5LMNM

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5lmnM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5lmnM02
4JI7M 2EA0A 4DR5M 2XZFA 1N34M 3C58A 4DUZM 4DR3M 5IWAM 5ITQA 4DR4M 3JR4A 3U6SA 5ITUA 4YHHM 3GQ4A 4DV5M 4B3TM 1Z59A 4PDGA 4NXNM 2ZM6M 3JAMS 4OX9M 3U6MA 3U6QA 3TWMA 4LF5M 3SARA 1Z5CA 2OPFA 1HR0M 4B3MM 2E5LM 4DV6M 3SATA 3GPPA 3GQ3A 4JI4M 4K0KM 1N33M 5LMUM 1XMOM 1PJIA 1IBLM 1L1ZA 2F5QA 2UUBM 3SAWA 5A2QS 4DV4M 4YY3M 3GQ5A 3U6LA 2VQFM 1TDHA 1EE8A 2OQ4A 2F5OA 4CISA 3VK8A 4LFCM 5FLXS 4KHPM 5ITYA 1R2YA 4JI0M 4PDIA 4NRVA 4DR2M 4PCZA 3A42A 4DR1M 5ITXA 4AQYM 4JI5M 3W0FA 4ITQA 1PJJA 5ITXE 2UUAM 4MB7A 1HNXM 4DV2M 4LF6M 4LF9M 1Q3BA 1MU5A 3GPYA 3TWKA 4X66M 2UU9M 4JI2M 5IT9S 3GO8A 3JR5A 1R2ZA 3U6PA 3OTOM 1L2DA 4LFBM 1K82A 1KFVA 1I94M 4JI1M 2HHHM 3J80S 3GPXA 1Q3CA 1L2BA 4DV0M 1HNZM 2Q2EB 4LF4M 4LF8M 4DV7M 4NXMM 4JI6M 3DOAA 4DV3M 2F5NA 2XZUA 1N32M 5ITRA 3J7AS 1Z5BA 2VQEM 3VK7A 1IBMM 3A45A 4X65M 3J81S 1XC8A 3T1HM 3U6OA 3GP1A 1XMQM 3SAUA 2F5SA 2UXCM 4B3RM 4GKJM 2UXDM 4DR7M 4PD2A 5LMNM 3GPUA 4DUYM 1TDZA 4DV1M 3T1YM 4X62M 1Z5AA 4DR6M 1HNWM 1PM5A 1IBKM 3U6EA 1K3XA 1L2CA 1XNRM 4G4RA 2ZBKB 5BR8M 1FJGM 2UXBM 1Q39A 2UUCM 3SBJA 4LF7M 3U6DA 3U6CA 4G4QA 3A46A 2F4VM 3TWLA 1MX0A 4X64M 3SAVA 4B3SM 4GKKM 4JI3M 1L1TA 2F5PA 4JYAM 4G4NA 1NNJA 1XNQM 1K3WA 4JV5M 2HKJA 4NRWA 3SASA 4G4OA 5ITTA 4JI8M 1J5EM 1N36M 4LFAM
chains in the Genus database with same CATH superfamily
4F1IA 2JUJA 3SYKA 3TE6A 4DR5M 1R6BX 5FTMA 2K9DA 5KQ8A 4QNRA 3SYLA 3LQQA 3H4MA 1DGGA 2DAMA 2DI0A 5F3WA 4GEWA 4GIPA 3FUTA 4KLNA 5ITUA 4LGMA 3GQ4A 4ZPXA 1A5TA 4S12A 1PJQA 1UFZA 4PDGA 1UM8A 4B7HA 3JAMS 2M5ZA 1V34A 2OO9A 4LRTA 3UGJA 4G3OA 3GLGE 4R3DA 3U5ZB 1OKSA 4BB9A 2C5RA 1Z5CA 2DXIA 3GQ3A 2Z4SA 4I5SA 1SG9A 4LY6A 5LMUM 4Z6YA 3U5ZA 3KOZE 3SAWA 1OFHA 3V76A 4YY3M 3U6LA 2VQFM 4L6V6 1TDHA 1XNRM 1QANA 4TUWA 2OQ4A 3ZQJA 2DWMA 4LFCM 3U61B 3CF2A 2L4FA 2KXEA 4QOSA 1HQYE 1NO1A 1Y8GA 1HT1E 3I01M 2W82A 4WP2A 1T6OA 5ITYA 4NRVA 4DR2M 3CGWA 2XSZD 1OAIA 3IG5A 1P3QQ 2D7HA 1JR3A 1IM2A 5IZ7D 3U61A 2UUAM 3AOEC 4ITQA 1IN5A 4JI5M 4KT0F 1HNXM 1DV0A 2MH8A 3TL4X 2Y0QA 4MGZE 4LF9M 3AL0C 5FTKA 2QP9X 1MU5A 3UK6A 3GPYA 2BNKA 2JA2A 3W0LB 3HU1A 4D82A 2DAKA 3R8FA 5L8RF 4JI2M 1AUAA 2MROB 2L09A 4FCWA 2EO2A 5C1BA 3I4VA 4HL4A 4JI1M 2C98A 2XFSA 4Z8XA 2EKFA 1NJFA 2X49A 2OOAA 4CHTB 2KNVA 3UZUA 1E32A 3VKGA 3C3DA 2Y0TA 4LF4M 1WXQA 4M9ZA 4NXMM 2YNMD 4DV3M 2LVAA 2RRUA 2Z3XA 3ZH9B 1Z5BA 1XXHE 2DHYA 3AFHA 3C9PA 1D0KA 2HWJA 1QZEA 3FTCA 3HJ8A 3VK7A 1IBMM 1MJGM 1ZMUA 1XC8A 3T1HM 2JY8A 3R9XB 5BPVA 3GP1A 1LV7A 4ANRA 5EQTA 2XLJA 3FUWA 4GH9A 2KW0A 2UXCM 2HAKA 5FTNA 4GKJM 3IECA 2UXDM 4I8OA 2CV0A 4IBEA 4OU7A 2R4JA 4LGYA 3SFZA 4PD2A 1TTEA 4DR7M 3FYDA 4I81A 4DUYM 2YR0A 2DVWB 4DV1M 2C9CA 2LVQD 2I7PA 1PM5A 1GO5A 3U6EA 1K3XA 3CF6E 1IXZA 1VEJA 2CEAA 4LZJA 2R65A 2BWEA 2O01F 5BR8M 1FJGM 4FCTA 5E26A 3HHWA 2WZJA 5C18A 2QZ4A 2BWBA 2CP8A 4IBBA 4OVZB 2FOIC 3U6CA 4LF7M 2Z7JA 1BVSA 1MX0A 3SAVA 2D7GA 4G4NA 3IHPA 4OVZA 1T43A 5FTLA 1ZMWA 2H1RA 3FTDA 3HHZA 3A98B 1JR3D 2H5XA 3SASA 4G4OA 1G4AE 3IG8A 4LFAM 3AKZA 1WJ7A 3HKPA 4JI7M 2EA0A 4IIWA 2ZAOA 1VG5A 1FNNA 4LZZA 1N34M 2XH9A 3C58A 1CUKA 1E94E 1HNWM 1EIJA 4LRSA 4RKUF 2EKKA 1NNUC 3C3EA 1I4WA 1PGYA 1GKIA 5FSWA 2MGWA 4YHHM 5DYGA 4DV5M 1TF0B 1YUBA 2X4AA 3K1JA 2R4EA 4FCVA 1IN6A 4XK8F 5EP1A 4NXNM 2ZM6M 1IXSB 1G41A 3BOSA 1W5TA 3U6MA 3U6QA 2JZ0A 3CF0A 2L7HA 4RF1A 5EJCA 3NBIA 4JXJA 1NY5A 2KZSA 4NSOB 4WURA 1G71A 2L4EA 4LJ9A 3GPPA 4DV6M 1DGBA 4F2LA 4JI4M 1IXSA 3H4JA 3KP0E 2LNHC 1YSYA 1XMOM 1V92A 2UUBM 3GRVA 5A2QS 2K0BX 4AKGA 1WGNA 3PFIA 1SXJC 4CISA 2CHQA 4BBAA 2DZOB 3HJQA 2GQFA 2DWZB 4KHPM 1GL7A 5EXXA 1QDTA 2QNJA 5EXTA 2KA6B 2QCUA 4DR1M 1TH2A 2RGHA 3HJSA 5ITXA 3W0FA 1TGUA 2KRUA 1JR3E 4MB7A 1H6UA 3GLHB 5EXSA 4Y28F 3K92A 4G6ZA 4FWGA 4LF6M 1GJSA 1QZMA 2VF8A 7CATA 2KZUA 1OJLA 1HJPA 3RGPA 3GLHA 1R2ZA 3E21A 2KHHA 3T6PA 2DKLA 3OTOM 1K82A 