The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
86
|
sequence length |
310
|
structure length |
301
|
Chain Sequence |
LRPSNFDGYIGQESIKKNLNVFIAAAKKRNECLDHILFSGPAGLGKTTLANIISYEMSANIKTTAAPMIEKSGDLAAILTNLSEGDILFIDEIHRLSPAIEEVLYPAMEDYRLAQTIKIDLPKFTLIGATTRAGMLSNPLRDRFGMQFRLEFYKDSELALILQKAALKLNKTCEEKAALEIAKRSRSTPRIALRLLKRVRDFADVNDEEIITEKRANEALNSLGVNELGFDAMDLRYLELLTAAKQKPIGLASIAAALSEDENTIEDVIEPYLLANGYIERTAKGRIASAKSYSALKLNYE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Holliday junction ATP-dependent DNA helicase ruvB
|
publication title |
2.7 Angstrom resolution crystal structure of a probable holliday junction DNA helicase (ruvB) from Campylobacter jejuni subsp. jejuni NCTC 11168 in complex with adenosine-5'-diphosphate
rcsb |
source organism |
Campylobacter jejuni subsp. jejuni
|
molecule tags |
Hydrolase
|
total genus |
86
|
structure length |
301
|
sequence length |
310
|
chains with identical sequence |
B
|
ec nomenclature |
ec
3.6.4.12: DNA helicase. |
pdb deposition date | 2010-10-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF05491 | RuvB_C | RuvB C-terminal winged helix domain |
A | PF05496 | RuvB_N | Holliday junction DNA helicase RuvB P-loop domain |
A | PF17864 | AAA_lid_4 | RuvB AAA lid domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Helicase, Ruva Protein; domain 3 | Helicase, Ruva Protein; domain 3 | ||
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |