4GKJM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gkjM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4gkjM02
3TWMA 1MX0A 4X64M 1Z5CA 3U6CA 5ITXE 4DR7M 2VQEM 4LF7M 2UXDM 3A45A 3SBJA 4DV3M 3C58A 2OQ4A 1TDZA 5LMNM 4OX9M 1XC8A 4G4OA 1IBKM 4DV4M 5IT9S 1NNJA 2F5SA 4JI0M 4B3RM 4LFCM 1Q3BA 3J81S 5ITUA 3A42A 4DR3M 4DR1M 2F5NA 5A2QS 4JI6M 3SAUA 1Q3CA 3JR5A 2XZFA 3SASA 3OTOM 4DR2M 1L1ZA 2F5PA 4X65M 4GKKM 3U6EA 2OPFA 1Q39A 2UUCM 1PM5A 3SAWA 1N33M 4PCZA 3GPYA 4AQYM 1TDHA 4YY3M 4NRWA 1N36M 4ITQA 2HKJA 1L1TA 3VK8A 3GQ4A 3VK7A 1K82A 4GKJM 1PJJA 2F5QA 3A46A 4DUZM 1MU5A 4JI3M 3U6LA 1R2YA 1J5EM 4K0KM 1R2ZA 4PDIA 3T1HM 4DV1M 4B3MM 4JI8M 4KHPM 5ITYA 1HR0M 4JI5M 2UUAM 4LFAM 4DUYM 1I94M 5ITQA 3U6PA 4NXNM 1XNRM 3GPXA 1PJIA 2F4VM 3GPUA 2ZM6M 2Q2EB 3J80S 1XNQM 1Z5AA 3U6SA 1K3XA 3JAMS 2UXCM 3J7AS 3GO8A 1HNZM 4CISA 1N32M 4JI4M 3U6QA 4G4NA 2UXBM 3U6OA 4JYAM 4NRVA 4JI7M 4DV7M 3SARA 4LF6M 4LF9M 1IBMM 4PDGA 2XZUA 1L2DA 4X62M 3GQ5A 1IBLM 3JR4A 1HNXM 3U6DA 2VQFM 4LF5M 4JV5M 3GP1A 4DR6M 1FJGM 4DV2M 1XMQM 4B3TM 3TWKA 5ITTA 1N34M 2ZBKB 2UUBM 4DV0M 5IWAM 3T1YM 4LF4M 1L2CA 5ITRA 3GPPA 5LMUM 4JI1M 5FLXS 3SAVA 2F5OA 4DV5M 1Z5BA 1L2BA 2E5LM 3GQ3A 4MB7A 3TWLA 4G4QA 4DR5M 1XMOM 1KFVA 2HHHM 4DV6M 4JI2M 4LF8M 4G4RA 3W0FA 4LFBM 4X66M 4NXMM 4B3SM 2EA0A 4YHHM 3DOAA 1EE8A 5BR8M 4PD2A 1HNWM 3U6MA 3SATA 4DR4M 1Z59A 5ITXA 2UU9M 1K3WA
chains in the Genus database with same CATH superfamily
3TWMA 1IN4A 1MX0A 2DZOB 2O25A 2R45A 2RGOA 4FD2A 4L15A 4ANRA 4B7GA 4X64M 2JWSA 5KO3A 4DR7M 2J5YA 1TF0B 2D7HA 3SBJA 1IXSB 3DA1A 4OX9M 1XC8A 2OOBA 1QZMA 3FRIA 3RGPA 1E9RA 1IXRC 1PJTA 3RFWA 5IT9S 2CE7A 4JI0M 4IBIA 1UM8A 5EXTA 5EQTA 1G59A 3IHPA 5EXPA 3MK6A 2R18A 3AV0A 3L29A 4RNAA 5H37D 2F5NA 2WSCF 1TGUA 2D7EA 2F5PA 3M7GA 1DO2A 2KXEA 2Z4RA 3FUVA 2MGWA 4GKKM 1TH4A 3D8LA 2J7NA 4GIPA 1Q39A 4QOSA 2UUCM 3SAWA 2C9OA 2C99A 2XH9A 3PNVA 4FWGA 2MH8A 3FTEA 2L6OA 1N36M 2MR9A 2KZSA 2H1RA 2EKKA 2MJ5B 1IQPA 2GQFA 4II7A 5BPVA 3CF6E 1RU3A 1GL7A 3E21A 4G3OA 7CATA 1GLNA 2KNAA 3GLFA 2WSEF 2CFOA 4DUZM 4JI3M 2G8LA 4PDIA 1YUBA 4DV1M 2JY5A 4EIWA 3FUUA 4FWDA 2JY8A 4GH9A 4I81A 3VKHA 1S3SA 1AUAA 5C18A 2G5GX 3KP0E 1E9SA 4Z6YA 2CHVA 1A5TA 1WGLA 4MGZE 4AG6A 3GPXA 2F4VM 3QWLA 1VG5A 3FE3A 4FCVA 5JI3E 8CATA 3B7ZA 2ZM6M 2JZ0A 3BXWA 4FWHA 2QPAA 1HQYE 2RGHA 2ZANA 3JAMS 3J7AS 3EIHA 3GRVA 1VEJA 2CUZA 2LHCA 1OIPA 4D82A 1N32M 4LGMA 3BBZA 3FD9A 5FTKA 1WJ7A 2Y0TA 3U6QA 4IBGA 1G3IA 3B9PA 2N35A 1DGHA 3PXGA 2QBYA 3AKZA 3ZCBB 5KQ8A 2L7HA 4IBCA 2M5ZA 3LQQA 1SXJC 1QAOA 1DGHB 4QNRA 3D8BA 2DI0A 2QBYB 5GKNA 4RF1A 3GQ5A 3AL0C 3B74A 4HL4A 1BVSA 3EIEA 2CEAA 2L2DA 2XLJA 4L8RC 1W5TA 1JR3A 4LJ7A 3WHKA 3AOGA 4LF5M 2QP9X 4MM3B 1TH3A 4LJ5A 2BNKA 4B3TM 1IY2A 1J09A 5FTLA 3GLGA 4IBDA 4DV0M 3KSXA 2C5RA 3KOWE 2KW0A 3IG5A 4CHTB 3KFUG 4OU7A 3GLGB 5EP2A 4WW0A 5DFLA 2L4EA 1Z5BA 1NV8A 1V92A 3ZQJA 4R71A 1I4WA 3CF2A 3I4VA 1L2BA 5E6JA 3W68A 4GRIA 3TWLA 3GQ3A 2X8AA 4JN6A 2HHHM 1NJGA 4DV6M 3MJ5A 2C96A 3B7NA 1IN8A 4L78A 2EA0A 1QUTA 4MGHA 3C3DA 2JXNA 1SXJA 1QYRA 4FVMA 3T15A 4AI6A 3UMMA 1NY6A 2A5YB 3DOAA 1EE8A 1CUKA 2DVWB 3AOEC 3C9PA 3E46A 5BR8M 3THGA 1SXJB 4KLNA 4NOOB 4DR4M 1HNWM 1OAOC 1K3WA 1OQYA 1TR8A 3LQRA 1VEGA 1YSYA 1Z5CA 1N75A 1IM2A 1ZMUA 1WXQA 3VDUA 3U6CA 2R65A 4LRTA 3AJIB 5EXXA 2G3QA 1DV0A 1EIJA 3H4MA 3GLIE 4IBBA 4HEOA 4DV3M 3U5ZA 2JP7A 2V1UA 2OQ4A 3RE8A 5LMNM 1F4IA 1IY1A 2MROB 3CGWA 4G4OA 3U5ZB 4LY6A 3DZDA 5DNYA 4QOZC 3L26A 1NNJA 2F5SA 1Z6TA 5FSWA 4OW0A 3MMPA 2AHMA 4I4LA 4CGYB 1NO1A 1V34A 3U60A 2BJWA 4CIZA 2FOIC 4QHSA 4AZFA 3SAUA 4L16A 3NBIA 4JI6M 3HY5A 3JR5A 2VF8A 1L1ZA 3U60B 3SASA 3U61A 3DFZA 3VLFB 2OPFA 4HLQA 2QQ8A 4OVZB 3U61B 4BBAA 3M6AA 2LVPC 3GPYA 2R46A 1IXSA 3SYLA 1TDHA 1GJSA 4JI1M 1D2NA 4NRWA 3J7BA 4NC6A 3L2AA 3VK8A 2EO2A 3VK7A 4P17A 4WURA 3I01M 3I51A 4KT0F 4LJ8A 4K0KM 4LRSA 4GMQA 4RF0A 3HHZA 3T1HM 4JI8M 5IZ7D 2CRUA 5ITYA 1QAMA 3PVSA 3L25A 4B08A 1XB2B 5FTMA 