3KOXE 3BBZA 2QENA 1IN4A 1I94M 3VLFB 3QWLA 4RNAA 2HHHM 2FS1A 1L2BA 2LVOC 2Y20A 4LJ8A 3FD9A 3DA1A 1ZMVA 4OW0A 2F5NA 1D0LA 2JXNA 4XBOA 4JN6A 4REZA 4FVMA 4BLCA 2VQEM 3QYBA 2MJ5B 4PT5A 2JP7A 2RGOA 1NVMA 3ILKA 3HU3A 4LJ5A 3EIHA 3LCVB 3PNVA 1WIVA 2JY5A 3K2LA 3Q8XA 1XMQM 1QAOA 2AHMA 4Q7JA 3L29A 1SXJB 1ZV1A 4GC9A 3GLFE 4B3RM 3HX3A 3KP1E 3GLIB 4L8RC 4IBFA 1XWIA 5LMNM 4HLQA 3MJ5A 1DGHB 1Q02A 1VEGA 1SXJA 3KXEC 3SMSA 4CGYB 4DR6M 2HL7A 4II7A 3GLIA 2KRKA 4I4LA 2CFOA 1NSFA 1R5LA 3FUVA 4M0WA 3WHKA 5JI2E 3GLGB 1L2CA 3KS8A 1ORYB 4RF0A 1DGHA 2UXBM 1F4IA 3FRHA 1VQ1A 1OIPA 3SBJA 2L6OA 3HGIA 1QAMA 3GLGA 1OFIA 1HQCA 4G4QA 3A46A 1J09A 1QYRA 2CRUA 2L2DA 4R71A 1IN7A 1N75A 4JI3M 3LW5F 2V1CA 2DENA 4KODA 3FTFA 4GHAA 1XNQM 1NHWC 1QUTA 2Z4RA 3BXWA 3HWSA 2HKJA 2QPAA 3MMPA 2O5RA 5ITTA 4FD2A 3FYCA 1N36M 4NSRA 4JI8M 1OIZA 1YLAA 2APLA 2C9OA 2CE7A 3FUUA 2YFQA 4M0DA 5DYIA 5E6JA 3RFWA 4AZFA 1GJTA 1YE9A 2J7NA 1WHCA 2JWSA 4DUZM 4D81A 3M7GA 1NHGC 5ITQA 3WHLA 3B89A 1G3IA 4DR4M 4DBGB 1R7RA 2BJVA 3JR4A 1N77A 3QYEA 3J7BA 4B3TM 2O25A 2JY7A 4IJEA 1EFUB 4MH0E 2VF7A 3W68A 4MGHA 3TWMA 3SC3A 2WSCF 3CTWB 2OPFA 1HR0M 1WR1B 4WW0A 3L28A 3SATA 3DZDA 1N33M 1PJIA 4MGIE 4AKHA 3HU2A 2F5QA 3LMMA 3QAUA 1IY1A 3SMPA 4LJ4A 4NOOB 1DO0A 4LCBA 3HZJA 3VDPA 3TPZA 1IQPA 5IREB 5FTJA 2OOBA 4NC6A 4IBKA 5FLXS 4KO8A 1R2YA 4MGKE 2JNHA 3LVVA 1PJTA 3UMMA 3A42A 2I7NA 1PJJA 5ITXE 3NBXX 1R4GA 1MN3A 1SXJD 1X37A 4LJ7A 3VKHA 3B74A 1Q3BA 3AJIB 3TWKA 4NL4H 4X66M 3KOYE 4D80A 1VEKA 5KQDA 4IBGA 2LHCA 1QDRA 3GO8A 3L27A 3JR5A 3E46A 1V33A 4IBJA 4AKIA 3U6PA 2R45A 1L2DA 1KFVA 2P5TA 2KEBA 3PNYA 5DFLA 3W67A 3J80S 1WGLA 1Q3CA 3GPXA 4MM3B 2NQ8C 4GC5A 1HNZM 4LF8M 2QSFX 4IBCA 2GNOA 3FKEA 5EP3A 3L25A 4JI6M 2JZ1A 3HHXA 2DWNA 2N35A 1DO2A 1GVNA 5KPRA 2LVPC 2XZUA 2MR9A 3KSJA 5ITRA 2FH0A 3J7AS 1W5SA 3LVWA 2C96A 3B9PA 4P17A 3UJNA 4X65M 1G59A 3J81S 3ZCBB 3U6OA 2R0IA 3E4RA 3KW6A 3SAUA 2F5SA 1E9SA 1NV9A 3J27B 3L2AA 1NJGA 3KS4A 3HY5A 3PVSA 1IN8A 3B7ZA 1D0MA 2HCBA 3FTEA 3KSXA 2ERCA 2CV1A 3GPUA 2Z8YM 4LJ6A 3LQRA 4X62M 1Z5AA 1SXJE 4K0KM 4W5WA 4QHTA 2R62A 2WSFF 4FWDA 2XGNA 4L4UA 4QNMA 3GLIE 2R44A 4IJFA 2ZBKB 4L16A 3FRIA 1Q39A 4IBIA 3AOGA 1QUSA 3U6DA 1N78A 2DZLA 3GRYA 2F4VM 1E9RA 2G3QA 3T38A 4QOZC 2R18A 3HHYA 2G8LA 5EXPA 4GKKM 1XHBA 3U60B 2LBCA 2F5PA 1AIPC 3J2PB 1NNJA 2DAEA 5EP4A 2CHVA 1C7YA 1XB2B 3M6AA 5JI3E 2RKOA 3K9PA 2QBYB 2V1UA 4JV5M 3RE8A 3LCUA 2CUZA 3U60A 1J5EM 4B7GA 1HT2E 5KO3A 4GHLA 1D2NA 4QHSA 4GRIA 3FUXA 2BJWA 2XZFA 2QBYA 2QHOB 3SHFA 3E9SA 2XFTA 4R7GA 4DR3M 5IWAM 4MGYE 2KNAA 4L78A 1VDDA 1GABA 1JQJC 3TQSA 3U6SA 1C1KA 3RGSA 1GLNA 1OAOC 2ZTDA 3MK6A 4FW9A 1Z59A 4OX9M 2FFJA 4LF5M 2M60A 3SARA 2DAIA 4B3MM 2E5LM 2V6ZM 3Q8GA 2EJSA 3KDSE 1NY6A 3B7NA 3KVWA 1J7KA 1IBLM 1L1ZA 1KSFX 3D8BA 4DV4M 1IFYA 2LHGA 2CWBA 3I04M 3GQ5A 2Y21A 1EE8A 1TH3A 4EIWA 5H37D 3VK8A 2F5OA 2K47A 4LJAA 2WSEF 1GL6A 4B7FA 2ZTCA 1NV8A 2DHRA 3L26A 3K8ZA 4JI0M 5EP2A 4PDIA 2R46A 8CATA 4PCZA 4XGIA 3VDUA 3DFZA 2DWLA 4GITA 2ZANA 1G8PA 2J7OA 3D8LA 4AQYM 3M0EA 3B7QA 2A5YB 3GLFB 2XF3A 1IY2A 2KDLA 5KPZA 1JB0F 2G5GX 4DV2M 5DNYA 1RU3A 4A3VB 3KFUG 3EIEA 2UU9M 5IT9S 3GLFA 3GRRA 1QAQA 5KPTA 4AW4A 4M9XA 4HEOA 1QVRA 4LFBM 2FNAA 3AV0A 1T3TA 4UN2B 1XXHB 2ZAMA 2K6BA 4AI6A 3FE3A 2YQZA 2D7EA 2QQ8A 4M9SA 1IXRC 4DV0M 2Q2EB 4DV7M 3DOAA 3MHVC 2LXEA 1XXHA 1N32M 2CV2A 2KNZA 1LTMA 3AOEA 2JY6B 3PXGA 2LH0A 3A45A 4IBDA 3ZC7B 1OTRA 2C99A 1DGFA 2L7IA 2XEPA 5GKNA 1KYIA 2EUCA 2LVNC 3KOWE 3THGA 1PRBA 3GLHE 4AG5A 2XSZA 4AG6A 1TH4A 1QQWA 1ZAEA 3K9OA 1TDZA 3T1YM 2VDBB 1L8QA 4GMQA 2J5YA 1IBKM 2DAGA 2DZNB 2B3TA 4CJ6A 3NWLA 4LG2A 4G4RA 3T15A 4CIZA 3GRUA 2UUCM 1IY0A 2LTUA 2CHGA 4L15A 2X8AA 2R6FA 3I51A 1ZQ9A 4FWHA 3TWLA 4X64M 4B3SM 1VDLA 2VIIA 1S3SA 1L1TA 4JYAM 3VFDA 4P16A 1TR8A 2DNAA 1OQYA 2LWXA 1PJSA 1K3WA 3F92A 3I4YA 1Z6TA 4B08A 4NRWA 2FE8A 3SHGB
chains in the Genus database with same CATH topology
