3PFIA

2.7 angstrom resolution crystal structure of a probable holliday junction dna helicase (ruvb) from campylobacter jejuni subsp. jejuni nctc 11168 in complex with adenosine-5'-diphosphate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
301
Chain Sequence
b'LRPSNFDGYIGQESIKKNLNVFIAAAKKRNECLDHILFSGPAGLGKTTLANIISYEMSANIKTTAAPMIEKSGDLAAILTNLSEGDILFIDEIHRLSPAIEEVLYPAMEDYRLAQTIKIDLPKFTLIGATTRAGMLSNPLRDRFGMQFRLEFYKDSELALILQKAALKLNKTCEEKAALEIAKRSRSTPRIALRLLKRVRDFADVNDEEIITEKRANEALNSLGVNELGFDAMDLRYLELLTAAKQKPIGLASIAAALSEDENTIEDVIEPYLLANGYIERTAKGRIASAKSYSALKLNYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvB
publication title 2.7 Angstrom resolution crystal structure of a probable holliday junction DNA helicase (ruvB) from Campylobacter jejuni subsp. jejuni NCTC 11168 in complex with adenosine-5'-diphosphate
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Hydrolase
total genus 86
structure length 301
sequence length 310
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05491 RuvB_C RuvB C-terminal winged helix domain
A PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain
A PF17864 AAA_lid_4 RuvB AAA lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3pfiA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3pfiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pfiA01
3OZXA 4DCVA 2JLQA 3TDZC 4R7ZA 2W85A 1AZTA 1D9XA 2D62A 2H16A 2GCPA 2P5VA 2ZPTX 3I92A 3K9LA 1FTNA 1P2TA 3OAAA 4PAOA 4BFTA 1SAXA 1CJKC 3KCCA 3ADKA 3KTAA 4LBZA 2H8KA 2V6JA 5JI2E 3CR8A 2ZYVX 4Q7KA 3VNVA 4B09A 3AF4A 3KZYA 5BYJA 5F3WB 3M4YA 2FG5A 4HDQB 3RRYA 5D6FA 3RRNA 2CXXA 3BBPA 4IHQA 3FX3A 1CJVC 3K2ZA 3I4PA 4DNCA 5CLQA 3WMEA 1QHIA 4IFEA 5C18A 1SVSA 2IA1A 2ZITA 4TLCA 3UPUA 1JR3E 1BC7C 3FWYA 4LHVA 4EPXA 3RC8A 1BN5A 1RVDA 3K0EA 5G3YA 3TVDA 1Z0FA 2JLUA 2JJ2A 4IDHA 1U81A 3DL0A 4S05A 4P4TA 1KSFX 2Y48A 1QPMA 1OKKA 2F6RA 1FMLA 4LJ7A 1GXQA 4QM7A 1A1VA 1GUAA 1ZGAA 4HAWA 3L2CA 4MKIA 4BFXA 1F60A 4I1OA 3C4JA 3C1DA 3GW2A 4IRGA 1VHLA 2VIIA 4QL3A 4G5SA 4PR0A 3Q8XB 3RS4A 2M5WA 3A1WA 1S0UA 5BMZA 3P4YA 3REFA 2WBLC 3LDAA 2ZYTX 1F9NA 2QQ9A 1PDNC 5FTNA 2ZSEA 4ON0A 2R7FA 4IVQA 2ZMEA 1ZD8A 4TLAA 1Q20A 2CDNA 3C7JA 2YWEA 3E1SA 4GNKA 4XVQA 5J4VA 3GPLA 5FD5A 5EEHA 4LC0A 4M9QA 1Z28A 3EIHA 4B6FA 4ZKEA 1KMHA 2XUBA 4M9ZA 4D4MA 4XSHA 5D4RA 3VHXA 1SXJC 5HLHA 3BRWD 3CIOA 1W4MA 1M6NA 1FNMA 5AJWA 4WZBE 1DPFA 4QNRA 4GGGA 1OYWA 3K69A 2O0JA 3KJGA 2ZSBA 1OLOA 2CK3A 2UZ3A 5DV5A 4DSTA 4ZCIA 1P5ZB 3X1DA 2HYDA 4I81A 2Z3YA 1J75A 1YLFA 2AKYA 1UPTA 1EESA 2L02A 2R7DA 3BFVA 3KB1A 5JJLA 2XOKA 2GXQA 1HT2E 1NI3A 2MA3A 1OYYA 1KOFA 4IRHA 4O5VA 4V03A 1ZN2A 3N5CA 2VXZA 1O3YA 2ZI7A 4MKHA 2J0VA 2RGCA 4M8NE 1XDSA 4Q7LA 5JMTA 3FKSA 2DTRA 4KI0A 3PFIA 3CPEA 1UDXA 4BHCA 2RGNC 3LXXA 4JT2A 1BO6A 2J5OA 1Z47A 5TVKA 1XB4A 2GXSA 3KDSE 3L8ZA 2CHVA 4MRSA 2RHMA 2FMYA 1K7AA 5EXPA 2RDPA 1P9WA 3PUVA 1NKSA 2M45A 1VECA 3A1TA 4P3YA 2GZHA 2M1BA 1EFHA 4U00A 3ZGXA 2DPXA 3HYIA 3UWOA 1H8HA 3TMKA 4L9NA 2BOVA 3JVUA 1RE0A 2GEVA 3MJHA 3TR0A 3VKWA 1FL9A 3IUYA 3GWZA 1UEIA 1ZM9A 2AXLA 3GJ7A 3OE7A 1LEBA 2J1LA 2X2FA 2FXAA 2JRTA 1BM9A 1UBGA 3ZMUA 3FYHA 4PAMA 1ZGJA 3F3XA 4KYUA 4PSAA 2QU8A 3JZMA 3VKHA 1HE1C 2QP9X 4L15A 1NBMA 1XEWX 5LHHA 2ZAOA 1W47A 3BWDD 4ZDWA 3CR7A 3IKJA 2XHKA 3TO7A 4AK9A 4DDWA 2NO7A 3MZHA 4F92B 4Z51A 4DHEA 1P2FA 4ACAA 3OOPA 1YW9A 4KJZA 4A6EA 3AVWA 3KUDA 5JWHA 1MKMA 2KB0A 3L43A 3W90A 4I7HA 1JHHA 2FGJA 1HY3A 4JLOA 5FO5A 4PPFA 2GK6A 1NP6A 2ZRGA 1HKSA 3ONWA 4TMVA 4BLQA 4JT4A 4KNYA 1ZH5A 1S7AA 1MDMA 1ZBDA 4FMCB 1KNQA 4DC9A 1SHZA 5JI3E 3QPHA 1QBJA 2VE9A 3CLVA 2KIMA 1PP7U 1TNDA 2GBLC 4Q01A 2O03A 1OHHD 4QM6A 2ESHA 4G6DA 1B59A 5BOXA 121PA 3LV8A 1DVRA 3GJ0A 1I5ZA 1XSDA 5E7IA 5EUQB 2C99A 2D7CA 2DQRA 2V1DA 1TL7C 2VHUA 2NNNA 2ZU0C 1DADA 3RI4A 1ZRHA 2B0LA 4RD2A 3LA3A 4ABYA 1XMIA 1R7RA 2F5EA 3GJ8A 1Q3TA 1WBBA 2DU9A 4GCVA 2BMFA 2OCBA 3EARA 1U0LA 4IXMA 3SFVA 4EJVA 2Q3MA 3LX5A 3K9GA 3Q5FA 2DPDA 3WE3A 3PUYA 2GF0A 1L8QA 2HS5A 1QG2A 1MDMB 3L7WA 3DKVA 1B23P 4GDFA 1DAFA 2ZFWA 3M8FA 4NCJA 4JMPA 1XEFA 4QRHA 3AF3A 3B82A 1GL9B 1XBTA 2LCFA 5KO2A 1V3FA 2XB2A 4QWQA 4LZZA 4XSZF 1FY7A 3CNLA 3ICQB 5D5WB 1IOZA 3RYRA 5BN4A 1R2QA 1F1ZA 1S6LA 2P67A 4HATA 5F6FA 1XZPA 3RWOA 2YWHA 2NQ2C 1HXDA 1N0WA 3B9QA 3TUZC 2ZVPX 3DDCA 3RYTC 1UEJA 4HI0E 4QBIA 1G4DA 3CJNA 1M1YE 4QBFA 3U44B 3W6JB 2FOLA 3T5DA 1YR8A 3BH6A 3F0TA 2GJ8A 4A0GA 2O8DA 2QORA 1O3TA 2C9YA 4ERNA 2HYIC 1X8KA 3F8MA 4JLBA 3MAAC 1B6AA 3MG9A 5FLXZ 1XD7A 1K5DA 4XTCS 5BN3A 3HJNA 4KSBA 2KBFA 2VOOA 2GDJA 2EFDB 3BFXA 2GHIA 2RGAA 3HUGA 1P75A 3H0KA 3THWB 1NMYA 3GEZA 4HF0A 1OFTA 2XVCA 2WSSD 3BD9A 5JS8A 2ZETA 1GWNA 1ZNZA 2NO1A 3EX7C 3SYNA 5AIQA 1Z07A 3SYLA 2QAGA 1G3YA 2ZI5A 3V8KA 1NY5A 3ZN0A 4CGZA 1LB1B 1R4AA 1T6NA 2ZSFA 5IHPA 3GFOA 5FH9A 3Q9SA 3O8RA 1GAJA 3RWMB 1Z63A 1R22A 2ZJAA 2JA1A 2VP9A 1FFHA 2ZRHA 2QL6A 2HGCA 1HBXG 2QT1A 1DG3A 1S3JA 1W1WA 3ADCA 4MKGA 4F7WA 1HV8A 3NG1A 1G3UA 2HFHA 3HTUA 4FWGA 3THYA 4W5HA 1X3SA 3EXAA 3RKXA 3AVQA 3FMRA 1KK3A 4DLSA 1ZUHA 4HX8A 1TUIA 3WYAA 3QQ5A 3AKEA 1E9FA 1P7CA 1OXVA 4R8HA 3CRVA 1IQPA 4MGZR 4RFSB 5KSOA 4A9AA 4CDGA 2OLJA 1DE0A 1DO0A 2Q21A 1KO5A 2RV8A 4PDKA 4AYTA 