4CJ6A 2KA6B 3QYBA 5ITQA 3U6PA 3IG8A 4NXNM 2CHQA 2XSZA 1HQCA 1XNQM 2CV0A 4Y28F 3ZH9B 4AW4A 2DWZB 2VDBB 3SYKA 3GRYA 2KRUA 3GLHA 4B7FA 3FYDA 1DGBA 4G6ZA 1HNZM 4CISA 4GHLA 1XXHE 4IJEA 1OJLA 2W82A 2K47A 3GLHB 4S12A 4JI4M 3U6OA 4AKGA 4Q7JA 1Y8GA 4NRVA 1G8PA 4I5SA 3SARA 4NSRA 4LF6M 2DAKA 1GVNA 3E4RA 3T6PA 1VDDA 1L2DA 1NV9A 2JY6B 3PFIA 1GL6A 1T6OA 3J27B 1WHCA 1QANA 2DENA 1IBLM 3JR4A 4AKIA 3TPZA 1IN5A 2VQFM 4JV5M 2ERCA 5JI2E 2K6BA 4GC5A 2QNJA 3HZJA 3GP1A 4A3VB 2DKLA 3HU1A 4W5WA 3GLFB 2ZBKB 3H4JA 3HHWA 2UUBM 2LXEA 5C1BA 2DHRA 5IWAM 2I7NA 2CV1A 1L2CA 3UK6A 5ITRA 5LMUM 3KDSE 5FLXS 2ZTCA 3HGIA 3K1JA 1R6BX 1IFYA 4BLCA 4G4QA 4MB7A 2CHGA 1VQ1A 2LVOC 1P3QQ 5FTNA 3IECA 1DGFA 1KFVA 4AG5A 2DXIA 1QVRA 1WGNA 4XBOA 3SMSA 2J7OA 4X66M 4YHHM 2HWJA 1KSFX 1OFHA 1VDLA 3SFZA 3ZC7B 4LCBA 1R5LA 1JB0F 1ZMWA 1HJPA 1YLAA 4L4UA 2LBCA 2LVQD 4M0WA 3FKEA 1NVMA 2QSFX 1OKSA 2EUCA 2RRUA 2P5TA 4WP2A 3UGJA 5L8RF 5ITXE 3A45A 3HJ8A 3E9SA 4GHAA 1QZEA 3CF0A 1IN7A 3C58A 4R7GA 3HU3A 4UN2B 3AFHA 5E26A 3VFDA 4DV4M 1IBKM 2RKOA 2I7PA 4JXJA 4B3RM 4MGYE 4LFCM 3V76A 3K8ZA 5ITUA 1FNNA 1QDRA 1ZV1A 2O01F 1Q3CA 2JA2A 3FTDA 4LGYA 1PJQA 1NJFA 2XZFA 1J7KA 4X65M 3K9OA 2ZAOA 4BB9A 3U6EA 4MGIE 3J2PB 2M60A 2X49A 1PM5A 1N33M 3TE6A 2R0IA 2FNAA 4KO8A 2BWBA 4AQYM 1NY5A 4ITQA 2Y0QA 3GRRA 3GRUA 2KNZA 2LNHC 4IBFA 3KSJA 1R4GA 4XGIA 2DWMA 4GKJM 2KHHA 4PT5A 2F5QA 1MU5A 1J5EM 3FTFA 1R2ZA 4TUWA 2XGNA 3GLFE 4KHPM 1QDTA 3KVWA 2C98A 4LZZA 1HR0M 2DAEA 4D81A 2UUAM 4JI5M 2LH0A 2DZNB 4OVZA 3SHFA 2XFTA 3LMMA 2LVNC 4AKHA 4QNMA 4REZA 5KQDA 3HX3A 1OTRA 4LG2A 3GPUA 1DGGA 2Q2EB 1XWIA 2BWEA 3J80S 4MGKE 5KPRA 2L4FA 3K2LA 1K3XA 3SC3A 2UXCM 1NHGC 4Z8XA 2WSFF 3L28A 1JR3D 4FW9A 4GC9A 1D0MA 2CWBA 2R62A 3HHYA 3KS8A 2UXBM 2VF7A 2FS1A 2V1CA 1PRBA 4DV7M 5EP3A 2XZUA 1AIPC 4X62M 1KYIA 1W5SA 2VIIA 3B7QA 2QHOB 2R44A 3L27A 3KOYE 2FH0A 2CP8A 3NWLA 4DR6M 1FJGM 1JR3E 4FCTA 1ZAEA 3C3EA 4LZJA 5FTJA 1T3TA 2Z3XA 4D80A 1QAQA 4LF4M 1R7RA 1N78A 2KRKA 1OFIA 1SXJD 1NNUC 3FYCA 2D7GA 4GEWA 4IBEA 3VDPA 1H6UA 2QENA 4I8OA 3GLGE 1OAIA 1GJTA 1GO5A 3UJNA 2BJVA 1N77A 2DNAA 4DR5M 1QQWA 1MN3A 1X37A 4G4RA 1XHBA 1TH2A 1L8QA 3FUTA 3W0LB 2DZLA 4M9ZA 4IIWA 3LVWA 2LWXA 4PD2A 1YE9A 1IY0A 1SXJE 2DAMA 2XEPA 2UU9M 2C9CA 3HWSA 1MJGM 3GLIA 3HU2A 3KOZE 2LHGA 2OOAA 2HL7A 2UXDM 2X4AA 2VQEM 4LF7M 2FFJA 3MHVC 4LJAA 2WZJA 1QUSA 4IBJA 2EJSA 5EJCA 3GLIB 3SHGB 1TDZA 1C7YA 3F92A 4LJ6A 2NQ8C 3KXEC 3Q8GA 4LJ9A 4MH0E 2JZ1A 2K0BX 3K92A 1Q3BA 2K9DA 2YNMD 3KP1E 2FE8A 2R6FA 3J81S 4KODA 3A42A 4LJ4A 4DR3M 4DR1M 5A2QS 1E94E 5KPZA 2OO9A 4IBKA 4P16A 3OTOM 4DR2M 1Q02A 1ORYB 3HKPA 1TTEA 1GKIA 2JY7A 4ZPXA 2KZUA 2O5RA 1IN6A 3KW6A 3UZUA 3QYEA 1OIZA 4PCZA 3QAUA 3ILKA 3LW5F 2R4EA 3HHXA 4YY3M 3VKGA 1D0KA 1UFZA 3CTWB 1ZQ9A 1NHWC 2Z7JA 2HKJA 2Z8YM 3M0EA 3BOSA 4M0DA 5F3WA 4NL4H 1L1TA 1T43A 3FRHA 4FCWA 1EFUB 2Z4SA 3GQ4A 1K82A 3TQSA 3FTCA 1D0LA 3A98B 3NBXX 4F1IA 1PJJA 3LCVB 3A46A 5EP4A 1PJSA 2ZAMA 3U6LA 1R2YA 2XSZD 3R9XB 4NSOB 2YR0A 4B3MM 5EP1A 3Q8XA 3B89A 4QHTA 3KS4A 2DWNA 2EKFA 4LFAM 4DUYM 1I94M 1C1KA 1WIVA 1JQJC 1XNRM 1PJIA 3PNYA 1DO0A 1SG9A 4F2LA 2CV2A 1XXHA 1Z5AA 2KNVA 3U6SA 3FUWA 4RKUF 3T38A 2ZTDA 3GO8A 2DWLA 2JNHA 2QCUA 1XXHB 4GITA 4IJFA 4B7HA 2HAKA 5IREB 2KEBA 3LVVA 4G4NA 3GLHE 1WR1B 1HT2E 5EXSA 2XF3A 4JYAM 1ZMVA 3I4YA 2KDLA 4JI7M 1V33A 2V6ZM 2HCBA 4LF9M 3RGSA 1IBMM 4PDGA 2DHYA 1VEKA 2LVAA 3SMPA 5DYGA 2LTUA 2JUJA 2APLA 1G4AE 2Y20A 1HNXM 3U6DA 2YQZA 1E32A 5KPTA 3FUXA 4DV2M 2R4JA 1XMQM 3TWKA 5ITTA 3I04M 4XK8F 3TL4X 2B3TA 4R3DA 1N34M 3HJQA 3HJSA 3T1YM 3R8FA 1IXZA 1LV7A 2Y21A 3KOXE 4DBGB 3GPPA 2GNOA 3SAVA 2F5OA 1GABA 4DV5M 3W67A 4M9XA 2E5LM 1XMOM 4JI2M 4LF8M 2H5XA 2L09A 4L6V6 3W0FA 4NXMM 4LFBM 4B3SM 1HT1E 3LCUA 3K9PA 2DAIA 3WHLA 2DAGA 1G41A 5DYIA 2YFQA 4M9SA 3AOEA 1G71A 1NSFA 3U6MA 2QZ4A 3SATA 1Z59A 2XFSA 5ITXA 2L7IA 1PGYA 1LTMA
chains in the Genus database with same CATH topology
