5LMNM

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5lmnM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5lmnM02
3J81S 4G4OA 2Q2EB 5IT9S 1KFVA 3U6DA 3U6QA 5ITXE 3GPXA 3GPPA 3U6PA 4OX9M 4DV4M 4DV3M 2F5SA 4PD2A 2OPFA 3U6OA 3JAMS 1R2YA 3GP1A 3VK8A 3JR5A 3SBJA 1Q3BA 4K0KM 1IBLM 3DOAA 2UXCM 1Z5CA 4B3RM 1PJJA 3GPUA 4LF5M 2VQFM 3U6EA 2HHHM 1IBMM 5LMUM 5ITUA 5FLXS 1Z5AA 1L2DA 3SATA 2XZUA 1L2CA 4YHHM 1Z5BA 4X64M 2VQEM 4PCZA 3JR4A 4NRWA 3GQ3A 4DR7M 1Q39A 2XZFA 1N32M 3J80S 3SARA 1K82A 4DV5M 5BR8M 4NRVA 4JI5M 4G4RA 1Z59A 4DV7M 4LF4M 4AQYM 3SASA 3TWMA 1J5EM 4LF7M 3A46A 1L1TA 4DV1M 2UU9M 4JI4M 2F5PA 4GKKM 4B3SM 3W0FA 1K3WA 1HNXM 4B3TM 1EE8A 1PJIA 1XNRM 3C58A 4LF9M 5A2QS 3SAWA 4LFAM 3SAVA 1XNQM 5ITRA 3U6LA 4G4QA 4KHPM 2ZM6M 4DV6M 1IBKM 2E5LM 2ZBKB 1HNWM 1N33M 3U6CA 4DUZM 2F5OA 4NXNM 4YY3M 1PM5A 4DR3M 4LF6M 4PDGA 4DR6M 4JI6M 4JI0M 3VK7A 5ITYA 2HKJA 4DUYM 3GPYA 1MU5A 2OQ4A 4X62M 4DR5M 2UUBM 4CISA 2F4VM 4DV0M 5IWAM 1XC8A 4LF8M 1XMQM 3T1HM 2UUCM 4DR4M 2UXDM 4X65M 1N34M 4JI7M 1L1ZA 2F5NA 2UXBM 4X66M 4GKJM 3A45A 1TDHA 4MB7A 4NXMM 5ITQA 3U6MA 1HNZM 4DR2M 1NNJA 1Q3CA 1L2BA 4PDIA 4DV2M 2F5QA 1MX0A 4DR1M 4B3MM 5ITXA 4ITQA 3J7AS 3SAUA 4G4NA 1N36M 1R2ZA 1HR0M 4LFCM 5ITTA 3OTOM 3TWLA 3U6SA 2EA0A 1I94M 4JI3M 2UUAM 4LFBM 3GQ5A 3A42A 1K3XA 5LMNM 4JI1M 4JI2M 1XMOM 4JYAM 3T1YM 4JV5M 1TDZA 3TWKA 4JI8M 1FJGM 3GO8A 3GQ4A
chains in the Genus database with same CATH superfamily
3UZUA 1UM8A 2R6FA 2Q2EB 2LH0A 3KP0E 2I7PA 1YE9A 3HKPA 5FTMA 4WP2A 4RF0A 4IBFA 3U6PA 1JR3D 4LJ7A 4D82A 4PD2A 3U6OA 1R2YA 1NJGA 3CF2A 3GP1A 2DXIA 1TH2A 1Q3BA 2VIIA 1NJFA 4AG5A 2KNVA 1AUAA 5H37D 3I01M 1PGYA 2CV2A 4B7GA 4B3RM 1E9SA 1PJJA 4HEOA 2G3QA 3HJ8A 2HHHM 4LZZA 3CF0A 5FLXS 4M9XA 4GHLA 1S3SA 2MROB 1Z5BA 1P3QQ 1VEJA 3Q8XA 4GMQA 4G6ZA 3JR4A 1E94E 2VQEM 4NRWA 4AKGA 1YLAA 4NSOB 4WURA 4AI6A 1IXRC 5BPVA 1SXJD 1N32M 3J80S 3SARA 2R0IA 3PVSA 3R9XB 3EIHA 1K82A 4LGYA 4GC5A 3B9PA 3RGSA 5F3WA 1R4GA 4MH0E 1ZQ9A 3BXWA 2CEAA 2DKLA 2RKOA 2D7EA 2R44A 1J09A 4HLQA 4MM3B 2D7GA 2VDBB 5C1BA 4LJ6A 2CHVA 2M5ZA 2WSCF 3EIEA 1ZMUA 3GLFB 2XFTA 4B3SM 1N75A 1HNXM 4B3TM 3KFUG 3F92A 3LVWA 1EE8A 3KOXE 1XNRM 4OU7A 4FWDA 3FUXA 3ZCBB 3ZH9B 4L4UA 3SAWA 3KS4A 3SAVA 2QQ8A 1XNQM 1TF0B 2ZM6M 2HWJA 1V33A 2Y21A 3T6PA 2ZTCA 5DNYA 2E5LM 1MJGM 2BWEA 1QAQA 5EJCA 2V1UA 1HNWM 3HHWA 3UMMA 1QUTA 4UN2B 1D0KA 3B74A 1ZV1A 2KHHA 4NXNM 1TH3A 4YY3M 2GQFA 4G3OA 1QANA 4LF6M 1GVNA 4PDGA 3FUVA 2MH8A 1DV0A 4B08A 4JI6M 2FE8A 2Z7JA 1NHGC 1ZAEA 2D7HA 2R45A 1QAOA 2XF3A 1VEKA 4IBGA 3UK6A 5C18A 4DUYM 1MU5A 1XWIA 3W0LB 3U5ZA 1F4IA 2JZ0A 3L29A 4LF8M 2KRKA 2LVAA 4LCBA 3AOEC 1WIVA 2XGNA 4REZA 3T1HM 3B89A 2UUCM 4DR4M 3HY5A 1IY2A 5EXSA 4X66M 3J2PB 3A45A 1E32A 3Q8GA 3QYEA 2L2DA 2QPAA 3PNYA 3CF6E 1NNJA 2Y0QA 3NBIA 3GRYA 1VEGA 3VLFB 4B3MM 1E9RA 5ITXA 1HT1E 4LZJA 4BLCA 4ITQA 4QNMA 2O25A 1R2ZA 4LFCM 4KO8A 2DZNB 4NSRA 3OTOM 3TWLA 4IIWA 3GLGB 3E21A 2I7NA 1IXSA 4LRTA 2KZSA 1R5LA 2DNAA 4GC9A 2KRUA 3AFHA 3GLHB 3AOGA 2JY8A 3FD9A 1QUSA 3UGJA 4FD2A 3BOSA 3U60A 2C5RA 2AHMA 2EJSA 4DR3M 2X8AA 2EUCA 5KQ8A 3FTFA 4G4OA 5IT9S 3SYKA 3K8ZA 3RFWA 5KQDA 2J5YA 1V92A 2KNAA 3PNVA 2KZUA 2RGOA 3AV0A 4CHTB 4OX9M 4GEWA 2FNAA 1JQJC 3JR5A 3C3EA 1IN8A 1NVMA 1QZEA 4PT5A 1GO5A 3HHZA 1GL7A 2CUZA 2C96A 1IBLM 4L6V6 1WGNA 2JY7A 4LF5M 3B7NA 5EP2A 3IG8A 1GJTA 3SMPA 2VQFM 3U61B 1GL6A 5KPZA 2KW0A 2JA2A 2X49A 3SATA 4P17A 1EIJA 4P16A 3GRUA 3KP1E 4IBKA 3DA1A 3QWLA 4X64M 4PCZA 2DENA 3HX3A 1PJSA 5EQTA 1HJPA 3AOEA 