4LYFA 2FSWA 4LK0F 4HB2A 4PZYA 2QM3A 2Q9CA 4NCIA 1TEXA 3DM9B 4JL6A 5C4MA 3I5YA 1JECA 4EJSA 4QHTA 4F4CA 1CS4C 3R9IA 3I62A 4LJ6A 5DSZA 1KO7A 1KMQA 3N2EA 5J8CA 3AP3A 2ZKZA 4ZDJA 1VYTA 3Q72A 4B47A 1CJTC 2PT5A 4I0AA 1AS0A 3KLOA 1AA9A 1MOZA 2NO6A 1DS6A 5D5VB 1WKMA 2PLRA 3AH8A 5TDHA 5F1RA 2VBYA 2WSMA 1ELOA 4TT3D 4B48A 3I8XA 2OBPA 2WPDA 4DB2A 1JBKA 5DNYB 1IN7A 4FD2A 5LB4A 2OA4A 2CL7X 1RJ9B 2FPMA 4MA4A 3X1ZA 5DHAA 3ADDA 4Q48A 2HT1A 2QN6A 4HDVA 1ZCBA 1G1MA 2I1QA 4RVCA 5E4FA 5AWFC 1J9IA 3GJ6A 4PC6A 1E69A 4KXFB 2OT3B 3QG5A 3NEUA 3NRVA 5EE9A 4EJSB 3JW4A 1U94A 1WQ1R 2OCPA 4GSYA 3EPKA 3V4FA 1YR9A 1LDDA 3I71A 5KVRA 1G3RA 1E1RD 2CMKA 1WI9A 2YOHA 4PGGA 2PEYA 2A61A 2W0MA 1E79A 3DZDA 4QHYA 1FX0A 2VTKA 4E07A 5D3QA 3C14C 1ZW6A 4BHPA 1Z08A 4PC2A 2IWRA 3K1PA 1YQTA 1E4VA 1G4AE 1C9KA 5ELXA 1D8KA 3AKCA 2QP4A 2OFXA 1ONBA 1YW7A 2E7WA 1BOFA 3JZAA 2ANBA 2ZUBA 3GLHB 2HZTA 1KQ8A 1VMAA 1OXTA 2HCBA 1SD6A 3CX6A 1YG2A 3SJCA 4CRWB 2BCJQ 2K86A 2KIUA 2O0YA 4Y17A 2LKCA 4GP6A 1JXOA 3IKVA 2G3YA 2IYLD 1XGNA 3V9PA 2P65A 3AF2A 4Q4HA 4PQRA 2XAQA 4A2WA 1XEXA 2ZJ2A 2NOAA 2ZVQX 3FMOB 4KFUA 4B43A 2EFPA 4XD7A 8OHMA 5FL7D 1OT3A 1FX0B 4KICA 4HLQB 3FPAA 3ZQ7A 4MQVA 5FL7A 3PEWA 1T6SA 1F5TA 4D82A 4QGHA 4OYHA 4QXAA 1C4OA 1MR3F 4KUMA 3EZ2A 5JSZA 4CO8A 1KHTA 1KTVA 5DGXA 1TUEA 2MSCB 4NYIR 2XXAB 1AK2A 4WXDA 3QSYA 1KU7A 2OAZA 3I59B 3R0JA 1US8A 5KTYA 5JR3A 1KI3A 2IS1A 3I72A 3Q7QA 2ONJA 2COMA 4Z1MA 2IXFA 4TL8A 3IWZA 1FT9A 2B8WA 3KE2A 2XJ9A 2RHDA 1CR2A 4ARZA 5HS7A 4A5MA 3QKUA 3N70A 4A15A 4HLYA 4Y0VA 1ZNXA 2EA4A 3I0TA 3CRW1 3UG6A 1K5GA 3U3OA 3GO5A 1PUEE 5CM8B 2OE2A 2DO7A 2PX3A 4TLBA 4YDSA 3OESA 1ZARA 1S4QA 4RD6A 5IT3A 2J7KA 3S1AA 1G5TA 4G6QA 1HW2A 3SI7A 1FC3A 4M71A 1QZXA 4KDPA 2VBWA 2RGVA 2QLZA 3A1UA 3EZ9A 3QXXA 3C16C 1NL3A 1E98A 2JZYA 1US8B 3KQKA 4YMTA 2ZUDA 3DMDA 3TUJC 4BH9A 2NMVA 4PC3A 4BZPA 3R61A 1TLHB 4KLNA 1YS7A 2JSCA 2WWHA 2IS6A 3CWZA 4II7A 5CITA 5EQTA 1XTJA 1ZG3A 4WX9A 2NGRA 2WWXA 4DLRA 1PV4A 1RUNA 1KK0A 4HX4A 2FEOA 2O61A 3LWFA 4N9IA 4BE7B 1XPOA 4HUQB 4HLUC 1T2KA 4V0LA 1R5NA 1R5GA 4PX9A 2QPOA 1ZHFA 1E2IA 1WBDA 2D2FA 2J0UA 4JKIA 4CEHA 4L9VA 2FV8A 3TNFA 1AOYA 4TMZA 2EU8A 1FQKA 1VPLA 4AKEA 1D5VA 5DD4A 1YQAA 4UNOA 2JLRA 3TSZA 1VCNA 2ZTSA 2ZUCA 4I99A 1RRFA 4B3CA 2D3WA 1YYVA 1SFUA 2XGXA 4LRTA 1CIPA 2JIZA 2JJ1A 3ZZTA 5HLGA 2DWPA 3AGQA 3X1YA 1NVVR 1OH7A 1K78B 1Z22A 5CM9C 1NY6A 3BJOA 4MUAA 2OSBA 4PANA 4H0EA 5CIQA 5E1XA 2GNOA 2GXUA 2V3CC 3GX4X 4MGRA 2XNSA 5DDGA 5AUOB 1KQ0A 4JYBA 2IA2A 2W25A 1XGSA 4EJOA 4HB4A 4HLDA 1STZA 3WTTC 4N9HA 4M74A 2PL3A 2PLFA 3KQLA 4HYYA 4CW7A 5AUPB 4AVPA 5BQTA 1OV4A 4C3ZA 4WCGA 2LSOA 1E2MA 1G7TA 1MABA 1WRBA 4P4UA 1IN8A 4RKEA 1E9AA 4LK2A 3VR1A 4DXAA 4YMVA 2GXGA 2IS4A 3S2WA 4EM0B 1E2FA 5JFRA 1KNXA 2WIBA 1XTQA 3QG1A 3ZD7A 1O57A 2YC4C 2DLLA 2OZEA 1UBCA 5CK4A 5CDFA 1W48A 1U8YA 1XXHE 4Q7JB 3F8CA 1Z0DA 3R6SA 4F93B 4BPBA 5E18F 4URWR 1NVUQ 1YE8A 1WF3A 4E5UA 2C9OA 1T5IA 2I3BA 1IY1A 3R20A 2ATVA 5CVIA 1G8FA 1JPNA 1I2DA 2AR7A 2UXNA 4LYHA 4AWXB 5L3GA 3IEVA 5K5OA 2V7QA 5AIPA 1JJ7A 1TX4B 2OU2A 2O8BA 1XPUA 1XMVA 2IC5A 3A1SA 3BGWA 2WHXA 1FOKA 4L4UA 4NYMQ 1EFUA 2CCJA 4V02A 5ILVA 4FMDF 1IAQA 4JLDA 3BPXA 1ZYUA 4ZIRB 1MABB 1XF9A 4FWDA 4PHHA 4ZYDA 1YZGA 2ZBKA 2P6TA 2WAXA 2F1JA 2AD5A 3KLNA 4TMWA 2OBNA 3ZZUA 4E03A 4B44A 2P7VB 3WXMA 3ZD6A 2G9NA 4RGXA 1W4RA 2AD1A 5JLJA 2ZSDA 2D4HA 2XAGA 2J45A 3QNUA 4C0KA 3KKPA 4P55A 1XMKA 2FNPA 3L8YA 4XWKA 2PBRA 2ZI9A 1XJQA 1P73A 5JJIA 221PA 4UJ5A 4A0RA 2XTNA 5LEJA 5K1YA 3LVQE 2JDID 1BJAA 2ANCA 2HLDD 3P26A 5CVUA 2X2EA 4PQFA 3SDZA 4BLTA 4OOIA 2FA5A 1ZIOA 2V8OA 2O8EB 4FINA 2JLVA 1GRNA 4OQLA 5JHUA 1KYWA 4I98B 2DY1A 4B2IA 4DIDA 5EP3A 5IK2A 1RIOH 2W57A 2QUZA 3SBEA 5BN5A 3DOEA 3I5XA 4Q1EA 1IJFA 1KJZA 1S9DA 2DFLA 2GVDC 1JQJC 3KFWX 4O2RA 4OQMA 4CF7A 2VHCA 4G7HF 2A5YB 1MRNA 1JALA 1R23A 4X8HA 4ZDIA 3WODF 4Q1BA 3O6BB 4I02A 3SE0A 5D6EA 5H6RA 1Z29A 2RGGA 2V1UA 3K1JA 2BE5F 3KP5A 3EUHA 3ULQB 3GLGA 2K4JA 2ZR0A 3ZVNA 1G7CA 1TF7A 3FXRA 3CNOA 1ZJ6A 4G8XA 1U98A 2XKPA 1TEVA 3COAC 4PZLA 721PA 2ZYWX 4JLMA 1JEEA 3WHLA 5FR2A 4G5QA 3ISPA 1OH8A 2IK8A 4LJ9A 3DKPA 2V54A 1NVMA 2YOFA 4L16A 1R1UA 4UV8A 4QGAA 4WBSA 1N6IA 1E2HA 1SVWA 2V6ZM 3QEJA 2FQ3A 3ELKA 4W5JA 5FUWA 3A58B 3QKRB 2AL7A 2I1VB 3HR8A 3CUQA 2KKOA 1YFHA 3PUZA 2CSOA 4L5BA 3NBXX 3T34A 4LLNA 4IOMA 4URUR 2XV4S 4CT5A 2JLSA 4JIMA 5DI3B 5B30A 3MLEA 4RGUA 2BJWA 2PQ8A 1O87A 1SULA 1S1CA 3IGFA 3L0SA 4TQAA 3BPVA 3GLGB 2K02A 1FUUA 2MSDB 1LDKB 4A4DA 1BOAA 3RSOA 4HAUA 3RDPA 1OSNA 4QKQA 3V8LA 2RGXA 2CJWA 3V8JA 3VFZA 1YZNA 5FPSA 3GEIA 5FBQB 1GM5A 3VLFB 4IVPA 4N1AA 2P7CB 4QJ4A 5GJCA 4M1WA 2R62A 4PZJA 4WF2A 3QKTA 3K09C 4LHZA 1NIJA 4C0HA 1OIVA 2UKDA 1P4WA 4MEYF 1LY1A 2QTFA 4V0OA 5HKKD 3CUQB 2JLWA 1R1VA 1J8YF 4EGYA 3IIMA 4A82A 5HKKA 4IEIA 1U5TB 4TL6A 1SKYE 3T8RA 1AN0A 2ASEA 2W6JD 2FSGA 1J8MF 3CM0A 2QQBA 3FFAA 1H0MA 4HB0A 4EJTA 4RS8A 3HU2A 1WRJA 1N3BA 3K70D 1XP8A 2QTVB 3IO5A 3OIYA 4MGKR 4BFYA 1F2UA 4NTZA 4PFSA 4BWYA 2YZ2A 4UNRA 5JHGB 4C2UA 1XD8A 4P9FA 1NIPA 2D2EA 3WU1B 2YINC 3ZN1A 1ZM7A 4IXNA 4NQWA 2C2HA 3WG9A 5K5RA 2YWFA 3CONA 3IIJA 3MCAA 2NS0A 4CZ2A 4NHJA 2PZGA 4JLJA 1P4XA 4LHYA 4PC1A 5K8IA 3HDTA 1XN7A 3WE2A 2CCGA 1E1QA 4IDQA 5AJYA 2XX3A 3MHVC 