5LMNM

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5lmnM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5lmnM02
4LF6M 1TDZA 1J5EM 1PJJA 4LF7M 4NXMM 1Z5BA 3W0FA 1HNZM 4LF8M 1N32M 2UUCM 1PM5A 3GO8A 1L2CA 3T1HM 2F5OA 5ITXA 1K3XA 4G4OA 2VQEM 2F5SA 3OTOM 4DV1M 4DR4M 4JI8M 3J80S 3T1YM 2HKJA 4LF5M 3GPPA 3SAVA 4JI6M 1PJIA 2OPFA 1IBLM 4DV2M 3TWMA 4CISA 1TDHA 2HHHM 5A2QS 3GP1A 4DV4M 1Q3CA 3TWKA 4B3TM 2EA0A 4ITQA 4DR7M 2UXDM 4DV6M 4PDGA 1MU5A 4JI1M 4X62M 4LF4M 3GPYA 4DUYM 4X65M 4DV0M 4LFCM 5IT9S 4B3MM 3SARA 2VQFM 1Z5CA 3U6CA 4X66M 4DR1M 4DR5M 3U6PA 3SASA 4DV3M 4LF9M 1XMQM 3A46A 4PD2A 1HR0M 3SAWA 4K0KM 1XNQM 4JI2M 4DR2M 4DV5M 3A42A 5LMNM 1K82A 2F5NA 4GKKM 3U6MA 4MB7A 4OX9M 1FJGM 1Z5AA 4JI4M 4NRVA 4G4NA 4DR3M 1Q3BA 2XZUA 1L1ZA 2F5QA 1K3WA 2ZM6M 5ITXE 5ITYA 2E5LM 4LFAM 3U6SA 2Q2EB 3U6LA 4JV5M 1XMOM 4PDIA 3U6OA 3SBJA 2UUAM 1KFVA 3DOAA 4JI7M 3GQ3A 1XNRM 1R2ZA 2XZFA 4AQYM 3GPXA 3JR4A 1XC8A 3TWLA 1I94M 3J7AS 4NXNM 5ITUA 1HNWM 1N34M 1IBKM 3J81S 3A45A 1L1TA 3SATA 3JR5A 5ITTA 1EE8A 4G4QA 4JYAM 1Q39A 3U6DA 1L2BA 5ITQA 2F4VM 5ITRA 4B3RM 5LMUM 1MX0A 4JI5M 4KHPM 1N33M 1R2YA 2UU9M 2UXCM 3JAMS 4NRWA 4LFBM 1IBMM 1HNXM 3GQ4A 4JI3M 3U6QA 2ZBKB 1N36M 5FLXS 4X64M 5IWAM 4YY3M 2F5PA 4JI0M 4DR6M 3SAUA 3GQ5A 2OQ4A 1NNJA 3GPUA 3C58A 4PCZA 4DUZM 3VK7A 5BR8M 3U6EA 2UXBM 1Z59A 4B3SM 1L2DA 4G4RA 4YHHM 4DV7M 3VK8A 4GKJM 2UUBM
chains in the Genus database with same CATH superfamily
4LF6M 1WR1B 4IBKA 3ZH9B 4BLCA 1W5TA 1J5EM 4BBAA 1QDRA 1PJJA 3W0FA 3AL0C 2G3QA 5EQTA 3FTCA 2DAKA 4Z6YA 1G59A 1IY0A 3U5ZA 2F5OA 2MROB 1IN5A 1D0LA 3CF6E 3NBIA 3QAUA 3GLGA 3FKEA 2WZJA 2L4FA 2RRUA 5EP3A 4LJ8A 2DXIA 4QOZC 1UM8A 2I7PA 2JY7A 2VDBB 4FWHA 3L25A 2BWEA 1ZMUA 2M60A 2Y0TA 4CISA 4RF0A 3GP1A 2EJSA 4HL4A 3U60A 2MGWA 2ERCA 3FUUA 3L29A 1QANA 4LJ7A 3UGJA 5F3WA 3KP0E 2DVWB 4FVMA 2C5RA 1OFHA 4B3TM 4ITQA 4DR7M 1VDLA 4D81A 1IXRC 4ZPXA 4REZA 3UZUA 3GPYA 4R3DA 4X65M 4LFCM 2JY5A 3NWLA 2VQFM 4IJEA 1QUTA 1OKSA 2RKOA 4DR5M 3U6PA 3FUXA 1W5SA 5GKNA 3A46A 1XMQM 2LVAA 2XSZD 5EP1A 3SAWA 4AKIA 3UJNA 1XNQM 4JI2M 4DR2M 4LZJA 3HJ8A 3J7BA 4GC5A 1SXJB 3M0EA 2P5TA 1KSFX 3C3DA 4M9SA 3RE8A 2QPAA 1Z5AA 4KODA 2WSCF 1WHCA 4IBJA 1Q3BA 4LRTA 1SXJE 3GLIB 3SYKA 5BPVA 2ZM6M 1D0MA 2DAGA 3GLIE 2DENA 3E4RA 2Q2EB 3U6LA 2FH0A 2C96A 3FUWA 5FTKA 2QCUA 2A5YB 2FOIC 4L4UA 4I8OA 1L8QA 4D80A 3HHXA 4OVZA 2KXEA 3GQ3A 3KXEC 5FTNA 4NL4H 1R2ZA 1G41A 4MGYE 1IY1A 4L8RC 2X8AA 3DA1A 3PNYA 1IBKM 1G71A 1N78A 4P16A 1TF0B 1VQ1A 3CF0A 2I7NA 3B9PA 3GLFE 2DAEA 3GLGB 3DFZA 3RGPA 2Y21A 1JB0F 1T6OA 2KNAA 3KP1E 4PT5A 5ITRA 1D0KA 3FTFA 1ZAEA 4IBBA 4L16A 2RGOA 1N33M 1E32A 1WGLA 4F2LA 1GABA 5JI3E 4GHLA 4IBFA 1VEKA 1XB2B 3CF2A 1IBMM 3BXWA 3LQRA 4JI3M 2ZBKB 3U6QA 1N36M 3BOSA 2LVQD 5FLXS 2Y0QA 2JXNA 4II7A 3IECA 3M6AA 1G3IA 1QVRA 4L78A 1DO2A 1NNJA 4GMQA 2CHQA 1IY2A 4DUZM 3VK7A 3LW5F 3D8BA 4CIZA 2MH8A 3L2AA 2DWNA 2AHMA 2HAKA 1L2DA 2L7IA 1XHBA 3E46A 4G4RA 1HQCA 2KDLA 5E26A 4AKHA 1GLNA 4B08A 3IHPA 1TDZA 2XLJA 2JWSA 1AUAA 2JZ1A 3FYCA 4L15A 3ZCBB 2V1UA 2RGHA 1ZMWA 2OO9A 3C3EA 1Z5BA 5KPZA 4HLQA 1GO5A 4W5WA 1IN4A 2O25A 1SXJA 3PNVA 1G8PA 4GH9A 4QNMA 3HJQA 2XFTA 1IXSA 2ZAOA 5JI2E 2KNZA 2VQEM 2G8LA 5IREB 3QWLA 4JI8M 4IBDA 3GLIA 4XBOA 5E6JA 5FTLA 4LF5M 3LMMA 3V76A 4AG5A 5DNYA 4NC6A 4OW0A 2HHHM 3E9SA 2JP7A 2R6FA 2CV0A 1QZEA 3VFDA 1YUBA 2KEBA 7CATA 2N35A 2HL7A 2FNAA 2EKKA 3FE3A 2K0BX 3ZQJA 1OJLA 2O01F 3FRIA 4GRIA 3UMMA 3IG5A 2CWBA 2DZNB 3KOWE 3I51A 4IIWA 4TUWA 4LF4M 4DUYM 2G5GX 2XFSA 3SMPA 4WURA 4AW4A 3VKGA 4DV0M 4L6V6 2DWZB 1I4WA 3FUTA 1QAQA 4M9XA 3GLFA 3KSXA 4X66M 3FUVA 4I81A 3SMSA 5EXPA 2KRKA 1ORYB 3TPZA 1HR0M 1TR8A 3I01M 1KYIA 4LGMA 2DZOB 2VIIA 3DZDA 4K0KM 3TE6A 2JY6B 4IBIA 5KQ8A 4LRSA 4DV5M 2Z7JA 5DYIA 1YE9A 5LMNM 2J7NA 3L28A 2LVOC 2DHRA 3H4MA 4NRVA 4DR3M 1PGYA 2C99A 3RGSA 2APLA 1L1ZA 2BWBA 3AOGA 1NJFA 2D7EA 4B7HA 5ITXE 2KHHA 2R18A 1GL7A 2K47A 4LFAM 3U6SA 1S3SA 3B7QA 3PFIA 2QSFX 4QHTA 1PRBA 3Q8XA 4PDIA 3U6OA 2FS1A 3HJSA 4M9ZA 4JI7M 3ILKA 1XNRM 4S12A 4GHAA 1NJGA 1WGNA 3TWLA 1XC8A 1OIPA 3T6PA 1PJTA 1IN6A 1N34M 1NY6A 4XGIA 1OTRA 3A45A 3RFWA 1QQWA 1L1TA 4RNAA 1IXSB 1N75A 1EE8A 4JYAM 2GNOA 1Q39A 3HU1A 5DFLA 3VKHA 3LVWA 1Z6TA 2QHOB 3FTDA 1Y8GA 1R2YA 3JAMS 4LFBM 3GQ4A 3I4YA 3KSJA 4X64M 1JR3D 4D82A 4LCBA 1GL6A 1F4IA 2HWJA 2DAIA 2H5XA 2CFOA 3GQ5A 3SC3A 3I4VA 2OQ4A 5KQDA 2J7OA 1MJGM 1TH3A 5L8RF 2K6BA 4Y28F 2UXBM 1G4AE 4MGKE 2Z4RA 4LY6A 1NO1A 2QZ4A 3GLFB 1R6BX 3K9OA 1E9SA 4GC9A 2YQZA 3KS8A 4OU7A 3HKPA 1TGUA 3LQQA 1IN8A 4GKJM 1NHGC 4RKUF 2NQ8C 3M7GA 4GIPA 2L09A 4NXMM 2CHGA 4XK8F 2BJVA 4LJ5A 3W68A 1HNZM 4LF8M 1N32M 2UUCM 3GO8A 1L2CA 4WW0A 5ITXA 3OTOM 3CTWB 3CGWA 3HU3A 3WHKA 3T1YM 2HKJA 4IJFA 4EIWA 2KZUA 3GPPA 1IBLM 3KOZE 2OPFA 4JI6M 1VEGA 4DV2M 3TWMA 1R4GA 4DBGB 5A2QS 2C98A 4DV4M 3BBZA 4R7GA 1WXQA 3MK6A 1IFYA 2KNVA 2EA0A 4NOOB 1NVMA 3C9PA 2UXDM 1EIJA 1SG9A 1OFIA 3J27B 1YSYA 5KPRA 5EJCA 1R7RA 4X62M 4IBCA 2JY8A 5IT9S 4B3MM 3SARA 3KVWA 1TTEA 4DR1M 1IQPA 2D7GA 2HCBA 3WHLA 2QBYB 3GRYA 1UFZA 3F92A 4LF9M 3W0LB 4PD2A 2LHGA 1OAIA 4LZZA 2CP8A 2LHCA 2KW0A 2R62A 5H37D 3K9PA 2KZSA 2R65A 3AOEA 1K82A 2R4EA 2C9CA 4NSRA 3VDPA 2JZ0A 4MB7A 4OX9M 3IG8A 3LCUA 5FSWA 5IZ7D 4G4NA 4JI4M 3GLHB 4R71A 4LG2A 2CRUA 1DO0A 3KS4A 3AJIB 2E5LM 2MJ5B 3GLHE 2L7HA 4KT0F 1Q02A 2CV2A 2DNAA 3KW6A 3AFHA 3E21A 1ZQ9A 1GVNA 3SHFA 2XSZA 4FCTA 5EP4A 1DGBA 2QENA 2L4EA 1PJQA 2LWXA 4NSOB 2X49A 4LGYA 5C18A 1A5TA 2KA6B 2ZAMA 4LJ9A 4MM3B 3LCVB 3HHYA 3MJ5A 4AQYM 3K1JA 1NSFA 4MGHA 3T38A 2XZFA 1I94M 3B7ZA 3J7AS 1QAMA 1QUSA 4FWGA 5KPTA 4NXNM 3TL4X 5ITUA 1VG5A 1NV9A 1HNWM 1QYRA 3J81S 3R9XB 3SATA 3JR5A 5FTMA 2X4AA 4FCVA 4BB9A 2L6OA 2ZTDA 3FD9A 1IXZA 4FW9A 2Z3XA 3U6DA 1AIPC 3GRRA 2OOAA 1L2BA 2XGNA 3B7NA 3SHGB 2R44A 3EIHA 1DGGA 4KHPM 4NRWA 3VLFB 3MMPA 2CUZA 4G3OA 1XXHB 4M0DA 4F1IA 4QOSA 2QP9X 2BNKA 2YFQA 2F5PA 1XXHE 4JI0M 3SYLA 4CJ6A 4DR6M 2JNHA 2M5ZA 4G6ZA 3GPUA 3K2LA 4FWDA 4IBGA 1H6UA 4B7GA 4PCZA 3C58A 2LVNC 5EXSA 5BR8M 4GEWA 1Z59A 1SXJD 4LJ4A 1QAOA 2LTUA 4MH0E 4WP2A 2FE8A 4LJ6A 4B3SM 3HHZA 1SXJC 1NHWC 4A3VB 2LNHC 4DV7M 3KDSE 3U61B 1OAOC 1HQYE 2O5RA 4JXJA 4MGIE 3THGA 1GKIA 3AOEC 1DGFA 3J2PB 2QBYA 2WSFF 3HZJA 3B74A 4LF7M 2DI0A 1PJSA 2QNJA 1LV7A 1GJTA 3TQSA 2ZANA 3I04M 5FTJA 1T43A 4RF1A 1PM5A 5DYGA 2XF3A 3T1HM 1K3XA 2EKFA 4G4OA 2F5SA 4DV1M 4DR4M 1J09A 3GLHA 1DGHB 2EUCA 2H1RA 4I5SA 3J80S 3T15A 3SAVA 1PJIA 3NBXX 1C1KA 2KRUA 5C1BA 1TDHA 2R0IA 3UK6A 1IN7A 3LVVA 2Z8YM 4UN2B 1V33A 3L27A 5EXXA 1Q3CA 3TWKA 4B7FA 3HHWA 4DV6M 2DWMA 2DHYA 1WJ7A 1MU5A 2LXEA 2B3TA 3KOXE 4PDGA 4JI1M 2LVPC 2VF7A 3L26A 1C7YA 1V34A 3D8LA 3H4JA 1TH2A 4QHSA 1BVSA 1X37A 1VDDA 1D2NA 3A98B 3GRVA 4CGYB 1Z5CA 3U6CA 1YLAA 1QDTA 1NY5A 4QNRA 4HEOA 1HJPA 3EIEA 2EO2A 3SASA 1JR3E 3MHVC 4DV3M 3QYBA 4P17A 4FCWA 2YR0A 2OOBA 1EFUB 2LH0A 2D7HA 4Q7JA 3A42A 2F5NA 2L2DA 3U5ZB 4MGZE 4GKKM 1VEJA 2XEPA 2JUJA 1QZMA 3U6MA 1FJGM 1MN3A 4LJAA 2XZUA 1XXHA 4Z8XA 3FRHA 3HX3A 2V1CA 2CEAA 1K3WA 2F5QA 2QQ8A 3PXGA 4M0WA 2R46A 3PVSA 5ITYA 8CATA 3GLGE 4AZFA 1P3QQ 3U60B 2R45A 4JV5M 4JN6A 2DKLA 1XMOM 2CHVA 2VF8A 4KLNA 5EXTA 3VDUA 3HWSA 3SBJA 1OIZA 2UUAM 4FD2A 1KFVA 1NNUC 3DOAA 2FFJA 4I4LA 2J5YA 1DV0A 3FYDA 2WSEF 1GJSA 5EP2A 1OQYA 3B89A 3GPXA 3JR4A 3ZC7B 2YNMD 2Z4SA 3U61A 2CV1A 3AKZA 1T3TA 4KO8A 2K9DA 3GRUA 4GITA 2GQFA 2XH9A 2DAMA 1HT1E 2MR9A 2DWLA 3K92A 1TH4A 3HGIA 3SFZA 5ITTA 1LTMA 1E94E 4G4QA 2F4VM 3FTEA 5ITQA 2JA2A 2ZTCA 4B3RM 1IM2A 1MX0A 3HY5A 5LMUM 4JI5M 1JQJC 5KO3A 1N77A 4AKGA 1J7KA 2UU9M 2UXCM 4AI6A 1ZV1A 1XWIA 3R8FA 1HNXM 1V92A 1HT2E 1R5LA 1DGHA 3HU2A 2W82A 4IBEA 2Y20A 5IWAM 3K8ZA 4YY3M 3SAUA 3KFUG 2C9OA 1FNNA 2V6ZM 3W67A 1RU3A 1E9RA 2R4JA 3QYEA 1WIVA 3AV0A 2BJWA 1ZMVA 3U6EA 4OVZB 2DZLA 2CE7A 3KOYE 4ANRA 1NV8A 4CHTB 2LBCA 4AG6A 1CUKA 4YHHM 3VK8A 3Q8GA 1JR3A 2UUBM
chains in the Genus database with same CATH topology