3D8BA 4HL4A 5FSWA 3RGPA 2XZFA 1IN5A 2BNKA 1VDLA 2LVPC 4BBAA 4FCTA 2KXEA 3QYBA 1OTRA 4LF4M 5E6JA 3L2AA 2K0BX 1VDDA 3GLIE 3HZJA 3E9SA 4DV1M 4JI4M 4GKKM 2F5PA 3TPZA 1K3WA 2R18A 2QNJA 2R65A 1HQCA 3LVVA 2LTUA 4LFAM 3GLFE 1G41A 3U6LA 3CGWA 2HAKA 2CHGA 2JZ1A 3KSJA 1OJLA 3FTEA 1N33M 1TGUA 2V6ZM 4FW9A 1CUKA 4DUZM 2F5OA 1NV8A 1NY5A 2MGWA 2EKFA 1XXHA 3LW5F 2HL7A 4B7HA 2KNZA 2BJWA 1NNUC 5KPTA 4AKHA 2C98A 3R8FA 1XXHE 1KYIA 3DZDA 4GIPA 4JI0M 2LVQD 2G5GX 2HKJA 2DAKA 3SYLA 4X62M 1D2NA 3GRRA 1FNNA 1GLNA 4BB9A 1XC8A 2QZ4A 4I8OA 4JI7M 2XEPA 2UXBM 1BVSA 2DZLA 4MB7A 3W68A 2JY6B 4I81A 4NXMM 3K9OA 1DGGA 3HU3A 3I51A 1HT2E 4WW0A 4DR2M 1GABA 2EKKA 2XSZA 1Q3CA 1JR3E 1LTMA 4I5SA 2L7IA 1WJ7A 2LBCA 2JNHA 4MGIE 5IZ7D 2P5TA 2ZAOA 3DFZA 5ITTA 3U6SA 2CWBA 4JI3M 3K9PA 1DGHA 1K3XA 4FVMA 4JI1M 3L27A 2JUJA 3GLIB 4JYAM 3CTWB 4ANRA 3FUUA 1WXQA 4IBJA 3SC3A 3T1YM 1IM2A 3MHVC 2JWSA 3SFZA 3TWKA 2CV0A 4JXJA 4B7FA 4LGMA 1WHCA 3GO8A 3A42A 4QOZC 1QAMA 1I4WA 1N77A 1XHBA 2L7HA 2Z4RA 3NWLA 1QVRA 1DO0A 1OKSA 2GNOA 1KFVA 3U6DA 3W67A 3U6QA 3KSXA 5ITXE 3GPXA 2G8LA 2YFQA 3HHYA 1DGFA 2YNMD 3GPPA 2JP7A 1NO1A 2OOAA 4XGIA 3LCUA 4AG6A 3MK6A 2F5SA 2W82A 2Z4SA 1WR1B 2OPFA 3JAMS 3VKHA 2BJVA 1IQPA 2JY5A 2O5RA 3ILKA 5FTJA 1QZMA 3KOWE 2JXNA 4QNRA 2DWLA 2FS1A 3FE3A 5FTNA 5EP3A 2DAIA 7CATA 3KOZE 2UXCM 4R3DA 3KS8A 1SG9A 2ZAMA 3E4RA 2LHGA 1DGBA 4IJFA 4GHAA 1X37A 2Z8YM 4L78A 5LMUM 2M60A 1L2DA 5EXXA 2Z3XA 2L6OA 4IBCA 2YQZA 2DAEA 1OIZA 2QCUA 1L2CA 4YHHM 4MGYE 4FCVA 3V76A 5EP1A 2DHRA 4GH9A 2BWBA 2CV1A 4CJ6A 4DR7M 2XSZD 4AKIA 2V1CA 1IFYA 1Q39A 4OVZA 1C1KA 1NHWC 1T3TA 4FWGA 1WGLA 4IBIA 4IBDA 3GLGA 5FTKA 4D80A 5BR8M 3GRVA 4DV5M 1IXSB 1V34A 4G4RA 3VFDA 4FCWA 5FTLA 3GLHA 1RU3A 4AQYM 3HU2A 4NL4H 3SASA 