3I51A

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
total genus 70
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3i51A01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3i51A02
3T63M 3PCGM 3PCCM 4WHQB 1DLMA 1EO2B 3PCKM 2AZQA 3HKPA 4WHOB 3PCIM 3PCMM 3N9TA 2BUYB 2BUVA 2PCDM 3LXVA 3PCHA 2XSVA 3MI5M 3PCEA 3PCNM 4WHPA 1EOCB 3MFLM 3PCLA 3T63A 3MV6A 4WHQA 1EO2A 2BUVB 3PCIA 3PCMA 4WHOA 1EOAA 2BUYA 2PCDA 4WHPB 3MI5A 1YKMA 3MI1M 3PCNA 3MFLA 1DLQA 1EOCA 1EOAB 1DLTA 3PCBA 1YKMB 3LMXM 4ILVA 2BUWA 2BUZA 3I4YA 3PCGA 3PCCA 3PCKA 2BUUA 3O6RA 5TD3A 1TMXA 1DMHA 2BUWB 1YKLA 2BUZB 2BUXB 3PCAM 4WHRF 3LMXA 3PCJM 1YKKA 2BUUB 2BUQA 3HHXA 3HGIA 2XSUA 4WHSD 1YKPB 1YKLB 2BURA 4ILTA 3O32A 3TH1A 1YKKB 2BV0A 3PCDM 1EOBA 3PCAA 1YKNA 2BUQB 2BUXA 3PCFM 3PCJA 3MI1A 1S9AA 3MV4M 3T67M 3PCEM 1EO9A 2BUMB 2BUTB 1YKOA 2BURB 2BOYA 3I51A 2BV0B 3MV6M 1EOBB 1YKPA 3LKTM 1YKNB 3HJQA 4WHPD 4WHSB 4WHRA 3PCDA 3HJSA 3O5UA 3PCFA 1EO9B 1YKOB 3HHYA 4WHOD 3MV4A 3T67A 2BUTA 3I4VA 2BUMA 4WHRB 3LKTA 3O6JA 3LXVM 3PCBM 4WHSA 2XSRA 3PCHM 3HJ8A 3PCLM
chains in the Genus database with same CATH superfamily
3B7QA 2O5RA 3U6LA 3GLFB 2UUAM 2DWNA 3FUUA 2OOAA 4Q7JA 4WHOB 5BPVA 1HNWM 1J09A 5FSWA 4YY3M 2M5ZA 5H37D 4CHTB 3U6PA 1XC8A 2R65A 3GO8A 3MI5M 4LZZA 1G4AE 4LJ4A 1KFVA 1IN7A 2QQ8A 5EQTA 3HU2A 4G3OA 1XNRM 4OX9M 1G71A 3B9PA 3LVWA 4MGHA 2R4EA 1PJJA 2DAIA 4L6V6 1TDZA 4B3RM 3AOGA 3GPXA 2XZUA 4AKIA 2QP9X 1QAOA 2R45A 4B7HA 4WHPB 2MJ5B 2P5TA 2NQ8C 1QVRA 3HU1A 2OQ4A 3MI5A 2L4FA 1YKMA 2ZANA 2R18A 1DGBA 3DZDA 2LWXA 1DLQA 2LHGA 1PJTA 2FOIC 3QYBA 1NNJA 1XMOM 3U5ZA 2JZ0A 3VDUA 1DLTA 1L2BA 1WHCA 4JI7M 1GL6A 3TQSA 1ZAEA 3JR5A 4JXJA 4WURA 1JR3E 3U6EA 1LV7A 1W5SA 4DV2M 4PDGA 4LF5M 4LZJA 1UFZA 4GITA 3D8LA 3PFIA 1WGLA 3K9PA 4I8OA 4IBFA 3K1JA 4JI0M 2QBYB 3B7NA 4OVZA 4IBIA 3EIEA 1E9SA 5ITYA 2DZLA 4LF6M 5EJCA 2LH0A 2KZSA 3A42A 2X4AA 4LJ8A 5FTNA 7CATA 3KOXE 4DR3M 1YKLA 3PCAM 1XB2B 1YE9A 2CHGA 4MGYE 4G4RA 1QANA 2N35A 4I5SA 2L09A 1XXHB 2Y21A 2QSFX 4IBJA 3AKZA 2V1UA 5FTKA 4LF8M 3KSJA 1SG9A 2BUQA 3HHXA 3HGIA 1IY1A 3TWLA 4F2LA 3AV0A 2DHRA 3F92A 2WSEF 1Z6TA 4PD2A 2Y0TA 2XSUA 1GKIA 1IN4A 5IZ7D 3IG5A 1GABA 2BURA 1NNUC 4P17A 5L8RF 3FTCA 4MGIE 3SFZA 1N36M 2FS1A 4JI6M 3L25A 3PCDM 2HWJA 3PCAA 1IY2A 1YKNA 4IBDA 4R7GA 1OQYA 5LMNM 4MH0E 3L27A 3MI1A 2F4VM 1YLAA 1S9AA 4FW9A 1IN6A 2RKOA 3PCEM 2DHYA 2LHCA 1HT1E 1NJFA 1YKOA 2BOYA 1Z5CA 5JI3E 1V33A 4GRIA 3I51A 1Y8GA 3VKGA 3MV6M 3LKTM 5FLXS 2DKLA 3GRRA 4DR2M 1ZV1A 3HJQA 3C3EA 1IQPA 1NHWC 1R4GA 2QENA 1QZEA 3C58A 3PCDA 2EKFA 3PNVA 4X65M 4II7A 3E9SA 2JZ1A 2D7HA 2QPAA 3L29A 4KO8A 4B7GA 2JY6B 1NSFA 4OW0A 1NHGC 5JI2E 1IY0A 5F3WA 2AHMA 3ZQJA 1C1KA 2Q2EB 3I4VA 1VQ1A 5IWAM 3TL4X 3A46A 2LNHC 4GKJM 2BUTA 1R6BX 4KT0F 2DZOB 3LKTA 4IBBA 1DO2A 2RGHA 3U6DA 2ZTDA 3CF2A 1NY6A 4MGKE 2J7NA 3PCBM 4B3SM 1F4IA 4AQYM 4LRSA 4JI2M 4B08A 3J7AS 3PCCM 2DAKA 3UZUA 3PCKM 3HKPA 3TWKA 3BBZA 4QNRA 2B3TA 1OFHA 4B3TM 4GEWA 3N9TA 5DNYA 4L16A 4AKHA 1K82A 1SXJC 1I94M 4NXMM 2I7NA 1Q3CA 1PM5A 1XHBA 2XSVA 4NXNM 3L26A 3LW5F 1XXHE 3GLGE 1G59A 3W0LB 3U6OA 4DR7M 1N32M 1V92A 4M9ZA 4QNMA 3FD9A 1BVSA 1IXRC 1YUBA 1E32A 2BUVB 3GQ5A 2MGWA 3ZC7B 1EOAA 3B7ZA 3BXWA 4AI6A 3H4MA 1TH3A 2BJVA 2DAEA 2FNAA 3GLIA 1NV8A 1N78A 3C3DA 1T6OA 3E21A 3HWSA 1V34A 4W5WA 1IBLM 3HU3A 3SARA 4Z6YA 1IBMM 1L1ZA 2VF8A 4DV0M 1ZQ9A 2DWZB 3GRYA 5EXXA 1EOCA 3FUVA 2L7IA 4LF4M 3W68A 3DA1A 4Z8XA 1PJSA 4RNAA 4G4NA 4G6ZA 3KVWA 4FWHA 1EE8A 3KOYE 4F1IA 2CV0A 4JI8M 2APLA 2DAGA 1ZMVA 3HY5A 3VK8A 2BUWA 4P16A 3KW6A 4LGYA 3V76A 4R3DA 2DZNB 2WSCF 3GLHA 3SMSA 2BUUA 2EKKA 3DFZA 4FWGA 5TD3A 4NSRA 2JXNA 1TMXA 1IXSA 4IBGA 2BUZB 4BBAA 5ITTA 3U61A 2MR9A 3A45A 4B7FA 2G8LA 4GIPA 3JAMS 4AKGA 4TUWA 1HJPA 3UJNA 1YSYA 4B3MM 4ITQA 1H6UA 3AOEA 4M9SA 2C5RA 4I81A 5EP1A 4M0WA 3SHFA 3SYLA 2KHHA 2XGNA 2JWSA 3L2AA 3SATA 3W67A 2G5GX 3KS4A 2W82A 3U6MA 1GVNA 2YQZA 2E5LM 4JYAM 4FWDA 2R46A 1YKKB 3M0EA 3HHWA 3RGPA 1EOBA 2BV0A 4MGZE 1T43A 5FTJA 1L2DA 2BUXA 5ITXA 4X66M 4CJ6A 1QDRA 2ZBKB 4NRWA 3E4RA 1R2YA 1OAIA 3SMPA 4K0KM 1G8PA 1GL7A 2K0BX 3RGSA 1EO9A 1NJGA 2BUMB 3FUXA 1VEKA 5KPRA 4D81A 2ERCA 1KYIA 1GLNA 4DUYM 2C99A 3U60B 4S12A 1VDLA 2GNOA 4JV5M 3SHGB 3NBXX 2OPFA 4L78A 3J81S 5ITUA 3VLFB 3T15A 4IJFA 3HJSA 3SAUA 3NBIA 3GLGB 4WHRA 5C18A 4UN2B 3OTOM 1SXJA 3VK7A 4R71A 1K3WA 