3PFIA

2.7 angstrom resolution crystal structure of a probable holliday junction dna helicase (ruvb) from campylobacter jejuni subsp. jejuni nctc 11168 in complex with adenosine-5'-diphosphate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
301
Chain Sequence
LRPSNFDGYIGQESIKKNLNVFIAAAKKRNECLDHILFSGPAGLGKTTLANIISYEMSANIKTTAAPMIEKSGDLAAILTNLSEGDILFIDEIHRLSPAIEEVLYPAMEDYRLAQTIKIDLPKFTLIGATTRAGMLSNPLRDRFGMQFRLEFYKDSELALILQKAALKLNKTCEEKAALEIAKRSRSTPRIALRLLKRVRDFADVNDEEIITEKRANEALNSLGVNELGFDAMDLRYLELLTAAKQKPIGLASIAAALSEDENTIEDVIEPYLLANGYIERTAKGRIASAKSYSALKLNYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvB
publication title 2.7 Angstrom resolution crystal structure of a probable holliday junction DNA helicase (ruvB) from Campylobacter jejuni subsp. jejuni NCTC 11168 in complex with adenosine-5'-diphosphate
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Hydrolase
total genus 86
structure length 301
sequence length 310
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05491 RuvB_C RuvB C-terminal winged helix domain
A PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain
A PF17864 AAA_lid_4 RuvB AAA lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3pfiA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3pfiA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3pfiA01
4OBEA 2K4JA 4EUNA 4MEYF 2ZSAA 2HCBA 1QG2A 3EW9A 3HJNA 2IYQA 3UMFA 4OIOF 1N5KA 2GAAA 3KW6A 3KQNA 3R0JA 5FD5A 1K8RA 4IOMA 4M9QA 3MWLA 2O52A 1OT3A 2GEVA 4AG5A 2STWA 2ZBKA 1UKYA 3LQRA 2RAPA 2WOOA 4IOJA 1E9AA 4PC7A 4QGFA 4KVGA 1GKIA 1RYFA 3K9NA 4TYQA 4LHXA 5LHIA 4WBSA 3B9QA 1IW7F 3RYRA 1GKYA 2CJWA 1EV7A 2REXB 3BD9A 5DE3A 3VQTA 3D31A 2F1RA 3M8FA 4N0DA 2PMUA 2CSOA 2CL7X 2ZI7A 2F43B 3ADKA 1RC8A 1E1QA 2JTVA 1ZGAA 1MH1A 2RHDA 1NVWQ 1Z2AA 4H1UA 2ZI6A 3LO5A 3W6PA 3NVAA 2P5TB 1XSVA 1Z6YA 2GESA 2O0HA 3P9KA 1E2IA 4XJXA 5J6XA 3N97A 3I32A 4CVNA 4POAA 3E6BA 1U5TA 2QP3A 5JSZA 3U3MA 1P6RA 1MJBA 2MMCA 4FW9A 4ENJA 1QGPA 3QRFF 1BKDR 1EFCA 1YQTA 3IHWA 2REBA 1BYUA 1HW2A 3ROUA 1CKEA 3BJAA 2MLGA 3FVQA 4HF1A 3ND8A 4GFDA 4AVPA 2ATVA 2E1RA 1XXHE 3LFUA 4ON9A 1NVMA 5F6FA 5CLSA 1KMHB 3QKRA 3VU9A 1FX7A 3WXMA 2V6JA 4D4MA 2Z4RA 3LAJA 2BOVA 1GAJA 5KK1A 4M0LA 1ZMXA 1Z9CA 2EWVA 2E7WA 3JTGA 3O6BB 1BN5A 2WKQA 1OW3B 4HB3A 4KMUX 1OLOA 4UXHA 2XAGA 1KJYA 2X2EA 5KNCA 4G5GA 3H2YA 1Z08A 3RC3A 4G9YA 1JBKA 4EJUA 3P9IA 5CLQA 4DJTA 2HYGD 4KICA 3FMPB 4G0NA 4LV6A 4PAMA 721PA 1DDNA 4HQEA 3I1FA 3P1JA 4DUGD 4TZ6A 1RFLA 3P4YA 4E07A 1SKYE 2ZJ2A 1I2MA 4QXAA 2WWXA 2P5VA 2GXAA 2GEDA 4AD9A 2BMEA 3KZ1E 1JR6A 3GYHX 3ZVNA 2MSEB 3PEUA 5HCIA 1ZVQA 5G53C 2VO1A 4EKDA 3EETA 2K86A 3LVRE 4U0WA 4IRHA 4H1VA 4KAXA 3DXJF 2PEYA 3AH8A 3U44B 2DTRA 2AFHE 2F3TA 3EA0A 4DDVA 5FGMA 1AZSC 1HURA 2DFNA 3FFAA 1HBXG 4KCGA 4OMZA 2QZ8A 4S05A 2Q9CA 3MAAC 2JLXA 2FPMA 4B3DA 5CK5A 4WXDA 1PUIA 2H18A 2LWIA 4B35A 4V03A 4D25A 4IRIA 4N9IA 5CJ9A 2F5FA 2YNMA 5DHAA 4B33A 3VAAA 2HOEA 3QP5A 1GUAA 2GBLA 3GLFA 4PR0A 1D8KA 1WRJA 1R8SA 4Q00A 3UANA 2GXGA 4AWXB 1ZRHA 2ZTSA 4NCNA 2D06A 2V3CC 1LEAA 1GRQA 2QU8A 2GZAA 4TTPA 2EFDB 1NJFA 5EZ5A 3AGPA 3R20A 3E5UA 4G1UC 1SFEA 4UXIA 2HYFA 4A0YA 2F5DA 1R0ZA 1XFAA 3L09A 1REPC 1S4QA 2AKAB 2IC5A 3LY5A 4GNKA 3CDHA 4JN6A 4TLCA 2XROA 3ZZUA 4N3NA 1G5PA 4GCVA 1W1WA 2N1BA 1ZH5A 3QF7A 1TW2A 2XNSA 2YKGA 1YG2A 1G19A 3WTVC 5J8FA 4URVR 4LBVA 4UNPA 3ZMTA 1IXCA 3H3ZA 5DUKA 1GNRA 2ZJYA 5J4KA 4OHZA 1H8ED 2WAYA 1BI0A 4P4SB 3FMSA 2ZS9A 4V0KA 1EESA 3C41J 2WWGA 3GWZA 2XTMA 3GX4X 3WRYC 3EWSA 2J7KA 1NSFA 2CWEA 4PZYA 2K5UA 4HQMA 3PFIA 2GA2A 3QPTA 3D8BA 4RB3C 1RRGA 4RZ3A 3IQWA 5FFXA 2NZJA 3KP2A 1R2QA 1I4TD 1NSTA 3RS3A 4DC9A 2WVJA 2EV0A 1S6LA 2ZO4A 2D45A 3FGNA 4PAQA 2KKOA 4PX9A 2EFWA 2KI5A 2OFOA 3H92A 3FFBA 3E5XA 3KKOA 4JBYA 5FPHA 1OJLA 4KU4A 2IPQX 4OHYA 2OEPA 2P5SA 3K0CA 1TEVA 4EPWA 1Y3AA 2JJ1A 2ZCWA 2R65A 2ANCA 1OE0A 4UJ5A 3CWZA 4D81A 4TL7A 1N5LA 2QE7D 1WF3A 3JZAA 4JVMA 2M5WA 1PUJA 4ZYHA 1R5BA 1RKBA 1W46A 2IEZA 4OK3A 5CIQA 1G8YA 2W6JD 3I5YA 1F2TA 4DIDA 5JJKA 5AIQA 3VLFB 2JLSA 3N2IA 1I1SA 5IDVA 3SHWA 1TW3A 3RTRA 3OE7D 2IUUA 1ZRFA 3TK1A 3SJCA 3TGPA 1CIPA 2ZSBA 3I73A 3KUDA 3RS2A 1ZBDA 4HLQB 1NIJA 1J7KA 1J0RA 1II8B 2ZIAA 2XASA 1YFHA 2YJTD 3NH9A 4EPXA 1ZN2A 2XXAB 4DZZA 2W2TA 1S3SA 3RDIA 4KFSA 4KVAA 1L2TA 4PPQA 1KDRA 4XVQA 4BLPA 1S9HA 4EPVA 3FHTA 2BBTA 2C95A 2FSHA 2W0SA 3PQCA 3UG6A 4BFZA 5LB2A 3K0SA 2IJLA 1E99A 2E1NA 1KU9A 2XOKA 3E70C 4BFXA 5HZHA 3QPWA 3X1WA 2D7DA 1TNTA 2F3RA 1CJUC 2DBYA 4JBAA 1S3JA 3SFZA 2CK3D 3CRRA 3GLGE 4N9HA 5L3DA 2QA5A 2Z5UA 3HRUA 2FZ4A 5FBVB 4IPAA 1Z3IX 1U81A 1Z28A 1RJ9A 5FR2A 1HT2E 2I1VB 1S7AA 1YS7A 4RSGA 4TQ9A 3AVXA 2GRJA 4FX0A 4BFWA 5ICEA 3HYRA 3K9HA 3ND9A 1P2FA 4ZDWA 4DXAA 4PZJA 3T8RA 4HAYA 4AIKA 4JQFA 4EVIA 2EFOA 3IRRA 1UKVY 2P6NA 4PTLA 4EJSA 2X0LA 3F8BA 4MGRA 2OZEA 1KQ8A 3KFWX 1SVIA 3JTHA 2NNYA 2CBZA 4MEXF 4BQAA 2J0UB 2ODBA 2WJYA 3CTAA 2CHGA 1O57A 5ICCA 1DAHA 1UFMA 5F1RA 1RYHA 5AJVB 2RNJA 2FF4A 2A5DA 4E22A 1XPRA 1YZQA 1P9RA 2Q8KA 3B78A 3CRMA 1VG0B 3IPYA 4BFTA 1J99A 2IF0A 3T1OA 1XTKA 4Q4JA 5FL7D 2ZUCA 2XTNA 4AURA 5JWOA 3LVQE 1IY0A 1CULC 4UXNA 3MFYA 2J0SA 2A6EF 1ZCBA 4G6QA 4L9JA 2DWOA 2J87A 3OFNA 3T12A 1U2WA 1S7OA 5ED4A 2AN9A 2C9YA 2CNWD 3E2IA 4HATA 1T98A 2D1VA 3ZIAA 4B74A 1JEDA 1IAQA 2GZWA 2B8TA 3GFLA 4Q18A 3MZYA 5DCMA 4IVPA 1J2XA 1S8NA 4Q01A 3JAMK 1XTQA 2ATXA 5F2EA 4OHWA 2JLWA 3NTUA 4D0LB 3K0EA 4K2EA 4URXR 1FNNA 4RFSA 5FPYA 1OIVA 1TQIA 1E2KA 2J5PA 2FFBA 3MCAA 4FINA 5IRCD 3BB1A 1WB9A 4IHSA 3BE4A 1UCRA 3K9LA 1XCMA 3RLFA 3I64A 1EH7A 3AVVA 1WP9A 1TMKA 1OKRA 1TQPA 1G8GA 3CIOA 1I2DA 5DIFA 4QGGA 2DWQA 2ZMEB 2IYVA 2D4HA 5CB8A 3EAQA 4W5HA 2JPBA 3A1TA 4A2UA 2VC0A 1R5NA 5SZKB 4HB0A 1ZREA 4KIFA 1YLFA 4WK8F 2IHYA 1OH6A 1NBMA 1SVKA 3CJNA 1T9HA 4V0ME 5BYKA 1CRPA 3HDTA 4UUVA 2Q6TA 4QC2A 4QG7A 3KKNA 5J40A 1OHHA 2DK8A 1TNDA 1X3UA 4RAZA 1W0KD 3KUCA 5JJIA 3LLMA 4I2OA 2C6YA 4A36A 1WQ2A 2RC4A 4KN7X 4HX7A 2NO9A 3O8RA 2H6CA 2ZRGA 1GILA 2VIIA 3I4PA 3J81K 2PEZA 1TTYA 4V0LA 4XTRA 5CDFA 3Q72A 2FMLA 3FDIA 1IQPA 1W36C 1IRGA 1WDTA 2B21A 2PT7A 3EPJA 1ANKA 2F1IA 4JVLA 2QNRA 3WBKA 2J7PA 3KZYA 3NHAA 3DFGA 3KCCA 4HX4A 2P6RA 1G9XA 1X8LA 2ECKA 1W2HA 1KGSA 4M72A 4A6EA 3THXB 1LF0A 3NEYA 1BMFA 1P2VA 2ZI3A 1NJGA 2OAQ1 1WI9A 4XLNF 1GVJA 1Q12A 3F72A 1XPOA 2VSXA 4KYIB 3BK7A 3RWOA 3CRW1 3SS8A 1QBKC 4Q5SF 2JDID 5LRSA 1IHUA 3OEHA 4MRNA 3CRVA 1RIOH 3O47A 4RKEA 1JR3E 2O8EA 4F4IA 3UWOA 4IDQA 4B71A 3N5CA 1TX4B 4S04A 3U2RA 1CJMA 4A3VB 4RB1A 2V4ZA 4HUQA 4G5SA 1JAHA 1M8PA 3BB3A 1A5TA 5H6RA 1HEIA 4O0MA 4EM2A 4CEIA 1E1QD 1FUUA 4WZAE 4EV0A 5TV2A 4ARZB 3ZD6A 4XOIA 1FYKA 2BCJQ 4MDFA 1ZG1A 4Q7LA 1R23A 3CUQA 4JSTA 1X8JA 3NQOA 1C0WA 4LHVA 5E7JA 4BECA 4KSCA 1FFHA 2IT0A 1Q1QA 4R2IA 3GZ6A 3DZ8A 2CG4A 1TQ2A 3RHFA 4CZ2A 1J90A 1UM8A 3F8FA 3SHFA 4IHTA 1ZUNB 4CXFA 4IXMA 1BOAA 1D2EA 1KO5A 1I5ZA 1J9IA 1G3MA 1UBCA 4R98A 1K78B 4URZR 3T1VA 1XCVA 3PQKA 2OBPA 4A4DA 1HSJA 2G7HA 3SN6A 2IA0A 1AM4D 4YONB 1Q22A 1Z0KA 1SVWA 2IWHA 3E6DA 3I8SA 1YS6A 3AVPA 1Z7UA 1QHYA 3ZS8A 4HAWA 4KFTA 3GXOA 5HDGA 2AWNA 3QOPA 3ZMZA 2A9KA 5H1YA 4A6PA 2HF9A 1Y63A 1HW5A 1XEXB 2UKDA 3QEOA 2O8FB 1ZG5A 2IXFA 3GJ4A 1FZPB 3SYLA 1YKSA 2MSCB 3RS7A 5EUQB 2HEIA 2XZLA 3AP2A 5FPSA 4A2PA 4XLPF 1A82A 4QNMA 3TKLA 4HUTA 3TUIC 2Z5FA 2ASEA 3P27A 1COWA 4JLBA 4TMXA 2KIFA 4ENNA 2HCJB 4DCNA 3OIUA 3WNDA 5JEEA 3THYB 1KAOA 3NKVA 3CO5A 4KHZA 4YMUA 2R8RA 3QXHA 3AF1A 3QG5A 3F8CA 1K5DA 3U1DA 5L8VA 4NKRA 4HZUB 1K79A 3B7GA 2L0XA 2BDTA 3WTUC 3TQFA 2EFQA 3TGNA 2VPPA 1HYQA 4EJVA 1FP1D 2ZRIA 3IO3A 1NVVQ 4LV5B 1V5WA 5G41A 1P3JA 2WWWA 1D5CA 3T06B 4C2UA 3KXLA 1VIYA 1F6BA 1SXJC 1GP2A 1U0JA 4V02A 3WNBA 2FEMA 1EFUA 3KB1A 2FE3A 3HR7A 2IW3A 4WAUA 1MO5A 3H4MA 4UKDA 4JBWA 3LBNA 4JLDA 4PC3A 3EASA 2WTUA 1K5GA 3GLIA 1GVNB 2PZGA 3W3AA 2FBKA 3K09A 4LJ9A 4M9XA 5A0FA 1KU3A 4EIWA 1NKSA 4YG2F 4FMBB 4L4UA 2J59A 4P0TA 4MUAA 2IS2A 1FP7A 2ZROA 1R4AA 2O03A 5EP4A 2GZHA 2NZ8A 2XAQA 1QHHB 3WGIA 4I7HA 2VP4A 3AVOA 4PO1A 5TXGA 2IYZA 3K70D 2BEOA 2GCOB 4G7ZF 4DKXA 4RFVA 2WKPA 3TE6A 2A6HF 1X1RA 4PCQA 5E1ZB 5KU1A 3GLHB 2PMDA 3BFKA 3GJ8A 1XMSA 3VODA 2V6IA 4R1HA 5E1WA 1ELOA 4EGYA 1YZKA 2IS1A 2VXZA 1R5OA 4Q4HB 3VR6A 1QO0D 3NRVA 1VDZA 1USTA 4M1MA 3AAFA 2JAQA 2VF8A 2BKUA 3QVVA 1QG4A 1TF5A 3MJHA 5P21A 3FHZA 1Q1EA 1XGOA 5GJWC 4A5MA 2VSOA 2C2HA 2XZOA 1ZIOA 3H0KA 3SI7A 1E96A 3BOSA 3K1MA 2AXNA 4DSOA 3N2EA 3ISPA 2OHFA 2K27A 5FBQB 2N42A 1H65A 1FTSA 2ODEA 3VTKA 1VYTA 1EX7A 2I4IA 1VYUA 3K2ZA 3EDPA 3LSTA 1AKEA 1KY3A 1B9MA 1ZIPA 2B7CA 1CR4A 5FI1B 3UWKA 4EQ6B 1GIAA 2HZTA 4EFMA 3NBXX 1GNQA 4LGMA 3ZDQA 1W7PB 5LDDC 5KVRA 3C8UA 4B6FA 4LSGA 4XWAA 1U98A 1XEFA 3BGWA 3QI2A 1KKLA 1L4UA 4GZLA 4FT8A 2G9NA 1OFTA 3GJXC 3DM9B 3TR5A 2FMYA 5JJLA 4DRZA 1N6HA 2FN4A 2JJ1D 3A1UA 3IBYA 3U7GA 2PJRA 1Z47A 2FOKA 3R60A 2C99A 2JRTA 2J41A 2RGDA 1G3WA 3THWB 2QSZA 2R6AA 4GMXA 1N6OA 2FA5A 1ZD1A 2FSIA 2VF7A 4PANA 4TMKA 4PHGA 4Q02A 2OU2A 4KXFB 3MWKA 3MWYW 4TQAA 4QHYA 3LWFA 3M7GA 3AVWA 4C7OA 1YR9A 2O8BA 1TUEA 5K5RA 2XVCA 1QVAA 4Q9LA 4YDSA 4Q4LA 2J5XA 1F2UA 1IBRA 2CCGA 2Z0MA 4MYUA 4HF2A 2FSGA 2GVDC 4HB2A 2ZANA 3EQLF 4EMSA 3E6MA 3PQJA 1ZCAA 3HOTA 1KI3A 1ZM2A 2E87A 2ZITA 4Q1BA 3DPLC 2DAOA 3ZMSA 4XBFA 1SMYF 2FFHA 2QAGC 4L9VA 4G01B 4RD2A 4A8JC 1NY5A 4C3ZA 4HAXA 2XOKD 3B1YA 2ESNA 1KJWA 1E9DA 2Z43A 3QXXA 2K4BA 4R9UC 4GSYA 3GEEA 5D8LB 5EJEA 4OOIA 1KZGB 2C77A 3SZRA 2HXSA 2DQRA 3CR8A 1OFHA 2FJUA 1GTVA 4Q03A 5DEQA 3CPJB 4YDHB 3VR3A 4BE7B 1R1TA 5HZKA 4IDNA 1F9NA 1G8HA 3RSLA 2QE7A 1Z6TA 3NEUA 4Y13A 1IONA 1NVVR 3FKQA 3V4FA 3GVAA 4MQ9F 1OKKA 3SZTA 1N3BA 4L9NA 5DV5A 3LRPA 4G7HF 3SDZA 1HA3A 1VG8A 4PQYA 3B2EA 4F93B 1Z6GA 5ELXA 4XSHA 3QIAA 3MLEA 2PZEA 1KI6A 4M1YA 4DDUA 2Q0OA 5DHFA 4U88A 2R6FA 4DLWA 2XUBA 4ESFA 4M21A 5BS6A 3RABA 3U6BA 1W36B 1J75A 2IRFG 2VLIA 2LNBA 3CRQA 3FMQA 3Q5FA 2VSFA 3UXMA 4ESHA 4D4KA 1IXZA 3H86A 3L2CA 4NCKA 3BWGA 3U3RA 1C1KA 3HSEA 2W58A 5FD6A 3QU6A 1BS1A 2ETHA 4RB2C 1BM9A 2ZQ5A 1AIPA 4I1UA 5UKDA 3ZQJA 2V1XA 4FX4A 4WVFA 5FBLB 5JI2E 2JLQA 1ZHFA 3K9TA 2EB7A 2ZYUX 3OFND 4R2HA 4LK1F 5TDHA 4JBXA 4RJLA 3ZIAD 2BMDA 1YR6A 3DMNA 3GJ5A 4BLRA 4X8MA 2JLVA 3GFPA 4L5JA 4UV9A 4LX0A 1F5NA 1P73A 1BI1A 2J45A 3T5DA 1D8JA 1T8TA 4GOXA 5G40A 1UB9A 1YW9A 5DH9A 3R8CA 5DGXA 1UDXA 3M9AA 3TVTA 3PUXA 3OHMA 1XEWX 3AQ4A 3Q85A 2ODNA 1T0FA 2F43A 4MKGA 4HOBA 4CYMA 4B3GA 2Q21A 3RVBA 3IWZA 4QM7A 4KNYA 3H84A 2W2VA 3AP3A 2JEOA 4BYYA 2G1JA 4OQMA 4QJ3A 5F9FA 4TLBA 4DB4A 4ZYDA 2FBIA 1AOYA 2Y75A 1GG2A 4LLNA 3CX7A 1IOZA 1BO6A 4LC1A 4IKEA 4DEYA 2EFCB 4TL9A 3ADCA 2P65A 4FWTA 2XNDA 3RI4A 3SOPA 2OG2A 1R8QA 1NBMD 2VT2A 2P7CB 2QMEA 1U5TC 5L3QB 2E9SA 3IL2A 5IT9Z 2A7QA 3AVQA 3MWMA 1OHHD 4AKIA 3BRWD 1P2TA 3E97A 3R8FA 3I62A 1YJ5A 2JLRA 2ZE5A 5JRZA 1FX0B 1KMHA 4HAZA 1P4SA 3NBZC 3KXIA 4P3YA 2WJVA 3UATA 4BLTA 2BBOA 4JJKA 4B73A 2D74A 4B2IA 2HJVA 1WSUA 4KYUA 2FFAA 3F3YA 5FR1A 5JEDA 1J8YF 1C9KA 2GA8A 2H1LA 5CVVA 5B58C 3WTWC 1AS3A 3CWQA 3T8TA 2IWRA 5B30A 1BC7C 1HSTA 3HSFA 3CF2A 1SKQA 2J7PD 2WHXA 3IIKA 3PUWA 1X6VA 3Q9SA 3QKSB 3V9PA 4DCSA 2XHKA 4YIIA 4JT4A 3VB2A 2YX7A 3MWJA 4I02A 3NH6A 1OH8A 1G64A 1R0YA 1RI7A 2D62A 3P20A 4OQXA 4WXRA 2GHIA 2YOHA 1BBYA 4CEJA 3KP6A 1BMFD 3F0TA 1FOEB 1RW4A 1ZAKA 3QG1A 5FOTA 3SU8A 1R7JA 3B1WA 1B0UA 3V7RA 4BLQA 4C4PA 3G73A 3OEHD 2F9LA 4JLAA 4B8XA 4CGZA 1KYZA 3EZFA 3QOFA 4FCWA 4O6JA 5KSPA 4OK5A 4B2LA 2QY9A 2FH5B 3U44A 4F4JA 3GQBA 2RCNA 3IC7A 4C0JA 1N6LA 1CGPA 1V43A 1OH7A 2L02A 3DOFA 4RCZA 2NRAC 5D5VB 3QPVA 5GJBA 3T1QA 3Q9LA 3IKVA 2PN6A 3KE2A 4UNSA 1SXJB 1GL7A 1FL9A 1LB1B 3UK6A 1YZGA 3GJ6A 4RZ2A 4ABYA 3HU2A 3LWNA 2BBYA 3QU3A 4RGSA 4TMVA 3VX4A 4N0BA 2VBCA 2L54A 4NHOA 3QF4B 4C0BA 2HFHA 3PUVA 1L8QA 2PEXA 1KI8A 3VNVA 4HYYA 1SVLA 2BBWA 4URUR 4BHPA 1XB4A 2FPKA 2PCJA 5HTKA 4AWXA 3L7WA 1KSJA 3K0FB 3E5HA 5CJ2A 5LPNA 1FPMA 4PXAA 4AKGA 3PR1A 5AJZA 3KFXA 1ZW6A 4LC0A 5DI3B 5EE1A 1A2BA 3KETA 3CW2A 3QENA 5JS8A 4EJTA 2EFHB 4A6XA 2X8AA 3D0SA 2GJ9A 4HLYA 1LNZA 5CYOA 1Z1DA 2DFKB 4ZI2A 2ZVQX 2JDIA 3BPVA 2GXUA 2AD5A 2G77B 1YYVA 1MABB 2O0YA 3I3SR 3HU1A 3PJRA 4US0R 3TDUC 4TWZA 4YC7A 5IHPA 1LS6A 2OFXA 3BROA 2HYDA 3L8YA 2WSSA 3V4RA 1UJ2A 5BQ5A 3KQUA 1B59A 3RRZA 2GQQA 5HLHA 1KO4A 1MOZA 1U2RA 4P4SA 3K69A 4HBLA 1COWD 4UV8A 3B73A 4MUBA 5FH9A 3T0YA 2D2WA 2KIUA 4JMPA 1ZYRF 4PZLA 4MNUA 4YMWA 1MR3F 5D3MB 4ZI3A 1HE8B 4AC9A 5K8TA 1FW6A 5JWRA 4M73A 1E0JA 1VG9B 2JASA 2RHMA 2V6CA 5SZJA 2L01A 3HHGA 4PHFA 3DV8A 4WX9A 4OI4A 4GO1A 4WF2A 2OV2A 2ZE7A 2X1VA 3SBEA 3TSZA 2HXYA 3W3ZB 4LJAA 4RD3A 4YIFA 2V1UA 2XGXA 1PLLA 4DLZA 3I4LA 1PP8F 1XDUA 2VE9A 4TLAA 4V0NA 5FUVA 1DO0A 5JZVA 1VTNC 4AKEA 1W2GA 2WZQA 1D8TA 4U00A 3QBTA 1IN5A 4M9ZA 2FZLA 3SEAA 2G3YA 3GF2A 1QHXA 1VECA 3QKTA 1GXQA 3KL4A 3LXXA 1EH6A 1HXDA 3GLXA 5L3RA 1UF9A 2BIFA 3SNHA 2YINC 2M87A 5JLJA 1T39A 3PEYA 1LVGA 3ZQ6A 3BBPA 5J47A 3NDPA 3MEXA 2WAXA 4YFXF 1F3OA 2P0EA 1S3GA 3VKGA 2W84A 1DELA 3NXSA 2OBNA 1R22A 1XGMA 2YU3A 4ZDJA 3I61A 4TTRA 2DVWB 3U60B 1II8A 2IX3A 3P9CA 2GXQA 1I6XA 3C18A 4YXWA 1E9RA 2XXAA 4ZYGA 2ONJA 2H09A 1JE8A 2KSQA 1W5TA 1S1CA 2RGNA 4M71A 2VHQA 1B1BA 4LRTA 3VMFA 3KQLA 3R6SA 1ZM4A 3D5LA 2ISYA 5F3WB 1F48A 2JIZA 1UDWA 3WE3A 3I92A 4PQRA 1UPTA 2VEDA 4Q19A 4QFMA 2O61A 2BVNA 1XX6A 1R0XA 1WXQA 1DO2A 4GZMA 1QPMA 4JKIA 5HLGA 2J3EA 2WJJA 4DLTA 4Q7KA 1N0UA 5LEKA 1ON2A 3A6PC 2YYZA 4PZZA 3BJOA 4YQFA 3SXYA 1FSEA 1Z2CA 1V4RA 2MC3A 1LV7A 4Q4ZF 3BH0A 3IIJA 4D2IA 2F5CA 1T38A 4O25A 2FNPA 2WICA 5JHGB 2QRNA 4AI6A 4IEEA 2G9WA 3GO5A 4CDGA 1Z83A 4JL8A 5EE9A 1CR2A 4ENMA 1ZU4A 4HF0A 4GT1A 5L3BA 1YR8A 2OE2A 4NYMQ 3RS5A 4FCTA 3ZZTA 2VC1A 5D5XB 2BMJA 3UPUA 3CPHA 3F21A 3M8EA 2J0UA 1OF1A 1W49A 4BFYA 4EJSC 3I54A 3KLOA 4WZ6A 2GF9A 5JBQA 3W9YA 1XZQA 4JLPA 2V7QA 5FFMA 3WYFA 1FYLA 2A5FA 2KRKA 2IVMA 2R2AA 3CKLA 4QGAA 4BEJA 1ESMA 1XXHB 2VE8A 1QQIA 2FX3A 2QN6A 3E6CC 3R7WB 4NCHA 2QP4A 4O5VA 2OO7A 4G3XA 1CTQA 1G1MA 4GP7A 1C1YA 1E2JA 1TQ4A 4Q7JB 4QWQA 5C4GB 3UMSA 2E7XA 4HW0A 3T1TA 5DDGA 5L3CA 3U7HB 2A3RA 5A5GA 2EFPA 5D8KB 3R61A 4M9SA 1MV5A 1E2XA 3LDAA 3W34A 3B60A 1R6BX 2VHTA 3F8MA 3A8TA 4URWR 5BN5A 2IS6A 1SAXA 4IJMA 3HWSA 1DBSA 1N6RA 1XSDA 5CB6A 2IYWA 2DPUA 1J8MF 3GEZA 1SKYB 3V7CA 1KSHA 2H94A 1W4AA 3QE0A 3SE0A 1PP7U 3G5UA 4C0HA 1C4OA 1A2KC 2ZMEA 1D9XA 1E2PA 2PBRA 3WBJA 3GLFE 1E4VA 3L43A 1SHZA 3QY0A 2QP9X 1UHWA 2CCKA 3QXCA 3WE2A 2UWMA 2J0QA 5KDLA 3BFXA 2EA4A 4F7WA 3KQHA 4C0QC 5KYKA 1BOFA 1G6HA 4JLNA 5A2QZ 3I71A 3DF8A 5BPDA 4UNOA 2HQNA 2F7SA 4CT5A 4X8HA 3TUZC 2QM7A 3AVTA 1OKKD 2O8DB 1I27A 2W6IA 5E7MA 1ZRDA 1GKUB 3TQCA 5FOUA 5FLXZ 1BJAA 2PX0A 2M8EA 4EJWA 1EGAA 3DKPA 3I72A 1K6MA 4LD5A 4IXNA 4QBHA 1N2CE 4DEXA 5B64A 3TQNA 1XTSA 2VBWA 5DD8A 2MH9A 2Q2EA 4QOSA 5LD2C 3VFZA 2BHRA 1YTYA 5EXSA 5L3SB 2BE5F 1RPZA 4GL2A 2WM9B 1G4UR 4BPBA 2QM3A 2PLYA 3MMPA 1KU2A 2Y8EA 8OHMA 4DLXA 4ZCLA 2XB4A 2G0NA 2QQ0A 4B34A 2QL6A 4TL8A 4MH0R 2OFWA 3THXA 4NHJA 1E2FA 4EM0B 3J80Z 4NTZA 5JHUA 1GZSA 3AGQA 4JLMA 5LB4A 5KNDA 4ZZDA 4ZIRB 1FSHA 5E8IA 5EXXA 5JI3E 1WE2A 3CLVA 4LBWA 2ZNYA 4MDEA 3ABUA 3RPQA 4UQOA 3KP7A 5DD4A 5HOOA 1VTKA 4GITA 3AF2A 4WOPA 2C96A 2GKSA 5LGNA 1LB2A 3WY9A 3VOEA 3MSXA 4DDWA 1IJFA 2EFGA 2M30A 3MQ0A 1EK0A 2IL1A 3U6KA 4DVGA 2JGNA 1NLZA 4ARZA 5KSZA 3ERED 4GDFA 2PQ8A 1GRNA 2ZSDA 4L8GA 3KB2A 5HCNA 2BGCA 2O8XA 2QM8A 4MGZR 4D0PA 2PFBA 1XMJA 2OUKA 2WOJA 4PHTA 3ZYCA 2JLZA 1YW8A 2D1HA 3CUQC 4RB0A 4C0AC 2BBSA 2XNDD 3IDQA 2NGRA 1US8B 4TMWA 1SD4A 4LRWA 1Z05A 3KKMA 1JB1A 3VKWA 1VMAA 1K78A 2NAZA 1E0KA 2ZE6A 4NYMR 4PPGA 1E2MA 3FHCB 4HA8A 1XBTA 4IOKA 2RKOA 2AFIE 1UEIA 4JYCA 2QLZA 1G16A 4JS0A 1E0SA 1QZMA 4Q1AA 2EQBA 4KLNA 4DWJA 2J5OA 1JALA 1HY3A 4EPRA 4G5QA 5D4RA 2IP2A 2ISZA 2RH5A 5ANRB 2P67A 5H70A 1XEXA 2O8FA 3CH5A 2Q0HA 2QMUA 2QT1A 1UBFA 1E32A 2W00A 3CNOA 2H6BA 4NYIQ 2RQPA 5K8IA 1YRBA 3SJAA 1KO1A 5E20A 1BI2A 4LHWA 4ESBA 5JRJA 1KIMA 4ACBA 3VFDA 5E1XA 4A0ZA 3PIRA 4RD4A 1KNQA 1ZLKA 3CR7A 2Z3YA 1ZM3A 3THYA 3A4MA 1HTWA 2DB3A 2IYRA 1NVXQ 4ZCMA 4F92B 2FEZA 4FMCF 3DMDA 1TADA 2HLDA 3BERA 2IUTA 1YVDA 3K0AB 1E2HA 3QXSA 4HZUA 4PQFA 3GLGB 1YQAA 1JXMA 1Z22A 2ZPTX 4DBLC 3E1SA 3GZ5A 3I5UA 1NY6A 2VH5R 3EG5A 3NWJA 3PG5A 4OI1A 4AYXA 2OT3B 5TRDA 3CO7C 1WWXA 3WYGA 4TZ0A 1P62B 2JZYA 1SD7A 5ILUA 1ZUHA 2QEQA 4FWIB 3KFVA 4Q66C 3S1AB 1U8ZA 1XJQA 1FQJA 1W4CA 4FN5A 3WNCA 2FOLA 3ZGXA 5HKKA 3N4MA 4DT1B 4L0ZB 4RZXA 2ZREA 1E79A 4HV5A 1QHHA 3BJIC 1FWZA 4E03A 1JJVA 1XGSA 3BJ6A 3F6VA 2GCOA 2VTKA 3FMFA 1Z06A 2DU9A 4NBSA 1UFQA 4QBGB 2LKDA 4OJQA 3OOPA 1T5IA 4MYTA 4AKHA 1YU9A 2TMKA 3GLHA 3P7NA 5LGTA 1R1VA 4MQBA 3I53A 1F4KA 2VHJA 1M7BA 2BJVA 3LW8A 4Q4HA 5BQTA 3T35A 3MAJA 3KKQA 4LJYA 5KDDA 4PC2A 4ZKDA 2C5LA 1A04A 1NI3A 4XVUA 2WSSD 2VA8A 2FGKA 1QZXA 2V55B 1UKZA 2K7LA 1P4WA 4ZYEA 2VODA 1LY1A 1GXPA 2H16A 3GD7A 3MUFA 3WYAA 3QXJA 3HR8A 4B3BA 3EIHA 1HW1A 4MYCA 1CR0A 1FMLA 4GP6A 5BN4A 1AJEA 1LW7A 3EZ7A 1NBME 3LNCA 5GVSA 4LG0B 1G8FA 3C7KA 4GGGA 4B3FX 1TF7A 4KBFA 4HLUA 3IGFA 1MO3A 2UXNA 3CB4A 4EQ6A 2H57A 2W25A 1R58A 2HKXA 1ZM7A 3MG9A 4CIDA 4QL3A 2BV6A 1DG3A 1W7PA 1SD6A 2NPIA 3CX8A 4LJ5A 1MJ9A 1S29A 4U02A 821PA 3Q7PA 3IO5A 5CDFE 1KI2A 4WWCA 4GBMA 3TAUA 4LBZA 1ZG3A 3QAHA 1XD2B 2HGCA 2IYYA 121PA 1QBJA 2WPDA 2VYFA 3SFVA 4L16A 1UKEA 3WTXC 5LGUA 1KKMA 2TDXA 1DS6A 1ZM9A 2ORVA 2EV5A 3CBQA 3DDCA 2MH2A 1OFIA 2P7VB 2ZS8A 3BORA 1YRAA 4PC6A 4Y15A 4A12A 3V8KA 3THWA 1NMXA 4KODA 4R8HA 3HOSA 1ZD8A 1NG9A 5FTMA 1EFRA 2QAJA 4E70A 4BWYA 2ZRMA 3B1VA 1CF4A 2MD5A 1W4BA 4HV6A 1GRRA 3HPRA 4HEJA 1ONVA 3M1IA 3AKYA 1TEXA 2EYUA 3HHHA 4NYIR 4BXUA 2PMKA 2Z6VA 2FSWA 2N46A 4A0FA 3PUYA 4YXWD 5CLLA 1CU1A 4ZDKA 1DE0A 1E1RA 3U3KA 2WC2A 3X1ZA 3B5JA 621PA 3RS4A 2W2XA 3LLUA 3IWFA 4QBFA 4Z1MA 1XP8A 4W5WA 5AWFC 2EJRA 4B48A 3SQWA 1YR7A 3L0SA 2JIZD 3ZZ0A 5BPIA 3SJZA 3PITA 5IF9A 2KWIA 4KFRA 3LAWA 1LVAA 2O8CB 2QG6A 4Q1FA 3LA3A 1UADA 2ZRPA 1H9GA 4F4CA 5D6EA 2BM0A 5J5CA 4DCTA 2VBXA 3BP8A 4HDQB 4MGKR 4WIAA 4DIEA 1XMAA 1MKMA 2QVOA 1A7JA 5KSOA 3RPUA 4J0QA 3KTAB 3EX7C 3LD9A 2A78A 5CM8B 2YR2A 3C15C 1JI0A 1B6AA 1N25A 1TAGA 2L3DA 2ZKZA 1J5YA 1CLUA 4N1AA 4Q21A 1FBQA 3TH5A 1XN7A 2EWWA 4B2PA 5F9HA 1E2DA 1Q0UA 2AK2A 2IEYA 3VR2A 2CDNA 3KEQA 1E2NA 3LA6A 2R62A 1Q20A 1SD5A 3SYNA 4BZXA 1TPZA 1U9IA 1AQUA 4MKFA 5BYJA 1S1MA 5H20A 2RGCA 4HDVA 2HR3A 2GJSA 5K8LA 3L2OB 2XV4S 2KB0A 3GFJA 2V7QD 2MA3A 1G4DA 4HLXA 1SFUA 3A1SA 4XSGA 4A1FA 1DOAA 3TVDA 1N6NA 5KTYA 2C04A 4PGHA 2G6BA 2VP9A 1GOTA 1TU4A 4II7A 1QZZA 1SULA 3B85A 2ZJBA 3W6OA 5K8UA 1P7CA 2DI3A 5D6FA 1GL6A 3TNFA 1VIAA 4BFUA 3KJEA 2RN7A 2P8TA 2IHBA 4X8OA 4Z2YA 4XIGS 3WG9A 2DO7A 1PLKA 4HYEA 1G7SA 1P6XA 1W0JA 2JJ8A 2VQSA 1GM5A 5EP2A 2KJCA 5LLQA 2YWEA 2FV8A 1XPUA 2IXGA 3PEWA 4Q9IA 1Q21A 4Q1EA 5C18A 3DKVA 2P3SA 3L8ZA 3ADBA 4LYAA 2C9OA 2OSBA 1WRBA 3ULQB 1E69A 4L0YB 1ODFA 1NKTA 2ZRCA 3CH4B 5D3QA 4CW7A 4ITRC 3CUEF 4WXCA 5EP1A 2CFXA 1UBGA 2VP0A 3GLIE 5JECA 2ZXUA 4BAYA 4B6EA 3LQQA 2HT6A 2PH1A 3GFMA 1BIFA 1P2UA 1U8RA 1VCNA 2RMKA 2MLKA 3FM3A 5A2QK 1J2JA 1G3RA 3LA7A 5LHHA 1KO8A 1P60A 1DP7P 2OXCA 5BWMA 4IVNA 5L3QA 3FPAA 1W7AA 3BPXA 4LYFA 4M1WA 4PO9A 4PGGA 2MMGA 3RKWA 3TKYA 1P9NA 5LBIA 3U4QB 1MO4A 5FLXK 2W6ID 3ZN1A 5L3EA 1DAFA 2YC2C 4N0EA 5FOVA 2IW5A 1NHAA 2ZNZA 2HDCA 1FX0A 1KI7A 1T3LA 2ANBA 4OQFA 1T0HB 2CXXA 2HKOA 2NG1A 4TL6A 5AR1A 2EV6A 4CO8A 2G1KA 4W9MC 2ZJ5A 2IK8A 3NEJA 3OF5A 5AUPB 3HIFA 2G83A 2LSOA 5AUOB 3OV8A 1U78A 4MGIR 4XD7A 4IW3B 2BMFA 2XSZA 4FMDB 2VL7A 3TMKA 3W5JA 2GK6A 4HX8A 3QKSA 4LPKA 2FE4A 2ZI9A 1GSIA 1Z0IA 2G88A 2GJKA 3TUJC 2IYTA 4IRGA 1OXSC 2P5LC 4NZYA 3FWEA 2W0MA 4PPFA 2Z9OA 5BXQC 4I1OA 1E4YA 1LDKB 3RJPA 2P6TA 2XGJA 4S35A 3KQKA 1E94E 1HKSA 1G21E 1N6PA 2WKRA 2QENA 2QUFA 1PLJA 4CEHB 4KIBA 1NP6A 1SGWA 2OA4A 1XTJA 1EG7A 3FYHA 6Q21A 1II9A 3AVYA 1G20E 1NN5A 2B7BA 2ZAMA 4JT2A 5AUNB 5C4MA 2YHSA 2G0TA 1OXXK 1ZP6A 5J4YA 2C98A 1T3SA 2FMXA 1L0OC 5TJJA 2HTSA 2KJQA 4WA7A 4PSVA 4R79A 1SVMA 2V9PA 4K46A 5EE0A 3FXQA 3D3QA 1SXJA 4DHEA 5KSYA 5JI6A 3BOQA 4P4UA 3U9GA 1G7CA 1G18A 2CHVA 2ODWA 3IEVA 1NMYA 1DAGA 2W57A 3QF4A 2CQKA 1YW7A 4QLCU 2YOFA 3ZLJA 4LHYA 1NF3A 3EA5A 2K02A 4TSFA 3PUZA 2A61A 2IUSA 4LBYA 4P5OA 3IEUA 5G3YA 2CE7A 4O2RA 4I01A 1H0MA 3K0FA 5FTJA 4Q47A 4A6DA 1CRQA 1KGDA 1UEJA 2R44A 3AF0A 5TB5A 4LJ8A 2RB4A 1FP2A 4MRRA 2XRNA 4QJ5A 5DI3A 2RDPA 1J59A 2QWWA 5CVIA 2R7FA 2VBYA 2VRWA 3TO9A 1HV8A 3JW4A 2Z83A 2YPRA 4P4TA 1RUNA 4OMYA 2FDCA 3IUYA 4TYNA 2QBYB 1HKQA 5L3FA 2LDUA 1MDMB 1G3UA 4EM1A 1MABA 1G41A 4D80A 4LMYA 4PHHA 5TVKA 4V0OA 4DB2A 1YZLA 1SQ5A 3GEHA 2QI9C 3U5ZB 3BZ6A 5E8GA 2LKCA 2YWHA 2JLUA 2ZRNA 4IF4A 5HVQC 3BH6A 1XJCA 2YZ2A 4L18B 1XSXA 2STTA 3QEJA 1XD7A 2F6RA 1L4YA 1U99A 1DARA 4ILEA 3JZMA 4QBIA 5FUYA 3TW8B 4AK9A 5E3HA 3EPHA 4KIGA 2WMNB 4M53A 1WKMA 1J70A 1IM2A 2NNNA 1BI3A 3I59B 2HJGA 3IHLA 5D3MA 2EWNA 3G0HA 3ML6A 4UNQA 3CF6R 4NL4H 5TARA 1OB5A 2IXEA 4C2TA 4LGWA 2HLDD 3HPQA 3ZH9B 1T91A 2H17A 3IKJA 1Q57A 4TQUS 4LK0F 2UXXA 2QMOA 2OD5A 3IKTA 1ONBA 3KJIA 1X3SA 2Y48A 2WSMA 1S8FA 1OR7A 4A0XA 2O3FA 1XF9A 1P4AA 1IXSB 2FXAA 