4LF6M 4IBKA 3ZH9B 4BLCA 1W5TA 1J5EM 4BBAA 1PJJA 3W0FA 3AL0C 5EQTA 3FTCA 4Z6YA 1G59A 1IY0A 3U5ZA 2F5OA 1IN5A 3CF6E 3NBIA 3QAUA 3GLGA 3FKEA 5EP3A 4LJ8A 2DXIA 4QOZC 1UM8A 2I7PA 4FWHA 3L25A 2M60A 2Y0TA 4CISA 4RF0A 3GP1A 4HL4A 3U60A 2ERCA 3FUUA 3L29A 1QANA 4LJ7A 3UGJA 5F3WA 3KP0E 2DVWB 4FVMA 2C5RA 1OFHA 4B3TM 4ITQA 4DR7M 4D81A 1IXRC 4ZPXA 4REZA 3UZUA 3GPYA 4R3DA 4X65M 4LFCM 3NWLA 2VQFM 4IJEA 2RKOA 4DR5M 3U6PA 3FUXA 1W5SA 5GKNA 3A46A 1XMQM 5EP1A 2XSZD 3SAWA 4AKIA 3UJNA 1XNQM 4JI2M 4DR2M 4LZJA 3HJ8A 3J7BA 4GC5A 1SXJB 3M0EA 2P5TA 1KSFX 4M9SA 3RE8A 2QPAA 1Z5AA 4KODA 4LRTA 4IBJA 1Q3BA 1SXJE 3GLIB 3SYKA 5BPVA 2ZM6M 3E4RA 2Q2EB 3U6LA 3FUWA 2C96A 5FTKA 2QCUA 2A5YB 2FOIC 4L4UA 4I8OA 1L8QA 4D80A 3HHXA 4OVZA 2KXEA 3GQ3A 3KXEC 5FTNA 4NL4H 1R2ZA 1G41A 4MGYE 1IY1A 4L8RC 2X8AA 3DA1A 3PNYA 1IBKM 1N78A 4P16A 3CF0A 2I7NA 3B9PA 3GLGB 3DFZA 3RGPA 2Y21A 5ITRA 3KP1E 4PT5A 3FTFA 1ZAEA 4IBBA 4L16A 2RGOA 1N33M 1E32A 5JI3E 4GHLA 4IBFA 1IBMM 3CF2A 3U6QA 3LQRA 4JI3M 2ZBKB 1N36M 3BOSA 5FLXS 2Y0QA 4II7A 3M6AA 1G3IA 1QVRA 4L78A 1DO2A 1NNJA 4GMQA 2CHQA 1IY2A 4DUZM 3VK7A 3D8BA 3L2AA 2DWNA 2AHMA 1L2DA 2L7IA 1XHBA 4G4RA 1HQCA 5E26A 4AKHA 1GLNA 4B08A 1TDZA 2XLJA 3FYCA 4L15A 3ZCBB 2V1UA 2RGHA 1Z5BA 5KPZA 4HLQA 4W5WA 1IN4A 1SXJA 3PNVA 1G8PA 4GH9A 4QNMA 3HJQA 2XFTA 2ZAOA 5JI2E 2VQEM 2G8LA 5IREB 3QWLA 4JI8M 4IBDA 3GLIA 4XBOA 5E6JA 5FTLA 4LF5M 3LMMA 4AG5A 5DNYA 4OW0A 2HHHM 3E9SA 2CV0A 3VFDA 1YUBA 2KEBA 7CATA 2HL7A 2FNAA 1OJLA 4GRIA 3UMMA 3IG5A 2DZNB 3KOWE 3I51A 4IIWA 4TUWA 4LF4M 4DUYM 2G5GX 2XFSA 3SMPA 4WURA 4AW4A 3VKGA 4DV0M 2DWZB 1I4WA 3FUTA 1QAQA 4M9XA 3GLFA 3KSXA 4X66M 3FUVA 4I81A 3SMSA 5EXPA 2KRKA 1ORYB 3TPZA 1HR0M 4LGMA 1KYIA 4K0KM 2DZOB 2VIIA 3DZDA 3TE6A 5KQ8A 4IBIA 4DV5M 4LRSA 2Z7JA 5DYIA 1YE9A 5LMNM 2J7NA 3L28A 2DHRA 3H4MA 4NRVA 4DR3M 2C99A 3RGSA 1L1ZA 3AOGA 1NJFA 2D7EA 4B7HA 5ITXE 2R18A 1GL7A 2K47A 4LFAM 3U6SA 1S3SA 3PFIA 4QHTA 3Q8XA 4PDIA 3U6OA 3HJSA 4M9ZA 4JI7M 3ILKA 1XNRM 4S12A 4GHAA 1NJGA 1XC8A 3TWLA 1IN6A 1N34M 1NY6A 4XGIA 3RFWA 3A45A 1L1TA 1QQWA 4RNAA 1IXSB 1N75A 1EE8A 4JYAM 1Q39A 3HU1A 3VKHA 3LVWA 1Z6TA 3FTDA 1R2YA 3JAMS 4LFBM 3GQ4A 3I4YA 3KSJA 4X64M 1JR3D 4D82A 4LCBA 1GL6A 2CFOA 3GQ5A 3SC3A 3I4VA 2OQ4A 5KQDA 2J7OA 1TH3A 2UXBM 1G4AE 4MGKE 2Z4RA 4LY6A 2QZ4A 3GLFB 1R6BX 1E9SA 4GC9A 2YQZA 3KS8A 4OU7A 3HKPA 1TGUA 3LQQA 1IN8A 4GKJM 1NHGC 2NQ8C 3M7GA 4GIPA 2L09A 4NXMM 2CHGA 2BJVA 4LJ5A 1HNZM 4LF8M 1N32M 2UUCM 3GO8A 1L2CA 4WW0A 5ITXA 3OTOM 3CTWB 3HU3A 3WHKA 3T1YM 2HKJA 4IJFA 4EIWA 2KZUA 3GPPA 1IBLM 3KOZE 2OPFA 4JI6M 4DV2M 3TWMA 5A2QS 2C98A 4DV4M 4R7GA 1WXQA 3MK6A 2EA0A 4NOOB 1NVMA 2UXDM 1OFIA 3J27B 1YSYA 5KPRA 5EJCA 1R7RA 4X62M 4IBCA 5IT9S 4B3MM 3SARA 3KVWA 4DR1M 1IQPA 2D7GA 2HCBA 3WHLA 2QBYB 3GRYA 4LF9M 3W0LB 4PD2A 4LZZA 2KW0A 2R62A 5H37D 2KZSA 2R65A 3AOEA 1K82A 2R4EA 2C9CA 4NSRA 3VDPA 4MB7A 4OX9M 3IG8A 5FSWA 4JI4M 5IZ7D 4G4NA 4LG2A 3GLHB 1DO0A 3KS4A 3AJIB 2E5LM 2L7HA 2CV2A 3KW6A 3AFHA 1ZQ9A 1GVNA 3SHFA 2XSZA 4FCTA 5EP4A 1DGBA 2QENA 2LWXA 4NSOB 2X49A 4LGYA 5C18A 2KA6B 2ZAMA 4LJ9A 4MM3B 3HHYA 3MJ5A 4AQYM 3K1JA 1NSFA 4MGHA 3T38A 2XZFA 1I94M 3J7AS 1QAMA 5KPTA 4FWGA 4NXNM 3TL4X 5ITUA 1HNWM 1QYRA 3J81S 3R9XB 3SATA 3JR5A 5FTMA 2X4AA 4FCVA 4BB9A 2L6OA 3FD9A 1IXZA 4FW9A 2Z3XA 3U6DA 3GRRA 1L2BA 2XGNA 3SHGB 3EIHA 1DGGA 4KHPM 4NRWA 3VLFB 2CUZA 1XXHB 4M0DA 4QOSA 2QP9X 2BNKA 2YFQA 2F5PA 4DR6M 4JI0M 3SYLA 2M5ZA 4G6ZA 3GPUA 3K2LA 4FWDA 4IBGA 1H6UA 4B7GA 4PCZA 3C58A 5EXSA 5BR8M 1Z59A 1SXJD 4LJ4A 1QAOA 4MH0E 2FE8A 4LJ6A 4B3SM 3HHZA 1SXJC 1NHWC 4A3VB 2LNHC 4DV7M 3KDSE 3U61B 2O5RA 1HQYE 4JXJA 4MGIE 3THGA 1GKIA 3AOEC 1DGFA 3J2PB 2QBYA 4LF7M 1LV7A 3TQSA 2ZANA 5FTJA 4RF1A 1PM5A 5DYGA 2XF3A 3T1HM 1K3XA 4G4OA 2F5SA 4DV1M 4DR4M 1J09A 3GLHA 1DGHB 2EUCA 2H1RA 4I5SA 3J80S 3T15A 3SAVA 1PJIA 1C1KA 2KRUA 5C1BA 1TDHA 3UK6A 1IN7A 3LVVA 3L27A 5EXXA 1Q3CA 3TWKA 4B7FA 3HHWA 4DV6M 2DWMA 4PDGA 1MU5A 2LXEA 4JI1M 3KOXE 3L26A 3D8LA 1TH2A 4QHSA 