3TWMA 1IN4A 1MX0A 2DZOB 2R45A 2RGOA 4FD2A 4L15A 4B7GA 4X64M 5KO3A 4DR7M 2D7HA 3SBJA 1IXSB 3DA1A 4OX9M 1XC8A 1QZMA 3RGPA 1E9RA 1IXRC 3RFWA 5IT9S 2CE7A 4JI0M 4IBIA 1UM8A 5EXTA 5EQTA 1G59A 5EXPA 3MK6A 2R18A 3AV0A 3L29A 4RNAA 5H37D 2F5NA 1TGUA 2D7EA 2F5PA 3M7GA 1DO2A 2KXEA 2Z4RA 3FUVA 4GKKM 1TH4A 3D8LA 2J7NA 4GIPA 1Q39A 4QOSA 2UUCM 3SAWA 2C9OA 2C99A 2XH9A 3PNVA 4FWGA 3FTEA 2L6OA 1N36M 2KZSA 2H1RA 4II7A 1IQPA 5BPVA 3CF6E 1GL7A 3GLFA 7CATA 1GLNA 2CFOA 4DUZM 4JI3M 2G8LA 4PDIA 1YUBA 4DV1M 4EIWA 4FWDA 4GH9A 4I81A 1S3SA 5C18A 2G5GX 3KP0E 1E9SA 4Z6YA 2CHVA 4MGZE 4AG6A 3GPXA 2F4VM 3QWLA 4FCVA 5JI3E 2ZM6M 8CATA 4FWHA 2QPAA 1HQYE 2RGHA 2ZANA 3JAMS 3J7AS 3EIHA 3GRVA 2CUZA 4D82A 1N32M 4LGMA 3FD9A 5FTKA 2Y0TA 3U6QA 4IBGA 1G3IA 3B9PA 1DGHA 3PXGA 2QBYA 3AKZA 3ZCBB 5KQ8A 2L7HA 4IBCA 2M5ZA 3LQQA 1SXJC 1QAOA 1DGHB 4QNRA 3D8BA 2QBYB 5GKNA 4RF1A 3GQ5A 3AL0C 4HL4A 2CEAA 2XLJA 4L8RC 1W5TA 1JR3A 4LJ7A 3WHKA 3AOGA 4LF5M 2QP9X 4MM3B 1TH3A 4LJ5A 2BNKA 4B3TM 1IY2A 1J09A 5FTLA 3GLGA 4IBDA 4DV0M 3KSXA 2C5RA 3KOWE 2KW0A 3IG5A 4CHTB 3KFUG 4OU7A 3GLGB 5EP2A 4WW0A 1Z5BA 1L2BA 1I4WA 3CF2A 3I4VA 5E6JA 3GQ3A 4GRIA 3TWLA 2HHHM 2X8AA 4JN6A 1NJGA 4DV6M 3MJ5A 2C96A 1IN8A 4L78A 2EA0A 4MGHA 1SXJA 3T15A 1QYRA 4FVMA 4AI6A 3UMMA 1NY6A 2A5YB 3DOAA 1EE8A 2DVWB 3AOEC 5BR8M 3THGA 1SXJB 4KLNA 4NOOB 4DR4M 1HNWM 1K3WA 3LQRA 1YSYA 1Z5CA 1N75A 1IM2A 3VDUA 1WXQA 3U6CA 2V1UA 2R65A 4LRTA 3AJIB 5EXXA 3H4MA 4IBBA 3U5ZA 4DV3M 2OQ4A 3RE8A 5LMNM 1IY1A 4G4OA 3U5ZB 4LY6A 3DZDA 5DNYA 4QOZC 1NNJA 2F5SA 1Z6TA 5FSWA 4OW0A 2AHMA 4I4LA 4CGYB 3U60A 2BJWA 2FOIC 4QHSA 4AZFA 3SAUA 4L16A 3NBIA 4JI6M 2L7IA 3JR5A 3SASA 1L1ZA 3U60B 3U61A 3DFZA 3VLFB 2OPFA 4HLQA 4OVZB 3U61B 4BBAA 3M6AA 3GPYA 2R46A 3SYLA 1TDHA 1D2NA 4NRWA 3J7BA 3L2AA 3VK8A 2EO2A 3VK7A 4WURA 4LJ8A 3I51A 4K0KM 4LRSA 4GMQA 4RF0A 3HHZA 3T1HM 4JI8M 5IZ7D 5ITYA 1QAMA 3PVSA 3L25A 4B08A 2KA6B 5ITQA 3U6PA 3IG8A 4NXNM 2CHQA 2XSZA 1HQCA 1XNQM 2CV0A 3ZH9B 4AW4A 2DWZB 3SYKA 3GRYA 2KRUA 3GLHA 4B7FA 3FYDA 1DGBA 4G6ZA 1HNZM 4CISA 4GHLA 4IJEA 1OJLA 2W82A 2K47A 3GLHB 4S12A 4JI4M 3U6OA 4AKGA 4NRVA 1G8PA 4I5SA 3SARA 4NSRA 4LF6M 3E4RA 1GVNA 1VDDA 1L2DA 3PFIA 1GL6A 3J27B 1QANA 1IBLM 3JR4A 4AKIA 3TPZA 1IN5A 2VQFM 4JV5M 2ERCA 5JI2E 4GC5A 3GP1A 4A3VB 3HU1A 4W5WA 2ZBKB 3HHWA 2UUBM 2LXEA 5C1BA 2DHRA 5IWAM 2I7NA 2CV1A 1L2CA 3UK6A 5ITRA 5LMUM 3KDSE 5FLXS 3HGIA 3K1JA 1R6BX 4BLCA 4G4QA 4MB7A 2CHGA 5FTNA 1KFVA 3VKHA 1DGFA 4AG5A 2DXIA 1QVRA 4XBOA 3SMSA 2J7OA 4X66M 4YHHM 3ZC7B 1KSFX 1OFHA 3SFZA 4LCBA 4L4UA 4M0WA 3FKEA 1NVMA 2EUCA 2P5TA 3UGJA 5ITXE 3A45A 3HJ8A 3E9SA 4GHAA 3CF0A 1IN7A 3C58A 4R7GA 3HU3A 3AFHA 5E26A 3VFDA 4DV4M 1IBKM 2RKOA 2I7PA 4JXJA 4B3RM 4MGYE 4LFCM 3K8ZA 5ITUA 1FNNA 1Q3CA 2JA2A 3FTDA 4LGYA 1NJFA 2XZFA 1J7KA 4X65M 2ZAOA 4BB9A 3U6EA 4MGIE 3J2PB 2M60A 2X49A 1PM5A 1N33M 3TE6A 2FNAA 4KO8A 4AQYM 1NY5A 4ITQA 2Y0QA 3GRRA 3GRUA 2LNHC 4IBFA 3KSJA 4XGIA 2DWMA 4GKJM 4PT5A 2F5QA 1MU5A 1J5EM 3FTFA 1R2ZA 4TUWA 2XGNA 4KHPM 3KVWA 4LZZA 2C98A 2XFSA 1HR0M 4D81A 2UUAM 4JI5M 2LH0A 2DZNB 4OVZA 3SHFA 2XFTA 3LMMA 4AKHA 4QNMA 4REZA 5KQDA 4LG2A 3GPUA 1DGGA 2Q2EB 1XWIA 3J80S 4MGKE 5KPRA 3K2LA 1K3XA 3SC3A 2UXCM 1NHGC 4Z8XA 3L28A 1JR3D 4FW9A 4GC9A 2R62A 3HHYA 2UXBM 3KS8A 2V1CA 4DV7M 5EP3A 2XZUA 4X62M 1KYIA 1W5SA 2VIIA 3L27A 3KOYE 3NWLA 4DR6M 1FJGM 4FCTA 1ZAEA 4LZJA 5FTJA 1T3TA 2Z3XA 4D80A 1QAQA 4LF4M 1R7RA 1N78A 2KRKA 1OFIA 1SXJD 1NNUC 3FYCA 2D7GA 4IBEA 3VDPA 4JI1M 1H6UA 2QENA 4I8OA 3UJNA 2BJVA 1N77A 4DR5M 1QQWA 1X37A 4G4RA 1XHBA 1TH2A 1L8QA 3FUTA 3W0LB 4M9ZA 4IIWA 3LVWA 2LWXA 4PD2A 1YE9A 1IY0A 1SXJE 2XEPA 2UU9M 2C9CA 3HWSA 3GLIA 3HU2A 3KOZE 2HL7A 2UXDM 2X4AA 2VQEM 4LF7M 2FFJA 3MHVC 4LJAA 4IBJA 5EJCA 3GLIB 3SHGB 1TDZA 4LJ6A 2NQ8C 3KXEC 4LJ9A 4MH0E 3L26A 3K92A 3GLFB 1Q3BA 2YNMD 3KP1E 3J81S 2FE8A 4KODA 3A42A 4LJ4A 4DR3M 4DR1M 5A2QS 1E94E 5KPZA 4IBKA 4P16A 3OTOM 4DR2M 1ORYB 3HKPA 1GKIA 4ZPXA 2KZUA 2O5RA 1IN6A 3KW6A 3UZUA 4PCZA 3QAUA 