1Z0FA 2DCUA 4IOLA 4HSEA 3V8JA 1XTRA 4YMTA 2COMA 1KI1A 4M8NE 5H8WA 3BY6A 1KAGA 2ELHA 3J7AO 1IAWA 1QVRA 1E9BA 5C2JB 1JGSA 2G7UA 2ZI4A 1FZQA 4ESJA 4BZPA 5HKKD 4ZV4A 1QHSA 1O3TA 4G94A 4BNCA 4P31A 4GOJA 3FXRA 3KEOA 1CP2A 1JJ7A 1S96A 2ZJOA 1T3HA 1E2LA 4D4JA 3K1JA 4ESVA 2ZRFA 3ICEA 1E79D 2ZRDA 1S2MA 1XD9A 3T61A 1ETUA 1FBUA 5LEJA 1GWNA 1XCGB 1T6SA 2NS0A 1P5ZB 1RZ3A 3LFKA 2CLCX 2HF8A 5ILSA 3WODF 1RZ4A 1XMIA 2GNOA 2OLJA 3DOEA 4BUJA 3DKWA 5FFZA 1QNTA 3EIEA 4QHTA 5EQTA 3LA2A 5FB2A 2PX3A 3BH7A 4L9SA 5FOSA 4U0VA 4FWHA 3UG7A 2PG4A 1ZRCA 1Q3TA 1CBUA 4O2LA 1B4AA 4W7SA 1XDSA 2JPCA 3DPTA 2GJ8A 2ADUA 3NHBA 2V8OA 3QUSA 3TOBA 3M0EA 3C7JA 1CJKC 2VN2A 4MKHA 3JAMZ 3A36A 4HB4A 4LYJA 3J81k 2GK7A 2RGNC 1X1SA 4G7OF 4EDHA 2I3BA 1DTSA 2W85A 2UVQA 3ZMUA 1SHKA 5LBQA 2LCFA 2IBMA 3JSPA 2B92A 5BMZA 4TMTA 3IPXA 2EK5A 3EUHA 4DCVA 5JFGA 1EXMA 1WCV1 1P92A 3HU3A 1LFDB 3KP4A 2X77A 1DAIA 5B2ZA 5KPDA 1CR1A 4CF7A 1S0UA 2FWRA 3HTSB 2GBLC 2OBLA 2VOPA 3MD0A 1OH5A 2CVHA 1W7PD 3JVUA 4EQQA 3W6NA 3SQNA 1NRJB 1CEEA 3U3JA 1WBDA 5HDNA 2Z33A 4TMZA 2DLLA 2X2FA 1YO5C 2QMHA 2RGAA 3NC1C 4P55A 3CZPA 3IHUA 4Z8YA 3ECOA 2QPTA 3WTTC 3K70C 2CLDX 4JL5A 2WPDD 2V9VA 4OIPF 3BDDA 2R6GA 1LTQA 2DYKA 1OYIA 2IF2A 5K5OA 1P75A 2HQRA 3OEED 1KYIA 3RKYA 4LRSA 1Z0AA 3O8DA 1LS1A 2J1LA 5HE9A 1XXHA 4HLDA 5L3GA 4CHUA 2CHQA 2Z4SA 3CLOA 5D4SA 4JVSB 3R7WA 3ABTA 1XDBA 3HRMA 4LPSA 4F38A 2LKPA 5DCFA 3PVSA 1G6NA 1U6GA 1DVRA 1EFRD 4Q48A 3QKUA 3E3VA 3VX3A 4B3CA 2DK5A 4CRWB 2NO6A 2DZNB 1G6OA 3ZJYA 5A4JA 1KJZA 2PLFA 3K9GA 4L15A 4DLSA 2JATA 3NG1A 2GWHA 1ZC4A 2KJBA 3VNUA 3IILA 2PJZA 3ASYA 3X1XA 4QJ4A 1FQKA 1QZYA 4H0EA 1FMJA 1WQ1R 1KDPA 2X19A 5E18F 4URYR 2J46A 3FMRA 1E1RD 5IT5A 4I99A 5JMTA 4XTCS 2O0JA 4CT4B 4XSZF 3DEFA 2D3WA 5EEGA 2WWYA 4BGDA 1RRCA 1T8UA 4OU0A 1QDEA 3DVLA 1KQ9A 2FRHA 2OM2A 4Z1MD 2ZSFA 2XB2A 1AQYA 3MGCA 2HUPA 1KI9A 1IUYA 3H3UA 4OK6A 1KO7A 2QQ9A 4A0GA 5FPTA 1ZNXA 4UNRA 1Q1ZA 4I1SA 1YIOA 4UVBA 2YV5A 3WMGA 4CYDA 5DSZA 2DT5A 3EWAA 1MO6A 1ZARA 1KZ7B 3OZXA 5FO5A 1OB2A 3FXUA 4IXAA 1LF5A 1MRNA 1N5IA 1NMZA 1I4DD 2ZVPX 3K0CC 4A82A 2GJAA 3RYPA 2OCBA 4GYIA 3S2WA 4KA4A 4HAVA 5SZIA 3RAPR 3QQ5A 2O8DA 4ZH4F 3FMOB 2GA1A 1G5RA 3F5FA 2WV0A 3PENA 1H8HA 2PBIA 4RKFA 3BAFA 4MRPA 3PCRB 1OXVA 2OXRA 2ZJ8A 3CM0A 3OIYA 4IVQA 4NONA 1JHFA 5EXPA 3B13B 2JSCA 1RIFA 2NOAA 4B44A 1W36D 5L3SA 3GP8A 1N0WA 1VHTA 3UMRA 3E5QA 3HRTA 3ELKA 3C14C 3LH5A 4JK1X 1MRSA 1Y0UA 2QAGB 1PJRA 2VP2A 1DEKA 4HZIA 1DAKA 2GF0A 4A8JB 2QQBA 5HS8A 2GZDA 2HV8A 4MYHA 4KFUA 4TTQA 3FB4A 1NIPA 3AP1A 1E2QA 4Q9JA 4TYYA 2WJHA 3QP6A 2CGPA 2XEXA 2ORWA 3DPUA 4Q5IA 1P72A 4ZIRA 3LBIA 3LV8A 1G3IA 3KP3A 5JWHA 3FKSD 1PDNC 1JNYA 1W0JD 1YZUA 4OINF 1XCBA 1Q44A 4C0KA 2XIGA 1G3QA 1TQ6A 1SVOA 1Q3HA 2YOGA 4I0BA 1KHTA 3TJZA 2W83A 3A4NA 4JLVA 1TTTA 1UAAA 1CF7B 2XITA 421PA 4U7DA 1ZJ6A 2QRZA 2CVFA 3AUXA 4CEJB 1GDDA 1ON1A 1ESNA 4XH9B 4KMFA 3T5XA 1KSGA 2RGGA 4MKIA 5KNBA 4OI0A 5KDOA 3FOZA 4WCGA 2ZSEA 4JLKA 3ZVRA 1NL3A 1XTIA 3Q3JB 4Q9HA 3LAPA 5CYPA 2JJ2A 5EE3A 2ZJAA 5IK2A 5CK4A 1RNLA 4H9GA 4D6PA 3CUOA 2RGEA 4KT5C 1G3TA 2D2FA 4PAOA 5JS7A 5FBRB 3V8LA 1US8A 2NIPA 4U0YA 4C0LA 6PAXA 2ZRJA 4M2LA 1PUEE 4KJZA 3A4LA 2V1DA 2ZR0A 1T5LA 3GUDA 3K1NA 2DR3A 2GETA 3EC1A 1E98A 1ZD9A 3SYKA 1D6JA 2WIAA 3L0IB 3B6EA 1O7FA 1OYWA 1F1ZA 4GXOA 5JR3A 1FOKA 4RAYA 2DPXA 2AXPA 2P2LA 3OAAA 1O3SA 4D4LA 2HYIC 2WJGA 5DLQC 2V79A 4W5JA 1CXZA 1D2MA 1GFIA 4G6DA 3B82A 4TYPA 4BFSA 3THOA 3A1WA 4JLOA 4XD7D 5J4LA 2XSZD 3EXAA 1SMTA 3SC3A 5CYVA 1LQ1A 1IN7A 3DEUA 5D5UB 2QSYA 2UZ3A 5HS9A 1DAEA 2XZPA 1KK1A 1KSFX 1E9EA 2CJWB 1PVOA 2VP5A 2ZYTX 4MRSA 5FL3A 5M04A 4FMCB 2KBEA 3EIQA 1XMVA 4NDZA 2QGZA 1II0A 4G5RA 3RRYA 4EFNA 1G3SA 3AM1A 3WGHA 1R5HA 3GJ7A 4NP6A 1BC8C 3RIRA 4AD8A 3SQXA 3RSOA 4DLRA 1U3EM 1OIXA 3K0AA 3EPKA 3SJBA 2C9CA 5H6QA 2HTJA 3GLGA 1U5TB 4NCJA 5JSZB 3I0TA 1OYYA 4B09A 2GIVA 2LF8A 2IYLD 3U7FB 2A3SA 5ILVA 2FA9A 1FUKA 1B9NA 1Q1HA 2Q3HA 2Q9BA 3FHOA 1D3YA 2AS5F 3JVVA 4R7ZA 1SXJD 2DFTA 5FTKA 4I09A 4LCBA 3CO6C 1OPXA 4I98B 4E5UA 1KQ0A 1AN0A 4WW0A 5EE5B 3M1EA 5F64A 3A37A 4GOKA 4IDOA 3S1AA 3ETLA 3QKRB 2JCSA 3T15A 2ZRBA 3VU9B 3WMEA 4LOAA 4DLYA 1DPUA 4TSFD 1P4XA 3V4GA 1AWCA 4ZZLA 5EP3A 3A58B 2IA2A 1FLIA 3EC2A 4OIQF 4PC1A 2UZIR 4TT3D 4KO8A 4DT1A 3SZPA 3N70A 3ZMVA 3KXKA 4IEIA 4XWKA 1IY1A 2BCGY 1E2EA 3I8XA 5FTNA 2PI0A 2OCYC 1LDDA 2C03A 3NBYC 3P32A 4HDUA 2ZYWX 4LJ7A 1K7AA 4M1SA 2WWHA 2BWJA 3CF0A 2QTVB 4WZBE 3ZP5A 4FI3C 4S2EA 4Y0VA 2PZFA 3RDPA 3MHVC 2J0VA 1W5SA 2IYSA 1LDJA 1NN1A 4AYWA 4LZZA 2EA2A 4OI2A 1VCIA 2CLSA 3AJIB 2XJ9A 1QHGA 3L0OA 2AK3A 3WMFA 4TYWA 4D26A 2BEJA 4LB5A 1SZPA 1BIBA 4JYBA 5BN3A 4MQVA 1MJAA 4KYWA 2YVUA 5HE8A 1CJVC 1XJ0A 1VKJA 2A2ZA 2YWFA 3LX5A 4B3XA 3LBHA 4AY2A 4I0AA 4LDJA 2EYQA 3TAHA 5L3VA 4MTEA 5CM9C 4LK2A 5GVRA 4HAUA 4RGUA 2ZEJA 3TW4A 4P32A 4XVRA 4KITB 221PA 1QF9A 2DFLA 1ZC3A 3RYTC 2F1HA 1R7RA 3DHWC 1NLFA 1IJEA 4LG0A 1ZU5A 2QPOA 4IDPA 4L5BA 2GCNA 2CW0F 2IYUA 4Q1CA 1IY2A 4B75A 4K81B 2F55A 4JLJA 2AD1A 1ZNZA 3T34A 3P4XA 4QM6A 4KN4X 2ZM5A 2R3SA 3CPEA 3ICQB 1XEWY 4EPYA 1BYIA 2C8VA 3AKCA 2W24A 4HLUC 4UNNA 3HUGA 5IT9K 3K8YA 3GLFB 1N6IA 1OFUX 3K0LA 4AG6A 4LLGF 2O5VA 4LY6A 1A4RA 3CX6A 1T0JB 3FZVA 4EGZA 2Q3MA 4Y0AA 3VR1A 3GPLA 