1X37A 1VDDA 1D2NA 3A98B 3GRVA 4CGYB 1Z5CA 3U6CA 1NY5A 4QNRA 3EIEA 2EO2A 3SASA 3MHVC 4DV3M 4FCWA 2YR0A 2LH0A 2D7HA 3A42A 2F5NA 3U5ZB 4MGZE 4GKKM 2XEPA 3U6MA 1QZMA 1FJGM 4LJAA 2XZUA 1XXHA 4Z8XA 2F5QA 2V1CA 2CEAA 1K3WA 3PXGA 4M0WA 2R46A 3PVSA 5ITYA 8CATA 4AZFA 3U60B 2R45A 4JV5M 4JN6A 1XMOM 2CHVA 4KLNA 5EXTA 3VDUA 3HWSA 3SBJA 2UUAM 4FD2A 1KFVA 1NNUC 3DOAA 2FFJA 4I4LA 3FYDA 5EP2A 3GPXA 3JR4A 3ZC7B 2YNMD 2Z4SA 3U61A 2CV1A 3AKZA 1T3TA 4KO8A 3GRUA 4GITA 2XH9A 1HT1E 2DWLA 3K92A 1TH4A 3HGIA 3SFZA 5ITTA 4G4QA 1E94E 2F4VM 3FTEA 5ITQA 2JA2A 4B3RM 1IM2A 1MX0A 5LMUM 4JI5M 1JQJC 5KO3A 1N77A 4AKGA 1J7KA 2UU9M 2UXCM 4AI6A 1XWIA 3R8FA 1HNXM 1HT2E 1DGHA 3HU2A 2W82A 4IBEA 2Y20A 5IWAM 3K8ZA 4YY3M 3SAUA 3KFUG 2C9OA 1FNNA 2V6ZM 1E9RA 2R4JA 3AV0A 2BJWA 3U6EA 4OVZB 2CE7A 3KOYE 4CHTB 4AG6A 4YHHM 3VK8A 1JR3A 2UUBM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 M;  1TDZ A;  1J5E M;  1PJJ A;  4LF7 M;  4NXM M;  1Z5B A;  3W0F A;  1HNZ M;  4LF8 M;  1N32 M;  2UUC M;  1PM5 A;  3GO8 A;  1L2C A;  3T1H M;  2F5O A;  5ITX A;  1K3X A;  4G4O A;  2VQE M;  2F5S A;  3OTO M;  4DV1 M;  4DR4 M;  4JI8 M;  3J80 S;  3T1Y M;  2HKJ A;  4LF5 M;  3GPP A;  3SAV A;  4JI6 M;  1PJI A;  2OPF A;  1IBL M;  4DV2 M;  3TWM A;  4CIS A;  1TDH A;  2HHH M;  5A2Q S;  3GP1 A;  4DV4 M;  1Q3C A;  3TWK A;  4B3T M;  2EA0 A;  4ITQ A;  4DR7 M;  2UXD M;  4DV6 M;  4PDG A;  1MU5 A;  4JI1 M;  4X62 M;  4LF4 M;  3GPY A;  4DUY M;  4X65 M;  4DV0 M;  4LFC M;  5IT9 S;  4B3M M;  3SAR A;  2VQF M;  1Z5C A;  3U6C A;  4X66 M;  4DR1 M;  4DR5 M;  3U6P A;  3SAS A;  4DV3 M;  4LF9 M;  1XMQ M;  3A46 A;  4PD2 A;  1HR0 M;  3SAW A;  4K0K M;  1XNQ M;  4JI2 M;  4DR2 M;  4DV5 M;  3A42 A;  5LMN M;  1K82 A;  2F5N A;  4GKK M;  3U6M A;  4MB7 A;  4OX9 M;  1FJG M;  1Z5A A;  4JI4 M;  4NRV A;  4G4N A;  4DR3 M;  1Q3B A;  2XZU A;  1L1Z A;  2F5Q A;  1K3W A;  2ZM6 M;  5ITX E;  5ITY A;  2E5L M;  4LFA M;  3U6S A;  2Q2E B;  3U6L A;  4JV5 M;  1XMO M;  4PDI A;  3U6O A;  3SBJ A;  2UUA M;  1KFV A;  3DOA A;  4JI7 M;  3GQ3 A;  1XNR M;  1R2Z A;  2XZF A;  4AQY M;  3GPX A;  3JR4 A;  1XC8 A;  3TWL A;  1I94 M;  3J7A S;  4NXN M;  5ITU A;  1HNW M;  1N34 M;  1IBK M;  3J81 S;  3A45 A;  1L1T A;  3SAT A;  3JR5 A;  5ITT A;  1EE8 A;  4G4Q A;  4JYA M;  1Q39 A;  3U6D A;  1L2B A;  5ITQ A;  2F4V M;  5ITR A;  4B3R M;  5LMU M;  1MX0 A;  4JI5 M;  4KHP M;  1N33 M;  1R2Y A;  2UU9 M;  2UXC M;  3JAM S;  4NRW A;  4LFB M;  1IBM M;  1HNX M;  3GQ4 A;  4JI3 M;  3U6Q A;  2ZBK B;  1N36 M;  5FLX S;  4X64 M;  5IWA M;  4YY3 M;  2F5P A;  4JI0 M;  4DR6 M;  3SAU A;  3GQ5 A;  2OQ4 A;  1NNJ A;  3GPU A;  3C58 A;  4PCZ A;  4DUZ M;  3VK7 A;  5BR8 M;  3U6E A;  2UXB M;  1Z59 A;  4B3S M;  1L2D A;  4G4R A;  4YHH M;  4DV7 M;  3VK8 A;  4GKJ M;  2UUB M; 
#chains in the Genus database with same CATH topology
 4LF6 M;  1WR1 B;  4IBK A;  3ZH9 B;  4BLC A;  1W5T A;  1J5E M;  4BBA A;  1QDR A;  1PJJ A;  3W0F A;  3AL0 C;  2G3Q A;  5EQT A;  3FTC A;  2DAK A;  4Z6Y A;  1G59 A;  1IY0 A;  3U5Z A;  2F5O A;  2MRO B;  1IN5 A;  1D0L A;  3CF6 E;  3NBI A;  3QAU A;  3GLG A;  3FKE A;  2WZJ A;  2L4F A;  2RRU A;  5EP3 A;  4LJ8 A;  2DXI A;  4QOZ C;  1UM8 A;  2I7P A;  2JY7 A;  2VDB B;  4FWH A;  3L25 A;  2BWE A;  1ZMU A;  2M60 A;  2Y0T A;  4CIS A;  4RF0 A;  3GP1 A;  2EJS A;  4HL4 A;  3U60 A;  2MGW A;  2ERC A;  3FUU A;  3L29 A;  1QAN A;  4LJ7 A;  3UGJ A;  5F3W A;  3KP0 E;  2DVW B;  4FVM A;  2C5R A;  1OFH A;  4B3T M;  4ITQ A;  4DR7 M;  1VDL A;  4D81 A;  1IXR C;  4ZPX A;  4REZ A;  3UZU A;  3GPY A;  4R3D A;  4X65 M;  4LFC M;  2JY5 A;  3NWL A;  2VQF M;  4IJE A;  1QUT A;  1OKS A;  2RKO A;  4DR5 M;  3U6P A;  3FUX A;  1W5S A;  5GKN A;  3A46 A;  1XMQ M;  2LVA A;  2XSZ D;  5EP1 A;  3SAW A;  4AKI A;  3UJN A;  1XNQ M;  4JI2 M;  4DR2 M;  4LZJ A;  3HJ8 A;  3J7B A;  4GC5 A;  1SXJ B;  3M0E A;  2P5T A;  1KSF X;  3C3D A;  4M9S A;  3RE8 A;  2QPA A;  