4GKJM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gkjM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4gkjM02
3SBJA 5IT9S 3T1HM 1TDHA 2UUAM 4G4OA 2OQ4A 4JI7M 3SATA 4DV3M 4PCZA 3J80S 3TWLA 4NRVA 4OX9M 2XZFA 3U6DA 3U6SA 3U6OA 2F5OA 3GPYA 1N34M 1HR0M 1L1TA 3C58A 4LFAM 4JI5M 4K0KM 2UXDM 3W0FA 1N33M 5ITXA 2F5NA 1J5EM 1K3WA 5FLXS 1XMQM 3A42A 3TWMA 1L1ZA 5LMUM 3U6MA 4X64M 4DR3M 3GP1A 3GQ4A 1EE8A 4JI3M 3U6LA 2F5SA 1NNJA 3JR4A 4B3SM 3U6EA 4CISA 4DR2M 1IBMM 4JV5M 3JAMS 4PDGA 1XC8A 4JI0M 4DR7M 1R2YA 1IBLM 5BR8M 4LFBM 1MX0A 4JI8M 4DUZM 1Z5BA 1XMOM 3GPXA 4AQYM 1HNXM 4B3RM 3SAUA 4B3TM 2OPFA 3OTOM 4G4NA 2XZUA 4JI2M 5LMNM 4ITQA 4DV7M 5ITRA 5IWAM 4YY3M 4LF5M 3U6QA 4JI4M 3GQ5A 4JI6M 4NXNM 4G4RA 1TDZA 1HNWM 2VQFM 3GO8A 4GKJM 5ITUA 3SARA 4DV0M 4X66M 4DV4M 1XNRM 2UUBM 5ITXE 4LF7M 1Q3BA 4NRWA 3JR5A 2ZM6M 4LFCM 3A46A 2E5LM 1FJGM 4JI1M 3GQ3A 3U6PA 3J7AS 1Z5CA 4DR5M 3GPPA 2EA0A 1MU5A 4MB7A 4DR1M 1K82A 4NXMM 2ZBKB 3SAWA 1HNZM 1K3XA 4DR4M 1N36M 2Q2EB 3SAVA 1IBKM 4X65M 4B3MM 1Z5AA 2VQEM 1L2BA 1I94M 3U6CA 1KFVA 2UU9M 3J81S 1L2DA 1R2ZA 3DOAA 3VK8A 4DR6M 1PJJA 3GPUA 1L2CA 4LF8M 4LF4M 3T1YM 5ITQA 4DV2M 4GKKM 1PJIA 2UXBM 2UXCM 4G4QA 4JYAM 1PM5A 4DUYM 4LF6M 2F4VM 1XNQM 4PDIA 4X62M 4DV1M 1N32M 2F5QA 2HKJA 4PD2A 4LF9M 4YHHM 2UUCM 1Q39A 5ITYA 5A2QS 4DV6M 2F5PA 3TWKA 5ITTA 2HHHM 4KHPM 3SASA 3A45A 3VK7A 1Z59A 4DV5M 1Q3CA
chains in the Genus database with same CATH superfamily
3GRUA 2OOAA 1QAQA 1EIJA 4FCTA 1SXJC 1SXJA 3GLIE 1TDHA 5C1BA 2DZNB 2DNAA 2UUAM 4RNAA 4FVMA 3FRIA 4G3OA 3SHFA 4OX9M 3SC3A 1DO2A 1VDDA 3U6OA 3K1JA 3IG5A 5KQ8A 3IG8A 1N34M 1OIZA 4B08A 2C9CA 3PVSA 2DWZB 3CF0A 3KOWE 2CP8A 1P3QQ 3FTEA 3PFIA 2Z4SA 3I4YA 2DWMA 2F5NA 3A98B 5DFLA 2DHRA 3TQSA 2OOBA 3GLHB 1L1ZA 3KOZE 5LMUM 2R6FA 4P17A 4QOZC 4X64M 1N78A 3FUXA 2KHHA 1YSYA 4S12A 2DAEA 4IBBA 1WGLA 3K2LA 4ZPXA 3UK6A 2DWLA 2DKLA 4IBJA 4B3SM 1IBMM 4JV5M 2DZOB 3HKPA 2CV0A 3JAMS 4PDGA 1F4IA 4NL4H 1IBLM 5BR8M 3FE3A 1L8QA 1ORYB 3IHPA 2QSFX 2R4JA 5IREB 3W0LB 5H37D 4DUZM 3GPXA 3VKGA 1NJFA 4B3TM 3BXWA 3OTOM 5EP2A 4LZJA 2X4AA 4QHTA 3U61B 1OJLA 5ITRA 5EXXA 1UM8A 4ANRA 5FTMA 1G4AE 1NSFA 1JR3E 4NSOB 2YQZA 3DZDA 1QZMA 2M60A 1WIVA 4AZFA 2UUBM 1OAOC 3RFWA 1LTMA 4LF7M 2QP9X 1Q3BA 4IJEA 3HJ8A 3MHVC 1R7RA 3U60A 3A46A 5L8RF 4JI1M 2FS1A 1I4WA 3GQ3A 3U6PA 1Z5CA 2R65A 3AV0A 3GPPA 1MU5A 4XBOA 1G71A 4NXMM 2L7HA 2CEAA 2D7EA 4IBEA 4IJFA 3SAWA 2LVOC 2YFQA 3NBIA 4GH9A 1K3XA 1SG9A 1S3SA 1HNZM 2CE7A 1G41A 1WGNA 2Q2EB 2R4EA 4OW0A 3ZC7B 4BB9A 4X65M 4B3MM 3R9XB 4AI6A 2DAKA 1QUSA 4GRIA 1QDTA 1TGUA 3HJSA 5JI3E 2H1RA 2G3QA 3HU1A 1KFVA 3J81S 3RGSA 1L2DA 3DOAA 3FTFA 1OFIA 1ZV1A 3Q8GA 1PJJA 1GLNA 1DGHA 1SXJB 4RF0A 2WSEF 2BNKA 5EP1A 3T1YM 4LJ9A 4DV2M 3FYCA 4FCVA 3L26A 4GKKM 4GIPA 3QAUA 1D2NA 3DFZA 2MGWA 2KZSA 4HLQA 3GLFE 3L28A 4XK8F 4JYAM 1PM5A 1IXZA 1XNQM 1N75A 3AOGA 4IBIA 4OU7A 2LWXA 4D81A 2XSZD 3LVVA 3KOXE 4PD2A 4QNRA 4MGIE 4YHHM 1Q39A 1D0KA 2KDLA 3B9PA 7CATA 5A2QS 2F5PA 4GHAA 3UGJA 4AKIA 1A5TA 3J2PB 1PGYA 1DO0A 2CHGA 1E32A 3KVWA 3A45A 5GKNA 2QPAA 3HHYA 4LF5M 1YLAA 1TH3A 4DV5M 2DVWB 3SBJA 2BWEA 2XH9A 3PXGA 2VDBB 5KQDA 2LHGA 3PNYA 2OQ4A 1TR8A 2QBYA 2JWSA 3U6SA 1C1KA 1NHGC 5EQTA 3L25A 1G59A 3C3EA 2VF7A 3QYBA 2WSFF 4HL4A 1L1TA 1TF0B 2KNAA 2LH0A 3EIEA 4K0KM 3FTCA 4HEOA 3W0FA 5ITXA 2OO9A 5EXSA 1XMQM 3MK6A 3AKZA 3MMPA 3A42A 3GLFA 3U6MA 2I7NA 2MROB 2X8AA 3AOEC 2KA6B 3AOEA 4DR3M 3E4RA 4I4LA 3U6LA 2F5SA 1IQPA 3ILKA 1QVRA 1QZEA 3JR4A 3BBZA 2C98A 4Z6YA 4CHTB 3U6EA 4DR2M 1HJPA 1IN7A 3GRVA 2R46A 1WHCA 2DI0A 1E94E 5FTJA 2NQ8C 2DAGA 5C18A 2J5YA 5EJCA 4LZZA 1TTEA 3T6PA 4JI8M 4LJ4A 1V92A 2KRKA 2CWBA 2RKOA 2Z8YM 1XMOM 3W67A 1NNUC 3D8BA 3FTDA 3C3DA 5JI2E 3TL4X 4CGYB 2XZUA 4F1IA 4JI2M 1D0MA 1OKSA 2LVQD 3E9SA 5LMNM 1TH2A 3E21A 3QWLA 3HU2A 1QYRA 4YY3M 4GMQA 1GVNA 4M9XA 4R3DA 1IXSA 2DZLA 4MGHA 2K0BX 1R5LA 1NY5A 4QOSA 2JNHA 4NOOB 1OAIA 2LBCA 2VQFM 4GKJM 2JY7A 3SARA 2M5ZA 