3I51A

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
total genus 70
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3i51A01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3i51A02
1S9AA 3LXVA 3PCBM 3PCBA 2BUMA 3MV6A 3MI1A 3MV4A 3PCFA 1EOBA 1DLMA 1YKLB 4WHSD 1EOAB 4WHOB 1EOCB 3T63A 3PCCM 3I4YA 3PCKM 3O32A 3PCJA 3T67M 3PCHA 3PCLA 3PCHM 3PCLM 1DLTA 1YKOB 2BUVB 2PCDM 2XSVA 4WHOD 2BURB 3PCKA 2BUUA 3O6JA 3MFLM 4WHRA 3T67A 3HHXA 3T63M 3PCDM 3PCEM 3HGIA 3O6RA 1YKNA 4WHRF 3I51A 1YKMA 2AZQA 4ILVA 2BUXA 4WHRB 2BUUB 3PCIA 2BUQB 1YKKB 3LKTM 3TH1A 3MV4M 2BUTB 2XSUA 3HJQA 1DMHA 3PCAM 1YKOA 2BUVA 2BV0B 1YKPB 3PCIM 1EOCA 1EO9B 1EO9A 3LKTA 3PCMA 1YKPA 1EOBB 4WHPA 3PCDA 2BUWA 3PCGM 4WHOA 2BUMB 1YKLA 3LMXM 1YKKA 4WHQA 2BUWB 3HHYA 2PCDA 1DLQA 4WHPB 3N9TA 2BUXB 3PCEA 4ILTA 2XSRA 3PCCA 2BV0A 1EO2A 3PCJM 2BUYA 4WHSA 2BUTA 3I4VA 3MFLA 3HKPA 2BUQA 2BUZB 2BUZA 3HJSA 3PCGA 1TMXA 3PCAA 3PCNA 3LMXA 2BUYB 3HJ8A 2BURA 3PCMM 4WHPD 1YKMB 3MI5A 5TD3A 2BOYA 3MI1M 3MV6M 4WHSB 1YKNB 3PCFM 3LXVM 3MI5M 3PCNM 3O5UA 1EO2B 4WHQB 1EOAA
chains in the Genus database with same CATH superfamily
2Z4RA 2CFOA 4GH9A 1E9RA 4FD2A 3MV6A 2ZM6M 2CRUA 3F92A 1IFYA 2E5LM 1SXJD 4JI6M 1N33M 3B89A 2V1UA 2OOAA 2YFQA 3D8LA 5DYIA 4JI2M 2XF3A 2Y21A 4LRSA 1EOBA 2OQ4A 1YKLB 4REZA 4QHSA 1Z5BA 1CUKA 2VDBB 5F3WA 2NQ8C 2W82A 1JR3D 4RF1A 3PCCM 2L09A 4FW9A 3I4YA 3BOSA 4GEWA 4HEOA 1PJQA 2CHQA 2QSFX 4BBAA 5FSWA 3PCJA 2JY5A 1IBKM 3FRHA 2L4FA 1HNWM 2PCDM 2BJVA 3B7QA 2BURB 1OAIA 3U61A 3PCKA 2P5TA 1E94E 2K6BA 2LXEA 1GL6A 5ITYA 2BUUA 3MFLM 3T67A 3AOEC 3MMPA 3FRIA 3U6MA 1G3IA 2LH0A 2JY8A 2QHOB 2HAKA 3PCEM 4NOOB 3QAUA 4GIPA 4IIWA 3SHFA 1Q3CA 1VDDA 1NV9A 3E9SA 1UM8A 2C9OA 2R0IA 3FTCA 2EUCA 3RFWA 3UK6A 3UJNA 1N32M 3LMMA 1NNJA 1DGHA 2JNHA 2Y0QA 3FUWA 3THGA 2JY6B 2DNAA 2ZTCA 3T15A 3U6EA 5A2QS 3GRRA 4ITQA 4G4QA 2Z7JA 3GLHA 4CGYB 1WR1B 2WSFF 3SHGB 1T6OA 1GABA 4M0WA 1WIVA 4QOSA 1JR3E 4OW0A 3KS8A 4LZZA 4FVMA 2UUAM 3E21A 1OKSA 5ITTA 3TH1A 3A46A 2X8AA 1EOAA 2CWBA 1YSYA 2OO9A 3PNVA 4IBIA 2BUVA 4RF0A 1EOCA 1HQYE 1S3SA 7CATA 1EO9B 3LKTA 3A45A 1G71A 2M5ZA 4I8OA 2G3QA 2J5YA 3PCMA 1GJTA 4KT0F 1XHBA 4AW4A 2KRUA 4IBKA 3PCDA 4NL4H 5ITRA 5BR8M 2QBYA 3KDSE 3E46A 3M0EA 4OVZB 1R6BX 1JB0F 1SXJA 2Q2EB 2WSCF 2JWSA 3U6SA 4DV6M 5FTNA 5DNYA 4M9XA 1YKKA 1QDRA 3HHWA 1EFUB 3KOWE 3HHYA 4NSOB 1HT1E 4X62M 1IN4A 4WHPB 3LQQA 3N9TA 2L7IA 3KP1E 3PCEA 4NC6A 3CGWA 3K1JA 2X4AA 4NXMM 1XB2B 3L27A 1TDZA 4GC9A 3T1HM 3DZDA 3GO8A 1Z5CA 4X64M 2F5PA 4ZPXA 4IBFA 1D0KA 2VIIA 3KOYE 5KO3A 4DR5M 2DAMA 1N78A 1DGHB 1Q02A 3T6PA 4BLCA 2KW0A 4G6ZA 2I7PA 3NWLA 3HY5A 1SG9A 5LMNM 2QQ8A 1OFHA 3HZJA 1R2ZA 2BUZB 2DAEA 2MJ5B 1EE8A 1H6UA 1XXHB 2H1RA 1IBLM 3HJSA 3J7BA 1IN5A 2GQFA 3PCGA 3PCNA 4YY3M 3HU3A 1HNZM 1T3TA 3W0LB 4IBGA 1OIPA 4WHPD 4MH0E 1T43A 4AKGA 1VEKA 2DWZB 3MV6M 2FH0A 4ANRA 4B7GA 4DV7M 3FUXA 3MI5M 3KOZE 3QYBA 4W5WA 3GLFE 4LG2A 2ZANA 4MB7A 1N77A 3LXVA 3PCBA 3A42A 3HU2A 4NRVA 2F5OA 2DZOB 2BUYB 2X49A 3J80S 4HL4A 3MV4A 3C3EA 4FCTA 4UN2B 4MGIE 3V76A 4JI1M 3PXGA 4EIWA 4IBEA 5FTLA 2EKFA 2HWJA 1DLMA 1SXJB 1XC8A 1TH3A 2HKJA 3NBIA 3W68A 1MN3A 4L78A 2JY7A 1WHCA 2C5RA 3PCKM 5ITUA 3O32A 1YLAA 3T67M 1Q39A 3PCLA 3LW5F 2EJSA 4IBCA 1DLTA 2BUVB 3HWSA 2XSVA 4DR1M 2ZTDA 1BVSA 3GQ3A 4DR4M 1QAOA 3DOAA 4M9ZA 4QOZC 3RGPA 4B3RM 4L6V6 1ZQ9A 4AG5A 2LWXA 3TPZA 4X66M 2CP8A 4LJ5A 2LVAA 5KQ8A 4KO8A 5JI2E 4JI5M 3HGIA 3O6RA 4OX9M 1IXSA 1YKNA 3EIEA 4WHRF 4X65M 2R45A 4LJ6A 3EIHA 3I51A 3VLFB 3FUTA 1UFZA 4AZFA 3L29A 1IY0A 1G8PA 2VQFM 2AZQA 3U6LA 2KRKA 3KS4A 2D7HA 1QVRA 1D0LA 1TR8A 4FCWA 2L4EA 2BUXA 3MHVC 3KSXA 4WHRB 3PCIA 2KXEA 4B3TM 3LCVB 2UUBM 3IG5A 4LF8M 2DAIA 2F4VM 1YKKB 4II7A 5ITQA 3MV4M 2BUTB 2DWLA 3UZUA 3FUUA 1VG5A 3PVSA 4GITA 4D81A 3B9PA 1G59A 4L8RC 1IN6A 1TGUA 2DZLA 3LVVA 1DMHA 2BV0B 4JI4M 3TE6A 3AFHA 1HT2E 4CIZA 1EO9A 1E9SA 4NXNM 2YR0A 3H4JA 1KYIA 3JR4A 3L25A 2O25A 5L8RF 4DV2M 4AG6A 2BJWA 5C18A 5DYGA 3U6QA 5EXTA 2BUMB 3PCGM 3GPUA 1YKLA 4JI0M 5ITXE 1HJPA 3WHLA 2O01F 4G4NA 2BUWB 3SAWA 3J7AS 4AKIA 1AUAA 3ILKA 1NVMA 3QYEA 4GRIA 4PT5A 2K9DA 3TWLA 2QCUA 5EP4A 2XSRA 4B7FA 5EXSA 2VF7A 1XWIA 4LFBM 2F5NA 1EO2A 3PCJM 2R18A 3LVWA 1OAOC 4DR7M 1DGGA 1IBMM 3GLHE 3J81S 4GKJM 2APLA 2KZSA 2UXDM 3SYKA 4B3MM 1TTEA 1WJ7A 3U6PA 1L2BA 3VKHA 2FNAA 2BUTA 3I4VA 2C98A 2VQEM 1NHGC 