3PFIA

2.7 angstrom resolution crystal structure of a probable holliday junction dna helicase (ruvb) from campylobacter jejuni subsp. jejuni nctc 11168 in complex with adenosine-5'-diphosphate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
301
Chain Sequence
LRPSNFDGYIGQESIKKNLNVFIAAAKKRNECLDHILFSGPAGLGKTTLANIISYEMSANIKTTAAPMIEKSGDLAAILTNLSEGDILFIDEIHRLSPAIEEVLYPAMEDYRLAQTIKIDLPKFTLIGATTRAGMLSNPLRDRFGMQFRLEFYKDSELALILQKAALKLNKTCEEKAALEIAKRSRSTPRIALRLLKRVRDFADVNDEEIITEKRANEALNSLGVNELGFDAMDLRYLELLTAAKQKPIGLASIAAALSEDENTIEDVIEPYLLANGYIERTAKGRIASAKSYSALKLNYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Holliday junction ATP-dependent DNA helicase ruvB
publication title 2.7 Angstrom resolution crystal structure of a probable holliday junction DNA helicase (ruvB) from Campylobacter jejuni subsp. jejuni NCTC 11168 in complex with adenosine-5'-diphosphate
rcsb
source organism Campylobacter jejuni subsp. jejuni
total genus 86
structure length 301
sequence length 310
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05491 RuvB_C RuvB C-terminal winged helix domain
A PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain
A PF17864 AAA_lid_4 RuvB AAA lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3pfiA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3pfiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pfiA01
2F43A 3BE4A 3ZZTA 1JR3D 3R8FA 4I7HA 4Q66C 1NN1A 1G3SA 3PIRA 4HB2A 3TNFA 3GLHA 4K2EA 1XJQA 1G3YA 1J2XA 1EV7A 3DFGA 2AS5F 3P9KA 2H16A 2UKDA 2ZJ8A 3EIQA 5BQTA 3WTTC 2BMJA 1YZLA 5EE1A 5D4RA 3G73A 2L4MA 5E1XA 3TO7A 5A5GA 1OH6A 4P4SB 4WWCA 1AGPA 2J0VA 3ADBA 2AK2A 4KDPA 4M9SA 4OHWA 2WV0A 5CLSA 5FTJA 1E79D 1RVDA 5J8FA 1T3SA 2EU8A 2GK6A 1C1KA 5ICCA 1GIAA 1PLKA 2LCFA 3KTAA 2QM8A 2XV4S 3LA3A 2WICA 3DPUA 1LV7A 3S2WA 3OEHD 3KQHA 1XXHE 3FOZA 4AKIA 1UKVY 2RQPA 2A2ZA 2JT1A 3KKNA 5DSZA 1Q44A 3I1FA 3TBKA 1FTNA 3Q9LA 4HSEA 2IRFG 3K0CC 3THWA 3COAC 2PZGA 4W5WA 3K1NA 1GDDA 4B48A 3HHGA 1JI0A 2C03A 1XD8A 2W6JD 2HCBA 1DADA 1MT0A 2XJ9A 3AF1A 3H84A 1G5PA 3VEPA 2GZAA 2IUSA 4WF2A 4KMFA 2N46A 2JDIA 2Z0MA 2MBFA 1IOZA 1I6XA 1R8QA 3QKTA 3T15A 3J81K 3ETLA 3GLIE 2CYYA 2XXAB 1E1RA 3I73A 1XMAA 1VECA 2IXEA 4LYJA 1HT1E 2F1RA 3D3QA 4HAYA 4E03A 4Q7KA 1KDPA 3RNLA 3BPVA 1VTNC 4TL8A 3WODF 1VCOA 2C04A 1CS4C 3AV0B 2IT1A 3MSXA 3ICEA 1IF1A 4XWOA 4OI0A 2PEXA 2VOPA 1FL9A 2ZETA 1R22A 1G6HA 4XWKA 3V7CA 4ESBA 4ENJA 5DYMA 4FHTA 3K09C 3REOA 2E1NA 2D2EA 4EFMA 3ZVLA 4GZMA 3U4QA 2WJIA 2P6TA 3RRYA 5FOWA 3WGGA 3GPLA 1UPTA 5TXGA 3KJEA 3M0EA 5EXTA 3LWFA 2IK8A 2Z43A 2L54A 4Z54A 2JATA 1N6NA 2CJWB 1KI6A 3IGFA 1ZC3A 1KI8A 4JVNA 2ISYA 1VYVA 2XRNA 2SHKA 4CGZA 4YONB 4PQFA 4DEYA 3I3SR 5E1WA 2Q3HA 4LFUA 5CVVA 4BZPA 4RB1A 1G7SA 2J5PA 4LJ6A 4B34A 3B02A 1NLZA 2V8OA 4QHTA 1G16A 4B75A 1NHAA 2WMNB 1EXMA 1M6NA 3KKQA 1U0JA 2FEOA 4LJ8A 2QG6A 5KOYA 2CQKA 3QRFF 2VHQA 4BFXA 4AIKA 1Z6RA 2H27A 2QORA 1I5ZA 3QF7A 4WA7A 2R2AA 1J99A 3TAUA 5DLQC 1HBXG 4ASUA 2L4AA 5E95A 4ZYHA 4ZH4F 2P7CB 1OIWA 1TQ6A 3KJIA 1TQPA 2AK3A 5HLIA 2OZUA 4A6EA 3LNCA 3RS2A 2H09A 1DAHA 4NMMA 1KI7A 3P9IA 1B6AA 3HRSA 3GLGA 2MLKA 4LLGF 4LGWA 4UVAA 1P2TA 1PLJA 1T9HA 2GAAA 1BKDR 4HQMA 3EPKA 5JR3A 1T5LA 2XSZA 4ZDWA 1DTSA 1N6HA 3AP1A 4M71A 4XBFA 4EJSB 2I3BA 3ZH9B 2EFWA 2DFTA 3SEAA 4A9AA 2PEZA 5EE9A 5L8VA 5BOXA 4CEIA 4UV8A 4L9VA 4R2HA 5DH9A 3B60A 2DHRA 5H6QA 4NZYA 2D4HA 1JGSA 2E87A 3QPWA 4KFTA 4DKXA 4W7SA 3I5XA 1U2RA 2QL6A 3HDTA 1E0KA 1XN7A 3V8JA 1WQ1R 2ZRGA 2JLWA 3KLOA 3GJ6A 2HEOA 3FMOB 2FE3A 5HE8A 3TW8B 2QQ9A 2WOJA 4I02A 4U02A 2ZUCA 3VKHA 3V7RA 4HDQB 1P3JA 4MNUA 1MR3F 2QBYA 3RC3A 2QRZA 4D80A 1F4KA 3RRMA 3R7WB 5HKKD 3TOBA 1MJBA 1XSXA 1SKQA 4M74A 4IXMA 4TT3A 2ZJ2A 3LQRA 1FOEB 2F9LA 1NBMA 5F9HA 2P0EA 2Q3FA 3V8KA 2RN7A 3U2RA 1R4AA 1G4DA 3A6PC 2WHXA 3ASYA 1HSTA 3CZPA 2PN6A 1GILA 1YJ5A 3MFKA 1XCVA 3O8BA 2Y75A 1E2FA 3E6BA 3BJ6A 4QKQA 4HEJA 4DT1A 1RRCA 2ZRHA 3DOFA 5CVRA 4LV5B 3DKVA 2HTSA 1JXOA 1KSFX 3HYIA 4Q5SF 1I1GA 3ZMUA 1DG1G 1RJ9A 2J59A 2EK5A 3TOAA 2V1DA 1A1VA 4BHBA 2IS4A 4LPSA 3GXOA 5AJYA 4DUGA 5IRCD 4Y17A 3K0FB 2YWFA 1U2WA 3DPLC 2F7SA 3HYRA 2OT3B 4IEIA 1AZSC 4LX0A 1N5KA 4FCTA 1ZM9A 2OXRA 3CKLA 3L82B 5J40A 2O8XA 3NIBA 2RGCA 3TKYA 4TYWA 3ZMSA 1XD2A 2LKPA 2PMHA 3GLHE 1C1YA 5D8LB 1NG1A 5FD6A 5J8CA 1Z29A 5IDVA 1BI0A 3VHLB 1OH5A 4Y0VA 3T06B 1P4AA 5CM8B 1JR3A 3TIFA 5AUNB 2VP4A 5CB6A 3F0TA 2F5DA 4PPNA 4C0JA 4L0ZB 3KW6A 3RPUA 3GEEA 3PR1A 2ODBA 1GUAA 5B2ZA 1I27A 1FQKA 2H1LA 3D8BA 3AJIB 3QU3A 5BMZA 3NHAA 2ODEA 3C1DA 1KO7A 1Z2CA 2J0QA 2VP2A 4Q9KA 4Q4HB 1VCNA 1Y63A 3ZQJA 2BM0A 2Z83A 4YG2F 4HUTA 2B8WA 1R1UA 2IYRA 2Z5FA 5A2QZ 1R5GA 1T8TA 2OAZA 1KNXA 5D6FA 4I1OA 4MGYR 3OEHA 4DCSA 1WF3A 1NG9A 3A37A 4RKFA 3IILA 3EIEA 1DP7P 2ZE8A 3KB1A 2O61A 4K81B 2MSCB 1FNMA 1LTQA 2PEYA 1XCMA 1WSUA 1XTKA 4OKSA 1R7JA 1G3IA 3K1PA 1NL3A 1SFUA 1VIYA 4NCNA 4LHWA 1YR6A 3GFTA 4LCBA 2W6JA 3BWDD 3NTUA 5GJBA 1DELA 2OSBA 2Z5UA 4GMXA 4U00A 3SJZA 5JFGA 1FWZA 4TLEA 2IEZA 1RUNA 1X86B 1TF7A 3CTAA 4QGFA 1NY6A 3GZ6A 3WGIA 1KHTA 1NVVR 1QBKC 1QRAA 2R7DA 1R0WA 2JLRA 1WXQA 1MABA 3K9GA 4JLMA 2E7WA 2DBYA 3QU6A 2BEKA 4BQAA 1I4DD 1DDNA 1ZLKA 2NQ2C 3HJNA 4OYHA 2XZLA 2HYDA 3QPVA 