3EQLF 2OUKA 2Z33A 2WJIA 5HCNA 2RC4A 2H18A 4NL4H 1SFXA 5FTMA 5AUQA 3SZTA 1KDTA 2E87A 2N42A 2XTMA 2QAJA 4TZ0A 3U3RA 1E2GA 1JXSA 2GQQA 2HYGD 1GNRA 2EYUA 4KVGA 1IHUA 4ZZLA 3M7GA 1NMXA 3SC3A 1PJRA 3VQTA 3HOTA 1ZG5A 3PQKA 3F5FA 2ZRPA 4D0GA 4CYMA 1Z8FA 3AJIB 2NO9A 5J40A 5M04A 3SZRA 1H8ED 2RGBA 2FNAA 4OHXA 3WGIA 5FPHA 2X8AA 1X1SA 4BEJA 4ESBA 4LJ5A 3GLFE 1QNTA 3KQUA 1TMKA 2ODBA 4K8OA 1ON1A 1R8SA 3GD7A 2E1NA 2PMHA 3RYPA 1BC8C 4GFDA 4TTRA 5DN6A 2FDCA 3RTRA 1LQ1A 2ZR7A 3DMNA 4GI7A 3DP7A 4HQEA 4NYJQ 3W34A 1NNEA 5B57C 4IF4A 1CR4A 2BBTA 1JNYA 4B74A 4DBLC 2G0TA 3FFBA 1FBSA 1TPZA 5EE5B 1UFQA 2FBHA 1SXJE 2MD5A 4A0ZA 4AIHA 1FMJA 1G21E 3A4MA 3K1NA 3WNDA 2CFXA 4FN5A 4BHBA 4G3XA 3KQHA 1FW6A 3KXKA 4JBWA 1WMSA 3O47A 5TARA 1ULYA 3QRFF 2EWVA 2A3RA 1XGMA 4JN6A 4AD9A 3DM5A 2BM0A 4C0LA 3FB4A 4ZCMA 5EP2A 3ROUA 3CBQA 2EWWA 2HDNB 1NLFA 3DF8A 3MQ0A 1CP2A 2HOEA 3AF1A 3PENA 2B7BA 4IOLA 4P33A 1MT0A 2F5FA 4C0SA 1HW5A 1NVWQ 5EZ6B 3X2SA 1EH6A 2XEXA 1WP9A 3OAAD 4KYIB 1EX7A 4X8OA 4U0WA 1N5LA 5FI0B 1HEIA 4G7OF 2ERYA 4F38A 4C7OA 3AP1A 4M1TA 1COWA 2C04A 3WBKA 3GLIE 3THXA 3WBJA 2HXSA 4LRWA 2EFNA 2VONA 1BH2A 4DCUA 3AVXA 2H27A 5DE3A 2A2ZA 1KYZA 2PMDA 3C7KA 1DELA 3P1JA 1XB2A 2RNJA 3WTZA 1FUKA 1LS1A 2L0XA 2ZI4A 4ZV4A 3H86A 1G291 1Y3AA 4FWIB 1Z1DA 3B2EA 2BCGY 4C2TA 1M2OB 3LW8A 3L09A 3BP8A 4LLLA 1IXSB 3HSFA 1AKYA 1NRJB 1QHGA 4HDUA 2QENA 2BM1A 2JJ2D 4DRZA 1OKKD 3KJIA 1Z9CA 2REXB 3LY5A 4C30A 1F5NA 4D4KA 3R8FA 1U8ZA 1XTRA 2D1VA 3F22A 4Q5IA 5CK5A 3LLMA 2FOKA 2QMHA 1G64A 3EG5A 1OR7A 2GEUA 4B6EA 1O7LA 1G5PA 4QBGB 4TSFA 3KTAB 1PZNA 2KRFA 5C1BA 1OFHA 4JSTA 3THXB 4AC9A 1LFDB 3H92A 5JRJA 1EG7A 2IS2A 2A5GA 4QJ5A 5D5XB 1MO3A 3W6NA 3C18A 4ESHA 3HSEA 5E17F 2O8XA 1W2HA 1PLJA 2IW5A 1ZAOA 5FPYA 3CUQC 1Z6RA 4CZZA 3JSPA 1UBEA 2M30A 1UKZA 1U3EM 3OIVA 3TQNA 5F2EA 4A8JA 4PC7A 4ZYHA 1U5TC 2OQRA 4Q47A 1Y63A 3ECHA 3I53A 4ILEA 2FGKA 1IXCA 2X0LA 2GJSA 1GXPA 2CGPA 2OCAA 4M6YA 1N5IA 4HZFA 5D4SA 1KAGA 2DFIA 3SR0A 3J80K 3Q9LA 2PJPA 1ZRCA 2BMEA 4B34A 2QEQA 3DOFA 3T61A 1SVIA 1ZUIA 2YR2A 2Z83A 5CLLA 4DSUA 4QJ3A 3O8CA 2ZRKA 4JLNA 2Z99A 3K1MA 1II0A 1P9NA 2CK3D 2IUUA 2ECKA 2W84A 2MSEB 5BS6A 4O25A 2EWNA 3AKDA 1AGPA 1NHAA 1E96A 1KI2A 5ERIA 2VT2A 1KDRA 1KSJA 5UKDA 1DG1G 2IXGA 2XOKD 3N4MA 3QF7A 3BB1A 4RD1A 3HYTA 1XCBA 3ECOA 3P9CA 1R0YA 3CO5A 3EZ6A 3SJZA 3ETLA 1GKYA 2G9WA 3A6PC 2ZMEB 5LRSA 2CYYA 1U6GA 3FXUA 3FMQA 3KETA 1J99A 1N2CE 4TL9A 4AYXA 1E17A 3W6KB 3TKLA 4BASA 5JECA 1FSEA 1R1TA 2F3TA 3K70C 1BMFA 2P2LA 3FKSD 4RZXA 2H7VA 3QBTA 3VKGA 1KMHB 1N25A 1GVNB 3M0EA 1Z06A 3V4RA 4UXNA 4BLPA 2L01A 1IW7F 4LC1A 2DB3A 4NU0A 2PFBA 2ZJOA 1PVOA 3VU9A 4A12A 4D25A 1RI7A 2DBYA 1RRGA 2N46A 3GFJA 3EAQA 2REOA 2EV5A 5FI1B 1NVXQ 2VHQA 3SQWA 3GCGA 1GOTA 1KI6A 1H8HD 2C03A 1ZVQA 2QBYA 2STTA 3QBVA 1KY3A 2EK5A 5ICGA 2QSZA 3OE7D 3ZYCA 2WIAA 5SZKB 3VR5A 2XITA 3KW6A 2QQ0A 1ZLJA 5CJPA 3VHLB 2QY9A 3FHCB 4TWZA 1AS2A 3CDHA 3PQCA 1NBMD 2CHQA 2FFBA 2K5UA 3CKLA 4KBGA 4WOPA 5SZJA 3U3JA 3VEPA 4C4PA 3QPTA 1UDWA 5LGUA 4BFWA 1G9XA 3SFZA 2XNDA 1JAHA 3LA7A 1XMSA 4WWCA 1JPJA 3QU6A 1MRSA 2YJTD 4HLCA 3VU9B 3NEJA 2ZROA 1A4RA 3OHMA 4LOAA 2EA2A 4KBFA 4G1UC 2A68F 2WKQA 1U78A 4LRSA 1M7BA 1KI6B 4BQAA 3QEOA 4NCKA 2GXBA 2Q3FA 4YXWA 2ZJZA 5GVRA 4J0QA 2GESA 2OXCA 5LD2B 3ND8A 1GFIA 5GVSA 3HRUA 3KP7A 1TBXA 1ZMXA 4UQOA 4LD5A 3VTKA 1XX6A 1QZMA 5FOUA 2YYZA 2ZJBA 1AWCA 3EC2A 1E2DA 2O3FA 3BY6A 3M1IA 3BC1A 3BZ6A 2B7CA 3GVAA 1J2JA 2QTHA 2GA2A 1Z6AA 1B4AA 2B92A 2IA5A 4KFTA 3AM1A 3NDBB 2J9RA 2Z5UA 1J59A 2J7PA 1OFIA 1A82A 4LG0A 2AFHE 1GNQA 3ASZA 2ZO4A 4OI0A 3ZVLA 4UNNA 1P2SA 3RKWA 3A37A 2WJGA 2ODEA 4MNUA 2FPLA 2JAQA 4ENNA 5C2JB 621PA 1KYIA 3K0CC 4NHOA 2DI3A 3HRSA 4JBXA 4LJAA 3JTHA 1HQCA 4IEEA 4ACBA 4LGWA 4TLDA 4IDPA 4YMSA 3LA6A 4GYGA 1VKJA 1YR6A 1X86B 1S29A 1YZKA 3B5JA 2REBA 3T15A 3C41J 1NF3A 3ZDQA 4D6PA 2VE8A 3CZPA 3TGNA 3HRTA 4Q66C 4XIGS 2R6AA 3KZ1E 5FPKA 2MLGA 2VT3A 4V0ME 5EJEA 2PCJA 3DPLC 5EZ5A 1Q44A 4LG0B 1WB9A 1UM8A 2IYRA 5DCFA 4M2LA 3MCZA 2ISZA 4HOBA 3HIFA 5G41A 2GCOA 2R6CA 5BPDA 1C1YA 2J46A 4FWHA 3C3WA 1JHFA 1YZUA 2B6HA 3B7GA 3CZQA 1XSVA 3U3MA 4OBEA 3R4KA 4LB6B 4IFBA 2UXXA 3RS0A 1L3LA 1EX6A 1KI4A 4DZZA 3AUYA 2Z6VA 1UHWA 4B3DA 1NSTA 4IOJA 5DYIA 4O3MA 2FFQA 1E9SA 5J4LA 1RC8A 2HV8A 2O0KA 3IBGA 1J90A 4GRAA 2VBZA 4DEYA 4A92A 2OZ6A 1LNWA 1FZQA 2Q9AA 1FOEB 3C5CA 2FWRA 4URVR 1Z83A 4PTLA 2IWHA 3U5ZB 4WXHA 1R7JA 1E0JA 2HT6A 4PCQA 1QZZA 1U2WA 3D8BA 3HWSA 3OIUA 3CB4A 4Q9HA 5EUMA 1E3MA 5H6QA 1LTQA 1G19A 4IKEA 2PZEA 1NSFA 4BYYA 2ZU6A 3SBDA 2EV0A 1EH7A 4HLXA 4XWAA 3EYYA 1Q21A 1UADA 1W4AA 2WWIA 3NBFA 4OMZA 1GKUB 4AURA 1P72A 1CULC 3KUCA 4R71A 1EWRA 2O8DB 3HTSB 3BS4A 3GFTA 2GEDA 4HDCA 3DKWA 4PHTA 2IEYA 5E7MA 1KSHA 3B13B 5KDLA 1CKEA 4O2LA 1FLIA 2C5LA 1HKTA 4UKDA 2VF7A 3KKMA 3NWJA 3ZIAA 3KJHA 5AUNB 3WYGA 4POAA 3U4QA 3CF6R 1L4UA 2Q6TA 1MD0A 4LMYA 2F9LA 3DVLA 4Q00A 3VFDA 2QAGB 3BAFA 3W6OA 1CEEA 1R5HA 1BIFA 1OMIA 3AUXA 4AY2A 2P6SA 1SGWA 4EPTA 1YZTA 1QHSA 1L7VC 3KZZA 1YVDA 2A5JA 2EYQA 2QT0A 4E22A 5F98A 3V7CA 4I4LA 4KHZA 5FOSA 3C15C 3REOA 1FBQA 2DFNA 1Z0AA 4D81A 4RJLA 4S35A 3W3ZB 3RNLA 1PUJA 1OPCA 4ZZDA 5D8KB 2YOGA 2EJRA 4EJWA 2OBLA 2P6UA 3CW2A 1XPRA 1J2XA 3THYB 1G8YA 2DR3A 2PLYA 3PG5A 