3SYKA 3TE6A 4DR5M 1R6BX 5FTMA 5KQ8A 4QNRA 3SYLA 3LQQA 3H4MA 1DGGA 5F3WA 4GIPA 3FUTA 4KLNA 5ITUA 4LGMA 3GQ4A 4ZPXA 4S12A 4PDGA 1UM8A 4B7HA 3JAMS 2M5ZA 3UGJA 4LRTA 4R3DA 3U5ZB 2C5RA 4BB9A 1Z5CA 2DXIA 3GQ3A 2Z4SA 4I5SA 4LY6A 5LMUM 4Z6YA 3U5ZA 3KOZE 3SAWA 1OFHA 4YY3M 3U6LA 2VQFM 4TUWA 1TDHA 1QANA 2OQ4A 2DWMA 4LFCM 3U61B 3CF2A 4QOSA 2KXEA 1HQYE 1HT1E 5ITYA 2W82A 4NRVA 4DR2M 2XSZD 3IG5A 2D7HA 1JR3A 1IM2A 5IZ7D 3U61A 2UUAM 3AOEC 4ITQA 1IN5A 4JI5M 1HNXM 3TL4X 2Y0QA 4MGZE 4LF9M 3AL0C 5FTKA 2QP9X 1MU5A 3UK6A 3GPYA 2BNKA 2JA2A 3W0LB 3HU1A 4D82A 4JI2M 3R8FA 2L09A 4FCWA 2EO2A 5C1BA 3I4VA 4HL4A 4JI1M 2C98A 2XFSA 4Z8XA 1NJFA 2X49A 4CHTB 3VKGA 3UZUA 1E32A 2Y0TA 4LF4M 1WXQA 4M9ZA 4NXMM 2YNMD 4DV3M 2Z3XA 3ZH9B 1Z5BA 3AFHA 3FTCA 3HJ8A 3VK7A 1IBMM 1XC8A 3T1HM 3R9XB 5BPVA 3GP1A 1LV7A 5EQTA 2XLJA 3FUWA 4GH9A 2KW0A 2UXCM 4GKJM 5FTNA 2UXDM 4I8OA 2CV0A 4IBEA 4OU7A 2R4JA 4LGYA 3SFZA 4PD2A 4DR7M 3FYDA 4I81A 4DUYM 2YR0A 2DVWB 4DV1M 2C9CA 2I7PA 1PM5A 3U6EA 1K3XA 3CF6E 1IXZA 2CEAA 4LZJA 2R65A 5BR8M 1FJGM 4FCTA 5E26A 3HHWA 5C18A 2QZ4A 4IBBA 4OVZB 4LF7M 3U6CA 2FOIC 2Z7JA 1MX0A 3SAVA 2D7GA 4G4NA 4OVZA 5FTLA 2H1RA 3FTDA 3HHZA 3A98B 1JR3D 3SASA 4G4OA 1G4AE 3IG8A 4LFAM 3AKZA 3HKPA 4JI7M 2EA0A 4IIWA 2ZAOA 1FNNA 4LZZA 1N34M 2XH9A 3C58A 1E94E 1HNWM 4LRSA 1NNUC 1I4WA 1GKIA 5FSWA 4YHHM 4DV5M 5DYGA 1YUBA 3K1JA 2X4AA 4FCVA 2R4EA 5EP1A 1IN6A 4NXNM 2ZM6M 1IXSB 1G41A 3BOSA 1W5TA 3U6MA 3U6QA 3CF0A 2L7HA 4RF1A 5EJCA 3NBIA 4JXJA 1NY5A 2KZSA 4NSOB 4WURA 4LJ9A 3GPPA 4DV6M 4JI4M 4K0KM 1DGBA 1XMOM 3KP0E 2LNHC 1YSYA 2UUBM 3GRVA 5A2QS 4AKGA 3PFIA 1SXJC 4CISA 2CHQA 4BBAA 2DZOB 3HJQA 2DWZB 4KHPM 1GL7A 5EXXA 5EXTA 2KA6B 2QCUA 4DR1M 1TH2A 2RGHA 3HJSA 5ITXA 3W0FA 1TGUA 2KRUA 4MB7A 1H6UA 3GLHB 5EXSA 3K92A 4G6ZA 4FWGA 4LF6M 1QZMA 7CATA 2KZUA 1OJLA 3RGPA 3GLHA 1R2ZA 3OTOM 1K82A 3KOXE 2QENA 1IN4A 1I94M 3VLFB 3QWLA 4RNAA 2HHHM 1L2BA 2Y20A 4LJ8A 3FD9A 3DA1A 4OW0A 2F5NA 4XBOA 4JN6A 4REZA 4FVMA 4BLCA 2VQEM 4PT5A 2RGOA 1NVMA 3ILKA 3HU3A 4LJ5A 3EIHA 3PNVA 3K2LA 3Q8XA 1XMQM 1QAOA 2AHMA 3L29A 1SXJB 4GC9A 4B3RM 3GLIB 3KP1E 4L8RC 4IBFA 1XWIA 5LMNM 4HLQA 3MJ5A 1DGHB 1SXJA 3KXEC 3SMSA 4CGYB 4DR6M 2HL7A 4II7A 3GLIA 2KRKA 4I4LA 2CFOA 1NSFA 3FUVA 4M0WA 3WHKA 5JI2E 3GLGB 1L2CA 3KS8A 1ORYB 4RF0A 1DGHA 2UXBM 3SBJA 2L6OA 3HGIA 1QAMA 3GLGA 1OFIA 1HQCA 4G4QA 3A46A 1J09A 1QYRA 1IN7A 1N75A 4JI3M 2V1CA 4GHAA 4KODA 3FTFA 1XNQM 1NHWC 2Z4RA 3HWSA 2HKJA 2QPAA 2O5RA 5ITTA 4FD2A 3FYCA 1N36M 4NSRA 4JI8M 3RFWA 4M0DA 2C9OA 2CE7A 3FUUA 2YFQA 5DYIA 5E6JA 4AZFA 1YE9A 2J7NA 4DUZM 4D81A 3M7GA 1NHGC 5ITQA 3WHLA 1G3IA 4DR4M 1R7RA 2BJVA 3JR4A 1N77A 3J7BA 4B3TM 4IJEA 4MH0E 4MGHA 3TWMA 3SC3A 3CTWB 2OPFA 1HR0M 4WW0A 3L28A 3SATA 3DZDA 1N33M 1PJIA 4MGIE 4AKHA 3HU2A 2F5QA 3LMMA 3QAUA 1IY1A 3SMPA 4LJ4A 4NOOB 1DO0A 4LCBA 3VDPA 3TPZA 1IQPA 5IREB 5FTJA 4IBKA 5FLXS 4KO8A 1R2YA 4MGKE 3LVVA 3UMMA 3A42A 2I7NA 1PJJA 5ITXE 1SXJD 1X37A 4LJ7A 3VKHA 1Q3BA 3AJIB 3TWKA 4NL4H 4X66M 3KOYE 4D80A 5KQDA 4IBGA 3GO8A 3JR5A 3L27A 4AKIA 4IBJA 3U6PA 2R45A 1L2DA 1KFVA 2P5TA 2KEBA 3PNYA 3J80S 3GPXA 1Q3CA 4MM3B 2NQ8C 4GC5A 1HNZM 4LF8M 4IBCA 3FKEA 5EP3A 3L25A 4JI6M 3HHXA 2DWNA 1DO2A 1GVNA 5KPRA 2XZUA 3KSJA 5ITRA 3J7AS 1W5SA 3LVWA 2C96A 3B9PA 3UJNA 4X65M 1G59A 3J81S 3ZCBB 3U6OA 3E4RA 3KW6A 3SAUA 2F5SA 1E9SA 3J27B 3L2AA 1NJGA 3KS4A 3PVSA 1IN8A 2HCBA 3FTEA 3KSXA 2ERCA 2CV1A 3GPUA 4LJ6A 3LQRA 4X62M 1Z5AA 1SXJE 4W5WA 4QHTA 2R62A 1XNRM 4FWDA 2XGNA 4L4UA 4QNMA 4IJFA 2ZBKB 4L16A 1Q39A 4IBIA 3AOGA 3U6DA 1N78A 3GRYA 2F4VM 1E9RA 3T38A 4QOZC 2R18A 3HHYA 2G8LA 5EXPA 4GKKM 1XHBA 3U60B 2F5PA 3J2PB 1NNJA 5EP4A 2CHVA 3M6AA 5JI3E 2RKOA 2QBYB 2V1UA 4JV5M 3RE8A 2CUZA 3U60A 1J5EM 4B7GA 1HT2E 5KO3A 4GHLA 1D2NA 4QHSA 4GRIA 3FUXA 2BJWA 2XZFA 2QBYA 3SHFA 3E9SA 2XFTA 4R7GA 4DR3M 5IWAM 4MGYE 4L78A 1VDDA 1JQJC 3TQSA 3U6SA 1C1KA 3RGSA 1GLNA 4FW9A 3MK6A 1Z59A 4OX9M 2FFJA 4LF5M 2M60A 3SARA 4B3MM 2E5LM 2V6ZM 3KDSE 1NY6A 3KVWA 1J7KA 1IBLM 