4DSUA 2FFHA 2HZTA 1B0UA 2G0NA 1G8YA 3U3KA 4XD7A 4IXNA 1Z9CA 1ZG5A 4OIQF 3P20A 2J46A 2OEPA 4KLZA 1WRBA 2WWXA 3R9IA 4LD5A 4MYTA 5HCIA 2YC2C 3QG5A 4RFSA 3U5ZB 4P33A 1XSDA 2ZNZA 1QHXA 3W9YA 1N0VC 3IHUA 1T5IA 1S1CA 2VH5R 5JRZA 2W57A 1Z1DA 3DEUA 2IYWA 3SDZA 3AGQA 3MCZA 3NBZC 2QQBA 1OV4A 2XX3A 5EP1A 4GZLA 3PV0A 1XCGB 3DMNA 2P6UA 3K70D 2J5XA 3RKXA 3KFVA 5E18F 3U6BA 4QFMA 1XMJA 3FFBA 5IT9Z 2WTUA 2ZI5A 3EZFA 1SD5A 2H6BA 1FTSA 3ZS8A 4EGZA 1KQ0A 2DW4A 2AXPA 3MUFA 4GNKA 4TTPA 3H92A 1E2DA 3VB2A 1NVVQ 4B33A 4D0NA 2CL0X 1RI7A 5A2QK 5IK2D 3AVXA 3HSRA 3TUIC 2HKOA 2Q6TA 3CO6C 5DEQA 1K79A 2IF0A 1P2FA 2R6GA 2ZROA 1LDJA 1N6PA 1J5YA 2CWEA 3R61A 4IRUB 2ZANA 4HW0A 4A36A 2P3SA 3Q3JB 3UANA 4JIMA 3LQQA 2ZKZA 4HUQB 4RGSA 2RGAA 4QBIA 2GA8A 3UWOA 4EFLA 2IS2A 1AIPA 3WBJA 3M8FA 5HPYB 4OHZA 3THYA 4WBSA 2HS5A 4B2LA 3I58A 2FE4A 2YYZA 3CRRA 1ZP6A 1UM8A 2JIZD 3R60A 1GNRA 3DM5A 5BN4A 3H1TA 4TZ6A 1S2MA 1IJEA 2PMKA 5B57C 2CHVA 4BFSA 4G1UC 2PBRA 2G3YA 2ZR0A 4EJSC 4KN7X 1F2TB 4G7ZF 2QM3A 1MGTA 3W3AA 1U6GA 4Z8XA 4MRRA 2AKAB 3FWEA 1FC3A 3SZPA 1WI9A 3U3JA 1H8HD 1J90A 3LXXA 4HZIA 1P9NA 4KHZA 5ILSA 3QXSA 4R71A 3OESA 4F7WA 4US2R 4DCVA 5LB2A 5GVRA 1HKQA 5EZ5A 4BAYA 1P2SA 2RH5A 4CZZA 2QROA 1K8RA 1NBME 2FU4A 1ONBA 2CE2X 5HKKA 3HPQA 1ESMA 1ZJ6A 5H20A 4YFKF 2Q0HA 2YV5A 3WBKA 2ZSBA 2RGXA 3WU0A 5FTLA 3WGHA 5J6XA 1U90A 2GXSA 1E4VA 2OV2A 4RVCA 5JRJA 1H9TA 1W36B 1XEWX 4C0BA 3TQCA 4KIBA 2PJZA 2ZSFA 4KNYA 1L0OC 3EX7C 2H5EA 2QP9X 1JPNA 1VKJA 3B7GA 1FZQA 2O8DA 4ETSA 2X77A 1YG2A 2IXFA 4BASA 2M5WA 2PLYA 3SYNA 4D4KA 2DPXA 4JBYA 2ZYWX 1F2UB 3TO9A 1MZBA 4KUMA 1U8YA 4WVFA 5E7JA 2IYSA 2PJRA 1W2GA 2GJ9A 2OFOA 2EW1A 1XMKA 4KLNA 1EFRD 3N4MA 2YWEA 3AKYA 2YU3A 1KI2A 1M74A 3QEJA 5KNCA 2BIFA 2R7FA 2YSRA 1JR3E 3ND8A 1ZRFA 1HYQA 1KDOA 2XAHA 3B1VA 4GP6A 3EUHA 4CT5A 2VHTA 1SZPA 2GK7A 4GBMA 3M1EA 5DD8A 1PLLA 3BFVA 4RKEA 3PENA 1W49A 4L8GA 4WOPA 1NY5A 1GRNA 4BRUA 4X8OA 4XSHA 1YE8A 3B82A 3RS4A 4ZIRB 3PJRA 4S35A 3TGPA 1FYMA 2XTZA 5F9FA 4A2PA 3T1OA 4WXHA 4ZCLA 1EX6A 4TL9A 4B76A 5DYIA 5IHPA 3NDPA 1DAMA 2GF0A 3Q7PA 2NS0A 2IJLA 2NIPA 2X19A 4YXWD 4TLDA 4I81A 4YFXF 3SXYA 3AVOA 1UFQA 3BXZA 2GF9A 4PSAA 2V9VA 3T34A 4CEJA 4LC1A 2OXCA 2FOKA 3ZMDA 1LDDA 4U0VA 4TMWA 4TYQA 4TYPA 4MEXF 4F4IA 2KIUA 2C95A 1SVMA 1Q1ZA 3AF4A 1E2PA 5H6RA 4H1VA 2GBLC 5L3SB 3KQUA 4Z2YA 1O3RA 3PXGA 2AN9A 2W0SA 5JJLA 3X2SA 4RGUA 1U94A 2FXAA 3E6DA 3U61B 1EGAA 3KXLA 3WE3A 5F6FA 4B8XA 4PO9A 1J8YF 2PZFA 5TARA 3GP8A 2K5UA 3JTGA 3KJGA 3EYIA 4O3MA 4MTDA 4CF7A 2ZS8A 3JW4A 1BMFD 2KSQA 2QT0A 2REOA 1TX4B 3Q9VA 3NQOA 1P72A 4AYXA 2OBNA 2WJHA 4NE2A 3K8YA 2ZRKA 2EB7A 3E5HA 3AAFA 2ZJZA 4KVAA 4U88A 5GJWC 2ZI9A 1G17A 2O0KA 2VODA 1OYYA 2W2XA 4JQFA 5JWOA 1COWD 2ZI6A 1IW7F 5JI2E 1ZRDA 3L0PA 3QBTA 4Q4LA 4XVQA 2NAZA 3WTWC 1YRBA 2ZRAA 3NC0C 3A1VA 1RNLA 1H0MA 3HR8A 3LVQE 4B43A 3ZP5A 1AQYA 1DAEA 3H4MA 1XRJA 4ZDKA 2YR2A 2DQLA 3L00A 5HS9A 3TDZC 1CEEA 4NCKA 1T98A 4NYJR 1R6BX 2Z6VA 4LSGA 3GJXC 2R65A 3F6VA 5ILUA 1D5CA 1XEXB 4UKDA 2C9YA 4G6DA 3OIUA 3CF0A 2MH2A 3V7SA 3EG5A 3LSTA 3GJ4A 2QVOA 1GKIA 4WZ6A 3SU8A 3UIEA 5JSZA 3C14C 1XB2A 4JSTA 5LPNA 3CRQA 2ZR9A 1FW6A 4GXOA 4R79A 5AIPA 1LS1A 2W6IA 1NVWQ 4A12A 1DUXC 1EG7A 2UXXA 4QHYA 3OOPA 2ODWA 4MH0R 2PCLA 3RS0A 2IHYA 4C7OB 1M7HA 2FN4A 4JSYA 1SD7A 4DDTA 4KV9A 3WMFA 1TU4A 3OFNA 4DDVA 1OPCA 3ECOA 4W5HA 3V4FA 4M22A 4MDEA 3BH0A 4V02A 4EFNA 1QF9A 1SVLA 2GRJA 2HJGA 1GAJA 1W7PD 2PG4A 5DUIA 5BW8A 2N1BA 1IN8A 4OI2A 1QPMA 1BYIA 4E22A 5JS7A 4EM0B 1AJEA 2CO5A 2AFHE 5KUTA 5DN6D 4WAUA 3KZZA 2ZU6A 3FMPB 1J7KA 4I0AA 2C5LA 4PSKA 2IW3A 4TMZA 2R6FA 1O7LA 5G53C 5F2EA 4TTRA 1XB4A 3V00A 1CBUA 4HAVA 4NYJQ 3O8DA 5TV2A 1K78B 4IVRA 3HU1A 1W44A 2V6ZM 3LD9A 3RS5A 3CUQC 3V9PA 5HR5A 2JIZA 5D3MA 2WKQA 4DLYA 3SQXA 5F64A 4MYHA 1NI3A 2ETHA 1ZG1A 2P6RA 2JEOA 4HZUB 1XDBA 3VX4A 4AY2A 4Y15A 2B0LA 2NRAC 2HT1A 4LV8B 1HW1A 4AIIA 4BEBA 1GSIA 3L9FA 1RKBA 2J1LA 2PT7A 1AWCA 3JSOA 3U6KA 2VRWA 3FMSA 4U0WA 3W6KB 2FZLA 3SI7A 4DLXA 4CEHA 4CDGA 4Q1CA 4M0LA 3QPTA 2XASA 1RW4A 4RAZA 3WE2A 3JVVA 3KL4A 4JLNA 2QE7D 1ZGJA 4PZYA 1E3MA 3F8NA 2OFWA 2WIAA 1N6LA 3GWZA 4R98A 3S1AA 1WKMA 1E4YA 4DIEA 5FTMA 5L3CA 3ZGXA 5L3QB 4OQFA 4ZCIA 1A2KC 2VL7A 4JYBA 4LBWA 1DPRA 1GHCA 4MKIA 1GL7A 4OL0A 4XJXA 5C2JB 1U0LA 2V6JA 4KITB 3EW9A 3AVVA 2DK8A 4ON0A 2DPUA 1PV4A 4LBZA 3E97A 3GFIA 4DLSA 3KP3A 2K27A 3FDIA 4N1AA 4L9WA 5HS7A 4QM7A 4X8LA 4LHZA 1W36C 2WMOB 4M6YA 2ZS7A 3RDPA 1HQCA 3K0AB 2D7CA 4UXIA 2F5EA 4GITA 1N6OA 5KDOA 2ZYUX 1DS6A 2ZQ5A 1P9WA 5DYGA 3SFZA 3E70C 5FPHA 2CXXA 5JLJA 1FQJA 3FKQA 4LJYA 2O03A 1VHLA 2ZBKA 1AZTA 1N6RA 4G5QA 1EFRA 2FPMA 1SVKA 5AK0A 4FCWA 5AJXA 3K53A 1KI9A 4A15A 3EPHA 1HKTA 4Q4ZF 4B3XA 1X1SA 3E1SA 4I4LA 5LGNA 3FMIA 2GZDA 5AUQA 1WWXA 3M7GA 4CT4B 5LLQA 1STZA 2GWHA 2JJ8A 5TY0A 1R0YA 2L02A 4Q4JB 3EA5A 1ZM3A 4M1MA 5DHFA 3EDPA 1ZNYA 4L5BA 1P6XA 1FY7A 3CH5A 4XTRA 3WHKA 3ADCA 4AD9A 3ISPA 1OXTA 1G7RA 5J5CA 4HV5A 5FO5A 1W0JA 3KFXA 5AJVB 4AURA 5CJ9A 4EMSA 1XGSA 4GCVA 1G7CA 3OHMA 4IRIA 4LHVA 4YXWA 3VFZA 3W90A 4DB4A 3TUZC 2OCPA 2J0UA 2A5FA 1KO5A 5FLXZ 3IRQA 5FPSA 4X8HA 3VFDA 1MJAA 4FT8A 4ESJA 3M1IA 4O0MA 5DCMB 4ZYDA 4GYGA 1I2DA 4BRWA 2BJWA 1OYWA 4XLNF 2J7PD 4HF1A 2GXAA 3EYYA 4LK1F 1E98A 1EH7A 2H7VA 