3I51A

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
256
structure length
256
Chain Sequence
b'ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 70
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3i51A01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3i51A02
1TMXA 3HJSA 2BV0A 3LXVM 3PCBM 2BUZB 1EOAA 2BUMB 3HKPA 3O5UA 1DMHA 3PCNA 3PCKA 1DLTA 3T63M 2BUWB 4WHSD 3MV4A 4WHQA 1YKMB 2BUTB 2PCDA 3I51A 3PCGA 4WHSB 2BUXA 3PCJA 2XSUA 1YKPA 3MI1M 3HHYA 4WHOD 4WHRB 1EOBA 2AZQA 3PCLA 1EOCA 4WHOA 3MI5M 2BV0B 3LMXA 3I4VA 2BUQA 2XSRA 1EOAB 1EO2A 3MV6M 3PCFA 3PCBA 3O6RA 3PCCA 1YKOA 2XSVA 4WHQB 3T63A 1S9AA 3LKTM 3PCDA 2BURA 2BUXB 3PCMA 1YKPB 1YKKA 3MFLA 3PCAA 3PCHA 1EOBB 1EOCB 3HHXA 4WHOB 3PCEA 3PCIA 3T67A 2BUUA 3TH1A 2BUQB 1EO2B 3LXVA 1YKOB 2BUVA 1YKNA 3PCNM 3PCKM 3MV4M 1DLMA 2BURB 2PCDM 3PCGM 3PCJM 1YKKB 4WHPA 3O32A 2BOYA 3MI1A 2BUYA 3N9TA 1YKLA 3HGIA 4ILVA 3LMXM 2BUUB 3I4YA 3MI5A 4ILTA 4WHRF 1EO9A 3PCFM 2BUVB 1YKNB 3O6JA 3PCCM 3MV6A 2BUZA 2BUMA 4WHPD 3PCDM 5TD3A 3PCMM 2BUWA 3LKTA 4WHPB 1YKMA 3MFLM 3PCAM 2BUTA 3PCHM 4WHSA 2BUYB 1YKLB 4WHRA 3HJQA 3PCLM 3PCEM 1DLQA 3PCIM 3T67M 1EO9B 3HJ8A
chains in the Genus database with same CATH superfamily
3C3EA 1TMXA 2KW0A 2FNAA 2BV0A 3CF6E 3LXVM 1IN6A 5EP2A 3JAMS 5A2QS 2JA2A 1OAOC 2EUCA 3UZUA 1ZQ9A 3W0FA 3HKPA 3O5UA 3M6AA 4NL4H 2XGNA 2EA0A 2CHGA 4QHTA 3HHZA 3FUXA 2K9DA 5BPVA 1PGYA 3SBJA 3GLHB 2XSUA 3IECA 4IJEA 2K6BA 5LMNM 2DXIA 2KXEA 3HHYA 4RF0A 1W5TA 1J5EM 5ITRA 2R62A 4OX9M 2DWZB 2BJWA 2WSCF 3U6PA 3KSXA 1G59A 4WHRB 1ZAEA 1I4WA 1WJ7A 2AZQA 3PCLA 1R7RA 4MH0E 2G3QA 2K47A 3GLGA 4WHOA 3J81S 5IREB 3NWLA 3KOWE 1KFVA 1PM5A 2CV0A 4ZPXA 3NBXX 3AKZA 4FCVA 2E5LM 4X64M 4GKJM 4MGIE 2L4FA 3E4RA 2L09A 3A42A 3FTFA 2F4VM 1SXJE 3K92A 4RNAA 3GLFE 4FVMA 3SAWA 3PFIA 2HHHM 1EIJA 2XSVA 1IXRC 2GQFA 1L8QA 2L2DA 1S9AA 1H6UA 1QDTA 3ILKA 3SC3A 3LKTM 2RKOA 1GJTA 4G4NA 3GLIA 4DV0M 2LHGA 4KLNA 3QYEA 2LVPC 1HR0M 3MFLA 4D82A 3PCHA 2FH0A 4MM3B 4FCWA 3U6QA 4CJ6A 1ZMWA 3PVSA 3GPUA 2OQ4A 1HNWM 5IWAM 3R8FA 1YE9A 4EIWA 2J5YA 3BBZA 1GVNA 2WSFF 3SASA 1TDZA 2HWJA 3T67A 4Z6YA 4LF6M 2CWBA 4JI1M 2BUQB 4DR3M 2LBCA 1QAQA 1EO2B 1OJLA 1OFIA 3V76A 2Z3XA 1IN5A 1N36M 2EO2A 2DWMA 4JYAM 3H4MA 3FUTA 1N32M 2B3TA 2HCBA 4I4LA 4NRWA 1I94M 4JI0M 3U5ZB 1G8PA 4LF8M 4AKIA 2PCDM 5EXTA 1ZV1A 4GIPA 3FD9A 4NXMM 1Q39A 4DBGB 1N33M 3KS4A 2OO9A 3MI1A 2XZUA 3QYBA 2KHHA 3MHVC 1VEJA 1VQ1A 4IBJA 3N9TA 1YKLA 5DFLA 2Y0QA 5FTNA 2X49A 2MH8A 4GC5A 2LH0A 4MGKE 1QYRA 1NNJA 4R3DA 3HGIA 2BWEA 5ITQA 3LMXM 2V6ZM 2ZAMA 2BUUB 3MI5A 4WHRF 3C3DA 3ZH9B 5EP3A 4B3RM 4L16A 4QHSA 3HZJA 3ZQJA 3U6OA 3TE6A 5KPZA 2QBYB 2JY7A 4XBOA 1DV0A 3PCCM 2LVAA 3CF0A 1JR3E 3SAUA 1QZEA 2F5NA 2BUZA 2ZANA 1Y8GA 3VKGA 1VG5A 1XXHB 2QPAA 4G6ZA 4PT5A 3J7AS 2VF8A 3PCMM 3FTCA 3L27A 4DR1M 1MJGM 1HNZM 4WHSA 4GHAA 1FJGM 2C98A 2RGHA 3U6EA 3VDPA 5C18A 2BUYB 1IXSA 3U60A 2O5RA 4L6V6 4AQYM 3M7GA 1L2DA 1PJTA 1V33A 2DAKA 3TWMA 4JI6M 1DLQA 3PCEM 1P3QQ 2CFOA 1HQYE 2CEAA 1BVSA 1NHWC 2DZLA 2HAKA 2R44A 3SHFA 1G41A 3HU3A 1JB0F 2ERCA 2A5YB 2DHRA 3CTWB 4G3OA 3LCUA 4Q7JA 3FUVA 3RFWA 2F5QA 2LVQD 1R4GA 4IBKA 3HX3A 4B7HA 4R71A 1EOAA 2BUMB 1NJGA 1Q02A 2BUQA 3K9OA 2JXNA 1XMOM 3PCKA 1DLTA 3GLGE 3T63M 2N35A 4JI5M 2APLA 3MV4A 4WHQA 1YKMB 4UN2B 4AI6A 2QNJA 4OW0A 3FUUA 2X4AA 1IM2A 3J27B 3GQ4A 4LCBA 2J7NA 1IXZA 3FKEA 4L8RC 1YKPA 1AIPC 2VF7A 4WHOD 3B7ZA 2Z4SA 4B3SM 1PRBA 1QUTA 4CISA 1XNRM 5FLXS 4FD2A 1EOCA 3HHWA 3MJ5A 1NSFA 1Z5CA 4QOSA 3TWLA 3QWLA 1L1TA 2FE8A 3GLIE 1NV9A 3KDSE 1JQJC 2LXEA 3SARA 2KNZA 4Z8XA 4QOZC 3SMSA 2DAIA 1HJPA 1TH4A 1IN4A 3K9PA 3PCDA 2BUXB 2M5ZA 2AHMA 3SMPA 1MN3A 2Z7JA 3J7BA 3SYLA 3U6DA 1EOBB 1Q3CA 4NSRA 2GNOA 4REZA 1QUSA 1Z5BA 1DGBA 2LVNC 4LJ6A 2MGWA 4QNRA 1IFYA 2XLJA 1DO0A 1SXJC 3RGPA 3D8LA 2X8AA 5F3WA 3PXGA 3J2PB 1N34M 2UXBM 4DV3M 1G4AE 4IBDA 1OQYA 4AG5A 2R18A 4OVZA 3U6LA 3LMMA 8CATA 4A3VB 1PJSA 4XK8F 2YFQA 1YKOB 2M60A 2VIIA 2W82A 1FNNA 1YKNA 2BUVA 2DZNB 2QQ8A 1NHGC 3AOEC 4TUWA 3LVWA 5KQDA 2QP9X 2D7GA 4KODA 2BURB 1VDDA 1Z59A 3KOZE 3JR5A 4M9SA 3M0EA 4L78A 4D81A 1YKKB 2C96A 3EIEA 1R5LA 1SXJD 4JI4M 3O32A 3Q8GA 2QZ4A 3K2LA 3F92A 4LG2A 2DZOB 1SXJB 1KSFX 2P5TA 2DAGA 2Y21A 4LRSA 3GLFB 4CIZA 4GH9A 1IBMM 2DAMA 2KNAA 4RKUF 3TL4X 1PJJA 2UXDM 4IBEA 2QCUA 1GJSA 3L25A 2O25A 1QVRA 3U61A 4ILTA 3KS8A 2C9CA 3CF2A 3VDUA 