1L1ZA 1KSFX 3D8BA 4DV4M 3GQ5A 2Y21A 1EE8A 1TH3A 4EIWA 5H37D 3VK8A 2F5OA 2K47A 4LJAA 1GL6A 4B7FA 2DHRA 3L26A 3K8ZA 4JI0M 5EP2A 4PDIA 2R46A 8CATA 4PCZA 4XGIA 3VDUA 3DFZA 2DWLA 4GITA 2ZANA 1G8PA 2J7OA 3D8LA 4AQYM 3M0EA 2A5YB 3GLFB 2XF3A 1IY2A 5KPZA 2G5GX 4DV2M 5DNYA 4A3VB 3KFUG 3EIEA 2UU9M 5IT9S 3GLFA 3GRRA 1QAQA 5KPTA 4AW4A 4M9XA 1QVRA 4LFBM 2FNAA 3AV0A 1T3TA 1XXHB 2ZAMA 4AI6A 2YQZA 2D7EA 4M9SA 1IXRC 4DV0M 2Q2EB 4DV7M 3DOAA 3MHVC 2LXEA 1XXHA 1N32M 2CV2A 3AOEA 3PXGA 2LH0A 3A45A 4IBDA 3ZC7B 2C99A 1DGFA 2L7IA 2XEPA 5GKNA 1KYIA 2EUCA 3KOWE 3THGA 4AG5A 2XSZA 4AG6A 1TH4A 1QQWA 1ZAEA 1TDZA 3T1YM 1L8QA 4GMQA 1IBKM 2DZNB 3NWLA 4LG2A 4G4RA 3T15A 3GRUA 2UUCM 1IY0A 2CHGA 4L15A 2X8AA 3I51A 1ZQ9A 4FWHA 3TWLA 4X64M 4B3SM 2VIIA 1S3SA 1L1TA 4JYAM 3VFDA 4P16A 2LWXA 1K3WA 3I4YA 1Z6TA 4B08A 4NRWA 2FE8A 3SHGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 M;  2EA0 A;  4DR5 M;  2XZF A;  1N34 M;  3C58 A;  4DUZ M;  4DR3 M;  5IWA M;  5ITQ A;  4DR4 M;  3JR4 A;  3U6S A;  5ITU A;  4YHH M;  3GQ4 A;  4DV5 M;  4B3T M;  1Z59 A;  4PDG A;  4NXN M;  2ZM6 M;  3JAM S;  4OX9 M;  3U6M A;  3U6Q A;  3TWM A;  4LF5 M;  3SAR A;  1Z5C A;  2OPF A;  1HR0 M;  4B3M M;  2E5L M;  4DV6 M;  3SAT A;  3GPP A;  3GQ3 A;  4JI4 M;  4K0K M;  1N33 M;  5LMU M;  1XMO M;  1PJI A;  1IBL M;  1L1Z A;  2F5Q A;  2UUB M;  3SAW A;  5A2Q S;  4DV4 M;  4YY3 M;  3GQ5 A;  3U6L A;  2VQF M;  1TDH A;  1EE8 A;  2OQ4 A;  2F5O A;  4CIS A;  3VK8 A;  4LFC M;  5FLX S;  4KHP M;  5ITY A;  1R2Y A;  4JI0 M;  4PDI A;  4NRV A;  4DR2 M;  4PCZ A;  3A42 A;  4DR1 M;  5ITX A;  4AQY M;  4JI5 M;  3W0F A;  4ITQ A;  1PJJ A;  5ITX E;  2UUA M;  4MB7 A;  1HNX M;  4DV2 M;  4LF6 M;  4LF9 M;  1Q3B A;  1MU5 A;  3GPY A;  3TWK A;  4X66 M;  2UU9 M;  4JI2 M;  5IT9 S;  3GO8 A;  3JR5 A;  1R2Z A;  3U6P A;  3OTO M;  1L2D A;  4LFB M;  1K82 A;  1KFV A;  1I94 M;  4JI1 M;  2HHH M;  3J80 S;  3GPX A;  1Q3C A;  1L2B A;  4DV0 M;  1HNZ M;  2Q2E B;  4LF4 M;  4LF8 M;  4DV7 M;  4NXM M;  4JI6 M;  3DOA A;  4DV3 M;  2F5N A;  2XZU A;  1N32 M;  5ITR A;  3J7A S;  1Z5B A;  2VQE M;  3VK7 A;  1IBM M;  3A45 A;  4X65 M;  3J81 S;  1XC8 A;  3T1H M;  3U6O A;  3GP1 A;  1XMQ M;  3SAU A;  2F5S A;  2UXC M;  4B3R M;  4GKJ M;  2UXD M;  4DR7 M;  4PD2 A;  5LMN M;  3GPU A;  4DUY M;  1TDZ A;  4DV1 M;  3T1Y M;  4X62 M;  1Z5A A;  4DR6 M;  1HNW M;  1PM5 A;  1IBK M;  3U6E A;  1K3X A;  1L2C A;  1XNR M;  4G4R A;  2ZBK B;  5BR8 M;  1FJG M;  2UXB M;  1Q39 A;  2UUC M;  3SBJ A;  4LF7 M;  3U6D A;  3U6C A;  4G4Q A;  3A46 A;  2F4V M;  3TWL A;  1MX0 A;  4X64 M;  3SAV A;  4B3S M;  4GKK M;  4JI3 M;  1L1T A;  2F5P A;  4JYA M;  4G4N A;  1NNJ A;  1XNQ M;  1K3W A;  4JV5 M;  2HKJ A;  4NRW A;  3SAS A;  4G4O A;  5ITT A;  4JI8 M;  1J5E M;  1N36 M;  4LFA M; 
#chains in the Genus database with same CATH topology
 4F1I A;  2JUJ A;  3SYK A;  3TE6 A;  4DR5 M;  1R6B X;  5FTM A;  2K9D A;  5KQ8 A;  4QNR A;  3SYL A;  3LQQ A;  3H4M A;  1DGG A;  2DAM A;  2DI0 A;  5F3W A;  4GEW A;  4GIP A;  3FUT A;  4KLN A;  5ITU A;  4LGM A;  3GQ4 A;  4ZPX A;  1A5T A;  4S12 A;  1PJQ A;  1UFZ A;  4PDG A;  1UM8 A;  4B7H A;  3JAM S;  2M5Z A;  1V34 A;  2OO9 A;  4LRT A;  3UGJ A;  4G3O A;  3GLG E;  4R3D A;  3U5Z B;  1OKS A;  4BB9 A;  2C5R A;  1Z5C A;  2DXI A;  3GQ3 A;  2Z4S A;  4I5S A;  1SG9 A;  4LY6 A;  5LMU M;  4Z6Y A;  3U5Z A;  3KOZ E;  3SAW A;  1OFH A;  3V76 A;  4YY3 M;  3U6L A;  2VQF M;  4L6V 6;  1TDH A;  1XNR M;  1QAN A;  4TUW A;  2OQ4 A;  3ZQJ A;  2DWM A;  4LFC M;  3U61 B;  3CF2 A;  2L4F A;  2KXE A;  4QOS A;  1HQY E;  1NO1 A;  1Y8G A;  1HT1 E;  3I01 M;  2W82 A;  4WP2 A;  1T6O A;  5ITY A;  4NRV A;  4DR2 M;  3CGW A;  2XSZ D;  1OAI A;  3IG5 A;  1P3Q Q;  2D7H A;  1JR3 A;  1IM2 A;  5IZ7 D;  3U61 A;  2UUA M;  3AOE C;  4ITQ A;  1IN5 A;  4JI5 M;  4KT0 F;  1HNX M;  1DV0 A;  2MH8 A;  3TL4 X;  2Y0Q A;  4MGZ E;  4LF9 M;  3AL0 C;  5FTK A;  2QP9 X;  