2CBZA 2NPIA 1Z6GA 1UDXA 4O25A 5CVUA 1T0FA 2IHBA 5F3WB 4V0OA 2J5OA 1JEDA 2GCOA 2NPFA 2VEDA 4D4JA 3MGCA 2XOKD 3NH6A 2JJ1D 3Q72A 2MA3A 2O8EB 3ZMVA 2F1HA 3RANA 1TTTA 3Q5FA 2RC4A 3MAJA 1MV5A 1BMFA 2QMEA 2R62A 2CLDX 1IXCA 2ORWA 2IUTA 1DAGA 1RC8A 3FMQA 4I1SA 2KJQA 4II7A 4MKFA 4A0HA 4PTLA 2QT1A 3VR2A 1ESNA 3IEVA 3Q7QA 1U0HC 2GDJA 3LWNA 1JJ7A 1XD9A 3GJ8A 2GJ8A 5JJKA 2QPOA 1XEFA 3I32A 3K69A 4HF2A 3MCAA 2MSEB 5DE3A 2JLVA 4N9IA 1ZU5A 3LRPA 1G20E 1COWA 3EA0A 1OXXK 4HYYA 4QBGB 1FX0B 1H9GA 4L15A 3OV8A 1CTQA 1W4RA 3W34A 2OLKA 2IA0A 3QEOA 4EGYA 1Z6XA 2GVZC 3UKDA 4JLPA 2OM2A 2ORIA 1SXJA 3I0TA 5LHGA 1LY1A 1MO4A 3SJBA 1IXSB 2OA4A 1XX6A 3KEQA 4DCUA 2IPQX 1VYUA 1G1MA 2CJWA 3QPHA 1E2IA 3GEHA 2JLZA 1ZNWA 1BIFA 2RHDA 5AUPB 1MD0A 2FV8A 2ZPTX 1SMTA 3AKDA 1XXHB 3LLMA 2QZ8A 2IF2A 4ILEA 4D82A 1IY1A 2BKEA 2ZRLA 4B44A 1GRRA 5HLGA 4I09A 1GWNA 1KU7A 1QQIA 2F2EA 3RC8A 3E5UA 3N97A 2DY1A 2NGRA 4ZI2A 3HTSB 3F5FA 4TWZA 3SJAA 3R9XA 1Q1EA 2D74A 1FBQA 1S1MA 3W5JA 2H94A 4OI1A 2OFXA 1LF0A 1R5OA 2M30A 3QVUA 3GLIB 5JCZA 5FLXK 3P7NA 4YMWA 1W7PA 1OT3A 4WXPA 3Q9SA 1TEXA 1REPC 2VO1A 4OK3A 1YKSA 5K8LA 3ML6A 4URXR 2F5FA 4WZAE 5CM9C 4EQ6B 5DN6A 3SQNA 3QBVA 4TL6A 1E99A 1TPZA 1MDMA 4PQYA 4GSYA 1NVUQ 5FUYA 2FA5A 4NU0A 3M9AA 1RRGA 5FUWA 4MKGA 2FRHA 5AJWA 2D3WA 4EJSA 5BWMA 2MC3A 1J75A 1KO4A 2WWHA 1BM9A 1Q57A 3LH5A 3ABUA 3TDUC 3E2IA 2D1VA 2P4WA 3U1DA 3Q85A 5DGXA 2OQRA 2Z99A 4IFBA 1HE1C 1OFHA 5E1ZB 1T0JB 2OCBA 3BJIC 3OIYA 2HQRA 3QKRA 5CK4A 4DLZA 1U78A 2O8BA 1IZ1A 1RFLA 4OIOF 3HRMA 1X8KA 2GXQA 3KP2A 1IY2A 1SAXA 5GJVC 1ZLJA 2W84A 5E20A 4AKHA 1NIPA 5E8GA 1HT2E 4LHXA 1W7AA 4KIGA 1XTRA 3DL0A 4C0HA 3SHWA 5FPKA 5J4VA 2EQBA 1BN5A 1YRAA 3F3XA 4P4UA 3WNDA 1FT9A 1E9CA 1YHNA 1OXUA 3AUYA 3AVYA 5EE0A 1J59A 2QE7A 4B74A 4FWGA 1ZYRF 2QYOA 3TK1A 4NCIA 4LRSA 4R8HA 3BJOA 3PQKA 2QAJA 2R6CA 1VPLA 3HRTA 3R7WA 4B09A 1F48A 3B9QA 4BHCA 1SD6A 3CNLA 3T8TA 5FD5A 3CZQA 3N2IA 5HZKA 4PPFA 3GEIA 2EV5A 1UAAA 1WBBA 2FDCA 1W36D 3JAMZ 4IHTA 5SZJA 4UV9A 1E94E 1FFHA 4LOAA 4PSVA 4DNCA 2HT6A 2I1VB 4M4SA 3PVSA 4G9YA 5ANRB 1ZUIA 4URUR 1W2HA 2D06A 4ZO4A 1S4QA 2WJYA 4TL7A 1U9IA 2DWPA 4URWR 4TTQA 5L3DA 2PBIA 2P6NA 3I8XA 3WTUC 3K0FA 2ZJ5A 3LVRE 3QKSB 2FFQA 3JZMA 3OF5A 4F38A 3I71A 1BC7C 3MD0A 4Q02A 1ZIPA 1PZNA 3QQ5A 4Q9LA 4BYYA 1NVMA 1USTA 3I61A 1F9NA 3DXJF 1R8SA 2VPPA 4A0FA 4CO8A 3MMPA 4XSZF 2CVFA 1YO5C 1E9SA 2CK3D 1UJ2A 2QU8A 5FUXA 4Y0AA 3IIMA 3IHLA 3BOQA 5FFXA 2CMKA 2F1IA 2RGNC 5FR2A 3H3UA 1Z2AA 5EEGA 5CIWA 421PA 1F1ZA 5KPJA 2WKPA 5JEEA 4RD4A 3X1WA 2VYFA 1TF2A 4Q4HA 4CW7A 1R5BA 1OB5A 3T5DA 1BJAA 3IIJA 4MKHA 2DK5A 3AVPA 1KYZA 5FOSA 1D9ZA 1P75A 3WNBA 2D7DA 1DEKA 2FG5A 1ON2A 1VHTA 4B73A 2A6EF 3N5CA 1OR7A 4NYIR 4DHEA 4MDFA 2HXSA 4GOKA 5FBLB 4OHXA 4YFNF 2VT2A 3QY0A 3SR0A 1P6RA 4EPRA 1F5TA 2M8EA 1PP7U 1MOZA 2IYYA 5JZVA 3CPHA 1KU2A 3MQ0A 5K5QA 1SULA 1JAHA 2OHFA 2P65A 5LB4A 3PUVA 4OJKA 3FE2A 1EESA 2VQSA 2DU9A 1US8B 2ZYVX 2ZJYA 2GKSA 2XOKA 1B23P 4MUBA 2JJ1A 2L01A 1ZMXA 2ZRDA 5BS6A 2JGNA 2XHKA 4A0GA 2HEIA 4IDQA 1OKRA 5BQ5A 3R0JA 3HIFA 3PITA 1X6VA 1Z91A 3CDHA 3JAMK 2ZUDA 4IVNA 4FD2A 3QVVA 4POAA 4W9MC 1G291 2F43B 3QJYA 3HP1A 1G6OA 4CICA 2DQRA 4NL4H 5DO9A 3ECHA 4BPBA 3GLHB 4BLSA 3RDIA 5HVQC 5LHHA 5KDDA 1I1SA 2WOOA 4HAZA 3FTQA 2WWYA 1ZAKA 1XBTA 5EEHA 3ADKA 2P5TB 6Q21A 4ACAA 3F8MA 3PUWA 1JECA 1IQPA 3ND9A 1G8HA 2CLSA 4HB4A 4QRHA 2GXGA 1SXJE 2HYGD 3RKWA 3T5XA 4ZYEA 3GYHX 4LBYA 2FBKA 4YMSA 5JS8A 3VNVA 4A5MA 4NYIQ 4D0LB 3D7MA 3L0IB 4C4PA 3BORA 4UXHA 1E1QD 2F3RA 5JMTA 2FBIA 4F7ZA 3N70A 3UK6A 1V3FA 3UMSA 2GNOA 3BB4A 3T1TA 1T39A 3PUZA 1RRFA 2CNWD 2RHMA 4KICA 3KJHA 1FBSA 1AK2A 1BO6A 5FBRB 3I54A 3DF8A 4LDJA 1YTYA 1YZKA 2A5YB 2YC4C 2RMKA 4GYIA 1CR2A 2BBTA 1X3SA 1HA3A 3KKMA 2PJPA 1GVJA 4M21A 3WTZA 1U5TC 1KY2A 3CPJB 5BYKA 2QAGA 4G5GA 5CDFE 2XAGA 2HDNB 3A4LA 2YOGA 1AS2A 1Z07A 2F9MA 2R6AA 2EFCB 1IAWA 1G19A 4HI0E 1OH7A 1U99A 3G5UA 1XTIA 3B8HA 4JLJA 1FPMA 1YQAA 1CR0A 5K8IA 3LFUA 4M1WA 4BLPA 5A0FA 3C5HA 2G88A 4FMCF 1H8EA 4NKRA 4WXRA 1M1YE 3N2EA 1KSGA 5DD4A 3P32A 2VHUA 1W4MA 3IKVA 2A30A 4XSGA 3T1VA 4B3DA 2K7LA 3VHXA 3IBYA 1XGMA 4BHPA 1Z6YA 1T38A 1KAGA 4QJ3A 1YZNA 1W4CA 1WBDA 1ZHFA 3A4NA 3CR7A 1RUOA 2I1QA 1N5LA 3U4QB 2GQQA 1NLFA 2HXYA 4KN4X 4Q21A 2QENA 2BE5F 3FM5A 2D2FA 1C0WA 1M7BA 2A5GA 2FSFA 2KB0A 4DDUA 2ONKA 2ZJAA 2LWIA 2WWIA 2PL3A 3BOSA 5TRDA 4ZZLA 2UXNA 2P5SA 3S1AB 2NMVA 1CRQA 1E79A 2DT5A 1HE8B 1Z63A 3RAPR 3AP2A 4MRSA 4A0RA 4C0KA 2VBYA 3R6SA 1FSHA 1A5TA 1OFTA 1EFHA 2A61A 3PEYA 1TNTA 1P5ZB 2ZM5A 3TVDA 4PZJA 1T3LA 4ON9A 4HYEA 4GDFA 1VG1A 3L2OB 3LBNA 2GA1A 2IYVA 4GO1A 1A2BA 3PUYA 1KJYA 5C46F 4UXNA 2VOOA 2W00A 3T5GA 3L8ZA 2ZAOA 2HKXA 4PDKA 3CW2A 1P9RA 1HTWA 4RY2A 1KSJA 3QE0A 2A9KA 4MHGA 3KQKA 5ICFA 5C18A 1WB9A 2JLXA 2CHGA 4IDOA 3MFYA 3WRYC 1QZYA 4HDUA 3WTXC 2QTFA 2FEZA 3E6CC 2ZXJA 2OBMA 3BC1A 2EFNA 2PI0A 4N0DA 4US1R 2P2LA 2DFNA 3FHCB 2VHCA 4DIDA 5IT5A 4A6DA 2GEVA 1AQUA 3OIVA 1G9XA 1LNZA 3QKUA 1UHWA 3HSFA 1BIAA 2IYLD 5HCNA 1IN4A 5ELXA 2E7XA 1T91A 4EJVA 3AM1A 3GFMA 2P5VA 2MH9A 3W6OA 2MMGA 1Z0JA 2L3DA 4NP6A 1CF4A 5FBQB 5HDGA 4E70A 4NH0A 1F2UA 2FSGA 2AWOA 3RS3A 4ITRC 3LO5A 2ZRMA 3QENA 4CEIB 2B21A 4A4DA 1KNQA 1N2CE 1ZREA 3B1ZA 2BBYA 5J4KA 1Y0UA 2JLSA 1P62B 