1R5LA 3HKPA 2G8LA 3K2LA 1VEJA 4G4OA 1PGYA 2BUQA 2LVOC 1GO5A 2JA2A 3ZC7B 3U6CA 3SATA 2BUZA 4DV4M 3HX3A 4FWGA 1YE9A 4DV3M 5EJCA 3PCAA 3CF2A 1XXHA 1Z59A 1F4IA 5IT9S 5GKNA 1NNUC 4B3SM 2BURA 1ZMUA 1YKMB 3J27B 1VQ1A 2R6FA 2DWMA 5FTKA 1MJGM 3VK7A 3MI5A 3MI1M 5TD3A 2JP7A 4QHTA 4DBGB 2KNVA 4AKHA 4LFCM 1YKNB 3PCNM 3PCFM 1PRBA 1V34A 2Z8YM 4I81A 2ZAMA 3GP1A 3H4MA 3J2PB 3AKZA 1S9AA 2XH9A 2BNKA 2R44A 2BUMA 1J09A 3FYCA 3RE8A 5H37D 3VKGA 5LMUM 2EO2A 4LF4M 1PJIA 3AOGA 3PFIA 1EOAB 4DUZM 3TWMA 4WHOB 2XGNA 1EOCB 3T63A 3KOXE 2O5RA 2RGOA 4CJ6A 4DR2M 2QBYB 4GC5A 1D2NA 2JZ1A 2LBCA 1QUTA 2YQZA 4M9SA 1NV8A 1L1ZA 3PCHA 2MR9A 3PCHM 3R8FA 1YKOB 3FTEA 2J7OA 4CHTB 2CV0A 1I94M 1WXQA 2R65A 1WGNA 3Q8GA 1J5EM 3O6JA 1L8QA 4DV1M 4WHRA 1IY2A 1IQPA 3T63M 4BB9A 1ORYB 2RKOA 2EKKA 4MGKE 1DO0A 2H5XA 3ZH9B 5BPVA 4L15A 3GPXA 3GLIE 2UXCM 3PCDM 1N36M 3CF0A 5KPTA 2CV2A 2YNMD 1G4AE 2KDLA 4LGYA 5IZ7D 1K82A 4LJAA 2KNZA 1AIPC 1QQWA 2C99A 1YKMA 2ZAOA 4IBJA 3GLGE 2K47A 3CTWB 2N35A 4A3VB 4JI8M 3UMMA 1Z6TA 1NHWC 1DGBA 1VEGA 1TF0B 3LCUA 1QUSA 3KSJA 2OPFA 3D8BA 1OFIA 3HU1A 5KPZA 3C9PA 2R46A 2BUUB 1IN8A 2G5GX 3BBZA 3KXEC 1C1KA 4KLNA 5E6JA 3U61B 2BUQB 2DHRA 1PJTA 3T38A 2ZBKB 3RGSA 4K0KM 2XSUA 4F2LA 1N34M 1QAQA 4FCVA 2R62A 2ERCA 4Z8XA 2D7GA 4PDIA 3BXWA 3OTOM 3SC3A 3PCIM 2A5YB 1YKPB 2C96A 3K9PA 1YUBA 1NO1A 2BWEA 2FOIC 2KA6B 4L16A 1GLNA 1KFVA 3AJIB 4GHLA 4LGMA 2K0BX 4MM3B 2UUCM 2DENA 4WHPA 2WZJA 1XMOM 2UU9M 4I5SA 2BUWA 1NY6A 4IJEA 5KQDA 3LMXM 4YHHM 1XMQM 2DVWB 1Q3BA 5DFLA 5EXXA 4WHQA 2PCDA 4Y28F 3FD9A 2L6OA 4LF7M 1DLQA 3W0FA 2XFTA 4NSRA 4L4UA 1QYRA 1XXHE 2WSEF 1QZEA 4LRTA 4LJ7A 3TQSA 4ILTA 1NSFA 4WURA 2L7HA 3R9XB 1K3XA 2BV0A 3SMSA 3FYDA 2HCBA 4R7GA 5IREB 3L2AA 4RNAA 3CF6E 1R7RA 3U6OA 4TUWA 2JUJA 2R4EA 4LF9M 1G41A 2XEPA 4CISA 4OU7A 3C3DA 4JN6A 5EP2A 1GJSA 1ZV1A 4P16A 2DZNB 2CUZA 3IG8A 4LFAM 3M7GA 4B7HA 4R71A 2RRUA 4IBBA 2XFSA 2FE8A 3GLFA 4JI3M 4GMQA 1PJJA 3KP0E 3M6AA 3GLHB 2QP9X 2LVNC 3DA1A 1W5TA 2BWBA 4HLQA 4I4LA 3FE3A 2MH8A 3KW6A 1KSFX 3WHKA 4PD2A 4G4RA 4G3OA 3PCMM 1ZMVA 1HR0M 1NJFA 3K92A 2HHHM 2BOYA 3U60B 1SXJC 1GVNA 4JXJA 2C9CA 4WHSB 3JR5A 2F5SA 1XNQM 2R4JA 3O5UA 3KFUG 3I04M 2KZUA 1Y8GA 4R3DA 2QNJA 4IBDA 1TH2A 4JI7M 1OIZA 3PCBM 4MGZE 4Z6YA 3AOEA 2KHHA 4OVZA 3SFZA 3MI1A 1QDTA 1V92A 2XLJA 4IJFA 3HHZA 3PCFA 2V6ZM 3GRVA 1JQJC 4M0DA 1R4GA 1LV7A 1VDLA 1XNRM 1QZMA 1L2CA 4WHSD 4D82A 3SYLA 1WGLA 3UGJA 2GNOA 3MK6A 4XBOA 1C7YA 3SAUA 1IXZA 1PJSA 3GLGA 3PCLM 2FFJA 2VF8A 3I01M 4P17A 1LTMA 4WHOD 2M60A 3L26A 4LJ8A 4FWDA 1SXJE 3W67A 4LF6M 2DI0A 5FTMA 3E4RA 5FTJA 4GKKM 3HHXA 2MROB 3SAVA 2CE7A 3QWLA 3GLIA 4DR6M 3IECA 3C58A 4PDGA 4GHAA 4DV0M 4MGYE 5JI3E 3GRUA 4WP2A 4QNRA 4MGHA 3GRYA 3B7NA 4DV5M 1NY5A 3NBXX 2AHMA 1TDHA 3SASA 2Z4SA 4LY6A 3GLIB 1Z5AA 2LHCA 5FLXS 3GPPA 2JXNA 1K3WA 4ILVA 3MJ5A 2XZFA 1QANA 3GQ4A 2LVPC 1MX0A 4LJ4A 2KNAA 3KVWA 1QAMA 1P3QQ 1OTRA 3AV0A 2LTUA 1ZAEA 4QNMA 3TL4X 3VDPA 5EXPA 3ZQJA 3LKTM 3K9OA 2LVQD 2UXBM 1D0MA 3GLGB 1E32A 3HJQA 4DUYM 2Y0TA 2OOBA 4AI6A 3PCAM 1FJGM 1YKOA 4LJ9A 3B74A 3VK8A 2DXIA 1JR3A 2QZ4A 1IXRC 5EP3A 3SMPA 3B7ZA 1PM5A 1YKPA 1EOBB 1V33A 4D80A 2XSZA 1IM2A 3JAMS 2QPAA 2Z3XA 1GL7A 2DKLA 3FTFA 4JYAM 3SBJA 4WHOA 3FKEA 4LF5M 2DAGA 2LHGA 3Q8XA 2DHYA 4XGIA 5E26A 5IWAM 3GQ5A 3SARA 4LZJA 4AQYM 5EQTA 1MU5A 4NRWA 1L1TA 1OQYA 2DAKA 2BUXB 4DR3M 4LCBA 1GKIA 3VFDA 3PCCA 3U6DA 3U5ZA 3U60A 3A98B 2MGWA 2QENA 4XK8F 1EIJA 1FNNA 2CEAA 1NJGA 3AL0C 1R2YA 5ITXA 1IY1A 2LNHC 2BUYA 4WHSA 3L28A 2B3TA 4KODA 5KPRA 1RU3A 2CHGA 4S12A 3T1YM 2DWNA 1IXSB 3MFLA 8CATA 1A5TA 3FUVA 3IHPA 2D7EA 4FWHA 1DGFA 4WW0A 1DV0A 4JV5M 2L2DA 2KEBA 2J7NA 2FS1A 4Q7JA 3TWKA 4B08A 1L2DA 5EP1A 2I7NA 2Y20A 3GLFB 2RGHA 3FTDA 1HNXM 1TMXA 2CHVA 2EA0A 2V1CA 3LMXA 4F1IA 3K8ZA 1ZMWA 3DFZA 3PNYA 2F5QA 1J7KA 3ZCBB 2HL7A 3HJ8A 2XSZD 4PCZA 1TH4A 1DO2A 1W5SA 2XZUA 4KHPM 2JZ0A 3U5ZB 1N75A 5C1BA 3GPYA 2CV1A 1HQCA 1IN7A 3LXVM 3LQRA 1EO2B 1X37A 4RKUF 1OJLA 3VDUA 4WHQB 1I4WA
chains in the Genus database with same CATH topology