3KFUG 1DGGA 1N77A 3J27B 4IJEA 2LBCA 3FTEA 2EA0A 1XMQM 3RE8A 2VF7A 4QHTA 4Y28F 2VIIA 5EP3A 1VEJA 2D7EA 3RFWA 3PXGA 4PT5A 1WIVA 3GQ3A 3GLFA 3MMPA 3SASA 1WGNA 5KPTA 3SC3A 2CV2A 1PGYA 3O6JA 2F5QA 4WHSA 1TR8A 1QYRA 2XSRA 4JI1M 3PCHM 3B89A 3AFHA 1TTEA 1MJGM 1QUSA 2LVQD 3GRUA 2F5SA 1VDDA 3KP0E 2LVPC 3PCGM 2ZAMA 1DLMA 3M6AA 1OJLA 2JY5A 3LVVA 4LCBA 5EP4A 1NO1A 1NVMA 1GO5A 1DGHA 3K8ZA 2EO2A 3AOEC 3EIHA 1PJIA 1EFUB 4HLQA 4PDIA 4AG6A 3PCHA 2L7HA 3T1HM 3PCEA 3UGJA 4WHPA 2VQFM 1EOCB 3Q8XA 2CHVA 2JNHA 4GKKM 2XH9A 3MV6A 4WHQA 1IXZA 1PRBA 1WJ7A 4OU7A 1XNQM 1EO2A 3Q8GA 3MJ5A 4LG2A 1WXQA 1TF0B 1NV9A 1Z5AA 3GPUA 2CWBA 2BUYA 4M0DA 4NRVA 1QUTA 2CFOA 4FVMA 4NC6A 4GC5A 5ITRA 4NSOB 1OIPA 3HHZA 4LF9M 4JN6A 3GLHB 2ZAOA 1EIJA 1QAMA 4ZPXA 3ZCBB 1IN8A 2UUCM 4G4OA 2BUTB 3SYKA 4AW4A 4FCTA 2G3QA 1FJGM 2L2DA 2UXCM 3HX3A 3KS8A 5E26A 4LJ6A 2LXEA 5LMUM 3U61B 3PCBA 2YFQA 4DR1M 2VQEM 4KODA 2R62A 4JI3M 1YKMB 3LMXM 2I7PA 4M9XA 2L4EA 3KDSE 3T1YM 4ILVA 2HCBA 1D0MA 1G41A 2YNMD 4XGIA 2C98A 4D80A 2DWLA 1L8QA 2H1RA 1A5TA 3I04M 2F5OA 3PCCA 3PCKA 2CEAA 3U5ZB 5ITQA 4DV7M 3FTFA 2ZM6M 3O6RA 4G4QA 4X62M 3DOAA 2BWBA 2LVOC 3LQQA 3K92A 4LJ5A 1SXJD 3T38A 2Z4RA 4LJ7A 1DMHA 2CHQA 2XLJA 2DXIA 3M7GA 3PVSA 4GHLA 4IBEA 2R0IA 4MM3B 3FE3A 2BUXB 2FE8A 4WHRF 3WHLA 4LRTA 3LMXA 3PCJM 3MHVC 2Z7JA 3GPPA 2A5YB 1FNNA 4OVZB 2QNJA 4RKUF 2BNKA 1TH2A 2KNVA 3GP1A 3C9PA 1E9RA 1K3XA 2HHHM 1HT2E 3FRHA 1P3QQ 1OTRA 4WHSD 4A3VB 1YKLB 3J2PB 4IBCA 2LVAA 3D8BA 2KDLA 2RRUA 3JR4A 4DUZM 1DV0A 1GJSA 5FTLA 1J7KA 3I01M 3GLIE 4RF0A 4DV5M 4GH9A 4DR5M 2KNAA 1D0LA 3KSXA 4DR4M 1SXJB 5KQDA 1VEGA 2BUQB 2BUMA 3PCJA 3PCFM 3FYDA 2BWEA 2QZ4A 1ORYB 4LY6A 3T67M 2XF3A 1AIPC 4LFAM 5KPZA 1HNZM 3K9OA 1MX0A 2XEPA 2BURB 3TPZA 1R2ZA 4DR6M 4JI4M 1OKSA 2C9CA 3AJIB 1YKPA 1WR1B 2DWMA 1I4WA 2KRKA 1S3SA 1Z59A 3FTDA 2Z8YM 4GHAA 1YKNB 4WHPD 3IHPA 2XSZA 4WHSB 1D0KA 1QDTA 2GQFA 2MH8A 5IREB 4X64M 3PCFA 3VKHA 4FCWA 1YKOB 3HHYA 3KOZE 1IN5A 3T67A 2BJWA 2DI0A 1IM2A 3GLHE 3H4JA 4LF7M 1R5LA 1IBKM 4CISA 3LMMA 2CP8A 3FYCA 1JB0F 2CRUA 1DGHB 5DFLA 1MU5A 2HKJA 2DENA 1IFYA 5GKNA 2LTUA 3TWMA 1JR3A 2V6ZM 3AL0C 3LXVM 1KSFX 2UXBM 3E46A 3UMMA 4HL4A 4PCZA 3IECA 4QHSA 1Q39A 3HJ8A 3PCLM 4NOOB 4D82A 4XBOA 4WHQB 3T63M 1EO2B 1N33M 2AZQA 3KXEC 3VFDA 2RGOA 3PCIM 3PCMM 1T3TA 3K2LA 2R4JA 4WP2A 5FTMA 2BUYB 2XFTA 2BUVA 1E94E 1D2NA 2JY7A 2HAKA 2PCDM 5ITXE 3LXVA 1MN3A 2CUZA 4AG5A 1TH4A 4HEOA 4REZA 2UXDM 3PCNM 3NWLA 3IG8A 4JI5M 4I4LA 4KHPM 3PCLA 3MFLM 1TDHA 2WSFF 1GJTA 1QAQA 3T63A 3J7BA 4L8RC 2QHOB 3L28A 1OFIA 1Q3BA 2R44A 3PCIA 3PCMA 3VDPA 4WHOA 1N75A 3UK6A 2EUCA 1G3IA 1ZMWA 4LJ9A 4MB7A 4DV3M 3MK6A 2PCDA 2K47A 2Y20A 1UM8A 1ZMUA 1R7RA 1DGFA 1SXJE 3QAUA 2M60A 5DYIA 1NY5A 4GC9A 2DAMA 5EP2A 5KQ8A 3MI1M 3PCNA 3PNYA 3W0FA 2CV1A 2MROB 3LCVB 3MFLA 4LFCM 1EOAB 2KRUA 1OIZA 4XK8F 4L4UA 3GLIB 3GLFE 1TGUA 5BR8M 1XWIA 3QWLA 5DYGA 1LTMA 2DNAA 4FCVA 5EXTA 2OOBA 4EIWA 2J7OA 3LCUA 2KEBA 3A98B 5A2QS 1JQJC 2UUBM 1W5TA 2C9OA 4BB9A 5IT9S 2BUZA 4DV6M 3I4YA 2ZTCA 3PCGA 5EXPA 2X49A 2XSZD 2KNZA 4DV1M 2L6OA 2LVNC 5EXSA 1Z5BA 3U6CA 3R8FA 4LJAA 2OO9A 4YHHM 2F5NA 2BUWB 3QYEA 2K9DA 3J80S 2O25A 3SAWA 3R9XB 2K6BA 1VG5A 2KXEA 4IIWA 1YKKA 2BUUB 3CTWB 2XZFA 2QBYA 4QOZC 3CGWA 3SBJA 1JR3D 1J5EM 1AUAA 1IXSB 2DVWB 1HNXM 1YKPB 3U6SA 3FUWA 3FUTA 3B74A 1HR0M 4IBKA 3U60A 3T6PA 3GPYA 4ILTA 2KW0A 3O32A 3TH1A 4RF1A 8CATA 2XFSA 3ILKA 4DV4M 5E6JA 4LFBM 1OAOC 3KP1E 2KZUA 4KLNA 1XXHA 3GLGA 3MV4M 2X8AA 2D7GA 3HZJA 1X37A 2FFJA 3TE6A 3U6QA 2CE7A 1RU3A 3ZH9B 3LQRA 5KO3A 2J5YA 3BOSA 3THGA 1C7YA 2BV0B 2VDBB 1EOBB 1HQCA 1Q02A 1N34M 3WHKA 2C96A 4DBGB 4CGYB 2JP7A 1QQWA 2YR0A 2Z3XA 1HQYE 3O5UA 3SAVA 2JY8A 4ANRA 2H5XA 3GRVA 2Y0QA 4GMQA 4FD2A 2R6FA 4L15A 2EJSA 1EO9B 4WHOD 3MV4A 4WW0A 1PJQA 3GQ4A 2QCUA 4BLCA 1L2CA 2F5PA 4LGMA 2Z4SA 3FRIA 1CUKA 2KA6B 4WHRB 1L1TA 3CF6E 3KOWE 4AZFA 2HL7A 3FKEA 4QOSA 5C1BA 2JA2A 2FH0A 2O01F 4NL4H 1QZMA 4CIZA 1DO0A 2UU9M 2WZJA 2JUJA 2V1CA 3CF0A
chains in the Genus database with same CATH topology
2O5RA 3U6LA 3GLFB 2UUAM 2DWNA 3FUUA 4WHOB 5BPVA 1HNWM 1J09A 5FSWA 4YY3M 2M5ZA 5H37D 4CHTB 3U6PA 1XC8A 2R65A 3GO8A 3MI5M 4LZZA 1G4AE 4LJ4A 1KFVA 1IN7A 5EQTA 1XNRM 3HU2A 4OX9M 3B9PA 3LVWA 4MGHA 2R4EA 1PJJA 1TDZA 4B3RM 3AOGA 3GPXA 2XZUA 4AKIA 2QP9X 1QAOA 2R45A 4B7HA 4WHPB 2P5TA 3HU1A 2NQ8C 1QVRA 2OQ4A 3MI5A 1YKMA 2ZANA 2R18A 1DGBA 3DZDA 2LWXA 1DLQA 2FOIC 1NNJA 1XMOM 3U5ZA 3VDUA 1DLTA 1L2BA 4JI7M 1GL6A 3TQSA 1ZAEA 3JR5A 4JXJA 4WURA 3U6EA 1LV7A 1W5SA 4DV2M 4PDGA 4LF5M 4LZJA 4GITA 3D8LA 3PFIA 4I8OA 4IBFA 4JI0M 2QBYB 3K1JA 4OVZA 4IBIA 3EIEA 1E9SA 5ITYA 4LF6M 5EJCA 2LH0A 2KZSA 3A42A 2X4AA 4LJ8A 5FTNA 7CATA 3KOXE 4DR3M 1YKLA 3PCAM 1YE9A 2CHGA 4MGYE 4G4RA 1QANA 4I5SA 2L09A 1XXHB 2Y21A 4IBJA 3AKZA 2V1UA 5FTKA 4LF8M 3KSJA 2BUQA 3HHXA 3HGIA 1IY1A 3TWLA 3AV0A 2DHRA 4PD2A 2XSUA 1Z6TA 2Y0TA 1GKIA 1IN4A 5IZ7D 3IG5A 2BURA 1NNUC 3FTCA 4MGIE 3SFZA 1N36M 4JI6M 3L25A 3PCDM 3PCAA 1IY2A 1YKNA 4IBDA 4R7GA 5LMNM 4MH0E 3L27A 3MI1A 2F4VM 1S9AA 4FW9A 1IN6A 2RKOA 3PCEM 1NJFA 1YKOA 1HT1E 2BOYA 1Z5CA 5JI3E 4GRIA 3I51A 3VKGA 3MV6M 3LKTM 5FLXS 3GRRA 4DR2M 3HJQA 1IQPA 1NHWC 2QENA 3C58A 3PCDA 3PNVA 4X65M 4II7A 3E9SA 2D7HA 2QPAA 3L29A 4KO8A 4B7GA 1NSFA 4OW0A 1NHGC 5JI2E 1IY0A 5F3WA 2AHMA 1C1KA 2Q2EB 3I4VA 2BUTA 5IWAM 3TL4X 3A46A 2LNHC 4GKJM 2BUMA 1R6BX 2DZOB 3LKTA 4IBBA 1DO2A 2RGHA 3U6DA 4MGKE 3CF2A 1NY6A 2J7NA 3PCBM 4B3SM 4AQYM 4LRSA 4JI2M 4B08A 3J7AS 3PCCM 3UZUA 3PCKM 3HKPA 3TWKA 4QNRA 1OFHA 4B3TM 3N9TA 5DNYA 4L16A 4AKHA 1K82A 1SXJC 1I94M 4NXMM 2I7NA 1Q3CA 1PM5A 1XHBA 2XSVA 4NXNM 3L26A 1G59A 3W0LB 3U6OA 4DR7M 1N32M 4M9ZA 4QNMA 3FD9A 1IXRC 1YUBA 1E32A 2BUVB 3GQ5A 3ZC7B 1EOAA 4AI6A 3H4MA 1TH3A 2BJVA 2FNAA 3GLIA 1N78A 3HWSA 1IBLM 4W5WA 3SARA 3HU3A 4Z6YA 1IBMM 1L1ZA 4DV0M 1ZQ9A 2DWZB 3GRYA 5EXXA 1EOCA 3FUVA 2L7IA 4LF4M 3DA1A 4Z8XA 4G4NA 4RNAA 4G6ZA 3KVWA 4FWHA 1EE8A 3KOYE 2CV0A 4JI8M 3VK8A 2BUWA 4P16A 3KW6A 4LGYA 4R3DA 2DZNB 3GLHA 3SMSA 2BUUA 3DFZA 4FWGA 5TD3A 4NSRA 1TMXA 4IBGA 2BUZB 4BBAA 5ITTA 3U61A 3A45A 4B7FA 2G8LA 4GIPA 3JAMS 4AKGA 4TUWA 3UJNA 1YSYA 4B3MM 4ITQA 1H6UA 3AOEA 4M9SA 2C5RA 4I81A 5EP1A 4M0WA 3SHFA 3SYLA 2XGNA 3L2AA 3SATA 2G5GX 3KS4A 2W82A 3U6MA 1GVNA 2YQZA 2E5LM 4JYAM 4FWDA 2R46A 1YKKB 3M0EA 3HHWA 3RGPA 1EOBA 2BV0A 4MGZE 5FTJA 1L2DA 2BUXA 5ITXA 4X66M 2ZBKB 4NRWA 3E4RA 1R2YA 3SMPA 4K0KM 1G8PA 1GL7A 3RGSA 1EO9A 2BUMB 1NJGA 2BUTB 3FUXA 5KPRA 4D81A 2ERCA 1KYIA 1GLNA 4DUYM 2C99A 3U60B 4S12A 4JV5M 3SHGB 2OPFA 4L78A 3J81S 5ITUA 3VLFB 3T15A 4IJFA 3HJSA 3SAUA 3NBIA 3GLGB 4WHRA 5C18A 3OTOM 1SXJA 3VK7A 1K3WA 3KFUG 1DGGA 1N77A 3J27B 4IJEA 3FTEA 2EA0A 1XMQM 3RE8A 4QHTA 5EP3A 2VIIA 2D7EA 3RFWA 3GQ3A 3PXGA 4PT5A 3GLFA 3SASA 5KPTA 3SC3A 2CV2A 3O6JA 2F5QA 4WHSA 1QYRA 2XSRA 4JI1M 3PCHM 3AFHA 3GRUA 2F5SA 1VDDA 3KP0E 3PCGM 2ZAMA 1DLMA 3M6AA 1OJLA 3LVVA 4LCBA 5EP4A 1NVMA 1DGHA 3K8ZA 2EO2A 3AOEC 3EIHA 1PJIA 4HLQA 4PDIA 4AG6A 3PCHA 2L7HA 3T1HM 3PCEA 3UGJA 4WHPA 2VQFM 1EOCB 3Q8XA 2CHVA 4GKKM 2XH9A 3MV6A 4WHQA 1IXZA 4OU7A 1XNQM 1EO2A 3MJ5A 4LG2A 1WXQA 1Z5AA 3GPUA 2BUYA 4M0DA 4NRVA 2CFOA 4FVMA 4GC5A 5ITRA 4NSOB 3HHZA 4LF9M 4JN6A 3GLHB 2ZAOA 1QAMA 4ZPXA 3ZCBB 1IN8A 2UUCM 4G4OA 3SYKA 4AW4A 4FCTA 1FJGM 2UXCM 3KS8A 5E26A 4LJ6A 2LXEA 5LMUM 3U61B 3PCBA 2YFQA 4DR1M 2VQEM 4KODA 2R62A 4JI3M 1YKMB 3LMXM 2I7PA 4M9XA 3KDSE 3T1YM 4ILVA 2HCBA 2YNMD 1G41A 4XGIA 2C98A 4D80A 2DWLA 1L8QA 2H1RA 2F5OA 3PCCA 3PCKA 2CEAA 3U5ZB 5ITQA 4DV7M 3FTFA 2ZM6M 3O6RA 4G4QA 4X62M 3DOAA 3LQQA 3T38A 3K92A 4LJ5A 1SXJD 2Z4RA 4LJ7A 1DMHA 2CHQA 2XLJA 2DXIA 3M7GA 3PVSA 4GHLA 4IBEA 4MM3B 2BUXB 2FE8A 4WHRF 3WHLA 4LRTA 3LMXA 3PCJM 3MHVC 2Z7JA 3GPPA 2A5YB 1FNNA 4OVZB 2BNKA 1TH2A 3GP1A 1E9RA 1K3XA 2HHHM 1HT2E 4WHSD 4A3VB 1YKLB 3J2PB 4IBCA 3D8BA 3JR4A 4DUZM 5FTLA 1J7KA 4RF0A 4DV5M 4GH9A 4DR5M 2BUQB 3KSXA 4DR4M 1SXJB 5KQDA 3PCJA 3PCFM 3FYDA 3T67M 2QZ4A 1ORYB 4LY6A 2XF3A 4LFAM 5KPZA 1HNZM 1MX0A 2XEPA 2BURB 3TPZA 1R2ZA 4DR6M 4JI4M 2C9CA 3AJIB 1YKPA 1YKNB 2DWMA 1I4WA 2KRKA 1S3SA 1Z59A 3FTDA 4GHAA 4WHPD 2XSZA 4WHSB 4X64M 5IREB 3PCFA 3VKHA 4FCWA 1YKOB 3HHYA 3KOZE 1IN5A 3T67A 2BJWA 1IM2A 4LF7M 1IBKM 4CISA 3LMMA 3FYCA 1DGHB 1MU5A 2HKJA 5GKNA 3TWMA 1JR3A 2V6ZM 3AL0C 3LXVM 1KSFX 2UXBM 3UMMA 4HL4A 4PCZA 4QHSA 1Q39A 3HJ8A 3PCLM 4NOOB 4D82A 4XBOA 4WHQB 3T63M 1EO2B 1N33M 2AZQA 3KXEC 3VFDA 2RGOA 3PCIM 3PCMM 1T3TA 3K2LA 2R4JA 5FTMA 2BUYB 2XFTA 2BUVA 1E94E 1D2NA 2PCDM 3LXVA 5ITXE 2CUZA 4AG5A 1TH4A 4REZA 2UXDM 3PCNM 3NWLA 3IG8A 4JI5M 4I4LA 4KHPM 3PCLA 3MFLM 1TDHA 3T63A 1QAQA 3J7BA 4L8RC 3L28A 1OFIA 1Q3BA 3PCIA 3PCMA 4WHOA 3VDPA 1N75A 3UK6A 2EUCA 1G3IA 4LJ9A 4MB7A 4DV3M 3MK6A 2PCDA 2K47A 2Y20A 1UM8A 1R7RA 1DGFA 1SXJE 