3G3ZA 1CJVC 1FTSA 4IJMA 4OI2A 1QHGA 5LD2B 2QM8A 3EPKA 2XXAA 4HZUA 3JAMZ 2ZUBA 2CWEA 1V5WA 5E17F 4GMDA 1G3UA 5FI0B 3C8UA 3ZS8A 3MAAC 2ZRBA 2ZRDA 1XEFA 4KI0A 4KBFA 2XB2A 3EZ6A 2Q0HA 1Q57A 2MC3A 4BFVA 1W2GA 1G20E 3L09A 2EFCB 4Q1AA 2C9CA 1COWA 1IZ1A 4QGGA 2IXEA 2R62A 1W7PA 3E2IA 4Q7LA 1OYIA 2ZYUX 3ECCA 1SZPA 1NBME 3NH9A 3TAHA 5JHHB 3VEPA 1I4LD 4IW3B 1SD7A 5IF9A 1D2MA 2QUFA 5FFXA 2IEZA 2AHOA 2JIZD 2UKDA 3DOFA 1F1ZA 2DTRA 2AD5A 4C0LA 4RB1A 2JATA 3OZXA 2YYZA 1G3QA 2R44A 1R7RA 1N5JA 4LRSA 2DFTA 3RKYA 4JLDA 1EV7A 5DHFA 1DARA 5D8LB 3ND8A 4UNOA 3RS4A 1X86B 2WPDD 2VIIA 2LF7A 2Y75A 1VTNC 2D2EA 4HUQA 1ZGAA 4PC2A 2HZTA 4B2PA 1G3WA 2DHRA 3CKLA 5FTNA 4D4LA 1SVLA 3F22A 2Z33A 4PZLA 3KETA 2CCGA 4HI0E 3CF0A 1XMKA 2A5YB 3GFIA 1WA5A 3H4MA 3I8SA 3R9XA 2PG4A 2DVWB 3I71A 1SXJA 3OHMA 2F2EA 2EFGA 3GFTA 5C46F 1UHWA 3HRMA 2QQAA 2JGNA 2EV6A 2V1UA 1Z7UA 2F43B 2YC4C 4XTRA 3VOEA 4JLKA 2P8TA 3CUQB 1YZLA 2ZJ5A 3GZ5A 2CL7X 3UMFA 2HUPA 3KZ1E 4KYIB 2R2AA 1E0SA 3M8FA 2OCYC 1TF7A 3NBFA 4JLVA 1FFHA 4QG7A 1BI0A 1XMSA 2ZYVX 1D2NA 2PCJA 2VODA 2YX7A 3HSRA 4CXFA 1HY3A 3TO9A 5GJWC 1G9XA 2A5FA 2GXAA 4WBSA 1XDUA 2EJRA 3V9PA 3KQKA 4HV5A 2IHBA 3M7GA 2KJBA 2W2TA 4Q1EA 2V54A 2QBYB 3GW2A 3A4LA 3MZHA 4NMMA 5FL3A 3AF3A 2LNBA 1KO7A 2ANBA 3C15C 3MD0A 4NCNA 1W5SA 1BIFA 1KNXA 1UPTA 2AFIE 1KJWA 4V0MA 2QVOA 2VHCA 3B82A 2IWRA 1AQYA 3B78A 1YQAA 3Q5FA 2IF0A 1RFLA 4S04A 3QXXA 4NZYA 4ZDWA 2L3DA 4A92A 1TQ6A 1LNWA 2G1JA 4I7HA 1LF5A 2FOKA 3Q9VA 2WSSA 1G1MA 2PEYA 3TAUA 1JNYA 1NJGA 3K0AB 4G01B 3FMPB 2RH5A 1TW3A 1E9AA 2CVHA 1UEJA 1BJAA 4B6EA 2HYDA 4JYBA 1C9KA 1XEXA 2A30A 5JCZA 3U6BA 3Q8XB 1EK0A 2CJWA 3TSWA 4LV5B 1LTQA 2R8RA 4KITB 1E98A 1KDOA 4FWTA 621PA 3K9LA 2WWXA 1DE0A 3ADKA 3BB3A 3FMFA 4UVAA 2ZCWA 3Q7QA 4CEJB 3BDDA 3BJOA 3RTRA 3WODF 2ZJBA 1JQJC 3CR8A 3JZMA 4A4DA 4BZQA 3T1VA 3CRQA 5F9HA 1N0WA 1EH7A 5TRDA 1U9IC 2ZRFA 1BYUA 1MR3F 1SFUA 3EZ9A 3ML6A 2P6TA 5HLGA 1W36B 2DWQA 2M1BA 4B32A 1L7VC 1TQDA 4JVSB 4MITA 4ZKEA 3GP8A 2J87A 4HDOB 2IXGA 4YONB 1DPUA 4JSYA 3RDPA 3DQVC 4Q4ZF 1F5NA 2K5UA 3AUXA 4Q21A 1Z6TA 3OEEA 4FXPA 2B92A 3WRYC 4A8JB 4C2TA 4EJWA 2WTEA 3THWB 2VTKA 3AP1A 2QI9C 3UIEA 2YSRA 4ZO4A 4BHCA 3QUSA 821PA 4GNKA 3TO6A 3PUVA 4L9VA 2ODWA 4NBSA 2E9SA 3FYHA 2O0HA 3C14C 4K8OA 1CF7B 1AA9A 2QPTA 4BLPA 4DKXA 5JCPA 2C96A 4OKSA 3RS5A 5F64A 2ORVA 4M21A 2J5XA 3RLFA 5ICGA 3GFOA 1CJTC 2VEDA 3FXUA 2ZR0A 1XCPA 3FHCB 3KXLA 1JI0A 5EUQB 2XZPA 2M87A 1JHHA 4U00A 2WWIA 2GJKA 2OBPA 1RW4A 4HYYA 4NCKA 4P4SA 5A5GA 4A6XA 3AP3A 4GMXA 4P5OA 4Q4AA 5BWMA 1AJEA 3CWZA 4XWOA 2VP2A 1G8YA 3EIEA 1R7JA 1RYFA 2FSWA 4EJSB 4FMCB 4M1KA 3NWJA 4Q18A 1T3SA 3QXHA 3WNDA 2FSHA 3ASZA 3L8YA 1U5TA 5LEJA 1GITA 5FBQB 2I1VB 2KSQA 1IN4A 2P4WA 1GSIA 2CCJA 3D8BA 2GJAA 2ZRHA 3I1FA 5AWFC 1NN1A 4G5OA 3TR0A 4P0TA 2G83A 2Z6VA 2W6JD 4GPTA 4LJ6A 4TL6A 5G41A 3KP6A 3FGNA 4GITA 2ASEA 3AKYA 3QKSB 2VBYA 3NRVA 3RYPA 1XCMA 2YOFA 4BFSA 1T6SA 2NGRA 4JJZA 4YMSA 1MD0A 2R65A 3CPEA 4MQBA 4DWJA 3FHZA 2AL7A 3WHKA 2E87A 5JLJA 4LHZA 3KFVA 4TN1A 5CLLA 4ZCLA 3U9GA 1Z6GA 3LLMA 1NY6A 2YOHA 4CT5A 4OQFA 1XZPA 1LB2A 5KSPA 3CX7A 4W9MC 1QHHA 3SHWA 1TUIA 4C7OB 2ZUDA 3BC1A 3EYIA 2ERYA 4DLVA 5D4SA 4DB2A 4L0ZB 1GKIA 3WRXC 1XTSA 1LJ9A 2DT5A 3BOQA 1D6JA 2PT7A 1T3HA 3TLXA 1VCMA 2G7HA 4LG0B 3TDUC 1G17A 4EM2A 2CK3D 1OPXA 4IHQA 2ZXUA 4FIDA 3GLIA 5DD8A 1X8JA 4TV7A 3WE3A 3QJYA 2STWA 1R5HA 1Z07A 3VLFB 3DPTA 4HBLA 1GRQA 2KE5A 2WBLC 3I59A 1GVNB 4Q03A 4QGFA 3ZVRA 3R7WB 1OXUA 4JBAA 4EPRA 3TKYA 2ZRAA 2VBZA 2P5SA 3TQCA 4UVBA 4LHXA 5FR2A 4N0BA 5GJBA 1U6GA 3BZ6A 4EPXA 2QE7D 2ESNA 1MABA 1ZAOA 3THXA 2NMVA 3L8ZA 4TLBA 1KMQA 1V4RA 3ZMSA 1O87A 1XU4A 2GJ8A 2NG1A 2V7QD 4IXNA 4X8HA 3T5GA 4EJUA 1P60A 3LBHA 2EB7A 1E1RD 3PUWA 5FBVB 3VU9A 1PVOA 5C4MA 2WJJA 4AC9A 4R1HA 2GZHA 2J7PA 2ZJ8A 2QN6A 3VFZA 2H16A 3LVRE 3O8BA 1WBBA 3BFVA 3R8CA 2QTHA 2A6HF 2QLZA 5E20A 4NONA 4PC6A 5CYOA 1KNQA 3PIRA 1Z1DA 4GT1A 1WMSA 4CYDA 4NP6A 2X4HA 4IEIA 4PC7A 4G5QA 4M22A 2ZQ5A 2V1DA 4WAUA 4I1SA 2J0UA 1DDNA 3FXQA 4HAWA 4LPSA 4WWCA 4DLTA 3EIHA 3FMRA 1N6KA 4G3XA 3X1ZA 3QAHA 3WU1B 1KQ9A 1ZREA 1ZCAA 2GCOA 1L8QA 2ANCA 4QM6A 1G8PA 4FW9A 4A0ZA 1Z08A 3DM9B 1IN5A 3DL0A 2E1NA 