3VK8A 2KA6B 3LW5F 5LMUM 3C58A 4DUZM 3UK6A 3MV6A 3A45A 4BBAA 3H4JA 3LQQA 4WHPD 3I04M 2DWLA 1GL6A 3OTOM 4B3MM 4M9ZA 1ORYB 3AV0A 5GKNA 2VQEM 3B7NA 4M0DA 5ITTA 4GKKM 4WHPB 3ZC7B 3MFLM 4LFAM 1EE8A 3U60B 3PCHM 3AOGA 2BNKA 3GLHA 2RRUA 2R4JA 3GP1A 1OFHA 2EJSA 3JR4A 2HL7A 2XH9A 5FTJA 2OOAA 3IHPA 5EP1A 4LF9M 3CGWA 2D7EA 2XSZD 3B9PA 4WHRA 2V1UA 2MROB 3HU2A 4L4UA 4YHHM 1IY1A 3FRIA 3T67M 1EO9B 1OIPA 3EIHA 2QSFX 2G8LA 3FUWA 4LJ9A 3SAVA 1HNXM 5DYIA 4KT0F 3B74A 1E9SA 2LHCA 4GC9A 3PCBM 1YUBA 4X65M 1DMHA 3PCNA 1DGHB 1TH2A 2BUWB 4G4QA 3KP1E 1TGUA 4IJFA 3GRYA 1X37A 3THGA 2BUTB 1JR3D 3PCGA 2DHYA 2I7PA 3PCJA 1NNUC 1QQWA 4FWGA 3MI1M 4LZZA 2CE7A 2YR0A 5H37D 3WHKA 1RU3A 2JUJA 3AFHA 4JI2M 2XF3A 3VK7A 5KO3A 1C1KA 2NQ8C 1WGLA 4LGYA 3KFUG 5ITYA 1LV7A 2R45A 2KRKA 1E32A 4WP2A 4IIWA 3MI5M 1N77A 4DR4M 4S12A 3W68A 3J80S 2BV0B 1XC8A 5FTMA 4X66M 4LJ8A 5ITXA 3I4VA 3QAUA 1S3SA 4IBGA 1TH3A 5DNYA 4JI7M 1YSYA 4GRIA 2WZJA 3RE8A 4GMQA 4F1IA 3FTEA 3HY5A 1EO2A 3AOEA 3PCFA 3DOAA 4LRTA 1K82A 2Z8YM 2JY8A 4M0WA 2K0BX 2Y20A 3AL0C 3T63A 1G3IA 3VLFB 3AJIB 4MGHA 2L7IA 2VQFM 4LGMA 3MK6A 2EKKA 1OIZA 2BJVA 1IBLM 3GRRA 4K0KM 2XZFA 1EFUB 2CHQA 4B3TM 3PCAA 1UFZA 4DV5M 1GKIA 1HQCA 4NXNM 4I81A 1WR1B 1VEKA 4JV5M 1WXQA 3E9SA 1NY6A 3HHXA 1W5SA 4F2LA 3GLGB 1A5TA 4WHOB 4RF1A 2XFSA 5FTKA 3GRVA 3I01M 2H5XA 4DUYM 1YLAA 1OKSA 5FSWA 1KYIA 3PCIA 4PDIA 2BUUA 3TH1A 4HLQA 2DWNA 2F5PA 2Z4RA 5E26A 1K3WA 2HKJA 3LXVA 4G4RA 3VKHA 2QBYA 4IBCA 3LCVB 2O01F 3PCKM 3IG5A 3FRHA 4P17A 2KEBA 3GRUA 3MV4M 4II7A 1XXHA 3DFZA 4NRVA 4WURA 4I8OA 4I5SA 3GLIB 1E94E 3KVWA 3SYKA 4CGYB 4DR5M 4LY6A 1ZMUA 1QZMA 2KRUA 2J7OA 4M9XA 2ZTDA 2DNAA 2CUZA 2CV1A 2BUYA 3GO8A 1MX0A 4IBIA 3L2AA 2MR9A 5KPRA 2F5OA 3SATA 2L7HA 1R2ZA 2EKFA 2JP7A 1IY2A 2DVWB 1Z5AA 4JXJA 4LFBM 1NVMA 1N78A 2D7HA 2CRUA 3I4YA 1R2YA 4BB9A 3K1JA 4G4OA 2L6OA 3K8ZA 1NY5A 3GLHE 1J7KA 4R7GA 4LZJA 1CUKA 1NV8A 1QANA 3SHGB 2Y0TA 3GPXA 4LF7M 1GO5A 2BUMA 3PCDM 3NBIA 5IT9S 4XGIA 4AZFA 2FOIC 3LKTA 3KW6A 4ANRA 1YKMA 3GPYA 4LFCM 1GLNA 4OU7A 2UUCM 1XMQM 3BOSA 5C1BA 2UU9M 1TTEA 4P16A 3WHLA 1YKLB 1J09A 4LJAA 1TR8A 3DZDA 3HJQA 5BR8M 2DAEA 1DGGA 3PCLM 1XHBA 4PCZA 2C9OA 5E6JA 1F4IA 3FTDA 3GPPA 2JZ1A 4B7GA 1PJQA 3T15A 5KPTA 4Y28F 3T38A 4IBBA 1GABA 1HT1E 3HJSA 1NJFA 1VDLA 4AW4A 3W0LB 3KSJA 2BUZB 4B7FA 1UM8A 4DR2M 3L28A 3KP0E 1GL7A 2LWXA 2YNMD 3VFDA 3L26A 4DR7M 4WHSD 1AUAA 2XEPA 2FFJA 1V34A 2YQZA 4BLCA 3A98B 1TF0B 4LF4M 2PCDA 2CHVA 3I51A 4WHSB 5ITXE 1C7YA 2BUXA 1T43A 4JI3M 2WSEF 1IXSB 1MU5A 5EXSA 2LTUA 2CV2A 2R46A 3T6PA 3HWSA 4NC6A 2JY6B 3UJNA 3U6SA 4GITA 3T1YM 1L2BA 1EOBA 2R4EA 4HL4A 5ITUA 2XFTA 1HT2E 5EJCA 2VDBB 1G71A 4AKHA 1XNQM 4DV7M 3C9PA 4JN6A 3LMXA 1NO1A 2G5GX 4GEWA 3R9XB 4KHPM 1EOAB 2I7NA 2XSRA 3MV6M 3PCBA 1IY0A 2QENA 3O6RA 3PCCA 5DYGA 5EXPA 1YKOA 1IN8A 2ZAOA 2H1RA 3L29A 4FW9A 4DV2M 4WHQB 1SG9A 1XB2B 4PD2A 2DKLA 3TWKA 3U6MA 4ITQA 2BURA 3PCMA 1YKPB 4JI8M 2F5SA 4YY3M 1YKKA 2C5RA 7CATA 1WIVA 2V1CA 5EXXA 3KOYE 3GQ3A 3E21A 1OAIA 1SXJA 1Z6TA 2FS1A 3GLFA 4NSOB 1EOCB 2ZM6M 1XXHE 2UXCM 3PCEA 4LJ5A 1T6OA 1E9RA 3Q8XA 1QDRA 2JWSA 2JZ0A 5IZ7D 3SFZA 4LF5M 1L1ZA 2JY5A 2LVOC 2UUAM 2R6FA 3PCNM 1T3TA 4FCTA 1IQPA 4DR6M 2R65A 2ZTCA 5EP4A 5JI2E 1N75A 5JI3E 3TQSA 3PNYA 4MGYE 1DLMA 4D80A 1D2NA 3KXEC 2QHOB 4NOOB 5L8RF 3U6CA 4MB7A 3PCGM 3PCJM 1DGFA 3U5ZA 4WHPA 3A46A 2BOYA 3TPZA 1D0LA 4KO8A 5FTLA 1PJIA 3UGJA 4QNMA 1R6BX 2BWBA 2MJ5B 5KQ8A 2OOBA 2C99A 3T1HM 2UUBM 3B89A 4IBFA 1V92A 3E46A 3DA1A 4PDGA 4LJ4A 2Q2EB 1D0KA 1DO2A 3LVVA 4GHLA 3KOXE 4ILVA 4OVZB 4AG6A 1VEGA 1TDHA 2DI0A 2XSZA 2LNHC 1EO9A 1IN7A 3FYDA 4W5WA 4WW0A 3MMPA 3PCFM 2BUVB 1YKNB 3O6JA 1LTMA 1WGNA 1WHCA 2DENA 2R0IA 4FWHA 4X62M 3PNVA 2ZBKB 4L15A 4LJ7A 2KZUA 2L4EA 5TD3A 4CHTB 1OTRA 1DGHA 3UMMA 3GQ5A 4DV4M 2BUWA 3W67A 4HEOA 3RGSA 2CP8A 4AKGA 2KZSA 3HU1A 2RGOA 3LQRA 2BUTA 4MGZE 3PCAM 3ZCBB 3IG8A 4DV6M 3D8BA 4FWDA 1JR3A 1L2CA 1ZMVA 1K3XA 1QAOA 1D0MA 3FE3A 3FYCA 2KDLA 4B08A 2OPFA 3BXWA 1QAMA 2KNVA 3U61B 1Q3BA 5EQTA 1XWIA 1IBKM 3PCIM 2JNHA 3HJ8A 4DV1M 3B7QA
chains in the Genus database with same CATH topology