1Z5A A;  4KOD A;  2WSC F;  1WHC A;  4IBJ A;  1Q3B A;  4LRT A;  1SXJ E;  3GLI B;  3SYK A;  5BPV A;  2ZM6 M;  1D0M A;  2DAG A;  3GLI E;  2DEN A;  3E4R A;  2Q2E B;  3U6L A;  2FH0 A;  2C96 A;  3FUW A;  5FTK A;  2QCU A;  2A5Y B;  2FOI C;  4L4U A;  4I8O A;  1L8Q A;  4D80 A;  3HHX A;  4OVZ A;  2KXE A;  3GQ3 A;  3KXE C;  5FTN A;  4NL4 H;  1R2Z A;  1G41 A;  4MGY E;  1IY1 A;  4L8R C;  2X8A A;  3DA1 A;  3PNY A;  1IBK M;  1G71 A;  1N78 A;  4P16 A;  1TF0 B;  1VQ1 A;  3CF0 A;  2I7N A;  3B9P A;  3GLF E;  2DAE A;  3GLG B;  3DFZ A;  3RGP A;  2Y21 A;  1JB0 F;  1T6O A;  2KNA A;  3KP1 E;  4PT5 A;  5ITR A;  1D0K A;  3FTF A;  1ZAE A;  4IBB A;  4L16 A;  2RGO A;  1N33 M;  1E32 A;  1WGL A;  4F2L A;  1GAB A;  5JI3 E;  4GHL A;  4IBF A;  1VEK A;  1XB2 B;  3CF2 A;  1IBM M;  3BXW A;  3LQR A;  4JI3 M;  2ZBK B;  3U6Q A;  1N36 M;  3BOS A;  2LVQ D;  5FLX S;  2Y0Q A;  2JXN A;  4II7 A;  3IEC A;  3M6A A;  1G3I A;  1QVR A;  4L78 A;  1DO2 A;  1NNJ A;  4GMQ A;  2CHQ A;  1IY2 A;  4DUZ M;  3VK7 A;  3LW5 F;  3D8B A;  4CIZ A;  2MH8 A;  3L2A A;  2DWN A;  2AHM A;  2HAK A;  1L2D A;  2L7I A;  1XHB A;  3E46 A;  4G4R A;  1HQC A;  2KDL A;  5E26 A;  4AKH A;  1GLN A;  4B08 A;  3IHP A;  1TDZ A;  2XLJ A;  2JWS A;  1AUA A;  2JZ1 A;  3FYC A;  4L15 A;  3ZCB B;  2V1U A;  2RGH A;  1ZMW A;  2OO9 A;  3C3E A;  1Z5B A;  5KPZ A;  4HLQ A;  1GO5 A;  4W5W A;  1IN4 A;  2O25 A;  1SXJ A;  3PNV A;  1G8P A;  4GH9 A;  4QNM A;  3HJQ A;  2XFT A;  1IXS A;  2ZAO A;  5JI2 E;  2KNZ A;  2VQE M;  2G8L A;  5IRE B;  3QWL A;  4JI8 M;  4IBD A;  3GLI A;  4XBO A;  5E6J A;  5FTL A;  4LF5 M;  3LMM A;  3V76 A;  4AG5 A;  5DNY A;  4NC6 A;  4OW0 A;  2HHH M;  3E9S A;  2JP7 A;  2R6F A;  2CV0 A;  1QZE A;  3VFD A;  1YUB A;  2KEB A;  7CAT A;  2N35 A;  2HL7 A;  2FNA A;  2EKK A;  3FE3 A;  2K0B X;  3ZQJ A;  1OJL A;  2O01 F;  3FRI A;  4GRI A;  3UMM A;  3IG5 A;  2CWB A;  2DZN B;  3KOW E;  3I51 A;  4IIW A;  4TUW A;  4LF4 M;  4DUY M;  2G5G X;  2XFS A;  3SMP A;  4WUR A;  4AW4 A;  3VKG A;  4DV0 M;  4L6V 6;  2DWZ B;  1I4W A;  3FUT A;  1QAQ A;  4M9X A;  3GLF A;  3KSX A;  4X66 M;  3FUV A;  4I81 A;  3SMS A;  5EXP A;  2KRK A;  1ORY B;  3TPZ A;  1HR0 M;  1TR8 A;  3I01 M;  1KYI A;  4LGM A;  2DZO B;  2VII A;  3DZD A;  4K0K M;  3TE6 A;  2JY6 B;  4IBI A;  5KQ8 A;  4LRS A;  4DV5 M;  2Z7J A;  5DYI A;  1YE9 A;  5LMN M;  2J7N A;  3L28 A;  2LVO C;  2DHR A;  3H4M A;  4NRV A;  4DR3 M;  1PGY A;  2C99 A;  3RGS A;  2APL A;  1L1Z A;  2BWB A;  3AOG A;  1NJF A;  2D7E A;  4B7H A;  5ITX E;  2KHH A;  2R18 A;  1GL7 A;  2K47 A;  4LFA M;  3U6S A;  1S3S A;  3B7Q A;  3PFI A;  2QSF X;  4QHT A;  1PRB A;  3Q8X A;  4PDI A;  3U6O A;  2FS1 A;  3HJS A;  4M9Z A;  4JI7 M;  3ILK A;  1XNR M;  4S12 A;  4GHA A;  1NJG A;  1WGN A;  3TWL A;  1XC8 A;  1OIP A;  3T6P A;  1PJT A;  1IN6 A;  1N34 M;  1NY6 A;  4XGI A;  1OTR A;  3A45 A;  3RFW A;  1QQW A;  1L1T A;  4RNA A;  1IXS B;  1N75 A;  1EE8 A;  4JYA M;  2GNO A;  1Q39 A;  3HU1 A;  5DFL A;  3VKH A;  3LVW A;  1Z6T A;  2QHO B;  3FTD A;  1Y8G A;  1R2Y A;  3JAM S;  4LFB M;  3GQ4 A;  3I4Y A;  3KSJ A;  4X64 M;  1JR3 D;  4D82 A;  4LCB A;  1GL6 A;  1F4I A;  2HWJ A;  2DAI A;  2H5X A;  2CFO A;  3GQ5 A;  3SC3 A;  3I4V A;  2OQ4 A;  5KQD A;  2J7O A;  1MJG M;  1TH3 A;  5L8R F;  2K6B A;  4Y28 F;  2UXB M;  1G4A E;  4MGK E;  2Z4R A;  4LY6 A;  1NO1 A;  2QZ4 A;  3GLF B;  1R6B X;  3K9O A;  1E9S A;  4GC9 A;  2YQZ A;  3KS8 A;  4OU7 A;  3HKP A;  1TGU A;  3LQQ A;  1IN8 A;  4GKJ M;  1NHG C;  4RKU F;  2NQ8 C;  3M7G A;  4GIP A;  2L09 A;  4NXM M;  2CHG A;  4XK8 F;  2BJV A;  4LJ5 A;  3W68 A;  1HNZ M;  4LF8 M;  1N32 M;  2UUC M;  3GO8 A;  1L2C A;  4WW0 A;  5ITX A;  3OTO M;  3CTW B;  3CGW A;  3HU3 A;  3WHK A;  3T1Y M;  2HKJ A;  4IJF A;  4EIW A;  2KZU A;  3GPP A;  1IBL M;  3KOZ E;  2OPF A;  4JI6 M;  1VEG A;  4DV2 M;  3TWM A;  1R4G A;  4DBG B;  5A2Q S;  2C98 A;  4DV4 M;  3BBZ A;  