3ILKA 2R4EA 3HHXA 4YY3M 3VKGA 3CTWB 1ZQ9A 1NHWC 2Z7JA 2HKJA 3M0EA 4M0DA 3BOSA 5F3WA 4NL4H 1L1TA 4FCWA 2Z4SA 3GQ4A 1K82A 3TQSA 3FTCA 3A98B 1PJJA 3A46A 5EP4A 2ZAMA 1R2YA 3U6LA 2XSZD 3R9XB 4NSOB 2YR0A 4B3MM 5EP1A 3Q8XA 4QHTA 3KS4A 2DWNA 4LFAM 4DUYM 1I94M 1C1KA 1JQJC 1XNRM 1PJIA 3PNYA 1DO0A 2CV2A 1XXHA 1Z5AA 3U6SA 3FUWA 3T38A 2DWLA 3GO8A 2QCUA 1XXHB 4GITA 4IJFA 4B7HA 5IREB 2KEBA 3LVVA 4G4NA 1HT2E 5EXSA 2XF3A 4JYAM 3I4YA 4JI7M 2V6ZM 2HCBA 4LF9M 3RGSA 1IBMM 4PDGA 3SMPA 5DYGA 2Y20A 1G4AE 1HNXM 3U6DA 2YQZA 1E32A 5KPTA 3FUXA 4DV2M 2R4JA 1XMQM 3TWKA 5ITTA 1N34M 3TL4X 4R3DA 3HJQA 3HJSA 3T1YM 3R8FA 3KOXE 1IXZA 1LV7A 2Y21A 3GPPA 3SAVA 2F5OA 4DV5M 2E5LM 4M9XA 1XMOM 4JI2M 4LF8M 2L09A 3W0FA 4LFBM 4NXMM 4B3SM 1HT1E 3WHLA 1G41A 5DYIA 2YFQA 4M9SA 3AOEA 1NSFA 3U6MA 2QZ4A 3SATA 1Z59A 3FUUA 5ITXA 3EIEA 5FTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWM A;  1MX0 A;  4X64 M;  1Z5C A;  3U6C A;  5ITX E;  4DR7 M;  2VQE M;  4LF7 M;  2UXD M;  3A45 A;  3SBJ A;  4DV3 M;  3C58 A;  2OQ4 A;  1TDZ A;  5LMN M;  4OX9 M;  1XC8 A;  4G4O A;  1IBK M;  4DV4 M;  5IT9 S;  1NNJ A;  2F5S A;  4JI0 M;  4B3R M;  4LFC M;  1Q3B A;  3J81 S;  5ITU A;  3A42 A;  4DR3 M;  4DR1 M;  2F5N A;  5A2Q S;  4JI6 M;  3SAU A;  1Q3C A;  3JR5 A;  2XZF A;  3SAS A;  3OTO M;  4DR2 M;  1L1Z A;  2F5P A;  4X65 M;  4GKK M;  3U6E A;  2OPF A;  1Q39 A;  2UUC M;  1PM5 A;  3SAW A;  1N33 M;  4PCZ A;  3GPY A;  4AQY M;  1TDH A;  4YY3 M;  4NRW A;  1N36 M;  4ITQ A;  2HKJ A;  1L1T A;  3VK8 A;  3GQ4 A;  3VK7 A;  1K82 A;  4GKJ M;  1PJJ A;  2F5Q A;  3A46 A;  4DUZ M;  1MU5 A;  4JI3 M;  3U6L A;  1R2Y A;  1J5E M;  4K0K M;  1R2Z A;  4PDI A;  3T1H M;  4DV1 M;  4B3M M;  4JI8 M;  4KHP M;  5ITY A;  1HR0 M;  4JI5 M;  2UUA M;  4LFA M;  4DUY M;  1I94 M;  5ITQ A;  3U6P A;  4NXN M;  1XNR M;  3GPX A;  1PJI A;  2F4V M;  3GPU A;  2ZM6 M;  2Q2E B;  3J80 S;  1XNQ M;  1Z5A A;  3U6S A;  1K3X A;  3JAM S;  2UXC M;  3J7A S;  3GO8 A;  1HNZ M;  4CIS A;  1N32 M;  4JI4 M;  3U6Q A;  4G4N A;  2UXB M;  3U6O A;  4JYA M;  4NRV A;  4JI7 M;  4DV7 M;  3SAR A;  4LF6 M;  4LF9 M;  1IBM M;  4PDG A;  2XZU A;  1L2D A;  4X62 M;  3GQ5 A;  1IBL M;  3JR4 A;  1HNX M;  3U6D A;  2VQF M;  4LF5 M;  4JV5 M;  3GP1 A;  4DR6 M;  1FJG M;  4DV2 M;  1XMQ M;  4B3T M;  3TWK A;  5ITT A;  1N34 M;  2ZBK B;  2UUB M;  4DV0 M;  5IWA M;  3T1Y M;  4LF4 M;  1L2C A;  5ITR A;  3GPP A;  5LMU M;  4JI1 M;  5FLX S;  3SAV A;  2F5O A;  4DV5 M;  1Z5B A;  1L2B A;  2E5L M;  3GQ3 A;  4MB7 A;  3TWL A;  4G4Q A;  4DR5 M;  1XMO M;  1KFV A;  2HHH M;  4DV6 M;  4JI2 M;  4LF8 M;  4G4R A;  3W0F A;  4LFB M;  4X66 M;  4NXM M;  4B3S M;  2EA0 A;  4YHH M;  3DOA A;  1EE8 A;  5BR8 M;  4PD2 A;  1HNW M;  3U6M A;  3SAT A;  4DR4 M;  1Z59 A;  5ITX A;  2UU9 M;  1K3W A; 
#chains in the Genus database with same CATH topology
 3TWM A;  1IN4 A;  1MX0 A;  2DZO B;  2O25 A;  2R45 A;  2RGO A;  4FD2 A;  4L15 A;  4ANR A;  4B7G A;  4X64 M;  2JWS A;  5KO3 A;  4DR7 M;  2J5Y A;  1TF0 B;  2D7H A;  3SBJ A;  1IXS B;  3DA1 A;  4OX9 M;  1XC8 A;  2OOB A;  1QZM A;  3FRI A;  3RGP A;  1E9R A;  1IXR C;  1PJT A;  3RFW A;  5IT9 S;  2CE7 A;  4JI0 M;  4IBI A;  1UM8 A;  5EXT A;  5EQT A;  1G59 A;  3IHP A;  5EXP A;  3MK6 A;  2R18 A;  3AV0 A;  3L29 A;  4RNA A;  5H37 D;  2F5N A;  2WSC F;  1TGU A;  2D7E A;  2F5P A;  3M7G A;  1DO2 A;  2KXE A;  2Z4R A;  3FUV A;  2MGW A;  4GKK M;  1TH4 A;  3D8L A;  2J7N A;  4GIP A;  1Q39 A;  4QOS A;  2UUC M;  3SAW A;  2C9O A;  2C99 A;  2XH9 A;  3PNV A;  4FWG A;  2MH8 A;  3FTE A;  2L6O A;  1N36 M;  2MR9 A;  2KZS A;  2H1R A;  2EKK A;  2MJ5 B;  1IQP A;  2GQF A;  4II7 A;  5BPV A;  3CF6 E;  1RU3 A;  1GL7 A;  3E21 A;  4G3O A;  7CAT A;  1GLN A;  2KNA A;  3GLF A;  2WSE F;  2CFO A;  4DUZ M;  4JI3 M;  2G8L A;  4PDI A;  1YUB A;  4DV1 M;  2JY5 A;  4EIW A;  3FUU A;  4FWD A;  2JY8 A;  4GH9 A;  4I81 A;  3VKH A;  1S3S A;  1AUA A;  5C18 A;  