2OLJA 2FSIA 3KQLA 3GFPA 4A2QA 3GZ5A 1UKYA 2XUBA 2A78A 3IO5A 4TMTA 1S8FA 5FPTA 2COMA 2HV8A 3L0SA 2F1JA 4OHYA 1ZRCA 3AQ4A 3DPTA 4LLLA 2LNBA 2VA8A 3HOTA 4M73A 4JL6A 3W6JB 4UUVA 4EJTA 2PMUA 2EJRA 2QQAA 4UNQA 1KY3A 3U7EB 4S2EA 3DQVC 4ZIRA 5GADl 5TVKA 3HTUA 4OIPF 1BH2A 4URZR 3W8NA 5L3RA 5CYVA 4I1UA 1FP2A 3LY5A 1G3TA 1FYKA 2VSOA 1S3GA 1YR9A 3A4MA 4DC9A 4LG0B 3B85A 3AKCA 2HYIC 1GM5A 4PAQA 5KNBA 1KTVA 3EWAA 4R7ZA 1KK2A 3DKWA 3AB3A 1S3JA 2QPAA 3NRVA 4ZDIA 3BZ6A 3CH4B 1L4UA 2QGNA 4LV6A 5HLHA 3KUDA 3VR5A 3T8RA 2Q3MA 1HY3A 1ZCBA 3GLGE 3MLEA 3KQNA 5KDLA 3AVUA 2K86A 3LW8A 1JQJC 4P0TA 2JASA 3FB4A 2XGJA 3DM9B 3VU9A 4C0AC 2LSOA 1RJ9B 1JHFA 1TEVA 3WTVC 3CUQB 4JK1X 2ZYTX 1A04A 4OU0A 4WXCA 4JJKA 5FOUA 1KYIA 4FWHA 1SVSA 4BLOA 2QTHA 3HRUA 1K6MA 1KK0A 3MJRA 1YR7A 1OLOA 1NN5A 4PR0A 1RRPA 4AYTA 1UBFA 4HAUA 3THXB 1J70A 4FWTA 3LA7A 3Q5DA 3RHFA 1YVDA 3ZYCA 1MKMA 1XD2B 2A69F 1FUUA 4JLAA 4B6FA 1RZ4A 1LNWA 3QI2A 1K5GA 1OYIA 4Q1EA 5KHOC 4PO8A 4Q00A 1TQMA 1G3UA 5FUVA 4RB3C 4LPKA 5L3EA 3E6MA 4PZZA 5FFMA 1JXMA 2DO7A 1E9FA 1S0UA 3O8RA 4TYYA 2XTMA 1I2MA 4DLTA 3GLXA 3D5LA 1KJWA 1Z8FA 5JI6A 1XNJA 2QQ0A 2QP3A 5LDDC 3NKVA 2W83A 5FH9A 1EK0A 2VC1A 4OIRF 3K0EA 4YMUA 1IBRA 2WTEA 1VIAA 1M2OB 3LXRA 4LJ7A 2RKHA 2NO9A 1JAIA 4HDVA 2XITA 3LLUA 4W5JA 2X1VA 1YW8A 2ZRPA 1E1QA 2V54A 4UJ3A 1QHNA 2R9VA 4IHQA 1QHGA 4WW0A 4PC6A 5D3QA 2EWNA 1XEXA 3OAAD 4BNCA 4RGXA 2G1JA 3JZAA 2CNWA 1LDKB 2A3RA 4YMVA 2HR3A 2HJVA 5EJEA 2C99A 1TL7C 3ROUA 2KKOA 5H1YA 2RKOA 3A1UA 4G5SA 2EFDB 4KBFA 3L2CA 2UVQA 1OKKD 4FWIB 4NONA 2IEYA 5LRSA 4I99A 3GJ0A 2ADUA 1QO0D 1K7AA 1QHHB 4LJ5A 5CLLA 3R9WA 4C7OA 2JPCA 2ZE6A 4A8JA 1EFTA 4N3NA 4TLBA 2QRNA 2CSOA 4BECA 1CXZA 3ZN1A 1UF9A 2H57A 2XNDD 4US0R 3K9TA 3DHWC 3NEUA 2ZO4A 2DWOA 4TSFD 4IF4A 4UNPA 1T2KA 1PUJA 5DI3B 5JJIA 1DAKA 1KMHA 1MABB 4LYHA 4Q1FA 2HDCA 4U7BA 4EIWA 2O0JA 2VP6A 1Z0KA 4R1HA 3BB3A 3HWSA 1GG2A 1XZPA 4P32A 3CNNA 1ZVQA 2NNNA 2HQNA 4HX8A 1A82A 2NO7A 4PZLA 4DSNA 1ETUA 4R9UC 1QZXA 1X8LA 2JLQA 4PHFA 4E07A 4EPXA 5L3GA 2HF8A 2ZRNA 1PVOA 1XGNA 2ZXUA 4IOMA 4RFSB 1K78A 2XB4A 3ZIAD 4ZKEA 4EV0A 1YLFA 2GXBA 2WKRA 1XCBA 1CF7A 5DUKA 3EC1A 5EE5B 1CJKC 4DRZA 4RCYA 1G64A 1XFAA 3GMTA 3E5QA 3LBIA 5KSYA 1G4AE 1E2JA 1O87A 2KIMA 3K0CA 3P1JA 2RAPA 1ZIOA 4ZPXA 2AFIE 1IAQA 2BMFA 1YZGA 3K9NA 1GL6A 2PLRA 1TW3A 4RS8A 3NHBA 4KCGA 4Q4AB 1CJTC 2O5VA 4WZBE 3A36A 3VTKA 2Z4SA 3ZN0A 4NYMR 1W0KD 3CUEF 2LF8A 2KIFA 3W8RA 2FPLA 2YOFA 5L3QA 4Q03A 5AWFC 4OJQA 4TMKA 5DHAA 3IPXA 3FXRA 5KSOA 1S7OA 3THOA 3BIFA 4Q01A 2W25A 2Z9OA 4MRNA 5P21A 4DJTA 4IJAA 5BN3A 2HCJB 3P27A 3L09A 4DCNA 4H9GA 3K09A 4IOJA 3QXJA 4JMPA 2CE7A 3D0SA 3VX3A 4B47A 1YZUA 3M4YA 1W48A 1U98A 3FHZA 3LX5A 4X8MA 1FP7A 4G5OA 1OIXA 3B13B 1OFIA 3ABTA 1FYLA 2VP5A 5E8IA 2ZTSA 3ZVMA 4RB0A 1G21E 2BV6A 3LAJA 3KKPA 5K8UA 3K0AA 2DFKB 1XDSA 3GLFA 4WK8F 4G7HF 1VTKA 2Y8EA 3VR6A 4A0ZA 1HURA 2ZITA 4MGRA 1KK1A 5AONA 3F21A 3TSZA 4DLRA 5G41A 1XDUA 4BEJA 5FBVB 5JI3E 2IBMA 1HW2A 1II0A 1II8B 2ZREA 5EUQB 3U9GA 5BYJA 4EAQA 3P4XA 4Y13A 2A3SA 2D1HA 2XVCA 3GFJA 1KGSA 4ZYGA 1V5WA 2YZ2A 5CVJA 4DCTA 4Z51A 1LB1B 3EZ9A 1L3LA 3U44B 3RSOA 3CLOA 3B9PA 3AEZA 2C6YA 4LJ9A 1EH8A 2RV8A 2ZMEA 1XMVA 4IOLA 2VXZA 1OFUX 2JA1A 4CVNA 4L9SA 3IUYA 5KK1A 3JVUA 1HQYE 4Q4JA 1GOTA 2TMKA 3MWYW 1R5NA 4PHHA 2KBFA 2KJCA 1X37A 1G5RA 2Q21A 2FOLA 2UWMA 4M6XA 2ESHA 2B8TA 3JSPA 1E32A 1ZUHA 2UZ3A 3QF4B 4FN5A 1ZARA 1BI2A 4EQQA 3F23A 1G18A 4IVPA 3QP5A 2OAP1 5IK2A 4PAMA 4EM2A 2ZU0C 5HS8A 2DCUA 2JZYA 3VOEA 4LUCA 1PDNC 1E69A 4QL3A 1AA9A 3F8CA 4I01A 4A5NA 2FU5C 3NEJA 4JBAA 4GOXA 1WMSA 4NBSA 4Z8YA 4NDZA 3W3ZB 3PEVA 4UNRA 4F92B 2O8DB 2VN2A 1E2HA 3C7KA 2X2FA 3FF5A 4KYIB 4QGHA 1QBJA 1KIMA 2IA2A 1H65A 4QHSA 1PJRA 4Q9IA 3O3KA 3WP1B 4EKDA 4MEYF 1ZM4A 4S05A 3T1QA 1LF5A 1YYVA 3OE7D 2WJVA 3UMRA 3V8LA 3BDDA 2O8CB 1FSEA 3AF3A 2NO6A 4LBVA 2FSHA 4P55A 2C78A 1GKUB 1A4RA 2STWA 1TTYA 3KP7A 1WP9A 3KB2A 5JWRA 2FMLA 5CJ2A 4HAMA 3R0AA 4AWXA 3B1YA 4CRWB 4OK6A 3ZZ0A 4Q18A 4N9HA 2YJTD 3DZ8A 5ERIA 4LK2A 1MRNA 4JYCA 2FQ3A 2CDNA 3KFWX 1G8FA 1NMZA 4D2IA 1X1RA 2AXLA 3CO7C 3CO5A 5K5OA 2O3FA 1H8HA 1O57A 2WVJA 2W24A 3BERA 3NXSA 4FINA 4PC2A 5JHHB 2V3CC 1LQ1A 5H70A 1U8AA 1WCV1 2IW5A 4L18B 1M34E 1FX0A 1TBXA 3DEFA 4UNNA 4TYNA 3ZDQA 2RGGA 1Z83A 1SKYE 2FGKA 4M1SA 4XH9B 4BZXA 1Q1QA 4HQEA 1E96A 4L9JA 3FPAA 4O6JA 1OIVA 4JVSB 1N0UA 3TJZA 4AIJA 1S6LA 5BPDA 1KZGB 2ZVQX 3SFVA 2F55A 4EPWA 1UFMA 3P4YA 3K0SA 3VNUA 3WTSC 3B5JA 1V4RA 4AK9A 3BFXA 2OILA 4R2IA 1OH8A 2HTJA 4FX0A 1TQ2A 2M45A 3GJ7A 3HHHA 1XXHA 4C30A 3RYRA 1DAFA 4IEEA 3FFAA 4G94A 3DVLA 3GCGA 4EPYA 1NIJA 4MYUA 1OKKA 3SZRA 4QG7A 4JS0A 3AVTA 2K02A 1RIOH 5LEKA 1IN6A 4XWAA 3F3YA 4LHYA 3L8YA 3U7FB 3ZVRA 1D2EA 2PQ8A 4HV6A 2QM7A 5FTNA 4Q7JB 3MHVC 1ZG3A 2VBCA 4A1FA 1XZQA 1KJZA 3TKLA 4YIFA 2XNDA 3GLIA 1UADA 4TSFA 4GL2A 2IYQA 3V4GA 5HE9A 1R1TA 4DEXA 4IJMA 4A6XA 1J2JA 1FZPB 3CLVA 2RDPA 3ZMZA 3EWSA 2WPDD 4AYWA 1KU3A 4I98B 1VCMA 2EV6A 2CG4A 2GJAA 2YWHA 2NO1A 3FZVA 4B71A 2ZE5A 2O8FB 4B3GA 3EETA 1IRGA 3IPYA 4P4SA 2Z33A 2XB2A 3CJNA 4JBWA 2RB4A 1E9EA 2VIIA 2R3SA 5F1RA 4H0EA 1OE0A 3P26A 3X1XA 1KI1A 4OQMA 1D8KA 5KNDA 4OBEA 4BGDA 2LF7A 4WCGA 2EYQA 1MO3A 2QY9A 3HSEA 2A5DA 3SJCA 3BB1A 4JT2A 2ZAMA 1E0JA 5H68A 