4R7G A;  1WXQ A;  3MK6 A;  1IFY A;  2KNV A;  2EA0 A;  4NOO B;  1NVM A;  3C9P A;  2UXD M;  1EIJ A;  1SG9 A;  1OFI A;  3J27 B;  1YSY A;  5KPR A;  5EJC A;  1R7R A;  4X62 M;  4IBC A;  2JY8 A;  5IT9 S;  4B3M M;  3SAR A;  3KVW A;  1TTE A;  4DR1 M;  1IQP A;  2D7G A;  2HCB A;  3WHL A;  2QBY B;  3GRY A;  1UFZ A;  3F92 A;  4LF9 M;  3W0L B;  4PD2 A;  2LHG A;  1OAI A;  4LZZ A;  2CP8 A;  2LHC A;  2KW0 A;  2R62 A;  5H37 D;  3K9P A;  2KZS A;  2R65 A;  3AOE A;  1K82 A;  2R4E A;  2C9C A;  4NSR A;  3VDP A;  2JZ0 A;  4MB7 A;  4OX9 M;  3IG8 A;  3LCU A;  5FSW A;  5IZ7 D;  4G4N A;  4JI4 M;  3GLH B;  4R71 A;  4LG2 A;  2CRU A;  1DO0 A;  3KS4 A;  3AJI B;  2E5L M;  2MJ5 B;  3GLH E;  2L7H A;  4KT0 F;  1Q02 A;  2CV2 A;  2DNA A;  3KW6 A;  3AFH A;  3E21 A;  1ZQ9 A;  1GVN A;  3SHF A;  2XSZ A;  4FCT A;  5EP4 A;  1DGB A;  2QEN A;  2L4E A;  1PJQ A;  2LWX A;  4NSO B;  2X49 A;  4LGY A;  5C18 A;  1A5T A;  2KA6 B;  2ZAM A;  4LJ9 A;  4MM3 B;  3LCV B;  3HHY A;  3MJ5 A;  4AQY M;  3K1J A;  1NSF A;  4MGH A;  3T38 A;  2XZF A;  1I94 M;  3B7Z A;  3J7A S;  1QAM A;  1QUS A;  4FWG A;  5KPT A;  4NXN M;  3TL4 X;  5ITU A;  1VG5 A;  1NV9 A;  1HNW M;  1QYR A;  3J81 S;  3R9X B;  3SAT A;  3JR5 A;  5FTM A;  2X4A A;  4FCV A;  4BB9 A;  2L6O A;  2ZTD A;  3FD9 A;  1IXZ A;  4FW9 A;  2Z3X A;  3U6D A;  1AIP C;  3GRR A;  2OOA A;  1L2B A;  2XGN A;  3B7N A;  3SHG B;  2R44 A;  3EIH A;  1DGG A;  4KHP M;  4NRW A;  3VLF B;  3MMP A;  2CUZ A;  4G3O A;  1XXH B;  4M0D A;  4F1I A;  4QOS A;  2QP9 X;  2BNK A;  2YFQ A;  2F5P A;  1XXH E;  4JI0 M;  3SYL A;  4CJ6 A;  4DR6 M;  2JNH A;  2M5Z A;  4G6Z A;  3GPU A;  3K2L A;  4FWD A;  4IBG A;  1H6U A;  4B7G A;  4PCZ A;  3C58 A;  2LVN C;  5EXS A;  5BR8 M;  4GEW A;  1Z59 A;  1SXJ D;  4LJ4 A;  1QAO A;  2LTU A;  4MH0 E;  4WP2 A;  2FE8 A;  4LJ6 A;  4B3S M;  3HHZ A;  1SXJ C;  1NHW C;  4A3V B;  2LNH C;  4DV7 M;  3KDS E;  3U61 B;  1OAO C;  1HQY E;  2O5R A;  4JXJ A;  4MGI E;  3THG A;  1GKI A;  3AOE C;  1DGF A;  3J2P B;  2QBY A;  2WSF F;  3HZJ A;  3B74 A;  4LF7 M;  2DI0 A;  1PJS A;  2QNJ A;  1LV7 A;  1GJT A;  3TQS A;  2ZAN A;  3I04 M;  5FTJ A;  1T43 A;  4RF1 A;  1PM5 A;  5DYG A;  2XF3 A;  3T1H M;  1K3X A;  2EKF A;  4G4O A;  2F5S A;  4DV1 M;  4DR4 M;  1J09 A;  3GLH A;  1DGH B;  2EUC A;  2H1R A;  4I5S A;  3J80 S;  3T15 A;  3SAV A;  1PJI A;  3NBX X;  1C1K A;  2KRU A;  5C1B A;  1TDH A;  2R0I A;  3UK6 A;  1IN7 A;  3LVV A;  2Z8Y M;  4UN2 B;  1V33 A;  3L27 A;  5EXX A;  1Q3C A;  3TWK A;  4B7F A;  3HHW A;  4DV6 M;  2DWM A;  2DHY A;  1WJ7 A;  1MU5 A;  2LXE A;  2B3T A;  3KOX E;  4PDG A;  4JI1 M;  2LVP C;  2VF7 A;  3L26 A;  1C7Y A;  1V34 A;  3D8L A;  3H4J A;  1TH2 A;  4QHS A;  1BVS A;  1X37 A;  1VDD A;  1D2N A;  3A98 B;  3GRV A;  4CGY B;  1Z5C A;  3U6C A;  1YLA A;  1QDT A;  1NY5 A;  4QNR A;  4HEO A;  1HJP A;  3EIE A;  2EO2 A;  3SAS A;  1JR3 E;  3MHV C;  4DV3 M;  3QYB A;  4P17 A;  4FCW A;  2YR0 A;  2OOB A;  1EFU B;  2LH0 A;  2D7H A;  4Q7J A;  3A42 A;  2F5N A;  2L2D A;  3U5Z B;  4MGZ E;  4GKK M;  1VEJ A;  2XEP A;  2JUJ A;  1QZM A;  3U6M A;  1FJG M;  1MN3 A;  4LJA A;  2XZU A;  1XXH A;  4Z8X A;  3FRH A;  3HX3 A;  2V1C A;  2CEA A;  1K3W A;  2F5Q A;  2QQ8 A;  3PXG A;  4M0W A;  2R46 A;  3PVS A;  5ITY A;  8CAT A;  3GLG E;  4AZF A;  1P3Q Q;  3U60 B;  2R45 A;  4JV5 M;  4JN6 A;  2DKL A;  1XMO M;  2CHV A;  2VF8 A;  4KLN A;  5EXT A;  3VDU A;  3HWS A;  3SBJ A;  1OIZ A;  2UUA M;  4FD2 A;  1KFV A;  1NNU C;  3DOA A;  2FFJ A;  4I4L A;  2J5Y A;  1DV0 A;  3FYD A;  2WSE F;  1GJS A;  5EP2 A;  1OQY A;  3B89 A;  3GPX A;  3JR4 A;  3ZC7 B;  2YNM D;  2Z4S A;  3U61 A;  2CV1 A;  3AKZ A;  1T3T A;  4KO8 A;  2K9D A;  3GRU A;  4GIT A;  2GQF A;  2XH9 A;  2DAM A;  1HT1 E;  2MR9 A;  2DWL A;  3K92 A;  1TH4 A;  3HGI A;  3SFZ A;  5ITT A;  1LTM A;  1E94 E;  4G4Q A;  2F4V M;  3FTE A;  5ITQ A;  2JA2 A;  2ZTC A;  4B3R M;  1IM2 A;  1MX0 A;  3HY5 A;  5LMU M;  4JI5 M;  1JQJ C;  5KO3 A;  1N77 A;  4AKG A;  1J7K A;  2UU9 M;  2UXC M;  4AI6 A;  1ZV1 A;  1XWI A;  3R8F A;  1HNX M;  1V92 A;  1HT2 E;  1R5L A;  1DGH A;  3HU2 A;  2W82 A;  4IBE A;  2Y20 A;  5IWA M;  3K8Z A;  4YY3 M;  3SAU A;  3KFU G;  2C9O A;  1FNN A;  2V6Z M;  3W67 A;  1RU3 A;  1E9R A;  2R4J A;  3QYE A;  1WIV A;  3AV0 A;  2BJW A;  1ZMV A;  3U6E A;  4OVZ B;  2DZL A;  2CE7 A;  3KOY E;  4ANR A;  1NV8 A;  4CHT B;  2LBC A;  4AG6 A;  1CUK A;  4YHH M;  3VK8 A;  3Q8G A;  1JR3 A;  2UUB M; 
#chains in the Genus database with same CATH homology
 4LF6 M;  4IBK A;  3ZH9 B;  4BLC A;  1W5T A;  1J5E M;  4BBA A;  1PJJ A;  3W0F A;  3AL0 C;  5EQT A;  3FTC A;  4Z6Y A;  1G59 A;  1IY0 A;  3U5Z A;  2F5O A;  1IN5 A;  3CF6 E;  3NBI A;  3QAU A;  3GLG A;  3FKE A;  5EP3 A;  4LJ8 A;  2DXI A;  4QOZ C;  1UM8 A;  2I7P A;  4FWH A;  3L25 A;  2M60 A;  2Y0T A;  4CIS A;  4RF0 A;  3GP1 A;  4HL4 A;  3U60 A;  2ERC A;  3FUU A;  3L29 A;  1QAN A;  4LJ7 A;  3UGJ A;  5F3W A;  3KP0 E;  2DVW B;  4FVM A;  2C5R A;  1OFH A;  4B3T M;  4ITQ A;  4DR7 M;  4D81 A;  1IXR C;  4ZPX A;  4REZ A;  3UZU A;  3GPY A;  4R3D A;  4X65 M;  4LFC M;  3NWL A;  2VQF M;  4IJE A;  2RKO A;  4DR5 M;  3U6P A;  3FUX A;  1W5S A;  5GKN A;  3A46 A;  1XMQ M;  5EP1 A;  2XSZ D;  3SAW A;  4AKI A;  3UJN A;  1XNQ M;  4JI2 M;  4DR2 M;  4LZJ A;  3HJ8 A;  3J7B A;  4GC5 A;  1SXJ B;  3M0E A;  2P5T A;  1KSF X;  4M9S A;  3RE8 A;  2QPA A;  1Z5A A;  4KOD A;  4LRT A;  4IBJ A;  1Q3B A;  1SXJ E;  3GLI B;  3SYK A;  5BPV A;  2ZM6 M;  3E4R A;  2Q2E B;  3U6L A;  3FUW A;  2C96 A;  5FTK A;  2QCU A;  2A5Y B;  2FOI C;  4L4U A;  4I8O A;  1L8Q A;  4D80 A;  3HHX A;  4OVZ A;  2KXE A;  3GQ3 A;  3KXE C;  5FTN A;  4NL4 H;  1R2Z A;  1G41 A;  4MGY E;  1IY1 A;  4L8R C;  2X8A A;  3DA1 A;  3PNY A;  1IBK M;  1N78 A;  4P16 A;  3CF0 A;  2I7N A;  3B9P A;  3GLG B;  3DFZ A;  3RGP A;  2Y21 A;  5ITR A;  3KP1 E;  4PT5 A;  3FTF A;  1ZAE A;  4IBB A;  4L16 A;  2RGO A;  1N33 M;  1E32 A;  5JI3 E;  4GHL A;  4IBF A;  1IBM M;  3CF2 A;  3U6Q A;  3LQR A;  4JI3 M;  2ZBK B;  1N36 M;  3BOS A;  5FLX S;  2Y0Q A;  4II7 A;  3M6A A;  1G3I A;  1QVR A;  4L78 A;  1DO2 A;  1NNJ A;  4GMQ A;  2CHQ A;  1IY2 A;  4DUZ M;  3VK7 A;  3D8B A;  3L2A A;  2DWN A;  2AHM A;  1L2D A;  2L7I A;  1XHB A;  4G4R A;  1HQC A;  5E26 A;  4AKH A;  1GLN A;  4B08 A;  1TDZ A;  2XLJ A;  3FYC A;  4L15 A;  3ZCB B;  2V1U A;  2RGH A;  1Z5B A;  5KPZ A;  4HLQ A;  4W5W A;  1IN4 A;  1SXJ A;  3PNV A;  1G8P A;  4GH9 A;  4QNM A;  3HJQ A;  2XFT A;  2ZAO A;  5JI2 E;  2VQE M;  2G8L A;  5IRE B;  3QWL A;  4JI8 M;  4IBD A;  3GLI A;  4XBO A;  5E6J A;  5FTL A;  4LF5 M;  3LMM A;  4AG5 A;  5DNY A;  4OW0 A;  2HHH M;  3E9S A;  2CV0 A;  3VFD A;  1YUB A;  2KEB A;  7CAT A;  2HL7 A;  2FNA A;  1OJL A;  4GRI A;  3UMM A;  3IG5 A;  2DZN B;  3KOW E;  3I51 A;  4IIW A;  4TUW A;  4LF4 M;  4DUY M;  2G5G X;  2XFS A;  3SMP A;  4WUR A;  4AW4 A;  3VKG A;  4DV0 M;  2DWZ B;  1I4W A;  3FUT A;  1QAQ A;  4M9X A;  3GLF A;  3KSX A;  4X66 M;  3FUV A;  4I81 A;  3SMS A;  5EXP A;  2KRK A;  1ORY B;  3TPZ A;  1HR0 M;  4LGM A;  1KYI A;  4K0K M;  2DZO B;  2VII A;  3DZD A;  3TE6 A;  5KQ8 A;  4IBI A;  4DV5 M;  4LRS A;  2Z7J A;  5DYI A;  1YE9 A;  5LMN M;  2J7N A;  3L28 A;  2DHR A;  3H4M A;  4NRV A;  4DR3 M;  2C99 A;  3RGS A;  1L1Z A;  3AOG A;  1NJF A;  2D7E A;  4B7H A;  5ITX E;  2R18 A;  1GL7 A;  2K47 A;  4LFA M;  3U6S A;  1S3S A;  3PFI A;  4QHT A;  3Q8X A;  4PDI A;  3U6O A;  3HJS A;  4M9Z A;  4JI7 M;  3ILK A;  1XNR M;  4S12 A;  4GHA A;  1NJG A;  1XC8 A;  3TWL A;  1IN6 A;  1N34 M;  1NY6 A;  4XGI A;  3RFW A;  3A45 A;  1L1T A;  1QQW A;  4RNA A;  1IXS B;  1N75 A;  1EE8 A;  4JYA M;  1Q39 A;  3HU1 A;  3VKH A;  3LVW A;  1Z6T A;  3FTD A;  1R2Y A;  3JAM S;  4LFB M;  3GQ4 A;  3I4Y A;  3KSJ A;  4X64 M;  1JR3 D;  4D82 A;  4LCB A;  1GL6 A;  2CFO A;  3GQ5 A;  3SC3 A;  