4GKJM

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aug-codon in the a-site and paromomycin.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Expanded use of sense codons is regulated by modified cytidines in tRNA.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4gkjM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4gkjM02
3C58A 1MU5A 1L1TA 3SAVA 4LF6M 5BR8M 2F5QA 5ITYA 4DV6M 4PDIA 4GKKM 1N34M 3U6MA 4X65M 1TDHA 3J81S 4X66M 4GKJM 4B3MM 4DR2M 3GPXA 2EA0A 4G4RA 2OQ4A 3VK7A 1IBMM 2E5LM 5LMUM 3SARA 1EE8A 4JI2M 4LF8M 4G4NA 4LFAM 4NXMM 3TWLA 3U6SA 1K3WA 4JI7M 2UXDM 5IT9S 1FJGM 1L2CA 4LFCM 4JI0M 3GP1A 4JYAM 1Z5CA 4LFBM 3J7AS 2VQEM 1N33M 4YHHM 3JR4A 3U6PA 1L2DA 4DUYM 3J80S 1R2ZA 1HNWM 2UUBM 2ZBKB 4DV2M 1HNZM 1I94M 1HNXM 4AQYM 2F5SA 4PD2A 4LF9M 1KFVA 1J5EM 1XC8A 4LF5M 4G4OA 1N32M 4NRWA 1Z5BA 4JV5M 2ZM6M 4JI6M 4DR6M 3U6CA 2UXCM 1L2BA 4PCZA 4YY3M 4B3TM 1XNQM 1PJIA 1R2YA 1K82A 3W0FA 4ITQA 1Q39A 5IWAM 5ITXE 3U6EA 3U6DA 3GQ3A 5A2QS 1NNJA 4CISA 4X64M 4JI8M 3SAUA 2F4VM 2VQFM 4NRVA 3T1YM 4B3RM 2OPFA 3SAWA 4JI1M 1XMQM 3OTOM 1XNRM 4DR4M 4DV1M 1MX0A 5ITRA 1PJJA 3JAMS 4K0KM 4DR5M 1IBLM 4G4QA 4X62M 3SBJA 4OX9M 2Q2EB 4DUZM 2UXBM 4MB7A 1N36M 4JI3M 4KHPM 4PDGA 3GPYA 3U6OA 4DV5M 3SATA 3TWKA 2XZUA 4JI4M 3DOAA 1Q3BA 4B3SM 1Q3CA 2F5NA 3T1HM 1HR0M 3A45A 4DR1M 2F5OA 2UUAM 3SASA 1TDZA 4DR7M 3JR5A 2XZFA 3A46A 3A42A 3GQ4A 1PM5A 3U6LA 1Z5AA 1Z59A 3U6QA 1IBKM 5LMNM 4DV3M 4DV7M 1K3XA 4LF4M 1XMOM 4NXNM 5ITUA 4JI5M 2F5PA 5FLXS 3GO8A 3VK8A 5ITTA 4LF7M 4DV4M 2HKJA 3TWMA 5ITQA 2UUCM 4DV0M 2HHHM 2UU9M 1L1ZA 3GQ5A 3GPUA 3GPPA 5ITXA 4DR3M
chains in the Genus database with same CATH superfamily
1ZQ9A 2DENA 4LY6A 1MU5A 3C9PA 1J7KA 2JY6B 2DWLA 1DGHA 1ZAEA 2Z4SA 1IM2A 2M60A 1TDHA 2L2DA 3HKPA 3FE3A 1ZV1A 4BB9A 2XSZA 4G4RA 4L16A 3KFUG 3F92A 2C96A 5KPTA 1IBMM 3T15A 5LMUM 4WURA 3B89A 4QOZC 1EE8A 2LVOC 4JI2M 3KSJA 4G4NA 2DWZB 4NXMM 2DXIA 4L8RC 5IT9S 2JY7A 3BOSA 2QP9X 2V1UA 3SYKA 4NL4H 3GP1A 2WSFF 4FCWA 2R45A 2ERCA 2OO9A 3FUXA 2QQ8A 4LFBM 4FW9A 3J7AS 1GJSA 2BJVA 1GO5A 1IN4A 1ORYB 1PGYA 2L4EA 4YHHM 1TGUA 3MJ5A 3U6PA 4DUYM 3M7GA 1XXHE 5EP1A 1TR8A 2ZBKB 4A3VB 2R4JA 2DZOB 1HNXM 4GRIA 3SYLA 2MR9A 2QBYB 4IBBA 3J2PB 1OAOC 4XGIA 2F5SA 4LF9M 4FVMA 4LJ8A 4MGZE 2LHGA 2DAIA 1TF0B 4XK8F 3VKHA 1S3SA 2CHVA 4QHSA 1Z5BA 4CHTB 3FTFA 2GQFA 5C18A 2BWBA 2R4EA 5F3WA 2X4AA 4JI6M 1N75A 4YY3M 1D0KA 3C3EA 4GIPA 1R2YA 1Q39A 4Q7JA 3GQ3A 5A2QS 1GJTA 1NNJA 4CISA 4HL4A 4AW4A 1XWIA 4JI8M 2F4VM 4AKHA 4R71A 1P3QQ 2BWEA 3K8ZA 3OTOM 1G59A 1E32A 4CJ6A 4DV1M 3B74A 3JAMS 4F1IA 1UM8A 4DR5M 1IBLM 1JR3E 2JXNA 2Z3XA 1QYRA 4X62M 3SBJA 2JY8A 4P16A 3K2LA 2Q2EB 4P17A 1IQPA 2ZTCA 2KNZA 4GC9A 1N36M 4KO8A 4G3OA 1D2NA 1R7RA 4DV5M 3U6OA 3TWKA 4RF0A 3IHPA 5KPZA 4B7GA 1XB2B 2HCBA 2DAGA 4IBEA 1Q3CA 1WJ7A 1HR0M 5EP4A 2KDLA 2LH0A 4FD2A 1QZMA 3SASA 1VDDA 1TDZA 1FNNA 4AKIA 3A46A 2CRUA 1VQ1A 1NV9A 1DO2A 3U6LA 4MH0E 3U6QA 4M0WA 2ZANA 1IBKM 2MH8A 4OVZB 2DI0A 1MJGM 1K3XA 2YNMD 4L15A 2BNKA 4MM3B 4ANRA 3B7QA 2R65A 2DZLA 2QNJA 2CHGA 4JI5M 2DAKA 3HHWA 2L7IA 4S12A 3WHLA 5DNYA 3L29A 3TWMA 4GHLA 3J7BA 5DYIA 2KNVA 1PJQA 2O5RA 2Z7JA 2L09A 4BBAA 3LW5F 4OVZA 2L7HA 3U5ZB 3GLFE 4FWHA 3GQ5A 5KO3A 4CIZA 3EIHA 3KOWE 3GPUA 4AKGA 2ZAOA 3PNYA 1PJSA 1QDRA 3PFIA 3DFZA 1OIZA 2EJSA 1QAMA 5ITXA 2H1RA 1GLNA 2N35A 3GPPA 1IXRC 3GRVA 3M6AA 1L1TA 3SAVA 1OIPA 1W5SA 2WSEF 3LVVA 5ITYA 1F4IA 3GLFB 2KXEA 2QCUA 3U5ZA 5C1BA 3QWLA 2DVWB 3HY5A 3KDSE 4LGYA 1IY2A 3RGPA 3E9SA 3GLHB 4DR2M 5L8RF 4GMQA 4II7A 5FSWA 2LXEA 3L27A 2X8AA 3HJ8A 3L28A 1E94E 1WXQA 3MK6A 5E26A 3W0LB 3ZH9B 2VF8A 2OQ4A 1D0LA 2EUCA 5E6JA 4Z6YA 2FOIC 2DHRA 4GH9A 3SMSA 2R6FA 2XF3A 3HHZA 2VIIA 1OFHA 1T6OA 4FWGA 3TWLA 1R6BX 3K92A 4IBKA 1OAIA 3U6SA 3SMPA 2WZJA 3GLHA 1FJGM 1WIVA 1NO1A 4LGMA 4FWDA 3QYBA 3C3DA 3K9PA 2V6ZM 1HJPA 4I4LA 4JYAM 1TH2A 2JP7A 2VQEM 1VEKA 1N33M 4NSOB 4L78A 3GLIE 1L2DA 1E9RA 3W67A 1OTRA 2JNHA 2Y21A 2O25A 2V1CA 2UUBM 2JZ0A 3VFDA 1HNZM 5DFLA 3VKGA 2KRKA 2YQZA 2HAKA 1NHGC 3I4YA 1JQJC 1RU3A 2KHHA 1VEGA 2RGHA 3Q8XA 3QAUA 4KLNA 1VDLA 3SC3A 2Z8YM 2KW0A 4PT5A 1DGFA 1NSFA 4Z8XA 1NY6A 3KS8A 4G4OA 2CV0A 5EXSA 4NRWA 4JV5M 4OW0A 5EJCA 2MJ5B 2P5TA 4DR6M 2O01F 2UXCM 1XNQM 2XEPA 3FRHA 3FD9A 3J27B 4ITQA 3H4JA 3GLGE 1NVMA 2BJWA 3U6DA 4LCBA 4MGIE 4B7HA 2CV1A 4KT0F 1IXSB 2GNOA 2G3QA 2VQFM 3T1YM 2OPFA 2DHYA 4WW0A 5FTLA 4IJEA 3GLGB 5ITRA 2JA2A 1PJJA 4BLCA 4G4QA 4L4UA 2CP8A 2XFSA 4OX9M 3B7NA 4NSRA 4MB7A 3ZQJA 4JI3M 3SFZA 1DGBA 4WP2A 4PDGA 2EO2A 3QYEA 4LJ5A 2VDBB 2FFJA 3SATA 3SHGB 3KW6A 4IBCA 1XXHB 1SXJE 2K0BX 1LTMA 1ZMVA 2NQ8C 2RRUA 1WGLA 1NJFA 2F5NA 3T1HM 1ZMUA 3L25A 3E46A 1BVSA 2UUAM 4IBIA 3FRIA 3FYCA 4DR7M 1HT2E 2QBYA 4HLQA 3DA1A 1PM5A 1Z5AA 1Z59A 1SXJB 3FTEA 1XXHA 5IREB 4DV3M 2D7EA 4DV7M 1C7YA 4NXNM 5ITUA 2J7NA 5KPRA 2F5PA 4LF7M 4R3DA 1E9SA 1YLAA 3K1JA 2I7NA 1IXZA 1G3IA 1YSYA 3E21A 2R62A 4D80A 2FNAA 2D7HA 3IG8A 3RE8A 1L1ZA 2LWXA 3TPZA 2HL7A 2FS1A 2K9DA 3U60B 3HU1A 1GABA 1Z6TA 1JR3D 4KODA 1N78A 2LHCA 2OOBA 3TL4X 4LJ9A 1W5TA 2C9CA 3B9PA 3UZUA 1NY5A 1QQWA 3C58A 3I51A 4OU7A 1G71A 5BR8M 4DV6M 4LF6M 1DGGA 3U61B 3U6MA 3M0EA 4LJ7A 3T38A 3UK6A 3U60A 3HX3A 3J81S 3KSXA 3UJNA 4GKJM 3HU3A 4B3MM 1JR3A 1HQCA 2QHOB 4QOSA 1PRBA 4I5SA 1CUKA 3I4VA 2E5LM 1TH3A 2DKLA 2FE8A 1QVRA 1OKSA 4CGYB 4LFAM 4AZFA 4F2LA 3AFHA 3AJIB 1IN7A 1GL6A 3LCVB 4RKUF 1K3WA 2UXDM 4B7FA 4NOOB 4LFCM 1G4AE 2Y0QA 3VDPA 1Z5CA 2H5XA 1TH4A 3HWSA 4M9XA 3I04M 2R46A 1YUBA 2CFOA 4TUWA 1IFYA 5EXPA 1R2ZA 1TTEA 3H4MA 1HNWM 1XHBA 2X49A 4DV2M 4IJFA 3GRYA 3NWLA 1I94M 3CF0A 3VDUA 1WHCA 4PD2A 3UMMA 2I7PA 3E4RA 3HJQA 4REZA 2VF7A 3GLFA 1J5EM 3D8BA 4RNAA 1N32M 4AG6A 1PJTA 2DAEA 1EFUB 1KSFX 1OFIA 3KVWA 4JN6A 4FCVA 1WR1B 1L2BA 4MGKE 2DWMA 2HWJA 1OJLA 1R4GA 2C9OA 1PJIA 2AHMA 1K82A 5IWAM 5BPVA 1T3TA 3IECA 4X64M 3Q8GA 3I01M 2DNAA 1QAQA 3FUUA 1G41A 3AV0A 1XMQM 2D7GA 1IY1A 1XNRM 2ZTDA 1ZMWA 2YR0A 1IN6A 4IBFA 4ZPXA 4RF1A 2C99A 4M9ZA 4K0KM 2J7OA 2CUZA 1R5LA 4L6V6 3LQRA 4FCTA 5JI3E 5EXTA 4DUZM 2UXBM 2KNAA 2XH9A 4Y28F 3L2AA 3GLIB 4LZJA 3ILKA 2LBCA 1MN3A 3TE6A 1J09A 2XZUA 4GC5A 4JI4M 4AI6A 3DOAA 1QAOA 3UGJA 1Q3BA 3FUWA 2K6BA 2CHQA 2QPAA 1GVNA 4JXJA 2F5OA 2KEBA 1DV0A 3TQSA 2LVQD 8CATA 3NBXX 3JR5A 2A5YB 3GLIA 2DWNA 4HEOA 3CF2A 4GEWA 5EP2A 1I4WA 1QDTA 2DAMA 3IG5A 3FKEA 2Y0TA 2JZ1A 5EQTA 4LF4M 3KP0E 3PNVA 2LVNC 2MGWA 5FLXS 1VEJA 3HHXA 2L6OA 3AOGA 5ITTA 5KQ8A 3GO8A 2OOAA 3VK8A 1QANA 5ITQA 2G5GX 1IXSA 4D82A 4DV0M 4QNRA 2XFTA 2UU9M 1IN8A 1IN5A 1G8PA 2LVAA 3MMPA 3HU2A 1UFZA 3LCUA 3GLGA 3HZJA 2CWBA 4DR3M 3A98B 2MROB 1GL7A 2F5QA 4PDIA 4GKKM 1N34M 1LV7A 4W5WA 3WHKA 3R8FA 1SXJD 1AUAA 3AKZA 1A5TA 3ZCBB 4X65M 4X66M 2KA6B 3GPXA 1V34A 3HHYA 2XLJA 2KZUA 5FTNA 2R18A 2EA0A 4AG5A 4LJAA 4M0DA 1X37A 3KOZE 3VK7A 5FTMA 4LRSA 2LNHC 3SARA 1C1KA 1HQYE 4LF8M 2Z4RA 1SXJA 2G8LA 4IBJA 5EP3A 3FUTA 4JI7M 2RKOA 2JUJA 3KP1E 4I81A 1L2CA 1IY0A 2KRUA 4JI0M 4QNMA 1EIJA 2LTUA 4LJ4A 3LMMA 4EIWA 1GKIA 3JR4A 5H37D 5JI2E 4G6ZA 3J80S 2ZAMA 1QZEA 2DZNB 3AOEA 3LQQA 3LVWA 7CATA 1Y8GA 4LZZA 3B7ZA 1AIPC 4LRTA 5KQDA 3CGWA 2CE7A 2B3TA 1JB0F 3FYDA 4AQYM 1NV8A 3T6PA 5FTKA 3V76A 1KFVA 1V33A 3U61A 3GRUA 1T43A 1XC8A 4LF5M 2K47A 1KYIA 3PXGA 2CEAA 2ZM6M 5DYGA 3MHVC 4QHTA 3ZC7B 3U6CA 4PCZA 3GRRA 4B3TM 3VLFB 3BXWA 4B08A 2R0IA 3W0FA 4IBGA 5ITXE 1N77A 4MGHA 4M9SA 3U6EA 3CF6E 3KOXE 3AL0C 4MGYE 3SAUA 1D0MA 3CTWB 3RGSA 2CV2A 1VG5A 5FTJA 4IBDA 4NRVA 4B3RM 3SAWA 4JI1M 2Y20A 2QZ4A 2C5RA 1NJGA 4DR4M 3SHFA 1MX0A 2FH0A 3FTCA 4I8OA 2KZSA 1SG9A 5EXXA 2XGNA 4NC6A 4UN2B 1SXJC 4KHPM 2W82A 3GPYA 2WSCF 1V92A 3KS4A 2R44A 2YFQA 3THGA 1Q02A 4R7GA 3K9OA 3BBZA 4B3SM 3GLHE 1OQYA 3A45A 4DR1M 3KXEC 3HJSA 3W68A 2APLA 4IIWA 3RFWA 3FTDA 3DZDA 2JY5A 2XZFA 4GHAA 2EKKA 3A42A 3FUVA 3KOYE 3NBIA 1H6UA 4D81A 3GQ4A 3R9XB 3AOEC 1WGNA 3PVSA 5LMNM 2C98A 2M5ZA 5IZ7D 1DO0A 1XMOM 2LVPC 3D8LA 4LJ6A 4DBGB 2L4FA 5GKNA 3L26A 4DV4M 4LG2A 1L8QA 2HKJA 4GITA 2JWSA 1NHWC 1YE9A 2QSFX 1QUTA 2UUCM 2HHHM 2RGOA 1DGHB 2EKFA 2J5YA 1QUSA 2QENA 3EIEA 1NNUC 1HT1E 4XBOA 2XSZD 3HGIA