3RGPA 2I7PA 2QHOB 4I81A 4R7GA 2DHYA 4NC6A 4GITA 5FSWA 4NRWA 2LTUA 2HL7A 1G8PA 3J27B 3KW6A 4AKHA 4II7A 2KNZA 2Y0TA 1T6OA 2DENA 4DR5M 4IBFA 3F92A 4QNMA 4MB7A 5EXTA 3GLIA 2EA0A 4DR1M 1GJSA 4GC5A 2JZ1A 1EFUB 2FH0A 3ZH9B 8CATA 2L6OA 3M6AA 3AFHA 2FOIC 3SAVA 1IBKM 1Z5AA 1C7YA 4DBGB 1QQWA 2CRUA 1T3TA 3J7BA 1FNNA 1W5TA 3VDPA 1IN8A 2LVAA 1NJGA 2HAKA 2O01F 3B7NA 3U6CA 4FD2A 2JZ0A 3SFZA 3L27A 3VK8A 2KZUA 5KPRA 2JUJA 3K8ZA 3AJIB 3T38A 2K6BA 4LF4M 1UFZA 3GLHE 2QBYB 2CFOA 1MN3A 2UXBM 3LQQA 2UXCM 5DYGA 4RF1A 4G4QA 4DUYM 2JY8A 4GHLA 4GC9A 4OVZB 4IBKA 2HKJA 1G3IA 4L15A 1XXHB 3FKEA 1PJQA 3TWKA 1DGBA 5ITTA 3U5ZB 2K9DA 4KT0F 3HY5A 4L4UA 1XWIA 4BLCA 4F2LA 2EKKA 4LY6A 3FRHA 1Z59A 3FUUA 3SATA 4IBDA 1W5SA 1OFHA 2XFSA 5IT9S 2XGNA 2RGHA 3CF6E 3GLGB 1QANA 3W68A 1JR3D 3KP0E 3CTWB 4KODA 3VLFB 4G4OA 4JI7M 4PCZA 2L4FA 3J80S 3TWLA 3HZJA 4B7FA 2R44A 3U6DA 4AW4A 2EKFA 2Y20A 1NV9A 2ZAOA 2FE8A 4FWHA 1XB2B 3SYKA 4LJ7A 1NVMA 2JY5A 2LXEA 5IZ7D 1HT1E 1Q02A 1JR3A 1X37A 1HR0M 4R71A 4EIWA 4G6ZA 4A3VB 3C58A 2MJ5B 2HWJA 3TPZA 1N33M 3FUVA 3GLHA 2JP7A 2H5XA 1K3WA 5FLXS 2GNOA 2W82A 3VDUA 3GP1A 1QAMA 1NNJA 5FTNA 1HQYE 3DA1A 1XXHE 2JXNA 2ZTCA 4LJ8A 2C99A 1ZMVA 3HGIA 4Q7JA 5EP3A 4Y28F 2EUCA 1LV7A 4FWDA 4LGYA 2CV2A 4DR7M 2RRUA 3UJNA 1MX0A 2CHVA 3CGWA 3I51A 2DAMA 2L7IA 1GJTA 4NSRA 4CJ6A 2K47A 3E46A 3GLGE 3LVWA 3HHWA 4AQYM 3U61A 1HNXM 3SAUA 4B3RM 3GLIB 3L2AA 1SXJE 3VFDA 2CV1A 1YUBA 3LMMA 4G4NA 2G5GX 4L78A 3GRYA 4I8OA 1GL7A 4KLNA 1HT2E 3D8LA 1XHBA 3LCVB 3LW5F 4B7GA 2D7HA 3RE8A 1ZAEA 3U6QA 3NBXX 2DWNA 2FNAA 4UN2B 3IECA 3B74A 1J7KA 5FTKA 4JI6M 1OQYA 1R4GA 5FTLA 3H4JA 4P16A 2V1CA 1IY2A 1HNWM 3GO8A 2J7OA 4DV0M 4X66M 2AHMA 4DV4M 3BOSA 3UMMA 4D80A 1GO5A 3JR5A 3GLGA 2ERCA 2R18A 2JY6B 1IFYA 2KNVA 1FJGM 2XF3A 2CUZA 1NHWC 3HWSA 3U60B 1QUTA 3SMSA 1JB0F 1OIPA 3K9PA 1T43A 1NY6A 4JXJA 3WHKA 1N36M 1VEJA 4LJ5A 3FUWA 1VQ1A 2R45A 4AG5A 4TUWA 2KXEA 1IN5A 2Z7JA 1JQJC 2V6ZM 3I4VA 3KSXA 1I94M 4LGMA 2ZANA 3KSJA 4REZA 4L8RC 4IBCA 3KS8A 1NV8A 3AL0C 4MH0E 3C9PA 2QQ8A 3PNVA 2KW0A 1L2CA 3ZQJA 2N35A 1QDRA 3FUTA 5EP4A 3KS4A 5ITQA 5KO3A 1DGGA 4JN6A 1DGHB 1TH4A 2C96A 2Z4RA 3CF2A 3K9OA 2QZ4A 1J09A 2F4VM 1E9SA 4L6V6 1IY1A 4PDIA 4X62M 4DV1M 3HHZA 4LRTA 2LHCA 1KSFX 5ITYA 3ZCBB 4DV6M 1VEKA 2UUCM 4WP2A 2F5OA 2MH8A 1QAOA 2BJWA 2BWBA 4LRSA 4KHPM 2O25A 2Z3XA 4I5SA 3SASA 5KPZA 3VK7A 4D82A 1Q3CA 4BBAA 1DGFA 2QCUA 4M0WA 3T1HM 2HCBA 1D0LA 3LCUA 2L2DA 4M9ZA 4DV3M 3KOYE 4NRVA 2DXIA 5BPVA 1OTRA 3FYDA 3H4MA 2ZTDA 3LQRA 4FCWA 3KXEC 2XZFA 1WJ7A 3SHGB 2KRUA 2YNMD 3GPYA 3KDSE 2XLJA 1N77A 2BJVA 1IXRC 2C9OA 4LFAM 4JI5M 4L16A 2R62A 2UXDM 1IN4A 3VKHA 2EJSA 2O5RA 3HJQA 4IBGA 1J5EM 2EO2A 1YE9A 1V34A 3TWMA 4AG6A 1ZQ9A 1EE8A 3L29A 2Y0QA 3I04M 2WSCF 4JI3M 1ZMUA 3GQ4A 2XFTA 3GLFB 4LCBA 3B89A 3UZUA 4MM3B 5F3WA 1VG5A 4B7HA 2B3TA 1AUAA 3QYEA 4CISA 4CIZA 3T15A 2QNJA 2CHQA 2LNHC 1XC8A 4JI0M 2QENA 4M9SA 1V33A 4M0DA 1R2YA 1DV0A 1H6UA 2FFJA 2G8LA 4LFBM 3THGA 4XGIA 2L4EA 3FD9A 3R8FA 1Y8GA 1Z5BA 1PJTA 1BVSA 2OPFA 3HHXA 3HX3A 1VDLA 2X49A 4LJAA 4ITQA 4DV7M 5IWAM 2R0IA 3GRRA 3NWLA 4LJ6A 5KPTA 5E6JA 2YR0A 4JI4M 3GQ5A 4NXNM 4G4RA 1TDZA 1RU3A 1IXSB 5ITUA 2RGOA 3KP1E 1XNRM 4AKGA 5ITXE 2APLA 4RKUF 2ZM6M 4LFCM 2LVNC 2E5LM 4PT5A 2JA2A 3J7AS 1PJSA 1AIPC 4FWGA 2WZJA 1E9RA 3M7GA 4FW9A 4MGKE 2Y21A 1K82A 2ZBKB 4KO8A 4DR4M 1Z6TA 1CUKA 3V76A 3WHLA 2LVPC 2XEPA 2V1UA 2P5TA 1IM2A 2XSZA 2VQEM 1GKIA 2J7NA 3M0EA 1L2BA 1KYIA 5DYIA 4GEWA 2UU9M 1R2ZA 1GABA 4LG2A 4DR6M 3HU3A 2D7GA 3Q8XA 3GPUA 1ZMWA 3B7ZA 4Z8XA 4LF8M 3TE6A 2GQFA 1PJIA 2VF8A 4MGZE 2L09A 1PRBA 1GL6A 3K92A 1VEGA 1WXQA 4OVZA 2DAIA 1WR1B 2KEBA 2ZAMA 4WURA 4LF6M 3KFUG 1NO1A 1XXHA 5EXPA 2MR9A 3U5ZA 2C5RA 2F5QA 1N32M 1HQCA 3SMPA 4LF9M 3I01M 1MJGM 4IIWA 4QHSA 5DNYA 1IY0A 2A5YB 1SXJD 2HHHM 4W5WA 4WW0A 5E26A 3EIHA 3SYLA 1IN6A 4MGYE 3B7QA 2VIIA 1R6BX 3MJ5A
chains in the Genus database with same CATH topology