2GVZC 3LA6A 4M9QA 3DF8A 5HZKA 4FX4A 2G9WA 1G41A 1R1VA 3CRMA 2RKHA 4RB2C 1NLFA 1P73A 5AJVB 2YVUA 3T1QA 1X8LA 2OT3B 2RGNA 4POAA 3COAC 2KBFA 4TL8A 4XSXF 4FINA 3F8FA 4F7ZA 1N6NA 1KU2A 3CH5A 2RGEA 2ZRNA 4JVMA 2BBTA 4ZDKA 1M7GA 2YWFA 2FF7A 2ZR7A 2ZS8A 2ZI9A 5IDVA 3SQWA 4CEIA 3KUDA 1ZUIA 3KJIA 5FL7A 1Z6RA 3DKVA 3S1AA 1E4VA 1VYVA 4ENJA 4JIMA 4O0MA 4MDEA 4Z8XA 5BQTA 5SZHB 3V8LA 2R6FA 4BEJA 2OHFA 2VT3A 3EZ7A 2IS4A 3SI7A 4KDPA 3PV0A 4M1YA 2G7UA 3KP4A 3ND9A 1XPRA 2FBKA 1OR7A 2OXCA 5JWOA 2PCLA 1S4QA 3OIYA 1QG4A 2RGVA 2AR7A 1XJQA 3KKNA 3M4YA 4JL5A 1IY1A 2ZS7A 4I0AA 1KI4A 3KDSE 3RIRA 2P6NA 4ON9A 2RHMA 4JT4A 3B1ZA 2YPRA 2QL6A 3TDZC 3CNNA 1COWD 5LD2C 2IYTA 3KE2A 4AKGA 1GILA 2OO7A 2WSMA 4LX0A 4M1WA 2YR2A 1W7PD 4NH0A 4Z1MD 3ERED 4US0R 4NE2A 1CJUC 4O5VA 2ZO4A 1E69A 3U44B 1VDZA 3UK6A 3P9KA 1ZNWA 2O8DB 1KDPA 4I1OA 1F2UA 2BVNA 2MMCA 2XX3A 1BI2A 2AS5F 1BBYA 4LGWA 3ZP5A 3ZH9B 1ZRDA 3MCAA 5BN5A 5CDFA 5SZIA 1LW7A 1CIPA 1IQPA 2QG6A 5AIQA 2UZKA 4OK5A 1R58A 1CJMA 3DPLC 2FPLA 3ZN0A 1W4BA 2JDIA 1Q21A 2MSDB 2OLJA 4G1UC 5HTKA 3SS8A 1MKMA 4RJLA 1OB5A 2Q2EA 3V7CA 5IT9K 2BEJA 1XCVA 3LA7A 2FSGA 4YMUA 2YHSA 4BLOA 1P6XA 3I64A 2N46A 4IKEA 2DZOB 4K2EA 3WTXC 4OQNA 5AIPA 2ZMEA 3WYAA 5A2QZ 1JALA 1SXJD 5E7MA 5EE0A 2ZAOA 1UCRA 3EC1A 3LLUA 1QVAA 5JI3E 2O8CB 3Q5EA 1NG9A 1EFCA 1MOZA 5TMPA 3F21A 2R9VA 1I5ZA 1D3YA 1I6XA 5F98A 1F48A 2ZAMA 1KO4A 1GDDA 3ZMZA 5E1XA 1ZC4A 1UM8A 4EKDA 4HDVA 2REBA 4NYIQ 1IN8A 5FOWA 4PZJA 1UHMA 2L02A 3GLHA 5LGNA 2VHJA 4XVUA 5FBLB 4TLEA 5FBWB 2FBHA 3UWOA 2AKYA 4JL8A 2VBWA 1MT0A 3ZVMA 4UNSA 3IQWA 2QQ0A 3FHOA 2GCPA 4L9NA 5FLXZ 1TQ2A 3VR2A 2BBSA 3AVUA 3HSFA 5TB5A 1UB9A 2CO5A 2HT6A 1DUXC 1JAIA 4E70A 3CUQC 1OXSC 3KP3A 3FMQA 3ZPLA 1Q1ZA 3KXKA 4Q4LA 5BXQC 1G4DA 3G5UA 4GGGA 4ZIRA 3U4QA 5D6FA 4EV0A 2OQGA 1AKYA 2J41A 4ARZA 1AM4D 4DLZA 5BPDA 1ZLJA 4HUTA 5JBQA 3TSZA 3IIJA 1XZQA 4AIJA 1ZD8A 2BWJA 3VX4A 2WWHA 4EMSA 4QJ4A 4GI7A 1L4UA 2C04A 1JB1A 2P67A 3EW9A 4GYGA 2L01A 2EWVA 4BASA 4KLNA 3JSPA 1BKDR 4MYTA 1YR8A 3QP5A 4TLCA 2PMKA 3WTZA 3GEHA 4UKDA 2O8EB 1XX6A 3G82C 4ACAA 1KO1A 1R5GA 3GJ6A 5FUWA 4Q9HA 4M1MA 2QM7A 4NCJA 3D6TB 1K78B 3GLXA 2IYVA 4C0JA 1DG3A 1XNJA 3I4PA 2GDJA 4Q4JA 2C9OA 1WCV1 1SVOA 1KSGA 2BV6A 2STTA 1EGAA 1HT2E 1BI1A 1OFIA 1S6LA 5EP4A 5TJJA 3L2CA 1N6OA 2YC2C 3EZ2A 3LRPA 4Q00A 4US1R 3ECOA 3BERA 3OIVA 5TXGA 4QJ3A 3T0YA 2IF2A 4QBIA 3T61A 1KI8A 5KTYA 3V8JA 4IHTA 3PUZA 2ZR9A 5GJCA 1SD5A 4WOPA 4PAQA 1RZ4A 4DNCA 5CVRA 1Z0JA 3QG5A 3UPUA 2Z3YA 1ZVQA 4KAXA 4FWGA 3BBPA 2IYYA 3VKHA 1IXZA 1A82A 4DIEA 3FXRA 3KQNA 3F6OA 4RSGA 3ABUA 3OEED 1DEKA 4G5RA 1NN3A 4JLOA 2IK8A 4KBGA 3DMNA 2UVQA 3W8RA 2O0JA 4DSNA 1U8ZA 4EQ6B 4LB6B 1W36C 1B1BA 1E9BA 1IM2A 1HW2A 2V79A 3D7MA 3O47A 3MAJA 4A12A 1II8A 1X3UA 3GFPA 2DFKB 3OIWA 1B4AA 1CULC 2GXSA 3DEFA 2ZEJA 1G8FA 4A8JC 1ANKA 3W5IA 4UUVA 4O2LA 1GTVA 4AY2A 2QRNA 4C30A 1JQLB 1K6MA 4LUCA 2IYWA 3K1JA 2Y0MA 1DVRA 2FFAA 4BFWA 4EDHA 4YC7A 3BAFA 2ZXJA 3TE6A 2BYVE 1NKSA 4BPBA 4HLYA 4OJQA 2OD5A 4Q66C 3ADBA 2GEDA 4FWHA 2FMYA 3RYRA 1LNZA 1P2VA 1SQ5A 2HKXA 1FNMA 4TMXA 1T98A 4I02A 1G6HA 3H3ZA 1OH7A 4AWXA 3FX3A 1OXTA 1P62B 4ESHA 1XMIA 3ECHA 1QNTA 1R8QA 3P32A 1RRCA 2NOAA 2XJ4A 3EASA 1I2MA 1C4OA 5FFMA 2NZJA 1D8KA 2XB4A 3MSXA 5E7JA 2JAQA 3K9NA 3T12A 4EJSC 2GXBA 2BMJA 3KLNA 4FX0A 4KMUX 4TLAA 4ERNA 4R98A 1O7LA 1WB9A 1T38A 2J0QA 1Z06A 2GA2A 1XBTA 1G4AE 4NYMR 1W5TA 4B71A 2O5VA 4LOAA 4NTZA 4OL0A 3U2RA 5FLXK 1LS6A 4QGAA 4E07A 3MFYA 3PENA 3T8TA 2EFWA 2OZEA 4IFBA 3NBZC 3REOA 2ZJ2A 3HR8A 1B0UA 5FH9A 1E9EA 2H92A 4O2RA 4LRWA 4ESBA 1KMHA 5ILUA 1H8EA 3UG7A 4D0NA 3P7NA 1ZGJA 4CZZA 3QPTA 5TV2A 5FOVA 4UQOA 3RPQA 5D6EA 3B1YA 1KI9A 4MYHA 3UG6A 3KQLA 3VR4A 2REOA 2VP5A 4FCVA 4WIAA 1YJ5A 2QAGA 3J7AO 2FH5B 2FSIA 2RQPA 2N1BA 2PL3A 3N5CA 2ODBA 4JLJA 3ZZUA 5EXPA 3AVWA 4URYR 2JLWA 2JA1A 3IKVA 4KT5C 3VHLB 1QBJA 2P6UA 4QXAA 4CRWB 4E22A 2VSFA 3K1MA 1TQ4A 3LY5A 4KFSA 2FEZA 3L0IB 3PQKA 1JHFA 3KUCA 4AI6A 2DO7A 4DZZA 3VKWA 4EGYA 1E79D 5L3DA 4LHYA 4TMZA 2UZIR 3GLFE 1JR3A 3P9CA 4GZMA 1CR4A 1XD2B 1OV4A 4AD8A 3LA2A 3F72A 1U8RA 1E99A 2CW0F 1ZU4A 2B8TA 4Y17A 1G8HA 1G21E 1E2NA 1DTSA 2W00A 3BE4A 1MDMA 5E1ZB 3QNUA 3M9AA 1RI7A 