1MU5 A;  3UK6 A;  3GPY A;  2BNK A;  2JA2 A;  3W0L B;  3HU1 A;  4D82 A;  2DAK A;  3R8F A;  5L8R F;  4JI2 M;  1AUA A;  2MRO B;  2L09 A;  4FCW A;  2EO2 A;  5C1B A;  3I4V A;  4HL4 A;  4JI1 M;  2C98 A;  2XFS A;  4Z8X A;  2EKF A;  1NJF A;  2X49 A;  2OOA A;  4CHT B;  2KNV A;  3UZU A;  1E32 A;  3VKG A;  3C3D A;  2Y0T A;  4LF4 M;  1WXQ A;  4M9Z A;  4NXM M;  2YNM D;  4DV3 M;  2LVA A;  2RRU A;  2Z3X A;  3ZH9 B;  1Z5B A;  1XXH E;  2DHY A;  3AFH A;  3C9P A;  1D0K A;  2HWJ A;  1QZE A;  3FTC A;  3HJ8 A;  3VK7 A;  1IBM M;  1MJG M;  1ZMU A;  1XC8 A;  3T1H M;  2JY8 A;  3R9X B;  5BPV A;  3GP1 A;  1LV7 A;  4ANR A;  5EQT A;  2XLJ A;  3FUW A;  4GH9 A;  2KW0 A;  2UXC M;  2HAK A;  5FTN A;  4GKJ M;  3IEC A;  2UXD M;  4I8O A;  2CV0 A;  4IBE A;  4OU7 A;  2R4J A;  4LGY A;  3SFZ A;  4PD2 A;  1TTE A;  4DR7 M;  3FYD A;  4I81 A;  4DUY M;  2YR0 A;  2DVW B;  4DV1 M;  2C9C A;  2LVQ D;  2I7P A;  1PM5 A;  1GO5 A;  3U6E A;  1K3X A;  3CF6 E;  1IXZ A;  1VEJ A;  2CEA A;  4LZJ A;  2R65 A;  2BWE A;  2O01 F;  5BR8 M;  1FJG M;  4FCT A;  5E26 A;  3HHW A;  2WZJ A;  5C18 A;  2QZ4 A;  2BWB A;  2CP8 A;  4IBB A;  4OVZ B;  2FOI C;  3U6C A;  4LF7 M;  2Z7J A;  1BVS A;  1MX0 A;  3SAV A;  2D7G A;  4G4N A;  3IHP A;  4OVZ A;  1T43 A;  5FTL A;  1ZMW A;  2H1R A;  3FTD A;  3HHZ A;  3A98 B;  1JR3 D;  2H5X A;  3SAS A;  4G4O A;  1G4A E;  3IG8 A;  4LFA M;  3AKZ A;  1WJ7 A;  3HKP A;  4JI7 M;  2EA0 A;  4IIW A;  2ZAO A;  1VG5 A;  1FNN A;  4LZZ A;  1N34 M;  2XH9 A;  3C58 A;  1CUK A;  1E94 E;  1HNW M;  1EIJ A;  4LRS A;  4RKU F;  2EKK A;  1NNU C;  3C3E A;  1I4W A;  1PGY A;  1GKI A;  5FSW A;  2MGW A;  4YHH M;  5DYG A;  4DV5 M;  1TF0 B;  1YUB A;  2X4A A;  3K1J A;  2R4E A;  4FCV A;  1IN6 A;  4XK8 F;  5EP1 A;  4NXN M;  2ZM6 M;  1IXS B;  1G41 A;  3BOS A;  1W5T A;  3U6M A;  3U6Q A;  2JZ0 A;  3CF0 A;  2L7H A;  4RF1 A;  5EJC A;  3NBI A;  4JXJ A;  1NY5 A;  2KZS A;  4NSO B;  4WUR A;  1G71 A;  2L4E A;  4LJ9 A;  3GPP A;  4DV6 M;  1DGB A;  4F2L A;  4JI4 M;  1IXS A;  3H4J A;  3KP0 E;  2LNH C;  1YSY A;  1XMO M;  1V92 A;  2UUB M;  3GRV A;  5A2Q S;  2K0B X;  4AKG A;  1WGN A;  3PFI A;  1SXJ C;  4CIS A;  2CHQ A;  4BBA A;  2DZO B;  3HJQ A;  2GQF A;  2DWZ B;  4KHP M;  1GL7 A;  5EXX A;  1QDT A;  2QNJ A;  5EXT A;  2KA6 B;  2QCU A;  4DR1 M;  1TH2 A;  2RGH A;  3HJS A;  5ITX A;  3W0F A;  1TGU A;  2KRU A;  1JR3 E;  4MB7 A;  1H6U A;  3GLH B;  5EXS A;  4Y28 F;  3K92 A;  4G6Z A;  4FWG A;  4LF6 M;  1GJS A;  1QZM A;  2VF8 A;  7CAT A;  2KZU A;  1OJL A;  1HJP A;  3RGP A;  3GLH A;  1R2Z A;  3E21 A;  2KHH A;  3T6P A;  2DKL A;  3OTO M;  1K82 A;  3KOX E;  3BBZ A;  2QEN A;  1IN4 A;  1I94 M;  3VLF B;  3QWL A;  4RNA A;  2HHH M;  2FS1 A;  1L2B A;  2LVO C;  2Y20 A;  4LJ8 A;  3FD9 A;  3DA1 A;  1ZMV A;  4OW0 A;  2F5N A;  1D0L A;  2JXN A;  4XBO A;  4JN6 A;  4REZ A;  4FVM A;  4BLC A;  2VQE M;  3QYB A;  2MJ5 B;  4PT5 A;  2JP7 A;  2RGO A;  1NVM A;  3ILK A;  3HU3 A;  4LJ5 A;  3EIH A;  3LCV B;  3PNV A;  1WIV A;  2JY5 A;  3K2L A;  3Q8X A;  1XMQ M;  1QAO A;  2AHM A;  4Q7J A;  3L29 A;  1SXJ B;  1ZV1 A;  4GC9 A;  3GLF E;  4B3R M;  3HX3 A;  3KP1 E;  3GLI B;  4L8R C;  4IBF A;  1XWI A;  5LMN M;  4HLQ A;  3MJ5 A;  1DGH B;  1Q02 A;  1VEG A;  1SXJ A;  3KXE C;  3SMS A;  4CGY B;  4DR6 M;  2HL7 A;  4II7 A;  3GLI A;  2KRK A;  4I4L A;  2CFO A;  1NSF A;  1R5L A;  3FUV A;  4M0W A;  3WHK A;  5JI2 E;  3GLG B;  1L2C A;  3KS8 A;  1ORY B;  4RF0 A;  1DGH A;  2UXB M;  1F4I A;  3FRH A;  1VQ1 A;  1OIP A;  3SBJ A;  2L6O A;  3HGI A;  1QAM A;  3GLG A;  1OFI A;  1HQC A;  4G4Q A;  3A46 A;  1J09 A;  1QYR A;  2CRU A;  2L2D A;  4R71 A;  1IN7 A;  1N75 A;  4JI3 M;  3LW5 F;  2V1C A;  2DEN A;  4KOD A;  3FTF A;  4GHA A;  1XNQ M;  1NHW C;  1QUT A;  2Z4R A;  3BXW A;  3HWS A;  2HKJ A;  2QPA A;  3MMP A;  2O5R A;  5ITT A;  4FD2 A;  3FYC A;  1N36 M;  4NSR A;  4JI8 M;  1OIZ A;  1YLA A;  2APL A;  2C9O A;  