3GRUA 1QAQA 4FCTA 1SXJC 1SXJA 1TDHA 5C1BA 2DZNB 2UUAM 4RNAA 4FVMA 4OX9M 3SHFA 3SC3A 1DO2A 1VDDA 3U6OA 3K1JA 3IG5A 5KQ8A 3IG8A 1N34M 4B08A 2C9CA 3PVSA 2DWZB 3CF0A 3KOWE 3FTEA 3PFIA 2Z4SA 3I4YA 2DWMA 2F5NA 3A98B 2DHRA 3TQSA 3GLHB 1L1ZA 3KOZE 5LMUM 4QOZC 1N78A 4X64M 3FUXA 1YSYA 4S12A 4IBBA 3K2LA 4ZPXA 3UK6A 4IBJA 4B3SM 1IBMM 4JV5M 2DZOB 3HKPA 2CV0A 3JAMS 4PDGA 4NL4H 1IBLM 5BR8M 1L8QA 1ORYB 2R4JA 5IREB 3W0LB 5H37D 4DUZM 3GPXA 3VKGA 1NJFA 4B3TM 3OTOM 5EP2A 4LZJA 2X4AA 4QHTA 3U61B 1OJLA 5ITRA 5EXXA 1UM8A 5FTMA 1G4AE 1NSFA 4NSOB 2YQZA 3DZDA 1QZMA 2M60A 4AZFA 2UUBM 3RFWA 4LF7M 2QP9X 1Q3BA 4IJEA 3HJ8A 3MHVC 1R7RA 3U60A 3A46A 4JI1M 1I4WA 3GQ3A 3U6PA 1Z5CA 2R65A 3AV0A 3GPPA 1MU5A 4XBOA 4NXMM 2L7HA 2CEAA 2D7EA 4IBEA 4IJFA 3SAWA 1HNZM 2YFQA 3NBIA 4GH9A 1K3XA 1S3SA 2CE7A 1G41A 2Q2EB 2R4EA 4OW0A 3ZC7B 4X65M 4BB9A 4B3MM 3R9XB 4AI6A 4GRIA 1TGUA 3HJSA 5JI3E 2H1RA 3HU1A 1KFVA 3J81S 3RGSA 1L2DA 3DOAA 3FTFA 1OFIA 1PJJA 1GLNA 1DGHA 1SXJB 4RF0A 2BNKA 5EP1A 3T1YM 4LJ9A 4DV2M 3FYCA 4FCVA 3L26A 4GKKM 4GIPA 3QAUA 1D2NA 3DFZA 4HLQA 2KZSA 4JYAM 3L28A 1PM5A 1IXZA 1XNQM 1N75A 3AOGA 4IBIA 4OU7A 2LWXA 4D81A 2XSZD 3LVVA 3KOXE 4PD2A 4QNRA 4MGIE 4YHHM 1Q39A 5A2QS 3B9PA 7CATA 2F5PA 4GHAA 3UGJA 4AKIA 3J2PB 1DO0A 2CHGA 1E32A 3KVWA 3A45A 5GKNA 2QPAA 3HHYA 4LF5M 4DV5M 1TH3A 2DVWB 3SBJA 2XH9A 3PXGA 5KQDA 3PNYA 2OQ4A 2QBYA 3U6SA 1C1KA 1NHGC 5EQTA 3L25A 1G59A 4HL4A 1L1TA 3EIEA 2LH0A 4K0KM 3FTCA 3W0FA 5ITXA 5EXSA 1XMQM 3MK6A 3AKZA 3A42A 3GLFA 3U6MA 2I7NA 2X8AA 3AOEC 2KA6B 3AOEA 4DR3M 3E4RA 4I4LA 3U6LA 2F5SA 1IQPA 3ILKA 1QVRA 3JR4A 2C98A 4Z6YA 4CHTB 3U6EA 4DR2M 3GRVA 1IN7A 2R46A 1E94E 5FTJA 2NQ8C 5C18A 5EJCA 4LZZA 4JI8M 4LJ4A 2KRKA 2RKOA 1XMOM 1NNUC 3D8BA 3FTDA 5JI2E 3TL4X 4CGYB 2XZUA 4JI2M 5LMNM 3E9SA 1TH2A 3QWLA 3HU2A 1QYRA 4YY3M 4GMQA 1GVNA 4M9XA 4R3DA 4MGHA 1NY5A 4QOSA 4NOOB 2VQFM 4GKJM 3SARA 2M5ZA 3RGPA 2I7PA 4I81A 4R7GA 4GITA 5FSWA 4NRWA 2HL7A 1G8PA 3J27B 3KW6A 4AKHA 4II7A 2Y0TA 4DR5M 4IBFA 4QNMA 3GLIA 4MB7A 5EXTA 2EA0A 4DR1M 4GC5A 3ZH9B 8CATA 2L6OA 3M6AA 3AFHA 2FOIC 3SAVA 1IBKM 1Z5AA 1QQWA 1T3TA 3J7BA 1FNNA 1W5TA 3VDPA 1IN8A 3U6CA 1NJGA 4FD2A 3SFZA 3L27A 3VK8A 2KZUA 5KPRA 3K8ZA 3AJIB 3T38A 4LF4M 2QBYB 2CFOA 2UXBM 3LQQA 2UXCM 5DYGA 4RF1A 4G4QA 4DUYM 4GHLA 4GC9A 4OVZB 4IBKA 2HKJA 1G3IA 4L15A 1XXHB 3FKEA 3TWKA 1DGBA 5ITTA 3U5ZB 4L4UA 1XWIA 4BLCA 4LY6A 3FUUA 1Z59A 3SATA 4IBDA 1W5SA 1OFHA 2XFSA 5IT9S 2XGNA 2RGHA 3CF6E 3GLGB 1QANA 1JR3D 3KP0E 3CTWB 4KODA 3VLFB 4G4OA 4JI7M 4PCZA 3J80S 3TWLA 4B7FA 3U6DA 4AW4A 2Y20A 2ZAOA 2FE8A 4FWHA 3SYKA 2F5OA 4LJ7A 1NVMA 2LXEA 5IZ7D 1HR0M 1HT1E 1X37A 1JR3A 4EIWA 4G6ZA 4A3VB 3C58A 3TPZA 1N33M 3FUVA 3GLHA 1K3WA 5FLXS 2W82A 3VDUA 3GP1A 1QAMA 1NNJA 5FTNA 1HQYE 3DA1A 4LJ8A 5EP3A 2C99A 3HGIA 2EUCA 1LV7A 4FWDA 4LGYA 2CV2A 4DR7M 3UJNA 1MX0A 2CHVA 4NSRA 3I51A 2L7IA 2K47A 3LVWA 3HHWA 4AQYM 3U61A 1HNXM 3SAUA 4B3RM 3GLIB 3L2AA 1SXJE 3VFDA 2CV1A 1YUBA 3LMMA 4G4NA 2G5GX 4L78A 3GRYA 4I8OA 1GL7A 4KLNA 1HT2E 3D8LA 1XHBA 4B7GA 2D7HA 3RE8A 1ZAEA 3U6QA 2DWNA 2FNAA 1J7KA 5FTKA 4JI6M 5FTLA 4P16A 2V1CA 1IY2A 1HNWM 3GO8A 2J7OA 4DV0M 4X66M 2AHMA 4DV4M 3BOSA 3UMMA 4D80A 3JR5A 3GLGA 2ERCA 2R18A 1FJGM 2XF3A 2CUZA 1NHWC 3HWSA 3U60B 3SMSA 1NY6A 4JXJA 3WHKA 1N36M 4LJ5A 3FUWA 2R45A 4AG5A 4TUWA 2Z7JA 1IN5A 2KXEA 2V6ZM 1JQJC 3I4VA 3KSXA 1I94M 4LGMA 2ZANA 3KSJA 4REZA 4L8RC 4IBCA 3KS8A 3AL0C 4MH0E 3PNVA 2KW0A 1L2CA 5EP4A 3FUTA 5ITQA 5KO3A 3KS4A 1DGGA 4JN6A 1DGHB 1TH4A 2C96A 2Z4RA 3CF2A 2QZ4A 1J09A 2F4VM 1E9SA 4PDIA 1IY1A 4X62M 4DV1M 3HHZA 4LRTA 1KSFX 5ITYA 3ZCBB 4DV6M 2UUCM 4LRSA 1QAOA 2BJWA 4KHPM 2Z3XA 4I5SA 3SASA 5KPZA 3VK7A 4D82A 1Q3CA 4BBAA 1DGFA 2QCUA 4M0WA 3T1HM 2HCBA 4M9ZA 4DV3M 3KOYE 4NRVA 2DXIA 5BPVA 3FYDA 3H4MA 3LQRA 2XZFA 4FCWA 3KXEC 3SHGB 2KRUA 2YNMD 3GPYA 3KDSE 2XLJA 1N77A 2BJVA 1IXRC 2C9OA 4LFAM 4JI5M 4L16A 2R62A 2UXDM 1IN4A 3VKHA 2O5RA 3HJQA 4IBGA 1J5EM 2EO2A 1YE9A 3TWMA 4AG6A 1ZQ9A 1EE8A 3L29A 2Y0QA 