2Z4RA 2CFOA 4GH9A 1E9RA 4FD2A 3MV6A 2ZM6M 2E5LM 1SXJD 4JI6M 1N33M 2V1UA 5DYIA 2YFQA 3D8LA 4JI2M 2XF3A 2Y21A 4LRSA 1EOBA 2OQ4A 1YKLB 4REZA 4QHSA 1Z5BA 5F3WA 2NQ8C 1JR3D 4RF1A 3PCCM 2L09A 4FW9A 3I4YA 3BOSA 2CHQA 4BBAA 3PCJA 5FSWA 1IBKM 1HNWM 2PCDM 2BJVA 2BURB 3PCKA 3U61A 2P5TA 1E94E 2LXEA 2BUUA 1GL6A 5ITYA 3MFLM 3T67A 3AOEC 3U6MA 1G3IA 2LH0A 3PCEM 4NOOB 3QAUA 4GIPA 4IIWA 3SHFA 1Q3CA 1VDDA 5JI2E 3E9SA 1UM8A 2C9OA 3T1YM 3FTCA 2EUCA 3RFWA 3UK6A 3UJNA 1N32M 3LMMA 1NNJA 1DGHA 2Y0QA 3FUWA 3THGA 3T15A 3U6EA 5A2QS 3GRRA 4ITQA 4G4QA 2Z7JA 3GLHA 4CGYB 3SHGB 4M0WA 4QOSA 4OW0A 3KS8A 4LZZA 4FVMA 2UUAM 5ITTA 3TH1A 3A46A 2X8AA 1EOAA 1YSYA 3PNVA 4IBIA 2BUVA 4RF0A 1EOCA 1HQYE 1S3SA 7CATA 1EO9B 3LKTA 3A45A 2M5ZA 4I8OA 3PCMA 1XHBA 4AW4A 2KRUA 4IBKA 3PCDA 4NL4H 5ITRA 5BR8M 2QBYA 3KDSE 3M0EA 4OVZB 1R6BX 3U6SA 1SXJA 2Q2EB 4DV6M 5FTNA 5DNYA 4M9XA 1YKKA 3HHWA 3KOWE 3HHYA 4NSOB 1HT1E 4X62M 1IN4A 4WHPB 3LQQA 3N9TA 2L7IA 3KP1E 3PCEA 3K1JA 2X4AA 4NXMM 3L27A 1TDZA 4GC9A 3T1HM 3DZDA 3GO8A 1Z5CA 4X64M 2F5PA 4ZPXA 4IBFA 2VIIA 3KOYE 5KO3A 4DR5M 1N78A 1DGHB 4BLCA 2KW0A 4G6ZA 2I7PA 3NWLA 5LMNM 1R2ZA 2BUZB 1OFHA 1EE8A 1H6UA 1XXHB 2H1RA 1IBLM 3HJSA 3J7BA 1IN5A 3PCGA 3PCNA 4YY3M 3HU3A 1HNZM 1T3TA 3W0LB 4IBGA 4WHPD 4MH0E 4AKGA 2DWZB 3MV6M 4B7GA 4DV7M 3FUXA 3MI5M 3KOZE 4W5WA 4LG2A 2ZANA 4MB7A 1N77A 3LXVA 3PCBA 3A42A 3HU2A 4NRVA 2F5OA 2DZOB 2X49A 3J80S 4HL4A 3MV4A 4FCTA 4MGIE 4JI1M 4EIWA 4IBEA 5FTLA 1DLMA 1SXJB 1XC8A 1TH3A 2HKJA 3NBIA 4L78A 2C5RA 3PCKM 5ITUA 3O32A 3T67M 1Q39A 3PCLA 1DLTA 4IBCA 2BUVB 2XSVA 3HWSA 4DR1M 3GQ3A 4DR4M 1QAOA 3DOAA 4M9ZA 4QOZC 3RGPA 4B3RM 1I4WA 1ZQ9A 4AG5A 2LWXA 3TPZA 4X66M 4LJ5A 5KQ8A 4KO8A 4JI5M 3HGIA 3O6RA 4OX9M 1YKNA 3EIEA 4WHRF 4X65M 2R45A 4LJ6A 3EIHA 3I51A 3VLFB 3FUTA 4AZFA 3L29A 1IY0A 1G8PA 2VQFM 2AZQA 3U6LA 2KRKA 3KS4A 2D7HA 1QVRA 4FCWA 2BUXA 3MHVC 3KSXA 4WHRB 3PCIA 2KXEA 4B3TM 2UUBM 3IG5A 4LF8M 2F4VM 1YKKB 4II7A 5ITQA 3MV4M 2BUTB 2DWLA 3UZUA 3FUUA 3PVSA 4GITA 1G59A 4D81A 3B9PA 4L8RC 1IN6A 1TGUA 3LVVA 1DMHA 2BV0B 4JI4M 3TE6A 3AFHA 1HT2E 1EO9A 1E9SA 4NXNM 2YR0A 1KYIA 3JR4A 3L25A 4DV2M 4AG6A 2BJWA 5C18A 5DYGA 3U6QA 5EXTA 2BUMB 3PCGM 3GPUA 1YKLA 4JI0M 5ITXE 3WHLA 4G4NA 2BUWB 3SAWA 3J7AS 4AKIA 3ILKA 1NVMA 4GRIA 4PT5A 3TWLA 2QCUA 5EP4A 2XSRA 4B7FA 5EXSA 4LFBM 1XWIA 2F5NA 1EO2A 3PCJM 2R18A 3LVWA 4DR7M 1DGGA 1IBMM 3J81S 4GKJM 2KZSA 2UXDM 3SYKA 4B3MM 3U6PA 1L2BA 3VKHA 2FNAA 2BUTA 3I4VA 2C98A 2VQEM 1NHGC 3HKPA 2G8LA 3K2LA 4G4OA 2BUQA 2JA2A 3ZC7B 3U6CA 3SATA 2BUZA 4DV4M 4FWGA 1YE9A 5EJCA 3PCAA 3CF2A 1XXHA 1Z59A 5IT9S 5GKNA 1NNUC 2BURA 1YKMB 3J27B 3MI5A 5TD3A 2DWMA 5FTKA 3VK7A 3MI1M 4QHTA 4AKHA 1YKNB 3PCFM 4LFCM 3PCNM 4I81A 2ZAMA 3GP1A 3H4MA 3J2PB 3AKZA 1S9AA 2XH9A 2BNKA 2BUMA 1J09A 3FYCA 3RE8A 5H37D 3VKGA 5LMUM 2EO2A 4LF4M 1PJIA 3AOGA 3PFIA 1EOAB 4DUZM 3TWMA 4WHOB 2XGNA 1EOCB 3T63A 3KOXE 2O5RA 2RGOA 2QBYB 4DR2M 4GC5A 1D2NA 2YQZA 4M9SA 1L1ZA 3PCHA 3PCHM 3R8FA 1YKOB 3FTEA 2J7OA 4CHTB 2CV0A 1I94M 1WXQA 2R65A 1J5EM 3O6JA 1L8QA 4DV1M 4WHRA 1IY2A 1IQPA 3T63M 4BB9A 1ORYB 2RKOA 4MGKE 1DO0A 3ZH9B 5BPVA 4L15A 3GPXA 2UXCM 3PCDM 1N36M 3CF0A 5KPTA 2CV2A 2YNMD 1G4AE 4LGYA 5IZ7D 1K82A 4LJAA 1QQWA 2C99A 1YKMA 2ZAOA 4IBJA 2K47A 3CTWB 4A3VB 4JI8M 3UMMA 1Z6TA 1NHWC 1DGBA 3KSJA 2OPFA 3D8BA 1OFIA 3HU1A 5KPZA 2R46A 2BUUB 1IN8A 2G5GX 3KXEC 1C1KA 4KLNA 5E6JA 3U61B 2BUQB 2DHRA 3T38A 2ZBKB 3RGSA 4K0KM 2XSUA 1N34M 1QAQA 4FCVA 2R62A 2ERCA 4Z8XA 2D7GA 4PDIA 3OTOM 3SC3A 3PCIM 2A5YB 1YKPB 2C96A 1YUBA 2FOIC 2KA6B 4L16A 1GLNA 1KFVA 3AJIB 4GHLA 4LGMA 4MM3B 4WHPA 2UUCM 2UU9M 1XMOM 2BUWA 4I5SA 1NY6A 4IJEA 5KQDA 3LMXM 4YHHM 1XMQM 2DVWB 1Q3BA 5EXXA 4WHQA 2PCDA 3FD9A 2L6OA 4LF7M 1DLQA 3W0FA 2XFTA 4NSRA 4L4UA 1QYRA 4ILTA 4LRTA 3TQSA 4LJ7A 1NSFA 4WURA 2L7HA 3R9XB 1K3XA 2BV0A 3SMSA 3FYDA 2HCBA 4R7GA 5IREB 3L2AA 4RNAA 3CF6E 1R7RA 3U6OA 4TUWA 2R4EA 4LF9M 1G41A 2XEPA 4CISA 4OU7A 4JN6A 5EP2A 4P16A 4LFAM 3IG8A 2CUZA 2DZNB 3M7GA 4B7HA 4IBBA 2XFSA 2FE8A 3GLFA 4JI3M 4GMQA 1PJJA 3KP0E 3M6AA 3GLHB 2QP9X 4DV3M 3DA1A 1W5TA 4HLQA 4I4LA 4B3SM 3KW6A 2BUYB 1KSFX 3WHKA 4PD2A 4G4RA 3PCMM 1HR0M 1NJFA 3K92A 2HHHM 2BOYA 3U60B 1SXJC 1GVNA 4JXJA 2C9CA 4WHSB 3JR5A 2F5SA 1XNQM 2R4JA 3O5UA 3KFUG 2KZUA 4R3DA 4IBDA 1TH2A 4JI7M 3PCBM 4MGZE 4Z6YA 3AOEA 4OVZA 3SFZA 3MI1A 2XLJA 4IJFA 3HHZA 3PCFA 2V6ZM 3GRVA 1JQJC 4M0DA 1LV7A 1XNRM 1QZMA 1L2CA 4WHSD 4D82A 3SYLA 3UGJA 3MK6A 4XBOA 3SAUA 1IXZA 3GLGA 3PCLM 2FFJA 4WHOD 2M60A 3L26A 4LJ8A 1SXJE 4LF6M 5FTMA 3E4RA 5FTJA 4GKKM 3HHXA 3SAVA 2CE7A 3QWLA 3GLIA 4DR6M 3C58A 4PDGA 4GHAA 4DV0M 4MGYE 5JI3E 3GRUA 1OJLA 4QNRA 4MGHA 3GRYA 4DV5M 1NY5A 2AHMA 1TDHA 3SASA 2Z4SA 4LY6A 3GLIB 1Z5AA 5FLXS 3GPPA 1K3WA 4ILVA 3MJ5A 2XZFA 1QANA 3GQ4A 4LJ4A 1MX0A 3KVWA 4QNMA 1QAMA 3VDPA 3AV0A 1ZAEA 3TL4X 5EXPA 3LKTM 2UXBM 3GLGB 1E32A 3HJQA 4DUYM 2Y0TA 4AI6A 3PCAM 1FJGM 1YKOA 4LJ9A 2DXIA 3VK8A 1JR3A 2QZ4A 1IXRC 5EP3A 3SMPA 1PM5A 1YKPA 1EOBB 4D80A 2XSZA 1IM2A 3JAMS 2QPAA 2Z3XA 1GL7A 3FTFA 4JYAM 4WHOA 3SBJA 3FKEA 4LF5M 3Q8XA 4XGIA 5E26A 5IWAM 3GQ5A 3SARA 4LZJA 4AQYM 5EQTA 1MU5A 4NRWA 1L1TA 2BUXB 4DR3M 4LCBA 1GKIA 3VFDA 3PCCA 3U6DA 3U5ZA 3U60A 3A98B 2QENA 1FNNA 2CEAA 1NJGA 3AL0C 1R2YA 5ITXA 1IY1A 2LNHC 2BUYA 4WHSA 3L28A 4KODA 5KPRA 2CHGA 4S12A 3MFLA 2DWNA 1IXSB 8CATA 3FUVA 2D7EA 4FWHA 1DGFA 4WW0A 4JV5M 2J7NA 2KEBA 4B08A 1L2DA 3TWKA 5EP1A 2I7NA 2Y20A 3GLFB 2RGHA 3FTDA 1HNXM 1TMXA 2CHVA 2EA0A 2V1CA 3LMXA 3K8ZA 3PNYA 3DFZA 2F5QA 1J7KA 3ZCBB 2HL7A 3HJ8A 2XSZD 4PCZA 1TH4A 1DO2A 1W5SA 2XZUA 4KHPM 3U5ZB 1N75A 5C1BA 3GPYA 2CV1A 1HQCA 1IN7A 3LXVM 3LQRA 1EO2B 1X37A 3PXGA 4FWDA 3VDUA 4WHQB 2W82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S9A A;  3LXV A;  3PCB M;  3PCB A;  2BUM A;  3MV6 A;  3MI1 A;  3MV4 A;  3PCF A;  1EOB A;  1DLM A;  1YKL B;  4WHS D;  1EOA B;  4WHO B;  1EOC B;  3T63 A;  3PCC M;  3I4Y A;  3PCK M;  3O32 A;  3PCJ A;  3T67 M;  3PCH A;  3PCL A;  3PCH M;  3PCL M;  1DLT A;  1YKO B;  2BUV B;  2PCD M;  2XSV A;  4WHO D;  2BUR B;  3PCK A;  2BUU A;  3O6J A;  3MFL M;  4WHR A;  3T67 A;  3HHX A;  3T63 M;  3PCD M;  3PCE M;  3HGI A;  3O6R A;  1YKN A;  4WHR F;  3I51 A;  1YKM A;  2AZQ A;  4ILV A;  2BUX A;  4WHR B;  2BUU B;  3PCI A;  2BUQ B;  1YKK B;  3LKT M;  3TH1 A;  3MV4 M;  2BUT B;  2XSU A;  3HJQ A;  1DMH A;  3PCA M;  1YKO A;  2BUV A;  2BV0 B;  1YKP B;  3PCI M;  1EOC A;  1EO9 B;  1EO9 A;  3LKT A;  3PCM A;  1YKP A;  1EOB B;  4WHP A;  3PCD A;  2BUW A;  3PCG M;  4WHO A;  2BUM B;  1YKL A;  3LMX M;  1YKK A;  4WHQ A;  2BUW B;  3HHY A;  2PCD A;  1DLQ A;  4WHP B;  3N9T A;  2BUX B;  3PCE A;  4ILT A;  2XSR A;  3PCC A;  2BV0 A;  1EO2 A;  3PCJ M;  2BUY A;  4WHS A;  2BUT A;  3I4V A;  3MFL A;  3HKP A;  2BUQ A;  2BUZ B;  2BUZ A;  3HJS A;  3PCG A;  1TMX A;  3PCA A;  3PCN A;  3LMX A;  2BUY B;  3HJ8 A;  2BUR A;  3PCM M;  4WHP D;  1YKM B;  3MI5 A;  5TD3 A;  2BOY A;  3MI1 M;  3MV6 M;  4WHS B;  1YKN B;  3PCF M;  3LXV M;  3MI5 M;  3PCN M;  3O5U A;  1EO2 B;  4WHQ B;  1EOA A; 
#chains in the Genus database with same CATH topology
 2Z4R A;  2CFO A;  4GH9 A;  1E9R A;  4FD2 A;  3MV6 A;  2ZM6 M;  2CRU A;  3F92 A;  1IFY A;  2E5L M;  1SXJ D;  4JI6 M;  1N33 M;  3B89 A;  2V1U A;  2OOA A;  2YFQ A;  3D8L A;  5DYI A;  4JI2 M;  2XF3 A;  2Y21 A;  4LRS A;  1EOB A;  2OQ4 A;  1YKL B;  4REZ A;  4QHS A;  1Z5B A;  1CUK A;  2VDB B;  5F3W A;  2NQ8 C;  2W82 A;  1JR3 D;  4RF1 A;  3PCC M;  2L09 A;  4FW9 A;  3I4Y A;  3BOS A;  4GEW A;  4HEO A;  1PJQ A;  2CHQ A;  2QSF X;  4BBA A;  5FSW A;  3PCJ A;  2JY5 A;  1IBK M;  3FRH A;  2L4F A;  1HNW M;  2PCD M;  2BJV A;  3B7Q A;  2BUR B;  1OAI A;  3U61 A;  3PCK A;  2P5T A;  1E94 E;  2K6B A;  2LXE A;  1GL6 A;  5ITY A;  2BUU A;  3MFL M;  3T67 A;  3AOE C;  3MMP A;  3FRI A;  3U6M A;  1G3I A;  2LH0 A;  2JY8 A;  2QHO B;  2HAK A;  3PCE M;  4NOO B;  3QAU A;  4GIP A;  4IIW A;  3SHF A;  1Q3C A;  1VDD A;  1NV9 A;  3E9S A;  1UM8 A;  2C9O A;  2R0I A;  3FTC A;  2EUC A;  3RFW A;  3UK6 A;  3UJN A;  1N32 M;  3LMM A;  1NNJ A;  1DGH A;  2JNH A;  2Y0Q A;  3FUW A;  3THG A;  2JY6 B;  2DNA A;  2ZTC A;  3T15 A;  3U6E A;  5A2Q S;  3GRR A;  4ITQ A;  4G4Q A;  2Z7J A;  3GLH A;  4CGY B;  1WR1 B;  2WSF F;  3SHG B;  1T6O A;  1GAB A;  4M0W A;  1WIV A;  4QOS A;  1JR3 E;  4OW0 A;  3KS8 A;  4LZZ A;  4FVM A;  2UUA M;  3E21 A;  1OKS A;  5ITT A;  3TH1 A;  3A46 A;  2X8A A;  1EOA A;  2CWB A;  1YSY A;  2OO9 A;  3PNV A;  4IBI A;  2BUV A;  4RF0 A;  1EOC A;  1HQY E;  1S3S A;  7CAT A;  1EO9 B;  3LKT A;  3A45 A;  1G71 A;  2M5Z A;  4I8O A;  2G3Q A;  2J5Y A;  3PCM A;  1GJT A;  4KT0 F;  1XHB A;  4AW4 A;  2KRU A;  4IBK A;  3PCD A;  4NL4 H;  5ITR A;  5BR8 M;  2QBY A;  3KDS E;  3E46 A;  3M0E A;  4OVZ B;  1R6B X;  1JB0 F;  1SXJ A;  2Q2E B;  2WSC F;  2JWS A;  3U6S A;  4DV6 M;  5FTN A;  5DNY A;  4M9X A;  1YKK A;  1QDR A;  3HHW A;  1EFU B;  3KOW E;  3HHY A;  4NSO B;  1HT1 E;  4X62 M;  1IN4 A;  4WHP B;  3LQQ A;  3N9T A;  2L7I A;  3KP1 E;  3PCE A;  4NC6 A;  3CGW A;  3K1J A;  2X4A A;  4NXM M;  1XB2 B;  3L27 A;  1TDZ A;  4GC9 A;  3T1H M;  3DZD A;  3GO8 A;  1Z5C A;  4X64 M;  2F5P A;  4ZPX A;  4IBF A;  1D0K A;  2VII A;  3KOY E;  5KO3 A;  4DR5 M;  2DAM A;  1N78 A;  1DGH B;  1Q02 A;  3T6P A;  4BLC A;  2KW0 A;  4G6Z A;  2I7P A;  3NWL A;  3HY5 A;  1SG9 A;  5LMN M;  2QQ8 A;  1OFH A;  3HZJ A;  1R2Z A;  2BUZ B;  2DAE A;  2MJ5 B;  1EE8 A;  1H6U A;  1XXH B;  2H1R A;  1IBL M;  3HJS A;  3J7B A;  1IN5 A;  2GQF A;  3PCG A;  3PCN A;  4YY3 M;  3HU3 A;  1HNZ M;  1T3T A;  3W0L B;  4IBG A;  1OIP A;  4WHP D;  4MH0 E;  1T43 A;  4AKG A;  1VEK A;  2DWZ B;  3MV6 M;  2FH0 A;  4ANR A;  4B7G A;  4DV7 M;  3FUX A;  3MI5 M;  3KOZ E;  3QYB A;  4W5W A;  3GLF E;  4LG2 A;  2ZAN A;  4MB7 A;  1N77 A;  3LXV A;  3PCB A;  3A42 A;  3HU2 A;  4NRV A;  2F5O A;  2DZO B;  2BUY B;  2X49 A;  3J80 S;  4HL4 A;  3MV4 A;  3C3E A;  4FCT A;  4UN2 B;  4MGI E;  3V76 A;  4JI1 M;  3PXG A;  4EIW A;  4IBE A;  5FTL A;  2EKF A;  2HWJ A;  1DLM A;  1SXJ B;  1XC8 A;  1TH3 A;  2HKJ A;  3NBI A;  3W68 A;  1MN3 A;  4L78 A;  2JY7 A;  1WHC A;  2C5R A;  3PCK M;  5ITU A;  3O32 A;  1YLA A;  3T67 M;  1Q39 A;  3PCL A;  3LW5 F;  2EJS A;  4IBC A;  1DLT A;  2BUV B;  3HWS A;  2XSV A;  4DR1 M;  2ZTD A;  1BVS A;  3GQ3 A;  4DR4 M;  1QAO A;  3DOA A;  4M9Z A;  4QOZ C;  3RGP A;  4B3R M;  4L6V 6;  1ZQ9 A;  4AG5 A;  2LWX A;  3TPZ A;  4X66 M;  2CP8 A;  4LJ5 A;  2LVA A;  5KQ8 A;  4KO8 A;  5JI2 E;  4JI5 M;  3HGI A;  3O6R A;  4OX9 M;  1IXS A;  1YKN A;  3EIE A;  4WHR F;  4X65 M;  2R45 A;  4LJ6 A;  3EIH A;  3I51 A;  3VLF B;  3FUT A;  1UFZ A;  4AZF A;  3L29 A;  1IY0 A;  1G8P A;  2VQF M;  2AZQ A;  3U6L A;  2KRK A;  3KS4 A;  2D7H A;  1QVR A;  1D0L A;  1TR8 A;  4FCW A;  2L4E A;  2BUX A;  3MHV C;  3KSX A;  4WHR B;  3PCI A;  2KXE A;  4B3T M;  3LCV B;  2UUB M;  3IG5 A;  4LF8 M;  2DAI A;  2F4V M;  1YKK B;  4II7 A;  5ITQ A;  3MV4 M;  2BUT B;  2DWL A;  3UZU A;  3FUU A;  1VG5 A;  3PVS A;  4GIT A;  4D81 A;  3B9P A;  1G59 A;  4L8R C;  1IN6 A;  1TGU A;  2DZL A;  3LVV A;  1DMH A;  2BV0 B;  4JI4 M;  3TE6 A;  3AFH A;  1HT2 E;  4CIZ A;  1EO9 A;  1E9S A;  4NXN M;  2YR0 A;  3H4J A;  1KYI A;  3JR4 A;  3L25 A;  2O25 A;  5L8R F;  4DV2 M;  4AG6 A;  2BJW A;  5C18 A;  5DYG A;  3U6Q A;  5EXT A;  2BUM B;  3PCG M;  3GPU A;  1YKL A;  4JI0 M;  5ITX E;  1HJP A;  3WHL A;  2O01 F;  4G4N A;  2BUW B;  3SAW A;  3J7A S;  4AKI A;  1AUA A;  3ILK A;  1NVM A;  3QYE A;  4GRI A;  4PT5 A;  2K9D A;  3TWL A;  2QCU A;  5EP4 A;  2XSR A;  4B7F A;  5EXS A;  2VF7 A;  1XWI A;  4LFB M;  2F5N A;  1EO2 A;  3PCJ M;  2R18 A;  3LVW A;  1OAO C;  4DR7 M;  1DGG A;  1IBM M;  3GLH E;  3J81 S;  4GKJ M;  2APL A;  2KZS A;  2UXD M;  3SYK A;  4B3M M;  1TTE A;  1WJ7 A;  3U6P A;  1L2B A;  3VKH A;  2FNA A;  2BUT A;  3I4V A;  2C98 A;  2VQE M;  1NHG C;  1R5L A;  3HKP A;  2G8L A;  3K2L A;  1VEJ A;  4G4O A;  1PGY A;  2BUQ A;  2LVO C;  1GO5 A;  2JA2 A;  3ZC7 B;  3U6C A;  3SAT A;  2BUZ A;  4DV4 M;  3HX3 A;  4FWG A;  1YE9 A;  4DV3 M;  5EJC A;  3PCA A;  3CF2 A;  1XXH A;  1Z59 A;  1F4I A;  5IT9 S;  5GKN A;  1NNU C;  4B3S M;  2BUR A;  1ZMU A;  1YKM B;  3J27 B;  1VQ1 A;  2R6F A;  2DWM A;  5FTK A;  1MJG M;  3VK7 A;  3MI5 A;  3MI1 M;  5TD3 A;  2JP7 A;  4QHT A;  4DBG B;  2KNV A;  4AKH A;  4LFC M;  1YKN B;  3PCN M;  3PCF M;  1PRB A;  1V34 A;  2Z8Y M;  4I81 A;  2ZAM A;  3GP1 A;  3H4M A;  3J2P B;  3AKZ A;  1S9A A;  2XH9 A;  2BNK A;  2R44 A;  2BUM A;  1J09 A;  3FYC A;  3RE8 A;  5H37 D;  3VKG A;  5LMU M;  2EO2 A;  4LF4 M;  1PJI A;  3AOG A;  3PFI A;  1EOA B;  4DUZ M;  3TWM A;  4WHO B;  2XGN A;  1EOC B;  3T63 A;  3KOX E;  2O5R A;  2RGO A;  4CJ6 A;  4DR2 M;  2QBY B;  4GC5 A;  1D2N A;  2JZ1 A;  2LBC A;  1QUT A;  2YQZ A;  4M9S A;  1NV8 A;  1L1Z A;  3PCH A;  2MR9 A;  3PCH M;  3R8F A;  1YKO B;  3FTE A;  2J7O A;  4CHT B;  2CV0 A;  1I94 M;  1WXQ A;  2R65 A;  1WGN A;  3Q8G A;  1J5E M;  3O6J A;  1L8Q A;  4DV1 M;  4WHR A;  1IY2 A;  1IQP A;  3T63 M;  4BB9 A;  1ORY B;  2RKO A;  2EKK A;  4MGK E;  1DO0 A;  2H5X A;  3ZH9 B;  5BPV A;  4L15 A;  3GPX A;  3GLI E;  2UXC M;  3PCD M;  1N36 M;  3CF0 A;  5KPT A;  2CV2 A;  2YNM D;  1G4A E;  2KDL A;  4LGY A;  5IZ7 D;  1K82 A;  4LJA A;  2KNZ A;  1AIP C;  1QQW A;  2C99 A;  1YKM A;  2ZAO A;  4IBJ A;  3GLG E;  2K47 A;  3CTW B;  