2CE7 A;  3FUU A;  2YFQ A;  4M0D A;  5DYI A;  5E6J A;  3RFW A;  4AZF A;  1GJT A;  1YE9 A;  2J7N A;  1WHC A;  2JWS A;  4DUZ M;  4D81 A;  3M7G A;  1NHG C;  5ITQ A;  3WHL A;  3B89 A;  1G3I A;  4DR4 M;  4DBG B;  1R7R A;  2BJV A;  3JR4 A;  1N77 A;  3QYE A;  3J7B A;  4B3T M;  2O25 A;  2JY7 A;  4IJE A;  1EFU B;  4MH0 E;  2VF7 A;  3W68 A;  4MGH A;  3TWM A;  3SC3 A;  2WSC F;  3CTW B;  2OPF A;  1HR0 M;  1WR1 B;  4WW0 A;  3L28 A;  3SAT A;  3DZD A;  1N33 M;  1PJI A;  4MGI E;  4AKH A;  3HU2 A;  2F5Q A;  3LMM A;  3QAU A;  1IY1 A;  3SMP A;  4LJ4 A;  4NOO B;  1DO0 A;  4LCB A;  3HZJ A;  3VDP A;  3TPZ A;  1IQP A;  5IRE B;  5FTJ A;  2OOB A;  4NC6 A;  4IBK A;  5FLX S;  4KO8 A;  1R2Y A;  4MGK E;  2JNH A;  3LVV A;  1PJT A;  3UMM A;  3A42 A;  2I7N A;  1PJJ A;  5ITX E;  3NBX X;  1R4G A;  1MN3 A;  1SXJ D;  1X37 A;  4LJ7 A;  3VKH A;  3B74 A;  1Q3B A;  3AJI B;  3TWK A;  4NL4 H;  4X66 M;  3KOY E;  4D80 A;  1VEK A;  5KQD A;  4IBG A;  2LHC A;  1QDR A;  3GO8 A;  3L27 A;  3JR5 A;  3E46 A;  1V33 A;  4IBJ A;  4AKI A;  3U6P A;  2R45 A;  1L2D A;  1KFV A;  2P5T A;  2KEB A;  3PNY A;  5DFL A;  3W67 A;  3J80 S;  1WGL A;  1Q3C A;  3GPX A;  4MM3 B;  2NQ8 C;  4GC5 A;  1HNZ M;  4LF8 M;  2QSF X;  4IBC A;  2GNO A;  3FKE A;  5EP3 A;  3L25 A;  4JI6 M;  2JZ1 A;  3HHX A;  2DWN A;  2N35 A;  1DO2 A;  1GVN A;  5KPR A;  2LVP C;  2XZU A;  2MR9 A;  3KSJ A;  5ITR A;  2FH0 A;  3J7A S;  1W5S A;  3LVW A;  2C96 A;  3B9P A;  4P17 A;  3UJN A;  4X65 M;  1G59 A;  3J81 S;  3ZCB B;  3U6O A;  2R0I A;  3E4R A;  3KW6 A;  3SAU A;  2F5S A;  1E9S A;  1NV9 A;  3J27 B;  3L2A A;  1NJG A;  3KS4 A;  3HY5 A;  3PVS A;  1IN8 A;  3B7Z A;  1D0M A;  2HCB A;  3FTE A;  3KSX A;  2ERC A;  2CV1 A;  3GPU A;  2Z8Y M;  4LJ6 A;  3LQR A;  4X62 M;  1Z5A A;  1SXJ E;  4K0K M;  4W5W A;  4QHT A;  2R62 A;  2WSF F;  4FWD A;  2XGN A;  4L4U A;  4QNM A;  3GLI E;  2R44 A;  4IJF A;  2ZBK B;  4L16 A;  3FRI A;  1Q39 A;  4IBI A;  3AOG A;  1QUS A;  3U6D A;  1N78 A;  2DZL A;  3GRY A;  2F4V M;  1E9R A;  2G3Q A;  3T38 A;  4QOZ C;  2R18 A;  3HHY A;  2G8L A;  5EXP A;  4GKK M;  1XHB A;  3U60 B;  2LBC A;  2F5P A;  1AIP C;  3J2P B;  1NNJ A;  2DAE A;  5EP4 A;  2CHV A;  1C7Y A;  1XB2 B;  3M6A A;  5JI3 E;  2RKO A;  3K9P A;  2QBY B;  2V1U A;  4JV5 M;  3RE8 A;  3LCU A;  2CUZ A;  3U60 A;  1J5E M;  4B7G A;  1HT2 E;  5KO3 A;  4GHL A;  1D2N A;  4QHS A;  4GRI A;  3FUX A;  2BJW A;  2XZF A;  2QBY A;  2QHO B;  3SHF A;  3E9S A;  2XFT A;  4R7G A;  4DR3 M;  5IWA M;  4MGY E;  2KNA A;  4L78 A;  1VDD A;  1GAB A;  1JQJ C;  3TQS A;  3U6S A;  1C1K A;  3RGS A;  1GLN A;  1OAO C;  2ZTD A;  3MK6 A;  4FW9 A;  1Z59 A;  4OX9 M;  2FFJ A;  4LF5 M;  2M60 A;  3SAR A;  2DAI A;  4B3M M;  2E5L M;  2V6Z M;  3Q8G A;  2EJS A;  3KDS E;  1NY6 A;  3B7N A;  3KVW A;  1J7K A;  1IBL M;  1L1Z A;  1KSF X;  3D8B A;  4DV4 M;  1IFY A;  2LHG A;  2CWB A;  3I04 M;  3GQ5 A;  2Y21 A;  1EE8 A;  1TH3 A;  4EIW A;  5H37 D;  3VK8 A;  2F5O A;  2K47 A;  4LJA A;  2WSE F;  1GL6 A;  4B7F A;  2ZTC A;  1NV8 A;  2DHR A;  3L26 A;  3K8Z A;  4JI0 M;  5EP2 A;  4PDI A;  2R46 A;  8CAT A;  4PCZ A;  4XGI A;  3VDU A;  3DFZ A;  2DWL A;  4GIT A;  2ZAN A;  1G8P A;  2J7O A;  3D8L A;  4AQY M;  3M0E A;  3B7Q A;  2A5Y B;  3GLF B;  2XF3 A;  1IY2 A;  2KDL A;  5KPZ A;  1JB0 F;  2G5G X;  4DV2 M;  5DNY A;  1RU3 A;  4A3V B;  3KFU G;  3EIE A;  2UU9 M;  5IT9 S;  3GLF A;  3GRR A;  1QAQ A;  5KPT A;  4AW4 A;  4M9X A;  4HEO A;  1QVR A;  4LFB M;  2FNA A;  3AV0 A;  1T3T A;  4UN2 B;  1XXH B;  2ZAM A;  2K6B A;  4AI6 A;  3FE3 A;  2YQZ A;  2D7E A;  2QQ8 A;  4M9S A;  1IXR C;  4DV0 M;  2Q2E B;  4DV7 M;  3DOA A;  3MHV C;  2LXE A;  1XXH A;  1N32 M;  2CV2 A;  2KNZ A;  1LTM A;  3AOE A;  2JY6 B;  3PXG A;  2LH0 A;  3A45 A;  4IBD A;  3ZC7 B;  1OTR A;  2C99 A;  1DGF A;  2L7I A;  2XEP A;  5GKN A;  1KYI A;  2EUC A;  2LVN C;  3KOW E;  3THG A;  1PRB A;  3GLH E;  4AG5 A;  2XSZ A;  4AG6 A;  1TH4 A;  1QQW A;  1ZAE A;  3K9O A;  1TDZ A;  3T1Y M;  2VDB B;  1L8Q A;  4GMQ A;  2J5Y A;  1IBK M;  2DAG A;  2DZN B;  2B3T A;  4CJ6 A;  3NWL A;  4LG2 A;  4G4R A;  3T15 A;  4CIZ A;  3GRU A;  2UUC M;  1IY0 A;  2LTU A;  2CHG A;  4L15 A;  2X8A A;  2R6F A;  3I51 A;  1ZQ9 A;  4FWH A;  3TWL A;  4X64 M;  4B3S M;  1VDL A;  2VII A;  1S3S A;  1L1T A;  4JYA M;  3VFD A;  4P16 A;  1TR8 A;  2DNA A;  1OQY A;  2LWX A;  1PJS A;  1K3W A;  3F92 A;  3I4Y A;  1Z6T A;  4B08 A;  4NRW A;  2FE8 A;  3SHG B; 