3W6PA 1GITA 1XTSA 2WPDD 1XSXA 2HUPA 4QHSA 3MD0A 3P27A 4NBSA 5HTKA 3G0HA 1GNPA 5LD2C 4FT8A 5FLXK 1OF1A 3ABUA 4HAYA 1SKQA 3BJIC 2H57A 2LWIA 3T1QA 3D3QA 1TADA 1BI2A 2QQEA 4NB5A 1K8RA 1FP2A 2DZNB 2DWZB 3FMFA 4L8GA 4OQNA 3KQNA 2GA1A 1E2NA 3SZPA 3AVVA 4KVAA 2KIFA 3N2IA 4RAZA 2GAAA 4U0VA 3BJ6A 4B75A 1T98A 1RNLA 3U61B 1DDNA 2OESA 1U9IA 2VC0A 2YNMA 3QXCA 3R8CA 3PCRB 5KNCA 4EQ6A 4MYHA 1CR0A 2VQSA 3LAWA 3FM5A 5F64A 4IHSA 2DWOA 3H3UA 3LFKA 2H17A 3GJ3A 4DVGA 2F1RA 1TW3A 3GF2A 3TJZA 2R3SA 2XTZA 1E79D 1YHNA 2HF8A 3LA2A 4KO8A 5LGNA 1KQ9A 1AS3A 4L5JA 2O5VA 2OILA 1GZSA 2QMEA 3BXZA 5JCZA 1JXMA 1LVGA 3Q9VA 4GPTA 2W0SA 1AJEA 4B3XA 1VCOA 2ZYUX 1P4AA 4BUJA 4LCBA 3BB3A 2OG2A 3E5UA 4KFRA 4AD8A 4B71A 5IRCD 5D3MA 2CW0F 1T4GA 2ELHA 1XTIA 1KK1A 2PMUA 2ZI6A 3B78A 3H2YA 4M53A 4Q18A 4BGDA 2Q2EA 2I4IA 4BLRA 5K8LA 1NN0A 5TB5A 4B76A 1Q57A 3NTUA 1OKRA 3VB2A 5L3SA 4TTPA 2XSZD 4EQ6B 3J81k 3B1XA 3THOA 3U7FB 3W8NA 5CYPA 2XSZA 3F6VA 2AS5F 1W36D 3ML6A 2IHYA 4PO8A 1DAEA 2QI9C 2IT0A 5J4KA 4US2R 4LJ4A 4LPSA 1FPMA 4XD7D 5KUTA 1T91A 4OJQA 4Q9IA 3FE2A 3ZQ6A 4FW9A 2EV6A 3DXJF 1QG4A 1Q3HA 1RFLA 3BIFA 3GJ5A 4B73A 1BBYA 4GYIA 4O0MA 2RGDA 3W5JA 3IHLA 1J0RA 1ZM2A 3RVBA 5K8TA 5D3MB 2HR3A 3CUEF 4ENMA 2TMKA 2A5DA 3ZS8A 5J8FA 5FOXA 1U90A 1RRCA 2GVZC 4Z1MD 2YV5A 4XBFA 3VR3A 3TOAA 4S2EA 1M34E 4HF2A 1MJAA 1VYUA 2XAUA 1KI8A 2V6CA 4RKFA 3AVTA 1QRAA 1GIAA 3QPVA 1E2KA 5EP4A 1BIBA 3E6BA 4YMUA 3GYHX 5AONA 1IXRC 5HE8A 3OEEA 4Q4HB 2CVFA 4TLEA 1W36B 4ZYEA 1EH8A 2D7DA 1G8GA 2D74A 2EFGA 1XEXB 4BECA 5ANRB 2AX4A 2A69F 1RW4A 2GRJA 3RS5A 1NN1A 1Z5ZA 4JS0A 4Q1AA 1ZU5A 2NYXA 3UIEA 4RFVA 1M7HA 2WMOB 3HHGA 2G88A 3WP0A 3WMFA 4DCTA 1P6XA 1ZUNB 2ZJYA 3LW7A 4NP6A 4R2IA 5JSZB 3ZPLA 2VPPA 3MWYW 3TSWA 4XRFA 1DAHA 3GLHE 1NG1A 3RANA 2VP2A 2CCKA 4FMCF 2PJRA 1IN4A 4LYAA 3B02A 3TIFA 4MRNA 3KP3A 3QVUA 4OI2A 4DDUA 3U6KA 3ICEA 1IN6A 4MRVA 2B21A 3I4LA 4ARZB 1AQYA 2Q3HA 4JVLA 1YZLA 4G9YA 4RAYA 1MO5A 1X8JA 1YR7A 5ED4A 4AKIA 2BJVA 1A5TA 5HS9A 2QAGC 1T0JB 4FMBB 3L00A 2FBIA 2WWFA 4JJKA 5BXQC 1D2EA 1W0KA 1XWIA 1LNZA 1Y0UA 3ZH9B 4ZKDA 2VP4A 3S1AB 2XZOA 2FPKA 1GSIA 1VDZA 1A7JA 1TQIA 4UVAA 1F4KA 1JAIA 2VC1A 5F9HA 4AKHA 1IZ1A 1SVMA 4ETSA 3TAUA 4BFUA 2QPAA 1U0HC 1QGPA 2JIZD 421PA 4OQFA 2FSFA 2JJ1D 3OEHA 5FOVA 1VG9B 1Z0KA 2J87A 2IT1A 1VYVA 4PO9A 4TQUS 4RB3C 2KRKA 3KXIA 4HAVA 1LEAA 3JTGA 3FHZA 3R9WA 4FI3C 2J41A 3E3VA 3TDUC 1BI3A 2VHJA 2D2WA 2XZPA 2CL6X 2ZR9A 5E1WA 1JEDA 3EWSA 2LDUA 1LF0A 4NDZA 3GMTA 1KZGB 1SQ5A 3JVVA 4L5IA 3TO6A 1W0JA 1YU9A 2F2EA 3KL4A 4EFNA 3B9PA 1G7SA 2HTSA 4EVIA 1E4YA 2W00A 2FF7A 2R6DA 3B1VA 4EJSC 4CEHB 2J0UB 4ZH4F 4G7ZF 4ENKA 1FTSA 3WU0A 2C78A 2FA9A 2EQBA 2VSXA 2ZE8A 3KFXA 1AIPA 4DJTA 1YKSA 4R98A 4D26A 3WYFA 4Y13A 2Y75A 4A0HA 3UMRA 1QHNA 4C0BA 3U7HB 2IJLA 3DEFA 5KNBA 4ASNA 2X19A 1HSTA 3BB4A 2FZ4A 1P4SA 3SJBA 4DKXA 3QPUA 5K8UA 1T3SA 2IYXA 5LDDC 2A6EF 1CRQA 4BLOA 1N6LA 2OO7A 2VL7A 2KSQA 1BKDR 2RCNA 3I8SA 4A6XA 3PV0A 1E2XA 1D2NA 4GOKA 3CLOA 4I0BA 2V7QD 1HUQA 1X8LA 1W46A 2DFTA 2OFWA 5GJWC 2ZS9A 5ICFA 3CH4B 4XSXF 1G3MA 1A04A 5DCMA 1TQPA 2IPQX 4HV5A 4JQFA 1T38A 3A8TA 4A6PA 3AVUA 4TMKA 1ZNYA 4KFSA 2FMXA 4YQFA 4Z54A 4Q1CA 5IF9A 3WTUC 1SHKA 3QUSA 2VN2A 4B2LA 4CYDA 2QG6A 5KYKA 5EE3A 1G17A 4M0LA 1Q1BA 4HAMA 2GKSA 1H9TA 4DUGA 3W9YA 4NKRA 3UWKA 4IVRA 5CJ9A 2PEZA 4IDNA 4B32A 4LJ8A 2IUTA 2EFOA 3IPXA 1N6NA 4CEJA 5FFXA 4UNQA 3RS2A 5JVTA 3CO7C 5E7JA 3FF5A 1JQLB 1E2PA 2GETA 4L18B 3CX8A 3ECCA 3ND9A 4JVMA 2QE7D 5FTLA 4JBYA 4XJXA 4NYIQ 3RRMA 4A1FA 4KIFA 2UWMA 2QE7A 4MQ9F 2ZRLA 3L82B 1MH1A 4LLGF 5DLQC 4PPNA 2O8BB 5HS8A 2F9MA 5IK2D 2F5CA 4MKFA 4XH9B 5LEKA 3TUIC 4XLPF 5EXSA 1T9HA 2ADUA 821PA 4WXRA 1W36C 2XAHA 1ZC3A 3GEEA 1R10A 4US0R 3MGCA 3EPHA 1TNSA 1E9CA 2GCNA 2IL1A 3R60A 2NNYA 5G40A 5LB2A 5L3FA 1GL6A 1NLZA 1T3HA 2RVCA 4JVNA 2UVQA 2YX7A 2EFCB 3V4GA 4GT1A 4C9BA 2PZFA 4AKGA 3QKSA 2QZ8A 4WZ6A 4EKDA 3HU3A 2L4AA 1DOAA 2DFKB 2PCLA 4DLWA 2Z5FA 2PBIA 3ASYA 3DO6A 1P60A 3JSOA 4RB2C 3ZVMA 1I27A 1M74A 1TQ4A 2W6IA 4QFMA 2QP3A 3HPRA 4BFSA 3U7GA 1KU3A 1XCVA 4ASUD 2J0SA 2O8FA 1Z0IA 4PZZA 3PQJA 4ASUA 1SD7A 4XTRA 4DLYA 4QOSA 2JCSA 5BYKA 4DWJA 2STWA 3TAHA 1KI9A 2HKOA 2BBWA 4KAXA 5GJVC 3UK6A 2BEOA 1ZU4A 1OB2A 1QVAA 3TVTA 5DYMA 2IYTA 5FUXA 2D06A 2J59A 1YS6A 1KJYA 5E20A 4P5OA 5HVQC 4GZLA 2DQLA 4QGFA 4Q1FA 1KSGA 3FHTA 1F3OA 2BBOA 1T8TA 1MV5A 1WWXA 4M72A 1WXQA 4EQQA 3UMSA 2P4WA 3GXOA 1KA8A 2O52A 1RZ3A 1K79A 1BI1A 1N6HA 2QRNA 2RH5A 1F48A 1HH4A 2ZS7A 5HLIA 4RD4A 3IO3A 4TYNA 5GJBA 2O8FB 1FNNA 2M87A 1USTA 2HXYA 1J70A 2ATXA 1S8NA 4PHGA 4Z8YA 4EM2A 1GG2A 2BVNA 2ZRJA 2P5KA 3IL2A 1G6NA 1Z0JA 5B64A 5FBRB 2FE4A 4QGGA 5DD8A 1QF9A 2V1XA 1TQ2A 1XU4A 4Z8XA 3GLFA 3F8NA 3LAJA 2YWGA 3SOPA 5LRRA 5LPNA 2LKDA 1O3SA 2ZXJA 1SZPA 2NG1A 2PH1A 1NVVQ 2ZE6A 2WICA 2HQNA 4Q4JA 4D4JA 5FB2A 2CLSA 2IHBA 1M7GA 2FX3A 1G8HA 5FFMA 5IT9Z 3EZ7A 1F2TA 3X1XA 5DYGA 4EPWA 3HHHA 3U1DA 5H1YA 3T5GA 3MAJA 4AI6A 1USSA 2YU3A 1N0UA 2P8TA 3D0SA 1F6BA 4QBHA 3RC3A 4D0PA 4I1SA 2BMDA 4OHYA 1UHMA 1LF5A 3SYKA 2VOPA 4YC7A 5C4GB 1Q12A 4N0DA 1SXJA 1GDDA 2V9VA 2CJWB 4GP7A 2DVWB 2QPTA 4D0NA 5ILSA 2W58A 3CRQA 5KU1A 4OL0A 3MRSA 5FD6A 5JI6A 4JLPA 4I1VA 1E1QD 2WOJA 1XCPA 5CYOA 4MDEA 5DIFA 3H1TA 2WVJA 1VTKA 