3I4V A;  2OQ4 A;  5KQD A;  2J7O A;  1TH3 A;  2UXB M;  1G4A E;  4MGK E;  2Z4R A;  4LY6 A;  2QZ4 A;  3GLF B;  1R6B X;  1E9S A;  4GC9 A;  2YQZ A;  3KS8 A;  4OU7 A;  3HKP A;  1TGU A;  3LQQ A;  1IN8 A;  4GKJ M;  1NHG C;  2NQ8 C;  3M7G A;  4GIP A;  2L09 A;  4NXM M;  2CHG A;  2BJV A;  4LJ5 A;  1HNZ M;  4LF8 M;  1N32 M;  2UUC M;  3GO8 A;  1L2C A;  4WW0 A;  5ITX A;  3OTO M;  3CTW B;  3HU3 A;  3WHK A;  3T1Y M;  2HKJ A;  4IJF A;  4EIW A;  2KZU A;  3GPP A;  1IBL M;  3KOZ E;  2OPF A;  4JI6 M;  4DV2 M;  3TWM A;  5A2Q S;  2C98 A;  4DV4 M;  4R7G A;  1WXQ A;  3MK6 A;  2EA0 A;  4NOO B;  1NVM A;  2UXD M;  1OFI A;  3J27 B;  1YSY A;  5KPR A;  5EJC A;  1R7R A;  4X62 M;  4IBC A;  5IT9 S;  4B3M M;  3SAR A;  3KVW A;  4DR1 M;  1IQP A;  2D7G A;  2HCB A;  3WHL A;  2QBY B;  3GRY A;  4LF9 M;  3W0L B;  4PD2 A;  4LZZ A;  2KW0 A;  2R62 A;  5H37 D;  2KZS A;  2R65 A;  3AOE A;  1K82 A;  2R4E A;  2C9C A;  4NSR A;  3VDP A;  4MB7 A;  4OX9 M;  3IG8 A;  5FSW A;  4JI4 M;  5IZ7 D;  4G4N A;  4LG2 A;  3GLH B;  1DO0 A;  3KS4 A;  3AJI B;  2E5L M;  2L7H A;  2CV2 A;  3KW6 A;  3AFH A;  1ZQ9 A;  1GVN A;  3SHF A;  2XSZ A;  4FCT A;  5EP4 A;  1DGB A;  2QEN A;  2LWX A;  4NSO B;  2X49 A;  4LGY A;  5C18 A;  2KA6 B;  2ZAM A;  4LJ9 A;  4MM3 B;  3HHY A;  3MJ5 A;  4AQY M;  3K1J A;  1NSF A;  4MGH A;  3T38 A;  2XZF A;  1I94 M;  3J7A S;  1QAM A;  5KPT A;  4FWG A;  4NXN M;  3TL4 X;  5ITU A;  1HNW M;  1QYR A;  3J81 S;  3R9X B;  3SAT A;  3JR5 A;  5FTM A;  2X4A A;  4FCV A;  4BB9 A;  2L6O A;  3FD9 A;  1IXZ A;  4FW9 A;  2Z3X A;  3U6D A;  3GRR A;  1L2B A;  2XGN A;  3SHG B;  3EIH A;  1DGG A;  4KHP M;  4NRW A;  3VLF B;  2CUZ A;  1XXH B;  4M0D A;  4QOS A;  2QP9 X;  2BNK A;  2YFQ A;  2F5P A;  4DR6 M;  4JI0 M;  3SYL A;  2M5Z A;  4G6Z A;  3GPU A;  3K2L A;  4FWD A;  4IBG A;  1H6U A;  4B7G A;  4PCZ A;  3C58 A;  5EXS A;  5BR8 M;  1Z59 A;  1SXJ D;  4LJ4 A;  1QAO A;  4MH0 E;  2FE8 A;  4LJ6 A;  4B3S M;  3HHZ A;  1SXJ C;  1NHW C;  4A3V B;  2LNH C;  4DV7 M;  3KDS E;  3U61 B;  2O5R A;  1HQY E;  4JXJ A;  4MGI E;  3THG A;  1GKI A;  3AOE C;  1DGF A;  3J2P B;  2QBY A;  4LF7 M;  1LV7 A;  3TQS A;  2ZAN A;  5FTJ A;  4RF1 A;  1PM5 A;  5DYG A;  2XF3 A;  3T1H M;  1K3X A;  4G4O A;  2F5S A;  4DV1 M;  4DR4 M;  1J09 A;  3GLH A;  1DGH B;  2EUC A;  2H1R A;  4I5S A;  3J80 S;  3T15 A;  3SAV A;  1PJI A;  1C1K A;  2KRU A;  5C1B A;  1TDH A;  3UK6 A;  1IN7 A;  3LVV A;  3L27 A;  5EXX A;  1Q3C A;  3TWK A;  4B7F A;  3HHW A;  4DV6 M;  2DWM A;  4PDG A;  1MU5 A;  2LXE A;  4JI1 M;  3KOX E;  3L26 A;  3D8L A;  1TH2 A;  4QHS A;  1X37 A;  1VDD A;  1D2N A;  3A98 B;  3GRV A;  4CGY B;  1Z5C A;  3U6C A;  1NY5 A;  4QNR A;  3EIE A;  2EO2 A;  3SAS A;  3MHV C;  4DV3 M;  4FCW A;  2YR0 A;  2LH0 A;  2D7H A;  3A42 A;  2F5N A;  3U5Z B;  4MGZ E;  4GKK M;  2XEP A;  3U6M A;  1QZM A;  1FJG M;  4LJA A;  2XZU A;  1XXH A;  4Z8X A;  2F5Q A;  2V1C A;  2CEA A;  1K3W A;  3PXG A;  4M0W A;  2R46 A;  3PVS A;  5ITY A;  8CAT A;  4AZF A;  3U60 B;  2R45 A;  4JV5 M;  4JN6 A;  1XMO M;  2CHV A;  4KLN A;  5EXT A;  3VDU A;  3HWS A;  3SBJ A;  2UUA M;  4FD2 A;  1KFV A;  1NNU C;  3DOA A;  2FFJ A;  4I4L A;  3FYD A;  5EP2 A;  3GPX A;  3JR4 A;  3ZC7 B;  2YNM D;  2Z4S A;  3U61 A;  2CV1 A;  3AKZ A;  1T3T A;  4KO8 A;  3GRU A;  4GIT A;  2XH9 A;  1HT1 E;  2DWL A;  3K92 A;  1TH4 A;  3HGI A;  3SFZ A;  5ITT A;  4G4Q A;  1E94 E;  2F4V M;  3FTE A;  5ITQ A;  2JA2 A;  4B3R M;  1IM2 A;  1MX0 A;  5LMU M;  4JI5 M;  1JQJ C;  5KO3 A;  1N77 A;  4AKG A;  1J7K A;  2UU9 M;  2UXC M;  4AI6 A;  1XWI A;  3R8F A;  1HNX M;  1HT2 E;  1DGH A;  3HU2 A;  2W82 A;  4IBE A;  2Y20 A;  5IWA M;  3K8Z A;  4YY3 M;  3SAU A;  3KFU G;  2C9O A;  1FNN A;  2V6Z M;  1E9R A;  2R4J A;  3AV0 A;  2BJW A;  3U6E A;  4OVZ B;  2CE7 A;  3KOY E;  4CHT B;  4AG6 A;  4YHH M;  3VK8 A;  1JR3 A;  2UUB M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...