#chains in the Genus database with same CATH homology
 3SYK A;  3TE6 A;  4DR5 M;  1R6B X;  5FTM A;  5KQ8 A;  4QNR A;  3SYL A;  3LQQ A;  3H4M A;  1DGG A;  5F3W A;  4GIP A;  3FUT A;  4KLN A;  5ITU A;  4LGM A;  3GQ4 A;  4ZPX A;  4S12 A;  4PDG A;  1UM8 A;  4B7H A;  3JAM S;  2M5Z A;  3UGJ A;  4LRT A;  4R3D A;  3U5Z B;  2C5R A;  4BB9 A;  1Z5C A;  2DXI A;  3GQ3 A;  2Z4S A;  4I5S A;  4LY6 A;  5LMU M;  4Z6Y A;  3U5Z A;  3KOZ E;  3SAW A;  1OFH A;  4YY3 M;  3U6L A;  2VQF M;  4TUW A;  1TDH A;  1QAN A;  2OQ4 A;  2DWM A;  4LFC M;  3U61 B;  3CF2 A;  4QOS A;  2KXE A;  1HQY E;  1HT1 E;  5ITY A;  2W82 A;  4NRV A;  4DR2 M;  2XSZ D;  3IG5 A;  2D7H A;  1JR3 A;  1IM2 A;  5IZ7 D;  3U61 A;  2UUA M;  3AOE C;  4ITQ A;  1IN5 A;  4JI5 M;  1HNX M;  3TL4 X;  2Y0Q A;  4MGZ E;  4LF9 M;  3AL0 C;  5FTK A;  2QP9 X;  1MU5 A;  3UK6 A;  3GPY A;  2BNK A;  2JA2 A;  3W0L B;  3HU1 A;  4D82 A;  4JI2 M;  3R8F A;  2L09 A;  4FCW A;  2EO2 A;  5C1B A;  3I4V A;  4HL4 A;  4JI1 M;  2C98 A;  2XFS A;  4Z8X A;  1NJF A;  2X49 A;  4CHT B;  3VKG A;  3UZU A;  1E32 A;  2Y0T A;  4LF4 M;  1WXQ A;  4M9Z A;  4NXM M;  2YNM D;  4DV3 M;  2Z3X A;  3ZH9 B;  1Z5B A;  3AFH A;  3FTC A;  3HJ8 A;  3VK7 A;  1IBM M;  1XC8 A;  3T1H M;  3R9X B;  5BPV A;  3GP1 A;  1LV7 A;  5EQT A;  2XLJ A;  3FUW A;  4GH9 A;  2KW0 A;  2UXC M;  4GKJ M;  5FTN A;  2UXD M;  4I8O A;  2CV0 A;  4IBE A;  4OU7 A;  2R4J A;  4LGY A;  3SFZ A;  4PD2 A;  4DR7 M;  3FYD A;  4I81 A;  4DUY M;  2YR0 A;  2DVW B;  4DV1 M;  2C9C A;  2I7P A;  1PM5 A;  3U6E A;  1K3X A;  3CF6 E;  1IXZ A;  2CEA A;  4LZJ A;  2R65 A;  5BR8 M;  1FJG M;  4FCT A;  5E26 A;  3HHW A;  5C18 A;  2QZ4 A;  4IBB A;  4OVZ B;  4LF7 M;  3U6C A;  2FOI C;  2Z7J A;  1MX0 A;  3SAV A;  2D7G A;  4G4N A;  4OVZ A;  5FTL A;  2H1R A;  3FTD A;  3HHZ A;  3A98 B;  1JR3 D;  3SAS A;  4G4O A;  1G4A E;  3IG8 A;  4LFA M;  3AKZ A;  3HKP A;  4JI7 M;  2EA0 A;  4IIW A;  2ZAO A;  1FNN A;  4LZZ A;  1N34 M;  2XH9 A;  3C58 A;  1E94 E;  1HNW M;  4LRS A;  1NNU C;  1I4W A;  1GKI A;  5FSW A;  4YHH M;  4DV5 M;  5DYG A;  1YUB A;  3K1J A;  2X4A A;  4FCV A;  2R4E A;  5EP1 A;  1IN6 A;  4NXN M;  2ZM6 M;  1IXS B;  1G41 A;  3BOS A;  1W5T A;  3U6M A;  3U6Q A;  3CF0 A;  2L7H A;  4RF1 A;  5EJC A;  3NBI A;  4JXJ A;  1NY5 A;  2KZS A;  4NSO B;  4WUR A;  4LJ9 A;  3GPP A;  4DV6 M;  4JI4 M;  4K0K M;  1DGB A;  1XMO M;  3KP0 E;  2LNH C;  1YSY A;  2UUB M;  3GRV A;  5A2Q S;  4AKG A;  3PFI A;  1SXJ C;  4CIS A;  2CHQ A;  4BBA A;  2DZO B;  3HJQ A;  2DWZ B;  4KHP M;  1GL7 A;  5EXX A;  5EXT A;  2KA6 B;  2QCU A;  4DR1 M;  1TH2 A;  2RGH A;  3HJS A;  5ITX A;  3W0F A;  1TGU A;  2KRU A;  4MB7 A;  1H6U A;  3GLH B;  5EXS A;  3K92 A;  4G6Z A;  4FWG A;  4LF6 M;  1QZM A;  7CAT A;  2KZU A;  1OJL A;  3RGP A;  3GLH A;  1R2Z A;  3OTO M;  1K82 A;  3KOX E;  2QEN A;  1IN4 A;  1I94 M;  3VLF B;  3QWL A;  4RNA A;  2HHH M;  1L2B A;  2Y20 A;  4LJ8 A;  3FD9 A;  3DA1 A;  4OW0 A;  2F5N A;  4XBO A;  4JN6 A;  4REZ A;  4FVM A;  4BLC A;  2VQE M;  4PT5 A;  2RGO A;  1NVM A;  3ILK A;  3HU3 A;  4LJ5 A;  3EIH A;  3PNV A;  3K2L A;  3Q8X A;  1XMQ M;  1QAO A;  2AHM A;  3L29 A;  1SXJ B;  4GC9 A;  4B3R M;  3GLI B;  3KP1 E;  4L8R C;  4IBF A;  1XWI A;  5LMN M;  4HLQ A;  3MJ5 A;  1DGH B;  1SXJ A;  3KXE C;  3SMS A;  4CGY B;  4DR6 M;  2HL7 A;  4II7 A;  3GLI A;  2KRK A;  4I4L A;  2CFO A;  1NSF