3QAUA 2M60A 5DYIA 1NY5A 4GC9A 5EP2A 3MI1M 5KQ8A 3PCNA 3PNYA 3W0FA 2CV1A 3MFLA 4LFCM 1EOAB 2KRUA 4L4UA 3GLIB 1TGUA 5BR8M 1XWIA 3QWLA 5DYGA 5EXTA 4FCVA 4EIWA 2J7OA 2KEBA 3A98B 5A2QS 1JQJC 2UUBM 1W5TA 2C9OA 4BB9A 5IT9S 2BUZA 4DV6M 3I4YA 3PCGA 5EXPA 2X49A 2XSZD 4DV1M 2L6OA 5EXSA 1Z5BA 3U6CA 3R8FA 4LJAA 4YHHM 2F5NA 2BUWB 3J80S 3SAWA 3R9XB 2KXEA 4IIWA 1YKKA 2BUUB 3CTWB 2XZFA 2QBYA 4QOZC 3SBJA 1JR3D 1J5EM 2DVWB 1IXSB 1HNXM 1YKPB 3U6SA 3FUWA 3FUTA 1HR0M 4IBKA 3U60A 3GPYA 4ILTA 2KW0A 3O32A 3TH1A 4RF1A 8CATA 2XFSA 3ILKA 4DV4M 5E6JA 4LFBM 3KP1E 2KZUA 4KLNA 1XXHA 3GLGA 3MV4M 2X8AA 2D7GA 1X37A 2FFJA 3TE6A 3U6QA 2CE7A 3ZH9B 3LQRA 5KO3A 3BOSA 3THGA 2BV0B 1EOBB 1HQCA 1N34M 3WHKA 2C96A 4CGYB 1QQWA 2YR0A 2Z3XA 1HQYE 3O5UA 3SAVA 3GRVA 1EO9B 2Y0QA 4GMQA 4FD2A 4L15A 4WHOD 3MV4A 4WW0A 3GQ4A 2QCUA 4BLCA 1L2CA 2F5PA 4LGMA 2Z4SA 4WHRB 2KA6B 1L1TA 3CF6E 3KOWE 4AZFA 2HL7A 3FKEA 4QOSA 5C1BA 2JA2A 4NL4H 1QZMA 2UU9M 1DO0A 2V1CA 3CF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T63 M;  3PCG M;  3PCC M;  4WHQ B;  1DLM A;  1EO2 B;  3PCK M;  2AZQ A;  3HKP A;  4WHO B;  3PCI M;  3PCM M;  3N9T A;  2BUY B;  2BUV A;  2PCD M;  3LXV A;  3PCH A;  2XSV A;  3MI5 M;  3PCE A;  3PCN M;  4WHP A;  1EOC B;  3MFL M;  3PCL A;  3T63 A;  3MV6 A;  4WHQ A;  1EO2 A;  2BUV B;  3PCI A;  3PCM A;  4WHO A;  1EOA A;  2BUY A;  2PCD A;  4WHP B;  3MI5 A;  1YKM A;  3MI1 M;  3PCN A;  3MFL A;  1DLQ A;  1EOC A;  1EOA B;  1DLT A;  3PCB A;  1YKM B;  3LMX M;  4ILV A;  2BUW A;  2BUZ A;  3I4Y A;  3PCG A;  3PCC A;  3PCK A;  2BUU A;  3O6R A;  5TD3 A;  1TMX A;  1DMH A;  2BUW B;  1YKL A;  2BUZ B;  2BUX B;  3PCA M;  4WHR F;  3LMX A;  3PCJ M;  1YKK A;  2BUU B;  2BUQ A;  3HHX A;  3HGI A;  2XSU A;  4WHS D;  1YKP B;  1YKL B;  2BUR A;  4ILT A;  3O32 A;  3TH1 A;  1YKK B;  2BV0 A;  3PCD M;  1EOB A;  3PCA A;  1YKN A;  2BUQ B;  2BUX A;  3PCF M;  3PCJ A;  3MI1 A;  1S9A A;  3MV4 M;  3T67 M;  3PCE M;  1EO9 A;  2BUM B;  2BUT B;  1YKO A;  2BUR B;  2BOY A;  3I51 A;  2BV0 B;  3MV6 M;  1EOB B;  1YKP A;  3LKT M;  1YKN B;  3HJQ A;  4WHP D;  4WHS B;  4WHR A;  3PCD A;  3HJS A;  3O5U A;  3PCF A;  1EO9 B;  1YKO B;  3HHY A;  4WHO D;  3MV4 A;  3T67 A;  2BUT A;  3I4V A;  2BUM A;  4WHR B;  3LKT A;  3O6J A;  3LXV M;  3PCB M;  4WHS A;  2XSR A;  3PCH M;  3HJ8 A;  3PCL M; 
#chains in the Genus database with same CATH topology
 3B7Q A;  2O5R A;  3U6L A;  3GLF B;  2UUA M;  2DWN A;  3FUU A;  2OOA A;  4Q7J A;  4WHO B;  5BPV A;  1HNW M;  1J09 A;  5FSW A;  4YY3 M;  2M5Z A;  5H37 D;  4CHT B;  3U6P A;  1XC8 A;  2R65 A;  3GO8 A;  3MI5 M;  4LZZ A;  1G4A E;  4LJ4 A;  1KFV A;  1IN7 A;  2QQ8 A;  5EQT A;  3HU2 A;  4G3O A;  1XNR M;  4OX9 M;  1G71 A;  3B9P A;  3LVW A;  4MGH A;  2R4E A;  1PJJ A;  2DAI A;  4L6V 6;  1TDZ A;  4B3R M;  3AOG A;  3GPX A;  2XZU A;  4AKI A;  2QP9 X;  1QAO A;  2R45 A;  4B7H A;  4WHP B;  2MJ5 B;  2P5T A;  2NQ8 C;  1QVR A;  3HU1 A;  2OQ4 A;  3MI5 A;  2L4F A;  1YKM A;  2ZAN A;  2R18 A;  1DGB A;  3DZD A;  2LWX A;  1DLQ A;  2LHG A;  1PJT A;  2FOI C;  3QYB A;  1NNJ A;  1XMO M;  3U5Z A;  2JZ0 A;  3VDU A;  1DLT A;  1L2B A;  1WHC A;  4JI7 M;  1GL6 A;  3TQS A;  1ZAE A;  3JR5 A;  4JXJ A;  4WUR A;  1JR3 E;  3U6E A;  1LV7 A;  1W5S A;  4DV2 M;  4PDG A;  4LF5 M;  4LZJ A;  1UFZ A;  4GIT A;  3D8L A;  3PFI A;  1WGL A;  3K9P A;  4I8O A;  4IBF A;  3K1J A;  4JI0 M;  2QBY B;  3B7N A;  4OVZ A;  4IBI A;  3EIE A;  1E9S A;  5ITY A;  2DZL A;  4LF6 M;  5EJC A;  2LH0 A;  2KZS A;  3A42 A;  2X4A A;  4LJ8 A;  5FTN A;  7CAT A;  3KOX E;  4DR3 M;  1YKL A;  3PCA M;  1XB2 B;  1YE9 A;  2CHG A;  4MGY E;  4G4R A;  1QAN A;  2N35 A;  4I5S A;  2L09 A;  1XXH B;  2Y21 A;  2QSF X;  4IBJ A;  3AKZ A;  2V1U A;  5FTK A;  4LF8 M;  3KSJ A;  1SG9 A;  2BUQ A;  3HHX A;  3HGI A;  1IY1 A;  3TWL A;  4F2L A;  3AV0 A;  2DHR A;  3F92 A;  2WSE F;  1Z6T A;  4PD2 A;  2Y0T A;  2XSU A;  1GKI A;  1IN4 A;  5IZ7 D;  3IG5 A;  1GAB A;  2BUR A;  1NNU C;  4P17 A;  5L8R F;  3FTC A;  4MGI E;  3SFZ A;  1N36 M;  2FS1 A;  4JI6 M;  3L25 A;  3PCD M;  2HWJ A;  3PCA A;  1IY2 A;  1YKN A;  4IBD A;  4R7G A;  1OQY A;  5LMN M;  4MH0 E;  3L27 A;  3MI1 A;  2F4V M;  1YLA A;  1S9A A;  4FW9 A;  1IN6 A;  2RKO A;  3PCE M;  2DHY A;  2LHC A;  1HT1 E;  1NJF A;  1YKO A;  2BOY A;  1Z5C A;  5JI3 E;  