4JI3M 3GQ4A 3GLFB 2DWLA 2XFTA 4LCBA 3UZUA 4MM3B 5F3WA 4B7HA 4CISA 3T15A 2CHQA 2LNHC 1XC8A 4JI0M 2QENA 4M9SA 4M0DA 1R2YA 1H6UA 2FFJA 2G8LA 4LFBM 3THGA 4XGIA 3FD9A 3R8FA 1Z5BA 2OPFA 3HHXA 2X49A 4LJAA 4ITQA 4DV7M 5IWAM 3GRRA 3NWLA 4LJ6A 5KPTA 5E6JA 2YR0A 4JI4M 3GQ5A 4NXNM 4G4RA 1TDZA 1IXSB 5ITUA 2RGOA 3KP1E 1XNRM 4AKGA 5ITXE 2ZM6M 4LFCM 2E5LM 4PT5A 2JA2A 3J7AS 4FWGA 1E9RA 3M7GA 4FW9A 4MGKE 2Y21A 1K82A 2ZBKB 4KO8A 4DR4M 1Z6TA 3WHLA 2XEPA 2V1UA 2XSZA 1IM2A 2P5TA 2VQEM 1GKIA 2J7NA 3M0EA 1L2BA 1KYIA 5DYIA 2UU9M 1R2ZA 4LG2A 4DR6M 3HU3A 2D7GA 3Q8XA 3GPUA 4Z8XA 4LF8M 3TE6A 1PJIA 4MGZE 2L09A 1GL6A 3K92A 1WXQA 4OVZA 2KEBA 2ZAMA 4WURA 4LF6M 3KFUG 1XXHA 5EXPA 3U5ZA 2C5RA 2F5QA 1N32M 1HQCA 3SMPA 4LF9M 4IIWA 4QHSA 5DNYA 1IY0A 2A5YB 1SXJD 2HHHM 4W5WA 4WW0A 5E26A 3EIHA 3SYLA 1IN6A 4MGYE 2VIIA 1R6BX 3MJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBJ A;  5IT9 S;  3T1H M;  1TDH A;  2UUA M;  4G4O A;  2OQ4 A;  4JI7 M;  3SAT A;  4DV3 M;  4PCZ A;  3J80 S;  3TWL A;  4NRV A;  4OX9 M;  2XZF A;  3U6D A;  3U6S A;  3U6O A;  2F5O A;  3GPY A;  1N34 M;  1HR0 M;  1L1T A;  3C58 A;  4LFA M;  4JI5 M;  4K0K M;  2UXD M;  3W0F A;  1N33 M;  5ITX A;  2F5N A;  1J5E M;  1K3W A;  5FLX S;  1XMQ M;  3A42 A;  3TWM A;  1L1Z A;  5LMU M;  3U6M A;  4X64 M;  4DR3 M;  3GP1 A;  3GQ4 A;  1EE8 A;  4JI3 M;  3U6L A;  2F5S A;  1NNJ A;  3JR4 A;  4B3S M;  3U6E A;  4CIS A;  4DR2 M;  1IBM M;  4JV5 M;  3JAM S;  4PDG A;  1XC8 A;  4JI0 M;  4DR7 M;  1R2Y A;  1IBL M;  5BR8 M;  4LFB M;  1MX0 A;  4JI8 M;  4DUZ M;  1Z5B A;  1XMO M;  3GPX A;  4AQY M;  1HNX M;  4B3R M;  3SAU A;  4B3T M;  2OPF A;  3OTO M;  4G4N A;  2XZU A;  4JI2 M;  5LMN M;  4ITQ A;  4DV7 M;  5ITR A;  5IWA M;  4YY3 M;  4LF5 M;  3U6Q A;  4JI4 M;  3GQ5 A;  4JI6 M;  4NXN M;  4G4R A;  1TDZ A;  1HNW M;  2VQF M;  3GO8 A;  4GKJ M;  5ITU A;  3SAR A;  4DV0 M;  4X66 M;  4DV4 M;  1XNR M;  2UUB M;  5ITX E;  4LF7 M;  1Q3B A;  4NRW A;  3JR5 A;  2ZM6 M;  4LFC M;  3A46 A;  2E5L M;  1FJG M;  4JI1 M;  3GQ3 A;  3U6P A;  3J7A S;  1Z5C A;  4DR5 M;  3GPP A;  2EA0 A;  1MU5 A;  4MB7 A;  4DR1 M;  1K82 A;  4NXM M;  2ZBK B;  3SAW A;  1HNZ M;  1K3X A;  4DR4 M;  1N36 M;  2Q2E B;  3SAV A;  1IBK M;  4X65 M;  4B3M M;  1Z5A A;  2VQE M;  1L2B A;  1I94 M;  3U6C A;  1KFV A;  2UU9 M;  3J81 S;  1L2D A;  1R2Z A;  3DOA A;  3VK8 A;  4DR6 M;  1PJJ A;  3GPU A;  1L2C A;  4LF8 M;  4LF4 M;  3T1Y M;  5ITQ A;  4DV2 M;  4GKK M;  1PJI A;  2UXB M;  2UXC M;  4G4Q A;  4JYA M;  1PM5 A;  4DUY M;  4LF6 M;  2F4V M;  1XNQ M;  4PDI A;  4X62 M;  4DV1 M;  1N32 M;  2F5Q A;  2HKJ A;  4PD2 A;  4LF9 M;  4YHH M;  2UUC M;  1Q39 A;  5ITY A;  5A2Q S;  4DV6 M;  2F5P A;  3TWK A;  5ITT A;  2HHH M;  4KHP M;  3SAS A;  3A45 A;  3VK7 A;  1Z59 A;  4DV5 M;  1Q3C A; 
#chains in the Genus database with same CATH topology
 3GRU A;  2OOA A;  1QAQ A;  1EIJ A;  4FCT A;  1SXJ C;  1SXJ A;  3GLI E;  1TDH A;  5C1B A;  2DZN B;  2DNA A;  2UUA M;  4RNA A;  4FVM A;  3FRI A;  4G3O A;  3SHF A;  4OX9 M;  3SC3 A;  1DO2 A;  1VDD A;  3U6O A;  3K1J A;  3IG5 A;  5KQ8 A;  3IG8 A;  1N34 M;  1OIZ A;  4B08 A;  2C9C A;  3PVS A;  2DWZ B;  3CF0 A;  3KOW E;  2CP8 A;  1P3Q Q;  3FTE A;  3PFI A;  2Z4S A;  3I4Y A;  2DWM A;  2F5N A;  3A98 B;  5DFL A;  2DHR A;  3TQS A;  2OOB A;  3GLH B;  1L1Z A;  3KOZ E;  5LMU M;  2R6F A;  4P17 A;  4QOZ C;  4X64 M;  1N78 A;  3FUX A;  2KHH A;  1YSY A;  4S12 A;  2DAE A;  4IBB A;  1WGL A;  3K2L A;  4ZPX A;  3UK6 A;  2DWL A;  2DKL A;  4IBJ A;  4B3S M;  1IBM M;  4JV5 M;  2DZO B;  3HKP A;  2CV0 A;  3JAM S;  4PDG A;  1F4I A;  4NL4 H;  1IBL M;  5BR8 M;  3FE3 A;  1L8Q A;  1ORY B;  3IHP A;  2QSF X;  2R4J A;  5IRE B;  3W0L B;  5H37 D;  4DUZ M;  3GPX A;  3VKG A;  1NJF A;  4B3T M;  3BXW A;  3OTO M;  5EP2 A;  4LZJ A;  2X4A A;  4QHT A;  3U61 B;  1OJL A;  5ITR A;  5EXX A;  1UM8 A;  4ANR A;  5FTM A;  1G4A E;  1NSF A;  1JR3 E;  4NSO B;  