3HPRA 5GJVC 2GXQA 2Q21A 4X8OA 5LLQA 4B35A 4D82A 1DAHA 1I1GA 2E7XA 3K0LA 1BS1A 1S2MA 3A1VA 5KSZA 4GFDA 4OIQF 1S8FA 1NVVR 2OCAA 3N70A 2QA5A 3QU3A 4Q48A 5L3EA 2HCJB 3QBVA 5AJWA 3E5HA 1XMVA 2NTYC 4PXAA 5L3RA 1RC8A 3VR3A 2W6JA 2CYYA 5EE1A 4HEJA 3TVDA 4C0QC 1XPUA 4IXAA 3SQNA 4L16A 1JEDA 1ZNZA 2CMKA 4N3NA 3RHFA 4IVRA 3QSYA 4L18B 4P4TA 1FOKA 2FBIA 4Y0AA 2W84A 2DPXA 4PR0A 5CLSA 1FSHA 1DAEA 1XCGB 1YR6A 3SDZA 4ZCMA 2FJUA 5J40A 3KTAB 2F55A 3L82B 2L54A 5FUVA 4LI0A 3QKRA 5A4JA 1UF9A 1S96A 1W1WA 4DB4A 1CRQA 2NZ8A 1OH8A 1YO5C 1KAOA 5EXTA 5LDDC 2CNWA 4N9IA 2H6CA 1OYYA 5FL7D 1MH1A 2KJQA 3DMDA 3R4KA 3QY0A 4QKQA 4C0BA 3FMIA 4IVNA 2IL1A 3EWAA 3FM3A 1ZJ6A 4LJ5A 3L9FA 3GLFB 1QDEA 2XIGA 4A2UA 2G9NA 3WYFA 2V3CC 1KHTA 2NPIA 2ORIA 5FO5A 5FFZA 1E2XA 1G5PA 4KFUA 2ZFWA 1Y63A 1YHNA 1B59A 1G3IA 2RC4A 1ZD1A 2WJVA 4KCGA 4Q4HB 3B1VA 3LAWA 1IRFA 1IRGA 1E2EA 1L2TA 4DLWA 3IEVA 1AKEA 1ETUA 1CKEA 5K1YA 2OA4A 2C2HA 1Z2CA 3FMOB 5FPTA 1J99A 5SZKB 5HPYB 5DYMA 4X8MA 2RKOA 1LF0A 5HDKA 3QI2A 3AVTA 1XXHA 4HLDA 2FQ3A 3OOPA 5JR3A 1W0JA 3AF4A 4JJKA 1O3QA 1ESNA 3HSEA 1XMJA 1WI9A 4IJAA 5LEKA 2EFPA 3B1XA 5JFRA 4EVIA 1J90A 1FC3A 2JEOA 2QMEA 1CGPA 5JS7A 4V0OA 1LDKB 4MUAA 4LC0A 3LFUA 4M2LA 2I3BA 3SFVA 5JJKA 4DDVA 1J2XA 3SC3A 4FI3C 4JS0A 2IW3A 1BIBA 1REPC 2ECKA 4KVAA 1ODFA 2RV8A 1ZRCA 4JYCA 3LX5A 3U7EB 5JI2E 2V6ZM 2GK6A 2RGCA 2HYIC 4EM1A 2PX0A 1U2WA 1K6OA 5JSZB 5M04A 4G9YA 2IP2A 1AIPA 2DY1A 1A2BA 2OBNA 2OCBA 1P3JA 4FWIB 2NO6A 2XZOA 4CICA 4JVLA 1E96A 4AKEA 2NO1A 1GXPA 3BIFA 3CWQA 3F8BA 5HZHA 2OLKA 1OJLA 1C0WA 3A1SA 4JL6A 3A4NA 3PJRA 1KK3A 4IRIA 1RKBA 4J0QA 2H17A 3RWOA 4U7DA 4AG6A 4A15A 1NSTA 1TTYA 1S0UA 3SEAA 1JXSA 2GF0A 5EQTA 1ZYUA 2QZ4A 1P2TA 3PFIA 4BECA 4U0YA 2XROA 3CRRA 3QF4B 2JLSA 4C2UA 3U7HB 1R1UA 4RGXA 4L8GA 4LV6A 3ROUA 1P2FA 1X37A 2PMUA 1TU4A 1YVDA 2ZRGA 4R2IA 2GILA 4C0KA 1K7AA 4L5JA 5FGMA 1YR9A 2FE3A 2K4BA 2QBYA 1KTVA 1DAFA 3X1DA 3QXJA 1N0UA 3CJNA 4M71A 1PLLA 3IO5A 1W0KD 1OYWA 1N25A 2BIFA 2IYUA 1D5CA 4IDHA 4L9TA 2PLFA 2EYUA 2RHDA 1D2EA 1QG2A 4EPVA 1UBCA 2GJ9A 3ZD7A 2GA8A 5KPDA 4Q9JA 2BJVA 1UKZA 1DAGA 2DR3A 4PQFA 4M9SA 2BBOA 3ISPA 2IC5A 4HQEA 4D0GA 5EXXA 2F6RA 3BB4A 5F3WB 3E97A 5ICEA 4HLUC 4MRNA 5J4HA 4EJOA 1RZ3A 2JTVA 1R10A 2ZRJA 2EW1A 3BOSA 3QF7A 4P3YA 4Q5IA 1PLKA 4I99A 4QLCU 1MKYA 4Z1MA 2J7KA 4ZDJA 3T1TA 5IT5A 1JR6A 2V1XA 3N2IA 5CM9C 1VG0B 2JCSA 1W4MA 3EETA 2OG2A 1T3LA 2FA9A 1P92A 4WK8F 5BYJA 1M8PA 3SN6A 3ZIAD 2ESHA 1MRSA 4JMPA 1CRPA 1R0WA 721PA 2EYQA 3WG9A 3ZQ7A 3DV8A 4BQAA 1G3MA 4KVGA 1DPRA 2OCPA 3GYHX 1E4YA 3RC8A 1FBQA 1OFTA 1GRRA 4RGUA 2PT5A 4LWZA 2AXPA 2ZREA 4WZ6A 3QU6A 1YQTA 4G0NA 1SD4A 4LSGA 5H20A 1GG2A 1SKQA 2V8OA 4NKRA 4KLZA 3SZPA 2JSCA 3WBKA 3SNHA 4B33A 2IA0A 2R7DA 2ODEA 1FX0B 3JW4A 3GFMA 4A8JA 3GJ5A 5L3GA 4LYHA 5F1RA 4A0RA 1LY1A 1W44A 3RJPA 4LJZF 5KNCA 1E9SA 2D62A 1TBXA 3HOTA 4O3MA 1MO4A 3NVAA 4UXNA 3TVTA 1FP7A 1BYIA 4MKIA 1FYKA 4WW0A 1BO6A 2QAJA 2YOGA 1KDTA 1FT9A 5DHAA 2WWYA 2EWNA 2YWHA 2IPQX 1GRNA 3P27A 2RGAA 3TQFA 3MWYW 3RPUA 1U8AA 5AK0A 3NDBB 2VF7A 1S3GA 1ESMA 4GP7A 5BOXA 3CO5A 1USTA 2UWMA 1I1SA 1OXXK 2H5EA 4JLPA 2GWRA 1W4CA 1FSEA 1ZM2A 4MDFA 3QP6A 4WXCA 3LAPA 4OU0A 4YDSA 2B21A 5J5CA 3DXJF 4Y15A 4F4CA 2Z5UA 4MQ9F 2JLRA 1CU1A 4YFXF 3ZN1A 1TQPA 4IRHA 2E1CA 4RFVA 2YINC 3W5JA 3AM1A 1CF4A 3SYLA 2ZJZA 2K27A 2L4MA 2WAYA 3CPJB 4R71A 1MV5A 1XGSA 1TF2A 3C5HA 2D1VA 1UBEA 3QKSA 3KQHA 1NG1A 2LCFA 1J7KA 4ZH4F 1RVDA 1WBDA 4Q01A 2A5DA 3THYA 3M1EA 1DG1G 4A82A 2BBWA 2Z4RA 3V4GA 3SOPA 2VRWA 1M74A 1IW7F 1FMLA 1T39A 4TYPA 5CM8B 3TBKA 3W6NA 1DAMA 1TADA 1KYZA 4XVRA 2FV8A 2XOKA 4DLYA 4DT1B 5EZ6B 1KSJA 3VTKA 2DK5A 3E6CC 2CE2X 2OV2A 1MGTA 3D0SA 2GF9A 3KL4A 3QEOA 5EEHA 3VNUA 2XTMA 4KODA 1D8TA 1U99A 3KB1A 4G5GA 4HZUB 4LJ7A 2FPKA 4HAVA 1B23P 2O8BA 3CRVA 4LC1A 4EFNA 4LG0A 4DDTA 4QWQA 3A4MA 2GA1A 2JLXA 1EX6A 1B6AA 3B1WA 4KIBA 5AJYA 1GNPA 2F3TA 1OE0A 3NHAA 1H8ED 2HLDD 4HX8A 2ZYWX 3JAMK 5JJLA 3IIKA 2BV3A 3TK1A 1KAGA 2W6IA 5JHGB 5DEQA 3MUFA 1F5TA 5KNDA 5JEEA 2XUBA 3QOFA 3R20A 1Z9CA 3K09C 5BN4A 1ZBDA 3CF6R 4HDQB 4DCUA 2IUSA 2DFLA 4CO8A 4Q9IA 4D0PA 1IBRA 1ZM3A 3R60A 1OHHA 1DOAA 1GUAA 1RJ9A 2JT1A 2WKRA 4RD0A 1V43A 