1V33 A;  4GRI A;  3I51 A;  1Y8G A;  3VKG A;  3MV6 M;  3LKT M;  5FLX S;  2DKL A;  3GRR A;  4DR2 M;  1ZV1 A;  3HJQ A;  3C3E A;  1IQP A;  1NHW C;  1R4G A;  2QEN A;  1QZE A;  3C58 A;  3PCD A;  2EKF A;  3PNV A;  4X65 M;  4II7 A;  3E9S A;  2JZ1 A;  2D7H A;  2QPA A;  3L29 A;  4KO8 A;  4B7G A;  2JY6 B;  1NSF A;  4OW0 A;  1NHG C;  5JI2 E;  1IY0 A;  5F3W A;  2AHM A;  3ZQJ A;  1C1K A;  2Q2E B;  3I4V A;  1VQ1 A;  5IWA M;  3TL4 X;  3A46 A;  2LNH C;  4GKJ M;  2BUT A;  1R6B X;  4KT0 F;  2DZO B;  3LKT A;  4IBB A;  1DO2 A;  2RGH A;  3U6D A;  2ZTD A;  3CF2 A;  1NY6 A;  4MGK E;  2J7N A;  3PCB M;  4B3S M;  1F4I A;  4AQY M;  4LRS A;  4JI2 M;  4B08 A;  3J7A S;  3PCC M;  2DAK A;  3UZU A;  3PCK M;  3HKP A;  3TWK A;  3BBZ A;  4QNR A;  2B3T A;  1OFH A;  4B3T M;  4GEW A;  3N9T A;  5DNY A;  4L16 A;  4AKH A;  1K82 A;  1SXJ C;  1I94 M;  4NXM M;  2I7N A;  1Q3C A;  1PM5 A;  1XHB A;  2XSV A;  4NXN M;  3L26 A;  3LW5 F;  1XXH E;  3GLG E;  1G59 A;  3W0L B;  3U6O A;  4DR7 M;  1N32 M;  1V92 A;  4M9Z A;  4QNM A;  3FD9 A;  1BVS A;  1IXR C;  1YUB A;  1E32 A;  2BUV B;  3GQ5 A;  2MGW A;  3ZC7 B;  1EOA A;  3B7Z A;  3BXW A;  4AI6 A;  3H4M A;  1TH3 A;  2BJV A;  2DAE A;  2FNA A;  3GLI A;  1NV8 A;  1N78 A;  3C3D A;  1T6O A;  3E21 A;  3HWS A;  1V34 A;  4W5W A;  1IBL M;  3HU3 A;  3SAR A;  4Z6Y A;  1IBM M;  1L1Z A;  2VF8 A;  4DV0 M;  1ZQ9 A;  2DWZ B;  3GRY A;  5EXX A;  1EOC A;  3FUV A;  2L7I A;  4LF4 M;  3W68 A;  3DA1 A;  4Z8X A;  1PJS A;  4RNA A;  4G4N A;  4G6Z A;  3KVW A;  4FWH A;  1EE8 A;  3KOY E;  4F1I A;  2CV0 A;  4JI8 M;  2APL A;  2DAG A;  1ZMV A;  3HY5 A;  3VK8 A;  2BUW A;  4P16 A;  3KW6 A;  4LGY A;  3V76 A;  4R3D A;  2DZN B;  2WSC F;  3GLH A;  3SMS A;  2BUU A;  2EKK A;  3DFZ A;  4FWG A;  5TD3 A;  4NSR A;  2JXN A;  1TMX A;  1IXS A;  4IBG A;  2BUZ B;  4BBA A;  5ITT A;  3U61 A;  2MR9 A;  3A45 A;  4B7F A;  2G8L A;  4GIP A;  3JAM S;  4AKG A;  4TUW A;  1HJP A;  3UJN A;  1YSY A;  4B3M M;  4ITQ A;  1H6U A;  3AOE A;  4M9S A;  2C5R A;  4I81 A;  5EP1 A;  4M0W A;  3SHF A;  3SYL A;  2KHH A;  2XGN A;  2JWS A;  3L2A A;  3SAT A;  3W67 A;  2G5G X;  3KS4 A;  2W82 A;  3U6M A;  1GVN A;  2YQZ A;  2E5L M;  4JYA M;  4FWD A;  2R46 A;  1YKK B;  3M0E A;  3HHW A;  3RGP A;  1EOB A;  2BV0 A;  4MGZ E;  1T43 A;  5FTJ A;  1L2D A;  2BUX A;  5ITX A;  4X66 M;  4CJ6 A;  1QDR A;  2ZBK B;  4NRW A;  3E4R A;  1R2Y A;  1OAI A;  3SMP A;  4K0K M;  1G8P A;  1GL7 A;  2K0B X;  3RGS A;  1EO9 A;  1NJG A;  2BUM B;  3FUX A;  1VEK A;  5KPR A;  4D81 A;  2ERC A;  1KYI A;  1GLN A;  4DUY M;  2C99 A;  3U60 B;  4S12 A;  1VDL A;  2GNO A;  4JV5 M;  3SHG B;  3NBX X;  2OPF A;  4L78 A;  3J81 S;  5ITU A;  3VLF B;  3T15 A;  4IJF A;  3HJS A;  3SAU A;  3NBI A;  3GLG B;  4WHR A;  5C18 A;  4UN2 B;  3OTO M;  1SXJ A;  3VK7 A;  4R71 A;  1K3W A;  3KFU G;  1DGG A;  1N77 A;  3J27 B;  4IJE A;  2LBC A;  3FTE A;  2EA0 A;  1XMQ M;  3RE8 A;  2VF7 A;  4QHT A;  4Y28 F;  2VII A;  5EP3 A;  1VEJ A;  2D7E A;  3RFW A;  3PXG A;  4PT5 A;  1WIV A;  3GQ3 A;  3GLF A;  3MMP A;  3SAS A;  1WGN A;  5KPT A;  3SC3 A;  2CV2 A;  1PGY A;  3O6J A;  2F5Q A;  4WHS A;  1TR8 A;  1QYR A;  2XSR A;  4JI1 M;  3PCH M;  3B89 A;  3AFH A;  1TTE A;  1MJG M;  1QUS A;  2LVQ D;  3GRU A;  2F5S A;  1VDD A;  3KP0 E;  2LVP C;  3PCG M;  2ZAM A;  1DLM A;  3M6A A;  1OJL A;  2JY5 A;  3LVV A;  4LCB A;  5EP4 A;  1NO1 A;  1NVM A;  1GO5 A;  1DGH A;  3K8Z A;  2EO2 A;  3AOE C;  3EIH A;  1PJI A;  1EFU B;  4HLQ A;  4PDI A;  4AG6 A;  3PCH A;  2L7H A;  3T1H M;  3PCE A;  3UGJ A;  4WHP A;  2VQF M;  1EOC B;  3Q8X A;  2CHV A;  2JNH A;  4GKK M;  2XH9 A;  3MV6 A;  4WHQ A;  1IXZ A;  1PRB A;  1WJ7 A;  4OU7 A;  1XNQ M;  1EO2 A;  3Q8G A;  3MJ5 A;  4LG2 A;  1WXQ A;  1TF0 B;  1NV9 A;  1Z5A A;  3GPU A;  2CWB A;  2BUY A;  4M0D A;  4NRV A;  1QUT A;  2CFO A;  4FVM A;  4NC6 A;  4GC5 A;  5ITR A;  4NSO B;  1OIP A;  3HHZ A;  4LF9 M;  4JN6 A;  3GLH B;  2ZAO A;  1EIJ A;  1QAM A;  4ZPX A;  3ZCB B;  1IN8 A;  2UUC M;  4G4O A;  2BUT B;  3SYK A;  4AW4 A;  4FCT A;  2G3Q A;  1FJG M;  2L2D A;  2UXC M;  3HX3 A;  3KS8 A;  5E26 A;  4LJ6 A;  2LXE A;  5LMU M;  3U61 B;  3PCB A;  2YFQ A;  4DR1 M;  2VQE M;  4KOD A;  2R62 A;  4JI3 M;  1YKM B;  3LMX M;  2I7P A;  4M9X A;  2L4E A;  3KDS E;  3T1Y M;  4ILV A;  2HCB A;  1D0M A;  