2N35 A;  4A3V B;  4JI8 M;  3UMM A;  1Z6T A;  1NHW C;  1DGB A;  1VEG A;  1TF0 B;  3LCU A;  1QUS A;  3KSJ A;  2OPF A;  3D8B A;  1OFI A;  3HU1 A;  5KPZ A;  3C9P A;  2R46 A;  2BUU B;  1IN8 A;  2G5G X;  3BBZ A;  3KXE C;  1C1K A;  4KLN A;  5E6J A;  3U61 B;  2BUQ B;  2DHR A;  1PJT A;  3T38 A;  2ZBK B;  3RGS A;  4K0K M;  2XSU A;  4F2L A;  1N34 M;  1QAQ A;  4FCV A;  2R62 A;  2ERC A;  4Z8X A;  2D7G A;  4PDI A;  3BXW A;  3OTO M;  3SC3 A;  3PCI M;  2A5Y B;  1YKP B;  2C96 A;  3K9P A;  1YUB A;  1NO1 A;  2BWE A;  2FOI C;  2KA6 B;  4L16 A;  1GLN A;  1KFV A;  3AJI B;  4GHL A;  4LGM A;  2K0B X;  4MM3 B;  2UUC M;  2DEN A;  4WHP A;  2WZJ A;  1XMO M;  2UU9 M;  4I5S A;  2BUW A;  1NY6 A;  4IJE A;  5KQD A;  3LMX M;  4YHH M;  1XMQ M;  2DVW B;  1Q3B A;  5DFL A;  5EXX A;  4WHQ A;  2PCD A;  4Y28 F;  3FD9 A;  2L6O A;  4LF7 M;  1DLQ A;  3W0F A;  2XFT A;  4NSR A;  4L4U A;  1QYR A;  1XXH E;  2WSE F;  1QZE A;  4LRT A;  4LJ7 A;  3TQS A;  4ILT A;  1NSF A;  4WUR A;  2L7H A;  3R9X B;  1K3X A;  2BV0 A;  3SMS A;  3FYD A;  2HCB A;  4R7G A;  5IRE B;  3L2A A;  4RNA A;  3CF6 E;  1R7R A;  3U6O A;  4TUW A;  2JUJ A;  2R4E A;  4LF9 M;  1G41 A;  2XEP A;  4CIS A;  4OU7 A;  3C3D A;  4JN6 A;  5EP2 A;  1GJS A;  1ZV1 A;  4P16 A;  2DZN B;  2CUZ A;  3IG8 A;  4LFA M;  3M7G A;  4B7H A;  4R71 A;  2RRU A;  4IBB A;  2XFS A;  2FE8 A;  3GLF A;  4JI3 M;  4GMQ A;  1PJJ A;  3KP0 E;  3M6A A;  3GLH B;  2QP9 X;  2LVN C;  3DA1 A;  1W5T A;  2BWB A;  4HLQ A;  4I4L A;  3FE3 A;  2MH8 A;  3KW6 A;  1KSF X;  3WHK A;  4PD2 A;  4G4R A;  4G3O A;  3PCM M;  1ZMV A;  1HR0 M;  1NJF A;  3K92 A;  2HHH M;  2BOY A;  3U60 B;  1SXJ C;  1GVN A;  4JXJ A;  2C9C A;  4WHS B;  3JR5 A;  2F5S A;  1XNQ M;  2R4J A;  3O5U A;  3KFU G;  3I04 M;  2KZU A;  1Y8G A;  4R3D A;  2QNJ A;  4IBD A;  1TH2 A;  4JI7 M;  1OIZ A;  3PCB M;  4MGZ E;  4Z6Y A;  3AOE A;  2KHH A;  4OVZ A;  3SFZ A;  3MI1 A;  1QDT A;  1V92 A;  2XLJ A;  4IJF A;  3HHZ A;  3PCF A;  2V6Z M;  3GRV A;  1JQJ C;  4M0D A;  1R4G A;  1LV7 A;  1VDL A;  1XNR M;  1QZM A;  1L2C A;  4WHS D;  4D82 A;  3SYL A;  1WGL A;  3UGJ A;  2GNO A;  3MK6 A;  4XBO A;  1C7Y A;  3SAU A;  1IXZ A;  1PJS A;  3GLG A;  3PCL M;  2FFJ A;  2VF8 A;  3I01 M;  4P17 A;  1LTM A;  4WHO D;  2M60 A;  3L26 A;  4LJ8 A;  4FWD A;  1SXJ E;  3W67 A;  4LF6 M;  2DI0 A;  5FTM A;  3E4R A;  5FTJ A;  4GKK M;  3HHX A;  2MRO B;  3SAV A;  2CE7 A;  3QWL A;  3GLI A;  4DR6 M;  3IEC A;  3C58 A;  4PDG A;  4GHA A;  4DV0 M;  4MGY E;  5JI3 E;  3GRU A;  4WP2 A;  4QNR A;  4MGH A;  3GRY A;  3B7N A;  4DV5 M;  1NY5 A;  3NBX X;  2AHM A;  1TDH A;  3SAS A;  2Z4S A;  4LY6 A;  3GLI B;  1Z5A A;  2LHC A;  5FLX S;  3GPP A;  2JXN A;  1K3W A;  4ILV A;  3MJ5 A;  2XZF A;  1QAN A;  3GQ4 A;  2LVP C;  1MX0 A;  4LJ4 A;  2KNA A;  3KVW A;  1QAM A;  1P3Q Q;  1OTR A;  3AV0 A;  2LTU A;  1ZAE A;  4QNM A;  3TL4 X;  3VDP A;  5EXP A;  3ZQJ A;  3LKT M;  3K9O A;  2LVQ D;  2UXB M;  1D0M A;  3GLG B;  1E32 A;  3HJQ A;  4DUY M;  2Y0T A;  2OOB A;  4AI6 A;  3PCA M;  1FJG M;  1YKO A;  4LJ9 A;  3B74 A;  3VK8 A;  2DXI A;  1JR3 A;  2QZ4 A;  1IXR C;  5EP3 A;  3SMP A;  3B7Z A;  1PM5 A;  1YKP A;  1EOB B;  1V33 A;  4D80 A;  2XSZ A;  1IM2 A;  3JAM S;  2QPA A;  2Z3X A;  1GL7 A;  2DKL A;  3FTF A;  4JYA M;  3SBJ A;  4WHO A;  3FKE A;  4LF5 M;  2DAG A;  2LHG A;  3Q8X A;  2DHY A;  4XGI A;  5E26 A;  5IWA M;  3GQ5 A;  3SAR A;  4LZJ A;  4AQY M;  5EQT A;  1MU5 A;  4NRW A;  1L1T A;  1OQY A;  2DAK A;  2BUX B;  4DR3 M;  4LCB A;  1GKI A;  3VFD A;  3PCC A;  3U6D A;  3U5Z A;  3U60 A;  3A98 B;  2MGW A;  2QEN A;  4XK8 F;  1EIJ A;  1FNN A;  2CEA A;  1NJG A;  3AL0 C;  1R2Y A;  5ITX A;  1IY1 A;  2LNH C;  2BUY A;  4WHS A;  3L28 A;  2B3T A;  4KOD A;  5KPR A;  1RU3 A;  2CHG A;  4S12 A;  3T1Y M;  2DWN A;  1IXS B;  3MFL A;  8CAT A;  1A5T A;  3FUV A;  3IHP A;  2D7E A;  4FWH A;  1DGF A;  4WW0 A;  1DV0 A;  4JV5 M;  2L2D A;  2KEB A;  2J7N A;  2FS1 A;  4Q7J A;  3TWK A;  4B08 A;  1L2D A;  5EP1 A;  2I7N A;  2Y20 A;  3GLF B;  2RGH A;  3FTD A;  1HNX M;  1TMX A;  2CHV A;  2EA0 A;  2V1C A;  3LMX A;  4F1I A;  3K8Z A;  1ZMW A;  3DFZ A;  3PNY A;  2F5Q A;  1J7K A;  3ZCB B;  2HL7 A;  3HJ8 A;  2XSZ D;  4PCZ A;  1TH4 A;  1DO2 A;  1W5S A;  2XZU A;  4KHP M;  2JZ0 A;  3U5Z B;  1N75 A;  5C1B A;  3GPY A;  2CV1 A;  1HQC A;  1IN7 A;  3LXV M;  3LQR A;  1EO2 B;  1X37 A;  4RKU F;  1OJL A;  3VDU A;  4WHQ B;  1I4W A; 