1ON1A 2G9WA 1SHKA 2ZRBA 4KI0A 4RD2A 2IUUA 3KKOA 3GQBA 1QNTA 3U60B 5JSZB 2G6BA 3TSOA 2KRKA 2QSZA 3UG6A 2F6RA 3PEWA 4JLKA 1Z22A 1CJMA 4FI3C 2RCNA 3BH6A 1W0KA 1S8NA 2BV3A 2IVMA 2PLFA 1K6OA 1P2UA 3LA6A 5AR1A 3H86A 2MLGA 5KTYA 2JPBA 2G1KA 2BYVE 2XXAA 1CU1A 4ASUD 1DPUA 4FIDA 1S9HA 2CL6X 4BXUA 1BYUA 4P4TA 4OI4A 4A3VB 3GD7A 4P3YA 2CLCX 3QXCA 4DBLC 4E09A 3AH8A 4N0BA 2PH1A 1XMIA 1E0AA 4OOIA 5G40A 1Q1HA 4HX4A 4G6QA 3GLFE 1CIPA 3SE0A 3I62A 4IVQA 4FMDF 5BXQC 2IX3A 1DBSA 4NPHA 3UATA 1KU9A 1OXVA 3QOFA 3M8EA 4KYWA 3AVQA 4CZ2A 3DZDA 5EQTA 3TSWA 2WWWA 3QKSA 1DARA 1D8JA 2V1XA 3MEXA 4IPAA 1W1WA 5D5WB 1DPFA 1KAOA 1TMKA 2V6IA 2AD5A 3LFKA 3H0KA 4M9XA 4PC7A 2ZUBA 5D3MB 5ILVA 2DB3A 2BEOA 3FGNA 3UXMA 4HA8A 4L4UA 1R36A 2HYFA 4YIIA 3AUXA 4TMXA 1XSVA 3LA2A 1ZGAA 221PA 1C9KA 2J7KA 2C98A 5EP4A 3QPUA 2OAQ1 4XRFA 4QXAA 2ZE7A 4CEHB 2ORVA 1U5TB 2VLIA 4KXFB 2FA9A 4LJZF 1OSNA 1CULC 4HLUC 1GZSA 1XTQA 4O2RA 4MGZR 4XLPF 2QPTA 2H92A 4Q1AA 1XJ0A 4A2UA 4KFSA 2IS1A 4KSBA 5FOXA 2GA2A 4QGAA 4BE7B 2HWVA 2PCJA 4FCVA 1L2TA 2FEMA 1NBMD 1XEWY 2REXB 1DAIA 4TLAA 2EVWX 2GHIA 4Z1MD 4TLCA 3I59B 2Q9BA 1PP8F 4G5RA 2NNYA 1YZTA 1W5TA 1ZBDA 1FPQA 3MWKA 4KMUX 2QSYA 2BBSA 2VE9A 3DKPA 4BLTA 1S9DA 4A82A 4BFVA 3VLFB 4LC0A 3HU3A 1MH1A 1R23A 2ZI3A 5DDGA 2ZR7A 3T35A 2M1BA 1OJLA 1TW2A 1KGDA 3IWFA 2K4JA 1SVWA 2VBZA 1R58A 1GTVA 1Y3AA 1JXSA 2XAJA 3KZYA 1Z5ZA 3GFOA 4FMCB 3EIHA 4JLDA 2JLUA 3OE7A 1JBKA 2CCJA 1US8A 4U5XA 4G01B 1LEBA 1TAGA 1TF5A 1ZNZA 3L0OA 4NCJA 3U3OA 4ERNA 4KU4A 1R00A 1XPOA 1NSFA 4RGRA 4LJAA 4LK0F 5HTKA 2NO0A 4HF0A 3ZMTA 2V55B 3FYHA 3SZTA 5ED4A 3B6EA 2W58A 4M1OA 4FX4A 4PC1A 3LBHA 4UNSA 4ARZB 3TVTA 2WJJA 2VTKA 5LD2C 1XPRA 3LAWA 1Z6TA 1LJ9A 1Q3HA 4RZ3A 3REGA 3WYAA 1HXDA 5FTKA 1GFIA 2DYKA 2EWWA 2R8RA 1GXPA 2A07F 2J9RA 3CB4A 3NG1A 4G0NA 4M8NE 3OEED 5KPDA 4ESFA 3CONA 1FP1D 2GXUA 4Q9HA 2KE5A 4ESVA 4JL5A 4BFZA 2AXNA 3EQLF 2ELHA 4BLRA 2R6DA 1OB2A 3C5CA 1VYTA 3CR8A 4BWYA 4PHTA 4V0KA 3F6OA 2WAXA 1JNYA 3CWZA 1FLIA 2J0UB 4IDPA 3TH5A 4EJUA 1L8QA 1L4YA 5E17F 3IQWA 3ULQB 4XOIA 5EUMA 4RZ2A 4DLVA 3KZ1E 4IDHA 4RCZA 5E7IA 4C9BA 2VF7A 2YX7A 1D2NA 1D8TA 1DE0A 5EP3A 1S29A 3BS4A 4M9ZA 3C15C 1ODDA 5D5VB 2D62A 2NZJA 2M87A 4HOBA 2O6GE 1GNQA 3NWJA 3A8TA 3NVAA 3L7WA 1EFCA 4L5JA 3TR5A 4JN6A 2GCOB 4M1TA 3IHWA 1ZM2A 2W85A 3BROA 1NF3A 4KAXA 2JAQA 2CCKA 3KEOA 1YFHA 2UZIR 1Q3TA 2EWVA 5HZHA 2QP4A 2CHQA 3RPQA 2EFGA 2OZ6A 4HX7A 4OQNA 4UNOA 5FPYA 1T6NA 4LGMA 2BGCA 2H18A 4C0LA 3MWLA 1CRPA 3C16C 5DI9A 3I5YA 4B3FX 2DAOA 4BZQA 4ZZDA 2B6HA 5JVTA 4XD7D 1PUEE 4S04A 2WPDA 4A2WA 3PFIA 2FWRA 1O3QA 2UZKA 1KOFA 2BWJA 4CIDA 4QLCU 1XWIA 4HDCA 4LI0A 2ZRJA 2QN6A 4LY6A 2X8AA 2EFPA 2EFHB 1O3YA 3RRZA 1IRFA 2A6HF 1A7JA 3CIOA 1SXJB 4WIAA 1LVGA 1FMJA 1ZUNB 5E4FA 4AI6A 3SBEA 1OMIA 2HOEA 1IN7A 3VKGA 2GBLA 2OE2A 4ZKDA 3GUDA 2FMYA 5B64A 1IXRC 1KQ9A 1NMXA 2RVCA 3EZ2A 2AD1A 4TQ9A 2VONA 4QOSA 1XCPA 5CIQA 1JR6A 3CRVA 3DV8A 3RYPA 4QC2A 1EX7A 4A0YA 2IYXA 2O52A 3WYGA 5JEDA 3C4JA 2JRTA 4HB0A 2J7PA 3AVWA 5D5UB 2ANCA 3CRMA 1NMYA 3K9HA 4YMTA 4M53A 1S3SA 3E5XA 2AKYA 4ZI3A 3GEZA 3K70C 3VODA 4ESHA 1JPJA 5D5XB 2E1RA 2STTA 4KIFA 3ZS9A 1UBGA 3RWOA 4G8XA 4Q7MB 3TRFA 4D4MA 2OBPA 2OU2A 4DVGA 3PCRB 5LRRA 2PX3A 1HW5A 3WY9A 2HLDD 1XJCA 4A6PA 3QUSA 121PA 2W2TA 1Z0DA 1W7PB 1P2VA 1EWRA 3IDQA 4NTZA 3J81k 3B1XA 4D0GA 1DG3A 1HEIA 3B78A 3LX8A 1BOAA 2NOAA 1LW7A 2QMUA 1XPUA 4HAXA 2P5LC 2P8TA 1MDMB 2X0LA 1W4BA 1KKLA 2ZJOA 3I64A 1TUEA 4B3CA 4BUJA 4DXAA 5EXXA 3SHFA 1JQLB 2QLZA 5FGMA 1J0RA 4Q7LA 2B7CA 4Q1DA 2GETA 4D25A 2OO7A 3QG1A 2OBLA 1CR1A 5C1BA 4L0YB 1KI4A 3AF2A 1QHYA 2IYTA 4PC3A 3RLFA 5D6EA 3QKRB 4PANA 3CF6R 3KTAB 2LKCA 2ERYA 3CM0A 1CGPA 3VR4A 4D26A 1E2LA 1P7CA 2Q9AA 4GPTA 2EFOA 5AIQA 1NVXQ 3O47A 4XTCS 3RIRA 4KODA 4NCHA 3VAAA 3GJ3A 2F5CA 2QQEA 3KXKA 3THWB 1AN0A 3NBFA 2XZPA 3I53A 1ANKA 2JJ2D 2QNRA 3CX6A 1TNSA 1WQ2A 3IIKA 4JVMA 5AUOB 2MD5A 3HYTA 1FMLA 2GWRA 5TJJA 3EPJA 1DOAA 1CLUA 3Q8XB 1R2QA 4KFUA 2WWGA 3TE6A 3IWZA 2KJBA 1QDEA 1BIBA 1B9MA 3K9LA 4OK5A 2XAQA 4LG0A 2FGJA 1Z3IX 4PO1A 1BC8C 1G41A 1QVRA 4V03A 4F91B 4GMDA 4HAWA 4LRTA 4D0PA 3UMFA 4HATA 4Z1MA 4P5OA 3ZQ7A 4BH9A 1E2QA 4BLQA 5LGTA 5J47A 2D2WA 2VBWA 2GCPA 4HUQA 3C18A 4B6EA 4PCQA 4JZKA 2WC2A 1ZD9A 5FI0B 1JHHA 3CUQA 2DI3A 3LV8A 4RSGA 3BP8A 3WXMA 1YU9A 2YPRA 1WDTA 1N6IA 2RGDA 1UBEA 2PT5A 4MGIR 3Q5EA 4URYR 3QXHA 3VMFA 5DNYB 3UPUA 3MJHA 5FFZA 2IYUA 1OXSC 1IJFA 1XTJA 4GRAA 4YLGA 3THXA 1T6SA 2FH5B 4OQLA 4U0YA 3PG5A 1V43A 1KI6B 1F2TA 4MA4A 1TLHB 2RNJA 3BPXA 3QXXA 3RKYA 2G7HA 1VG9B 1ZD1A 1U8ZA 721PA 5FB2A 1SVOA 4PXAA 4IRHA 1SFEA 1YW7A 2AR7A 5EE3A 3BK7A 3T1BA 2WAYA 1NN3A 4QJ4A 1BI1A 1NSTA 5KU1A 1NP6A 4PFSA 3FM3A 1G3WA 1B9NA 2FJUA 521PA 3JTHA 1OHHD 2B7BA 2YHSA 2ODNA 1IONA 4AG5A 2BCJQ 4AIHA 5B30A 1SFXA 4I2OA 3TUJC 4BFTA 2VBXA 4PGHA 3OEEA 1R5HA 2BMDA 4UVCA 1G3QA 2ZEJA 4DDWA 1HSJA 1N5IA 4DSTA 1T4GA 2WSSD 2BBOA 4M72A 2IA1A 3KP5A 4LRWA 4F93B 2A7QA 1QG4A 2FF4A 2E1CA 2KWIA 1QZMA 4TMVA 2TDXA 1E9DA 5FI1B 5SZIA 4M1KA 3O8CA 3FXQA 4NQWA 4JBXA 3CWQA 2YKGA 4C2UA 3KE2A 4LJ4A 1G8GA 5FOTA 5FL7A 3KCCA 2C77A 2GTPA 3GLGB 3A1TA 1G3RA 3HUGA 1X3UA 2GESA 1D5VA 3QAHA 3TR0A 1J9IA 1VG8A 5C4GB 4O5VA 2OCYC 4PPQA 1IY0A 4L5IA 1QHHA 1QVAA 4RZUA 4YQFA 2BM1A 