1G41 A;  2YNM D;  4XGI A;  2C98 A;  4D80 A;  2DWL A;  1L8Q A;  2H1R A;  1A5T A;  3I04 M;  2F5O A;  3PCC A;  3PCK A;  2CEA A;  3U5Z B;  5ITQ A;  4DV7 M;  3FTF A;  2ZM6 M;  3O6R A;  4G4Q A;  4X62 M;  3DOA A;  2BWB A;  2LVO C;  3LQQ A;  3K92 A;  4LJ5 A;  1SXJ D;  3T38 A;  2Z4R A;  4LJ7 A;  1DMH A;  2CHQ A;  2XLJ A;  2DXI A;  3M7G A;  3PVS A;  4GHL A;  4IBE A;  2R0I A;  4MM3 B;  3FE3 A;  2BUX B;  2FE8 A;  4WHR F;  3WHL A;  4LRT A;  3LMX A;  3PCJ M;  3MHV C;  2Z7J A;  3GPP A;  2A5Y B;  1FNN A;  4OVZ B;  2QNJ A;  4RKU F;  2BNK A;  1TH2 A;  2KNV A;  3GP1 A;  3C9P A;  1E9R A;  1K3X A;  2HHH M;  1HT2 E;  3FRH A;  1P3Q Q;  1OTR A;  4WHS D;  4A3V B;  1YKL B;  3J2P B;  4IBC A;  2LVA A;  3D8B A;  2KDL A;  2RRU A;  3JR4 A;  4DUZ M;  1DV0 A;  1GJS A;  5FTL A;  1J7K A;  3I01 M;  3GLI E;  4RF0 A;  4DV5 M;  4GH9 A;  4DR5 M;  2KNA A;  1D0L A;  3KSX A;  4DR4 M;  1SXJ B;  5KQD A;  1VEG A;  2BUQ B;  2BUM A;  3PCJ A;  3PCF M;  3FYD A;  2BWE A;  2QZ4 A;  1ORY B;  4LY6 A;  3T67 M;  2XF3 A;  1AIP C;  4LFA M;  5KPZ A;  1HNZ M;  3K9O A;  1MX0 A;  2XEP A;  2BUR B;  3TPZ A;  1R2Z A;  4DR6 M;  4JI4 M;  1OKS A;  2C9C A;  3AJI B;  1YKP A;  1WR1 B;  2DWM A;  1I4W A;  2KRK A;  1S3S A;  1Z59 A;  3FTD A;  2Z8Y M;  4GHA A;  1YKN B;  4WHP D;  3IHP A;  2XSZ A;  4WHS B;  1D0K A;  1QDT A;  2GQF A;  2MH8 A;  5IRE B;  4X64 M;  3PCF A;  3VKH A;  4FCW A;  1YKO B;  3HHY A;  3KOZ E;  1IN5 A;  3T67 A;  2BJW A;  2DI0 A;  1IM2 A;  3GLH E;  3H4J A;  4LF7 M;  1R5L A;  1IBK M;  4CIS A;  3LMM A;  2CP8 A;  3FYC A;  1JB0 F;  2CRU A;  1DGH B;  5DFL A;  1MU5 A;  2HKJ A;  2DEN A;  1IFY A;  5GKN A;  2LTU A;  3TWM A;  1JR3 A;  2V6Z M;  3AL0 C;  3LXV M;  1KSF X;  2UXB M;  3E46 A;  3UMM A;  4HL4 A;  4PCZ A;  3IEC A;  4QHS A;  1Q39 A;  3HJ8 A;  3PCL M;  4NOO B;  4D82 A;  4XBO A;  4WHQ B;  3T63 M;  1EO2 B;  1N33 M;  2AZQ A;  3KXE C;  3VFD A;  2RGO A;  3PCI M;  3PCM M;  1T3T A;  3K2L A;  2R4J A;  4WP2 A;  5FTM A;  2BUY B;  2XFT A;  2BUV A;  1E94 E;  1D2N A;  2JY7 A;  2HAK A;  2PCD M;  5ITX E;  3LXV A;  1MN3 A;  2CUZ A;  4AG5 A;  1TH4 A;  4HEO A;  4REZ A;  2UXD M;  3PCN M;  3NWL A;  3IG8 A;  4JI5 M;  4I4L A;  4KHP M;  3PCL A;  3MFL M;  1TDH A;  2WSF F;  1GJT A;  1QAQ A;  3T63 A;  3J7B A;  4L8R C;  2QHO B;  3L28 A;  1OFI A;  1Q3B A;  2R44 A;  3PCI A;  3PCM A;  3VDP A;  4WHO A;  1N75 A;  3UK6 A;  2EUC A;  1G3I A;  1ZMW A;  4LJ9 A;  4MB7 A;  4DV3 M;  3MK6 A;  2PCD A;  2K47 A;  2Y20 A;  1UM8 A;  1ZMU A;  1R7R A;  1DGF A;  1SXJ E;  3QAU A;  2M60 A;  5DYI A;  1NY5 A;  4GC9 A;  2DAM A;  5EP2 A;  5KQ8 A;  3MI1 M;  3PCN A;  3PNY A;  3W0F A;  2CV1 A;  2MRO B;  3LCV B;  3MFL A;  4LFC M;  1EOA B;  2KRU A;  1OIZ A;  4XK8 F;  4L4U A;  3GLI B;  3GLF E;  1TGU A;  5BR8 M;  1XWI A;  3QWL A;  5DYG A;  1LTM A;  2DNA A;  4FCV A;  5EXT A;  2OOB A;  4EIW A;  2J7O A;  3LCU A;  2KEB A;  3A98 B;  5A2Q S;  1JQJ C;  2UUB M;  1W5T A;  2C9O A;  4BB9 A;  5IT9 S;  2BUZ A;  4DV6 M;  3I4Y A;  2ZTC A;  3PCG A;  5EXP A;  2X49 A;  2XSZ D;  2KNZ A;  4DV1 M;  2L6O A;  2LVN C;  5EXS A;  1Z5B A;  3U6C A;  3R8F A;  4LJA A;  2OO9 A;  4YHH M;  2F5N A;  2BUW B;  3QYE A;  2K9D A;  3J80 S;  2O25 A;  3SAW A;  3R9X B;  2K6B A;  1VG5 A;  2KXE A;  4IIW A;  1YKK A;  2BUU B;  3CTW B;  2XZF A;  2QBY A;  4QOZ C;  3CGW A;  3SBJ A;  1JR3 D;  1J5E M;  1AUA A;  1IXS B;  2DVW B;  1HNX M;  1YKP B;  3U6S A;  3FUW A;  3FUT A;  3B74 A;  1HR0 M;  4IBK A;  3U60 A;  3T6P A;  3GPY A;  4ILT A;  2KW0 A;  3O32 A;  3TH1 A;  4RF1 A;  8CAT A;  2XFS A;  3ILK A;  4DV4 M;  5E6J A;  4LFB M;  1OAO C;  3KP1 E;  2KZU A;  4KLN A;  1XXH A;  3GLG A;  3MV4 M;  2X8A A;  2D7G A;  3HZJ A;  1X37 A;  2FFJ A;  3TE6 A;  3U6Q A;  2CE7 A;  1RU3 A;  3ZH9 B;  3LQR A;  5KO3 A;  2J5Y A;  3BOS A;  3THG A;  1C7Y A;  2BV0 B;  2VDB B;  1EOB B;  1HQC A;  1Q02 A;  1N34 M;  3WHK A;  2C96 A;  4DBG B;  4CGY B;  2JP7 A;  1QQW A;  2YR0 A;  2Z3X A;  1HQY E;  3O5U A;  3SAV A;  2JY8 A;  4ANR A;  2H5X A;  3GRV A;  2Y0Q A;  4GMQ A;  4FD2 A;  2R6F A;  4L15 A;  2EJS A;  1EO9 B;  4WHO D;  3MV4 A;  4WW0 A;  1PJQ A;  3GQ4 A;  2QCU A;  4BLC A;  1L2C A;  2F5P A;  4LGM A;  2Z4S A;  3FRI A;  1CUK A;  2KA6 B;  4WHR B;  1L1T A;  3CF6 E;  3KOW E;  4AZF A;  2HL7 A;  3FKE A;  4QOS A;  5C1B A;  2JA2 A;  2FH0 A;  2O01 F;  4NL4 H;  1QZM A;  4CIZ A;  1DO0 A;  2UU9 M;  2WZJ A;  2JUJ A;  2V1C A;  3CF0 A; 