2G5G X;  3KP0 E;  1E9S A;  4Z6Y A;  2CHV A;  1A5T A;  1WGL A;  4MGZ E;  4AG6 A;  3GPX A;  2F4V M;  3QWL A;  1VG5 A;  3FE3 A;  4FCV A;  5JI3 E;  8CAT A;  3B7Z A;  2ZM6 M;  2JZ0 A;  3BXW A;  4FWH A;  2QPA A;  1HQY E;  2RGH A;  2ZAN A;  3JAM S;  3J7A S;  3EIH A;  3GRV A;  1VEJ A;  2CUZ A;  2LHC A;  1OIP A;  4D82 A;  1N32 M;  4LGM A;  3BBZ A;  3FD9 A;  5FTK A;  1WJ7 A;  2Y0T A;  3U6Q A;  4IBG A;  1G3I A;  3B9P A;  2N35 A;  1DGH A;  3PXG A;  2QBY A;  3AKZ A;  3ZCB B;  5KQ8 A;  2L7H A;  4IBC A;  2M5Z A;  3LQQ A;  1SXJ C;  1QAO A;  1DGH B;  4QNR A;  3D8B A;  2DI0 A;  2QBY B;  5GKN A;  4RF1 A;  3GQ5 A;  3AL0 C;  3B74 A;  4HL4 A;  1BVS A;  3EIE A;  2CEA A;  2L2D A;  2XLJ A;  4L8R C;  1W5T A;  1JR3 A;  4LJ7 A;  3WHK A;  3AOG A;  4LF5 M;  2QP9 X;  4MM3 B;  1TH3 A;  4LJ5 A;  2BNK A;  4B3T M;  1IY2 A;  1J09 A;  5FTL A;  3GLG A;  4IBD A;  4DV0 M;  3KSX A;  2C5R A;  3KOW E;  2KW0 A;  3IG5 A;  4CHT B;  3KFU G;  4OU7 A;  3GLG B;  5EP2 A;  4WW0 A;  5DFL A;  2L4E A;  1Z5B A;  1NV8 A;  1V92 A;  3ZQJ A;  4R71 A;  1I4W A;  3CF2 A;  3I4V A;  1L2B A;  5E6J A;  3W68 A;  4GRI A;  3TWL A;  3GQ3 A;  2X8A A;  4JN6 A;  2HHH M;  1NJG A;  4DV6 M;  3MJ5 A;  2C96 A;  3B7N A;  1IN8 A;  4L78 A;  2EA0 A;  1QUT A;  4MGH A;  3C3D A;  2JXN A;  1SXJ A;  1QYR A;  4FVM A;  3T15 A;  4AI6 A;  3UMM A;  1NY6 A;  2A5Y B;  3DOA A;  1EE8 A;  1CUK A;  2DVW B;  3AOE C;  3C9P A;  3E46 A;  5BR8 M;  3THG A;  1SXJ B;  4KLN A;  4NOO B;  4DR4 M;  1HNW M;  1OAO C;  1K3W A;  1OQY A;  1TR8 A;  3LQR A;  1VEG A;  1YSY A;  1Z5C A;  1N75 A;  1IM2 A;  1ZMU A;  1WXQ A;  3VDU A;  3U6C A;  2R65 A;  4LRT A;  3AJI B;  5EXX A;  2G3Q A;  1DV0 A;  1EIJ A;  3H4M A;  3GLI E;  4IBB A;  4HEO A;  4DV3 M;  3U5Z A;  2JP7 A;  2V1U A;  2OQ4 A;  3RE8 A;  5LMN M;  1F4I A;  1IY1 A;  2MRO B;  3CGW A;  4G4O A;  3U5Z B;  4LY6 A;  3DZD A;  5DNY A;  4QOZ C;  3L26 A;  1NNJ A;  2F5S A;  1Z6T A;  5FSW A;  4OW0 A;  3MMP A;  2AHM A;  4I4L A;  4CGY B;  1NO1 A;  1V34 A;  3U60 A;  2BJW A;  4CIZ A;  2FOI C;  4QHS A;  4AZF A;  3SAU A;  4L16 A;  3NBI A;  4JI6 M;  3HY5 A;  3JR5 A;  2VF8 A;  1L1Z A;  3U60 B;  3SAS A;  3U61 A;  3DFZ A;  3VLF B;  2OPF A;  4HLQ A;  2QQ8 A;  4OVZ B;  3U61 B;  4BBA A;  3M6A A;  2LVP C;  3GPY A;  2R46 A;  1IXS A;  3SYL A;  1TDH A;  1GJS A;  4JI1 M;  1D2N A;  4NRW A;  3J7B A;  4NC6 A;  3L2A A;  3VK8 A;  2EO2 A;  3VK7 A;  4P17 A;  4WUR A;  3I01 M;  3I51 A;  4KT0 F;  4LJ8 A;  4K0K M;  4LRS A;  4GMQ A;  4RF0 A;  3HHZ A;  3T1H M;  4JI8 M;  5IZ7 D;  2CRU A;  5ITY A;  1QAM A;  3PVS A;  3L25 A;  4B08 A;  1XB2 B;  5FTM A;  4CJ6 A;  2KA6 B;  3QYB A;  5ITQ A;  3U6P A;  3IG8 A;  4NXN M;  2CHQ A;  2XSZ A;  1HQC A;  1XNQ M;  2CV0 A;  4Y28 F;  3ZH9 B;  4AW4 A;  2DWZ B;  2VDB B;  3SYK A;  3GRY A;  2KRU A;  3GLH A;  4B7F A;  3FYD A;  1DGB A;  4G6Z A;  1HNZ M;  4CIS A;  4GHL A;  1XXH E;  4IJE A;  1OJL A;  2W82 A;  2K47 A;  3GLH B;  4S12 A;  4JI4 M;  3U6O A;  4AKG A;  4Q7J A;  1Y8G A;  4NRV A;  1G8P A;  4I5S A;  3SAR A;  4NSR A;  4LF6 M;  2DAK A;  1GVN A;  3E4R A;  3T6P A;  1VDD A;  1L2D A;  1NV9 A;  2JY6 B;  3PFI A;  1GL6 A;  1T6O A;  3J27 B;  1WHC A;  1QAN A;  2DEN A;  1IBL M;  3JR4 A;  4AKI A;  3TPZ A;  1IN5 A;  2VQF M;  4JV5 M;  2ERC A;  5JI2 E;  2K6B A;  4GC5 A;  2QNJ A;  3HZJ A;  3GP1 A;  4A3V B;  2DKL A;  3HU1 A;  4W5W A;  3GLF B;  2ZBK B;  3H4J A;  3HHW A;  2UUB M;  2LXE A;  5C1B A;  2DHR A;  5IWA M;  2I7N A;  2CV1 A;  1L2C A;  3UK6 A;  5ITR A;  5LMU M;  3KDS E;  5FLX S;  2ZTC A;  3HGI A;  3K1J A;  1R6B X;  1IFY A;  4BLC A;  4G4Q A;  4MB7 A;  2CHG A;  1VQ1 A;  2LVO C;  1P3Q Q;  5FTN A;  3IEC A;  1DGF A;  1KFV A;  4AG5 A;  2DXI A;  1QVR A;  1WGN A;  4XBO A;  3SMS A;  2J7O A;  4X66 M;  4YHH M;  2HWJ A;  1KSF X;  1OFH A;  1VDL A;  3SFZ A;  3ZC7 B;  4LCB A;  1R5L A;  1JB0 F;  1ZMW A;  1HJP A;  1YLA A;  4L4U A;  2LBC A;  2LVQ D;  