2YQZ A;  3DZD A;  1QZM A;  2M60 A;  1WIV A;  4AZF A;  2UUB M;  1OAO C;  3RFW A;  1LTM A;  4LF7 M;  2QP9 X;  1Q3B A;  4IJE A;  3HJ8 A;  3MHV C;  1R7R A;  3U60 A;  3A46 A;  5L8R F;  4JI1 M;  2FS1 A;  1I4W A;  3GQ3 A;  3U6P A;  1Z5C A;  2R65 A;  3AV0 A;  3GPP A;  1MU5 A;  4XBO A;  1G71 A;  4NXM M;  2L7H A;  2CEA A;  2D7E A;  4IBE A;  4IJF A;  3SAW A;  2LVO C;  2YFQ A;  3NBI A;  4GH9 A;  1K3X A;  1SG9 A;  1S3S A;  1HNZ M;  2CE7 A;  1G41 A;  1WGN A;  2Q2E B;  2R4E A;  4OW0 A;  3ZC7 B;  4BB9 A;  4X65 M;  4B3M M;  3R9X B;  4AI6 A;  2DAK A;  1QUS A;  4GRI A;  1QDT A;  1TGU A;  3HJS A;  5JI3 E;  2H1R A;  2G3Q A;  3HU1 A;  1KFV A;  3J81 S;  3RGS A;  1L2D A;  3DOA A;  3FTF A;  1OFI A;  1ZV1 A;  3Q8G A;  1PJJ A;  1GLN A;  1DGH A;  1SXJ B;  4RF0 A;  2WSE F;  2BNK A;  5EP1 A;  3T1Y M;  4LJ9 A;  4DV2 M;  3FYC A;  4FCV A;  3L26 A;  4GKK M;  4GIP A;  3QAU A;  1D2N A;  3DFZ A;  2MGW A;  2KZS A;  4HLQ A;  3GLF E;  3L28 A;  4XK8 F;  4JYA M;  1PM5 A;  1IXZ A;  1XNQ M;  1N75 A;  3AOG A;  4IBI A;  4OU7 A;  2LWX A;  4D81 A;  2XSZ D;  3LVV A;  3KOX E;  4PD2 A;  4QNR A;  4MGI E;  4YHH M;  1Q39 A;  1D0K A;  2KDL A;  3B9P A;  7CAT A;  5A2Q S;  2F5P A;  4GHA A;  3UGJ A;  4AKI A;  1A5T A;  3J2P B;  1PGY A;  1DO0 A;  2CHG A;  1E32 A;  3KVW A;  3A45 A;  5GKN A;  2QPA A;  3HHY A;  4LF5 M;  1YLA A;  1TH3 A;  4DV5 M;  2DVW B;  3SBJ A;  2BWE A;  2XH9 A;  3PXG A;  2VDB B;  5KQD A;  2LHG A;  3PNY A;  2OQ4 A;  1TR8 A;  2QBY A;  2JWS A;  3U6S A;  1C1K A;  1NHG C;  5EQT A;  3L25 A;  1G59 A;  3C3E A;  2VF7 A;  3QYB A;  2WSF F;  4HL4 A;  1L1T A;  1TF0 B;  2KNA A;  2LH0 A;  3EIE A;  4K0K M;  3FTC A;  4HEO A;  3W0F A;  5ITX A;  2OO9 A;  5EXS A;  1XMQ M;  3MK6 A;  3AKZ A;  3MMP A;  3A42 A;  3GLF A;  3U6M A;  2I7N A;  2MRO B;  2X8A A;  3AOE C;  2KA6 B;  3AOE A;  4DR3 M;  3E4R A;  4I4L A;  3U6L A;  2F5S A;  1IQP A;  3ILK A;  1QVR A;  1QZE A;  3JR4 A;  3BBZ A;  2C98 A;  4Z6Y A;  4CHT B;  3U6E A;  4DR2 M;  1HJP A;  1IN7 A;  3GRV A;  2R46 A;  1WHC A;  2DI0 A;  1E94 E;  5FTJ A;  2NQ8 C;  2DAG A;  5C18 A;  2J5Y A;  5EJC A;  4LZZ A;  1TTE A;  3T6P A;  4JI8 M;  4LJ4 A;  1V92 A;  2KRK A;  2CWB A;  2RKO A;  2Z8Y M;  1XMO M;  3W67 A;  1NNU C;  3D8B A;  3FTD A;  3C3D A;  5JI2 E;  3TL4 X;  4CGY B;  2XZU A;  4F1I A;  4JI2 M;  1D0M A;  1OKS A;  2LVQ D;  3E9S A;  5LMN M;  1TH2 A;  3E21 A;  3QWL A;  3HU2 A;  1QYR A;  4YY3 M;  4GMQ A;  1GVN A;  4M9X A;  4R3D A;  1IXS A;  2DZL A;  4MGH A;  2K0B X;  1R5L A;  1NY5 A;  4QOS A;  2JNH A;  4NOO B;  1OAI A;  2LBC A;  2VQF M;  4GKJ M;  2JY7 A;  3SAR A;  2M5Z A;  3RGP A;  2I7P A;  2QHO B;  4I81 A;  4R7G A;  2DHY A;  4NC6 A;  4GIT A;  5FSW A;  4NRW A;  2LTU A;  2HL7 A;  1G8P A;  3J27 B;  3KW6 A;  4AKH A;  4II7 A;  2KNZ A;  2Y0T A;  1T6O A;  2DEN A;  4DR5 M;  4IBF A;  3F92 A;  4QNM A;  4MB7 A;  5EXT A;  3GLI A;  2EA0 A;  4DR1 M;  1GJS A;  4GC5 A;  2JZ1 A;  1EFU B;  2FH0 A;  3ZH9 B;  8CAT A;  2L6O A;  3M6A A;  3AFH A;  2FOI C;  3SAV A;  1IBK M;  1Z5A A;  1C7Y A;  4DBG B;  1QQW A;  2CRU A;  1T3T A;  3J7B A;  1FNN A;  1W5T A;  3VDP A;  1IN8 A;  2LVA A;  1NJG A;  2HAK A;  2O01 F;  3B7N A;  3U6C A;  4FD2 A;  2JZ0 A;  3SFZ A;  3L27 A;  3VK8 A;  2KZU A;  5KPR A;  2JUJ A;  3K8Z A;  3AJI B;  3T38 A;  2K6B A;  4LF4 M;  1UFZ A;  3GLH E;  2QBY B;  2CFO A;  1MN3 A;  2UXB M;  3LQQ A;  2UXC M;  5DYG A;  4RF1 A;  4G4Q A;  4DUY M;  2JY8 A;  4GHL A;  4GC9 A;  4OVZ B;  4IBK A;  2HKJ A;  1G3I A;  4L15 A;  1XXH B;  3FKE A;  1PJQ A;  3TWK A;  1DGB A;  5ITT A;  3U5Z B;  2K9D A;  4KT0 F;  3HY5 A;  4L4U A;  1XWI A;  4BLC A;  4F2L A;  2EKK A;  4LY6 A;  3FRH A;  1Z59 A;  3FUU A;  3SAT A;  4IBD A;  1W5S A;  1OFH A;  2XFS A;  5IT9 S;  2XGN A;  2RGH A;  3CF6 E;  3GLG B;  1QAN A;  3W68 A;  1JR3 D;  3KP0 E;  3CTW B;  4KOD A;  3VLF B;  4G4O A;  4JI7 M;  4PCZ A;  2L4F A;  3J80 S;  3TWL A;  3HZJ A;  