2GTPA 3QKTA 4U88A 1DPFA 4OQLA 4UV8A 4UVCA 4EJVA 3DDCA 4V0ME 2QEQA 421PA 1HKSA 4ZI3A 5E95A 5JWRA 3KEOA 2GETA 1IY2A 4N0DA 3BP8A 4HOBA 4FT8A 4MQVA 1JR3D 3WTUC 3LNCA 4HUQB 1P4AA 2RCNA 5EZ5A 3WBJA 2IYZA 4RD6A 3TJZA 2HXYA 4G8XA 2BM1A 2ZSDA 1R0ZA 1R00A 1QHYA 1J9IA 3QG1A 4NDZA 3FWEA 2VYFA 2M30A 1U2RA 2C78A 2PMDA 1ZP6A 1T8TA 4B2LA 4LDJA 4L4UA 1OXVA 2HV8A 3NBYC 3VMFA 1YRAA 4I2OA 3AP2A 1UKEA 4MHGA 3E3VA 1G6NA 1C1KA 1Z83A 2BHRA 3U3KA 1XSVA 4C0HA 1QZYA 1N5LA 4JQFA 4UXJA 3BRWD 4LK0F 3CF2A 4HF1A 3T5XA 1W47A 2ZRIA 4G7HF 4G7OF 3PQJA 5HR5A 1ONVA 2PJZA 1XD9A 3H0KA 2LKPA 3K0EA 1O3RA 1GL6A 3BH0A 1N6LA 3PG5A 5K5OA 3KXIA 4KHZA 4LBZA 2ZE8A 4OMZA 5LB4A 4KIGA 1QHSA 4AG5A 4B3DA 3WGIA 2VOOA 3CRW1 3K0FA 5FPHA 4BH9A 3BD9A 3I4LA 4TT3A 4AYXA 3KZYA 2IXFA 1S1MA 2EFNA 1HW1A 1DP7P 5E18F 3C5CA 2OAQ1 2BJWA 2VPPA 3DM5A 4GZLA 1JGSA 3SE0A 2G0NA 3IEUA 3IWFA 4AURA 4ESVA 4GCVA 2HDCA 4H1VA 4JLAA 1FTNA 1NIPA 2WICA 2L4AA 4IHSA 3JSOA 2ZJAA 2ZUCA 3MZYA 1ZMXA 3C16C 3KP5A 2CNWD 5K8TA 3UKDA 5BW8A 1ZG1A 2RGDA 1XSXA 3MHVC 1KDRA 4WA7A 5H68A 2CCKA 4B2IA 4LJ9A 3LW8A 3W90A 3AVVA 2YZ2A 3W6JB 2EFHB 1N6IA 3NDPA 1YFHA 4QHTA 1R5BA 1TUEA 3AV0B 2QPAA 4KV9A 2Q6TA 3GEZA 4HF2A 1E2IA 2JJ2A 1T6NA 2ZRLA 4PAMA 4XLNF 1LEBA 1EFRA 1XEXB 2FMXA 2FU5C 5CIQA 3WP0A 2CJWB 4AK9A 1LFDB 1M7HA 1XEWX 5G3YA 1OMIA 3TIFA 2NNYA 1HBXG 1ZNYA 2QP4A 2PEZA 2DPUA 1KZ7B 1W0JD 1YZKA 4B3FX 3SQXA 1SHKA 3DO6A 1P4XA 1N3BA 1AWCA 2P5TB 3WP1B 3CW2A 2RB4A 2LKDA 5LBIA 2A68F 4GDFA 4W5JA 5C4GB 2EU8A 1E79A 4TL9A 3I53A 2FWRA 5J8CA 3DKWA 4ZYEA 2JLYA 1PLJA 2R6CA 3P4XA 3DHWC 1Z0FA 4M8NE 1MZBA 1SKYE 2QMUA 2TMKA 4DCTA 2QU8A 4TMTA 4Q1FA 5G53C 3IPXA 2R6AA 3IL2A 1I4DD 3VR1A 3IWZA 3I5UA 4UV9A 5HOOA 3RWMB 2VSOA 3RANA 5J4YA 2FGKA 1UJ2A 2C6YA 2IW5A 3E5UA 3ELKA 4FCTA 1OW3B 1VG9B 1J70A 2H18A 2WOJA 3I32A 1E2QA 1NMYA 1RRFA 4B73A 2ZIAA 3K9TA 4RD2A 2O8CA 2P0EA 3AVOA 1E2FA 1UFMA 1KGDA 2VSXA 4Q9KA 2UXNA 4S35A 2GK7A 4PSAA 2BOVA 4RZXA 3SJBA 1AZTA 3WMGA 4GSYA 5LRSA 3IHLA 3J81Z 1SFXA 2ZS9A 5LBQA 5L3SB 4CEHA 4PAOA 2EK5A 121PA 4B3BA 2WC2A 5J8FA 4LMYA 2QP3A 3KP7A 1C1YA 1O3YA 4Q4AB 2QQEA 3HYRA 2IWHA 3PITA 6Q21A 1S8NA 3K70B 2O8FB 3B6EA 5JMTA 2ZNYA 4HAXA 3AF0A 5FTJA 4R8HA 2HJVA 1IONA 4OJKA 3ZD6A 1NBMD 2ZROA 3OESA 3B8HA 1U5TB 4MTEA 5DCMB 1US8A 3FOZA 1ON1A 1F9NA 2PMHA 2G6BA 4RB3C 2RMKA 2WWGA 3J80Z 3DVLA 5FD5A 1TTTA 3KZZA 5DIFA 1SKYB 3EIQA 2V6JA 5EE9A 3NEJA 2DFNA 4DCVA 2DCUA 2EWWA 4ZYDA 1D5VA 1NLZA 4EPTA 1KU9A 5JRJA 2GRJA 3IKJA 2J9RA 3TUZC 4B76A 2OEPA 4A6PA 1L4YA 2YJTD 3RKWA 3WNBA 3TGNA 1J75A 2OBMA 4HZFA 1EESA 3U3OA 1Z0KA 1QHHB 1XB2A 2C98A 2O0YA 2FX3A 4MH0R 4CDGA 4V02A 2A61A 4NHJA 1HV8A 4B44A 5CB8A 3KJGA 3X1WA 2PQ8A 5ELXA 5LGTA 2GBLC 4M1TA 5FOSA 1Z6XA 2H7VA 4KO8A 2FZLA 3VR6A 2SHKA 4EUNA 4RFSA 4RAYA 1BC7C 1RIFA 3FPAA 1Q12A 1LS1A 1ZNXA 3BORA 4BWYA 4OINF 4NYJQ 2PJPA 4TTRA 1PDNC 1UEIA 3LXRA 1TEVA 1CS4C 2KBEA 3GLGA 5FUYA 1ZH5A 3IDQA 4KFRA 5CJ9A 3GO5A 1P4SA 3I73A 3NTUA 4DLUA 4BQSA 1MABB 4HLCA 3THXB 1Q1BA 2XKOA 4TQ9A 2H57A 4XSZF 2IRFG 2HT1A 3MCZA 2HF9A 2BEOA 3PUXA 1E3MA 4WF2A 2HS5A 1CR1A 4PPFA 5JECA 3K0CC 5DI9A 2DU9A 3R0AA 3NEUA 3BS4A 5A0FA 5C1BA 5TARA 1A7JA 3QPHA 4DSUA 3TMKA 4BFXA 4B8XA 4KNYA 2QWWA 4M1SA 2G1KA 2CL6X 2LKCA 2O6GE 5F6FA 4N0EA 1IOZA 5DGXA 4B34A 2ZVPX 3RNLA 1SHZA 4PTLA 2BDTA 2XSZA 1WE2A 2F1HA 3FM5A 2NRAC 4DBLC 2PN6A 2J0UB 2VQSA 3RVBA 1BN5A 4IXMA 5DUIA 3BK7A 3CX8A 2ZNZA 2J3EA 2AKAB 3RRMA 3E1SA 2V6CA 3DEUA 2GCOB 5DSZA 4FMCF 3ZQJA 3AVXA 5D3MA 1FP2A 2L0XA 4FMDF 2EA4A 4WCGA 1G4UR 1W0KA 4D26A 5FTLA 1P9RA 4LV8B 2LDUA 4JN6A 1TAGA 4G6DA 2RAPA 3ADDA 4H9GA 1NN0A 1WRJA 2GESA 5CDFE 5ILVA 2I4IA 3QIAA 2MSCB 5DYIA 1HKQA 2Q3MA 4XH9B 4GP6A 1LVAA 3IO3A 2AXNA 2NIPA 3IUYA 4UNQA 2H94A 5LRRA 3THOA 3H1TA 3L0OA 4L5IA 1U9IA 2H09A 2V6IA 4Z8YA 3UANA 4CEIB 2BE5F 2KJCA 1VYUA 3FWYA 3S1AB 2GQQA 4EIWA 4OBEA 4YMTA 1VCIA 4XRFA 1KI2A 2XOKD 4LBYA 3ZIAA 4A2QA 2O3FA 1XJ0A 1O3TA 2YWEA 2WOOA 2AXLA 2P5VA 3I54A 3NKVA 3K09A 2AK3A 1H0MA 4RD1A 2F9LA 1BOFA 3R9WA 1Z05A 1E2LA 2GXGA 5BYKA 3Q9SA 2RN7A 1ZIOA 4BRWA 2FFBA 1W4AA 3P1JA 4HAZA 3GLHE 4TMKA 3TGPA 2MA3A 1T0JB 1H8HA 2HGCA 1SMTA 3NBXX 1SVKA 1F60A 3ZMVA 2OFWA 1GVJA 2W6ID 1I4TD 