chains in the Genus database with same CATH topology
1ZQ9A 4LY6A 1MU5A 1J7KA 2DWLA 1DGHA 1ZAEA 2Z4SA 1IM2A 2M60A 1TDHA 3HKPA 4BB9A 2XSZA 4G4RA 4L16A 3KFUG 2C96A 5KPTA 1IBMM 3T15A 5LMUM 4WURA 4QOZC 1EE8A 4JI2M 3KSJA 4G4NA 2DWZB 4NXMM 2DXIA 4L8RC 5IT9S 3BOSA 2QP9X 2V1UA 3SYKA 4NL4H 3GP1A 4FCWA 2R45A 2ERCA 3FUXA 4LFBM 4FW9A 3J7AS 2BJVA 1IN4A 1ORYB 4YHHM 1TGUA 3MJ5A 3U6PA 4DUYM 3M7GA 5EP1A 2ZBKB 4A3VB 2R4JA 2DZOB 1HNXM 4GRIA 3SYLA 2QBYB 4IBBA 3J2PB 4XGIA 2F5SA 4LF9M 4FVMA 4LJ8A 4MGZE 3VKHA 1S3SA 2CHVA 4QHSA 1Z5BA 4CHTB 3FTFA 5C18A 2R4EA 5F3WA 4JI6M 2X4AA 1N75A 4YY3M 1R2YA 4GIPA 1Q39A 3GQ3A 5A2QS 1NNJA 4CISA 4HL4A 4AW4A 1XWIA 4JI8M 2F4VM 4AKHA 3K8ZA 3OTOM 1G59A 1E32A 4DV1M 3JAMS 1UM8A 4DR5M 1IBLM 2Z3XA 1QYRA 4X62M 3SBJA 4P16A 3K2LA 2Q2EB 1IQPA 4GC9A 1N36M 4KO8A 1D2NA 1R7RA 4DV5M 3U6OA 3TWKA 4RF0A 5KPZA 4B7GA 2HCBA 4IBEA 1Q3CA 1HR0M 5EP4A 2LH0A 4FD2A 1QZMA 3SASA 1VDDA 1TDZA 1FNNA 4AKIA 3A46A 1DO2A 3U6LA 4MH0E 3U6QA 4M0WA 2ZANA 1IBKM 4OVZB 1K3XA 2YNMD 4L15A 2BNKA 4MM3B 4JI5M 2R65A 2CHGA 3HHWA 2L7IA 4S12A 3WHLA 5DNYA 3L29A 3TWMA 4GHLA 3J7BA 5DYIA 2O5RA 2Z7JA 2L09A 4BBAA 4OVZA 2L7HA 3U5ZB 4FWHA 3GQ5A 5KO3A 3EIHA 3KOWE 3GPUA 4AKGA 2ZAOA 3PNYA 3PFIA 3DFZA 5ITXA 3GPPA 1QAMA 2H1RA 1GLNA 1IXRC 3GRVA 3M6AA 1L1TA 3SAVA 1W5SA 3LVVA 5ITYA 3GLFB 2KXEA 2QCUA 3U5ZA 5C1BA 3QWLA 2DVWB 3KDSE 4LGYA 1IY2A 3RGPA 3E9SA 3GLHB 4DR2M 4GMQA 4II7A 5FSWA 2LXEA 3L27A 2X8AA 3HJ8A 3L28A 1E94E 1WXQA 3MK6A 5E26A 3W0LB 3ZH9B 2OQ4A 2EUCA 5E6JA 4Z6YA 2FOIC 2DHRA 4GH9A 3SMSA 3HHZA 2XF3A 2VIIA 1OFHA 4FWGA 3TWLA 1R6BX 3K92A 4IBKA 3U6SA 3SMPA 3GLHA 1FJGM 4LGMA 4FWDA 2V6ZM 4I4LA 4JYAM 1TH2A 2VQEM 1N33M 4NSOB 4L78A 1L2DA 1E9RA 2Y21A 2V1CA 2UUBM 3VFDA 1HNZM 3VKGA 2KRKA 2YQZA 1NHGC 3I4YA 1JQJC 2RGHA 3Q8XA 3QAUA 4KLNA 3SC3A 2KW0A 4PT5A 1DGFA 1NSFA 4Z8XA 1NY6A 3KS8A 4G4OA 2CV0A 5EXSA 4NRWA 4JV5M 4OW0A 5EJCA 2P5TA 4DR6M 2UXCM 1XNQM 2XEPA 3FD9A 3J27B 4ITQA 1NVMA 2BJWA 3U6DA 4LCBA 4MGIE 4B7HA 2CV1A 1IXSB 2VQFM 3T1YM 2OPFA 4WW0A 5FTLA 4IJEA 3GLGB 5ITRA 2JA2A 1PJJA 4BLCA 4G4QA 4L4UA 2XFSA 4OX9M 4NSRA 4MB7A 4JI3M 3SFZA 1DGBA 4PDGA 2EO2A 4LJ5A 2FFJA 3SATA 3SHGB 3KW6A 4IBCA 1XXHB 1SXJE 2NQ8C 2F5NA 1NJFA 3L25A 3T1HM 2UUAM 4IBIA 3FYCA 4DR7M 1HT2E 2QBYA 4HLQA 3DA1A 1PM5A 1Z5AA 1Z59A 1SXJB 3FTEA 1XXHA 5IREB 4DV3M 2D7EA 4DV7M 4NXNM 5ITUA 2J7NA 5KPRA 2F5PA 4LF7M 4R3DA 1E9SA 3K1JA 2I7NA 1IXZA 1G3IA 1YSYA 2R62A 4D80A 2FNAA 2D7HA 3IG8A 3RE8A 1L1ZA 2LWXA 3TPZA 2HL7A 3U60B 3HU1A 1Z6TA 1JR3D 4KODA 1N78A 3TL4X 4LJ9A 1W5TA 2C9CA 3B9PA 3UZUA 1NY5A 1QQWA 3C58A 3I51A 4OU7A 5BR8M 4LF6M 4DV6M 1DGGA 3U61B 3U6MA 3M0EA 4LJ7A 3T38A 3UK6A 3U60A 3J81S 3KSXA 3UJNA 4GKJM 3HU3A 4B3MM 1JR3A 1HQCA 4QOSA 4I5SA 2E5LM 3I4VA 1TH3A 2FE8A 1QVRA 4CGYB 4LFAM 4AZFA 3AFHA 3AJIB 1IN7A 1GL6A 1K3WA 2UXDM 4B7FA 4NOOB 4LFCM 1G4AE 2Y0QA 3VDPA 1Z5CA 1TH4A 3HWSA 4M9XA 2R46A 1YUBA 2CFOA 4TUWA 5EXPA 1R2ZA 3H4MA 1HNWM 1XHBA 2X49A 4DV2M 4IJFA 3GRYA 3NWLA 1I94M 3CF0A 3VDUA 4PD2A 3UMMA 2I7PA 3E4RA 3HJQA 4REZA 3GLFA 1J5EM 1N32M 3D8BA 4RNAA 4AG6A 1KSFX 1OFIA 3KVWA 4JN6A 4FCVA 1L2BA 4MGKE 2DWMA 1OJLA 1PJIA 2C9OA 1K82A 2AHMA 5IWAM 5BPVA 1T3TA 4X64M 1QAQA 3FUUA 1G41A 3AV0A 1XMQM 2D7GA 1IY1A 1XNRM 2YR0A 4IBFA 1IN6A 4ZPXA 4RF1A 2C99A 4M9ZA 4K0KM 2J7OA 2CUZA 5JI3E 3LQRA 4FCTA 4DUZM 5EXTA 2UXBM 2XH9A 3L2AA 3GLIB 4LZJA 3ILKA 3TE6A 1J09A 2XZUA 4GC5A 4JI4M 4AI6A 3DOAA 1QAOA 3UGJA 1Q3BA 3FUWA 2CHQA 2QPAA 1GVNA 4JXJA 2F5OA 2KEBA 3TQSA 8CATA 3JR5A 2A5YB 3GLIA 2DWNA 3CF2A 5EP2A 1I4WA 3IG5A 3FKEA 2Y0TA 4LF4M 5EQTA 3KP0E 3PNVA 5FLXS 3HHXA 2L6OA 3AOGA 5ITTA 5KQ8A 3GO8A 3VK8A 1QANA 5ITQA 2G5GX 4D82A 4DV0M 4QNRA 2XFTA 2UU9M 1IN8A 1IN5A 1G8PA 3HU2A 3GLGA 4DR3M 3A98B 1GL7A 2F5QA 4PDIA 4GKKM 1N34M 1LV7A 4W5WA 3WHKA 3R8FA 1SXJD 3AKZA 4X65M 3ZCBB 4X66M 2KA6B 3GPXA 3HHYA 2XLJA 2KZUA 5FTNA 2R18A 2EA0A 4AG5A 4LJAA 4M0DA 1X37A 