1TMXA 2KW0A 2FNAA 2BV0A 3CF6E 3LXVM 1IN6A 5EP2A 3JAMS 5A2QS 2JA2A 2EUCA 3UZUA 1ZQ9A 3W0FA 3HKPA 3O5UA 3M6AA 4NL4H 2XGNA 2EA0A 2CHGA 4QHTA 3HHZA 3FUXA 5BPVA 3SBJA 3GLHB 2XSUA 4IJEA 2DXIA 5LMNM 2KXEA 3HHYA 4RF0A 1W5TA 1J5EM 5ITRA 2R62A 4OX9M 2DWZB 2BJWA 4WHRB 3U6PA 3KSXA 1G59A 1ZAEA 1I4WA 2AZQA 3PCLA 1R7RA 4MH0E 2K47A 3GLGA 4WHOA 3J81S 5IREB 3NWLA 3KOWE 1KFVA 1PM5A 2CV0A 4ZPXA 3AKZA 4FCVA 2E5LM 4X64M 4GKJM 4MGIE 3E4RA 2L09A 3A42A 3FTFA 2F4VM 1SXJE 3K92A 4RNAA 2HHHM 4FVMA 3SAWA 3PFIA 2XSVA 1IXRC 1L8QA 1S9AA 1H6UA 3SC3A 3ILKA 3LKTM 2RKOA 4G4NA 3GLIA 4DV0M 4KLNA 1HR0M 3MFLA 4D82A 3PCHA 3U6QA 4MM3B 4FCWA 3GPUA 2OQ4A 3PVSA 1HNWM 5IWAM 3R8FA 1YE9A 4EIWA 1GVNA 3SASA 1TDZA 3T67A 4Z6YA 4LF6M 2BUQB 4JI1M 4DR3M 1QAQA 1EO2B 1OJLA 1OFIA 2Z3XA 1IN5A 1N36M 2EO2A 2DWMA 4JYAM 3H4MA 3FUTA 1N32M 2HCBA 4I4LA 4NRWA 1I94M 4JI0M 3U5ZB 1G8PA 4LF8M 4AKIA 2PCDM 5EXTA 4GIPA 3FD9A 4NXMM 1Q39A 1N33M 3KS4A 3MI1A 2XZUA 3MHVC 4IBJA 3N9TA 1YKLA 2Y0QA 5FTNA 2X49A 4GC5A 4MGKE 2LH0A 1QYRA 1NNJA 4R3DA 3HGIA 5ITQA 3LMXM 2V6ZM 2ZAMA 2BUUB 3MI5A 4WHRF 3ZH9B 5EP3A 4B3RM 4L16A 4QHSA 3U6OA 3TE6A 5KPZA 2QBYB 4XBOA 3PCCM 3CF0A 3SAUA 2F5NA 2BUZA 2ZANA 3VKGA 1XXHB 2QPAA 4PT5A 4G6ZA 3J7AS 3PCMM 3FTCA 3L27A 4DR1M 1HNZM 4WHSA 4GHAA 1FJGM 2C98A 2RGHA 3U6EA 3VDPA 5C18A 2BUYB 3U60A 2O5RA 4AQYM 3M7GA 1L2DA 3TWMA 3PCEM 1DLQA 4JI6M 2CFOA 1HQYE 2CEAA 1NHWC 3SHFA 1G41A 3HU3A 2ERCA 3CTWB 2A5YB 2DHRA 3RFWA 3FUVA 2F5QA 4IBKA 4B7HA 1EOAA 2BUMB 1NJGA 1XMOM 3PCKA 1DLTA 3T63M 4JI5M 3MV4A 4WHQA 1YKMB 4AI6A 4OW0A 3FUUA 2X4AA 1IM2A 3J27B 3GQ4A 4LCBA 2J7NA 1IXZA 3FKEA 4L8RC 1YKPA 4WHOD 2Z4SA 4B3SM 4CISA 1XNRM 5FLXS 4FD2A 1EOCA 3HHWA 3MJ5A 1NSFA 1Z5CA 4QOSA 3TWLA 3QWLA 1L1TA 2FE8A 3KDSE 1JQJC 2LXEA 3SARA 4Z8XA 4QOZC 3SMSA 1TH4A 1IN4A 3PCDA 2BUXB 2M5ZA 2AHMA 3SMPA 2Z7JA 3J7BA 3SYLA 3U6DA 1EOBB 1Q3CA 4NSRA 4REZA 1Z5BA 4LJ6A 1DGBA 4QNRA 2XLJA 1DO0A 1SXJC 3RGPA 3D8LA 2X8AA 5F3WA 3PXGA 3J2PB 1N34M 2UXBM 4DV3M 1G4AE 4IBDA 4AG5A 2R18A 4OVZA 3U6LA 3LMMA 8CATA 4A3VB 2YFQA 1YKOB 2M60A 2VIIA 2W82A 1FNNA 1YKNA 2BUVA 2DZNB 1NHGC 3AOEC 4TUWA 3LVWA 5KQDA 2QP9X 2D7GA 4KODA 2BURB 1VDDA 1Z59A 3KOZE 3JR5A 4M9SA 3M0EA 4L78A 4D81A 1YKKB 2C96A 3EIEA 1SXJD 4JI4M 3O32A 2QZ4A 3K2LA 4LG2A 2DZOB 1SXJB 1KSFX 2P5TA 2Y21A 4LRSA 3GLFB 2UXDM 4GH9A 1IBMM 1PJJA 3TL4X 4IBEA 2QCUA 3L25A 1QVRA 3U61A 4ILTA 3KS8A 2C9CA 3CF2A 3VDUA 3VK8A 2KA6B 4DUZM 5LMUM 3C58A 3UK6A 3MV6A 3A45A 4BBAA 3LQQA 4WHPD 2DWLA 1GL6A 3OTOM 4B3MM 4M9ZA 1ORYB 3AV0A 5GKNA 2VQEM 4M0DA 5ITTA 4GKKM 4WHPB 3ZC7B 3MFLM 4LFAM 1EE8A 3U60B 3PCHM 3AOGA 2BNKA 3GLHA 3GP1A 2R4JA 1OFHA 3JR4A 2HL7A 2XH9A 5FTJA 4WHRA 5EP1A 4LF9M 2D7EA 2XSZD 3B9PA 2V1UA 3HU2A 4L4UA 4YHHM 1IY1A 3T67M 1EO9B 3EIHA 3FUWA 2G8LA 4LJ9A 3SAVA 1HNXM 5DYIA 1E9SA 4GC9A 3PCBM 1YUBA 4X65M 1DMHA 3PCNA 1DGHB 1TH2A 2BUWB 4G4QA 3KP1E 1TGUA 4IJFA 3GRYA 1X37A 3THGA 2BUTB 1JR3D 3PCGA 2I7PA 3PCJA 1NNUC 1QQWA 4FWGA 3MI1M 4LZZA 2CE7A 2YR0A 5H37D 3WHKA 3AFHA 4JI2M 2XF3A 3VK7A 5KO3A 1C1KA 2NQ8C 4LGYA 3KFUG 5ITYA 1LV7A 2R45A 2KRKA 1E32A 4IIWA 3MI5M 1N77A 4DR4M 4S12A 3J80S 2BV0B 1XC8A 5FTMA 4X66M 4LJ8A 5ITXA 3I4VA 3QAUA 1S3SA 4IBGA 1TH3A 5DNYA 4JI7M 1YSYA 4GRIA 3RE8A 3FTEA 4GMQA 1EO2A 2BUQA 3PCFA 3AOEA 3DOAA 4LRTA 1K82A 4M0WA 2Y20A 3AL0C 3T63A 1G3IA 3VLFB 3AJIB 4MGHA 2L7IA 2VQFM 4LGMA 3MK6A 2BJVA 1IBLM 3GRRA 4K0KM 2XZFA 2CHQA 4B3TM 3PCAA 4DV5M 1GKIA 1HQCA 4NXNM 4I81A 4JV5M 1WXQA 3E9SA 1NY6A 3HHXA 1W5SA 3GLGB 4WHOB 4RF1A 2XFSA 5FTKA 3GRVA 4DUYM 5FSWA 1KYIA 3PCIA 4PDIA 2BUUA 3TH1A 4HLQA 2DWNA 2F5PA 2Z4RA 5E26A 1K3WA 2HKJA 3LXVA 4G4RA 3VKHA 2QBYA 4IBCA 3PCKM 3IG5A 2KEBA 3GRUA 3MV4M 4II7A 1XXHA 3DFZA 4NRVA 4WURA 4I8OA 4I5SA 3GLIB 1E94E 3KVWA 3SYKA 4CGYB 4DR5M 4LY6A 1QZMA 2KRUA 2J7OA 4M9XA 2CUZA 2CV1A 2BUYA 3GO8A 1MX0A 4IBIA 3L2AA 2F5OA 5KPRA 3SATA 2L7HA 1R2ZA 4LFBM 1IY2A 2DVWB 1Z5AA 4JXJA 1NVMA 1N78A 2D7HA 1R2YA 3I4YA 4BB9A 3K1JA 4G4OA 2L6OA 3K8ZA 1NY5A 1J7KA 4R7GA 4LZJA 1QANA 3SHGB 2Y0TA 3GPXA 4LF7M 2BUMA 3PCDM 3NBIA 5IT9S 4XGIA 4AZFA 2FOIC 3LKTA 3KW6A 1YKMA 3GPYA 4LFCM 1GLNA 4OU7A 2UUCM 1XMQM 3BOSA 5C1BA 2UU9M 4P16A 3WHLA 1YKLB 1J09A 4LJAA 3DZDA 5BR8M 3HJQA 3PCLM 1DGGA 1XHBA 4PCZA 2C9OA 5E6JA 3FTDA 3GPPA 5KPTA 4B7GA 3T15A 3T38A 4IBBA 1HT1E 3HJSA 1NJFA 4AW4A 3W0LB 3KSJA 2BUZB 4B7FA 1UM8A 4DR2M 3L28A 3KP0E 1GL7A 2LWXA 2YNMD 3VFDA 3L26A 4DR7M 4WHSD 2XEPA 2FFJA 2YQZA 4BLCA 4LF4M 3A98B 2PCDA 2CHVA 3I51A 4WHSB 5ITXE 2BUXA 4JI3M 1IXSB 1MU5A 5EXSA 2CV2A 2R46A 3UJNA 3HWSA 3T1YM 1L2BA 1EOBA 3U6SA 4GITA 2R4EA 4HL4A 5ITUA 2XFTA 1HT2E 5EJCA 4AKHA 1XNQM 4DV7M 3LMXA 4JN6A 