3E70C 3VODA 3OF5A 2BCJQ 1KI3A 1QBKC 4HV6A 4JKYA 5LGUA 2O8XA 1BMFA 1RRGA 1WRBA 2IEYA 1UBGA 3GCGA 2PX3A 2JJ8A 2XHKA 4GL2A 3FKSD 2IUUA 2FXAA 1FNNA 1RNLA 1XP8A 4MKHA 2DPDA 1F2UB 1N5KA 1ZRHA 4YIFA 1OHHD 3QQ5A 4RCZA 1S9DA 3B13B 1WF3A 1T91A 2X19A 3KW6A 4W5WA 5DI3B 1QVRA 2WV9A 4MRSA 1RE0A 2WVJA 4ENKA 3GJXC 5KNBA 5L3QA 3BY6A 1T2KA 2BM0A 5DLQC 2HYGD 2XAHA 1J0RA 3CDHA 1Q44A 3DPUA 3GJ7A 4I0BA 5TY0A 2BKUA 4LPKA 3LX8A 1XGOA 4KSBA 1TL7C 3EYYA 2RVCA 2XAQA 1OKKA 3EA0A 4BFTA 1ZD9A 2ZMEB 4OYHA 4YMWA 3W3AA 2DBBA 1KI6A 1ZINA 1YIOA 1FP6A 5CLQA 5AUNB 2ZI5A 2BEKA 4Q47A 1CXZA 2FG5A 3A8TA 3EA5A 3K9HA 1R23A 3IRQA 3LXXA 5A2QK 4D4JA 1XWIA 3L0PA 1NVXQ 1Q1QA 3BH7A 1O3SA 4WXHA 2KKOA 1E2HA 3U7GA 3KFWX 3GLHB 3HIFA 2QTVB 3ZZTA 2WZQA 1Z63A 3O8RA 5L3BA 1RUOA 1KQ8A 2VHUA 3LDAA 1CR2A 1N2CE 2CLSA 4DCSA 5KVRA 5ED4A 1ZG3A 1J8YF 3CPHA 1U78A 4K81B 2VE9A 4LD5A 2DI3A 1SVSA 2EFEB 2FFQA 4LB5A 2Z9OA 2ISYA 2VH5R 4TT3D 2ZANA 1YKSA 1JBKA 1NVWQ 3I58A 1JEEA 4PHFA 3PEYA 5EEGA 3LSTA 3N4MA 1SVWA 3F8TA 2AN9A 4IOKA 2MH2A 4XIGS 4ARZB 2FNPA 3SZTA 1P7CA 4OI0A 2NO7A 1HE1C 4PANA 4Q19A 3HOSA 2GZWA 2O03A 3GUDA 4JK1X 3QRFF 4XSHA 3GZ6A 2CBZA 3FFAA 1P6RA 1N6RA 4WXPA 4O25A 1YZQA 1B9NA 3JZAA 3FB4A 4ZKDA 5DO9A 4NL4H 4MRPA 4ZYGA 5HS9A 1VHLA 1ZU5A 2XNDA 2HLDA 2FSFA 4LJ4A 5JRZA 1EX7A 1Q1HA 3QPWA 1UKYA 2Q9BA 1XGNA 4IDPA 1G291 1MRNA 2JJ2D 2XGXA 4TMVA 4YDHB 4CYMA 5EXSA 4D80A 3U61B 3F6VA 2JPBA 1EFRD 1T9HA 1RYHA 1YG2A 2J45A 5CVJA 1LVGA 5HCNA 2XTZA 4IFEA 4Q4JB 4OQXA 2XVCA 1TNSA 2IA2A 1OPCA 4ZZLA 1U98A 3HWSA 4QL3A 4CF7A 1Z6YA 4XSGA 1CTQA 2PBIA 1P5ZB 4PSVA 5F9FA 4LBWA 5CYPA 2CDNA 2KB0A 4WVFA 2AX4A 4IOLA 1TNDA 1IHUA 4D6PA 3PVSA 2HQNA 4F4IA 1ZC3A 2WMOB 3PQCA 3DZDA 1ZM7A 4YIIA 1Z3IX 2GAOA 4PQYA 1PZNA 2ZU6A 1KQ0A 5H70A 3O3KA 2K02A 2CVFA 2DYKA 2F1JA 3O8DA 3VQTA 4DSOA 2NO9A 3B7GA 3AKEA 5H1YA 4TYNA 1A04A 4ITRC 4L9WA 2G0TA 1ZM4A 4V0KA 2P5LC 3WU0A 3A58B 4K46A 5IK2A 5JSZA 4IVQA 4EFLA 2VBXA 4A6EA 1N6PA 1R5NA 2MSEB 1WQ2A 4GRAA 3IHWA 4IDOA 1OFHA 5DCFA 3FKQA 2OM2A 4R7ZA 3TQNA 1FLIA 5KYKA 1NN5A 2WKPA 1IXCA 1QO0D 3T1BA 5DDGA 3H84A 4Q1BA 1UKVY 1Q20A 4LY6A 2K7LA 1E9RA 3KEQA 1YZNA 2FEOA 5GVRA 4AIIA 4C4PA 3NH6A 3L7WA 2JRTA 1TW2A 4A0XA 1KKMA 1QHXA 2HCBA 1HQYE 4CZ2A 1YE8A 3ZJYA 4A5MA 3AH8A 4QGHA 3UXMA 1E2GA 2IYRA 3CLOA 2B8WA 1Z8FA 5LHIA 1M1YE 2ZKZA 1CP2A 1R5OA 3BJIC 3JTGA 2MLGA 1SVIA 1MJBA 1G7CA 2J0SA 1MJAA 2VN2A 2YU3A 3X2SA 3VB2A 3ICEA 1VIAA 3HUGA 5C2JB 1T5IA 1G16A 1VECA 1UAAA 4A36A 3CNLA 1DELA 4TQAA 4LFUA 4AWXB 5DUKA 4NQWA 1A2KC 2W0MA 2JJ1A 2WTUA 2DAOA 5JZVA 2QZ8A 2CFXA 4RKEA 3ADCA 2AFHE 3B2EA 4D4MA 1E6CA 2C9YA 5BN3A 4F7WA 4F93B 1AK2A 2CEAA 2ATVA 3FZVA 5CYVA 3K70C 3RSOA 3EUHA 5KUTA 2ZRCA 3C1DA 5D5UB 1T4GA 1E0JA 1E9FA 2ZRPA 4H1UA 1II9A 4YQFA 4PZYA 2P65A 2AK2A 2F5CA 1L3LA 3W9YA 4XWKA 4PO8A 3AVQA 2EV5A 3U3JA 4JT2A 4DC9A 3TSOA 1M7BA 1E2DA 2HQRA 2VHQA 1ZAKA 1IF1A 3MMPA 2A7QA 1ZLKA 3QPVA 4LHWA 2M5WA 5AJZA 4W5HA 3MJRA 3AGQA 4UNNA 4PPNA 1TQMA 2DK8A 3RKXA 1FX7A 3HTUA 3W8NA 1UFQA 2ORWA 3CONA 4FCWA 5BQ5A 3W6PA 3FTQA 3DKPA 4FMBB 5FTMA 4HAUA 3RAPR 3IGFA 4JLBA 2O52A 2A2ZA 4QBHA 4OI1A 4TWZA 3SJAA 1P75A 1XGMA 5LHHA 1W48A 2XAUA 3I92A 3K0CA 2XZLA 2QENA 1WWXA 3F8NA 2DB3A 2CE7A 1ON2A 2R7FA 2V9VA 2GIVA 2VP4A 1F3OA 4TQUS 2X2FA 2D2WA 3PCRB 5B58C 4HDCA 4MGYR 3RC3A 4D25A 5B30A 2DQRA 2F1IA 1HH4A 2QAGB 4WZAE 1IN7A 4ZCIA 3CLVA 3PR1A 1FX0A 4M73A 4GOKA 5AUQA 4LRTA 5EJEA 5KHOC 2EVWX 3R61A 1XDBA 4MUBA 4JBWA 1SFEA 2F43A 4A1FA 3F23A 3TH5A 2FDCA 2K4JA 3P9IA 4E09A 3L2OB 3MRSA 2MD5A 3EG5A 4BLQA 4L15A 2NAZA 3CUQA 3TW8B 3HYIA 4KYUA 1XCBA 4I81A 2VL7A 1Z91A 3H3UA 2D74A 3SBEA 1VMAA 3K53A 3AKDA 1HXDA 3WTSC 2WIBA 2XNSA 5JI6A 3AF1A 2A3SA 4MNUA 2ISZA 3LQQA 3JVVA 3P20A 5JS8A 1OIVA 2XSZD 4DIDA 5HLHA 4MRVA 1G8GA 5FBRB 4DXAA 5FPKA 1OH5A 5L3CA 3IBYA 4QOSA 1XXHE 4RY2A 5E4FA 1NBMA 521PA 1YRBA 2NNNA 2VC1A 3KKMA 3SJCA 4A2PA 2RGBA 3OE7A 1FOEB 2QM3A 2Z83A 4HDUA 2IS6A 1STZA 1HURA 3WY9A 1NJFA 3LWFA 3EAQA 1KK2A 5EE3A 2QY9A 3V8KA 1DADA 2NO0A 2K86A 3ASYA 1KOFA 2DZNB 2ZYTX 3DOEA 3TNFA 3I61A 4P55A 4BAYA 1SULA 2M8EA 3M1IA 2Z5FA 3T34A 2AD1A 2WM9B 5KDLA 3RS3A 3CBQA 1Z6AA 3CB4A 3H92A 3F3XA 4P9UA 3BB1A 3U2QA 1XRJA 3IHUA 