4OIQF 2R8RA 3PJRA 1TQ6A 2HEOA 2VP0A 2ZJ5A 3IHUA 1WA5A 1ZM4A 3TH5A 1GKIA 3WNCA 1TAGA 2VF8A 2Q0OA 1F2TB 1KGDA 3EIEA 1CRPA 1Z05A 3GLGE 3GLIA 4FX0A 3F6OA 3VMFA 3D5LA 3LWNA 3BWGA 3QP6A 4K2EA 1XD2A 4F4IA 2BWJA 1F2UB 1U99A 1QDEA 1N6PA 5A4JA 5L3QA 1I4DD 3B1YA 4HSEA 4W9MC 2Q8KA 2FSHA 2ISYA 2RGNA 2VA8A 3Q5DA 4BAYA 3DHWC 3QF4A 3E6DA 2AK2A 3PEVA 2ZNZA 2WWYA 1D5CA 1J5YA 3KKOA 3QXJA 2NO0A 4LHWA 3TW8B 3WP1B 2CQKA 3K0LA 4Q19A 4Q4AA 1SMTA 2F55A 5P21A 1JR3D 1N6OA 3SNHA 2PJZA 5J4YA 4LGMA 3K0AA 4L0YB 2OM2A 4OMYA 2VP6A 1JR3A 3I32A 3OIWA 3IDQA 5TXGA 1ZIPA 1DP7P 2IXEA 1KO4A 3BORA 2BGCA 3PR1A 4KT5C 1MJBA 4ESJA 3VAAA 4BFZA 3Q5EA 5DI9A 3NKVA 4JBAA 2OXRA 2NIPA 2Z4RA 4GITA 3IRQA 3EYIA 2OAQ1 3X1WA 2G0NA 4M9XA 4KFCA 5IT9K 3LXRA 3OF5A 1LDJA 4RCZA 4I01A 3MZYA 3ABTA 4P96A 5DUIA 4M1YA 5L3QB 4L9JA 3D31A 2P5SA 3EZFA 4AYWA 1R36A 1T8UA 4I1UA 2FFAA 1L4YA 3O2PE 1L2TA 2VH5R 3FDIA 4V0NA 2A07F 2UZIR 4IW3B 5FOWA 4B3FX 1CGPA 3ZQJA 1E94E 4LYJA 1EXMA 1S3SA 4PSKA 2W24A 6PAXA 1D9ZA 1W7PD 3K0AB 3R9XA 3RABA 3TRFA 1KZ7B 2FEZA 1SVOA 1W7PA 2BHRA 4IJAA 2CE2X 5A2QZ 3MSXA 2WV9A 1P2VA 1T39A 2G77B 1FP7A 1DARA 1FQJA 2H09A 3CX7A 4WVFA 1COWD 4DT1A 1W44A 2R6GA 3MMPA 5H68A 1EGAA 3RPUA 3AVOA 2NPIA 2ETHA 2GBLA 4PAQA 5J47A 4YG2F 4OIOF 4PXAA 4UNSA 2IW3A 2DBBA 5AJXA 4WA7A 4LX0A 3RPQA 2Q9BA 4G94A 3V7SA 3HSRA 5DN6D 4WW0A 2C77A 2OV2A 1KO1A 4WZAE 2BBSA 3D6TB 4UVCA 2CNWA 1TNTA 1OYIA 1W7PB 1MJ9A 2JPCA 1PUIA 4JL8A 4EGZA 1B1BA 3KP6A 2ZJ8A 4Q5SF 2CLDX 4Q4LA 4GMXA 5KPDA 3ZP5A 3LBNA 1X6VA 4RY2A 2ERXA 2VP5A 4DT1B 2YX4A 1S1MA 4BNCA 4TSFD 4Q21A 4C7OB 2YHSA 3FMSA 5CVRA 4BFVA 2ZRCA 3GFIA 2QRZA 1TTYA 1V4RA 4KITB 1ZM3A 1DEKA 1W4CA 1XCGB 2DYKA 2W2VA 3I64A 5FOTA 1G4UR 3NVAA 3AGPA 4D2IA 5L3CA 2JJ8A 2ZQ5A 2P5LC 4B2PA 1IN5A 1DPRA 3C5HA 3F8TA 3P20A 5H8WA 2RAPA 3P32A 1OJLA 4N3NA 5LLQA 4H1UA 1I2MA 2G83A 2QM7A 1GTVA 2R44A 2R9VA 2ZSAA 3HPQA 4LWZA 3DPUA 3K0SA 2ZRIA 3G5UA 5L3VA 1HTWA 1QHYA 1UKVY 3KKQA 2KI5A 4LBYA 3SU8A 1XRJA 1IM2A 1DAKA 1XNJA 2V79A 3V00A 2FBKA 2BDTA 2CEAA 1KI7A 3BH0A 3I73A 5A2QK 5B2ZA 4MHGA 3VX3A 4IPAA 2PG4A 3L0PA 2C6YA 4PO1A 2D1HA 1MO6A 4JK1X 4X8MA 1A2KC 4LDJA 4RB0A 4HEJA 3KX2A 4JSYA 2QWWA 3PUWA 4N0EA 4HB3A 1KGSA 2KBEA 4RZ3A 2ORVA 2QUFA 3TK1A 4RZUA 1AZSC 2RQPA 5CB6A 3RS7A 2AFIE 3NBZC 4EDHA 2B8TA 2ZIAA 3T5XA 1MKYA 1YRAA 1H65A 4FCTA 3DV8A 1CXZA 1L0OC 1XJ0A 2HJVA 2KJQA 4A8JB 1B9MA 4HYEA 2V55B 5LGTA 5J5CA 2QYOA 5KSPA 1DO2A 4M4SA 4XVUA 3LAPA 3IIKA 4LB5A 3TLXA 1BMFD 4US1R 3ZJYA 3ERED 5SZHB 4TN1A 2GA8A 3FZVA 4EPYA 2P0EA 3HU1A 1S2MA 3HP1A 2KWIA 1FWZA 2DK5A 3ZMTA 1E9BA 1NKTA 1HKQA 1KU9A 2WTEA 1G18A 4MYTA 4ZO4A 4MRPA 4W5WA 1IONA 2WMNB 2EFWA 4Y15A 3MFYA 3HRMA 4BZQA 3RHFA 3EDPA 4KN7X 5ILUA 4NPHA 2IYSA 2P6NA 5JEEA 5HZKA 1VIAA 2GZWA 2IA0A 1K6OA 1W5SA 5CB8A 2P5TB 1HW1A 1N5JA 3NH6A 3GJXC 4OU0A 4B33A 5HPYB 3A36A 1OFUX 2IYVA 1W7AA 1IF1A 1G3SA 4IRUB 4HAXA 2WV0A 2IYWA 1X1RA 4OHWA 5FL3A 3EPLA 5AR1A 4G0NA 2QSYA 1AM4D 1P92A 1EV7A 4CICA 1W4BA 2BV3A 2F43A 2OAP1 2XNDD 3E5HA 4V0MA 1GRQA 5EE1A 3ZS9A 2IRFG 4YLGA 1IRGA 4L9WA 3GP8A 2OCYC 3FKQA 2CBZA 1DUXC 3K8YA 2AHOA 1R00A 2ZREA 4RD3A 3A4NA 2XAFA 1T0FA 3T1BA 4DCSA 4DDVA 4DQ2A 1QHHA 2MMGA 3KKNA 4YXWD 4W7SA 4B3GA 4OHZA 1KI1A 2KE5A 3LBHA 4TL7A 1RUOA 2JT1A 1NG9A 3JAMZ 2QBYB 3F8FA 1I4TD 2FN4A 2A6HF 4JVSB 2W83A 2QM8A 3U2RA 1KO8A 3ZMSA 2Z9OA 3WTSC 3VR4A 4LBVA 1FP1D 1YTYA 1N5KA 3IRRA 1RIFA 2WJVA 5KSZA 2UZKA 4Z2YA 2EB7A 3I54A 2XASA 1ZREA 2ORWA 1YW8A 1KKMA 2F43B 2J7PD 1KJWA 1RYHA 3PEYA 3J81Z 2RKHA 1G16A 2H6BA 3K9HA 3Q7PA 4LHXA 2BV6A 4RGRA 2VHTA 4KU4A 3HOSA 3RDIA 2QGZA 1XEWY 1G6HA 2YSRA 2OQGA 2NRAC 3MEXA 2ZS8A 4MITA 5JWRA 4FCVA 3RLFA 1OH6A 5E3HA 3U2QA 5JS7A 4HZIA 1QHHB 3M1EA 1ONVA 4S04A 2VSFA 4EMSA 3QXHA 3UKDA 4URXR 3EPJA 1TQDA 3SJAA 4FIDA 4QLCU 4NMMA 5E95A 1KIMA 3CTAA 5J6XA 3ZMVA 3UG7A 4FX4A 1RYFA 1UF9A 4PPQA 3ZMDA 1E0KA 2QA5A 3WRXC 5DHFA 4EFLA 4U7BA 4MGYR 1OHHA 2RB4A 2WKRA 3GLXA 4U88A 2EFHB 2F7SA 4TTQA 1SVLA 1S3GA 4D0LB 1ZCAA 1IJEA 1MZBA 2GILA 1KAOA 3FM3A 4DIEA 3B73A 1IY0A 1T5LA 2QROA 2IYUA 3LX8A 3RAPR 1IBRA 1I6XA 2H6CA 1TF5A 4ESFA 4ESVA 2JLYA 1Z6TA 4CXFA 4BRUA 4DSOA 3U44A 3I61A 4XSGA 1R0WA 4I2OA 2BC9A 3G3ZA 2GK7A 3AF0A 3ZZ0A 3AAFA 4EIWA 2F1IA 5L8VA 4UVBA 1WE2A 2HWVA 1E9RA 3JAMK 3C8UA 3WY9A 3OV8A 4ZYGA 3G73A 2BEJA 1XCMA 5FBVB 4JYCA 2A7QA 3PITA 1Q1ZA 4ZDKA 2ACJA 3TE6A 1IUYA 3NXSA 1OIXA 5HR5A 4E09A 3THWA 2GIVA 1NBME 1G7RA 2HDCA 1XDUA 2L3DA 2CE7A 1E0SA 2V6IA 1T3LA 1R6BX 5E8IA 3IQXA 3LLUA 5HCIA 1ZP6A 1W5TA 5KPJA 2XGJA 4TZ6A 4MTEA 2RMKA 4A8JC 2DK8A 1N0VC 2C95A 5IDVA 4FCWA 3J81K 4IJMA 2GCOB 5DH9A 1XGOA 1ANKA 3LQRA 1AKEA 2DCUA 2BKUA 1T0HB 4ZPXA 1OXUA 1Z6XA 2V4ZA 4GOJA 1JGSA 2YPRA 4ITRC 3TKYA 2R2AA 2XJ4A 1LW7A 4HZUA 4JLAA 3ADBA 1JB1A 3VR6A 4IHTA 4X8LA 3IPYA 3M6AA 2ZNYA 5EEGA 1ZAKA 2GTPA 4U02A 2WJHA 1Z6GA 2F1HA 3F3YA 3QXSA 1G5RA 1D8TA 3NC0C 3NBYC 3DZ8A 2H94A 5DUKA 2QNRA 3KJEA 3GFLA 3GZ5A 1TF2A 3QIAA 3IQWA 5HDGA 4RFSA 3ZIAD 1NJFA 1E2LA 2G7UA 2NTYC 3EC1A 4KN4X 2PT7A 2JEOA 2WSSA 1D6JA 1R8QA 3Q3JB 4BRWA 4HLUA 3KEOA 1U2RA 1SD5A 4NZYA 3T1OA 4FWTA 3WNBA 4HF1A 2GWHA 5F9FA 4LY6A 2E1RA 1HA3A 1DAGA 2ZAMA 1O3QA 1RRPA 2GJKA 2NZ8A 4FMDB 2IX3A 4HZUB 4URYR 3LBIA 5D5UB 4P9UA 4C0QC 1UAAA 4A36A 1UJ2A 1TTTA 