2G5GX 3R9XB 4KHPM 1EOAB 2I7NA 2XSRA 3MV6M 3PCBA 1IY0A 2QENA 3O6RA 3PCCA 5DYGA 5EXPA 1YKOA 1IN8A 2ZAOA 2H1RA 3L29A 4FW9A 4DV2M 4WHQB 4PD2A 3TWKA 3U6MA 4ITQA 2BURA 3PCMA 1YKPB 4JI8M 2F5SA 4YY3M 1YKKA 2C5RA 7CATA 2V1CA 5EXXA 3KOYE 3GQ3A 1EOCB 1SXJA 1Z6TA 3GLFA 4NSOB 2ZM6M 2UXCM 3PCEA 4LJ5A 1E9RA 3Q8XA 5IZ7D 3SFZA 4LF5M 1L1ZA 2UUAM 3PCNM 1T3TA 4FCTA 1IQPA 4DR6M 2R65A 5EP4A 5JI2E 1N75A 5JI3E 3TQSA 3PNYA 4MGYE 1DLMA 4D80A 1D2NA 3KXEC 4NOOB 3U6CA 4MB7A 3PCGM 3PCJM 1DGFA 3U5ZA 4WHPA 3A46A 2BOYA 3TPZA 5FTLA 4KO8A 1PJIA 3UGJA 4QNMA 1R6BX 5KQ8A 2UUBM 2C99A 3T1HM 4IBFA 3DA1A 4PDGA 4LJ4A 2Q2EB 1DO2A 4GHLA 3LVVA 4ILVA 3KOXE 4OVZB 4AG6A 2XSZA 1TDHA 1EO9A 2LNHC 1IN7A 3FYDA 4W5WA 4WW0A 3PCFM 2BUVB 1YKNB 3O6JA 4FWHA 4X62M 3PNVA 2ZBKB 4L15A 4LJ7A 2KZUA 5TD3A 4CHTB 3GQ5A 1DGHA 3UMMA 2BUWA 4DV4M 3RGSA 4AKGA 2KZSA 3HU1A 2RGOA 3LQRA 2BUTA 4MGZE 3PCAM 3ZCBB 3IG8A 4DV6M 3D8BA 4FWDA 1JR3A 1L2CA 1K3XA 1QAOA 3FYCA 2OPFA 4B08A 1QAMA 3U61B 1Q3BA 5EQTA 1XWIA 1IBKM 3PCIM 3HJ8A 4DV1M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TMX A;  3HJS A;  2BV0 A;  3LXV M;  3PCB M;  2BUZ B;  1EOA A;  2BUM B;  3HKP A;  3O5U A;  1DMH A;  3PCN A;  3PCK A;  1DLT A;  3T63 M;  2BUW B;  4WHS D;  3MV4 A;  4WHQ A;  1YKM B;  2BUT B;  2PCD A;  3I51 A;  3PCG A;  4WHS B;  2BUX A;  3PCJ A;  2XSU A;  1YKP A;  3MI1 M;  3HHY A;  4WHO D;  4WHR B;  1EOB A;  2AZQ A;  3PCL A;  1EOC A;  4WHO A;  3MI5 M;  2BV0 B;  3LMX A;  3I4V A;  2BUQ A;  2XSR A;  1EOA B;  1EO2 A;  3MV6 M;  3PCF A;  3PCB A;  3O6R A;  3PCC A;  1YKO A;  2XSV A;  4WHQ B;  3T63 A;  1S9A A;  3LKT M;  3PCD A;  2BUR A;  2BUX B;  3PCM A;  1YKP B;  1YKK A;  3MFL A;  3PCA A;  3PCH A;  1EOB B;  1EOC B;  3HHX A;  4WHO B;  3PCE A;  3PCI A;  3T67 A;  2BUU A;  3TH1 A;  2BUQ B;  1EO2 B;  3LXV A;  1YKO B;  2BUV A;  1YKN A;  3PCN M;  3PCK M;  3MV4 M;  1DLM A;  2BUR B;  2PCD M;  3PCG M;  3PCJ M;  1YKK B;  4WHP A;  3O32 A;  2BOY A;  3MI1 A;  2BUY A;  3N9T A;  1YKL A;  3HGI A;  4ILV A;  3LMX M;  2BUU B;  3I4Y A;  3MI5 A;  4ILT A;  4WHR F;  1EO9 A;  3PCF M;  2BUV B;  1YKN B;  3O6J A;  3PCC M;  3MV6 A;  2BUZ A;  2BUM A;  4WHP D;  3PCD M;  5TD3 A;  3PCM M;  2BUW A;  3LKT A;  4WHP B;  1YKM A;  3MFL M;  3PCA M;  2BUT A;  3PCH M;  4WHS A;  2BUY B;  1YKL B;  4WHR A;  3HJQ A;  3PCL M;  3PCE M;  1DLQ A;  3PCI M;  3T67 M;  1EO9 B;  3HJ8 A; 
#chains in the Genus database with same CATH topology
 3C3E A;  1TMX A;  2KW0 A;  2FNA A;  2BV0 A;  3CF6 E;  3LXV M;  1IN6 A;  5EP2 A;  3JAM S;  5A2Q S;  2JA2 A;  1OAO C;  2EUC A;  3UZU A;  1ZQ9 A;  3W0F A;  3HKP A;  3O5U A;  3M6A A;  4NL4 H;  2XGN A;  2EA0 A;  2CHG A;  4QHT A;  3HHZ A;  3FUX A;  2K9D A;  5BPV A;  1PGY A;  3SBJ A;  3GLH B;  2XSU A;  3IEC A;  4IJE A;  2K6B A;  5LMN M;  2DXI A;  2KXE A;  3HHY A;  4RF0 A;  1W5T A;  1J5E M;  5ITR A;  2R62 A;  4OX9 M;  2DWZ B;  2BJW A;  2WSC F;  3U6P A;  3KSX A;  1G59 A;  4WHR B;  1ZAE A;  1I4W A;  1WJ7 A;  2AZQ A;  3PCL A;  1R7R A;  4MH0 E;  2G3Q A;  2K47 A;  3GLG A;  4WHO A;  3J81 S;  5IRE B;  3NWL A;  3KOW E;  1KFV A;  1PM5 A;  2CV0 A;  4ZPX A;  3NBX X;  3AKZ A;  4FCV A;  2E5L M;  4X64 M;  4GKJ M;  4MGI E;  2L4F A;  3E4R A;  2L09 A;  3A42 A;  3FTF A;  2F4V M;  1SXJ E;  3K92 A;  4RNA A;  3GLF E;  4FVM A;  3SAW A;  3PFI A;  2HHH M;  1EIJ A;  2XSV A;  1IXR C;  2GQF A;  1L8Q A;  2L2D A;  1S9A A;  1H6U A;  1QDT A;  3ILK A;  3SC3 A;  3LKT M;  2RKO A;  1GJT A;  4G4N A;  3GLI A;  4DV0 M;  2LHG A;  4KLN A;  3QYE A;  2LVP C;  1HR0 M;  3MFL A;  4D82 A;  3PCH A;  2FH0 A;  4MM3 B;  4FCW A;  3U6Q A;  4CJ6 A;  1ZMW A;  3PVS A;  3GPU A;  2OQ4 A;  1HNW M;  5IWA M;  3R8F A;  1YE9 A;  4EIW A;  2J5Y A;  3BBZ A;  1GVN A;  2WSF F;  3SAS A;  1TDZ A;  2HWJ A;  3T67 A;  4Z6Y A;  4LF6 M;  2CWB A;  4JI1 M;  2BUQ B;  4DR3 M;  2LBC A;  1QAQ A;  1EO2 B;  1OJL A;  1OFI A;  3V76 A;  2Z3X A;  1IN5 A;  1N36 M;  2EO2 A;  2DWM A;  4JYA M;  3H4M A;  3FUT A;  1N32 M;  2B3T A;  2HCB A;  4I4L A;  4NRW A;  1I94 M;  4JI0 M;  3U5Z B;  1G8P A;  4LF8 M;  4AKI A;  2PCD M;  5EXT A;  1ZV1 A;  4GIP A;  3FD9 A;  4NXM M;  1Q39 A;  4DBG B;  1N33 M;  3KS4 A;  2OO9 A;  3MI1 A;  2XZU A;  3QYB A;  2KHH A;  3MHV C;  1VEJ A;  1VQ1 A;  4IBJ A;  3N9T A;  1YKL A;  5DFL A;  2Y0Q A;  5FTN A;  2X49 A;  2MH8 A;  4GC5 