2IYXA 4JLMA 4EPWA 4KFCA 2DWZB 3K0AA 2JLVA 4PCQA 2JASA 3GEIA 2CSOA 4LLGF 1YYVA 3VX3A 1K8RA 2W24A 1EXMA 1IXRC 4R79A 1E9CA 1T5LA 2WMNB 4UXHA 3SZRA 1OB2A 4CT4B 1HE8B 3WE2A 2VLIA 5KK1A 4I01A 2RGNC 4HW0A 4KYWA 4CEJA 2PFBA 3F8CA 1K5GA 4OK6A 1S1CA 4TYWA 2PJRA 4HB0A 1G19A 4V0LA 4Q5SF 4PC1A 1ULYA 2HJGA 5FR1A 4PO1A 1JECA 1P61B 1FWZA 1G3RA 3LFKA 2HFHA 3F0TA 4AD9A 1NMZA 3LH5A 4KN7X 1ZW6A 3K8YA 5D5WB 5HLIA 1AS3A 1FL9A 3K2ZA 4EM0B 4A3VB 2C03A 2MMGA 1XPOA 1G7RA 4MGIR 1XXHB 1H8HD 1U0LA 5CB6A 4KN4X 2X8AA 5HKKA 1P4WA 5CK5A 2OUKA 4NB5A 5FPYA 5J6XA 1XEWY 2DW4A 2BMFA 5KOYA 3THWA 1KGSA 1QQIA 3EX7C 2VP6A 1BMFD 2ZTSA 2IUTA 1YTYA 1X3SA 3RSLA 2YKGA 3VNVA 3FMSA 2IVMA 4ABYA 1X1RA 3ETLA 1CF7A 1RUNA 4LBVA 2W2XA 2A07F 4B3XA 1P9NA 2QT0A 1EWQA 4JBXA 5CIWA 3TR5A 3ZMDA 4RGRA 1LQ1A 1WDTA 5EE5B 3SYNA 1O57A 1U0HC 2ZRMA 4OI4A 3I62A 2EFQA 3E6DA 2ZI6A 4BFUA 5DNYB 3VAAA 3LAJA 3PUYA 3DP7A 4HQMA 5FD6A 1F2TB 3WTWC 3F3YA 1O7FA 2IT1A 1OKKD 1DAKA 3ZYCA 5DD4A 4EJSA 3I0TA 2HYFA 1XTIA 1S3JA 3DZ8A 4B09A 1VG8A 1LEAA 2GHIA 4U0VA 3EWSA 2CLCX 4B43A 1U3EM 1ZM9A 3T1OA 3BWGA 3DFGA 4HLXA 5AJXA 4M0LA 1XTRA 4LCBA 1Y3AA 2WWFA 5B57C 4LZZA 5G3ZA 3I72A 2I1QA 3WYGA 4GO1A 3U6KA 4KMFA 3GJ3A 4GYIA 1QHNA 1U81A 2ZRKA 1Z22A 3QEJA 2ZSAA 2C99A 3R0JA 5CJ2A 2BC9A 2H27A 4W7SA 4ZDIA 5BPIA 1VG1A 4TL7A 4PGHA 1NRJB 2CXXA 2OXRA 2Q0OA 4BXUA 3CH4B 3LV8A 1PUEE 3HDTA 4KFTA 4UXIA 8OHMA 3T5DA 5C18A 1PV4A 3B9PA 3WTYC 2HDNB 2P6RA 1YW8A 2F1RA 3EXAA 3NEYA 2LSOA 2P7CB 1SXJE 5E1WA 2IYLD 4D4KA 4G94A 1UDWA 2ETHA 3RS0A 4C7OA 3CZQA 3IQXA 1PP8F 3B73A 5D3QA 1IXSB 5DV5A 5HE9A 4D0LB 4XTCS 4QBGB 2XXAB 4I1UA 3O2PE 3C4JA 4JBYA 2P3SA 2WJYA 3CTAA 5DN6A 4HX4A 4G6QA 5LHGA 1B9MA 3M0EA 1R8SA 3RRZA 2HKOA 2XNDD 1VKJA 1RRPA 4MEXF 3LBNA 4A5NA 3R7WA 5GVSA 3BROA 2ZPTX 5FPSA 5FOXA 1W7PB 2H1LA 4AKIA 1TMKA 1IY0A 4V0NA 4LLNA 2D2FA 3AUYA 3FKSA 1E94E 2WJHA 4Z2YA 1CJKC 2QNRA 3IIMA 4TZ0A 2KRKA 1VIYA 2J5OA 4OOIA 3MFKA 1TX4B 2P7VB 2OBLA 1W46A 3IBGA 5DISB 4E03A 1A1VA 3HRSA 1G5TA 4DJTA 3WMFA 4MRRA 1FUUA 1EWRA 3P26A 1K79A 1HW5A 4WX9A 3U1DA 2ZE6A 4QNRA 3OIUA 1ZUHA 4MKFA 2WIAA 1PJRA 4D2IA 2MBFA 2GCNA 2IYQA 4HSEA 2W2VA 2W58A 3CX6A 1S9HA 1OKRA 4AKHA 2WJGA 1SXJB 1S7AA 2A5GA 3AGPA 2GNOA 5IK2D 3QE0A 1QPMA 4U0WA 2IX3A 1GOTA 1OLOA 5FB2A 1G3YA 1GXQA 4FD2A 3W34A 2WKQA 4KXFB 3M6AA 1AS0A 3U60B 4CVNA 2RGXA 2ZETA 3LBIA 3PXGA 1XN7A 3I5YA 5H8WA 2CLDX 3B85A 2XAJA 1A5TA 3CNOA 3ZVNA 4LLLA 1QZXA 1KIMA 3CR7A 5FOTA 1AS2A 1IAQA 3JTHA 1XMAA 1AN0A 5CJPA 5L3SA 2WJIA 1JXMA 3OAAA 4OIOF 4IVPA 2VE8A 3BH6A 3MWJA 3HHHA 1W2HA 3ONWA 3TKLA 2R3SA 5TDHA 4XBFA 4HX7A 3KP2A 4ASUA 2O8FA 1FPQA 2YX4A 4RD3A 1Z0AA 1ZYRF 5L8VA 3FF5A 1GFIA 4D81A 3ULQB 2W83A 2ZVQX 1YZTA 2ZI4A 4HATA 3ZVLA 3Q3JB 1KI1A 1KA8A 1ONBA 4BYYA 1J2JA 5DCMA 4FMDB 2KWIA 4HZIA 3BWDD 4RKFA 4U02A 3T15A 1EH8A 4QNMA 3NHBA 5FI1B 2B6HA 3REGA 4YMVA 2D1HA 2JJ1D 1JXOA 1KY3A 1NKTA 1E1QA 3KB2A 2HXSA 3UATA 2IS1A 1EFUA 4A9AA 1M34E 5CVIA 2IBMA 2PZFA 1NSFA 4I98B 3WTVC 3NC1C 1KK0A 5ICCA 3THYB 1GKUB 2QPOA 4MGZR 4RZUA 4RS8A 5CVVA 3PEVA 1VCNA 3TUIC 3K0SA 1EG7A 5ERIA 4BEBA 1DO0A 2WWWA 2FFHA 4DSTA 5E8IA 1RIOH 1OFUX 2W85A 3HTSB 2DWPA 3HR7A 1QZZA 2EA2A 3OFND 4GBMA 5KPJA 4URZR 4JZKA 5CVUA 4S05A 1FYLA 1OIWA 2Y8EA 3MQ0A 2VXZA 1E17A 2QUZA 4MYUA 2PZGA 2O8BB 3MG9A 2ONJA 5JJIA 4Y13A 4MGRA 3TOAA 3U44A 2FNAA 4BHPA 4ZIRB 3GVAA 5IT9Z 2D45A 1UBFA 2J0VA 3BJAA 1HA3A 3ICQB 1E2KA 3AB3A 1SMYF 2W25A 2ZI3A 1NIJA 4XOIA 3BFXA 1IUYA
chains in the Genus database with same CATH superfamily
3REQA 1W8IA 2Q8KA 2FU4A 4PFSA 1SPBS 4OXIA 3VOTA 1Z6ZA 3F67A 3FETA 1QO0A 2QX4A 2G9UA 3U7HB 5E8GA 1PJZA 4LK1F 1LWOA 5F77A 3ZU3A 3AKCA 4E51A 3B5JA 1FCJA 2JRCA 1W87A 5DB4A 4FGKA 5PNTA 2VUSA 1HDOA 4L95C 5E38A 1Z5AA 3L18A 2WYUA 1CT9A 4BLRA 4HL4A 2FPUA 4QHSA 5T6MA 3QKUA 4RENA 2R7WA 3HNPA 4FU0A 4U2KA 2CHVA 3HV0A 1J07A 4XB6B 4URWR 5E2IA 3SVLA 2VQHA 2ZJYA 3BXZA 5HKKD 2PIAA 2UUPA 4P3OA 4OHCA 2CUZA 1X1QA 1E7YA 6GPBA 4XIDA 1J49A 1UINA 3A36A 3EDCA 3E23A 2JHGA 2VLAA 3P94A 1I27A 4DA9A 1ZCFA 2CV0A 4Y9TA 1DV1A 1G2QA 3PJEA 1QF9A 3GWZA 5IHXA 2JI7A 4B4KA 3PIOF 5BSTA 2IEGA 2G63A 4OMCA 3BMOA 4TV9A 1PUJA 1P72A 1GFZA 4WFIA 2JY5A 4U39A 2PUHA 