2IYZA 1NKSA 3C41J 1W4AA 4XVRA 1W5SA 1R0ZA 4M1YA 4RD6A 4CYMA 5AJZA 4UVBA 4AD8A 5KO2A 4QNMA 3WNCA 4ENKA 5DI3A 3RS7A 5JECA 2K4BA 3MAAC 2QUZA 3QNUA 2IT0A 2CK3A 2G83A 2G9NA 5DCFA 1JALA 4Q48A 3VR3A 3FKSD 4DLUA 2QMOA 2QBYB 1U3EM 1ZNXA 2GEUA 2VP9A 3G82C 5CJPA 1HUQA 1ZM7A 2H6CA 1QGPA 2HFHA 3B2EA 4WXDA 4JKYA 5FL7D 3CF2A 3U3MA 5J4LA 1RE0A 1ZAOA 4EJOA 3A58B 4NHOA 5J4YA 3ERED 1Q20A 3F8BA 3PQJA 4M2LA 4QWQA 2GAUA 1MJ9A 1VDZA 1AOYA 1Q22A 2OG2A 2GZWA 3EZ6A 4XSXF 5M04A 2W2VA 5ICGA 2GZHA 2DTRA 3BFKA 1OPXA 1JB1A 1SXJC 2VSXA 2DFLA 1SVIA 1E9RA 4B35A 4DT1B 4Q4AA 5L3SA 1ZINA 8OHMA 2OESA 2ZRIA 1MRSA 1G8PA 2H8KA 1R0XA 1WRJA 4RZXA 2BDTA 5L3VA 2ZI4A 2W6ID 1I4LD 1I4TD 3IKJA 1KI3A 2QAGB 2CW0F 3W5IA 3LW7A 2ZFWA 5JHUA 4JL8A 2ZIAA 2ONJA 2E9SA 4P31A 4B32A 4B2IA 3OFND 1W46A 1UHMA 4O2LA 3H2YA 5EXSA 4HB3A 2JLYA 1PUIA 3DO6A 2AWNA 1ULYA 3KP4A 3BY6A 2HLDA 3C3WA 1ZYUA 3CX8A 5TMPA 4QNRA 2FBHA 2RGBA 1R7RA 1Z47A 3RVBA 3F8FA 2YINC 4YDSA 2JSCA 4JJZA 2QA5A 2J87A 1TADA 1AGRA 4V0MA 5CYPA 5CB8A 3G3ZA 5FL3A 4BFWA 5IF9A 3NBXX 3IKTA 2BOVA 4KO8A 2AL7A 2FSWA 3GF2A 3GVAA 2ZRFA 4Q9JA 3NDBB 2J3EA 3QOPA 3ZD7A 3NBYC 3U7GA 6PAXA 3ZLJA 3SN6A 1ONVA 3EXAA 2OD5A 2QEQA 2QI9C 4GOJA 2LKDA 1UB9A 2BEJA 2I4IA 3KDSE 1Z0IA 3I92A 1RYFA 3TO6A 2DPDA 3VKWA 1II8A 5LEJA 1E2GA 1LS6A 2OCAA 1NLYA 5DISB 3KP6A 3WMEA 4KSCA 1Q1BA 4EDHA 3EPLA 1RYHA 1DO0A 5CITA 2CCGA 4HLUA 2VSFA 3U44A 3E3VA 1Z08A 3PUXA 2FFAA 4I0BA 1XD7A 2V9PA 3CX7A 1NN0A 2FX3A 4KT5C 2ECKA 3AGPA 2XGXA 1Z0AA 2V4ZA 1G4UR 1VCIA 3PQCA 4JKIA 4L9TA 3RWMB 2V1UA 1SHZA 2JJ2A 2P5KA 1DVRA 1P60A 2BCGY 5UKDA 1IUYA 2R44A 3U7HB 4IHSA 3K1MA 1AM4D 1D9XA 3X1DA 4HLCA 2C96A 1CJVC 3FVQA 3QF4A 4DLWA 3R4KA 4QM6A 2IC5A 2P6SA 1KDRA 1R1VA 3FHOA 2DWZB 4IXAA 3SOPA 1R10A 2XNSA 3RRNA 4DQ2A 5EZ6B 3BGWA 4ENMA 4KBGA 4PQRA 5A4JA 1ZN2A 2V7QD 2C9OA 4TZ0A 4GT1A 3KX2A 2DZNB 1C4OA 1N25A 5IT9K 1KMQA 2DBBA 1MKYA 1IXZA 5J4HA 4P9UA 1QG2A 1F5NA 3OZXA 2IS6A 3GW2A 1UKEA 3BRWD 4E5UA 2ATXA 4MQVA 2O8CA 1E6CA 1XMSA 3F22A 4K8OA 1U9IC 1S96A 3SBDA 4A92A 4ZDJA 2VT3A 2OZEA 3EC2A 4EPVA 3FX3A 1UDWA 4DSOA 2XAFA 4EM1A 3V4RA 1N6KA 1ZW6A 4MUAA 1F3OA 2ZSDA 4HZUA 3W6NA 2REBA 2EV0A 5IT3A 2ZI7A 3EASA 3FMFA 5CLQA 3R8CA 1MO5A 1ELOA 3J80Z 4V0NA 4BFYA 4K46A 1SQ5A 1FOKA 2YOHA 4BQSA 1M7GA 5JCPA 3I4LA 2YX4A 2HF9A 4P9FA 3TAHA 5FR1A 1QZZA 4TN1A 3GO5A 1GVNB 1XU4A 1AKEA 4IW3B 5C4MA 2DWQA 1GNPA 2WZQA 3CRW1 1OW3B 5JBQA 1OHHA 2FPKA 1JJVA 3ECCA 1W0JD 1YW9A 2WM9B 5SZKB 1XF9A 4LLNA 4A0XA 2WSSA 4IRGA 4TV7A 3WG9A 2ZSAA 3CBQA 4IKEA 1N5JA 4LYAA 4NHJA 2IWHA 3EAQA 3P9CA 3MZYA 5TDHA 1B1BA 4N0EA 4XVUA 2BVNA 5KYKA 2IA5A 1Z28A 3ZPLA 4JLBA 2QTVB 1N0WA 2VE8A 1BI3A 1B4AA 4RD3A 3D6TB 3X1ZA 4ASNA 3VU9B 2L0XA 3HR7A 1TQDA 3QP6A 1HV8A 1N3BA 2O0HA 4MRPA 4DWJA 2RGVA 4UHTA 5JFRA 2W0MA 4FMBB 4LYFA 5DIFA 4B2PA 3THYB 1YS6A 2P67A 2Q8KA 3BBPA 4AC9A 3SQWA 3H3ZA 1USSA 1Z0FA 3ADDA 4TQAA 3A1WA 3PEUA 2ZSEA 1LFDB 2GAOA 2GJSA 4ZCMA 3I72A 1CR4A 3I4PA 2XJ4A 4FMDB 1FX7A 1JEEA 4OINF 5D8KB 1F6BA 2RGNA 1ZH5A 2ACJA 2H17A 4M9QA 2BBWA 4JT4A 5FOVA 4C0QC 1NNEA 5KVRA 5HDKA 1O7FA 4NYMQ 5E3HA 1E9BA 2YVUA 1RZ3A 2HUPA 3HPRA 1Z06A 3SYLA 1OF1A 2EFEB 3NEYA 5BN5A 1ODFA 2QMHA 2O0YA 4RAYA 2XIGA 5L3BA 2Y48A 3IL2A 2FF7A 3IO3A 5KSPA 2RGEA 2J0SA 1TQIA 3FKSA 3LAPA 3KUCA 1KDTA 1KO1A 3ASZA 3WYFA 1FBUA 4GGGA 4WX9A 1BS1A 4Q1BA 5F98A 2O8FA 2B92A 4KVGA 4IDNA 3M6AA 2EFQA 2MMCA 3TQFA 4DB2A 3MWJA 2Z3YA 2ZCWA 1ZC4A 1SXJD 1J8MF 2J41A 1SKYB 3IBGA 3QIAA 2IWRA 5CVIA 2JCSA 4HBLA 4AVPA 1KA8A 4OMYA 1D3YA 3ELKA 4ZV4A 2BJVA 5GJCA 2ISZA 5LHIA 3J80K 1UEJA 4D4LA 4L16A 3IC7A 3J7AO 2A5JA 5DCMA 1Q12A 3CNOA 2D45A 4FWDA 4KFCA 5CYOA 2ASEA 1E2NA 5JHGB 1BBYA 1GKYA 2C8VA 2VC0A 2XAUA 3ZQ6A 2J45A 1P4XA 4GP7A 2NTYC 5EXPA 1TNDA 4ABYA 4A8JB 5H8WA 4UJ5A 5LBIA 1TQ4A 2O8EA 1CJUC 1YIOA 2YNMA 4AG6A 4D6PA 4CYDA 2FMXA 2BKUA 2QAGC 3O6BB 4HDOB 5LD2B 3RSLA 1VG0B 3RJPA 1KMHB 4V0ME 4RFVA 4PAOA 2EA4A 5BPIA 1KKMA 1QHIA 1TU3A 2XKOA 2QZ4A 1UKZA 1ZU4A 4HLDA 1DO2A 3HU2A 1AS0A 2WJGA 4HLYA 2BMEA 1BOFA 3K2ZA 1KK3A 2GJKA 1GRQA 1EH6A 5L3FA 4PPGA 3ZD6A 1S7AA 3TGNA 2CGPA 2MSDB 4RD0A 5CK5A 3TQNA 3DP7A 4IOKA 2XKPA 1YQTA 4F4CA 2ERXA 4JLOA 3TMKA 4BFUA 5KSZA 1LVAA 2DZOB 4FXPA 3TW4A 4JVLA 3WRXC 5K8TA 2WBLC 2ZJBA 3U3RA 1AKYA 1KZ7B 3HOSA 4EJWA 1CF7B 2JTVA 3D31A 4JLVA 4MITA 4PX9A 5GVSA 3G0HA 1P73A 4RB2C 1P4WA 2IL1A 4CEJB 3X1YA 1E2MA 3VQTA 3RI4A 2PZEA 4TQUS 3GJ5A 2NYXA 4LZZA 3OAAA 1YS7A 1HH4A 4MTEA 4LB6B 4CHUA 1O3SA 1Q21A 2VP0A 1QHSA 1U5TA 3KETA 5FBWB 2QWWA 4P96A 821PA 3QSYA 4FW9A 2KRFA 4ACBA 1EWQA 2CFXA 3B73A 4ENNA 1O3TA 1LB2A 1II9A 1UCRA 5LBQA 3ONWA 3TLXA 2HGCA 4Q47A 3FHTA 2JDID 2PFBA 2KBEA 4C0SA 1GXQA 2GIVA 2GVDC 1Z05A 4KA4A 3SC3A 3GX4X 1E1RD 1GITA 1M8PA 2BHRA 2KI5A 2XEXA 3AP3A 3LDAA 4J0QA 3R20A 2Q0OA 4C3ZA 2Y0MA 3L43A 3FMRA 4YC7A 3I59A 1MO6A 1K5DA 4B3BA 4URVR 1FUKA 1GP2A 2FFBA 3WMGA 4C2TA 2V7QA 2ESNA 1T0HB 1IHUA 2ANBA 1E0SA 3O2PE 1XP8A 2NZ8A 5SZHB 621PA 4HLXA 4EQ6A 5DV5A 3W6PA 1E2KA 1G6NA 1NRJB 4D81A 2OUKA 3F8TA 3UG7A 1RPZA 3GLFB 4CXFA 4LWZA 1GL9B 3WU1B 1KO8A 2ATVA 4KJZA 2A68F 1SMYF 3MG9A 2XROA 1YZQA 3ZIAA 2C2HA 1W47A 1YR8A 4AKGA 1P92A 3FWYA 1Q0UA 3WTYC 4MYCA 1E2EA 1WE2A 2Q2EA 2GCNA 4AKEA 5D4SA 1P4SA 3I8SA 4LMYA 4ARZA 2ZMEB 1XTSA 3CPEA 3K70B 2G77B 2NG1A 5ICEA 4H1UA 2FZ4A 4MQBA 2PMDA 5HDNA 2PX0A 3EZ7A 3RABA 4EVIA 2AX4A 1NKTA 3T0YA 2G0TA 4OHVA 2DVWB 2VHJA 4MGKR 3F72A 2QUFA 3VR1A 4EUNA 3BJAA 3BD9A 2G7UA 3T12A 4EPTA 1U81A 1VMAA 1EFUA 4KYUA 3MRSA 4OMZA 4PGGA 1FP6A 3BWGA 3DOEA 4QGGA 2ZVPX 4QBFA 1XGOA 1AS3A 4G3XA 4IFEA 5G3ZA 5E7MA 1NJGA 5LGUA 4LB5A 4I1VA 1KQ8A 4QBHA 4U7DA 2FNPA 3A1SA 3MWMA 2N42A 4Q19A 4MRVA 2XZOA 3T61A 1G7TA 3K1JA 2LDUA 3BH7A 5K5RA 2XSZD 1UEIA 1F60A 2ZRCA 1E2XA 3NC1C 4QJ5A 3IEUA 5JWHA 5HOOA 4Q5IA 3EARA 2EYUA 3FXUA 2CEAA 3ZVNA 5B58C 1E9AA 2F3TA 3BAFA 2C9CA 1KSHA 1ZCAA 3C7JA 3KXIA 3NH9A 4AWXB 3WHLA 4OQXA 3ICQB 1SGWA 2FNAA 2CL7X 2DR3A 1Z6AA 4YDHB 1IN5A 1WA5A 1D6JA 4L9NA 4GFDA 3AF0A 1CKEA 2YWGA 3IQXA 1LEAA 2AHOA 2P7VB 1KYWA 2WV9A 4RJLA 1NJFA 2WSMA 2V6CA 4G7OF 2BC9A 2WWFA 4MQ9F 4HZFA 3IRRA 1L7VC 1D2MA 1TUIA 2XTNA 4KFRA 1CP2A 2OQGA 3I5UA 4RD1A 4TT3D 2GEDA 3SS8A 4DZZA 2DLLA 4V0LA 3J81Z 1U8RA 4PHGA 2O8BB 5EP2A 1ZRHA 2DFIA 4HLQB 1UBCA 3DDCA 2IP2A 2WIBA 3ZJYA 2Q9CA 1IM2A 1ZD8A 2X4HA 2QGZA 1FNNA 2ZNYA 3KLNA 4GI7A 3B1WA 4UQOA 1Z7UA 4NB5A 1B59A 2X2EA 5TB5A 1P61B 2VF8A 3UWKA 3U2QA 3SYKA 1G3MA 1HKSA 4UXJA 3CUOA 3RYTC 1X8JA 4F4JA 3MZHA 3OIWA 3GFLA 3WP0A 3ZZUA 4DUGD 1RIFA 4XIGS 3C8UA 2CVHA 1T8UA 1JE8A 1SD4A 3DMDA 2ZS9A 2Z4RA 3AKEA 5CDFA 2GILA 3SNHA 1G5TA 2V79A 5K1YA 2EA2A 2IXGA 3REFA 3RTRA 1T3HA 5G3YA 4A8JC 1H8ED 3K0LA 1E17A
chains in the Genus database with same CATH superfamily
3AHDA 4I7HA 4S0ZA 1XJQA 1J2XA 2BMJA 3A05A 1PRYA 4PYQA 4B3RB 3VGJA 2WV0A 1MNEA 1XXHE 5TPWB 1S7EA 3OT4A 1PL0A 2QRUA 2YJ5A 3TBKA 2APLA 1FTNA 4HSEA 3I05A 5ELMA 1B8NA 2CXHA 1B26A 3CZCA 3DG9A 2CW8A 1E1RA 2QD5A 1HDCA 5IJ9A 2PEXA 2ZETA 5FRDA 3ZCRA 4ZVOA 5C9ZA 2E1NA 4FSDA 3LK7A 1UPTA 1QH0A 4GC9A 2IK8A 4JJIA 1KI8A 2D2XA 4PQFA 4DEYA 3KK0A 3KEYA 1RETA 4B34A 2J5PA 1BN7A 4KN6A 2O3SA 1VXOA 3KKQA 3URMA 3DE0X 5DNCA 5CP8A 3LUJA 4UM9B 2XA1A 2QORA 3DS8A 2AW3A 4P82A 1A2QA 1W1WE 5DWVA 2UUBB 1XMPA 3P5BA 4IMPA 1RWPA 2F8MA 1ZCFA 3JRAA 2FUCA 2YV4A 5HE8A 2QQ9A 4ZC3A 2BFMA 4F56A 2XBLA 3EAGA 3LQRA 1UFVA 1HYHA 2C9ZA 2IITA 4IHJA 3C3AA 3IEXA 3CINA 2OB2A 4KLCA 5FKOA 4CG2A 5J3JA 4EGCB 3SGLA 4LITA 4YK7A 3GRRA 3L5OA 2WFZA 5HXAA 4PPNA 5E6RB 3GEEA 3AETB 2H1LA 1HYGA 4DMHA 2W2NA 1QPGA 1R1UA 4KQKA 1R6VA 1IDZA 4MGYR 4NOJA 3A4YA 1WSUA 1XTKA 2JLBA 3SY8A 2XT0A 4N48A 4U00A 2O7NA 1RXEA 2L2QA 3WGIA 1QBKC 5IC5A 1DOZA 3WBFA 4EARA 4FBMA 2HYDA 1B0UA 4D99A 4FVTA 2JK3A 2WWXA 3RE8A 4ATNA 2QNIA 5H3HA 5BNZA 2IEDA 5K6AA 2YBDA 1WOMA 1HDPA 3P0FA 4MUGA 3ABKH 2P30A 3VB2A 5TMEA 4MW0A 4RTNA 4B7ZA 5BW6B 5IX8A 4GMGA 4QECA 3LT1A 1J5YA 2P3SA 4XR6A 4ENVA 3ILXA 5HPYB 1XFDA 1NMEA 1JKQC 1RJEA 2HWJA 1F2TB 4G7ZF 1MGTA 1J8FA 2AKAB 3LTEA 3A3YA 1H8HD 4E4YA 3G6KA 2AFVA 3OYLA 3FTPA 1K7CA 1VQOI 3O8QB 4HFMA 2RGXA 1F1JA 3F5MA 3JAMS 1TIBA 3B7GA 1YG2A 3V4PB 4Y33A 1RC0A 3K4PA 3CCUI 4KPFC 1DU6A 2B35A 2G28A 2R1VA 3UK7A 2BIFA 3W2AA 5IYZA 1KDOA 3W5BA 5AOBA 2XMBA 4LFAM 3CZ9A 4ZZ0A 4DQVA 2NZWA 2B82A 4HH3C 3K8OE 5ITRA 1MEOA 2G8LA 3ZHYA 3BXZA 3G2LA 5LJLA 2V9VA 3F0CA 4IKFA 3AF4A 4JB8A 3COSA 2GBLC 1SXGA 3P97A 2W0SA 2Y0CA 4HYQA 3C7CB 2CZCA 2K5UA 1Z16A 4O3MA 4K1LA 2KSQA 2PKCA 3LHIA 1MX0A 1R16A 4B4VA 1G17A 2X6QA 1XNRB 2XUFA 1COWD 1Q92A 3NC0C 1O97D 4B43A 3DQPA 4FB4A 3GZTB 4ZDKA 2OC4A 2UZ4A 2QSGX 2JXNA 2ICWG 4R16A 1T98A 4R8SA 3LUGA 4MPTA 2MH2A 3V7SA 1AB6A 3RU3A 2FI1A 3OZDA 4WZ6A 3C14C 1XB2A 4GLOA 1AUOA 3QHAA 4GXOA 4R79A 5AIPA 1SU4A 3I76A 2QV7A 1JAXA 1SVLA 5BW8A 5TPZA 3O8NA 4GX2A 1CY0A 2VT6A 1IBLB 9MHTA 1T6OA 2C5LA 4DGWB 4TTRA 3H0GJ 2L7MP 3IP4B 1IUFA 1M1UA 1B8PA 1RWBA 4ALNA 1ZG1A 5IM4F 1LRJA 4G0UA 2GM3A 1RKBA 3OLVA 2QN9A 4UREA 5HMLA 2VPZA 5TQ2A 1CUVA 1ZGJA 1WSAA 1ZKDA 5K05A 3MZ0A 3LPNA 5FSWA 2DMNA 3FOWA 4YNBA 3ROFA 3HI6A 1T15A 5HS7A 3OJXA 2F5EA 3F98A 1F7VA 5C81A 3SFZA 3EIWA 2CXXA 4X7BA 1Y1PA 2X5JO 4LNUA 1EFRA 3EPZA 4A15A 3LLSA 3P9NA 4JHXA 3D64A 5DHFA 2O3JA 1YAHA 3OF3A 4XOUA 3ETNA 3WHKA 1H89C 3EVZA 1G7RA 5FO5A 5AJVB 3FUCA 5CJ9A 4YXWA 4IRIA 2Z98A 5ENVA 4Q3DA 4O4LA 2I2FA 2Y9MB 2PRYA 4ZYDA 3TOCA 2OKGA 2G6TA 3UJAA 1ZA2A 5C5EA 2PS3A 2F1HA 2Q9UA 1TTTA 4D97A 4G0WA 3UBTA 2QT1A 1T3GA 2FX5A 3EEQA 1PVVA 4J7AA 1Y0NA 3W5CA 3PPWA 5HTOA 3B9RA 4CKZA 1YR1A 5EJCA 3WWYA 1E2IA 2FEWB 2ZK7A 1JQEA 3GEHA 1BIFA 1RWKA 2FV8A 4GR4A 5EG0A 2QHXA 4DUYM 3MXOA 2QL5A 1GWNA 4WLVA 3UJ8A 2O2XA 3N97A 3S3OA 3SJAA 2H94A 4OI1A 2HQOA 3GLIB 3Q9SA 2KT0A 4ZOLB 3ETGA 5I6DA 4URXR 3RKRA 3WJ7A 1R5LA 1RRGA 5J58A 2C5FA 1IZ1A 3DXXA 4ZVNA 1MA0A 3ZGYA 1UAYA 1UT8A 4QNNA 1J49A 1ICEA 3ZHRA 1E9CA 1D2GA 4ZN6A 4FWGA 4RGVA 4EB3A 3BJOA 2REQA 2Q27A 3LG2A 4AY6A 5E3OA 2VJMA 5EZSA 1SU6A 4RXMA 2JQ7A 3EK2A 2AQIA 3HXQA 4FHCA 1WHTB 4F38A 4ZT2A 1N2CA 3LUBA 4B8WA 3IIMA 1WS6A 4R9VA 1KOLA 4NSOB 1POWA 2YIDA 3AVPA 3ZY4A 4RTOA 2BHYA 4R69A 2VT2A 1LNSA 4CUZA 1X7YA 5JZVA 4AU1A 2PH7A 2P2ZA 4J91A 3RGGA 5BQ5A 4QUAA 2XRMA 2PFKA 3ECHA 3UJ9A 2R8XA 1JECA 1FJ2A 4BUPA 3L0IB 2QQGA 1KQGA 3CLTD 4BXXJ 3CQZJ 2YMQA 1K63A 3FCXA 3OHPA 4MLOA 2EIKH 5AP9A 2HA3A 4MEAA 1QRTA 1WETA 4NSRA 3FYCA 3C98A 2FW8A 3B8HA 3SBOA 4N40A 3BBZA 2IODA 1JKMA 1A35A 2A30A 5H5JA 3G85A 7REQA 3O03A 2NSLA 3I0ZA 3DLPX 3JAWB 4Z53A 1TZKA 4A0RA 3ER8A 2V7WA 4PAGA 1VIDA 2LW7A 3N74A 1R4ZA 2A9KA 3GNSA 2B0JA 4G1VA 5HVNA 