A;  2LH0 A;  4MGK E;  1QYR A;  1NNJ A;  4R3D A;  3HGI A;  2BWE A;  5ITQ A;  3LMX M;  2V6Z M;  2ZAM A;  2BUU B;  3MI5 A;  4WHR F;  3C3D A;  3ZH9 B;  5EP3 A;  4B3R M;  4L16 A;  4QHS A;  3HZJ A;  3ZQJ A;  3U6O A;  3TE6 A;  5KPZ A;  2QBY B;  2JY7 A;  4XBO A;  1DV0 A;  3PCC M;  2LVA A;  3CF0 A;  1JR3 E;  3SAU A;  1QZE A;  2F5N A;  2BUZ A;  2ZAN A;  1Y8G A;  3VKG A;  1VG5 A;  1XXH B;  2QPA A;  4G6Z A;  4PT5 A;  3J7A S;  2VF8 A;  3PCM M;  3FTC A;  3L27 A;  4DR1 M;  1MJG M;  1HNZ M;  4WHS A;  4GHA A;  1FJG M;  2C98 A;  2RGH A;  3U6E A;  3VDP A;  5C18 A;  2BUY B;  1IXS A;  3U60 A;  2O5R A;  4L6V 6;  4AQY M;  3M7G A;  1L2D A;  1PJT A;  1V33 A;  2DAK A;  3TWM A;  4JI6 M;  1DLQ A;  3PCE M;  1P3Q Q;  2CFO A;  1HQY E;  2CEA A;  1BVS A;  1NHW C;  2DZL A;  2HAK A;  2R44 A;  3SHF A;  1G41 A;  3HU3 A;  1JB0 F;  2ERC A;  2A5Y B;  2DHR A;  3CTW B;  4G3O A;  3LCU A;  4Q7J A;  3FUV A;  3RFW A;  2F5Q A;  2LVQ D;  1R4G A;  4IBK A;  3HX3 A;  4B7H A;  4R71 A;  1EOA A;  2BUM B;  1NJG A;  1Q02 A;  2BUQ A;  3K9O A;  2JXN A;  1XMO M;  3PCK A;  1DLT A;  3GLG E;  3T63 M;  2N35 A;  4JI5 M;  2APL A;  3MV4 A;  4WHQ A;  1YKM B;  4UN2 B;  4AI6 A;  2QNJ A;  4OW0 A;  3FUU A;  2X4A A;  1IM2 A;  3J27 B;  3GQ4 A;  4LCB A;  2J7N A;  1IXZ A;  3FKE A;  4L8R C;  1YKP A;  1AIP C;  2VF7 A;  4WHO D;  3B7Z A;  2Z4S A;  4B3S M;  1PRB A;  1QUT A;  4CIS A;  1XNR M;  5FLX S;  4FD2 A;  1EOC A;  3HHW A;  3MJ5 A;  1NSF A;  1Z5C A;  4QOS A;  3TWL A;  3QWL A;  1L1T A;  2FE8 A;  3GLI E;  1NV9 A;  3KDS E;  1JQJ C;  2LXE A;  3SAR A;  2KNZ A;  4Z8X A;  4QOZ C;  3SMS A;  2DAI A;  1HJP A;  1TH4 A;  1IN4 A;  3K9P A;  3PCD A;  2BUX B;  2M5Z A;  2AHM A;  3SMP A;  1MN3 A;  2Z7J A;  3J7B A;  3SYL A;  3U6D A;  1EOB B;  1Q3C A;  4NSR A;  2GNO A;  4REZ A;  1QUS A;  1Z5B A;  1DGB A;  2LVN C;  4LJ6 A;  2MGW A;  4QNR A;  1IFY A;  2XLJ A;  1DO0 A;  1SXJ C;  3RGP A;  3D8L A;  2X8A A;  5F3W A;  3PXG A;  3J2P B;  1N34 M;  2UXB M;  4DV3 M;  1G4A E;  4IBD A;  1OQY A;  4AG5 A;  2R18 A;  4OVZ A;  3U6L A;  3LMM A;  8CAT A;  4A3V B;  1PJS A;  4XK8 F;  2YFQ A;  1YKO B;  2M60 A;  2VII A;  2W82 A;  1FNN A;  1YKN A;  2BUV A;  2DZN B;  2QQ8 A;  1NHG C;  3AOE C;  4TUW A;  3LVW A;  5KQD A;  2QP9 X;  2D7G A;  4KOD A;  2BUR B;  1VDD A;  1Z59 A;  3KOZ E;  3JR5 A;  4M9S A;  3M0E A;  4L78 A;  4D81 A;  1YKK B;  2C96 A;  3EIE A;  1R5L A;  1SXJ D;  4JI4 M;  3O32 A;  3Q8G A;  2QZ4 A;  3K2L A;  3F92 A;  4LG2 A;  2DZO B;  1SXJ B;  1KSF X;  2P5T A;  2DAG A;  2Y21 A;  4LRS A;  3GLF B;  4CIZ A;  4GH9 A;  1IBM M;  2DAM A;  2KNA A;  4RKU F;  3TL4 X;  1PJJ A;  2UXD M;  4IBE A;  2QCU A;  1GJS A;  3L25 A;  2O25 A;  1QVR A;  3U61 A;  4ILT A;  3KS8 A;  2C9C A;  3CF2 A;  3VDU A;  3VK8 A;  2KA6 B;  3LW5 F;  5LMU M;  3C58 A;  4DUZ M;  3UK6 A;  3MV6 A;  3A45 A;  4BBA A;  3H4J A;  3LQQ A;  4WHP D;  3I04 M;  2DWL A;  1GL6 A;  3OTO M;  4B3M M;  4M9Z A;  1ORY B;  3AV0 A;  5GKN A;  2VQE M;  3B7N A;  4M0D A;  5ITT A;  4GKK M;  4WHP B;  3ZC7 B;  3MFL M;  4LFA M;  1EE8 A;  3U60 B;  3PCH M;  3AOG A;  2BNK A;  3GLH A;  2RRU A;  2R4J A;  3GP1 A;  1OFH A;  2EJS A;  3JR4 A;  2HL7 A;  2XH9 A;  5FTJ A;  2OOA A;  3IHP A;  5EP1 A;  4LF9 M;  3CGW A;  2D7E A;  2XSZ D;  3B9P A;  4WHR A;  2V1U A;  2MRO B;  3HU2 A;  4L4U A;  4YHH M;  1IY1 A;  3FRI A;  3T67 M;  1EO9 B;  1OIP A;  3EIH A;  2QSF X;  2G8L A;  3FUW A;  4LJ9 A;  3SAV A;  1HNX M;  5DYI A;  4KT0 F;  3B74 A;  1E9S A;  2LHC A;  4GC9 A;  3PCB M;  1YUB A;  4X65 M;  1DMH A;  3PCN A;  1DGH B;  1TH2 A;  2BUW B;  4G4Q A;  3KP1 E;  1TGU A;  4IJF A;  3GRY A;  1X37 A;  3THG A;  2BUT B;  1JR3 D;  3PCG A;  2DHY A;  2I7P A;  3PCJ A;  1NNU C;  1QQW A;  4FWG A;  3MI1 M;  4LZZ A;  2CE7 A;  2YR0 A;  5H37 D;  3WHK A;  1RU3 A;  2JUJ A;  3AFH A;  4JI2 M;  2XF3 A;  3VK7 A;  5KO3 A;  1C1K A;  2NQ8 C;  1WGL A;  4LGY A;  3KFU G;  5ITY A;  1LV7 A;  2R45 A;  2KRK A;  1E32 A;  4WP2 A;  4IIW A;  3MI5 M;  1N77 A;  4DR4 M;  4S12 A;  3W68 A;  3J80 S;  2BV0 B;  1XC8 A;  5FTM A;  4X66 M;  4LJ8 A;  5ITX A;  3I4V A;  3QAU A;  1S3S A;  4IBG A;  1TH3 A;  5DNY A;  4JI7 M;  1YSY A;  4GRI A;  2WZJ A;  3RE8 A;  4GMQ A;  4F1I A;  3FTE A;  3HY5 A;  1EO2 A;  3AOE A;  3PCF A;  3DOA A;  4LRT A;  1K82 A;  2Z8Y M;  2JY8 A;  4M0W A;  2K0B X;  2Y20 