3KOZE 3VK7A 5FTMA 4LRSA 2LNHC 3SARA 1C1KA 1HQYE 4LF8M 2Z4RA 1SXJA 2G8LA 4IBJA 5EP3A 3FUTA 4JI7M 2RKOA 3KP1E 4I81A 1L2CA 1IY0A 2KRUA 4JI0M 4QNMA 4LJ4A 3LMMA 4EIWA 1GKIA 3JR4A 5H37D 5JI2E 4G6ZA 3J80S 2ZAMA 2DZNB 3AOEA 3LQQA 3LVWA 7CATA 4LZZA 4LRTA 5KQDA 2CE7A 3FYDA 4AQYM 5FTKA 1KFVA 3U61A 3GRUA 1XC8A 4LF5M 2K47A 1KYIA 3PXGA 2CEAA 2ZM6M 5DYGA 3MHVC 4QHTA 3ZC7B 3U6CA 4PCZA 3GRRA 4B3TM 3VLFB 4B08A 3W0FA 4IBGA 5ITXE 1N77A 4MGHA 4M9SA 3U6EA 3CF6E 3KOXE 3AL0C 4MGYE 3SAUA 3CTWB 3RGSA 2CV2A 5FTJA 4IBDA 4NRVA 4B3RM 3SAWA 4JI1M 2Y20A 2QZ4A 2C5RA 1NJGA 4DR4M 3SHFA 1MX0A 3FTCA 4I8OA 2KZSA 5EXXA 2XGNA 1SXJC 4KHPM 2W82A 3GPYA 3KS4A 2YFQA 3THGA 4R7GA 4B3SM 3A45A 4DR1M 3KXEC 3HJSA 3RFWA 4IIWA 3FTDA 3DZDA 4GHAA 2XZFA 3R9XB 3A42A 3FUVA 3KOYE 3NBIA 1H6UA 4D81A 3GQ4A 3AOEC 3PVSA 5LMNM 2C98A 2M5ZA 5IZ7D 1DO0A 1XMOM 3D8LA 4LJ6A 5GKNA 3L26A 4DV4M 4LG2A 1L8QA 2HKJA 4GITA 1NHWC 1YE9A 2UUCM 2HHHM 2RGOA 1DGHB 2QENA 3EIEA 1NNUC 1HT1E 4XBOA 2XSZD 3HGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C58 A;  1MU5 A;  1L1T A;  3SAV A;  4LF6 M;  5BR8 M;  2F5Q A;  5ITY A;  4DV6 M;  4PDI A;  4GKK M;  1N34 M;  3U6M A;  4X65 M;  1TDH A;  3J81 S;  4X66 M;  4GKJ M;  4B3M M;  4DR2 M;  3GPX A;  2EA0 A;  4G4R A;  2OQ4 A;  3VK7 A;  1IBM M;  2E5L M;  5LMU M;  3SAR A;  1EE8 A;  4JI2 M;  4LF8 M;  4G4N A;  4LFA M;  4NXM M;  3TWL A;  3U6S A;  1K3W A;  4JI7 M;  2UXD M;  5IT9 S;  1FJG M;  1L2C A;  4LFC M;  4JI0 M;  3GP1 A;  4JYA M;  1Z5C A;  4LFB M;  3J7A S;  2VQE M;  1N33 M;  4YHH M;  3JR4 A;  3U6P A;  1L2D A;  4DUY M;  3J80 S;  1R2Z A;  1HNW M;  2UUB M;  2ZBK B;  4DV2 M;  1HNZ M;  1I94 M;  1HNX M;  4AQY M;  2F5S A;  4PD2 A;  4LF9 M;  1KFV A;  1J5E M;  1XC8 A;  4LF5 M;  4G4O A;  1N32 M;  4NRW A;  1Z5B A;  4JV5 M;  2ZM6 M;  4JI6 M;  4DR6 M;  3U6C A;  2UXC M;  1L2B A;  4PCZ A;  4YY3 M;  4B3T M;  1XNQ M;  1PJI A;  1R2Y A;  1K82 A;  3W0F A;  4ITQ A;  1Q39 A;  5IWA M;  5ITX E;  3U6E A;  3U6D A;  3GQ3 A;  5A2Q S;  1NNJ A;  4CIS A;  4X64 M;  4JI8 M;  3SAU A;  2F4V M;  2VQF M;  4NRV A;  3T1Y M;  4B3R M;  2OPF A;  3SAW A;  4JI1 M;  1XMQ M;  3OTO M;  1XNR M;  4DR4 M;  4DV1 M;  1MX0 A;  5ITR A;  1PJJ A;  3JAM S;  4K0K M;  4DR5 M;  1IBL M;  4G4Q A;  4X62 M;  3SBJ A;  4OX9 M;  2Q2E B;  4DUZ M;  2UXB M;  4MB7 A;  1N36 M;  4JI3 M;  4KHP M;  4PDG A;  3GPY A;  3U6O A;  4DV5 M;  3SAT A;  3TWK A;  2XZU A;  4JI4 M;  3DOA A;  1Q3B A;  4B3S M;  1Q3C A;  2F5N A;  3T1H M;  1HR0 M;  3A45 A;  4DR1 M;  2F5O A;  2UUA M;  3SAS A;  1TDZ A;  4DR7 M;  3JR5 A;  2XZF A;  3A46 A;  3A42 A;  3GQ4 A;  1PM5 A;  3U6L A;  1Z5A A;  1Z59 A;  3U6Q A;  1IBK M;  5LMN M;  4DV3 M;  4DV7 M;  1K3X A;  4LF4 M;  1XMO M;  4NXN M;  5ITU A;  4JI5 M;  2F5P A;  5FLX S;  3GO8 A;  3VK8 A;  5ITT A;  4LF7 M;  4DV4 M;  2HKJ A;  3TWM A;  5ITQ A;  2UUC M;  4DV0 M;  2HHH M;  2UU9 M;  1L1Z A;  3GQ5 A;  3GPU A;  3GPP A;  5ITX A;  4DR3 M; 
#chains in the Genus database with same CATH topology
 1ZQ9 A;  2DEN A;  4LY6 A;  1MU5 A;  3C9P A;  1J7K A;  2JY6 B;  2DWL A;  1DGH A;  1ZAE A;  2Z4S A;  1IM2 A;  2M60 A;  1TDH A;  2L2D A;  3HKP A;  3FE3 A;  1ZV1 A;  4BB9 A;  2XSZ A;  4G4R A;  4L16 A;  3KFU G;  3F92 A;  2C96 A;  5KPT A;  1IBM M;  3T15 A;  5LMU M;  4WUR A;  3B89 A;  4QOZ C;  1EE8 A;  2LVO C;  4JI2 M;  3KSJ A;  4G4N A;  2DWZ B;  4NXM M;  2DXI A;  4L8R C;  5IT9 S;  2JY7 A;  3BOS A;  2QP9 X;  2V1U A;  3SYK A;  4NL4 H;  3GP1 A;  2WSF F;  4FCW A;  2R45 A;  2ERC A;  2OO9 A;  3FUX A;  2QQ8 A;  4LFB M;  4FW9 A;  3J7A S;  1GJS A;  2BJV A;  1GO5 A;  1IN4 A;  1ORY B;  1PGY A;  2L4E A;  4YHH M;  1TGU A;  3MJ5 A;  3U6P A;  4DUY M;  3M7G A;  1XXH E;  5EP1 A;  1TR8 A;  2ZBK B;  4A3V B;  2R4J A;  2DZO B;  1HNX M;  4GRI A;  3SYL A;  2MR9 A;  2QBY B;  4IBB A;  3J2P B;  1OAO C;  4XGI A;  2F5S A;  4LF9 M;  4FVM A;  4LJ8 A;  4MGZ E;  2LHG A;  2DAI A;  1TF0 B;  4XK8 F;  3VKH A;  1S3S A;  2CHV A;  4QHS