A;  3FUV A;  4M0W A;  3WHK A;  5JI2 E;  3GLG B;  1L2C A;  3KS8 A;  1ORY B;  4RF0 A;  1DGH A;  2UXB M;  3SBJ A;  2L6O A;  3HGI A;  1QAM A;  3GLG A;  1OFI A;  1HQC A;  4G4Q A;  3A46 A;  1J09 A;  1QYR A;  1IN7 A;  1N75 A;  4JI3 M;  2V1C A;  4GHA A;  4KOD A;  3FTF A;  1XNQ M;  1NHW C;  2Z4R A;  3HWS A;  2HKJ A;  2QPA A;  2O5R A;  5ITT A;  4FD2 A;  3FYC A;  1N36 M;  4NSR A;  4JI8 M;  3RFW A;  4M0D A;  2C9O A;  2CE7 A;  3FUU A;  2YFQ A;  5DYI A;  5E6J A;  4AZF A;  1YE9 A;  2J7N A;  4DUZ M;  4D81 A;  3M7G A;  1NHG C;  5ITQ A;  3WHL A;  1G3I A;  4DR4 M;  1R7R A;  2BJV A;  3JR4 A;  1N77 A;  3J7B A;  4B3T M;  4IJE A;  4MH0 E;  4MGH A;  3TWM A;  3SC3 A;  3CTW B;  2OPF A;  1HR0 M;  4WW0 A;  3L28 A;  3SAT A;  3DZD A;  1N33 M;  1PJI A;  4MGI E;  4AKH A;  3HU2 A;  2F5Q A;  3LMM A;  3QAU A;  1IY1 A;  3SMP A;  4LJ4 A;  4NOO B;  1DO0 A;  4LCB A;  3VDP A;  3TPZ A;  1IQP A;  5IRE B;  5FTJ A;  4IBK A;  5FLX S;  4KO8 A;  1R2Y A;  4MGK E;  3LVV A;  3UMM A;  3A42 A;  2I7N A;  1PJJ A;  5ITX E;  1SXJ D;  1X37 A;  4LJ7 A;  3VKH A;  1Q3B A;  3AJI B;  3TWK A;  4NL4 H;  4X66 M;  3KOY E;  4D80 A;  5KQD A;  4IBG A;  3GO8 A;  3JR5 A;  3L27 A;  4AKI A;  4IBJ A;  3U6P A;  2R45 A;  1L2D A;  1KFV A;  2P5T A;  2KEB A;  3PNY A;  3J80 S;  3GPX A;  1Q3C A;  4MM3 B;  2NQ8 C;  4GC5 A;  1HNZ M;  4LF8 M;  4IBC A;  3FKE A;  5EP3 A;  3L25 A;  4JI6 M;  3HHX A;  2DWN A;  1DO2 A;  1GVN A;  5KPR A;  2XZU A;  3KSJ A;  5ITR A;  3J7A S;  1W5S A;  3LVW A;  2C96 A;  3B9P A;  3UJN A;  4X65 M;  1G59 A;  3J81 S;  3ZCB B;  3U6O A;  3E4R A;  3KW6 A;  3SAU A;  2F5S A;  1E9S A;  3J27 B;  3L2A A;  1NJG A;  3KS4 A;  3PVS A;  1IN8 A;  2HCB A;  3FTE A;  3KSX A;  2ERC A;  2CV1 A;  3GPU A;  4LJ6 A;  3LQR A;  4X62 M;  1Z5A A;  1SXJ E;  4W5W A;  4QHT A;  2R62 A;  1XNR M;  4FWD A;  2XGN A;  4L4U A;  4QNM A;  4IJF A;  2ZBK B;  4L16 A;  1Q39 A;  4IBI A;  3AOG A;  3U6D A;  1N78 A;  3GRY A;  2F4V M;  1E9R A;  3T38 A;  4QOZ C;  2R18 A;  3HHY A;  2G8L A;  5EXP A;  4GKK M;  1XHB A;  3U60 B;  2F5P A;  3J2P B;  1NNJ A;  5EP4 A;  2CHV A;  3M6A A;  5JI3 E;  2RKO A;  2QBY B;  2V1U A;  4JV5 M;  3RE8 A;  2CUZ A;  3U60 A;  1J5E M;  4B7G A;  1HT2 E;  5KO3 A;  4GHL A;  1D2N A;  4QHS A;  4GRI A;  3FUX A;  2BJW A;  2XZF A;  2QBY A;  3SHF A;  3E9S A;  2XFT A;  4R7G A;  4DR3 M;  5IWA M;  4MGY E;  4L78 A;  1VDD A;  1JQJ C;  3TQS A;  3U6S A;  1C1K A;  3RGS A;  1GLN A;  4FW9 A;  3MK6 A;  1Z59 A;  4OX9 M;  2FFJ A;  4LF5 M;  2M60 A;  3SAR A;  4B3M M;  2E5L M;  2V6Z M;  3KDS E;  1NY6 A;  3KVW A;  1J7K A;  1IBL M;  1L1Z A;  1KSF X;  3D8B A;  4DV4 M;  3GQ5 A;  2Y21 A;  1EE8 A;  1TH3 A;  4EIW A;  5H37 D;  3VK8 A;  2F5O A;  2K47 A;  4LJA A;  1GL6 A;  4B7F A;  2DHR A;  3L26 A;  3K8Z A;  4JI0 M;  5EP2 A;  4PDI A;  2R46 A;  8CAT A;  4PCZ A;  4XGI A;  3VDU A;  3DFZ A;  2DWL A;  4GIT A;  2ZAN A;  1G8P A;  2J7O A;  3D8L A;  4AQY M;  3M0E A;  2A5Y B;  3GLF B;  2XF3 A;  1IY2 A;  5KPZ A;  2G5G X;  4DV2 M;  5DNY A;  4A3V B;  3KFU G;  3EIE A;  2UU9 M;  5IT9 S;  3GLF A;  3GRR A;  1QAQ A;  5KPT A;  4AW4 A;  4M9X A;  1QVR A;  4LFB M;  2FNA A;  3AV0 A;  1T3T A;  1XXH B;  2ZAM A;  4AI6 A;  2YQZ A;  2D7E A;  4M9S A;  1IXR C;  4DV0 M;  2Q2E B;  4DV7 M;  3DOA A;  3MHV C;  2LXE A;  1XXH A;  1N32 M;  2CV2 A;  3AOE A;  3PXG A;  2LH0 A;  3A45 A;  4IBD A;  3ZC7 B;  2C99 A;  1DGF A;  2L7I A;  2XEP A;  5GKN A;  1KYI A;  2EUC A;  3KOW E;  3THG A;  4AG5 A;  2XSZ A;  4AG6 A;  1TH4 A;  1QQW A;  1ZAE A;  1TDZ A;  3T1Y M;  1L8Q A;  4GMQ A;  1IBK M;  2DZN B;  3NWL A;  4LG2 A;  4G4R A;  3T15 A;  3GRU A;  2UUC M;  1IY0 A;  2CHG A;  4L15 A;  2X8A A;  3I51 A;  1ZQ9 A;  4FWH A;  3TWL A;  4X64 M;  4B3S M;  2VII A;  1S3S A;  1L1T A;  4JYA M;  3VFD A;  4P16 A;  2LWX A;  1K3W A;  3I4Y A;  1Z6T A;  4B08 A;  4NRW A;  2FE8 A;  3SHG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...