4B7F A;  2R44 A;  3U6D A;  4AW4 A;  2EKF A;  2Y20 A;  1NV9 A;  2ZAO A;  2FE8 A;  4FWH A;  1XB2 B;  3SYK A;  4LJ7 A;  1NVM A;  2JY5 A;  2LXE A;  5IZ7 D;  1HT1 E;  1Q02 A;  1JR3 A;  1X37 A;  1HR0 M;  4R71 A;  4EIW A;  4G6Z A;  4A3V B;  3C58 A;  2MJ5 B;  2HWJ A;  3TPZ A;  1N33 M;  3FUV A;  3GLH A;  2JP7 A;  2H5X A;  1K3W A;  5FLX S;  2GNO A;  2W82 A;  3VDU A;  3GP1 A;  1QAM A;  1NNJ A;  5FTN A;  1HQY E;  3DA1 A;  1XXH E;  2JXN A;  2ZTC A;  4LJ8 A;  2C99 A;  1ZMV A;  3HGI A;  4Q7J A;  5EP3 A;  4Y28 F;  2EUC A;  1LV7 A;  4FWD A;  4LGY A;  2CV2 A;  4DR7 M;  2RRU A;  3UJN A;  1MX0 A;  2CHV A;  3CGW A;  3I51 A;  2DAM A;  2L7I A;  1GJT A;  4NSR A;  4CJ6 A;  2K47 A;  3E46 A;  3GLG E;  3LVW A;  3HHW A;  4AQY M;  3U61 A;  1HNX M;  3SAU A;  4B3R M;  3GLI B;  3L2A A;  1SXJ E;  3VFD A;  2CV1 A;  1YUB A;  3LMM A;  4G4N A;  2G5G X;  4L78 A;  3GRY A;  4I8O A;  1GL7 A;  4KLN A;  1HT2 E;  3D8L A;  1XHB A;  3LCV B;  3LW5 F;  4B7G A;  2D7H A;  3RE8 A;  1ZAE A;  3U6Q A;  3NBX X;  2DWN A;  2FNA A;  4UN2 B;  3IEC A;  3B74 A;  1J7K A;  5FTK A;  4JI6 M;  1OQY A;  1R4G A;  5FTL A;  3H4J A;  4P16 A;  2V1C A;  1IY2 A;  1HNW M;  3GO8 A;  2J7O A;  4DV0 M;  4X66 M;  2AHM A;  4DV4 M;  3BOS A;  3UMM A;  4D80 A;  1GO5 A;  3JR5 A;  3GLG A;  2ERC A;  2R18 A;  2JY6 B;  1IFY A;  2KNV A;  1FJG M;  2XF3 A;  2CUZ A;  1NHW C;  3HWS A;  3U60 B;  1QUT A;  3SMS A;  1JB0 F;  1OIP A;  3K9P A;  1T43 A;  1NY6 A;  4JXJ A;  3WHK A;  1N36 M;  1VEJ A;  4LJ5 A;  3FUW A;  1VQ1 A;  2R45 A;  4AG5 A;  4TUW A;  2KXE A;  1IN5 A;  2Z7J A;  1JQJ C;  2V6Z M;  3I4V A;  3KSX A;  1I94 M;  4LGM A;  2ZAN A;  3KSJ A;  4REZ A;  4L8R C;  4IBC A;  3KS8 A;  1NV8 A;  3AL0 C;  4MH0 E;  3C9P A;  2QQ8 A;  3PNV A;  2KW0 A;  1L2C A;  3ZQJ A;  2N35 A;  1QDR A;  3FUT A;  5EP4 A;  3KS4 A;  5ITQ A;  5KO3 A;  1DGG A;  4JN6 A;  1DGH B;  1TH4 A;  2C96 A;  2Z4R A;  3CF2 A;  3K9O A;  2QZ4 A;  1J09 A;  2F4V M;  1E9S A;  4L6V 6;  1IY1 A;  4PDI A;  4X62 M;  4DV1 M;  3HHZ A;  4LRT A;  2LHC A;  1KSF X;  5ITY A;  3ZCB B;  4DV6 M;  1VEK A;  2UUC M;  4WP2 A;  2F5O A;  2MH8 A;  1QAO A;  2BJW A;  2BWB A;  4LRS A;  4KHP M;  2O25 A;  2Z3X A;  4I5S A;  3SAS A;  5KPZ A;  3VK7 A;  4D82 A;  1Q3C A;  4BBA A;  1DGF A;  2QCU A;  4M0W A;  3T1H M;  2HCB A;  1D0L A;  3LCU A;  2L2D A;  4M9Z A;  4DV3 M;  3KOY E;  4NRV A;  2DXI A;  5BPV A;  1OTR A;  3FYD A;  3H4M A;  2ZTD A;  3LQR A;  4FCW A;  3KXE C;  2XZF A;  1WJ7 A;  3SHG B;  2KRU A;  2YNM D;  3GPY A;  3KDS E;  2XLJ A;  1N77 A;  2BJV A;  1IXR C;  2C9O A;  4LFA M;  4JI5 M;  4L16 A;  2R62 A;  2UXD M;  1IN4 A;  3VKH A;  2EJS A;  2O5R A;  3HJQ A;  4IBG A;  1J5E M;  2EO2 A;  1YE9 A;  1V34 A;  3TWM A;  4AG6 A;  1ZQ9 A;  1EE8 A;  3L29 A;  2Y0Q A;  3I04 M;  2WSC F;  4JI3 M;  1ZMU A;  3GQ4 A;  2XFT A;  3GLF B;  4LCB A;  3B89 A;  3UZU A;  4MM3 B;  5F3W A;  1VG5 A;  4B7H A;  2B3T A;  1AUA A;  3QYE A;  4CIS A;  4CIZ A;  3T15 A;  2QNJ A;  2CHQ A;  2LNH C;  1XC8 A;  4JI0 M;  2QEN A;  4M9S A;  1V33 A;  4M0D A;  1R2Y A;  1DV0 A;  1H6U A;  2FFJ A;  2G8L A;  4LFB M;  3THG A;  4XGI A;  2L4E A;  3FD9 A;  3R8F A;  1Y8G A;  1Z5B A;  1PJT A;  1BVS A;  2OPF A;  3HHX A;  3HX3 A;  1VDL A;  2X49 A;  4LJA A;  4ITQ A;  4DV7 M;  5IWA M;  2R0I A;  3GRR A;  3NWL A;  4LJ6 A;  5KPT A;  5E6J A;  2YR0 A;  4JI4 M;  3GQ5 A;  4NXN M;  4G4R A;  1TDZ A;  1RU3 A;  1IXS B;  5ITU A;  2RGO A;  3KP1 E;  1XNR M;  4AKG A;  5ITX E;  2APL A;  4RKU F;  2ZM6 M;  4LFC M;  2LVN C;  2E5L M;  4PT5 A;  2JA2 A;  3J7A S;  1PJS A;  1AIP C;  4FWG A;  2WZJ A;  1E9R A;  3M7G A;  4FW9 A;  4MGK E;  2Y21 A;  1K82 A;  2ZBK B;  4KO8 A;  4DR4 M;  1Z6T A;  1CUK A;  3V76 A;  3WHL A;  2LVP C;  2XEP A;  2V1U A;  2P5T A;  1IM2 A;  2XSZ A;  2VQE M;  1GKI A;  2J7N A;  3M0E A;  1L2B A;  1KYI A;  5DYI A;  4GEW A;  2UU9 M;  1R2Z A;  1GAB A;  4LG2 A;  4DR6 M;  3HU3 A;  2D7G A;  3Q8X A;  3GPU A;  1ZMW A;  3B7Z A;  4Z8X A;  4LF8 M;  3TE6 A;  2GQF A;  1PJI A;  2VF8 A;  4MGZ E;  2L09 A;  1PRB A;  1GL6 A;  3K92 A;  1VEG A;  1WXQ A;  4OVZ A;  2DAI A;  1WR1 B;  2KEB A;  2ZAM A;  4WUR A;  4LF6 M;  3KFU G;  1NO1 A;  1XXH A;  5EXP A;  2MR9 A;  3U5Z A;  2C5R A;  2F5Q A;  1N32 M;  1HQC A;  3SMP A;  4LF9 M;  3I01 M;  1MJG M;  4IIW A;  4QHS A;  5DNY A;  1IY0 A;  2A5Y B;  1SXJ D;  2HHH M;  4W5W A;  4WW0 A;  5E26 A;  3EIH A;  3SYL A;  1IN6 A;  4MGY E;  3B7Q A;  2VII A;  1R6B X;  3MJ5 A; 