A;  1Z5B A;  4CHT B;  3FTF A;  2GQF A;  5C18 A;  2BWB A;  2R4E A;  5F3W A;  2X4A A;  4JI6 M;  1N75 A;  4YY3 M;  1D0K A;  3C3E A;  4GIP A;  1R2Y A;  1Q39 A;  4Q7J A;  3GQ3 A;  5A2Q S;  1GJT A;  1NNJ A;  4CIS A;  4HL4 A;  4AW4 A;  1XWI A;  4JI8 M;  2F4V M;  4AKH A;  4R71 A;  1P3Q Q;  2BWE A;  3K8Z A;  3OTO M;  1G59 A;  1E32 A;  4CJ6 A;  4DV1 M;  3B74 A;  3JAM S;  4F1I A;  1UM8 A;  4DR5 M;  1IBL M;  1JR3 E;  2JXN A;  2Z3X A;  1QYR A;  4X62 M;  3SBJ A;  2JY8 A;  4P16 A;  3K2L A;  2Q2E B;  4P17 A;  1IQP A;  2ZTC A;  2KNZ A;  4GC9 A;  1N36 M;  4KO8 A;  4G3O A;  1D2N A;  1R7R A;  4DV5 M;  3U6O A;  3TWK A;  4RF0 A;  3IHP A;  5KPZ A;  4B7G A;  1XB2 B;  2HCB A;  2DAG A;  4IBE A;  1Q3C A;  1WJ7 A;  1HR0 M;  5EP4 A;  2KDL A;  2LH0 A;  4FD2 A;  1QZM A;  3SAS A;  1VDD A;  1TDZ A;  1FNN A;  4AKI A;  3A46 A;  2CRU A;  1VQ1 A;  1NV9 A;  1DO2 A;  3U6L A;  4MH0 E;  3U6Q A;  4M0W A;  2ZAN A;  1IBK M;  2MH8 A;  4OVZ B;  2DI0 A;  1MJG M;  1K3X A;  2YNM D;  4L15 A;  2BNK A;  4MM3 B;  4ANR A;  3B7Q A;  2R65 A;  2DZL A;  2QNJ A;  2CHG A;  4JI5 M;  2DAK A;  3HHW A;  2L7I A;  4S12 A;  3WHL A;  5DNY A;  3L29 A;  3TWM A;  4GHL A;  3J7B A;  5DYI A;  2KNV A;  1PJQ A;  2O5R A;  2Z7J A;  2L09 A;  4BBA A;  3LW5 F;  4OVZ A;  2L7H A;  3U5Z B;  3GLF E;  4FWH A;  3GQ5 A;  5KO3 A;  4CIZ A;  3EIH A;  3KOW E;  3GPU A;  4AKG A;  2ZAO A;  3PNY A;  1PJS A;  1QDR A;  3PFI A;  3DFZ A;  1OIZ A;  2EJS A;  1QAM A;  5ITX A;  2H1R A;  1GLN A;  2N35 A;  3GPP A;  1IXR C;  3GRV A;  3M6A A;  1L1T A;  3SAV A;  1OIP A;  1W5S A;  2WSE F;  3LVV A;  5ITY A;  1F4I A;  3GLF B;  2KXE A;  2QCU A;  3U5Z A;  5C1B A;  3QWL A;  2DVW B;  3HY5 A;  3KDS E;  4LGY A;  1IY2 A;  3RGP A;  3E9S A;  3GLH B;  4DR2 M;  5L8R F;  4GMQ A;  4II7 A;  5FSW A;  2LXE A;  3L27 A;  2X8A A;  3HJ8 A;  3L28 A;  1E94 E;  1WXQ A;  3MK6 A;  5E26 A;  3W0L B;  3ZH9 B;  2VF8 A;  2OQ4 A;  1D0L A;  2EUC A;  5E6J A;  4Z6Y A;  2FOI C;  2DHR A;  4GH9 A;  3SMS A;  2R6F A;  2XF3 A;  3HHZ A;  2VII A;  1OFH A;  1T6O A;  4FWG A;  3TWL A;  1R6B X;  3K92 A;  4IBK A;  1OAI A;  3U6S A;  3SMP A;  2WZJ A;  3GLH A;  1FJG M;  1WIV A;  1NO1 A;  4LGM A;  4FWD A;  3QYB A;  3C3D A;  3K9P A;  2V6Z M;  1HJP A;  4I4L A;  4JYA M;  1TH2 A;  2JP7 A;  2VQE M;  1VEK A;  1N33 M;  4NSO B;  4L78 A;  3GLI E;  1L2D A;  1E9R A;  3W67 A;  1OTR A;  2JNH A;  2Y21 A;  2O25 A;  2V1C A;  2UUB M;  2JZ0 A;  3VFD A;  1HNZ M;  5DFL A;  3VKG A;  2KRK A;  2YQZ A;  2HAK A;  1NHG C;  3I4Y A;  1JQJ C;  1RU3 A;  2KHH A;  1VEG A;  2RGH A;  3Q8X A;  3QAU A;  4KLN A;  1VDL A;  3SC3 A;  2Z8Y M;  2KW0 A;  4PT5 A;  1DGF A;  1NSF A;  4Z8X A;  1NY6 A;  3KS8 A;  4G4O A;  2CV0 A;  5EXS A;  4NRW A;  4JV5 M;  4OW0 A;  5EJC A;  2MJ5 B;  2P5T A;  4DR6 M;  2O01 F;  2UXC M;  1XNQ M;  2XEP A;  3FRH A;  3FD9 A;  3J27 B;  4ITQ A;  3H4J A;  3GLG E;  1NVM A;  2BJW A;  3U6D A;  4LCB A;  4MGI E;  4B7H A;  2CV1 A;  4KT0 F;  1IXS B;  2GNO A;  2G3Q A;  2VQF M;  3T1Y M;  2OPF A;  2DHY A;  4WW0 A;  5FTL A;  4IJE A;  3GLG B;  5ITR A;  2JA2 A;  1PJJ A;  4BLC A;  4G4Q A;  4L4U A;  2CP8 A;  2XFS A;  4OX9 M;  3B7N A;  4NSR A;  4MB7 A;  3ZQJ A;  4JI3 M;  3SFZ A;  1DGB A;  4WP2 A;  4PDG A;  2EO2 A;  3QYE A;  4LJ5 A;  2VDB B;  2FFJ A;  3SAT A;  3SHG B;  3KW6 A;  4IBC A;  1XXH B;  1SXJ E;  2K0B X;  1LTM A;  1ZMV A;  2NQ8 C;  2RRU A;  1WGL A;  1NJF A;  2F5N A;  3T1H M;  1ZMU A;  3L25 A;  3E46 A;  1BVS A;  2UUA M;  4IBI A;  3FRI A;  3FYC A;  4DR7 M;  1HT2 E;  2QBY A;  4HLQ A;  3DA1 A;  1PM5 A;  1Z5A A;  1Z59 A;  1SXJ B;  3FTE A;  1XXH A;  5IRE B;  4DV3 M;  2D7E A;  4DV7 M;  1C7Y A;  4NXN M;  5ITU A;  2J7N A;  5KPR A;  2F5P A;  4LF7 M;  4R3D A;  1E9S A;  1YLA A;  3K1J A;  2I7N A;  1IXZ A;  1G3I A;  1YSY A;  3E21 A;  2R62 A;  4D80 A;  2FNA A;  2D7H A;  3IG8 A;  3RE8 A;  1L1Z A;  2LWX A;  3TPZ A;  2HL7 A;  2FS1 A;  2K9D A;  3U60 B;  3HU1 A;  1GAB A;  1Z6T