2ODWA 4P32A 2CVHA 3PEUA 4HBLA 1U0JA 4UHTA 1P61B 3T8TA 1P6RA 2X1VA 2AXNA 3QVVA 1JE8A 3M9AA 1E6CA 3DEUA 4PHFA 3IWFA 4ZCLA 3AVYA 3K53A 4Q1DA 3RSLA 1CU1A 2C96A 2FE3A 2WWGA 4QC2A 3A1VA 1V5WA 2G6BA 4WXPA 3HYRA 3U4QB 3RIRA 2OZUA 2LF7A 1RJ9A 3E6CC 1E2EA 2OBMA 3E97A 1KU2A 4MYUA 3NHAA 3U3KA 5FTJA 1OIWA 3CUOA 3FMIA 2VSOA 2JATA 1RKBA 3QOPA 5FUYA 4IDOA 4DDTA 2R65A 2JTVA 1G3QA 2F3RA 2ZEJA 4LV5B 1OPXA 2OLKA 1WSUA 4Q9JA 4B3BA 1QQIA 4LSGA 1FYLA 1I1GA 2XIGA 1IRFA 2MC3A 4F7ZA 5HOOA 3U60B 2IF0A 2C9CA 1WQ2A 3BJAA 5ICCA 4BZXA 4KA4A 3QOFA 2E9SA 1IY2A 2MLKA 1B9NA 2BYVE 3E5QA 5L3DA 1D2MA 3J7AO 1U8AA 2ZCWA 4TT3A 5H70A 1EFRD 1XMJA 5FBWB 2AWNA 4L9TA 4DCNA 5JCPA 5SZIA 1EFRA 3LH5A 5KHOC 3TGPA 1N6RA 4LPKA 3GLHA 5FTKA 3TO9A 4JLKA 3VODA 4RCYA 3RKYA 4A3VB 2WC2A 3CRRA 1P62B 3B85A 2ZRBA 2P6RA 3QENA 5CIWA 2EW1A 2DWQA 3EA5A 3O8DA 2QZ4A 1I1SA 2PEXA 3BE4A 1FPQA 1E1RA 3F72A 1UCRA 2JPBA 2J5PA 5DEQA 4IRIA 2BKEA 3WHKA 3AEZA 2OD5A 3P9KA 2E1CA 3QI2A 4AG5A 2GXAA 5JZVA 1Q22A 4LUCA 3LRPA 5BPIA 5CVJA 2XXAA 2YVUA 4V0KA 2ESNA 1Z7UA 3SQNA 3I59A 1FX7A 3P4XA 3CPJB 4LJYA 4HUTA 2Z4SA 3SHFA 2J5XA 3LNCA 4CVNA 4TYWA 3R0AA 3B6EA 2GZDA 3CRMA 1VHTA 3PUXA 4NYMR 2M8EA 1VIYA 3DQVC 4EV0A 1P9RA 4TV7A 1MGTA 1YO5C 1NMZA 1S9HA 4UXJA 2ZM5A 4HQMA 2GJAA 2L54A 4OIPF 5L3SB 4UUVA 4Q9KA 3QAHA 1XZQA 1SFEA 2X77A 3OEED 3WMGA 1SMYF 1TU4A 4DLXA 2BEKA 2VBXA 3WGGA 5L3EA 2H92A 4URZR 2AK3A 3NH9A 2ZANA 4KLZA 4ZI3A 1XTKA 4M1SA 4K81B 4D80A 1CJMA 1CTQA 2CLCX 3LD9A 1EFCA 1TQMA 3CPHA 1XD9A 3LVRE 5EXTA 2PI0A 5KNDA 1GVJA 1BI0A 5BW8A 1VCIA 2G1JA 5D8LB 5G3ZA 2WJYA 2O8CA 4U7DA 4HAZA 4R2HA 5JJKA 2ZRFA 3GJ4A 3NHBA 1G8PA 4Q03A 4C0AC 5KOYA 3H3ZA 1OE0A 4P31A 2C8VA 4DLZA 2XZLA 2MH9A 3DPTA 4KMFA 1C0WA 2P3SA 3CWQA 2VYFA 2OHFA 1HT1E 1DBSA 3VNUA 1GILA 2H1LA 1G3TA 4Q4ZF 1XXHA 1BIAA 4EJUA 1G41A 1O7FA 1FP6A 3SHWA 3A4LA 3B60A 4YIIA 5DO9A 4YMWA 2K7LA 4HUQA 5AK0A 4CIDA 4BEBA 5KDDA 1DAIA 1NJGA 2DHRA 1R5OA 2GAOA 1K6MA 1W0KD 3TR5A 4IOKA 1FSHA 3ZMZA 5FPTA 2A3SA 3T1VA 2C98A 3WTXC 2JASA 1VG8A 4EPVA 1ZRFA 1BYIA 4GL2A 1OXSC 3AV0B 3U9GA 2BIFA 2IYQA 3KXLA 4JJZA 5BWMA 1E0AA 4G5OA 4DB4A 3BH7A 4UV9A 2O8CB 1HSJA 3KP4A 3QJYA 3NIBA 1ON2A 2VBCA 1LB2A 3SEAA 1VG1A 5HDKA 4UXHA 5FUVA 3RS3A 5G53C 1SD4A 4XWOA 3OEHD 5TV2A 1DPUA 2AN9A 4B8XA 2XKOA 5E8GA 4RB1A 4BQSA 1H9GA 3F8BA 3K09A 2LF8A 3NC1C 1K78A 2VEDA 1XXHB 3L0OA 3F21A 5B58C 2FEMA 1Z91A 3I1FA 4MQBA 2NZJA 4MYCA 4LV8B 3EASA 5TY0A 4RZ2A 1G3IA 1ZD1A 4KIBA 1W0JD 3CNNA 4AIIA 3BROA 1R0ZA 4HW0A 3BFKA 2DPUA 1GHCA 2PMKA 4KV9A 5ICEA 1UKYA 4P0TA 1KDPA 2ORIA 2XRNA 2BMJA 5JWOA 5TJJA 5TRDA 2EFQA 3T35A 3RJPA 3WTYC 1W2GA 4QNMA 4YFXF 5KSYA 4NCNA 4A6DA 3MWLA 2RKOA 4K46A 4WIAA 3BDDA 5JRZA 1LJ9A 1TW2A 4D4LA 3WTWC 1S7OA 2CG4A 2LKPA 1J7KA 4EFMA 3WTVC 1CJUC 3KEQA 3ZLJA 4G5RA 1B0UA 2G7HA 3QY0A 1IXZA 4OI1A 5EP1A 4AWXA 2HJGA 2FZLA 4I09A 1NLYA 1OB5A 1C1KA 1XMAA 3I5UA 1KK2A 1R0XA 1HYQA 2A5FA 2WOOA 3FGNA 1Q0UA 1TU3A 2W2TA 4EAQA 3FWEA 4YFNF 3BERA 1U9IC 4MH0R 3TSOA 3U6BA 1G20E 1UFMA 2W2XA 3LFUA 4ZIRA 3IKTA 3AVPA 3Q85A 3PXGA 4A5NA 4GOXA 5FBLB 4AG6A 4KMUX 2WM9B 3PVSA 4MEXF 4JZKA 1E2QA 1KKLA 4ON9A 2IYYA 4DUGD 1U8RA 4XOIA 1JR6A 4M1KA 2MH2A 3N97A 2GWRA 1CBUA 4TMXA 2VO1A 2RN7A 1OXXK 2ONKA 4DLTA 2NPFA 4JL5A 5AJVB 1RPZA 2HF9A 3E70C 2KJCA 3TOBA 2A78A 2WKPA 2ZI3A 4KCGA 3T0YA 4KODA 2F5DA 1UBFA 4UXIA 2MMCA 4O6JA 1Z6YA 5LBIA 4YFKF 3TBKA 3NDPA 3RRZA 2AKAB 4FHTA 1M8PA 5TMPA 4LK1F 3GQBA 1CF4A 1E32A 2D45A 4OK6A 3I3SR 3B1WA 2Y0MA 3NQOA 2GF9A 2O8EA 1CF7A 1Q1QA 2IUSA 3K9TA 5DCMB 4A0YA 2FMLA 1PLKA 3K0CA 3MUFA 3CO6C 4U5XA 2VRWA 1ZG1A 4A2QA 4CEIA 2OFOA 1XJCA 2ZE5A 4AIKA 4F91B 3GEHA 1QZYA 2Q0HA 1YRBA 1BS1A 5LBQA 3FTQA 5C46F 5H20A 1FYMA 1Q1EA 3NEYA 3FMPB 4H1VA 4NONA 5JHHB 3CF2A 1RZ4A 1E99A 1E9DA 4WK8F 2DW4A 4DSNA 3IC7A 1X37A 2DAOA 2WWWA 5HE9A 3VR2A 1Q1HA 1W49A 1QBKC 2HKXA 4CEJB 3REGA 2ODNA 3W8RA 3BOQA 1FBUA 3QU3A 1V43A 3EW9A 3CF0A 3TQFA 4A2UA 1OW3B 2K4BA 1ESMA 3E2IA 2W6ID 4GBMA 1GP2A 4YONB 3GZ6A 2HCJB 2O0HA 3K0FA 4NYJR 2JDIA 4M21A 2HLDA 3L0IB 3P9IA 1CF7B 2KJBA 1G6OA 1ODFA 1CR1A 1R5BA 4G01B 4MGIR 5FGMA 5E1ZB 4PQYA 1P2UA 4IVNA 4OIRF 1Z3IX 5FFZA 1PP8F 4OQXA 4CT4B 4WXCA 4HDOB 4F4JA 3QKRA 3KP2A 4TYYA 3T12A 2NAZA 1ZRDA 3CH5A 3DFGA 4M9SA 1REPC 4LI0A 5J4HA 1N6KA 2IEZA 2A9KA 1S8FA 3AP2A 2HYFA 5DI3A 4B35A 5CDFE 1HURA 1SKYB 2ZRMA 1SVKA 2QMOA 3FHOA 2FF4A 2GZAA 3QKSB 4M1MA 2QMUA 4EPRA 3GUDA 4JLVA 4LJZF 4R79A 1WDTA 3B1ZA 4QG7A 1S96A 4XVRA 3K0FB 1VG0B 3MFKA 5JFGA 2FFHA 3HR7A 4PSVA 1YIOA 2TDXA 2EFEB 2PN6A 3OFND 5EE0A 1D3YA 5GADl 2YKGA 5L3BA 1FYKA 3QPWA 2AXPA 4RSGA 5L3RA 3OFNA 1XFAA 3AKYA 1EFTA 1VCMA 3LO5A 4CHUA 4OINF 3UATA 2QGNA 4DLUA 3GFPA 3O8BA 1JI0A 4H9GA 4NCHA 2DT5A 5CLSA 4E70A 2FU4A 1E9EA 1HE8B 3EWAA 2A30A 1HQYE 1U5TA 1ZYRF 1ZC4A 5LHIA 4M1OA 4M22A 4OKSA 2MBFA 3BOSA 2JGNA 2GJ9A 4JKYA 3IBYA 3IILA 5HDNA 2FU5C 4R1HA 4MRRA 2IP2A 1LVAA 1NN3A 1ZD9A 5IT5A 4LV6A 2VLIA 2ZXUA 2FJUA 2HEIA 1CLUA 4OJKA 4TQ9A 4A0XA 1SXJD 1PLLA 2K27A 2ZRAA 1YJ5A 4MUBA 5A5GA 2XAJA 2LNBA 4P4SA 1QHXA 3UXMA 3T1TA 4ZI2A 4DEXA 2YC2C 3V7RA 4OI4A 5AJZA 3SS8A 2WZQA 4OHVA 4L9SA 3L9FA 4Y0AA 2X4HA 4RGSA 2Y8EA 3AQ4A 2E7XA 4EM1A 4WAUA 4RD0A 2G1KA 4BLSA 2H5EA 1Z2AA 3GLFB 4LFUA 4PPGA 4EUNA 1X3UA 4Q7MB 4M73A 3O3KA 