A;  3AL0 C;  3T63 A;  1G3I A;  3VLF B;  3AJI B;  4MGH A;  2L7I A;  2VQF M;  4LGM A;  3MK6 A;  2EKK A;  1OIZ A;  2BJV A;  1IBL M;  3GRR A;  4K0K M;  2XZF A;  1EFU B;  2CHQ A;  4B3T M;  3PCA A;  1UFZ A;  4DV5 M;  1GKI A;  1HQC A;  4NXN M;  4I81 A;  1WR1 B;  1VEK A;  4JV5 M;  1WXQ A;  3E9S A;  1NY6 A;  3HHX A;  1W5S A;  4F2L A;  3GLG B;  1A5T A;  4WHO B;  4RF1 A;  2XFS A;  5FTK A;  3GRV A;  3I01 M;  2H5X A;  4DUY M;  1YLA A;  1OKS A;  5FSW A;  1KYI A;  3PCI A;  4PDI A;  2BUU A;  3TH1 A;  4HLQ A;  2DWN A;  2F5P A;  2Z4R A;  5E26 A;  1K3W A;  2HKJ A;  3LXV A;  4G4R A;  3VKH A;  2QBY A;  4IBC A;  3LCV B;  2O01 F;  3PCK M;  3IG5 A;  3FRH A;  4P17 A;  2KEB A;  3GRU A;  3MV4 M;  4II7 A;  1XXH A;  3DFZ A;  4NRV A;  4WUR A;  4I8O A;  4I5S A;  3GLI B;  1E94 E;  3KVW A;  3SYK A;  4CGY B;  4DR5 M;  4LY6 A;  1ZMU A;  1QZM A;  2KRU A;  2J7O A;  4M9X A;  2ZTD A;  2DNA A;  2CUZ A;  2CV1 A;  2BUY A;  3GO8 A;  1MX0 A;  4IBI A;  3L2A A;  2MR9 A;  5KPR A;  2F5O A;  3SAT A;  2L7H A;  1R2Z A;  2EKF A;  2JP7 A;  1IY2 A;  2DVW B;  1Z5A A;  4JXJ A;  4LFB M;  1NVM A;  1N78 A;  2D7H A;  2CRU A;  3I4Y A;  1R2Y A;  4BB9 A;  3K1J A;  4G4O A;  2L6O A;  3K8Z A;  1NY5 A;  3GLH E;  1J7K A;  4R7G A;  4LZJ A;  1CUK A;  1NV8 A;  1QAN A;  3SHG B;  2Y0T A;  3GPX A;  4LF7 M;  1GO5 A;  2BUM A;  3PCD M;  3NBI A;  5IT9 S;  4XGI A;  4AZF A;  2FOI C;  3LKT A;  3KW6 A;  4ANR A;  1YKM A;  3GPY A;  4LFC M;  1GLN A;  4OU7 A;  2UUC M;  1XMQ M;  3BOS A;  5C1B A;  2UU9 M;  1TTE A;  4P16 A;  3WHL A;  1YKL B;  1J09 A;  4LJA A;  1TR8 A;  3DZD A;  3HJQ A;  5BR8 M;  2DAE A;  1DGG A;  3PCL M;  1XHB A;  4PCZ A;  2C9O A;  5E6J A;  1F4I A;  3FTD A;  3GPP A;  2JZ1 A;  4B7G A;  1PJQ A;  3T15 A;  5KPT A;  4Y28 F;  3T38 A;  4IBB A;  1GAB A;  1HT1 E;  3HJS A;  1NJF A;  1VDL A;  4AW4 A;  3W0L B;  3KSJ A;  2BUZ B;  4B7F A;  1UM8 A;  4DR2 M;  3L28 A;  3KP0 E;  1GL7 A;  2LWX A;  2YNM D;  3VFD A;  3L26 A;  4DR7 M;  4WHS D;  1AUA A;  2XEP A;  2FFJ A;  1V34 A;  2YQZ A;  4BLC A;  3A98 B;  1TF0 B;  4LF4 M;  2PCD A;  2CHV A;  3I51 A;  4WHS B;  5ITX E;  1C7Y A;  2BUX A;  1T43 A;  4JI3 M;  2WSE F;  1IXS B;  1MU5 A;  5EXS A;  2LTU A;  2CV2 A;  2R46 A;  3T6P A;  3HWS A;  4NC6 A;  2JY6 B;  3UJN A;  3U6S A;  4GIT A;  3T1Y M;  1L2B A;  1EOB A;  2R4E A;  4HL4 A;  5ITU A;  2XFT A;  1HT2 E;  5EJC A;  2VDB B;  1G71 A;  4AKH A;  1XNQ M;  4DV7 M;  3C9P A;  4JN6 A;  3LMX A;  1NO1 A;  2G5G X;  4GEW A;  3R9X B;  4KHP M;  1EOA B;  2I7N A;  2XSR A;  3MV6 M;  3PCB A;  1IY0 A;  2QEN A;  3O6R A;  3PCC A;  5DYG A;  5EXP A;  1YKO A;  1IN8 A;  2ZAO A;  2H1R A;  3L29 A;  4FW9 A;  4DV2 M;  4WHQ B;  1SG9 A;  1XB2 B;  4PD2 A;  2DKL A;  3TWK A;  3U6M A;  4ITQ A;  2BUR A;  3PCM A;  1YKP B;  4JI8 M;  2F5S A;  4YY3 M;  1YKK A;  2C5R A;  7CAT A;  1WIV A;  2V1C A;  5EXX A;  3KOY E;  3GQ3 A;  3E21 A;  1OAI A;  1SXJ A;  1Z6T A;  2FS1 A;  3GLF A;  4NSO B;  1EOC B;  2ZM6 M;  1XXH E;  2UXC M;  3PCE A;  4LJ5 A;  1T6O A;  1E9R A;  3Q8X A;  1QDR A;  2JWS A;  2JZ0 A;  5IZ7 D;  3SFZ A;  4LF5 M;  1L1Z A;  2JY5 A;  2LVO C;  2UUA M;  2R6F A;  3PCN M;  1T3T A;  4FCT A;  1IQP A;  4DR6 M;  2R65 A;  2ZTC A;  5EP4 A;  5JI2 E;  1N75 A;  5JI3 E;  3TQS A;  3PNY A;  4MGY E;  1DLM A;  4D80 A;  1D2N A;  3KXE C;  2QHO B;  4NOO B;  5L8R F;  3U6C A;  4MB7 A;  3PCG M;  3PCJ M;  1DGF A;  3U5Z A;  4WHP A;  3A46 A;  2BOY A;  3TPZ A;  1D0L A;  4KO8 A;  5FTL A;  1PJI A;  3UGJ A;  4QNM A;  1R6B X;  2BWB A;  2MJ5 B;  5KQ8 A;  2OOB A;  2C99 A;  3T1H M;  2UUB M;  3B89 A;  4IBF A;  1V92 A;  3E46 A;  3DA1 A;  4PDG A;  4LJ4 A;  2Q2E B;  1D0K A;  1DO2 A;  3LVV A;  4GHL A;  3KOX E;  4ILV A;  4OVZ B;  4AG6 A;  1VEG A;  1TDH A;  2DI0 A;  2XSZ A;  2LNH C;  1EO9 A;  1IN7 A;  3FYD A;  4W5W A;  4WW0 A;  3MMP A;  3PCF M;  2BUV B;  1YKN B;  3O6J A;  1LTM A;  1WGN A;  1WHC A;  2DEN A;  2R0I A;  4FWH A;  4X62 M;  3PNV A;  2ZBK B;  4L15 A;  4LJ7 A;  2KZU A;  2L4E A;  5TD3 A;  4CHT B;  1OTR A;  1DGH A;  3UMM A;  3GQ5 A;  4DV4 M;  2BUW A;  3W67 A;  4HEO A;  3RGS A;  2CP8 A;  4AKG A;  2KZS A;  3HU1 A;  2RGO A;  3LQR A;  2BUT A;  4MGZ E;  3PCA M;  3ZCB B;  3IG8 A;  4DV6 M;  3D8B A;  4FWD A;  1JR3 A;  1L2C A;  1ZMV A;  1K3X A;  1QAO A;  1D0M A;  3FE3 A;  3FYC A;  2KDL A;  4B08 A;  2OPF A;  3BXW A;  1QAM A;  2KNV A;  3U61 B;  1Q3B A;  5EQT A;  1XWI A;  1IBK M;  3PCI M;  2JNH A;  3HJ8 A;  4DV1 M;  3B7Q A; 