A;  1JR3 D;  4KOD A;  1N78 A;  2LHC A;  2OOB A;  3TL4 X;  4LJ9 A;  1W5T A;  2C9C A;  3B9P A;  3UZU A;  1NY5 A;  1QQW A;  3C58 A;  3I51 A;  4OU7 A;  1G71 A;  5BR8 M;  4DV6 M;  4LF6 M;  1DGG A;  3U61 B;  3U6M A;  3M0E A;  4LJ7 A;  3T38 A;  3UK6 A;  3U60 A;  3HX3 A;  3J81 S;  3KSX A;  3UJN A;  4GKJ M;  3HU3 A;  4B3M M;  1JR3 A;  1HQC A;  2QHO B;  4QOS A;  1PRB A;  4I5S A;  1CUK A;  3I4V A;  2E5L M;  1TH3 A;  2DKL A;  2FE8 A;  1QVR A;  1OKS A;  4CGY B;  4LFA M;  4AZF A;  4F2L A;  3AFH A;  3AJI B;  1IN7 A;  1GL6 A;  3LCV B;  4RKU F;  1K3W A;  2UXD M;  4B7F A;  4NOO B;  4LFC M;  1G4A E;  2Y0Q A;  3VDP A;  1Z5C A;  2H5X A;  1TH4 A;  3HWS A;  4M9X A;  3I04 M;  2R46 A;  1YUB A;  2CFO A;  4TUW A;  1IFY A;  5EXP A;  1R2Z A;  1TTE A;  3H4M A;  1HNW M;  1XHB A;  2X49 A;  4DV2 M;  4IJF A;  3GRY A;  3NWL A;  1I94 M;  3CF0 A;  3VDU A;  1WHC A;  4PD2 A;  3UMM A;  2I7P A;  3E4R A;  3HJQ A;  4REZ A;  2VF7 A;  3GLF A;  1J5E M;  3D8B A;  4RNA A;  1N32 M;  4AG6 A;  1PJT A;  2DAE A;  1EFU B;  1KSF X;  1OFI A;  3KVW A;  4JN6 A;  4FCV A;  1WR1 B;  1L2B A;  4MGK E;  2DWM A;  2HWJ A;  1OJL A;  1R4G A;  2C9O A;  1PJI A;  2AHM A;  1K82 A;  5IWA M;  5BPV A;  1T3T A;  3IEC A;  4X64 M;  3Q8G A;  3I01 M;  2DNA A;  1QAQ A;  3FUU A;  1G41 A;  3AV0 A;  1XMQ M;  2D7G A;  1IY1 A;  1XNR M;  2ZTD A;  1ZMW A;  2YR0 A;  1IN6 A;  4IBF A;  4ZPX A;  4RF1 A;  2C99 A;  4M9Z A;  4K0K M;  2J7O A;  2CUZ A;  1R5L A;  4L6V 6;  3LQR A;  4FCT A;  5JI3 E;  5EXT A;  4DUZ M;  2UXB M;  2KNA A;  2XH9 A;  4Y28 F;  3L2A A;  3GLI B;  4LZJ A;  3ILK A;  2LBC A;  1MN3 A;  3TE6 A;  1J09 A;  2XZU A;  4GC5 A;  4JI4 M;  4AI6 A;  3DOA A;  1QAO A;  3UGJ A;  1Q3B A;  3FUW A;  2K6B A;  2CHQ A;  2QPA A;  1GVN A;  4JXJ A;  2F5O A;  2KEB A;  1DV0 A;  3TQS A;  2LVQ D;  8CAT A;  3NBX X;  3JR5 A;  2A5Y B;  3GLI A;  2DWN A;  4HEO A;  3CF2 A;  4GEW A;  5EP2 A;  1I4W A;  1QDT A;  2DAM A;  3IG5 A;  3FKE A;  2Y0T A;  2JZ1 A;  5EQT A;  4LF4 M;  3KP0 E;  3PNV A;  2LVN C;  2MGW A;  5FLX S;  1VEJ A;  3HHX A;  2L6O A;  3AOG A;  5ITT A;  5KQ8 A;  3GO8 A;  2OOA A;  3VK8 A;  1QAN A;  5ITQ A;  2G5G X;  1IXS A;  4D82 A;  4DV0 M;  4QNR A;  2XFT A;  2UU9 M;  1IN8 A;  1IN5 A;  1G8P A;  2LVA A;  3MMP A;  3HU2 A;  1UFZ A;  3LCU A;  3GLG A;  3HZJ A;  2CWB A;  4DR3 M;  3A98 B;  2MRO B;  1GL7 A;  2F5Q A;  4PDI A;  4GKK M;  1N34 M;  1LV7 A;  4W5W A;  3WHK A;  3R8F A;  1SXJ D;  1AUA A;  3AKZ A;  1A5T A;  3ZCB B;  4X65 M;  4X66 M;  2KA6 B;  3GPX A;  1V34 A;  3HHY A;  2XLJ A;  2KZU A;  5FTN A;  2R18 A;  2EA0 A;  4AG5 A;  4LJA A;  4M0D A;  1X37 A;  3KOZ E;  3VK7 A;  5FTM A;  4LRS A;  2LNH C;  3SAR A;  1C1K A;  1HQY E;  4LF8 M;  2Z4R A;  1SXJ A;  2G8L A;  4IBJ A;  5EP3 A;  3FUT A;  4JI7 M;  2RKO A;  2JUJ A;  3KP1 E;  4I81 A;  1L2C A;  1IY0 A;  2KRU A;  4JI0 M;  4QNM A;  1EIJ A;  2LTU A;  4LJ4 A;  3LMM A;  4EIW A;  1GKI A;  3JR4 A;  5H37 D;  5JI2 E;  4G6Z A;  3J80 S;  2ZAM A;  1QZE A;  2DZN B;  3AOE A;  3LQQ A;  3LVW A;  7CAT A;  1Y8G A;  4LZZ A;  3B7Z A;  1AIP C;  4LRT A;  5KQD A;  3CGW A;  2CE7 A;  2B3T A;  1JB0 F;  3FYD A;  4AQY M;  1NV8 A;  3T6P A;  5FTK A;  3V76 A;  1KFV A;  1V33 A;  3U61 A;  3GRU A;  1T43 A;  1XC8 A;  4LF5 M;  2K47 A;  1KYI A;  3PXG A;  2CEA A;  2ZM6 M;  5DYG A;  3MHV C;  4QHT A;  3ZC7 B;  3U6C A;  4PCZ A;  3GRR A;  4B3T M;  3VLF B;  3BXW A;  4B08 A;  2R0I A;  3W0F A;  4IBG A;  5ITX E;  1N77 A;  4MGH A;  4M9S A;  3U6E A;  3CF6 E;  3KOX E;  3AL0 C;  4MGY E;  3SAU A;  1D0M A;  3CTW B;  3RGS A;  2CV2 A;  1VG5 A;  5FTJ A;  4IBD A;  4NRV A;  4B3R M;  3SAW A;  4JI1 M;  2Y20 A;  2QZ4 A;  2C5R A;  1NJG A;  4DR4 M;  3SHF A;  1MX0 A;  2FH0 A;  3FTC A;  4I8O A;  2KZS A;  1SG9 A;  5EXX A;  2XGN A;  4NC6 A;  4UN2 B;  1SXJ C;  4KHP M;  2W82 A;  3GPY A;  2WSC F;  1V92 A;  3KS4 A;  2R44 A;  2YFQ A;  3THG A;  1Q02 A;  4R7G A;  3K9O A;  3BBZ A;  4B3S M;  3GLH E;  1OQY A;  3A45 A;  4DR1 M;  3KXE C;  3HJS A;  3W68 A;  2APL A;  4IIW A;  3RFW A;  3FTD A;  3DZD A;  2JY5 A;  2XZF A;  4GHA A;  2EKK A;  3A42 A;  3FUV A;  3KOY E;  3NBI A;  1H6U A;  4D81 A;  3GQ4 A;  3R9X B;  3AOE C;  1WGN A;  3PVS A;  5LMN M;  2C98 A;  2M5Z A;  5IZ7 D;  1DO0 A;  1XMO M;  2LVP C;  3D8L A;  4LJ6 A;  4DBG B;  2L4F A;  5GKN A;  3L26 A;  4DV4 M;  4LG2 A;  1L8Q A;  2HKJ A;  4GIT A;  2JWS A;  1NHW C;  1YE9 A;  2QSF X;  1QUT A;  2UUC M;  2HHH M;  2RGO A;  1DGH B;  2EKF A;  2J5Y A;  1QUS A;  2QEN A;  3EIE A;  1NNU C;  1HT1 E;  4XBO A;  2XSZ D;  3HGI A; 
#chains in the Genus database with same CATH homology
 1ZQ9 A;  4LY6 A;  1MU5 A;  1J7K A;  2DWL A;  1DGH A;  1ZAE A;  2Z4S A;  1IM2 A;  2M60 A;  1TDH A;  3HKP A;  4BB9 A;  2XSZ A;  4G4R A;  4L16 A;  3KFU G;  2C96 A;  5KPT A;  1IBM M;  3T15 A;  5LMU M;  4WUR A;  4QOZ C;  1EE8 A;  4JI2 M;  3KSJ A;  4G4N A;  2DWZ B;  4NXM M;  2DXI A;  4L8R C;  5IT9 S;  3BOS A;  2QP9 X;  2V1U A;  3SYK A;  4NL4 H;  3GP1 A;  4FCW A;  2R45 A;  2ERC A;  3FUX A;  4LFB M;  4FW9 A;  3J7A S;  2BJV A;  1IN4 A;  1ORY B;  4YHH M;  1TGU A;  3MJ5 A;  3U6P A;  4DUY M;  3M7G A;  5EP1 A;  2ZBK B;  4A3V B;  2R4J A;  2DZO B;  1HNX M;  4GRI A;  3SYL A;  2QBY B;  4IBB A;  3J2P B;  4XGI A;  2F5S A;  4LF9 M;  4FVM A;  4LJ8 A;  4MGZ E;  3VKH A;  1S3S A;  2CHV A;  4QHS A;  1Z5B A;  4CHT B;  3FTF A;  5C18 A;  2R4E A;  5F3W A;  4JI6 M;  2X4A A;  1N75 A;  4YY3 M;  1R2Y A;  4GIP A;  1Q39 A;  3GQ3 A;  5A2Q S;  1NNJ A;  4CIS A;  4HL4 A;  4AW4 A;  1XWI A;  4JI8 M;  2F4V M;  4AKH A;  3K8Z A;  3OTO M;  1G59 A;  1E32 A;  4DV1 M;  3JAM S;  1UM8 A;  4DR5 M;  1IBL M;  2Z3X A;  1QYR A;  4X62 M;  3SBJ A;  4P16 A;  3K2L A;  2Q2E B;  1IQP A;  4GC9 A;  1N36 M;  4KO8 A;  1D2N A;  1R7R A;  4DV5 M;  3U6O A;  3TWK A;  4RF0 A;  5KPZ A;  4B7G A;  2HCB A;  4IBE A;  1Q3C A;  1HR0 M;  5EP4 A;  2LH0 A;  4FD2 A;  1QZM A;  3SAS A;  1VDD A;  1TDZ A;  1FNN A;  4AKI A;  3A46 A;  1DO2 A;  3U6L A;  4MH0 E;  3U6Q A;  4M0W A;  2ZAN A;  1IBK M;  4OVZ B;  1K3X A;  2YNM D;  4L15 A;  2BNK A;  4MM3 B;  4JI5 M;  2R65 A;  2CHG A;  3HHW A;  2L7I A;  4S12 A;  3WHL A;  5DNY A;  3L29 A;  3TWM A;  4GHL A;  3J7B A;  5DYI A;  2O5R A;  2Z7J A;  2L09 A;  4BBA A;  4OVZ A;  2L7H A;  3U5Z B;  4FWH A;  3GQ5 A;  5KO3 A;  3EIH A;  3KOW E;  3GPU A;  4AKG A;  2ZAO A;  3PNY A;  3PFI A;  3DFZ A;  5ITX A;  3GPP A;  1QAM A;  2H1R A;  1GLN A;  1IXR C;  3GRV A;  3M6A A;  1L1T A;  3SAV A;  1W5S A;  3LVV A;  5ITY A;  3GLF B;  2KXE A;  2QCU A;  3U5Z A;  5C1B A;  3QWL A;  2DVW B;  3KDS E;  4LGY A;  1IY2 A;  3RGP A;  3E9S A;  3GLH B;  4DR2 M;  4GMQ A;  4II7 A;  5FSW A;  2LXE A;  3L27 A;  2X8A A;  3HJ8 A;  3L28 A;  1E94 E;  1WXQ A;  3MK6 A;  5E26 A;  3W0L B;  3ZH9 B;  2OQ4 A;  2EUC A;  5E6J A;  4Z6Y A;  2FOI C;  2DHR A;  4GH9 A;  3SMS A;  3HHZ A;  2XF3 A;  2VII A;  1OFH A;  4FWG A;  3TWL A;  1R6B X;  3K92 A;  4IBK A;  3U6S A;  3SMP A;  3GLH A;  1FJG M;  4LGM A;  4FWD A;  2V6Z M;  4I4L A;  4JYA M;  1TH2 A;  2VQE M;  1N33 M;  4NSO B;  4L78 A;  1L2D A;  1E9R A;  2Y21 A;  2V1C A;  2UUB M;  3VFD A;  1HNZ M;  3VKG A;  2KRK A;  2YQZ A;  1NHG C;  3I4Y A;  1JQJ C;  2RGH A;  3Q8X A;  3QAU A;  4KLN A;  3SC3 A;  2KW0 A;  4PT5 A;  1DGF A;  1NSF A;  4Z8X A;  1NY6 A;  3KS8 A;  4G4O A;  2CV0 A;  5EXS A;  4NRW A;  4JV5 M;  4OW0 A;  5EJC A;  2P5T A;  4DR6 M;  2UXC M;  1XNQ M;  2XEP A;  3FD9 A;  3J27 B;  4ITQ A;  1NVM A;  2BJW A;  3U6D A;  4LCB A;  4MGI E;  4B7H A;  2CV1 A;  1IXS B;  2VQF M;  3T1Y M;  2OPF A;  4WW0 A;  5FTL A;  4IJE A;  3GLG B;  5ITR A;  2JA2 A;  1PJJ A;  4BLC A;  4G4Q A;  4L4U A;  2XFS A;  4OX9 M;  4NSR A;  4MB7 A;  4JI3 M;  3SFZ A;  1DGB A;  4PDG A;  2EO2 A;  4LJ5 A;  2FFJ A;  3SAT A;  3SHG B;  3KW6 A;  4IBC A;  1XXH B;  1SXJ E;  2NQ8 C;  2F5N A;  1NJF A;  3L25 A;  3T1H M;  2UUA M;  4IBI A;  3FYC A;  4DR7 M;  1HT2 E;  2QBY A;  4HLQ A;  3DA1 A;  1PM5 A;  1Z5A A;  1Z59 A;  1SXJ B;  3FTE A;  1XXH A;  5IRE B;  4DV3 M;  2D7E A;  4DV7 M;  4NXN M;  5ITU A;  2J7N A;  5KPR A;  2F5P A;  4LF7 M;  4R3D A;  1E9S A;  3K1J A;  2I7N A;  1IXZ A;  1G3I A;  1YSY A;  2R62 A;  4D80 A;  2FNA A;  2D7H A;  3IG8 A;  3RE8 A;  1L1Z A;  2LWX A;  3TPZ A;  2HL7 A;  3U60 B;  3HU1 A;  1Z6T A;  1JR3 D;  4KOD A;  1N78 A;  3TL4 X;  4LJ9 A;  1W5T A;  2C9C A;  3B9P A;  3UZU A;  1NY5 A;  1QQW A;  3C58 A;  3I51 A;  4OU7 A;  5BR8 M;  4LF6 M;  4DV6 M;  1DGG A;  3U61 B;  3U6M A;  3M0E A;  4LJ7 A;  3T38 A;  3UK6 A;  3U60 A;  3J81 S;  3KSX A;  3UJN A;  4GKJ M;  3HU3 A;  4B3M M;  1JR3 A;  1HQC A;  4QOS A;  4I5S A;  2E5L M;  3I4V A;  1TH3 A;  2FE8 A;  1QVR A;  4CGY B;  4LFA M;  4AZF A;  3AFH A;  3AJI B;  1IN7 A;  1GL6 A;  1K3W A;  2UXD M;  4B7F A;  4NOO B;  4LFC M;  1G4A E;  2Y0Q A;  3VDP A;  1Z5C A;  1TH4 A;  3HWS A;  4M9X A;  2R46 A;  1YUB A;  2CFO A;  4TUW A;  5EXP A;  1R2Z A;  3H4M A;  1HNW M;  1XHB A;  2X49 A;  4DV2 M;  4IJF A;  3GRY A;  3NWL A;  1I94 M;  3CF0 A;  3VDU A;  4PD2 A;  3UMM A;  2I7P A;  3E4R A;  3HJQ A;  4REZ A;  3GLF A;  1J5E M;  1N32 M;  3D8B A;  4RNA A;  4AG6 A;  1KSF X;  1OFI A;  3KVW A;  4JN6 A;  4FCV A;  1L2B A;  4MGK E;  2DWM A;  1OJL A;  1PJI A;  2C9O A;  1K82 A;  2AHM A;  5IWA M;  5BPV A;  1T3T A;  4X64 M;  1QAQ A;  3FUU A;  1G41 A;  3AV0 A;  1XMQ M;  2D7G A;  1IY1 A;  1XNR M;  2YR0 A;  4IBF A;  1IN6 A;  4ZPX A;  4RF1 A;  2C99 A;  4M9Z A;  4K0K M;  2J7O A;  2CUZ A;  5JI3 E;  3LQR A;  4FCT A;  4DUZ M;  5EXT A;  2UXB M;  2XH9 A;  3L2A A;  3GLI B;  4LZJ A;  3ILK A;  3TE6 A;  1J09 A;  2XZU A;  4GC5 A;  4JI4 M;  4AI6 A;  3DOA A;  1QAO A;  3UGJ A;  1Q3B A;  3FUW A;  2CHQ A;  2QPA A;  1GVN A;  4JXJ A;  2F5O A;  2KEB A;  3TQS A;  8CAT A;  3JR5 A;  2A5Y B;  3GLI A;  2DWN A;  3CF2 A;  5EP2 A;  1I4W A;  3IG5 A;  3FKE A;  2Y0T A;  4LF4 M;  5EQT A;  3KP0 E;  3PNV A;  5FLX S;  3HHX A;  2L6O A;  3AOG A;  5ITT A;  5KQ8 A;  3GO8 A;  3VK8 A;  1QAN A;  5ITQ A;  2G5G X;  4D82 A;  4DV0 M;  4QNR A;  2XFT A;  2UU9 M;  1IN8 A;  1IN5 A;  1G8P A;  3HU2 A;  3GLG A;  4DR3 M;  3A98 B;  1GL7 A;  2F5Q A;  4PDI A;  4GKK M;  1N34 M;  1LV7 A;  4W5W A;  3WHK A;  3R8F A;  1SXJ D;  3AKZ A;  4X65 M;  3ZCB B;  4X66 M;  2KA6 B;  3GPX A;  3HHY A;  2XLJ A;  2KZU A;  5FTN A;  2R18 A;  2EA0 A;  4AG5 A;  4LJA A;  4M0D A;  1X37 A;  3KOZ E;  3VK7 A;  5FTM A;  4LRS A;  2LNH C;  3SAR A;  1C1K A;  1HQY E;  4LF8 M;  2Z4R A;  1SXJ A;  2G8L A;  4IBJ A;  5EP3 A;  3FUT A;  4JI7 M;  2RKO A;  3KP1 E;  4I81 A;  1L2C A;  1IY0 A;  2KRU A;  4JI0 M;  4QNM A;  4LJ4 A;  3LMM A;  4EIW A;  1GKI A;  3JR4 A;  5H37 D;  5JI2 E;  4G6Z A;  3J80 S;  2ZAM A;  2DZN B;  3AOE A;  3LQQ A;  3LVW A;  7CAT A;  4LZZ A;  4LRT A;  5KQD A;  2CE7 A;  3FYD A;  4AQY M;  5FTK A;  1KFV A;  3U61 A;  3GRU A;  1XC8 A;  4LF5 M;  2K47 A;  1KYI A;  3PXG A;  2CEA A;  2ZM6 M;  5DYG A;  3MHV C;  4QHT A;  3ZC7 B;  3U6C A;  4PCZ A;  3GRR A;  4B3T M;  3VLF B;  4B08 A;  3W0F A;  4IBG A;  5ITX E;  1N77 A;  4MGH A;  4M9S A;  3U6E A;  3CF6 E;  3KOX E;  3AL0 C;  4MGY E;  3SAU A;  3CTW B;  3RGS A;  2CV2 A;  5FTJ A;  4IBD A;  4NRV A;  4B3R M;  3SAW A;  4JI1 M;  2Y20 A;  2QZ4 A;  2C5R A;  1NJG A;  4DR4 M;  3SHF A;  1MX0 A;  3FTC A;  4I8O A;  2KZS A;  5EXX A;  2XGN A;  1SXJ C;  4KHP M;  2W82 A;  3GPY A;  3KS4 A;  2YFQ A;  3THG A;  4R7G A;  4B3S M;  3A45 A;  4DR1 M;  3KXE C;  3HJS A;  3RFW A;  4IIW A;  3FTD A;  3DZD A;  4GHA A;  2XZF A;  3R9X B;  3A42 A;  3FUV A;  3KOY E;  3NBI A;  1H6U A;  4D81 A;  3GQ4 A;  3AOE C;  3PVS A;  5LMN M;  2C98 A;  2M5Z A;  5IZ7 D;  1DO0 A;  1XMO M;  3D8L A;  4LJ6 A;  5GKN A;  3L26 A;  4DV4 M;  4LG2 A;  1L8Q A;  2HKJ A;  4GIT A;  1NHW C;  1YE9 A;  2UUC M;  2HHH M;  2RGO A;  1DGH B;  2QEN A;  3EIE A;  1NNU C;  1HT1 E;  4XBO A;  2XSZ D;  3HGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...