#chains in the Genus database with same CATH homology
 2O5R A;  3U6L A;  3GLF B;  2UUA M;  2DWN A;  3FUU A;  4WHO B;  5BPV A;  1HNW M;  1J09 A;  5FSW A;  4YY3 M;  2M5Z A;  5H37 D;  4CHT B;  3U6P A;  1XC8 A;  2R65 A;  3GO8 A;  3MI5 M;  4LZZ A;  1G4A E;  4LJ4 A;  1KFV A;  1IN7 A;  5EQT A;  1XNR M;  3HU2 A;  4OX9 M;  3B9P A;  3LVW A;  4MGH A;  2R4E A;  1PJJ A;  1TDZ A;  4B3R M;  3AOG A;  3GPX A;  2XZU A;  4AKI A;  2QP9 X;  1QAO A;  2R45 A;  4B7H A;  4WHP B;  2P5T A;  3HU1 A;  2NQ8 C;  1QVR A;  2OQ4 A;  3MI5 A;  1YKM A;  2ZAN A;  2R18 A;  1DGB A;  3DZD A;  2LWX A;  1DLQ A;  2FOI C;  1NNJ A;  1XMO M;  3U5Z A;  3VDU A;  1DLT A;  1L2B A;  4JI7 M;  1GL6 A;  3TQS A;  1ZAE A;  3JR5 A;  4JXJ A;  4WUR A;  3U6E A;  1LV7 A;  1W5S A;  4DV2 M;  4PDG A;  4LF5 M;  4LZJ A;  4GIT A;  3D8L A;  3PFI A;  4I8O A;  4IBF A;  4JI0 M;  2QBY B;  3K1J A;  4OVZ A;  4IBI A;  3EIE A;  1E9S A;  5ITY A;  4LF6 M;  5EJC A;  2LH0 A;  2KZS A;  3A42 A;  2X4A A;  4LJ8 A;  5FTN A;  7CAT A;  3KOX E;  4DR3 M;  1YKL A;  3PCA M;  1YE9 A;  2CHG A;  4MGY E;  4G4R A;  1QAN A;  4I5S A;  2L09 A;  1XXH B;  2Y21 A;  4IBJ A;  3AKZ A;  2V1U A;  5FTK A;  4LF8 M;  3KSJ A;  2BUQ A;  3HHX A;  3HGI A;  1IY1 A;  3TWL A;  3AV0 A;  2DHR A;  4PD2 A;  2XSU A;  1Z6T A;  2Y0T A;  1GKI A;  1IN4 A;  5IZ7 D;  3IG5 A;  2BUR A;  1NNU C;  3FTC A;  4MGI E;  3SFZ A;  1N36 M;  4JI6 M;  3L25 A;  3PCD M;  3PCA A;  1IY2 A;  1YKN A;  4IBD A;  4R7G A;  5LMN M;  4MH0 E;  3L27 A;  3MI1 A;  2F4V M;  1S9A A;  4FW9 A;  1IN6 A;  2RKO A;  3PCE M;  1NJF A;  1YKO A;  1HT1 E;  2BOY A;  1Z5C A;  5JI3 E;  4GRI A;  3I51 A;  3VKG A;  3MV6 M;  3LKT M;  5FLX S;  3GRR A;  4DR2 M;  3HJQ A;  1IQP A;  1NHW C;  2QEN A;  3C58 A;  3PCD A;  3PNV A;  4X65 M;  4II7 A;  3E9S A;  2D7H A;  2QPA A;  3L29 A;  4KO8 A;  4B7G A;  1NSF A;  4OW0 A;  1NHG C;  5JI2 E;  1IY0 A;  5F3W A;  2AHM A;  1C1K A;  2Q2E B;  3I4V A;  2BUT A;  5IWA M;  3TL4 X;  3A46 A;  2LNH C;  4GKJ M;  2BUM A;  1R6B X;  2DZO B;  3LKT A;  4IBB A;  1DO2 A;  2RGH A;  3U6D A;  4MGK E;  3CF2 A;  1NY6 A;  2J7N A;  3PCB M;  4B3S M;  4AQY M;  4LRS A;  4JI2 M;  4B08 A;  3J7A S;  3PCC M;  3UZU A;  3PCK M;  3HKP A;  3TWK A;  4QNR A;  1OFH A;  4B3T M;  3N9T A;  5DNY A;  4L16 A;  4AKH A;  1K82 A;  1SXJ C;  1I94 M;  4NXM M;  2I7N A;  1Q3C A;  1PM5 A;  1XHB A;  2XSV A;  4NXN M;  3L26 A;  1G59 A;  3W0L B;  3U6O A;  4DR7 M;  1N32 M;  4M9Z A;  4QNM A;  3FD9 A;  1IXR C;  1YUB A;  1E32 A;  2BUV B;  3GQ5 A;  3ZC7 B;  1EOA A;  4AI6 A;  3H4M A;  1TH3 A;  2BJV A;  2FNA A;  3GLI A;  1N78 A;  3HWS A;  1IBL M;  4W5W A;  3SAR A;  3HU3 A;  4Z6Y A;  1IBM M;  1L1Z A;  4DV0 M;  1ZQ9 A;  2DWZ B;  3GRY A;  5EXX A;  1EOC A;  3FUV A;  2L7I A;  4LF4 M;  3DA1 A;  4Z8X A;  4G4N A;  4RNA A;  4G6Z A;  3KVW A;  4FWH A;  1EE8 A;  3KOY E;  2CV0 A;  4JI8 M;  3VK8 A;  2BUW A;  4P16 A;  3KW6 A;  4LGY A;  4R3D A;  2DZN B;  3GLH A;  3SMS A;  2BUU A;  3DFZ A;  4FWG A;  5TD3 A;  4NSR A;  1TMX A;  4IBG A;  2BUZ B;  4BBA A;  5ITT A;  3U61 A;  3A45 A;  4B7F A;  2G8L A;  4GIP A;  3JAM S;  4AKG A;  4TUW A;  3UJN A;  1YSY A;  4B3M M;  4ITQ A;  1H6U A;  3AOE A;  4M9S A;  2C5R A;  4I81 A;  5EP1 A;  4M0W A;  3SHF A;  3SYL A;  2XGN A;  3L2A A;  3SAT A;  2G5G X;  3KS4 A;  2W82 A;  3U6M A;  1GVN A;  2YQZ A;  2E5L M;  4JYA M;  4FWD A;  2R46 A;  1YKK B;  3M0E A;  3HHW A;  3RGP A;  1EOB A;  2BV0 A;  4MGZ E;  5FTJ A;  1L2D A;  2BUX A;  5ITX A;  4X66 M;  2ZBK B;  4NRW A;  3E4R A;  1R2Y A;  3SMP A;  4K0K M;  1G8P A;  1GL7 A;  3RGS A;  1EO9 A;  2BUM B;  1NJG A;  2BUT B;  3FUX A;  5KPR A;  4D81 A;  2ERC A;  1KYI A;  1GLN A;  4DUY M;  2C99 A;  3U60 B;  4S12 A;  4JV5 M;  3SHG B;  2OPF A;  4L78 A;  3J81 S;  5ITU A;  3VLF B;  3T15 A;  4IJF A;  3HJS A;  3SAU A;  3NBI A;  3GLG B;  4WHR A;  5C18 A;  3OTO M;  1SXJ A;  3VK7 A;  1K3W A;  3KFU G;  1DGG A;  1N77 A;  3J27 B;  4IJE A;  3FTE A;  2EA0 A;  1XMQ M;  3RE8 A;  4QHT A;  5EP3 A;  2VII A;  2D7E A;  3RFW A;  3GQ3 A;  3PXG A;  4PT5 A;  3GLF A;  3SAS A;  5KPT A;  3SC3 A;  2CV2 A;  3O6J A;  2F5Q A;  4WHS A;  1QYR A;  2XSR A;  4JI1 M;  3PCH M;  3AFH A;  3GRU A;  2F5S A;  1VDD A;  