4M0W A;  3FKE A;  1NVM A;  2QSF X;  1OKS A;  2EUC A;  2RRU A;  2P5T A;  4WP2 A;  3UGJ A;  5L8R F;  5ITX E;  3A45 A;  3HJ8 A;  3E9S A;  4GHA A;  1QZE A;  3CF0 A;  1IN7 A;  3C58 A;  4R7G A;  3HU3 A;  4UN2 B;  3AFH A;  5E26 A;  3VFD A;  4DV4 M;  1IBK M;  2RKO A;  2I7P A;  4JXJ A;  4B3R M;  4MGY E;  4LFC M;  3V76 A;  3K8Z A;  5ITU A;  1FNN A;  1QDR A;  1ZV1 A;  2O01 F;  1Q3C A;  2JA2 A;  3FTD A;  4LGY A;  1PJQ A;  1NJF A;  2XZF A;  1J7K A;  4X65 M;  3K9O A;  2ZAO A;  4BB9 A;  3U6E A;  4MGI E;  3J2P B;  2M60 A;  2X49 A;  1PM5 A;  1N33 M;  3TE6 A;  2R0I A;  2FNA A;  4KO8 A;  2BWB A;  4AQY M;  1NY5 A;  4ITQ A;  2Y0Q A;  3GRR A;  3GRU A;  2KNZ A;  2LNH C;  4IBF A;  3KSJ A;  1R4G A;  4XGI A;  2DWM A;  4GKJ M;  2KHH A;  4PT5 A;  2F5Q A;  1MU5 A;  1J5E M;  3FTF A;  1R2Z A;  4TUW A;  2XGN A;  3GLF E;  4KHP M;  1QDT A;  3KVW A;  2C98 A;  4LZZ A;  1HR0 M;  2DAE A;  4D81 A;  2UUA M;  4JI5 M;  2LH0 A;  2DZN B;  4OVZ A;  3SHF A;  2XFT A;  3LMM A;  2LVN C;  4AKH A;  4QNM A;  4REZ A;  5KQD A;  3HX3 A;  1OTR A;  4LG2 A;  3GPU A;  1DGG A;  2Q2E B;  1XWI A;  2BWE A;  3J80 S;  4MGK E;  5KPR A;  2L4F A;  3K2L A;  1K3X A;  3SC3 A;  2UXC M;  1NHG C;  4Z8X A;  2WSF F;  3L28 A;  1JR3 D;  4FW9 A;  4GC9 A;  1D0M A;  2CWB A;  2R62 A;  3HHY A;  3KS8 A;  2UXB M;  2VF7 A;  2FS1 A;  2V1C A;  1PRB A;  4DV7 M;  5EP3 A;  2XZU A;  1AIP C;  4X62 M;  1KYI A;  1W5S A;  2VII A;  3B7Q A;  2QHO B;  2R44 A;  3L27 A;  3KOY E;  2FH0 A;  2CP8 A;  3NWL A;  4DR6 M;  1FJG M;  1JR3 E;  4FCT A;  1ZAE A;  3C3E A;  4LZJ A;  5FTJ A;  1T3T A;  2Z3X A;  4D80 A;  1QAQ A;  4LF4 M;  1R7R A;  1N78 A;  2KRK A;  1OFI A;  1SXJ D;  1NNU C;  3FYC A;  2D7G A;  4GEW A;  4IBE A;  3VDP A;  1H6U A;  2QEN A;  4I8O A;  3GLG E;  1OAI A;  1GJT A;  1GO5 A;  3UJN A;  2BJV A;  1N77 A;  2DNA A;  4DR5 M;  1QQW A;  1MN3 A;  1X37 A;  4G4R A;  1XHB A;  1TH2 A;  1L8Q A;  3FUT A;  3W0L B;  2DZL A;  4M9Z A;  4IIW A;  3LVW A;  2LWX A;  4PD2 A;  1YE9 A;  1IY0 A;  1SXJ E;  2DAM A;  2XEP A;  2UU9 M;  2C9C A;  3HWS A;  1MJG M;  3GLI A;  3HU2 A;  3KOZ E;  2LHG A;  2OOA A;  2HL7 A;  2UXD M;  2X4A A;  2VQE M;  4LF7 M;  2FFJ A;  3MHV C;  4LJA A;  2WZJ A;  1QUS A;  4IBJ A;  2EJS A;  5EJC A;  3GLI B;  3SHG B;  1TDZ A;  1C7Y A;  3F92 A;  4LJ6 A;  2NQ8 C;  3KXE C;  3Q8G A;  4LJ9 A;  4MH0 E;  2JZ1 A;  2K0B X;  3K92 A;  1Q3B A;  2K9D A;  2YNM D;  3KP1 E;  2FE8 A;  2R6F A;  3J81 S;  4KOD A;  3A42 A;  4LJ4 A;  4DR3 M;  4DR1 M;  5A2Q S;  1E94 E;  5KPZ A;  2OO9 A;  4IBK A;  4P16 A;  3OTO M;  4DR2 M;  1Q02 A;  1ORY B;  3HKP A;  1TTE A;  1GKI A;  2JY7 A;  4ZPX A;  2KZU A;  2O5R A;  1IN6 A;  3KW6 A;  3UZU A;  3QYE A;  1OIZ A;  4PCZ A;  3QAU A;  3ILK A;  3LW5 F;  2R4E A;  3HHX A;  4YY3 M;  3VKG A;  1D0K A;  1UFZ A;  3CTW B;  1ZQ9 A;  1NHW C;  2Z7J A;  2HKJ A;  2Z8Y M;  3M0E A;  3BOS A;  4M0D A;  5F3W A;  4NL4 H;  1L1T A;  1T43 A;  3FRH A;  4FCW A;  1EFU B;  2Z4S A;  3GQ4 A;  1K82 A;  3TQS A;  3FTC A;  1D0L A;  3A98 B;  3NBX X;  4F1I A;  1PJJ A;  3LCV B;  3A46 A;  5EP4 A;  1PJS A;  2ZAM A;  3U6L A;  1R2Y A;  2XSZ D;  3R9X B;  4NSO B;  2YR0 A;  4B3M M;  5EP1 A;  3Q8X A;  3B89 A;  4QHT A;  3KS4 A;  2DWN A;  2EKF A;  4LFA M;  4DUY M;  1I94 M;  1C1K A;  1WIV A;  1JQJ C;  1XNR M;  1PJI A;  3PNY A;  1DO0 A;  1SG9 A;  4F2L A;  2CV2 A;  1XXH A;  1Z5A A;  2KNV A;  3U6S A;  3FUW A;  4RKU F;  3T38 A;  2ZTD A;  3GO8 A;  2DWL A;  2JNH A;  2QCU A;  1XXH B;  4GIT A;  4IJF A;  4B7H A;  2HAK A;  5IRE B;  2KEB A;  3LVV A;  4G4N A;  3GLH E;  1WR1 B;  1HT2 E;  5EXS A;  2XF3 A;  4JYA M;  1ZMV A;  3I4Y A;  2KDL A;  4JI7 M;  1V33 A;  2V6Z M;  2HCB A;  4LF9 M;  3RGS A;  1IBM M;  4PDG A;  2DHY A;  1VEK A;  2LVA A;  3SMP A;  5DYG A;  2LTU A;  2JUJ A;  2APL A;  1G4A E;  2Y20 A;  1HNX M;  3U6D A;  2YQZ A;  1E32 A;  5KPT A;  3FUX A;  4DV2 M;  2R4J A;  1XMQ M;  3TWK A;  5ITT A;  3I04 M;  4XK8 F;  3TL4 X;  2B3T A;  4R3D A;  1N34 M;  3HJQ A;  3HJS A;  3T1Y M;  3R8F A;  1IXZ A;  1LV7 A;  2Y21 A;  3KOX E;  4DBG B;  3GPP A;  2GNO A;  3SAV A;  2F5O A;  1GAB A;  4DV5 M;  3W67 A;  4M9X A;  2E5L M;  1XMO M;  4JI2 M;  4LF8 M;  2H5X A;  2L09 A;  4L6V 6;  3W0F A;  4NXM M;  4LFB M;  4B3S M;  1HT1 E;  3LCU A;  3K9P A;  2DAI A;  3WHL A;  2DAG A;  1G41 A;  5DYI A;  2YFQ A;  4M9S A;  3AOE A;  1G71 A;  1NSF A;  3U6M A;  2QZ4 A;  3SAT A;  1Z59 A;  2XFS A;  5ITX A;  2L7I A;  1PGY A;  1LTM A; 