#chains in the Genus database with same CATH homology
 1TMX A;  2KW0 A;  2FNA A;  2BV0 A;  3CF6 E;  3LXV M;  1IN6 A;  5EP2 A;  3JAM S;  5A2Q S;  2JA2 A;  2EUC A;  3UZU A;  1ZQ9 A;  3W0F A;  3HKP A;  3O5U A;  3M6A A;  4NL4 H;  2XGN A;  2EA0 A;  2CHG A;  4QHT A;  3HHZ A;  3FUX A;  5BPV A;  3SBJ A;  3GLH B;  2XSU A;  4IJE A;  2DXI A;  5LMN M;  2KXE A;  3HHY A;  4RF0 A;  1W5T A;  1J5E M;  5ITR A;  2R62 A;  4OX9 M;  2DWZ B;  2BJW A;  4WHR B;  3U6P A;  3KSX A;  1G59 A;  1ZAE A;  1I4W A;  2AZQ A;  3PCL A;  1R7R A;  4MH0 E;  2K47 A;  3GLG A;  4WHO A;  3J81 S;  5IRE B;  3NWL A;  3KOW E;  1KFV A;  1PM5 A;  2CV0 A;  4ZPX A;  3AKZ A;  4FCV A;  2E5L M;  4X64 M;  4GKJ M;  4MGI E;  3E4R A;  2L09 A;  3A42 A;  3FTF A;  2F4V M;  1SXJ E;  3K92 A;  4RNA A;  2HHH M;  4FVM A;  3SAW A;  3PFI A;  2XSV A;  1IXR C;  1L8Q A;  1S9A A;  1H6U A;  3SC3 A;  3ILK A;  3LKT M;  2RKO A;  4G4N A;  3GLI A;  4DV0 M;  4KLN A;  1HR0 M;  3MFL A;  4D82 A;  3PCH A;  3U6Q A;  4MM3 B;  4FCW A;  3GPU A;  2OQ4 A;  3PVS A;  1HNW M;  5IWA M;  3R8F A;  1YE9 A;  4EIW A;  1GVN A;  3SAS A;  1TDZ A;  3T67 A;  4Z6Y A;  4LF6 M;  2BUQ B;  4JI1 M;  4DR3 M;  1QAQ A;  1EO2 B;  1OJL A;  1OFI A;  2Z3X A;  1IN5 A;  1N36 M;  2EO2 A;  2DWM A;  4JYA M;  3H4M A;  3FUT A;  1N32 M;  2HCB A;  4I4L A;  4NRW A;  1I94 M;  4JI0 M;  3U5Z B;  1G8P A;  4LF8 M;  4AKI A;  2PCD M;  5EXT A;  4GIP A;  3FD9 A;  4NXM M;  1Q39 A;  1N33 M;  3KS4 A;  3MI1 A;  2XZU A;  3MHV C;  4IBJ A;  3N9T A;  1YKL A;  2Y0Q A;  5FTN A;  2X49 A;  4GC5 A;  4MGK E;  2LH0 A;  1QYR A;  1NNJ A;  4R3D A;  3HGI A;  5ITQ A;  3LMX M;  2V6Z M;  2ZAM A;  2BUU B;  3MI5 A;  4WHR F;  3ZH9 B;  5EP3 A;  4B3R M;  4L16 A;  4QHS A;  3U6O A;  3TE6 A;  5KPZ A;  2QBY B;  4XBO A;  3PCC M;  3CF0 A;  3SAU A;  2F5N A;  2BUZ A;  2ZAN A;  3VKG A;  1XXH B;  2QPA A;  4PT5 A;  4G6Z A;  3J7A S;  3PCM M;  3FTC A;  3L27 A;  4DR1 M;  1HNZ M;  4WHS A;  4GHA A;  1FJG M;  2C98 A;  2RGH A;  3U6E A;  3VDP A;  5C18 A;  2BUY B;  3U60 A;  2O5R A;  4AQY M;  3M7G A;  1L2D A;  3TWM A;  3PCE M;  1DLQ A;  4JI6 M;  2CFO A;  1HQY E;  2CEA A;  1NHW C;  3SHF A;  1G41 A;  3HU3 A;  2ERC A;  3CTW B;  2A5Y B;  2DHR A;  3RFW A;  3FUV A;  2F5Q A;  4IBK A;  4B7H A;  1EOA A;  2BUM B;  1NJG A;  1XMO M;  3PCK A;  1DLT A;  3T63 M;  4JI5 M;  3MV4 A;  4WHQ A;  1YKM B;  4AI6 A;  4OW0 A;  3FUU A;  2X4A A;  1IM2 A;  3J27 B;  3GQ4 A;  4LCB A;  2J7N A;  1IXZ A;  3FKE A;  4L8R C;  1YKP A;  4WHO D;  2Z4S A;  4B3S M;  4CIS A;  1XNR M;  5FLX S;  4FD2 A;  1EOC A;  3HHW A;  3MJ5 A;  1NSF A;  1Z5C A;  4QOS A;  3TWL A;  3QWL A;  1L1T A;  2FE8 A;  3KDS E;  1JQJ C;  2LXE A;  3SAR A;  4Z8X A;  4QOZ C;  3SMS A;  1TH4 A;  1IN4 A;  3PCD A;  2BUX B;  2M5Z A;  2AHM A;  3SMP A;  2Z7J A;  3J7B A;  3SYL A;  3U6D A;  1EOB B;  1Q3C A;  4NSR A;  4REZ A;  1Z5B A;  4LJ6 A;  1DGB A;  4QNR A;  2XLJ A;  1DO0 A;  1SXJ C;  3RGP A;  3D8L A;  2X8A A;  5F3W A;  3PXG A;  3J2P B;  1N34 M;  2UXB M;  4DV3 M;  1G4A E;  4IBD A;  4AG5 A;  2R18 A;  4OVZ A;  3U6L A;  3LMM A;  8CAT A;  4A3V B;  2YFQ A;  1YKO B;  2M60 A;  2VII A;  2W82 A;  1FNN A;  1YKN A;  2BUV A;  2DZN B;  1NHG C;  3AOE C;  4TUW A;  3LVW A;  5KQD A;  2QP9 X;  2D7G A;  4KOD A;  2BUR B;  1VDD A;  1Z59 A;  3KOZ E;  3JR5 A;  4M9S A;  3M0E A;  4L78 A;  4D81 A;  1YKK B;  2C96 A;  3EIE A;  1SXJ D;  4JI4 M;  3O32 A;  2QZ4 A;  3K2L A;  4LG2 A;  2DZO B;  1SXJ B;  1KSF X;  2P5T A;  2Y21 A;  4LRS A;  3GLF B;  2UXD M;  4GH9 A;  1IBM M;  1PJJ A;  3TL4 X;  4IBE A;  2QCU A;  3L25 A;  1QVR A;  3U61 A;  4ILT A;  3KS8 A;  2C9C A;  3CF2 A;  3VDU A;  3VK8 A;  2KA6 B;  4DUZ M;  5LMU M;  3C58 A;  3UK6 A;  3MV6 A;  3A45 A;  4BBA A;  3LQQ A;  4WHP D;  2DWL A;  1GL6 A;  3OTO M;  4B3M M;  4M9Z A;  1ORY B;  3AV0 A;  5GKN A;  2VQE M;  4M0D A;  5ITT A;  4GKK M;  4WHP B;  3ZC7 B;  3MFL M;  4LFA M;  1EE8 A;  3U60 B;  3PCH M;  3AOG A;  2BNK A;  3GLH A;  3GP1 A;  2R4J A;  1OFH A;  3JR4 A;  2HL7 A;  2XH9 A;  5FTJ A;  4WHR A;  5EP1 A;  4LF9 M;  2D7E A;  2XSZ D;  3B9P A;  2V1U A;  3HU2 A;  4L4U A;  4YHH M;  1IY1 A;  3T67 M;  1EO9 B;  3EIH A;  3FUW A;  2G8L A;  4LJ9 A;  3SAV A;  