1UKEA 3M8EA 4YIFA 3MWMA 2N1BA 2HTJA 2Z43A 2ZRDA 4Q4JB 4AIJA 1KDOA 1MO4A 4UJ3A 4YDHB 3T06B 3VX4A 5KDOA 5CJ2A 1QO0D 3ZVRA 2L4MA 2V9PA 3SQXA 3PIRA 3E5XA 3SXYA 2CHGA 2W6JA 2OEPA 4NH0A 2XB4A 2IF2A 4OK5A 1A2BA 4TYQA 1JJVA 5JBQA 1LS6A 1ZINA 4GMDA 1AGRA 5KK1A 2Z0MA 4P4SB 1SXJB 1GL7A 3MWKA 3R7WA 1NN5A 4HX7A 3D7MA 4UNPA 3IHWA 5A0FA 4KYWA 5HZHA 2CO5A 3W3AA 4Q9LA 3EETA 3MJRA 2XROA 2JLZA 2J3EA 1EWQA 2EVWX 4BXUA 1DAMA 521PA 2IVMA 4U0YA 2BBYA 4Q02A 1ETUA 1DTSA 5FR1A 3B8HA 2HQRA 4HA8A 1XDBA 5BQ5A 5LHGA 1WCV1 2QQAA 4G5GA 2FRHA 2AWOA 1YZQA 3FOZA 3GLIB 4A2PA 3K70B 3MWJA 3AB3A 3UANA 3W5IA 4GXOA 3P7NA 4TMTA 1Z2CA 5CYVA 1XD2B 5EXXA 5DISB 3TQCA 4A0FA 1ODDA 2WTUA 4HV6A 3VOEA 4MDFA 4XLNF 3EIQA 3G82C 3QF4B 1QVRA 4PGHA 2CL0X 2J0QA 4MTDA 4M6XA 1E2JA 1ZNWA 1OH5A 4CEIB 4TYPA 2JLXA 3F23A 3R7WB 1R58A 3I58A 2VODA 4Q4AB 1H8EA 4LBWA 1G3WA 1GRRA 1II8A 2GAUA 2O6GE 3SN6A 1FZPB 3BK7A 3KB2A 3E6MA 2IBMA 1II9A 3TW4A 3QE0A 2WJJA 2FH5B 3EA0A 3UMFA 3U7EB 2SHKA 4DLVA 3QP5A 1BYUA 1KY2A 4FXPA 4C0JA 3LSTA 2DZOB 4ENJA 2WAYA 1O3RA 2ZE7A 6Q21A 5K5QA 4OK3A 3FXQA 3K9NA 1P3JA 3IEUA 1ZLKA 2IYZA 1D8JA 3L2OB 1EK0A 4NE2A 3H4MA 3FVQA 3WRYC 2CWEA 1ESNA 2FSIA 4L0ZB 1LV7A 4KIGA 5CVVA 5JEDA 2R6FA 4GZMA 2RGEA 1VTNC 1UB9A 1I4LD 1IAWA 3H84A 3KFVA 3GFMA 4IXAA 4GO1A 1II8B 2CNWD 3LQQA 3J80Z 1AQUA 2ZRNA 2QVOA 4R9UC 4KSCA 4N0BA 3WGHA 2PX0A
chains in the Genus database with same CATH superfamily
4CZCA 3NRCA 3TDZC 1CRWG 2W85A 2D62A 2E48A 4PAOA 4M3BA 3PXCX 5CR9A 3G7SA 3EGIA 4DR2B 4MUYA 1FC0A 1JFVA 3FWYA 3PNOA 4UTZA 2J9ZB 3HK2A 2LR0A 3Q87B 3FKIJ 5CXSA 4WP2A 3HY4A 3A1NA 4Q0MA 1D04A 3HBMA 1HXHA 2M5WA 3LVWA 4M0UA 5GADJ 5F76A 3EDOA 1ISPA 5EEHA 3OLWA 1Z28A 5FULA 4LTMA 5D4RA 3HZZA 5JY6A 1O89A 2AQIA 3N3BC 3W0LB 4JX6A 1YLFA 3ZK8A 4Z53A 4IRHA 2G5CA 4NJMB 1Q83A 4LWOA 1BO6A 1Z47A 2NUAB 5BUZA 2M45A 2HVQA 3F2IA 2W8BB 4ISBA 2WU4A 2BOVA 1RE0A 2GEVA 1EQUA 3VR4D 2ZB7A 2FXAA 4QYSA 3G17A 2B1RA 2XHKA 4IJKA 4DDWA 3ZGVA 4Z51A 4RMNA 1ZI9A 1P2FA 4PGFA 3OOPA 4PRLA 1SCUA 2G71A 5JAHA 2GLOA 3REQB 2VE9A 3SX2A 4CMHA 1XSDA 3A6LA 3U3XA 3LA3A 2IHUA 3MUNA 2F5EA 2WV7A 1Q3TA 5ED0A 2DU9A 1WCWA 4ZCTA 1RWKA 3JQAD 2J3MA 4A8HA 1Y3CE 4GDFA 2GMWA 2PJDA 2VZ8A 3EFHA 4BNLA 2XB2A 1K7FB 4XB2A 4ZVRA 3CNLA 2X0RA 5BN4A 2FPPB 1F1ZA 5EN4A 4M7RA 5F6FA 3RTBA 1BEUB 5EIAA 4LF6M 4IWXA 5ESXA 4XIYA 3F9IA 2OWDA 5MFPA 2JVKA 4WERA 3PSIA 3X44A 3H0KA 1PFUA 4A3DJ 1GWNA 4CL2A 3K8ZA 1LFPA 2I67A 4EGQA 5IHPA 2JI9A 1CZHA 3Q9SA 2HLPA 2VB6A 3S3TA 3WNQA 1HV8A 3FXLA 2JK0A 3OUZA 4YP6A 1GL3A 1D8AA 2HAEA 3ZHUA 1EEHA 2H4JA 2Q2NA 2D00A 4PZYA 5B4TA 2Z30A 3ZTYA 1Q15A 1CS0A 1CQIA 2V1CA 4IJFA 5J8CA 3CA8A 3W1EA 1SY7A 1VYTA 1JA0A 4B47A 5JTUA 5L4LA 4PYQA 5J2TA 5TDHA 2NQTA 4FT2A 4DB2A 2GM4A 3ETCA 3RJ5A 1IN7A 2Y1GA 4I8XA 2P1DA 4HDVA 3GJ6A 4PC6A 1E69A 1PVDA 3ADPA 1WCIA 2J4CA 4IJ5A 3J7AY 3MT7A 4CM3A 1E79A 5AQ1A 4OHKA 3ITNA 2FSPA 3TZKA 5D00A 2E7WA 1BOFA 2ANBA 1D1QA 1WW3A 3T6KA 2BR4A 1VMAA 3K6GA 1Y3FE 2G3YA 2P65A 2V58A 4L51A 4A2WA 2ZJ2A 2G25A 2PGDA 1OT3A 4IIGA 4X1OA 4BMPB 1AK2A 3NTLA 1US8A 3Q7QA 2P77A 2AG0A 1AKRA 2ONCA 2VKDA 2O48X 3GBSA 3T9FA 2WDPA 3ASNH 1W6RA 3K4PA 2Y0TA 1KYQA 2RGVA 2W11A 1G20A 1LQ2A 5J59A 4FZJA 2WA1A 4JQZA 1XTJA 1MJGM 3ROPA 1ECGA 2N1MA 3UUEA 2PU7A 2KRUA 2D2FA 2QUHA 3VK7A 4S1TA 2JLRA 2ZUCA 4F6RA 1P7YA 2D3WA 1MRZA 3JWIA 2NU8B 3GX4X 5I01A 2XNSA 2K9QA 5DDGA 5JFTA 4M74A 1NZFA 2Y0BA 1UK6A 4BKOA 3ZD7A 4FJ2A 4W97A 3ORSA 1WB5A 5I7SA 5AIPA 3GO8A 3BGWA 2WHXA 1FOKA 1XC8A 4DSAA 2QRLA 3HJRA 1XF9A 1L7OA 5JLJA 3AUFA 4ZZ3A 3L2AA 3RSGA 1LDGA 5F0HA 5FKOA 5KOJB 3UT5A 3LVQE 2HLDD 1C3LA 1USVA 2QUZA 1IJFA 5AI5A 1DEOA 3U31A 2JD0A 4HPQA 1T6OA 3AOEA 2VJOA 3WV4A 3C7AA 1DFHA 3RHTA 1F6WA 1TXGA 3EISA 1GKKA 2YZKA 3QKRB 5DOZA 4L5BA 4UN2B 2VPWA 1T9KA 1SULA 4A69C 1IUOA 1SK9A 4OU4A 2DUWA 2RGXA 3E7LA 3GX1A 4HEA1 1BN7A 2R8BA 1MJ5A 4V0OA 1VMDA 4DV7B 3FFAA 4O0LA 2PUFA 1SZDA 4ZYVA 4KE6A 3WU1B 4IXNA 1JBEA 3WG9A 3UAVA 2XNCA 3OO0A 1MAUA 4CMBA 4JLJA 1B6TA 4W5TA 1ZNQO 4IHKA 1K3XA 1JG4A 3CYFA 1YX5A 2DLDA 2VTDA 4X63A 1E3PA 3VUEA 1JQ3A 1M8GA 1HNNA 3G1LA 2VK2A 2IU0A 5L8RF 5J40A 2RGBA 2X8AA 5E3NA 4BEJA 1VHWA 1BC8C 1MU5A 1BVSA 4A03A 4LSMA 4HQEA 5JOQA 4QDKA 2P9QA 1H1DA 4WN9B 4B5KA 3PQEA 2O3UA 3FFBA 2JFGA 4JBWA 2HO5A 2R79A 3O47A 4YT8A 2BM0A 1JP7A 4HSRA 1ZCZA 3DF8A 3MQ0A 3JR9A 4O4JA 1MSFC 3GNQA 5FI0B 5C9ZA 4C7OA 3WBKA 2WAQN 1N34B 2HXSA 2VONA 1A1SA 2V7EA 1Y1PA 3P1JA 1Z6PA 3ZV4A 3WHCA 3LW8A 2BM1A 2IXTA 1M5UA 1ZKDA 2HNAA 1OR7A 2HRQA 1PZNA 3MZ8A 5JRJA 2HWWA 1QGZA 3IV5A 1XLVA 3M9WA 3SHQA 2FGKA 3GUYA 2QTNA 5D4SA 3T61A 1SVIA 2V6MA 2BOLA 2C97A 1A4XA 2I4LA 1P9NA 4IZHA 1Y6JA 2Y0CA 4XIJA 1PJIA 3DZCA 2ARKA 2UXBM 1XCBA 2C2ZA 2VNKA 1JDBC 3FXUA 1E17A 3TJRA 3ESQA 3EZNA 1QFSA 3WHPA 3QEMB 8LDHA 4UXNA 3NIWA 2XNHA 2R4GA 2EV5A 2KFDA 1TCBA 5SZKB 1ECCA 2QQ0A 3MGBA 4PVDA 1O9GA 3U3JA 3I34X 5LGUA 3DTVD 3M4OJ 1JPJA 3I2JA 1ZEJA 4LRSA 3ND8A 4I8DA 4UQOA 4LD5A 1QZMA 5BSFA 1RESA 4LTNA 3V1YA 5LQNA 1JKMA 3GRYA 2ME0A 4K6MA 4JBXA 3JTHA 2QGFA 4XPIA 2A7XA 4LVNA 3HQ4O 4DGWB 4TTIA 3TGNA 2MLGA 1JTYA 5EZ5A 2Z6QA 2OZKA 2NXCA 3SDBA 1WZ2A 1TDJA 2V3VA 3AM3A 2Q0QA 5AI9A 1KQGA 1NSTA 2FFQA 2O0KA 3P0EA 4BAUA 3R2JA 1MNQA 2IYNA 5ECGC 1LDMA 1QZZA 4B6OA 4NU8X 4BN0A 