3J80K 4CJXA 3BWMA 2EBFX 1NJ2A 2DBYA 3S14J 3U61A 1QDRA 2CB9A 3MFQA 1MMGA 3N2KA 4XPIA 3JRCA 2PX9A 1P0IA 5CBKA 3A6GA 3HHWA 3SMPA 2J6HA 3YASA 2HHHM 2Q3HA 1TF5A 3PA8A 4OXNA 5IFKA 4I8OA 2I22A 1MO5A 4HNQA 2QQBA 2RKWA 2DF8A 4R41A 2NUPB 4ILEA 5DT9A 3IJEB 3L0CA 2VBIA 3W67A 4FHTA 3NWTA 1W85A 3DVQX 5KQLA 3RRYA 3ZQFA 3WNCA 4MUMA 1ORDA 1B00A 1A9YA 4QDUA 3EPLA 4WINA 5FLYA 4ZOBA 2J1LA 3LG2A 1BH6A 4UU1A 1R36A 2NQ2C 1WQ1R 1QJ4A 5IH7A 2NX2A 4F3RA 3CCUI 1C9EA 1Z13A 1Q22A 3BEOA 2B5OA 2I4TA 1YRNA 5G4LA 4KR3A 3GBPA 2XYHA 3L7AA 1R66A 4ZARA 3A4YA 2JCXA 3D5TA 1MIHA 1ICIA 4LG1A 2CQNA 1WXWA 3GEDA 3M34A 1VP9A 2HAEA 2EZ8A 4EMTA 3WZMA 3TPCA 2CQKA 2XRLA 5JOQA 4DCNA 3I9V2 2QEXI 4Z54A 1XQ6A 3DQQA 2BFNA 3HEMA 4ZV7A 1RJDA 1MX1A 4MJLA 3GPYA 3ZGXA 5EVJA 1IYZA 4PO9A 1I3LA 2VUUA 1RWVA 3HPQA 1SXGA 2F5EA 4DRYA 5SY4A 1FBTA 3NV9A 1JR3E 5H80A 1FVFA 2FY8A 3NLLA 1XZLA 2NPFA 2VYCA 1AQIA 3OQIB 2P6MA 1YIAA 3NETA 4N1AA 4HAMA 4G0OA 2VONA 1SCDA 1UJ6A 2E49A 5ENZA 1T0HB 4GOJA 3NIWA 1KY2A 4D5GA 1EHCA 1XTJA 3FJYA 3OJEA 2QT1A 1JE8A 2ZBPA 4CIDA 2BMDA 3WHLA 2WD7B 4EUHA 5JSFA 5LP6C 4D98A 1C3OB 2AWOA 3IOEA 3CUEF 3I04A 1ZL2A 3IRUA 1R6RA 4JJ6A 2OILA 3SJZA 2Z0MA 2O05A 2FX5A 4ZI2A 1MBFA 4Q12A 2TMGA 2JVGA 2LUOA 4JI3M 4PICA 1YVPA 2G3YA 2GEVA 2CG4A 5D3KA 5AVRA 3DONA 5E79C 3FUCA 2ZQZA 4FHCA 4DNFA 1GU1A 1NG6A 1UQTA 4WADA 2VPWA 3M81A 4BFVA 1BX3A 1WEHA 1FNDA 2V6EA 1IZ1A 1QQWA 4M3DA 1TM3E 4FT2A 4Q7LA 1Z6QA 4BNDA 5K0ZA 3WLLA 5CB4F 4JYAB 3SKVA 4I55F 3OLYA 3TLBA 3I1YA 2AG1A 2VJQA 5T57A 2CCGA 3KZVA 3ZXXA 3R9XA 3I8SA 2DVWB 5CDHA 1IQRA 1UHWA 4A3LJ 1EK6A 1TWHJ 4LGYA 3IG5A 4A3EJ 4NRVA 4JLVA 3ZE7A 1NV8A 4QG7A 1XMSA 1PWYE 2YX7A 2JD1A 2BKVA 2B5WA 3GW2A 4YUXA 1PJSA 4EX6A 2HPIA 4KPEC 3T4PA 4V0MA 5HIAA 1J1ZA 1UMBB 1M2HA 1NNJA 3LGSA 1G42A 5K6RA 4HN4B 1VQ7I 2R5WA 3Q8XB 2CJWA 3EEQA 3U6QA 2PJRB 1EIZA 3G7UA 1G6Q1 4MO2A 2P6TA 1ZGCA 3NM6B 4JVSB 3B6AA 1PX0A 2YWXA 3DDUA 2G8NA 3AP1A 3J7AY 1LKZA 4GNKA 2MTBA 3IAXA 5JCPA 5H4GA 1NBWB 3WK4A 3NX4A 3LT5A 2XZPA 4U00A 3WMWA 5K5EA 1I30A 1TT7A 4Q34A 3A1FA 3GIWA 1TQHA 2CNLA 3TR0A 2G83A 1V7PC 2X4GA 1TR8A 1Y5RA 5KI6A 4BFSA 3NYRA 1T6SA 2DWNA 1TZ2A 1TK3A 4C21A 3VM6A 2H59A 1C30A 2JL1A 1T36A 4LVNA 4U3JA 2HSWA 3SIRA 2QTGA 5IAEA 2G4LA 4CKCB 2BZTA 1RYEA 2CYCA 1O54A 4IHQA 2ZXUA 2AX3A 3FWHA 4TM8A 2ZBQA 5LYJF 1TT5A 1PNOA 4JBAA 2AOWA 3ENKA 6YASA 1ZAOA 1YC2A 4NBTA 2C00A 2QG9A 3VZDA 4X5OA 1YFJA 3QRWA 1SN7A 1RM3A 1GA4A 4U5QA 1JKJA 5F1KA 2V1DA 4WAUA 4I1SA 4HAWA 2P9FA 3EIHA 4IH9A 1MO2A 4MFEA 2CBXA 1G8PA 4X62B 3DF8A 1GPKA 1JU9A 3K0KA 3L46A 1K6JA 5GTDA 4YJHA 5SZHB 5BMVF 1MMFB 5BMOA 3QWBA 3LUGA 5B2EA 3LUBA 2OD7A 3H2ZA 1A88A 4RSMA 1L7DA 2AR7A 5JW6A 3HN2A 5BSKA 3RIRA 1C1XA 1AN9A 4AKGA 2WSMA 1QTNA 3U56A 3WIOA 3ERED 3BK2A 1T0PA 2VYQA 1QP0A 4L3WA 1ZH0A 5SZIA 3JAKA 4V2IA 2QG6A 5A06A 2FPLA 4E4RA 1Z5VA 1GPWB 1JWBB 2FW7A 2D59A 1GV0A 1ZXXA 5FBLB 2FBHA 3L6DA 3DEHA 1LPQA 3HSFA 2HT6A 4E70A 4D9CA 1H1LB 3CBGA 4WFKA 1JG1A 4C07A 1JTXA 2QTLA 2IDZA 3VPRA 3G1WA 4HUTA 5JBQA 1U3DA 1XZQA 3H9GA 3LPDA 2C04A 1NSYA 1RM5A 1Y0BA 3GJ6A 1PYGA 2XQGA 1HLGA 5AXDA 2CJXA 4HDNA 3H0CA 1HT2E 3N8IA 5EP4A 3BXEA 3OIVA 5KTSA 3M07A 4PJMA 2BGIA 1A7UA 5GJCA 5DXJA 1E20A 4KL8S 2JH8A 3AETB 4L75A 4JLOA 4BU2A 2FG6C 1G8FA 1I13A 2UZAA 4ARCA 1HI9A 2CS3A 2QUKA 1WZNA 2GYWA 2OD5A 5MDHA 5AMXA 1AXRA 7YASA 3OYAA 2WY7Q 2R5NA 3AHJA 5D7BA 2APJA 3GRRA 1QUFA 3M6IA 3T12A 3MSCA 4U0KA 4BMOB 1O7LA 3KK0A 2ZB8A 3EMVA 2FSVA 3NGMA 1M6VB 3P9RA 2XD9A 3ZDFA 4E07A 3T8TA 1M2EA 4G07A 5F1PA 4F9TA 5FH9A 2BFFA 5LP6F 3MVEA 4LNUB 4LF4M 1LTHR 3B1YA 2REOA 3AO0B 3ZZUA 5EXPA 4URYR 4KUEA 2DC1A 1TDZA 1TQ4A 3VKWA 2G1AA 4TMZA 1JR3A 3MLAA 4QXMA 1VIMA 1E99A 1DX6A 3X0DA 3KQPA 1RI4A 1QP4A 3HPRA 1WQ3A 4X8OA 4QUAA 4AUNA 3CT4A 2IHZA 1X14A 4OIQF 3VISA 2X2OA 4Q48A 1CQJB 4ABTA 4BXOA 1M2VA 2AIRA 4JP1A 5J40A 2FJUA 2L54A 5FNVA 3L8MA 1OYYA 4C0BA 3EWAA 2IL1A 2ZFWA 2RC4A 1TCBA 1IRFA 2ECQA 3RGGA 3EAFA 2C2HA 3P9QA 3MELA 1LDYA 3QU7A 3QI2A 2B2NA 2LBPA 4IX9A 1XMJA 5LEKA 3G0OA 1R6XA 3LC0A 2QMEA 3U37A 4HVCA 4V0OA 3L1VA 2LG4A 2H4YA 4YV1A 1UUFA 5LQRA 3KJXA 1PGQA 1J2XA 1EP3B 2IW1A 1X92A 4EM1A 3KVRA 1AIPA 4CICA 1E96A 3BIFA 4D7NA 3RWOA 5ECDA 