3FX3A 2WIBA 2HT1A 1M34E 1XD2A 4BEBA 3TDZC 5FUXA 4BLOA 4AIJA 2ZXJA 4V0MA 3K70B 4HZFA 2DFIA 1P61B 1ZYUA 1Z0DA 1HE1C 1TF2A 2J9RA 2YSRA 2QT0A 4P96A 3L9FA 1L7VC 2QORA 3GFTA 3W90A 3ZVLA 1M2OB 2B0LA 2DQLA 3FM5A 2GXBA 2BYVE 2PJPA 1NN3A 3O2PE 1U8YA 2KE5A 3R9WA 4I4LA 2CL6X 2Q3FA 2EVWX 3FE2A 3AF4A 1U8AA 1M7HA 5EZ6B 4LWZA 5FOWA 3W8RA 4UXJA 1XZPA 4BH9A 1OXUA 1XNJA 4QKQA 2H27A 2FNAA 2AXLA 5DO9A 1JECA 1V3FA 3QNUA 3F22A 4CZZA 3T5GA 1USSA 1XRJA 1LNWA 1DPRA 5F98A 5E95A 3BIFA 3F8NA 2ZRKA 1XMKA 3AUYA 5AJWA 1IXRC 1FPQA 1KK3A 2ZETA 4YFNF 3GFOA 4DSUA 1NNEA 2EFNA 4GRAA 3U7EB 1PV4A 1ZNWA 2A5YB 1A1VA 3BS4A 5DISB 4JSYA 3C5HA 1JR3A 2HWVA 1U0LA 3REOA 1XCPA 3REFA 3X1DA 2O8CA 4UHTA 3RANA 3EZ2A 1AGPA 1O7LA 1E9SA 4QGHA 4MRVA 3IIMA 4TT3A 4IRUB 3EYYA 4P9UA 4LFUA 2OQRA 2OESA 3B1XA 3KTAA 3I58A 3Q5EA 2FFQA 4KI0A 2DBBA 1CS4C 3K53A 4DSNA 1M74A 1RRFA 4P9FA 4NH0A 4ASUA 4ASNA 3K09C 1G4AE 3GW2A 3I5XA 2QROA 4Z8XA 1HT1E 4MGYR 3Q8XB 3G3ZA 2BV3A 2RGBA 2E1CA 1F2TB 2WWFA 3WP1B 1KA8A 2R7DA 2F2EA 4L5IA 4GI7A 1RVDA 3O8CA 2QZ4A 5H68A 3C16C 2VOOA 4ON0A 1U9IC 4KV9A 2ZFWA 2PMHA 2A30A 1QHNA 1IN6A 1R0WA 1YE8A 2O0KA 521PA 3HSRA 3DM5A 4OHXA 3VKHA 4M74A 5JCPA 3PXGA 1R10A 3DL0A 1B23P 3L82B 2ZS7A 3U2QA 3WTSC 4BQSA 1MKYA 4EAQA 2OILA 5DN6A 1JHHA 4B76A 2IT1A 1D5VA 4RCYA 4LHZA 3CZQA 4FCVA 4Q7MB 3KP5A 3QVUA 1KDOA 2QTFA 4OHVA 5SZHB 1RJ9B 1STZA 4LUCA 2D2EA 1E6CA 2VHUA 3LXRA 4ENKA 4ZPXA 3EARA 4A0HA 2V6ZM 1XU4A 1FT9A 4JVNA 5C46F 3HRSA 5AUQA 1P2SA 4DCUA 1S9DA 2ZRAA 3DQVC 1L3LA 4AYTA 5HPYB 5JFRA 5JHHB 2ONKA 3HP1A 4JL6A 2AKYA 4EJSB 1HQCA 1Z6AA 1YZNA 1TNSA 2P6SA 3HTUA 3Q9VA 3BC1A 2XKPA 3OEEA 3NIBA 3NDBB 2FEOA 3VHXA 4XRFA 2SHKA 3ECCA 3L00A 2YC4C 1CJTC 2NO0A 3Q5DA 1GNPA 3KDSE 2C78A 2DWZB 5HLIA 3DP7A 1KOFA 3SR0A 3TRFA 3U4QA 2YX4A 1T2KA 3AEZA 4DDTA 3WHKA 2BKEA 3GLHE 1JQLB 2AWOA 4JIMA 4Q4JB 1MD0A 3RNLA 2H5EA 2OAP1 2AL7A 3SBDA 3UIEA 1H8HD 4BFVA 4F91B 4RS8A 1TU3A 2OQGA 2AHOA 2XJ4A 4R71A 1NN0A 3REGA 1R5GA 3L0PA 1FP6A 3RS0A 2O6GE 2WJIA 3PV0A 3QSYA 1O3YA 1MGTA 2WV9A 2BC9A 3O8BA 4NMMA 5DCMB 1ZAOA 1ZLJA 1EX6A 2PCLA 4Q9KA 3T1BA 1TBXA 2M1BA 5E17F 1SFXA 3M4YA 3TSWA 2GVZC 3W6KB 1VHLA 5CVJA 1LEBA 3QBVA 4RFSB 4US2R 1E9CA 2ZU6A 2ZUDA 1VPLA 4CICA 2GDJA 4NCIA 3VHLB 2D7CA 4A92A 1E3MA 3B1ZA 1JPJA 2NQ2C 3PEVA 4LJ6A 4CEHA 2GAOA 5CJPA 2R6DA 2LF7A 1U94A 3VR4A 5D5WB 1HH4A 2PLRA 2RGVA 4IHQA 3GJ0A 3C5CA 4DSTA 1WA5A 3V7SA 1EFHA 1E2GA 2OCPA 2ZR7A 4LV8B 1DPFA 4RD1A 4I1VA 1W48A 4BLSA 2CCJA 1DAMA 3RC8A 1KTVA 4LJ4A 3R9IA 2PT5A 2ZI5A 2ESHA 2NTYC 3OIWA 2CE2X 2GILA 1YHNA 2ORIA 3KZZA 4OIRF 3WTZA 2VP6A 3OESA 4WXPA 4NB5A 4DQ2A 1Z07A 3FF5A 2WMOB 5KHOC 3TO6A 1XB2A 5LD2B 4DLUA 5ICGA 5IK2D 1FY7A 2JJ2D 1P9WA 1KU7A 2DW4A 1NG1A 3KJHA 5FBWB 2NYXA 3WGGA 4MTDA 1KMQA 1JEEA 1XD8A 1JAIA 3LW7A 4B32A 4U7BA 3AVUA 1R36A 1KDTA 4C0SA 1T6NA 3B02A 2QGNA 5C1BA 2JA1A 4HLCA 5HR5A 3B9PA 1M6NA 2DWPA 5FUWA 3H1TA 2ERXA 5DNYB 1W4RA 3U61B 2FQ3A 1FTNA 3WHLA 5CVRA 1G291 1FC3A 3JSOA 5AJYA 2CYYA 4LB6B 2JLYA 1OXTA 4RD0A 4DUGA 2QTHA 4OKSA 4EJOA 5EEHA 3CNLA 4ZDIA 3FKSA 3OAAD 2QBYA 1MDMA 3ZPLA 2XX3A 2XAJA 4AIHA 4LYHA 2ZYVX 4HAMA 2CO5A 3ZN0A 1Z8FA 1HQYE 2L4MA 5DYMA 5GADl 3BFVA 2H8KA 5HS7A 2M45A 3ADDA 2O8EB 1EH8A 1JPNA 2WBLC 4E09A 3AKDA 5TY0A 4M22A 5K1YA 1RUOA 5AK0A 1R1UA 1GITA 4XSXF 4HUQB 1DADA 5FI0B 4QHSA 4LLLA 4KFCA 3FTQA 4CEIB 1MZBA 3I59A 1AZTA 3KLNA 1O3QA 1KK0A 2BEKA 2MBFA 1Z0JA 1E9FA 3RWMB 1JXSA 1KK2A 5G3ZA 2FSFA 2FG5A 3X1YA 3CUQB 2QYOA 1TL7C 1AGRA 1FNMA 1ZGJA 3MFKA 1Z91A 2ZE8A 3QJYA 4UJ3A 4RVCA 2JT1A 5CVUA 4P33A 5J4VA 2DZOB 1GHCA 3KJGA 2CEAA 4OQLA 3O3KA 1G7RA 2OBMA 4BRUA 2P6UA 4EPTA 3OIVA 3D6TB 5CIWA 1ZUIA 5AONA 3W5IA 3VEPA 4PPNA 2OZ6A 4IVRA 4YMSA 3GJ3A 5FPKA 3CNNA 5IT3A 3BXZA 3X2SA 2IYXA 4A2WA 4A9AA 1U0HC 3C3WA 1YZTA 2F1JA 3DO6A 3NC0C 1QHIA 3TIFA 2ZRLA 2XKOA 1X37A 5BOXA 1H9TA 1DG1G 2AR7A 2BM1A 2CMKA 4IFBA 4NPHA 4PFSA 1JXOA 4O3MA 4Z54A 2FF7A 4D82A 1ULYA 1TQDA 4YMVA 3J80K 2QUZA 4OL0A 4MHGA 3COAC 3TLXA 2GEUA 1UBEA 3C1DA 3WTYC 2EFEB 2FU5C 2H92A 4JZKA 1H8EA 5FTLA 1OV4A 4NYJQ 1NVUQ 3HYIA 1W4MA 1O87A 4DNCA 1IN4A 4ETSA 2BJWA 1XGNA 3GFIA 5EUMA 5KO2A 1VCMA 2GXSA 3P26A 4KDPA 4TV7A 4GPTA 4RGRA 2ZU0C 1TLHB 4M1KA 4IJAA 1DUXC 2R9VA 4PSKA 4FHTA 3IQXA 3D7MA 4TLDA 2P5KA 4RY2A 4ZCIA 4PDKA 5DYIA 1AA9A 3KX2A 2FGJA 4GMDA 4Q1DA 3KKPA 3ZVMA 4AIIA 3WU0A 5JVTA 4KSBA 3ASZA 2KIMA 3MRSA 3AF3A 2IA1A 2B6HA 2ZUBA 3W8NA 4EFLA 4TN1A 1D2NA 4UVCA 4M1OA 1RRPA 1ZINA 2NO7A 4QNRA 2OAZA 4RGXA 5J8CA 3TBKA 2NMVA 1EFTA 4Z51A 2DHRA 1BIAA 1AKYA 2A07F 1KNXA 3U3OA 1Z29A 4NQWA 5ICFA 3GLIB 1KYWA 4G8XA 1FYMA 1HKTA 1M7GA 3QPUA 4JKYA 1MT0A 4C9BA 2L4AA 3K1PA 5ERIA 1IN8A 2QQAA 2VONA 1Z6RA 3WU1B 1OIWA 4KLZA 5AJXA 1JQJC 2W6JA 4B47A 2QQEA 1ODDA 1Z6XA 2A5JA 3BB4A 1N0VC 2VT3A 3VR5A 2FU4A 3EPLA 3OE7A 1NLYA 1G7TA 4QRHA 1W44A 1F5TA 2FPLA 2XAUA 5HDKA 3HYTA 1N6KA 1OPCA 4HDOB 4FWDA 2F5EA 4M4SA 3RRNA 4X8LA 1XWIA 2PL3A 1LJ9A 4PO8A 4Q4AA 4OJKA 2REOA 5LRRA 5B57C 1I4LD 3R9XA 4PSAA 1RE0A 5DYGA 1G17A 1AK2A 2EU8A 3RKXA 1G3YA 2VBZA 1KI4A 2QPAA 3V00A 4A2QA 2EW1A 2CK3A 5BW8A 2KRFA 1TUIA 3B8HA 4GYGA 1U90A 2VHCA 4Y17A 4LI0A 4BZQA 1UHMA 2GCPA 4C30A 4UVAA 3FWYA 3RRMA 2IA5A 1SXJE 2HDNB 2RKHA 1GL9B 3CONA 4DLVA 3MCZA 1ZNYA 2DY1A 3GCGA 1K6OA 