2OK8A 3HCPA 1P72A 3JYLA 4PHTA 1DHRA 5KAMA 3ZZ1A 2Y66A 3UTCA 1Z2OX 4LMYA 3F7TA 3DVLA 4K9OA 2E4UA 4LX8A 5KVQA 4AL4A 1SGWA 2JFNA 4XPZA 2HMSA 1ZR2A 4F11A 1AF7A 1R9NA 3EGXB 3I9JA 2WPDD 1SZJG 3BJIC 4AF7A 1TADA 1BI2A 5KJCA 4MR8A 3ZGOA 5KNCD 3BJ6A 2GDZA 1T98A 3QXCA 3PCRB 3Q8WA 4QUIA 4E4TA 4PTZA 4DVGA 1UMCB 3U4AA 3USZA 5GY7A 4EKEA 1ZCFA 1JXMA 3BG7A 5D3MA 4B3MB 4RVOA 1EVKA 1DBWA 3BPSA 1Z4OA 3IAM2 1HFKA 2GYYA 3OBBA 2EV6A 4MWDA 1Q3HA 2QWXA 5M5WJ 5B7QA 5JXHA 1ZM2A 2HR3A 4QYIA 2DR2A 1O6CA 1C3OA 4ONEA 5ECDA 3ZX4A 2O14A 3TZEA 2E5LB 3R1IA 1W59A 4CMIA 1RAEA 1T5DX 2SICE 5HXAA 4R2WA 3AEUA 4JS0A 2NYXA 2FPXA 2Q6KA 3HHGA 2XNJA 2YXPX 3CUWA 2H9AA 4DFDA 4FMCF 3GMIA 3AF6A 1L6IA 3A6KA 3MS2A 1M2GA 2BJVA 1V37A 2WFMA 5BVHA 3L00A 3C1UA 4HOYA 3E9DA 2OFPA 2ZIZA 5FPPA 4Q3BA 2HJRA 4NV3A 2QN9A 5TQJA 5DX0A 4JYAM 2F2EA 3DGEC 4EFNA 2YQZA 4J3JA 3L1IA 1D4AA 1KU6A 2PS1A 1YKSA 4D9FA 1NHWA 2PNJA 1I3KA 4BLOA 4YRZA 1J2YA 3QVGB 3HBLA 4ZJUA 4A6PA 4GLJA 2V6BA 3L1PA 4XFDA 4B2LA 3HP4A 1ZVJA 3VBCA 3W9YA 4NKRA 2XWSA 1N6NA 3GGGA 5FFXA 3DU6A 4L9AA 1YFJA 5FTLA 3H4VA 3SSAA 5K6AA 1FSPA 1EQAA 3OZRA 1N36M 2PH7A 5EXSA 1T9HA 1V35A 4US0R 2H00A 2HI3A 2BZ0A 2GPAA 2IL1A 1HRKA 2W71A 3WHIA 2K4MA 2PZFA 4C5AA 1TQ4A 4QFMA 2QP3A 1E7QA 1AMUA 1E3EA 3L1KA 3TAHA 5CVTA 4EB6A 1ZU4A 1QVAA 5LYYA 3TNLA 5EJGA 4EQQA 1PR9A 3HNPA 3GLSA 1OBCA 1YJ9I 4IR7A 4D56A 1A97A 3S3MA 2V1XA 1QF9A 2YWGA 3EXEA 2Q4BA 2V9CA 2JS7A 4V39A 1F2TA 1P80A 3WL3A 5EHXA 1EXVA 2EAUA 1N0UA 3RC3A 4LYGA 3MJEA 5I9NA 1SRQA 3R5HA 3MLBA 3S8YA 1Z8HA 3CRQA 5CYOA 4O33A 3I37X 3I04A 5KKAA 5DHPA 1CR6A 1TF0B 3EIEA 4OVZA 5IMBA 2MIIA 3QP6A 4D9EA 1F2UB 1GGHA 1I4DD 1O8BA 1QBGA 1Z2DA 4U9UA 3B7WA 4LHWA 2QQGA 1S2LA 1Z62A 7MHTA 3H1AA 1N6OA 1XG5A 1KWKA 5DTQA 4RM3A 1MJBA 1P9QC 5LU8A 1TO2E 3QPCA 5D5PA 4P98A 5L3QB 1R36A 1LBEA 4MW9A 3I56I 1E94E 3DOJA 6PAXA 4DM3A 4JI7B 3TRFA 1SVOA 1PL7A 3ZE7A 3HV2A 1P2VA 1T39A 5AKHA 1GU0A 2R6GA 1VEKA 2VJ5A 3NS7A 4KXVA 2GBLA 3S2IA 3UV7A 1BKYA 1JILA 1N7IA 1R2YA 5IPAA 5BSMA 1YS4A 1EJ0A 5F23A 3RYHA 4DIKA 4IGEA 2A35A 3P0FA 1OWOA 4EKIA 5MHTA 2WF5A 4RK6A 4L4ZA 3RE8A 1PCXA 3LOUA 1IM5A 1GO2A 3QM1A 3FBIB 4CFSA 5H8WA 5LLQA 2ZSIB 2R44A 4IJWA 1JDPA 3V7NA 3DPUA 4CCMA 1XNJA 4PBSA 4I66A 4AUMA 2XMDA 3VX3A 5D8DA 3ILYA 4F1KA 3LX4A 2XBUA 4RZUA 3VDUA 2O7NA 3K0HA 5KQMA 4CDRA 1XNQM 3HJUA 4DBQA 1XJ0A 2W7NA 3FZVA 1Q0TA 2CXSA 6GPBA 4P93A 4D1YA 4CR7A 5HQ3A 2XCUA 4WK6A 2CUFA 2ZYSA 3M5CA 5JNRA 1J8VA 2BF4A 5CB8A 4ZVNA 4ESOA 4F2WA 1NJ8A 4G9BA 1O9BA 1E59A 1GN9A 4EJ6A 2MGWA 3A9CA 2VDMB 4NOJA 1P1BA 4C43A 1PS9A 4NQRA 4OXQA 4OKIA 3A4NA 3NANA 2YIJA 4DDVA 4DQ2A 4U9IS 1J0XO 2JT1A 3QTTA 5E8JA 1TO1E 3F8FA 1HNZM 1FP1D 5KSZA 1O77A 4KWIA 2BW3B 4ZP1A 5LFAA 2B8NA 4FGZA 3VNQA 4XYBA 4URXR 1K82A 4U2BA 3CP8A 1TQDA 3OYFA 3RKUA 1ID1A 5FF9A 2A9FA 3MXOA 4QXRA 4OG2A 2GILA 3I01M 3ZE0B 2HWUA 2JK3A 1D6SA 3U44A 4XSGA 4K9RA 1TYZA 4XQFA 4OLHA 4Y2QA 3AM5A 2WQZA 1FTGA 1XCMA 3AG3H 3NATA 2Q50A 2X4IA 1T3LA 3IPAA 4GKBA 2DK8A 4FCWA 3J81K 2C8KA 4RGBA 2BDUA 2DA2A 2VBFA 2FRXA 2XE8A 3U4IA 1QIFA 2BCEA 1N7HA 2G7UA 4JEUA 1R8QA 3GRRA 4MWSA 3KEOA 1U2RA 1E20A 4TGLA 1AXRA 2AYZA 3IJRA 4C0QC 2V26A 3PJGA 4HVLA 3QVVA 4JYMA 3K53A 4ZEWA 3C98A 2G6BA 2FN3A 2BWBA 3ND7A 2JATA 2PFGA 3M7IA 1PYDA 5JPDA 5LA6A 4X6AJ 4KXQA 4GM1A 2AMJA 4GD3Q 3UKGA 3E5QA 1KA9H 2FW7A 4WGGA 4ALLA 3VODA 3PUFA 2X9QA 2WC2A 3PS9A 2ZRBA 3L6RA 2EW1A 1FPQA 1R0SA 2WWVD 3P9KA 1I2AA 3V7UA 3ROFA 1OLTA 2ESNA 4W1SA 3WOHA 4LJYA 2J5XA 3KUXA 1MNAA 3AOGA 1NBEA 1YO5C 5F52A 3OKPA 3K2EA 4MW5A 1ZTRA 4ZZ1A 1T1RA 2B4YA 3TPCA 3OOHA 3O94A 3D7NA 4K81B 5EXTA 5THXA 3HXTA 3OZTA 3SOZA 2BVLA 4E5KA 2XDQB 4F72A 1GQ2A 2C8VA 4P82A 2FPUA 3BMNA 3CWQA 3AJDA 2NX2A 3VNUA 3ENZA 1XXHA 3MN2A 1PS0A 2IV7A 2WQ7A 3JWHA 4IOKA 5FPTA 3AB7A 2GGSA 3EUKL 1IH8A 4I4NA 4YXFA 2IIPA 1HSJA 3DLHA 1G2QA 5DHTA 3I76A 2PJRB 5KTOA 4XWOA 1DPUA 3T9EA 4LTDA 3F8BA 3L9XA 1QVVA 3PQ6A 1L4LA 1TQ8A 3EASA 4J0DA 4OU5A 4KQCA 2QSFX 3WLPA 1PTJA 1NRIA 5KSYA 2YRWA 1J5PA 5C3UA 3OCWA 1NLUA 3OTOM 1SUSA 4G5RA 3VVLA 4MI9A 1BMDA 1B73A 3RH0A 3PZBA 1ND6A 3JAMS 4JBGA 3AEYA 3HJ8A 4PG8A 4G5YA 1S4MA 3UEOA 5FWXA 4G8DA 4KMUX 3EAFA 2QZZA 4X1YB 2GWRA 5GAGJ 2ZC2A 1GSAA 1CF4A 4LK1F 3WWZA 1HLPA 2A9QA 2NW6A 2Y0MA 2C2KA 4RA6B 4AULA 3DKYA 2NO5A 1L1TA 1JDUA 4C29A 2DW4A 2WWWA 1UK8A 4Y9DA 4MWZA 1FBUA 2K4BA 5C8DA 2O0HA 2C2WA 4J0FA 2I5UA 4S0XA 4GI2A 1YT5A 1X8XA 4M3GA 4TXJA 3VSBA 4XKBA 2QL5A 1IE3A 3GUZA 3AHCA 3E58A 2FFHA 2J4FA 2JFUA 1Y33E 2EFEB 2PN6A 4ZI7F 4HH0A 1AZWA 3NBKA 3ROGA 4HWKA 3BTSA 1U8EA 4DR3M 1HE8B 3SF0A 4WUVA 1PQWA 4BVAA 1U5TA 4UEKA 3VOTA 1IHOA 4JKYA 4AWAA 4DBVO 2XF6A 3VV2A 1PLLA 4EYQA 3UOAB 5TF4A 3UJBA 4BY7J 3D2AA 3S3NA 3BSYA 2ZPUA 3L6BA 4YIFA 4L28A 3SQXA 2V9PA 3EXG1 4O4LB 3IAS6 2GFIA 2QD5A 3OSZA 1SXJB 4LOIA 5EY5B 2Y1WA 2ZKLA 3S2DJ 1T2NA 4CETA 3H4IA 4JV5M 1LI5A 2XDYA 5BQ5A 2XZDA 3IVMA 1FNCA 5CURA 5LP6F 1ODDA 4XLNF 5C5EA 3HVUA 4CR6A 1C30A 1UPUA 1IG0A 4BKPA 2J3QA 3GVHA 3LQ2A 3NNDA 3SN6A 1II8A 1X7GA 4KPFC 2P0WA 1FYXA 2ZE7A 2FB9A 3JRBA 5AFSA 3CJTB 4ZOLF 3KJQA 2GPBA 4L0ZB 5F9MA 4WADA 5B7PA 5CEJA 1BSVA 3GR6A 3LQQA 3KSZO 5AW2A 4OJNA 2X5NA 3WV5A 3UR3C 1FTNA 2A5WA 1E1KA 1LSSA 3Q8XA 1KVUA 2QJRA 3D6UA 4PFKA 1ISGA 4LWQA 3WMEA 3C4VA 3ZU6A