3KP0 E;  3PCG M;  2ZAM A;  1DLM A;  3M6A A;  1OJL A;  3LVV A;  4LCB A;  5EP4 A;  1NVM A;  1DGH A;  3K8Z A;  2EO2 A;  3AOE C;  3EIH A;  1PJI A;  4HLQ A;  4PDI A;  4AG6 A;  3PCH A;  2L7H A;  3T1H M;  3PCE A;  3UGJ A;  4WHP A;  2VQF M;  1EOC B;  3Q8X A;  2CHV A;  4GKK M;  2XH9 A;  3MV6 A;  4WHQ A;  1IXZ A;  4OU7 A;  1XNQ M;  1EO2 A;  3MJ5 A;  4LG2 A;  1WXQ A;  1Z5A A;  3GPU A;  2BUY A;  4M0D A;  4NRV A;  2CFO A;  4FVM A;  4GC5 A;  5ITR A;  4NSO B;  3HHZ A;  4LF9 M;  4JN6 A;  3GLH B;  2ZAO A;  1QAM A;  4ZPX A;  3ZCB B;  1IN8 A;  2UUC M;  4G4O A;  3SYK A;  4AW4 A;  4FCT A;  1FJG M;  2UXC M;  3KS8 A;  5E26 A;  4LJ6 A;  2LXE A;  5LMU M;  3U61 B;  3PCB A;  2YFQ A;  4DR1 M;  2VQE M;  4KOD A;  2R62 A;  4JI3 M;  1YKM B;  3LMX M;  2I7P A;  4M9X A;  3KDS E;  3T1Y M;  4ILV A;  2HCB A;  2YNM D;  1G41 A;  4XGI A;  2C98 A;  4D80 A;  2DWL A;  1L8Q A;  2H1R A;  2F5O A;  3PCC A;  3PCK A;  2CEA A;  3U5Z B;  5ITQ A;  4DV7 M;  3FTF A;  2ZM6 M;  3O6R A;  4G4Q A;  4X62 M;  3DOA A;  3LQQ A;  3T38 A;  3K92 A;  4LJ5 A;  1SXJ D;  2Z4R A;  4LJ7 A;  1DMH A;  2CHQ A;  2XLJ A;  2DXI A;  3M7G A;  3PVS A;  4GHL A;  4IBE A;  4MM3 B;  2BUX B;  2FE8 A;  4WHR F;  3WHL A;  4LRT A;  3LMX A;  3PCJ M;  3MHV C;  2Z7J A;  3GPP A;  2A5Y B;  1FNN A;  4OVZ B;  2BNK A;  1TH2 A;  3GP1 A;  1E9R A;  1K3X A;  2HHH M;  1HT2 E;  4WHS D;  4A3V B;  1YKL B;  3J2P B;  4IBC A;  3D8B A;  3JR4 A;  4DUZ M;  5FTL A;  1J7K A;  4RF0 A;  4DV5 M;  4GH9 A;  4DR5 M;  2BUQ B;  3KSX A;  4DR4 M;  1SXJ B;  5KQD A;  3PCJ A;  3PCF M;  3FYD A;  3T67 M;  2QZ4 A;  1ORY B;  4LY6 A;  2XF3 A;  4LFA M;  5KPZ A;  1HNZ M;  1MX0 A;  2XEP A;  2BUR B;  3TPZ A;  1R2Z A;  4DR6 M;  4JI4 M;  2C9C A;  3AJI B;  1YKP A;  1YKN B;  2DWM A;  1I4W A;  2KRK A;  1S3S A;  1Z59 A;  3FTD A;  4GHA A;  4WHP D;  2XSZ A;  4WHS B;  4X64 M;  5IRE B;  3PCF A;  3VKH A;  4FCW A;  1YKO B;  3HHY A;  3KOZ E;  1IN5 A;  3T67 A;  2BJW A;  1IM2 A;  4LF7 M;  1IBK M;  4CIS A;  3LMM A;  3FYC A;  1DGH B;  1MU5 A;  2HKJ A;  5GKN A;  3TWM A;  1JR3 A;  2V6Z M;  3AL0 C;  3LXV M;  1KSF X;  2UXB M;  3UMM A;  4HL4 A;  4PCZ A;  4QHS A;  1Q39 A;  3HJ8 A;  3PCL M;  4NOO B;  4D82 A;  4XBO A;  4WHQ B;  3T63 M;  1EO2 B;  1N33 M;  2AZQ A;  3KXE C;  3VFD A;  2RGO A;  3PCI M;  3PCM M;  1T3T A;  3K2L A;  2R4J A;  5FTM A;  2BUY B;  2XFT A;  2BUV A;  1E94 E;  1D2N A;  2PCD M;  3LXV A;  5ITX E;  2CUZ A;  4AG5 A;  1TH4 A;  4REZ A;  2UXD M;  3PCN M;  3NWL A;  3IG8 A;  4JI5 M;  4I4L A;  4KHP M;  3PCL A;  3MFL M;  1TDH A;  3T63 A;  1QAQ A;  3J7B A;  4L8R C;  3L28 A;  1OFI A;  1Q3B A;  3PCI A;  3PCM A;  4WHO A;  3VDP A;  1N75 A;  3UK6 A;  2EUC A;  1G3I A;  4LJ9 A;  4MB7 A;  4DV3 M;  3MK6 A;  2PCD A;  2K47 A;  2Y20 A;  1UM8 A;  1R7R A;  1DGF A;  1SXJ E;  3QAU A;  2M60 A;  5DYI A;  1NY5 A;  4GC9 A;  5EP2 A;  3MI1 M;  5KQ8 A;  3PCN A;  3PNY A;  3W0F A;  2CV1 A;  3MFL A;  4LFC M;  1EOA B;  2KRU A;  4L4U A;  3GLI B;  1TGU A;  5BR8 M;  1XWI A;  3QWL A;  5DYG A;  5EXT A;  4FCV A;  4EIW A;  2J7O A;  2KEB A;  3A98 B;  5A2Q S;  1JQJ C;  2UUB M;  1W5T A;  2C9O A;  4BB9 A;  5IT9 S;  2BUZ A;  4DV6 M;  3I4Y A;  3PCG A;  5EXP A;  2X49 A;  2XSZ D;  4DV1 M;  2L6O A;  5EXS A;  1Z5B A;  3U6C A;  3R8F A;  4LJA A;  4YHH M;  2F5N A;  2BUW B;  3J80 S;  3SAW A;  3R9X B;  2KXE A;  4IIW A;  1YKK A;  2BUU B;  3CTW B;  2XZF A;  2QBY A;  4QOZ C;  3SBJ A;  1JR3 D;  1J5E M;  2DVW B;  1IXS B;  1HNX M;  1YKP B;  3U6S A;  3FUW A;  3FUT A;  1HR0 M;  4IBK A;  3U60 A;  3GPY A;  4ILT A;  2KW0 A;  3O32 A;  3TH1 A;  4RF1 A;  8CAT A;  2XFS A;  3ILK A;  4DV4 M;  5E6J A;  4LFB M;  3KP1 E;  2KZU A;  4KLN A;  1XXH A;  3GLG A;  3MV4 M;  2X8A A;  2D7G A;  1X37 A;  2FFJ A;  3TE6 A;  3U6Q A;  2CE7 A;  3ZH9 B;  3LQR A;  5KO3 A;  3BOS A;  3THG A;  2BV0 B;  1EOB B;  1HQC A;  1N34 M;  3WHK A;  2C96 A;  4CGY B;  1QQW A;  2YR0 A;  2Z3X A;  1HQY E;  3O5U A;  3SAV A;  3GRV A;  1EO9 B;  2Y0Q A;  4GMQ A;  4FD2 A;  4L15 A;  4WHO D;  3MV4 A;  4WW0 A;  3GQ4 A;  2QCU A;  4BLC A;  1L2C A;  2F5P A;  4LGM A;  2Z4S A;  4WHR B;  2KA6 B;  1L1T A;  3CF6 E;  3KOW E;  4AZF A;  2HL7 A;  3FKE A;  4QOS A;  5C1B A;  2JA2 A;  4NL4 H;  1QZM A;  2UU9 M;  1DO0 A;  2V1C A;  3CF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...