3FNGA 1WCYA 3S1LA 1SIBE 3GFMA 1LEHA 2FSGA 4DR4B 2HVQA 4ZJZA 4ZI7A 4OQQA 3OSGA 4DXHA 3ANTA 1DU4A 4TMTA 1S8FA 2PMZN 3FXKA 2VA8A 3AL0C 5LJIA 2I3GA 2HIGA 1VSBA 3GJZA 5KTOA 3SP1A 1C30B 1GM5A 3JS5A 3DKWA 3KUDA 1HY3A 4PBRA 3MLEA 2LSOA 2NQ8A 3CCSI 1RR7A 2ZYTX 4JJKA 1NK3P 1D7OA 3RHFA 1AQNA 3AR6A 1FVFA 1FUUA 1SIWA 2W6CX 1LNWA 1TQMA 1QYCA 4RSRA 4NAVA 5TSDA 2B9VA 3JXEA 1VNDA 4A0QA 5FI5A 3ZWWA 2W48A 1VIAA 1EBFA 3BZUA 2VJBA 2ZRPA 2C7PA 4W7HA 2EQAA 3JZAA 1Q39A 2C99A 3WLLA 1B2LA 3IG8A 4TLLB 2ZBRA 4IJEA 2JPCA 5IEJA 3SASA 5H02A 3FGOA 3NHZA 4UBNA 2BGUA 1BHO1 1PVEA 4H6VA 4HEOA 4EPYA 3AG4H 3JTMA 1OI4A 4DCMA 1J4AA 2BEVB 4QT4A 2WYIA 4AZTA 4BE2A 1YLFA 4JV5B 8ADHA 2J6IA 1O87A 1WZCA 4ZPXA 2AFIE 2PLRA 1TW3A 3OQVA 3TQSA 8GPBA 4ZYVA 2QF7A 5A4MS 3PJFA 3FN4A 3U9SA 5PNTA 3DWLE 5AWFC 2HMVA 2HLHA 5DTEA 1V5IA 3ISVA 4IJAA 5EOVA 4IOJA 3QXJA 1M2JA 2NXNA 3MTGA 3I0NA 5K3EA 1PYVA 3LX5A 3QTTA 3NOVA 3I2GA 5JXHA 4YCCA 3HY3A 1Y6FA 3BXEA 4MUEA 1EJ9A 4QODA 1QMPA 3AG2H 1E6EA 1XMVA 5EJGA 1QP0A 3T52A 3BR0A 5IWAM 2Q21A 3VPAA 4QZVA 4FFNA 2OV6A 4IVPA 2HSGA 3U4HA 1SUIA 2DCUA 4FFRA 2ODPA 1PDNC 3DA1A 1MBJA 4EKGA 4G1EB 2KM1A 4UCWA 1XTPA 3DW1X 1TZMA 1V54H 3BDDA 2STWA 4UUSB 5JWRA 4N9HA 1I9CA 4BJ3A 1JWAB 2RCYA 4RGBA 2RNGA 2PH3A 3IOBA 1WCV1 3DEHA 2R5NA 4RJTA 1M34E 4QVGA 1TBXA 3ZDQA 3P8ZA 4UTPA 4HQEA 1FTZA 4N3GA 1XQXA 3EB9A 4N03A 3MBOA 5BQOA 4X0GA 4DANA 2M45A 1GY8A 1DJPA 3PWZA 4FKBA 3CJRA 1YQGA 3AVTA 2K02A 4XAQA 1L7PA 3UCXA 1B73A 3OD5A 4BYGA 1OC4A 2OYRA 1SH7A 2WPDD 2VZ8A 4R8LA 4BEHB 3FZVA 2PL9A 4IINA 3ND7A 1KS2A 3WK6A 2HOSA 1R6UA 5B37A 1XHEA 1TKBA 3E23A 3ETEA 4OFZA 4EUFA 2DCEA 2ZAMA 4HUJA 3TFQA 3WKDA 3PQ4A 2JBAA 4KI0A 3DNMA 2OGWA 1V37A 3T9CA 1VB5A 1SIUA 1BJRE 4QFDA 1U80A 4GM1A 4X20B 5G40A 2JA8J 2XUGA 3IOCA 2ZTVA 3OMXA 2WWWA 1DARA 5D5WB 4ARSA 1QRUA 4RF0A 1NOIA 2LXNA 4KE6A 4CMGA 3RIHA 1U5TB 4P92A 2HIMA 2I67A 5LQCA 3ONDA 4WFJA 2DHEA 5I7SA 4G5RA 4BB9A 5EMNA 4CLDA 1VL5A 1USUA 4TL6A 5DF1A 4XPZA 4CUKA 5EZHA 1QYVA 1R00A 1ADYA 4BVFA 2B4TO 4M8SA 4KGXA 4N18A 3VU1A 3KVNA 5ILGA 1K68A 2V7TA 5SY6A 4KMMA 2WILA 4HEHA 4AJIA 1NV9A 4Y28F 2HJWA 3CR8A 1EFUB 4OU7A 4BWYA 3LDGA 1K2VN 4IIXA 2J0UB 3HEAA 5FB3A 1BS2A 4V0RA 2D62A 3BUSA 2M87A 2HK7A 3VZBA 2PU5A 3KAJA 5HZHA 2W7TA 5TF4A 5FPYA 3ITNA 1T2DA 2Z8ZA 4ZZDA 3IQHX 5K8VA 3ZWQA 2XSDC 3AV3A 3SBEA 1NMXA 2J4FA 5EG5A 3KIPA 2JRTA 3KPJA 3CRMA 1H2BA 1UBRS 2GBPA 2STTA 3EMVA 4GLFA 1UBGA 1WFXA 1Z4JA 1ETOA 3EFHA 1NM5C 4A6PA 4CM9D 4RDHA 3BTSA 3CNBA 5BSEA 3IDQA 1HT3A 4NZ9A 1HEIA 2A5WA 3FIWA 2QYHA 1JQLB 1J0RA 5CA0F 5H0IA 1X77A 3UHOA 2BKLA 4L0YB 1KI4A 2BFEA 1RTTA 1EUYA 4RY8A 4UD6A 4GR5A 2O2DA 2EFOA 2ZW9A 4BV8A 3I4NJ 3IIKA 3AQIA 2FW7A 3Q8KA 3G79A 5BUSA 1FMLA 2BP7A 3DEYX 1CLUA 4JASB 4BLUA 3C39A 3ACBA 3TE6A 1GPMA 1O1YA 1ZMVA 4ZD6A 1QVRA 1Q7RA 1S7GA 2W43A 3L2VA 1H2FA 5AVTA 3K5IA 1RDFA 1GVHA 4R3DA 5MFPA 2DI3A 2BY4A 4NBKA 4NEGA 3R4CA 1UBEA 3T9FA 1XTJA 1NI4A 4AM3A 1PJSA 3GUZA 1JHMA 1R0KA 4YLEA 3D8HA 5EE3A 2UU9M 1GYPA 1NSTA 4GRIA 3TF5A 3ST7A 3S7TA 4HXEB 4XUDA 2G72A 3GUCA 5EKSA 2BCJQ 4ER0A 3K8QA 3UAWA 1MD9A 5BUQA 2KWIA 2TDXA 4QDTA 3D4PA 2YV3A 2QCOA 1T8PA 1CUUA 3A1TA 1EGVB 4KI7A 4E2ZA 5TEWA 2XDAA 1Q0TA 3PWSA 1U3VA 1DLJA 4UUAA 3QMVA 4CYMA 4AD8A 3E8SA 4HXYA 3RC7A 4A3FJ 1RC1A 1J2YA 2EF1A 3C3JA 4PLPA 3OC0A 4YMLA 1F8YA 1PUXA 1W52X 3PUBA 4NXNM 3RT1A 4LNHA 2DFLA 1L0BA 1QR2A 4DT1B 3D6FA 5CDTA 3CJQB 3P9YA 4FE3A 4DXDA 2PUEA 4ZCTA 2IZ0A 1RP1A 3DO6A 2RH4A 4XWYA 3KP1A 3I6QA 3BMCA 3I42A 4DCPA 3NBXX 3EDMA 4Q9JA 3J81A 3NBYC 4TKLA 3DV0A 3JCZA 2OD5A 2ZXHA 3NQ41 4B7CA 1SA0B 9ATCA 3H3VK 1ZY2A 5LA6F 3QELA 4UHEA 5CITA 2IFTA 2V9PA 1NN0A 3H4VA 3DKXA 1PO7A 2WU0A 4DWVA 1D9XA 1SCUB 1BD3A 1Z15A 5K0NA 5EZ6B 5LMUB 2VJAA 1KL7A 1NBIA 2CXRA 2FWIA 2M60A 3KX2A 3FBIB 1N25A 4CM1A 1KMQA 2HSZA 3DJFA 2V4JC 4KPUA 2HBRA 3EXFB 5LOVB 1ZW6A 3D02A 4HZUA 1XZ8A 5IT3A 5EKUA 3Q3IA 1SQ5A 4GBED 3MKZA 3W7BA 3PC4A 2DWQA 4L50A 2FXIA 3R6WA 4FYJA 3OR2C 1RKXA 5SZKB 3LTNC 1Y6JA 4BMYA 3V2IA 3MZYA 3OYDA 2JIBA 3E22A 3AUSA 4V3CA 4OGFA 4UHTA 5DIFA 4LYFA 1V4VA 2GQFA 3QE4A 4C20A 5A0TA 2FW0A 4W6ZA 5KSPA 4KOAA 5HWSA 1UMDB 1KO1A 5KVSA 3MWJA 5AKGA 3UGJA 1ZH8A 2QLBA 1BE0A 4MVJH 5E3LA 3IPLA 4L16A 3J7AO 2CD9A 3EULA 4K05A 1MT3A 4DSAA 4R2JA 4XM2A 1P29A 4JI2M 1R8XA 4ZARA 5H8WA 3PX3A 2ZJ1A 3HUUA 4AG6A 4QGHA 1QHIA 2RHRA 1AO0A 3K2ZA 2M2EA 4PPGA 4XLCA 3TQNA 3DE6X 5BQXA 4JUIA 2X8LA 4EJWA 4E0BA 1E6KA 2I6XA 2NYXA 5C7IO 4NR0A 4PNHA 2CBGA 5BY2A 1F43A 1VE9A 3F1KA 4NZMA 1SBQA 3FHTA 4KT0F 4MH0E 1EFVA 1E1RD 1Z62A 3W5HA 1ETYA 3AJ9A 2OCIA 1K5DA 4B3BA 1T0HB 1EUQA 4QLBA 1AH2A 1C1DA 2Q1TA 4V1CB 4LWZA 3WU1B 1NRIA 1SMYF 3DOJA 3VPSA 2EJCA 2VPQA 1JKJB 2A0XA 4KIWA 3K1AA 3GAZA 1WMAA 2EIJH 1GHTA 3STXA 2UUAM 4EVIA 2X3YA 4U7FA 1RPNA 2B4AA 3WRYA 1U81A 3MRSA 4QDKA 1EM8A 3O4JA 1T33A 3RT9A 3TDKA 3UJ3X 3QU9A 4CTJA 3BH7A 4TUYF 2QVCA 5LZ2A 4DNFA 1O0CA 1I3QJ 5HOOA 3FXUA 3K16A 4B7FA 2FNAA 1Z6AA 5FYQA 4RKYA 1I0LA 3E05A 2X5XA 3TWKA 4GFDA 2I6QA 4AYBN 4RJLA 2H4YA 2V6CA 2P7HA 3S1AB 2VFAA 2ZM6B 2DFIA 4JP5A 2IP2A 2WIBA 2GD0A 4YB8A 2AJTA 4F21A 1ORTA 4JI1B 3GVCA 2VSNA 4UXJA 3RYTC 1V95A 5G0VA 2XYVA 3OIQA 4ZODA 5BW4A 2Z4RA 3AKEA 5G3YA 2CUJA 3MWGA 3ZHUA 4HB2A 4QOGA 1I3AA 4ANJA 1CG6A 1PQPA 1UWVA 4GWLA