#chains in the Genus database with same CATH homology
 3GRU A;  1QAQ A;  4FCT A;  1SXJ C;  1SXJ A;  1TDH A;  5C1B A;  2DZN B;  2UUA M;  4RNA A;  4FVM A;  4OX9 M;  3SHF A;  3SC3 A;  1DO2 A;  1VDD A;  3U6O A;  3K1J A;  3IG5 A;  5KQ8 A;  3IG8 A;  1N34 M;  4B08 A;  2C9C A;  3PVS A;  2DWZ B;  3CF0 A;  3KOW E;  3FTE A;  3PFI A;  2Z4S A;  3I4Y A;  2DWM A;  2F5N A;  3A98 B;  2DHR A;  3TQS A;  3GLH B;  1L1Z A;  3KOZ E;  5LMU M;  4QOZ C;  1N78 A;  4X64 M;  3FUX A;  1YSY A;  4S12 A;  4IBB A;  3K2L A;  4ZPX A;  3UK6 A;  4IBJ A;  4B3S M;  1IBM M;  4JV5 M;  2DZO B;  3HKP A;  2CV0 A;  3JAM S;  4PDG A;  4NL4 H;  1IBL M;  5BR8 M;  1L8Q A;  1ORY B;  2R4J A;  5IRE B;  3W0L B;  5H37 D;  4DUZ M;  3GPX A;  3VKG A;  1NJF A;  4B3T M;  3OTO M;  5EP2 A;  4LZJ A;  2X4A A;  4QHT A;  3U61 B;  1OJL A;  5ITR A;  5EXX A;  1UM8 A;  5FTM A;  1G4A E;  1NSF A;  4NSO B;  2YQZ A;  3DZD A;  1QZM A;  2M60 A;  4AZF A;  2UUB M;  3RFW A;  4LF7 M;  2QP9 X;  1Q3B A;  4IJE A;  3HJ8 A;  3MHV C;  1R7R A;  3U60 A;  3A46 A;  4JI1 M;  1I4W A;  3GQ3 A;  3U6P A;  1Z5C A;  2R65 A;  3AV0 A;  3GPP A;  1MU5 A;  4XBO A;  4NXM M;  2L7H A;  2CEA A;  2D7E A;  4IBE A;  4IJF A;  3SAW A;  1HNZ M;  2YFQ A;  3NBI A;  4GH9 A;  1K3X A;  1S3S A;  2CE7 A;  1G41 A;  2Q2E B;  2R4E A;  4OW0 A;  3ZC7 B;  4X65 M;  4BB9 A;  4B3M M;  3R9X B;  4AI6 A;  4GRI A;  1TGU A;  3HJS A;  5JI3 E;  2H1R A;  3HU1 A;  1KFV A;  3J81 S;  3RGS A;  1L2D A;  3DOA A;  3FTF A;  1OFI A;  1PJJ A;  1GLN A;  1DGH A;  1SXJ B;  4RF0 A;  2BNK A;  5EP1 A;  3T1Y M;  4LJ9 A;  4DV2 M;  3FYC A;  4FCV A;  3L26 A;  4GKK M;  4GIP A;  3QAU A;  1D2N A;  3DFZ A;  4HLQ A;  2KZS A;  4JYA M;  3L28 A;  1PM5 A;  1IXZ A;  1XNQ M;  1N75 A;  3AOG A;  4IBI A;  4OU7 A;  2LWX A;  4D81 A;  2XSZ D;  3LVV A;  3KOX E;  4PD2 A;  4QNR A;  4MGI E;  4YHH M;  1Q39 A;  5A2Q S;  3B9P A;  7CAT A;  2F5P A;  4GHA A;  3UGJ A;  4AKI A;  3J2P B;  1DO0 A;  2CHG A;  1E32 A;  3KVW A;  3A45 A;  5GKN A;  2QPA A;  3HHY A;  4LF5 M;  4DV5 M;  1TH3 A;  2DVW B;  3SBJ A;  2XH9 A;  3PXG A;  5KQD A;  3PNY A;  2OQ4 A;  2QBY A;  3U6S A;  1C1K A;  1NHG C;  5EQT A;  3L25 A;  1G59 A;  4HL4 A;  1L1T A;  3EIE A;  2LH0 A;  4K0K M;  3FTC A;  3W0F A;  5ITX A;  5EXS A;  1XMQ M;  3MK6 A;  3AKZ A;  3A42 A;  3GLF A;  3U6M A;  2I7N A;  2X8A A;  3AOE C;  2KA6 B;  3AOE A;  4DR3 M;  3E4R A;  4I4L A;  3U6L A;  2F5S A;  1IQP A;  3ILK A;  1QVR A;  3JR4 A;  2C98 A;  4Z6Y A;  4CHT B;  3U6E A;  4DR2 M;  3GRV A;  1IN7 A;  2R46 A;  1E94 E;  5FTJ A;  2NQ8 C;  5C18 A;  5EJC A;  4LZZ A;  4JI8 M;  4LJ4 A;  2KRK A;  2RKO A;  1XMO M;  1NNU C;  3D8B A;  3FTD A;  5JI2 E;  3TL4 X;  4CGY B;  2XZU A;  4JI2 M;  5LMN M;  3E9S A;  1TH2 A;  3QWL A;  3HU2 A;  1QYR A;  4YY3 M;  4GMQ A;  1GVN A;  4M9X A;  4R3D A;  4MGH A;  1NY5 A;  4QOS A;  4NOO B;  2VQF M;  4GKJ M;  3SAR A;  2M5Z A;  3RGP A;  2I7P A;  4I81 A;  4R7G A;  4GIT A;  5FSW A;  4NRW A;  2HL7 A;  1G8P A;  3J27 B;  3KW6 A;  4AKH A;  4II7 A;  2Y0T A;  4DR5 M;  4IBF A;  4QNM A;  3GLI A;  4MB7 A;  5EXT A;  2EA0 A;  4DR1 M;  4GC5 A;  3ZH9 B;  8CAT A;  2L6O A;  3M6A A;  3AFH A;  2FOI C;  3SAV A;  1IBK M;  1Z5A A;  1QQW A;  1T3T A;  3J7B A;  1FNN A;  1W5T A;  3VDP A;  1IN8 A;  3U6C A;  1NJG A;  4FD2 A;  3SFZ A;  3L27 A;  3VK8 A;  2KZU A;  5KPR A;  3K8Z A;  3AJI B;  3T38 A;  4LF4 M;  2QBY