#chains in the Genus database with same CATH homology
 2Z4R A;  2CFO A;  4GH9 A;  1E9R A;  4FD2 A;  3MV6 A;  2ZM6 M;  2E5L M;  1SXJ D;  4JI6 M;  1N33 M;  2V1U A;  5DYI A;  2YFQ A;  3D8L A;  4JI2 M;  2XF3 A;  2Y21 A;  4LRS A;  1EOB A;  2OQ4 A;  1YKL B;  4REZ A;  4QHS A;  1Z5B A;  5F3W A;  2NQ8 C;  1JR3 D;  4RF1 A;  3PCC M;  2L09 A;  4FW9 A;  3I4Y A;  3BOS A;  2CHQ A;  4BBA A;  3PCJ A;  5FSW A;  1IBK M;  1HNW M;  2PCD M;  2BJV A;  2BUR B;  3PCK A;  3U61 A;  2P5T A;  1E94 E;  2LXE A;  2BUU A;  1GL6 A;  5ITY A;  3MFL M;  3T67 A;  3AOE C;  3U6M A;  1G3I A;  2LH0 A;  3PCE M;  4NOO B;  3QAU A;  4GIP A;  4IIW A;  3SHF A;  1Q3C A;  1VDD A;  5JI2 E;  3E9S A;  1UM8 A;  2C9O A;  3T1Y M;  3FTC A;  2EUC A;  3RFW A;  3UK6 A;  3UJN A;  1N32 M;  3LMM A;  1NNJ A;  1DGH A;  2Y0Q A;  3FUW A;  3THG A;  3T15 A;  3U6E A;  5A2Q S;  3GRR A;  4ITQ A;  4G4Q A;  2Z7J A;  3GLH A;  4CGY B;  3SHG B;  4M0W A;  4QOS A;  4OW0 A;  3KS8 A;  4LZZ A;  4FVM A;  2UUA M;  5ITT A;  3TH1 A;  3A46 A;  2X8A A;  1EOA A;  1YSY A;  3PNV A;  4IBI A;  2BUV A;  4RF0 A;  1EOC A;  1HQY E;  1S3S A;  7CAT A;  1EO9 B;  3LKT A;  3A45 A;  2M5Z A;  4I8O A;  3PCM A;  1XHB A;  4AW4 A;  2KRU A;  4IBK A;  3PCD A;  4NL4 H;  5ITR A;  5BR8 M;  2QBY A;  3KDS E;  3M0E A;  4OVZ B;  1R6B X;  3U6S A;  1SXJ A;  2Q2E B;  4DV6 M;  5FTN A;  5DNY A;  4M9X A;  1YKK A;  3HHW A;  3KOW E;  3HHY A;  4NSO B;  1HT1 E;  4X62 M;  1IN4 A;  4WHP B;  3LQQ A;  3N9T A;  2L7I A;  3KP1 E;  3PCE A;  3K1J A;  2X4A A;  4NXM M;  3L27 A;  1TDZ A;  4GC9 A;  3T1H M;  3DZD A;  3GO8 A;  1Z5C A;  4X64 M;  2F5P A;  4ZPX A;  4IBF A;  2VII A;  3KOY E;  5KO3 A;  4DR5 M;  1N78 A;  1DGH B;  4BLC A;  2KW0 A;  4G6Z A;  2I7P A;  3NWL A;  5LMN M;  1R2Z A;  2BUZ B;  1OFH A;  1EE8 A;  1H6U A;  1XXH B;  2H1R A;  1IBL M;  3HJS A;  3J7B A;  1IN5 A;  3PCG A;  3PCN A;  4YY3 M;  3HU3 A;  1HNZ M;  1T3T A;  3W0L B;  4IBG A;  4WHP D;  4MH0 E;  4AKG A;  2DWZ B;  3MV6 M;  4B7G A;  4DV7 M;  3FUX A;  3MI5 M;  3KOZ E;  4W5W A;  4LG2 A;  2ZAN A;  4MB7 A;  1N77 A;  3LXV A;  3PCB A;  3A42 A;  3HU2 A;  4NRV A;  2F5O A;  2DZO B;  2X49 A;  3J80 S;  4HL4 A;  3MV4 A;  4FCT A;  4MGI E;  4JI1 M;  4EIW A;  4IBE A;  5FTL A;  1DLM A;  1SXJ B;  1XC8 A;  1TH3 A;  2HKJ A;  3NBI A;  4L78 A;  2C5R A;  3PCK M;  5ITU A;  3O32 A;  3T67 M;  1Q39 A;  3PCL A;  1DLT A;  4IBC A;  2BUV B;  2XSV A;  3HWS A;  4DR1 M;  3GQ3 A;  4DR4 M;  1QAO A;  3DOA A;  4M9Z A;  4QOZ C;  3RGP A;  4B3R M;  1I4W A;  1ZQ9 A;  4AG5 A;  2LWX A;  3TPZ A;  4X66 M;  4LJ5 A;  5KQ8 A;  4KO8 A;  4JI5 M;  3HGI A;  3O6R A;  4OX9 M;  1YKN A;  3EIE A;  4WHR F;  4X65 M;  2R45 A;  4LJ6 A;  3EIH A;  3I51 A;  3VLF B;  3FUT A;  4AZF A;  3L29 A;  1IY0 A;  1G8P A;  2VQF M;  2AZQ A;  3U6L A;  2KRK A;  3KS4 A;  2D7H A;  1QVR A;  4FCW A;  2BUX A;  3MHV C;  3KSX A;  4WHR B;  3PCI A;  2KXE A;  4B3T M;  2UUB M;  3IG5 A;  4LF8 M;  2F4V M;  1YKK B;  4II7 A;  5ITQ A;  3MV4 M;  2BUT B;  2DWL A;  3UZU A;  3FUU A;  3PVS A;  4GIT A;  1G59 A;  4D81 A;  3B9P A;  4L8R C;  1IN6 A;  1TGU A;  3LVV A;  1DMH A;  2BV0 B;  4JI4 M;  3TE6 A;  3AFH A;  1HT2 E;  1EO9 A;  1E9S A;  4NXN M;  2YR0 A;  1KYI A;  3JR4 A;  3L25 A;  4DV2 M;  4AG6 A;  2BJW A;  5C18 A;  5DYG A;  3U6Q A;  5EXT A;  2BUM B;  3PCG M;  3GPU A;  1YKL A;  4JI0 M;  5ITX E;  3WHL A;  4G4N A;  2BUW B;  3SAW A;  3J7A S;  4AKI A;  3ILK A;  1NVM A;  4GRI A;  4PT5 A;  3TWL A;  2QCU A;  5EP4 A;  2XSR A;  4B7F A;  5EXS A;  4LFB M;  1XWI A;  2F5N A;  1EO2 A;  3PCJ M;  2R18 A;  3LVW A;  4DR7 M;  1DGG A;  1IBM M;  3J81 S;  4GKJ M;  2KZS A;  2UXD M;  3SYK A;  4B3M M;  3U6P A;  1L2B A;  3VKH A;  2FNA A;  2BUT A;  3I4V A;  2C98 A;  2VQE M;  1NHG C;  3HKP A;  2G8L A;  3K2L A;  4G4O A;  2BUQ A;  2JA2 A;  3ZC7 B;  3U6C A;  3SAT A;  2BUZ A;  4DV4 M;  4FWG A;  1YE9 A;  5EJC A;  3PCA A;  3CF2 A;  1XXH A;  1Z59 A;  5IT9 S;  5GKN A;  1NNU C;  2BUR A;  1YKM B;  3J27 B;  3MI5 A;  5TD3 A;  2DWM A;  5FTK A;  3VK7 A;  3MI1 M;  4QHT A;  4AKH A;  1YKN B;  3PCF M;  4LFC M;  3PCN M;  4I81 A;  2ZAM A;  3GP1 A;  3H4M A;  3J2P B;  3AKZ A;  1S9A A;  2XH9 A;  2BNK A;  2BUM A;  1J09 A;  3FYC A;  