2GTPA 1Z5ZA 2ZR9A 3EZ6A 2HS5A 3ZD7A 4FD2A 4HDCA 4ERNA 1JR3D 4KBGA 3F3XA 2A68F 4BHCA 1OSNA 4FIDA 2OCAA 1M1YE 1PZNA 4OYHA 4TLEA 2RVCA 4BASA 1E17A 4KUMA 3F23A 2B8WA 4US1R 4L9TA 3ZQ7A 3IRQA 1Q1BA 1X86B 1AS2A 1KY2A 3F8TA 3TSOA 5KUTA 2KBFA 4ASUD 4A0RA 2ZJZA 2NO1A 3MZHA 4XWOA 5K5QA 2AX4A 5E7IA 5TMPA 4A15A 5FL7A 1VG1A 2ACJA 4NE2A 2A69F 4D0NA 3UKDA 1E0AA 2NPFA 2CL0X 1IZ1A 1D9ZA 1T4GA 3DZDA 5GJCA 2O8BB 4M1TA 4C7OB 4IFEA 2GAUA 1W47A 2CNWA 3BWDD 3MJRA 5E4FA 3EYIA 3ZS9A 4BRWA 1VCOA 1TQMA 1EWQA 2I1QA 2GWRA 4FXPA 4BHBA 3TOAA 3C4JA 1IF1A 1F2UB 2QAGA 1EWRA 4ZO4A 3WRXC 4D0GA 4A8JA 2HEOA 2R6CA 3AKEA 4NYJR 2OLKA 1AS0A 2ZAOA 2Y0MA 1BH2A 1QRAA 4U5XA 5KOYA 1WBBA 4YLGA 3LX8A 2WWIA 2DPDA 2XTZA 3R4KA 3M6AA 2P4WA 4M6XA 3ZMDA 4F7ZA 3QPHA 2Q9AA 3AB3A 3EZ9A 2MSDB 2XAFA 3IBGA 4FMDF 5DN6D 1SVSA 1VYVA 4I81A 2H7VA 5FOXA 4B43A 1N5JA 4RZUA 2OZUA 5JCZA 1O3RA 1FBSA 1WMSA 3FMIA 3R0AA 1CF7A 5DI9A 2FBHA 5GJVC 3ECHA 2V54A 5EXTA 3W6JB 3F6OA 4MA4A 4NU0A 4ZKEA 2Z99A 3GMTA 4IDHA 4M6YA 4YFKF 2A5GA 3TR0A 2ZRHA 4A5NA 3NBFA 5AIPA 3TO7A 1W0KA 3ONWA 5KPJA 2RV8A 2WTEA 1X8KA 4L9WA 1I1GA 1G8PA 4ACAA 5J4HA 3GEIA 5CITA 2XAHA 1KI6B 5LHGA 4G5OA 2X4HA 2ERYA 4MITA 5DUIA 4OQNA 4LJZF 2IS4A 3J81Z 4K8OA 4RD6A 1IRFA 1R00A 1F60A 2F9MA 1Z63A 4FWGA 4Q4AB 4HI0E 1G5TA 4JJZA 2RGXA 3G82C 3Q7QA 1OMIA 3WP0A 3A1VA 1HUQA 3AV0B 2YWGA 2UZKA 4WXHA
chains in the Genus database with same CATH superfamily
3OSUA 2BSXA 3HU5A 4Y1FA 4XEUA 4TYQA 1GPAA 1EF4A 4OAPA 1EINA 2JTVA 2G04A 4QPQA 1ADCA 1D8AA 3IMCA 3DLLF 3K73O 2X13A 1UWCA 1DDGA 3O4FA 3GWGA 3FUCA 1YQTA 1EFCA 2REBA 1TGVA 2OZPA 1Y42X 1X2BA 1Z0SA 5JXIA 1MUUA 5JZBA 5A7FA 1F8XA 1K9SA 1IEXA 2X2EA 1VQ7I 3SATA 3P0FA 3FVTA 4IG9A 4KICA 1DMRA 4YYZA 2FUG2 1CZNA 2BD0A 3QFHA 1FRZA 5C5EA 2MCFA 4RYDA 7REQB 4F45A 1EWTA 4N8EA 2E5WA 3LVRE 4DDVA 1AZSC 1HURA 3L6EA 2IUEA 1B42A 2FPMA 2DERA 2LBCA 2CMFA 4N4OB 4DV6B 5BUSA 4Q00A 3AYXB 4UXIA 4J4HA 4YPFA 1S4QA 1T2DA 4JN6A 2FQYA 4BE1A 2GZ1A 5LQCA 2DETA 5FRDA 3QF7A 3WTVC 1JIVA 4P4SB 3BL6A 5IT4A 1G55A 2XUQA 4QRDA 2YMPA 4HQMA 4FOOA 5K3EA 4IIGA 3DNMA 5BUZA 3E5XA 4RA9B 5FNVB 4X1YB 3SMSA 4B7ZA 1FU8A 1OE0A 2WAQN 1GQFA 1QAMA 1OCZH 2Y1XA 4I7EA 4NHEA 2GX6A 4BBSJ 2I78A 2X1EA 1CIPA 2NU6B 4RQTA 5KWSA 2O1EA 1S3SA 4R84A 2RGWA 3HB4X 4BFZA 4R83A 1P1BA 3DWGA 4RJJA 1RXEA 1JHUA 1M5UA 2PLNA 3NP9A 1Y48E 4BY9E 4DCPA 1F0YA 2FZ4A 1JZQA 4RSGA 4TQ9A 3OT1A 4ZDWA 4JQFA 4AYBA 3PGVA 4WKOA 3KUUA 1VQ5I 4EJSA 4Z9YA 1MJNA 1U0NA 2J0UB 2CHGA 1QUEA 2B4QA 3KBBA 4WY5A 3VYUB 4YBZA 3DFKA 4QYIA 4J7UA 3UMGA 3PDCA 5ED4A 2ZJQF 4AMYA 1EKEA 1I6MA 1EU1A 1I32A 3LYHA 2DFFA 4DJFC 3DDOA 4D9CA 5FPYA 3VNAA 5IRCD 5IKOA 3FPJA 4ZXPA 1IFYA 1ZREA 1M5TA 1SVKA 1Q11A 1QQAA 2Q6TA 3DF7A 4WOJA 1X1BA 1QX3A 1WQ2A 5FRMA 2DCEA 1IM8A 3LQ4A 1EPUA 3T38A 5FT9A 3I4PA 3VPFA 4EB6B 2ZTLA 2PA0A 3NUQA 4M0PA 4JVLA 4R1MA 1PGPA 3RR2A 4GMHA 1RKUA 4DYCA 3THXB 2GCGA 4Q5SF 3CRVA 4FCCA 2BFNA 2J0EA 2JFUA 4S04A 1Z5OA 4Q1VA 2Z3XA 4B1FA 3H8SA 4ARZB 4Q3AA 4JSTA 4EYOA 1VLZA 3BGIA 3U1TA 5I9IA 3GUYA 1E64A 2IZ5A 2COEA 3EFEA 3EOZA 1OZAA 1N57A 3RZOJ 4BN5A 5KTMA 4ZICA 4F60A 5KNCD 4DOMA 5ENZA 5U9CA 4Z5XA 4BUPA 1CIVA 3CZ9A 4KN6A 5BQPA 1TAQA 1FFYA 1GJRA 4H4EA 2EJCA 2WWVD 1V5WA 5G41A 2WWWA 3KXLA 1F6BA 1DJPA 3E1GA 1YE5A 1AU9A 4INJA 4LJ9A 4PNEA 4KT6A 4N49A 4R8KA 3OC0A 4LF6M 4P0TA 2IS2A 1A96A 1YDEA 1R4AA 1IWPB 3CCEI 3K4KA 3DBLA 5E1ZB 3HYCA 2NZYA 1NG6A 4M3GA 1XQXA 4MHOA 1N0HA 1R5OA 4DSZA 2DAEA 5P21A 1WUTA 2IZOA 3SI7A 3BOSA 3GGDA 1E2UA 1XLVA 5SYAA 2ODEA 4OU4A 3G1WA 2KQUA 3EGCA 3CRZA 3QI2A 2DJIA 4DRXA 3S5JA 5EQJB 3FRHA 3GJXC 13PKA 1O89A 3UAWA 2I65A 4AQ7A 1N6HA 1TO1E 3INTA 2YQZA 1MNMC 4Q02A 4L95C 4Q9LA 1THMA 2FRXA 3M4JA 2Z0MA 2CCGA 4B4KA 2DPHA 4B6GA 2GVDC 4RKRA 3A02A 2B7EA 3HOTA 1GEEA 5AP9A 4NUBA 1TWHJ 3QXXA 3DW1X 3DO8A 3LM8A 3UF0A 3F6RA 4YDHB 1ZEMA 5KYVA 4XUGB 1G8HA 1LDEA 2VNKA 5DV9A 3VPRA 5DV5A 2Q7DA 1IV6A 2R86A 4DDUA 2Q0OA 3T7TA 4M21A 3QMVA 4F8EA 1BXGA 3H86A 5DK6A 1A9SA 3R6DA 3BWGA 1RHQA 1YI8A 5FD6A 3CP8A 3QU6A 2J3MA 1MG5A 4BB0A 3K9TA 4MUFA 3D9QX 4L5JA 1BI1A 2GMWA 3QX8A 2DBQA 2BGGA 3CG0A 4B3GA 3CCQI 5CDHA 4BYYA 1OLUA 3A6EA 5JS2A 2FBIA 1BO6A 4LC1A 3SOPA 1B0ZA 1EK5A 3ZCOA 4AU1A 1EK6A 2EKFA 2LDBA 3KQPA 1YJ5A 2XRLA 1QQWA 2D74A 4KYUA 3OF3A 5PGMA 3HBFA 2XUZA 2WA2A 4WLVA 3P20A 2YOHA 4CM5A 4NZMA 3WOHA 2NSHA 3V8MA 5JLWA 2Q1UA 4CGZA 3ZK9A 5JU6A 1OH7A 1N36B 4KAAA 4RZ2A 4TMVA 3PLNA 1IMJA 1NONA 4ZYVA 3RGPA 1E0EA 2B8JA 3T7RA 1GLNA 1SXGA 5GTDA 1HL7A 3MHPA 1KO4A 1H4VB 4NFYA 4TX1A 3TIVA 4BJ6A 4HBLA 4W1SA 3T0YA 1D0VA 1FW6A 3EZLA 1VG9B 2RHMA 2IJGX 4URHA 1MVNA 4RD3A 3SLRA 3I4LA 4U7WA 1NBIA 3KOOA 4MA5A 2O2IA 3I1IA 3GF2A 3M1AA 4EKEA 3ZQ6A 3Q3HA 3N7TA 5TPWB 4ZDJA 1Z68A 5EZYA 1XGKA 1S1CA 3LIPA 5F0HA 3HS3A 3M82A 3ZN2A 4B08A 2FR0A 1RKQA 4INPA 1UPTA 5B5SA 1IUNA 4W1RA 1ETVA 1AG9A 2JEZA 1ON2A 4TWAA 3CN9A 2H07A 4M0WA 2I8LA 5EE9A 3EWIA 5TGZA 1QYDA 3WJ2A 2C5RA 4ENPA 1OF1A 1W49A 4CMEC 3KLOA 1B8UA 3MJ4A 2Y99A 4PLWA 2JVJA 3W8FA 1NURA 2EL7A 4O5VA 2CKDA 3IVXA 3UMSA 4BMCA 3UJPA 1LSUA 1X74A 1MX0A 1V9LA 2BZSA 1C0LA 3TJMA 3U7HB 4GM1A 3ROXA 4M9SA 2XA9A 2C5SA 4EEFG 1YX5A 3I9OA 3NTVA 4UNOA 4CT5A 3R5XA 1OKKD 3EOBI 3HCWA 3W5DA 2HIAA 1BCRA 3LL4A 4W8OA 3PNOA 1IXKA 5LD2C 4KXYA 