B;  2CFO A;  2UXB M;  3LQQ A;  2UXC M;  5DYG A;  4RF1 A;  4G4Q A;  4DUY M;  4GHL A;  4GC9 A;  4OVZ B;  4IBK A;  2HKJ A;  1G3I A;  4L15 A;  1XXH B;  3FKE A;  3TWK A;  1DGB A;  5ITT A;  3U5Z B;  4L4U A;  1XWI A;  4BLC A;  4LY6 A;  3FUU A;  1Z59 A;  3SAT A;  4IBD A;  1W5S A;  1OFH A;  2XFS A;  5IT9 S;  2XGN A;  2RGH A;  3CF6 E;  3GLG B;  1QAN A;  1JR3 D;  3KP0 E;  3CTW B;  4KOD A;  3VLF B;  4G4O A;  4JI7 M;  4PCZ A;  3J80 S;  3TWL A;  4B7F A;  3U6D A;  4AW4 A;  2Y20 A;  2ZAO A;  2FE8 A;  4FWH A;  3SYK A;  2F5O A;  4LJ7 A;  1NVM A;  2LXE A;  5IZ7 D;  1HR0 M;  1HT1 E;  1X37 A;  1JR3 A;  4EIW A;  4G6Z A;  4A3V B;  3C58 A;  3TPZ A;  1N33 M;  3FUV A;  3GLH A;  1K3W A;  5FLX S;  2W82 A;  3VDU A;  3GP1 A;  1QAM A;  1NNJ A;  5FTN A;  1HQY E;  3DA1 A;  4LJ8 A;  5EP3 A;  2C99 A;  3HGI A;  2EUC A;  1LV7 A;  4FWD A;  4LGY A;  2CV2 A;  4DR7 M;  3UJN A;  1MX0 A;  2CHV A;  4NSR A;  3I51 A;  2L7I A;  2K47 A;  3LVW A;  3HHW A;  4AQY M;  3U61 A;  1HNX M;  3SAU A;  4B3R M;  3GLI B;  3L2A A;  1SXJ E;  3VFD A;  2CV1 A;  1YUB A;  3LMM A;  4G4N A;  2G5G X;  4L78 A;  3GRY A;  4I8O A;  1GL7 A;  4KLN A;  1HT2 E;  3D8L A;  1XHB A;  4B7G A;  2D7H A;  3RE8 A;  1ZAE A;  3U6Q A;  2DWN A;  2FNA A;  1J7K A;  5FTK A;  4JI6 M;  5FTL A;  4P16 A;  2V1C A;  1IY2 A;  1HNW M;  3GO8 A;  2J7O A;  4DV0 M;  4X66 M;  2AHM A;  4DV4 M;  3BOS A;  3UMM A;  4D80 A;  3JR5 A;  3GLG A;  2ERC A;  2R18 A;  1FJG M;  2XF3 A;  2CUZ A;  1NHW C;  3HWS A;  3U60 B;  3SMS A;  1NY6 A;  4JXJ A;  3WHK A;  1N36 M;  4LJ5 A;  3FUW A;  2R45 A;  4AG5 A;  4TUW A;  2Z7J A;  1IN5 A;  2KXE A;  2V6Z M;  1JQJ C;  3I4V A;  3KSX A;  1I94 M;  4LGM A;  2ZAN A;  3KSJ A;  4REZ A;  4L8R C;  4IBC A;  3KS8 A;  3AL0 C;  4MH0 E;  3PNV A;  2KW0 A;  1L2C A;  5EP4 A;  3FUT A;  5ITQ A;  5KO3 A;  3KS4 A;  1DGG A;  4JN6 A;  1DGH B;  1TH4 A;  2C96 A;  2Z4R A;  3CF2 A;  2QZ4 A;  1J09 A;  2F4V M;  1E9S A;  4PDI A;  1IY1 A;  4X62 M;  4DV1 M;  3HHZ A;  4LRT A;  1KSF X;  5ITY A;  3ZCB B;  4DV6 M;  2UUC M;  4LRS A;  1QAO A;  2BJW A;  4KHP M;  2Z3X A;  4I5S A;  3SAS A;  5KPZ A;  3VK7 A;  4D82 A;  1Q3C A;  4BBA A;  1DGF A;  2QCU A;  4M0W A;  3T1H M;  2HCB A;  4M9Z A;  4DV3 M;  3KOY E;  4NRV A;  2DXI A;  5BPV A;  3FYD A;  3H4M A;  3LQR A;  2XZF A;  4FCW A;  3KXE C;  3SHG B;  2KRU A;  2YNM D;  3GPY A;  3KDS E;  2XLJ A;  1N77 A;  2BJV A;  1IXR C;  2C9O A;  4LFA M;  4JI5 M;  4L16 A;  2R62 A;  2UXD M;  1IN4 A;  3VKH A;  2O5R A;  3HJQ A;  4IBG A;  1J5E M;  2EO2 A;  1YE9 A;  3TWM A;  4AG6 A;  1ZQ9 A;  1EE8 A;  3L29 A;  2Y0Q A;  4JI3 M;  3GQ4 A;  3GLF B;  2DWL A;  2XFT A;  4LCB A;  3UZU A;  4MM3 B;  5F3W A;  4B7H A;  4CIS A;  3T15 A;  2CHQ A;  2LNH C;  1XC8 A;  4JI0 M;  2QEN A;  4M9S A;  4M0D A;  1R2Y A;  1H6U A;  2FFJ A;  2G8L A;  4LFB M;  3THG A;  4XGI A;  3FD9 A;  3R8F A;  1Z5B A;  2OPF A;  3HHX A;  2X49 A;  4LJA A;  4ITQ A;  4DV7 M;  5IWA M;  3GRR A;  3NWL A;  4LJ6 A;  5KPT A;  5E6J A;  2YR0 A;  4JI4 M;  3GQ5 A;  4NXN M;  4G4R A;  1TDZ A;  1IXS B;  5ITU A;  2RGO A;  3KP1 E;  1XNR M;  4AKG A;  5ITX E;  2ZM6 M;  4LFC M;  2E5L M;  4PT5 A;  2JA2 A;  3J7A S;  4FWG A;  1E9R A;  3M7G A;  4FW9 A;  4MGK E;  2Y21 A;  1K82 A;  2ZBK B;  4KO8 A;  4DR4 M;  1Z6T A;  3WHL A;  2XEP A;  2V1U A;  2XSZ A;  1IM2 A;  2P5T A;  2VQE M;  1GKI A;  2J7N A;  3M0E A;  1L2B A;  1KYI A;  5DYI A;  2UU9 M;  1R2Z A;  4LG2 A;  4DR6 M;  3HU3 A;  2D7G A;  3Q8X A;  3GPU A;  4Z8X A;  4LF8 M;  3TE6 A;  1PJI A;  4MGZ E;  2L09 A;  1GL6 A;  3K92 A;  1WXQ A;  4OVZ A;  2KEB A;  2ZAM A;  4WUR A;  4LF6 M;  3KFU G;  1XXH A;  5EXP A;  3U5Z A;  2C5R A;  2F5Q A;  1N32 M;  1HQC A;  3SMP A;  4LF9 M;  4IIW A;  4QHS A;  5DNY A;  1IY0 A;  2A5Y B;  1SXJ D;  2HHH M;  4W5W A;  4WW0 A;  5E26 A;  3EIH A;  3SYL A;  1IN6 A;  4MGY E;  2VII A;  1R6B X;  3MJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...