3I51A 3EDRA 1V92A 3KQYA 1SCKA 2PMUA 2ZRGA 1ZAEA 4AUMA 2PPVA 4FX5A 1G2IA 4M71A 1N25A 4Y0NA 1YRQA 2P2CA 4BWFB 2WYOA 2FFJA 3ZD7A 3WZLA 1UKZA 1DRWA 4ZCQA 1JDZA 4N48A 1ETYA 3L6BA 4I99A 4QLCU 1ZK8A 3SN6A 5DTEA 2DMTA 4RKQA 1AKRA 3EIOA 1FBQA 1GRRA 5EWLB 2AXPA 1YQTA 1H4VB 2GAIA 2Y1LA 2OKGA 2YICA 4LRTB 5A4MS 2Z56A 3RJTA 5KNCA 3IDAA 1SU6A 1FSZA 1ZSNA 4O3MA 1UT6A 3OYDA 5DHAA 2RGAA 3HB7A 3I9FA 1L7MA 4J0JA 1XMOB 4DF3A 4B3JA 1ES9A 3ID6C 1WGLA 1H3FA 2G72A 3CUTA 3D6FA 1WBDA 3AQIA 2VRWA 1T39A 4RTMA 1HDGO 3F8SA 3JD2A 4BEWA 2WZJA 1YDMA 4AJEA 4G5GA 4HZUB 3F47A 1SELA 3NP9A 3S81A 2HWJA 3TWOA 3SDSA 3IIKA 2WT4A 5JHGB 3MUFA 1DBIA 3QOFA 5CDTA 3VO2A 4B7FA 4UUBA 1ZMUA 2RI6A 4G0UA 5F5LA 1M34A 1JKRC 3NT4A 4RYDA 1TUBA 5HIMA 4CETA 4MQVA 5EJGA 2RCNA 4O08A 2FMIA 3TJZA 4G8XA 1U2RA 4IZZA 4NOOB 4MHTA 1QZYA 3UQYS 2IIBA 4N3AA 4LK0F 3GO4A 4G7OF 5ER6A 5F7ZA 1E92A 4B45A 2YJ4A 1HW1A 2V4UA 3DM5A 3B3JA 4CKEA 2W11A 1R8XA 5BUCA 2PSFA 4KACA 1GXSA 4UHJA 4B2IA 2XMZA 3NDPA 4JBNA 4ZAXA 4F2DA 3AUFA 2O23A 5HZMA 3DHYA 5G3YA 2INGX 4TZTA 2OGTA 2K9NA 4W5JA 4EB6A 1DGFA 3DKWA 4BMSA 4OJYA 2L9SA 1MJNA 4Q1FA 3OD5A 5CD1A 4KHPM 3SIPA 3E5UA 5FBKA 1KEWA 2JAXA 3V1KA 2DA1A 2P0EA 4Q9KA 2CHFA 2NPOA 1KS2A 3KYLA 5CBPB 2REQA 1TT0A 1OX5A 4Q6BA 1KC1A 1H2XA 1C1YA 6Q21A 1IFXA 3ZD6A 1U5TB 1GGNA 5K01A 1Y6ZA 5ENDA 5D00A 4MUJA 5K6TA 3ZY2A 1EESA 1E3WB 4NXMB 2YIMA 1UXHA 4RFSA 4DV7M 1LS1A 1RBMA 4OINF 3WGYA 1DSSG 2J33A 3GLGA 3JRXA 4D8VA 1OVGA 4G25A 4KFRA 4QXRA 1N75A 2O0MA 5ALWA 4RJKA 4NBVA 4QPDA 1J24A 1SB9A 2RHJA 1UK7A 3DHVA 1K3UB 3QPHA 2RH4A 4BPRA 1QH0A 1LDMA 3ZNOA 1YK1A 5FPQA 3TKAA 1INLA 5M5WJ 3V8PA 4Y8VA 4ZAGA 4IMJB 3RRMA 2GCOB 1GQ2A 4GICA 5D3MA 3RVDA 5JU6A 2P9QA 2F6CA 4C76A 2J7OA 4CKWA 1RHRA 4AYBA 4H9GA 2DH6A 3R24A 1JHAA 2Q3MA 4DYRA 1LVAA 2ZXEA 1U9IA 4CEIB 3PGXA 4PAWA 2FZWA 3F90A 4IEFB 2IXSA 4E6EA 1ID1A 3MC1A 2Y2VA 1IUOA 1XF1A 1PJAA 3NKVA 2F9LA 1DWUA 3ZHTA 5BYKA 1QH9A 3HDQA 4QLAA 4MV3A 4D8TA 4B3MB 4IHVA 3CKYA 1O58A 2W6ID 2X0EA 4LJSA 4YA6A 2AHRA 2V0GA 4LXXA 1RQGA 4BKOA 3BY6A 3SLRA 1XZHA 3B3AA 1AKNA 3EYYA 2ZMEB 4C3HJ 3ZCUA 4HRVA 5AUNB 4ZVLA 2DHQA 1EUZA 4AICA 1E2HA 2QTVB 1IHOA 3IVCA 1RQLA 5L6LB 4KQHA 3IG8A 4LB5A 4FFSA 4CM1A 3QM1A 1L4EA 2AN9A 4IOKA 4GYKA 1FEXA 5JSQA 1OFGA 3FFAA 1RXSA 1YZQA 3WKAA 5DHPA 2AW5A 2HMAA 4B5KA 2W8ZA 1L1ZA 3BTOA 1ZVJA 2VH2A 3BCSA 1MRNA 5I9IA 4UAVA 3FOFC 4Q4JB 5L8RF 3UCXA 2NYAA 3HOVJ 2YCBA 4AU1A 3WLFA 4IOLA 4M9UA 3Q2KA 4QAQA 3D1JA 2PXHA 1N6PA 4HO1X 3PCTA 1UKVY 1EBUA 1F12A 2P75A 1HZZA 1DXYA 1GGKA 3ZJYA 2CXQA 4GS5A 4YJFA 5A3VA 5LHIA 1CP2A 1Q77A 2DODA 3GQ5A 4HR7A 2PUAA 3EGOA 4ZC8A 3CDLA 3FCEA 2WTUA 4L9RA 4RKEA 4DLPA 4Z99A 3OT1A 1E9FA 4J0KA 3BQ9A 4ROSA 4L85A 4KXNA 4O4IB 3AEKA 4JLBA 5EZGA 4KRXA 4LXUA 1HNNA 4PNHA 2ZRQA 3PCRB 1KQNA 2F1IA 3S4YA 1WVRA 4BY1J 4DMKA 4QAJA 1KAMA 3VU1A 4KYUA 3H3UA 4NS1A 5AVUA 5KOIA 3P20A 4K6GA 4R40A 4Z2AA 3IBYA 3E1GA 5M5YJ 1H6BA 3KKMA 3PIPF 4NZ9A 1QE5A 1M1NA 2R00C 2GO1A 1DADA 3EUEA 5IYZF 5K2MA 1P3DA 1C9DB 3F3XA 3R7LA 4NXNB 1YYVA 5CFQA 2B99A 5CX1A 3ZV4A 1P33A 2QI9F 4KPGA 4PO1A 3QODA 2UXBB 1HG0A 3WA7A 2DW4A 3VTAA 4HADA 3DC2A 4PNPA 2V0NA 4M6VA 1FFSA 3FPEA 1CF7A 3TS1A 3FNHA 3M9WA 1ZSVA 5LQUA 3SF0A 1O57A 2WM8A 1NV9A 2ZRMA 4OI4A 2A05A 3O2NA 2GEFA 2BZ0A 3J80S 2VBFA 3IA2A 2BFMA 1O7FA 3W06A 4GQBA 1S72I 4UZEA 2LVPC 1KOLA 2PMEA 3I4YA 2C99A 3R0JA 3TWLA 2M2IA 5CJ2A 4TL7A 1G8KA 3AEXA 2CXXA 5FTWA 2Q0OA 1AO0A 3HO8A 3EN0A 4R1NA 3S6JA 3EXAA 5E6UA 4KX3A 4G6ZA 2FW8A 4KIJA 2R5ZB 2XXAB 2VPYA 1U7OA 5DN6A 1X7DA 3IAHA 3N6VA 1A8IA 5GVSA 2Q62A 2XCLA 5FOXA 1AMOA 3BE6A 4LLNA 1FFBA 3ETNA 4XLTA 4D9EA 2E6UX 1B72A 1NXVA 1IMOA 1KH2A 3EGXA 4H31A 4QNRA 1XYYA 5DBGA 1KIFA 1ZIXA 1P19A 1QPMA 2GN1A 4QPJC 2JIRA 1Y5IA 2WKQA 3KKLA 1QZXA 1GUZA 5CJPA 2QLMA 4U6NA 2CXPA 3BH6A 4Z4QA 3MWJA 2ZBRA 2R3SA 3KP2A 4RD3A 2YX4A 1O0CA 2W83A 1ONBA 2OGZA 3S0JA 2I9KA 3NHBA 3REGA 2O7VA 3UATA 1K7CA 3UMVA 4I98B 1LDNA 2BZ1A 4PLFA 4RZUA 3QFFA 5KVQA 3BTIA 2B69A 5EERA 5KPJA 3H5LA 1H0RA 2H5IA 5B1EA 1RPWA 3OI7A 4GLFA 2YUIA 4FJ0A 4FS3A 5JS1A 3L0SA 2LDXA 4WXEA 1GKYA 5KWEA 2QGNA 1A69A 2X8JA 2VHEA 4BLWA 4BQFA 3PHLA 2X1MA 3GH3A 4YXWA 1J5EM 1KU7A 3I8XA 4X3PA 3BX1A 4LF6