2BE5F 1KL7A 2QM3A 3IJPA 4B9AA 4F2HA 1SD1A 4F21A 3W0LB 4NDAA 1ADBA 3RARA 5JI3E 1FSZA 2EUCA 3JR7A 4FLMA 4G4NA 3N6XA 3C3PA 1ESZA 2AR9A 2AUTA 2W6NA 3INNA 3ZYCA 1YW8A 3V1LA 2NGRA 5A0TA 1XRNA 4U4AA 1IZZA 1E2MA 2BFDB 5CLGA 4DWJA 4LW8A 2PAFA 1FJLA 2Z2ZA 4DW6A 5A05A 5HIAA 1UJBA 3ZHQA 3RK1A 1BXRA 1KVQA 2RH8A 1IUFA 4EZIA 1EQUA 3CTMA 3RBZA 3BYZA 2FEZA 4FMCF 2Q5CA 5BOSA 2GN1A 4CQMB 3R3VA 5ARBA 3GZ5A 4ZDIA 1MC1A 3A03A 1V0JA 1ZUHA 4JQZA 1E3HA 3F78A 3ZY6A 1M6EX 3D5RC 4R9VA 3IESA 2VZEA 4RZXA 1L5GB 1OAAA 4PZPA 3VOAA 1Z06A 4BY7J 3NHFA 4H1HA 4L85A 1F8UA 2E49A 4NJEA 3GAZA 1HRDA 1K75A 1SEPA 1A04A 1Q6ZA 2FGKA 3T9FA 3KEFA 3EIHA 4FCYA 3B9RA 1WPRA 4X63A 2OBXA 3M07A 3U6QA 3RCOA 3ETGA 4I2NA 1ZM7A 4YAOA 4DGQA 4JDPA 1D07A 2NPIA 3Q7PA 3TECE 1KI2A 4N65A 4UBJA 4MCAA 4C5CA 1ZM9A 3FYDA 3CBQA 1OFIA 3V8KA 1H5NA 4JI1B 2I4MA 1AGYA 1WCWA 1CNFA 3IT0A 1W4BA 3HPRA 1I4WA 4HEJA 3VYRB 1BGVA 4BMOB 4JXJA 1FFGA 3MQ4A 3X1ZA 3GH1A 1BHO1 1QVZA 2DRIA 1UFKA 3ZZ0A 1D2RA 3L7KA 4G0MA 4HDQB 2QRUA 4OM8A 5HNKA 1MKMA 4DEVA 3OYKA 4X20B 4B2PA 5F9HA 1E2DA 2QRQA 2NZUG 2C2WA 4BZXA 4PXYA 4G8BA 2PO7A 4P86A 2HR3A 2YV1A 1TC3C 5KKAA 2LVNC 1M2VA 2XUOA 4DXHA 1G8JA 3HKCB 2DO7A 1ES9A 2IXGA 3PDJA 5C18A 2E5LM 5EMMA 1ODFA 3KTDA 4MPJA 2KMLA 3DBOB 3D6NB 5A2QK 2DT6A 2XBMA 3NCTA 2B2NA 3S99A 1NHAA 2RAEA 3FXJA 3K15A 2G1KA 4CNQA 2PXAA 1MJ5A 1IDN1 4XLFA 1YI1A 1JSRA 1MC5A 1EVZA 4AVYA 4IJ6A 1E94E 1HKSA 4QDKA 3FYHA 2B7BA 2C42A 4F84A 2NW6A 2H48A 2HWUA 3K9QO 5JMWA 1IFXA 3IEVA 3RU9A 1RR6A 2P9QA 3USES 4F0JA 3EA5A 4TSFA 3B38A 4KMOA 4BQPA 1QC5B 4LJ8A 2X76A 1YCGA 4QJ5A 5L3FA 4DR5M 5TVKA 2JLUA 2ZRNA 3JWPA 3HABA 1U99A 4QBIA 3ICPA 2V4UA 2L09A 1M76A 4IBDA 3Q1KA 3U4AA 2Y48A 5ALLA 3L4BC 5FUBA 2H63A 3BY6A 2CDBA 3ESRA 5HKKD 1O3TA 1T5BA 5T4HA 1FB5A 2NS0A 1JEQA 4DZTA 4XR4A 4C3IJ 2RREA 1I6WA 4JJEA 1UC8A 2PG4A 4BAZA 1B4AA 1PGQA 2JAXA 2DA2A 1C3VA 1K27A 4BLVA 1CJKC 2VN2A 2BWEA 2CEKA 3F98A 2XA2A 2B92A 1ZMOA 3NKLA 4YQYA 4C7VA 4WBNA 1LFDB 4URFA 2FWRA 2CWWA 2XC7A 1F9AA 2CVHA 3SQNA 2DM6A 3IHKA 3I6IA 4RIGA 4F3KA 4G2TA 3SR3A 1HA8A 2CHQA 2Z4SA 1Z17A 1ULTA 1DVRA 4C22A 1XTTA 3HA3A 5AW2A 5A4JA 5CBPA 1WQ1R 3FMRA 1E1RD 4XTCS 1ILWA 2NTEA 4P38A 4R1PA 3ZXYA 2JY8A 1AQYA 4DYHA 5JAMA 4P35A 1E4EA 1V48A 3PC3A 1PTKA 3PCRB 2DMUA 4RIEA 5EXPA 3ZGVA 1RIFA 1SJ9A 1D2CA 1WEKA 3GP8A 2Y1LA 4EGAA 2I3AA 1IZ0A 4MYHA 5EWLA 4Q5IA 3AX6A 4RM3A 3DBHB 1JNYA 3QK7A 5K0LA 3GJSA 3ZR8X 2CVFA 2GCEA 2W48A 2ZSEA 2LLKA 3NGMA 1NNLA 5JS7A 5B55A 4IV8A 3A4LA 4CJ6A 2FPGB 2R8BA 2NVYJ 1T5LA 4UUTA 2GETA 3L06A 5IXJA 3D0KA 5D5QA 2A4KA 4C5BA 1EBBA 2P2ZA 1PJBA 2I4NA 1KSFX 4LQCA 4DOZA 1ZD3A 3FZYA 4NDLA 4MIMA 5E26A 1E6KA 2R5FA 1AVTA 1IJWC 3SQXA 5BNFA 1Q7RA 4CKWA 2C9CA 2HTJA 4NCJA 2GIVA 2H4YA 2IYLD 1AUOA 3FHOA 1DJMA 2XGDA 3JVVA 2DFTA 3EA4A 4NSRA 3UUFA 3T5DA 3KYIB 4KV7A 3K72B 4L2IA 1QYIA 3CD6I 1BCSA 5K6AC 2GD2A 4AL4A 2QVCA 1IY1A 1YRNB 1Q0ZA 4NC7A 1NXQA 1LDJA 3ZJUA 1VCIA 3WMFA 1V8OA 3AG2H 4MQVA 2NSYA 2ODPA 4IIJA 4KRYA 3DD1A 4FYPA 3E22A 1NLFA 4Q1CA 2I62A 2B0CA 2VZLA 4UASA 4EPYA 2C8VA 3AKCA 3TLJA 3TDKA 3FZVA 4BFCA 3VR1A 1ECFA 1M34E 1XD2A 1JDVA 3K70B 5CFPA 1Z0DA 3UJ8A 1HF3A 2QT0A 1L5SA 3L9FA 1L7VC 1NN3A 1IDZA 3WGQA 2CL6X 1XZPA 4G89A 4WH0A 1QO7A 1JMKC 4N5DA 4AO8A 1V3FA 3UQYS 1PGOA 4E08A 1Z67A 3F8NA 2ZRKA 5AJWA 4ZODA 4Y1RA 1FPQA 2BHZA 4KMSA 1JNXX 2WDZA 4ARCA 3PHBE 1WHSA 2PKXA 1OQAA 1W85B 4ASUA 1QTIA 1T35A 3K09C 4Z8XA 2Z9CA 3Q8XB 2X7JA 3G3ZA 2E1CA 3WP1B 1RVDA 2YFYA 4MVWA 3U40A 4KR6A 3SWWA 1FCJA 1SC3A 1MKYA 4B76A 1KDOA 1GEGA 3WA6A 2B1RA 2D2EA 1A6QA 3EARA 2R4QA 1P2SA 2JY6B 5HPYB 4RHFA 5HUHA 1IGNA 1HQCA 1ZL0A 4NC9A 3FUUA 1CQTA 3OZGA 3G1OA 4ETIA 3MJFA 4YN3A 3RKRA 2AL7A 3CUWA 5ECGC 5LMCA 2AHOA 3TOVA 3L7LA 2VXOA 1MGTA 2BC9A 1GPKA 3WKCA 4J1SA 3LGAA 4QYTA 2LCIA 3A9CA 4GICA 4E7PA 1E3MA 1GNLA 3B1ZA 3DE6X 3DNPA 3KYDA 1TECE 1U94A 16PKA 2FQWA 1HH4A 1WA5A 1EFHA 2H8GA 2X8BA 1QFYA 5BR8B 4BKRA 4JC0A 4RXTA 2FLVA 1CD5A 2WMOB 4DQ2A 3FF5A 4R01A 3ZDYB 3W7AA 4ZP1A 3GFRA 5JZMA 2P9HA 3GZNA 3TEJA 3AOEA 4OYYA 1A0OA 4M38A 4DV0M 3IS3A 4EJOA 2QBYA 2XAJA 2ZYVX 1AB5A 5EHIA 4B6PA 3RSGA 2ORYA 4CCLA 4GUAA 3VC2A 1M66A 2FPPA 4XSXF 4Y6LA 5KCZA 4NFHA 1WJEA 1K63A 3I59A 1KK0A 3DEHA 2EATA 2FSFA 3F9RA 3X1YA 3CUQB 1AGRA 2IOHA 1PD1A 2ZDQA 1RZUA 2BH2A 5JSKA 1TT5B 4IVRA 5REQB 2C1XA 3VSCA 3AIMA 1U0HC 4J07A 3TIFA 3L5KA 2BM1A 3UT6A 1JXOA 2FR8C 5KSWB 1XS9A 3COAC 2IBTA 3HXTA 3V2HA 1OV4A 3Q0EA 3TMAA 3JRAA 2G9RA 3GRZA 2YIVX 1ZMBA 1Q0LA 3JQGB 3ASZA 4TN1A 1LU9A 2VPQA 5ITRA 2A1TS 3U3OA 1ZELA 4CWAA 5BR4A 4I50F 1NLYA 1F5TA 2NTJA 4RSMA 3MWFA 5BWCA 5BUCA 1EJ0A 5KOJB 4NE7A 3DG9A 3H2ZA 4HFNA 1JUSA 3HZHA 2KXEA 1RQGA 4GGOA 2R8XA 4BZQA 4YRGA 5IBCA 1Y6RA 4JASB 3E7XA 1EJBA 1W8DA 2PSHA 2GTPA 3BJMA 3ZY5A 1MW8X 5T4BA 3MQFA 4US1R 1X86B 4D8WA 4XN0A 1U1FA 3G3EA 3P0IA 5CH5A 3FPGA 4JWKA 1K4TA 1QF7A 2BFCB 4UTNA 3AHCA 3ZS9A 1S02A 5FB3A 1EVYA 3RFVA 4D0GA 3VDUA 3S15J 1QU2A 3AUTA 2ZAOA 2R7SA 2DPDA 1U2EA 4HKTA 2A6PA 2Q9AA 3CNQS 2BTEA 4I81A 3BULA 1WMSA 4I4IA 2P27A 2V54A 5EXTA 1CE8B 2QZ9A 2Z99A 4A5NA 4ZJZA 4ZVOA 4YAJA 1WCYA 4G5OA 2E55A 4BNYA 2IS4A 1TWFJ 1R00A 2PSSA 1FFBA 3G82C 5F7OA 1HUQA 3AV0B 4WXHA 4MEYF 4MWDA 1WW3A 1N5KA 3BMOB 4QPDA 4A5SA 4IOMA 4RGYA 1M0SA 3IDOA 1O4WA 3KWM