3RE8 A;  5H37 D;  3VKG A;  5LMU M;  2EO2 A;  4LF4 M;  1PJI A;  3AOG A;  3PFI A;  1EOA B;  4DUZ M;  3TWM A;  4WHO B;  2XGN A;  1EOC B;  3T63 A;  3KOX E;  2O5R A;  2RGO A;  2QBY B;  4DR2 M;  4GC5 A;  1D2N A;  2YQZ A;  4M9S A;  1L1Z A;  3PCH A;  3PCH M;  3R8F A;  1YKO B;  3FTE A;  2J7O A;  4CHT B;  2CV0 A;  1I94 M;  1WXQ A;  2R65 A;  1J5E M;  3O6J A;  1L8Q A;  4DV1 M;  4WHR A;  1IY2 A;  1IQP A;  3T63 M;  4BB9 A;  1ORY B;  2RKO A;  4MGK E;  1DO0 A;  3ZH9 B;  5BPV A;  4L15 A;  3GPX A;  2UXC M;  3PCD M;  1N36 M;  3CF0 A;  5KPT A;  2CV2 A;  2YNM D;  1G4A E;  4LGY A;  5IZ7 D;  1K82 A;  4LJA A;  1QQW A;  2C99 A;  1YKM A;  2ZAO A;  4IBJ A;  2K47 A;  3CTW B;  4A3V B;  4JI8 M;  3UMM A;  1Z6T A;  1NHW C;  1DGB A;  3KSJ A;  2OPF A;  3D8B A;  1OFI A;  3HU1 A;  5KPZ A;  2R46 A;  2BUU B;  1IN8 A;  2G5G X;  3KXE C;  1C1K A;  4KLN A;  5E6J A;  3U61 B;  2BUQ B;  2DHR A;  3T38 A;  2ZBK B;  3RGS A;  4K0K M;  2XSU A;  1N34 M;  1QAQ A;  4FCV A;  2R62 A;  2ERC A;  4Z8X A;  2D7G A;  4PDI A;  3OTO M;  3SC3 A;  3PCI M;  2A5Y B;  1YKP B;  2C96 A;  1YUB A;  2FOI C;  2KA6 B;  4L16 A;  1GLN A;  1KFV A;  3AJI B;  4GHL A;  4LGM A;  4MM3 B;  4WHP A;  2UUC M;  2UU9 M;  1XMO M;  2BUW A;  4I5S A;  1NY6 A;  4IJE A;  5KQD A;  3LMX M;  4YHH M;  1XMQ M;  2DVW B;  1Q3B A;  5EXX A;  4WHQ A;  2PCD A;  3FD9 A;  2L6O A;  4LF7 M;  1DLQ A;  3W0F A;  2XFT A;  4NSR A;  4L4U A;  1QYR A;  4ILT A;  4LRT A;  3TQS A;  4LJ7 A;  1NSF A;  4WUR A;  2L7H A;  3R9X B;  1K3X A;  2BV0 A;  3SMS A;  3FYD A;  2HCB A;  4R7G A;  5IRE B;  3L2A A;  4RNA A;  3CF6 E;  1R7R A;  3U6O A;  4TUW A;  2R4E A;  4LF9 M;  1G41 A;  2XEP A;  4CIS A;  4OU7 A;  4JN6 A;  5EP2 A;  4P16 A;  4LFA M;  3IG8 A;  2CUZ A;  2DZN B;  3M7G A;  4B7H A;  4IBB A;  2XFS A;  2FE8 A;  3GLF A;  4JI3 M;  4GMQ A;  1PJJ A;  3KP0 E;  3M6A A;  3GLH B;  2QP9 X;  4DV3 M;  3DA1 A;  1W5T A;  4HLQ A;  4I4L A;  4B3S M;  3KW6 A;  2BUY B;  1KSF X;  3WHK A;  4PD2 A;  4G4R A;  3PCM M;  1HR0 M;  1NJF A;  3K92 A;  2HHH M;  2BOY A;  3U60 B;  1SXJ C;  1GVN A;  4JXJ A;  2C9C A;  4WHS B;  3JR5 A;  2F5S A;  1XNQ M;  2R4J A;  3O5U A;  3KFU G;  2KZU A;  4R3D A;  4IBD A;  1TH2 A;  4JI7 M;  3PCB M;  4MGZ E;  4Z6Y A;  3AOE A;  4OVZ A;  3SFZ A;  3MI1 A;  2XLJ A;  4IJF A;  3HHZ A;  3PCF A;  2V6Z M;  3GRV A;  1JQJ C;  4M0D A;  1LV7 A;  1XNR M;  1QZM A;  1L2C A;  4WHS D;  4D82 A;  3SYL A;  3UGJ A;  3MK6 A;  4XBO A;  3SAU A;  1IXZ A;  3GLG A;  3PCL M;  2FFJ A;  4WHO D;  2M60 A;  3L26 A;  4LJ8 A;  1SXJ E;  4LF6 M;  5FTM A;  3E4R A;  5FTJ A;  4GKK M;  3HHX A;  3SAV A;  2CE7 A;  3QWL A;  3GLI A;  4DR6 M;  3C58 A;  4PDG A;  4GHA A;  4DV0 M;  4MGY E;  5JI3 E;  3GRU A;  1OJL A;  4QNR A;  4MGH A;  3GRY A;  4DV5 M;  1NY5 A;  2AHM A;  1TDH A;  3SAS A;  2Z4S A;  4LY6 A;  3GLI B;  1Z5A A;  5FLX S;  3GPP A;  1K3W A;  4ILV A;  3MJ5 A;  2XZF A;  1QAN A;  3GQ4 A;  4LJ4 A;  1MX0 A;  3KVW A;  4QNM A;  1QAM A;  3VDP A;  3AV0 A;  1ZAE A;  3TL4 X;  5EXP A;  3LKT M;  2UXB M;  3GLG B;  1E32 A;  3HJQ A;  4DUY M;  2Y0T A;  4AI6 A;  3PCA M;  1FJG M;  1YKO A;  4LJ9 A;  2DXI A;  3VK8 A;  1JR3 A;  2QZ4 A;  1IXR C;  5EP3 A;  3SMP A;  1PM5 A;  1YKP A;  1EOB B;  4D80 A;  2XSZ A;  1IM2 A;  3JAM S;  2QPA A;  2Z3X A;  1GL7 A;  3FTF A;  4JYA M;  4WHO A;  3SBJ A;  3FKE A;  4LF5 M;  3Q8X A;  4XGI A;  5E26 A;  5IWA M;  3GQ5 A;  3SAR A;  4LZJ A;  4AQY M;  5EQT A;  1MU5 A;  4NRW A;  1L1T A;  2BUX B;  4DR3 M;  4LCB A;  1GKI A;  3VFD A;  3PCC A;  3U6D A;  3U5Z A;  3U60 A;  3A98 B;  2QEN A;  1FNN A;  2CEA A;  1NJG A;  3AL0 C;  1R2Y A;  5ITX A;  1IY1 A;  2LNH C;  2BUY A;  4WHS A;  3L28 A;  4KOD A;  5KPR A;  2CHG A;  4S12 A;  3MFL A;  2DWN A;  1IXS B;  8CAT A;  3FUV A;  2D7E A;  4FWH A;  1DGF A;  4WW0 A;  4JV5 M;  2J7N A;  2KEB A;  4B08 A;  1L2D A;  3TWK A;  5EP1 A;  2I7N A;  2Y20 A;  3GLF B;  2RGH A;  3FTD A;  1HNX M;  1TMX A;  2CHV A;  2EA0 A;  2V1C A;  3LMX A;  3K8Z A;  3PNY A;  3DFZ A;  2F5Q A;  1J7K A;  3ZCB B;  2HL7 A;  3HJ8 A;  2XSZ D;  4PCZ A;  1TH4 A;  1DO2 A;  1W5S A;  2XZU A;  4KHP M;  3U5Z B;  1N75 A;  5C1B A;  3GPY A;  2CV1 A;  1HQC A;  1IN7 A;  3LXV M;  3LQR A;  1EO2 B;  1X37 A;  3PXG A;  4FWD A;  3VDU A;  4WHQ B;  2W82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...