1HNX M;  5DYI A;  1E9S A;  4GC9 A;  3PCB M;  1YUB A;  4X65 M;  1DMH A;  3PCN A;  1DGH B;  1TH2 A;  2BUW B;  4G4Q A;  3KP1 E;  1TGU A;  4IJF A;  3GRY A;  1X37 A;  3THG A;  2BUT B;  1JR3 D;  3PCG A;  2I7P A;  3PCJ A;  1NNU C;  1QQW A;  4FWG A;  3MI1 M;  4LZZ A;  2CE7 A;  2YR0 A;  5H37 D;  3WHK A;  3AFH A;  4JI2 M;  2XF3 A;  3VK7 A;  5KO3 A;  1C1K A;  2NQ8 C;  4LGY A;  3KFU G;  5ITY A;  1LV7 A;  2R45 A;  2KRK A;  1E32 A;  4IIW A;  3MI5 M;  1N77 A;  4DR4 M;  4S12 A;  3J80 S;  2BV0 B;  1XC8 A;  5FTM A;  4X66 M;  4LJ8 A;  5ITX A;  3I4V A;  3QAU A;  1S3S A;  4IBG A;  1TH3 A;  5DNY A;  4JI7 M;  1YSY A;  4GRI A;  3RE8 A;  3FTE A;  4GMQ A;  1EO2 A;  2BUQ A;  3PCF A;  3AOE A;  3DOA A;  4LRT A;  1K82 A;  4M0W A;  2Y20 A;  3AL0 C;  3T63 A;  1G3I A;  3VLF B;  3AJI B;  4MGH A;  2L7I A;  2VQF M;  4LGM A;  3MK6 A;  2BJV A;  1IBL M;  3GRR A;  4K0K M;  2XZF A;  2CHQ A;  4B3T M;  3PCA A;  4DV5 M;  1GKI A;  1HQC A;  4NXN M;  4I81 A;  4JV5 M;  1WXQ A;  3E9S A;  1NY6 A;  3HHX A;  1W5S A;  3GLG B;  4WHO B;  4RF1 A;  2XFS A;  5FTK A;  3GRV A;  4DUY M;  5FSW A;  1KYI A;  3PCI A;  4PDI A;  2BUU A;  3TH1 A;  4HLQ A;  2DWN A;  2F5P A;  2Z4R A;  5E26 A;  1K3W A;  2HKJ A;  3LXV A;  4G4R A;  3VKH A;  2QBY A;  4IBC A;  3PCK M;  3IG5 A;  2KEB A;  3GRU A;  3MV4 M;  4II7 A;  1XXH A;  3DFZ A;  4NRV A;  4WUR A;  4I8O A;  4I5S A;  3GLI B;  1E94 E;  3KVW A;  3SYK A;  4CGY B;  4DR5 M;  4LY6 A;  1QZM A;  2KRU A;  2J7O A;  4M9X A;  2CUZ A;  2CV1 A;  2BUY A;  3GO8 A;  1MX0 A;  4IBI A;  3L2A A;  2F5O A;  5KPR A;  3SAT A;  2L7H A;  1R2Z A;  4LFB M;  1IY2 A;  2DVW B;  1Z5A A;  4JXJ A;  1NVM A;  1N78 A;  2D7H A;  1R2Y A;  3I4Y A;  4BB9 A;  3K1J A;  4G4O A;  2L6O A;  3K8Z A;  1NY5 A;  1J7K A;  4R7G A;  4LZJ A;  1QAN A;  3SHG B;  2Y0T A;  3GPX A;  4LF7 M;  2BUM A;  3PCD M;  3NBI A;  5IT9 S;  4XGI A;  4AZF A;  2FOI C;  3LKT A;  3KW6 A;  1YKM A;  3GPY A;  4LFC M;  1GLN A;  4OU7 A;  2UUC M;  1XMQ M;  3BOS A;  5C1B A;  2UU9 M;  4P16 A;  3WHL A;  1YKL B;  1J09 A;  4LJA A;  3DZD A;  5BR8 M;  3HJQ A;  3PCL M;  1DGG A;  1XHB A;  4PCZ A;  2C9O A;  5E6J A;  3FTD A;  3GPP A;  5KPT A;  4B7G A;  3T15 A;  3T38 A;  4IBB A;  1HT1 E;  3HJS A;  1NJF A;  4AW4 A;  3W0L B;  3KSJ A;  2BUZ B;  4B7F A;  1UM8 A;  4DR2 M;  3L28 A;  3KP0 E;  1GL7 A;  2LWX A;  2YNM D;  3VFD A;  3L26 A;  4DR7 M;  4WHS D;  2XEP A;  2FFJ A;  2YQZ A;  4BLC A;  4LF4 M;  3A98 B;  2PCD A;  2CHV A;  3I51 A;  4WHS B;  5ITX E;  2BUX A;  4JI3 M;  1IXS B;  1MU5 A;  5EXS A;  2CV2 A;  2R46 A;  3UJN A;  3HWS A;  3T1Y M;  1L2B A;  1EOB A;  3U6S A;  4GIT A;  2R4E A;  4HL4 A;  5ITU A;  2XFT A;  1HT2 E;  5EJC A;  4AKH A;  1XNQ M;  4DV7 M;  3LMX A;  4JN6 A;  2G5G X;  3R9X B;  4KHP M;  1EOA B;  2I7N A;  2XSR A;  3MV6 M;  3PCB A;  1IY0 A;  2QEN A;  3O6R A;  3PCC A;  5DYG A;  5EXP A;  1YKO A;  1IN8 A;  2ZAO A;  2H1R A;  3L29 A;  4FW9 A;  4DV2 M;  4WHQ B;  4PD2 A;  3TWK A;  3U6M A;  4ITQ A;  2BUR A;  3PCM A;  1YKP B;  4JI8 M;  2F5S A;  4YY3 M;  1YKK A;  2C5R A;  7CAT A;  2V1C A;  5EXX A;  3KOY E;  3GQ3 A;  1EOC B;  1SXJ A;  1Z6T A;  3GLF A;  4NSO B;  2ZM6 M;  2UXC M;  3PCE A;  4LJ5 A;  1E9R A;  3Q8X A;  5IZ7 D;  3SFZ A;  4LF5 M;  1L1Z A;  2UUA M;  3PCN M;  1T3T A;  4FCT A;  1IQP A;  4DR6 M;  2R65 A;  5EP4 A;  5JI2 E;  1N75 A;  5JI3 E;  3TQS A;  3PNY A;  4MGY E;  1DLM A;  4D80 A;  1D2N A;  3KXE C;  4NOO B;  3U6C A;  4MB7 A;  3PCG M;  3PCJ M;  1DGF A;  3U5Z A;  4WHP A;  3A46 A;  2BOY A;  3TPZ A;  5FTL A;  4KO8 A;  1PJI A;  3UGJ A;  4QNM A;  1R6B X;  5KQ8 A;  2UUB M;  2C99 A;  3T1H M;  4IBF A;  3DA1 A;  4PDG A;  4LJ4 A;  2Q2E B;  1DO2 A;  4GHL A;  3LVV A;  4ILV A;  3KOX E;  4OVZ B;  4AG6 A;  2XSZ A;  1TDH A;  1EO9 A;  2LNH C;  1IN7 A;  3FYD A;  4W5W A;  4WW0 A;  3PCF M;  2BUV B;  1YKN B;  3O6J A;  4FWH A;  4X62 M;  3PNV A;  2ZBK B;  4L15 A;  4LJ7 A;  2KZU A;  5TD3 A;  4CHT B;  3GQ5 A;  1DGH A;  3UMM A;  2BUW A;  4DV4 M;  3RGS A;  4AKG A;  2KZS A;  3HU1 A;  2RGO A;  3LQR A;  2BUT A;  4MGZ E;  3PCA M;  3ZCB B;  3IG8 A;  4DV6 M;  3D8B A;  4FWD A;  1JR3 A;  1L2C A;  1K3X A;  1QAO A;  3FYC A;  2OPF A;  4B08 A;  1QAM A;  3U61 B;  1Q3B A;  5EQT A;  1XWI A;  1IBK M;  3PCI M;  3HJ8 A;  4DV1 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...