#chains in the Genus database with same CATH homology
 3TWM A;  1IN4 A;  1MX0 A;  2DZO B;  2R45 A;  2RGO A;  4FD2 A;  4L15 A;  4B7G A;  4X64 M;  5KO3 A;  4DR7 M;  2D7H A;  3SBJ A;  1IXS B;  3DA1 A;  4OX9 M;  1XC8 A;  1QZM A;  3RGP A;  1E9R A;  1IXR C;  3RFW A;  5IT9 S;  2CE7 A;  4JI0 M;  4IBI A;  1UM8 A;  5EXT A;  5EQT A;  1G59 A;  5EXP A;  3MK6 A;  2R18 A;  3AV0 A;  3L29 A;  4RNA A;  5H37 D;  2F5N A;  1TGU A;  2D7E A;  2F5P A;  3M7G A;  1DO2 A;  2KXE A;  2Z4R A;  3FUV A;  4GKK M;  1TH4 A;  3D8L A;  2J7N A;  4GIP A;  1Q39 A;  4QOS A;  2UUC M;  3SAW A;  2C9O A;  2C99 A;  2XH9 A;  3PNV A;  4FWG A;  3FTE A;  2L6O A;  1N36 M;  2KZS A;  2H1R A;  4II7 A;  1IQP A;  5BPV A;  3CF6 E;  1GL7 A;  3GLF A;  7CAT A;  1GLN A;  2CFO A;  4DUZ M;  4JI3 M;  2G8L A;  4PDI A;  1YUB A;  4DV1 M;  4EIW A;  4FWD A;  4GH9 A;  4I81 A;  1S3S A;  5C18 A;  2G5G X;  3KP0 E;  1E9S A;  4Z6Y A;  2CHV A;  4MGZ E;  4AG6 A;  3GPX A;  2F4V M;  3QWL A;  4FCV A;  5JI3 E;  2ZM6 M;  8CAT A;  4FWH A;  2QPA A;  1HQY E;  2RGH A;  2ZAN A;  3JAM S;  3J7A S;  3EIH A;  3GRV A;  2CUZ A;  4D82 A;  1N32 M;  4LGM A;  3FD9 A;  5FTK A;  2Y0T A;  3U6Q A;  4IBG A;  1G3I A;  3B9P A;  1DGH A;  3PXG A;  2QBY A;  3AKZ A;  3ZCB B;  5KQ8 A;  2L7H A;  4IBC A;  2M5Z A;  3LQQ A;  1SXJ C;  1QAO A;  1DGH B;  4QNR A;  3D8B A;  2QBY B;  5GKN A;  4RF1 A;  3GQ5 A;  3AL0 C;  4HL4 A;  2CEA A;  2XLJ A;  4L8R C;  1W5T A;  1JR3 A;  4LJ7 A;  3WHK A;  3AOG A;  4LF5 M;  2QP9 X;  4MM3 B;  1TH3 A;  4LJ5 A;  2BNK A;  4B3T M;  1IY2 A;  1J09 A;  5FTL A;  3GLG A;  4IBD A;  4DV0 M;  3KSX A;  2C5R A;  3KOW E;  2KW0 A;  3IG5 A;  4CHT B;  3KFU G;  4OU7 A;  3GLG B;  5EP2 A;  4WW0 A;  1Z5B A;  1L2B A;  1I4W A;  3CF2 A;  3I4V A;  5E6J A;  3GQ3 A;  4GRI A;  3TWL A;  2HHH M;  2X8A A;  4JN6 A;  1NJG A;  4DV6 M;  3MJ5 A;  2C96 A;  1IN8 A;  4L78 A;  2EA0 A;  4MGH A;  1SXJ A;  3T15 A;  1QYR A;  4FVM A;  4AI6 A;  3UMM A;  1NY6 A;  2A5Y B;  3DOA A;  1EE8 A;  2DVW B;  3AOE C;  5BR8 M;  3THG A;  1SXJ B;  4KLN A;  4NOO B;  4DR4 M;  1HNW M;  1K3W A;  3LQR A;  1YSY A;  1Z5C A;  1N75 A;  1IM2 A;  3VDU A;  1WXQ A;  3U6C A;  2V1U A;  2R65 A;  4LRT A;  3AJI B;  5EXX A;  3H4M A;  4IBB A;  3U5Z A;  4DV3 M;  2OQ4 A;  3RE8 A;  5LMN M;  1IY1 A;  4G4O A;  3U5Z B;  4LY6 A;  3DZD A;  5DNY A;  4QOZ C;  1NNJ A;  2F5S A;  1Z6T A;  5FSW A;  4OW0 A;  2AHM A;  4I4L A;  4CGY B;  3U60 A;  2BJW A;  2FOI C;  4QHS A;  4AZF A;  3SAU A;  4L16 A;  3NBI A;  4JI6 M;  2L7I A;  3JR5 A;  3SAS A;  1L1Z A;  3U60 B;  3U61 A;  3DFZ A;  3VLF B;  2OPF A;  4HLQ A;  4OVZ B;  3U61 B;  4BBA A;  3M6A A;  3GPY A;  2R46 A;  3SYL A;  1TDH A;  1D2N A;  4NRW A;  3J7B A;  3L2A A;  3VK8 A;  2EO2 A;  3VK7 A;  4WUR A;  4LJ8 A;  3I51 A;  4K0K M;  4LRS A;  4GMQ A;  4RF0 A;  3HHZ A;  3T1H M;  4JI8 M;  5IZ7 D;  5ITY A;  1QAM A;  3PVS A;  3L25 A;  4B08 A;  2KA6 B;  5ITQ A;  3U6P A;  3IG8 A;  4NXN M;  2CHQ A;  2XSZ A;  1HQC A;  1XNQ M;  2CV0 A;  3ZH9 B;  4AW4 A;  2DWZ B;  3SYK A;  3GRY A;  2KRU A;  3GLH A;  4B7F A;  3FYD A;  1DGB A;  4G6Z A;  1HNZ M;  4CIS A;  4GHL A;  4IJE A;  1OJL A;  2W82 A;  2K47 A;  3GLH B;  4S12 A;  4JI4 M;  3U6O A;  4AKG A;  4NRV A;  1G8P A;  4I5S A;  3SAR A;  4NSR A;  4LF6 M;  3E4R A;  1GVN A;  1VDD A;  1L2D A;  3PFI A;  1GL6 A;  3J27 B;  1QAN A;  1IBL M;  3JR4 A;  4AKI A;  3TPZ A;  1IN5 A;  2VQF M;  4JV5 M;  2ERC A;  5JI2 E;  4GC5 A;  3GP1 A;  4A3V B;  3HU1 A;  4W5W A;  2ZBK B;  3HHW A;  2UUB M;  2LXE A;  5C1B A;  2DHR A;  5IWA M;  2I7N A;  2CV1 A;  1L2C A;  3UK6 A;  5ITR A;  5LMU M;  3KDS E;  5FLX S;  3HGI A;  3K1J A;  1R6B X;  4BLC A;  4G4Q A;  4MB7 A;  2CHG A;  5FTN A;  1KFV A;  3VKH A;  1DGF A;  4AG5 A;  2DXI A;  1QVR A;  4XBO A;  3SMS A;  2J7O A;  4X66 M;  4YHH M;  3ZC7 B;  1KSF X;  1OFH A;  3SFZ A;  4LCB A;  4L4U A;  4M0W A;  3FKE A;  1NVM A;  2EUC A;  2P5T A;  3UGJ A;  5ITX E;  3A45 A;  3HJ8 A;  3E9S A;  4GHA A;  3CF0 A;  1IN7 A;  3C58 A;  4R7G A;  3HU3 A;  3AFH A;  5E26 A;  3VFD A;  4DV4 M;  1IBK M;  2RKO A;  2I7P A;  4JXJ A;  4B3R M;  4MGY E;  4LFC M;  3K8Z A;  5ITU A;  1FNN A;  1Q3C A;  2JA2 A;  3FTD A;  4LGY A;  1NJF A;  2XZF A;  1J7K A;  4X65 M;  2ZAO A;  4BB9 A;  3U6E A;  4MGI E;  3J2P B;  2M60 A;  2X49 A;  1PM5 A;  1N33 M;  3TE6 A;  2FNA A;  4KO8 A;  4AQY M;  1NY5 A;  4ITQ A;  2Y0Q A;  3GRR A;  3GRU A;  2LNH C;  4IBF A;  3KSJ A;  4XGI A;  2DWM A;  4GKJ M;  4PT5 A;  2F5Q A;  1MU5 A;  1J5E M;  3FTF A;  1R2Z A;  4TUW A;  2XGN A;  4KHP M;  3KVW A;  4LZZ A;  2C98 A;  2XFS A;  1HR0 M;  4D81 A;  2UUA M;  4JI5 M;  2LH0 A;  2DZN B;  4OVZ A;  3SHF A;  2XFT A;  3LMM A;  4AKH A;  4QNM A;  4REZ A;  5KQD A;  4LG2 A;  3GPU A;  1DGG A;  2Q2E B;  1XWI A;  3J80 S;  4MGK E;  5KPR A;  3K2L A;  1K3X A;  3SC3 A;  2UXC M;  1NHG C;  4Z8X A;  3L28 A;  1JR3 D;  4FW9 A;  4GC9 A;  2R62 A;  3HHY A;  2UXB M;  3KS8 A;  2V1C A;  4DV7 M;  5EP3 A;  2XZU A;  4X62 M;  1KYI A;  1W5S A;  2VII A;  3L27 A;  3KOY E;  3NWL A;  4DR6 M;  1FJG M;  4FCT A;  1ZAE A;  4LZJ A;  5FTJ A;  1T3T A;  2Z3X A;  4D80 A;  1QAQ A;  4LF4 M;  1R7R A;  1N78 A;  2KRK A;  1OFI A;  1SXJ D;  1NNU C;  3FYC A;  2D7G A;  4IBE A;  3VDP A;  4JI1 M;  1H6U A;  2QEN A;  4I8O A;  3UJN A;  2BJV A;  1N77 A;  4DR5 M;  1QQW A;  1X37 A;  4G4R A;  1XHB A;  1TH2 A;  1L8Q A;  3FUT A;  3W0L B;  4M9Z A;  4IIW A;  3LVW A;  2LWX A;  4PD2 A;  1YE9 A;  1IY0 A;  1SXJ E;  2XEP A;  2UU9 M;  2C9C A;  3HWS A;  3GLI A;  3HU2 A;  3KOZ E;  2HL7 A;  2UXD M;  2X4A A;  2VQE M;  4LF7 M;  2FFJ A;  3MHV C;  4LJA A;  4IBJ A;  5EJC A;  3GLI B;  3SHG B;  1TDZ A;  4LJ6 A;  2NQ8 C;  3KXE C;  4LJ9 A;  4MH0 E;  3L26 A;  3K92 A;  3GLF B;  1Q3B A;  2YNM D;  3KP1 E;  3J81 S;  2FE8 A;  4KOD A;  3A42 A;  4LJ4 A;  4DR3 M;  4DR1 M;  5A2Q S;  1E94 E;  5KPZ A;  4IBK A;  4P16 A;  3OTO M;  4DR2 M;  1ORY B;  3HKP A;  1GKI A;  4ZPX A;  2KZU A;  2O5R A;  1IN6 A;  3KW6 A;  3UZU A;  4PCZ A;  3QAU A;  3ILK A;  2R4E A;  3HHX A;  4YY3 M;  3VKG A;  3CTW B;  1ZQ9 A;  1NHW C;  2Z7J A;  2HKJ A;  3M0E A;  4M0D A;  3BOS A;  5F3W A;  4NL4 H;  1L1T A;  4FCW A;  2Z4S A;  3GQ4 A;  1K82 A;  3TQS A;  3FTC A;  3A98 B;  1PJJ A;  3A46 A;  5EP4 A;  2ZAM A;  1R2Y A;  3U6L A;  2XSZ D;  3R9X B;  4NSO B;  2YR0 A;  4B3M M;  5EP1 A;  3Q8X A;  4QHT A;  3KS4 A;  2DWN A;  4LFA M;  4DUY M;  1I94 M;  1C1K A;  1JQJ C;  1XNR M;  1PJI A;  3PNY A;  1DO0 A;  2CV2 A;  1XXH A;  1Z5A A;  3U6S A;  3FUW A;  3T38 A;  2DWL A;  3GO8 A;  2QCU A;  1XXH B;  4GIT A;  4IJF A;  4B7H A;  5IRE B;  2KEB A;  3LVV A;  4G4N A;  1HT2 E;  5EXS A;  2XF3 A;  4JYA M;  3I4Y A;  4JI7 M;  2V6Z M;  2HCB A;  4LF9 M;  3RGS A;  1IBM M;  4PDG A;  3SMP A;  5DYG A;  2Y20 A;  1G4A E;  1HNX M;  3U6D A;  2YQZ A;  1E32 A;  5KPT A;  3FUX A;  4DV2 M;  2R4J A;  1XMQ M;  3TWK A;  5ITT A;  1N34 M;  3TL4 X;  4R3D A;  3HJQ A;  3HJS A;  3T1Y M;  3R8F A;  3KOX E;  1IXZ A;  1LV7 A;  2Y21 A;  3GPP A;  3SAV A;  2F5O A;  4DV5 M;  2E5L M;  4M9X A;  1XMO M;  4JI2 M;  4LF8 M;  2L09 A;  3W0F A;  4LFB M;  4NXM M;  4B3S M;  1HT1 E;  3WHL A;  1G41 A;  5DYI A;  2YFQ A;  4M9S A;  3AOE A;  1NSF A;  3U6M A;  2QZ4 A;  3SAT A;  1Z59 A;  3FUU A;  5ITX A;  3EIE A;  5FTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...