3TWMA 3AL0C 4LF7M 4ZPXA 2CRUA 2K47A 3LQQA 4L16A 4MGKE 4CIZA 1SXJC 2O01F 1PJIA 2YR0A 2RGHA 3GLFA 2K6BA 3C58A 4LF9M 4II7A 4Z8XA 1IN6A 5A2QS 2Y0TA 3B7QA 3VDUA 4XK8F 3AKZA 4KHPM 3FYCA 1R6BX 2C9CA 5JI3E 1EFUB 4F2LA 2ZBKB 4KT0F 1Z6TA 1YUBA 1VG5A 3FTCA 4EIWA 1JB0F 1LV7A 2WSEF 1PM5A 1GJSA 3L26A 2QBYB 3B7ZA 1R7RA 3C3DA 4DR6M 1QDTA 2QBYA 4F1IA 3HWSA 3K1JA 3VK7A 2CHQA 4LG2A 4W5WA 4RNAA 4DV0M 3BBZA 4MGHA 2F4VM 4MGZE 1TTEA 2H5XA 3I04M 5L8RF 3VKGA 3K92A 3IHPA 4NOOB 2LVOC 2UXDM 2OOBA 4X65M 1N34M 1QDRA 1G59A 2N35A 2DAMA 1TDHA 1D0MA 2QP9X 4QOSA 1A5TA 5ITQA 1SXJA 2KEBA 1OIPA 1ZMVA 2WSFF 5EP4A 1IN4A 1D0LA 4KODA 4DBGB 1SXJE 3FYDA 3H4JA 4PDIA 2F5QA 2EO2A 3RE8A 4DR1M 3J7AS 1G8PA 1N36M 3LCVB 3SHFA 1HR0M 2APLA 2DWZB 2H1RA 3L28A 1OFHA 2QENA 1W5SA 5DFLA 1PJTA 4JI2M 4M0DA 3VDPA 3WHLA 1DGHB 2K9DA 3M6AA 1VQ1A 1TDZA 1FJGM 4LRSA 3MMPA 3LQRA 5E26A 3GQ4A 1G4AE 3T38A 1JR3A 3FRHA 3J81S 3GLHE 4LY6A 1IY0A 1OAIA 1C7YA 2R4EA 3FTDA 3M7GA 4GITA 2KA6B 3D8LA 4JN6A 4OW0A 4TUWA 4DV4M 4DV3M 1QYRA 2WZJA 5DYGA 3VK8A 1G71A 3HHXA 3SBJA 1NV9A 3FUWA 2DWMA 4LJ8A 3ZQJA 3IG5A 4K0KM 4Y28F 3DOAA 4IBEA 4Z6YA 3U61A 1Z5CA 4R71A 3GPUA 3U6EA 1IBMM 3SMSA 5ITUA 1Z5AA 2XH9A 2XZUA 2QSFX 2NQ8C 3HU1A 2CE7A 1IY1A 1PJQA 2B3TA 2FOIC 4LJ9A 3J7BA 1IN7A 4R7GA 3GQ3A 1OFIA 3I4YA 1OAOC 1N78A 1ZMWA 3GLGE 3U60B 4IJEA 1T6OA 2LVNC 3SHGB 1TH4A 5EXTA 2QHOB 1PRBA 4NRVA 1NSFA 2KDLA 2Y20A 2J7OA 1GKIA 1ORYB 1Z59A 1MN3A 4DV7M 3TQSA 5KO3A 4GRIA 3PXGA 3THGA 2FH0A 2L4EA 3AJIB 3NBXX 3LMMA 5KPRA 2HCBA 2XFSA 3KVWA 5EXPA 3UJNA 4M9ZA 3A46A 1J5EM 2LWXA 4M9SA 1L1TA 1J7KA 4Q7JA 4XBOA 2UU9M 3W0FA 3K2LA 4AW4A 4QHSA 1DO2A 3KW6A 1AIPC 2DZOB 4IBBA 3L25A 2VF7A 5GKNA 5ITRA 4G4QA 1QQWA 5JI2E 2FFJA 2CFOA 2DWNA 1H6UA 4LJ5A 4DV6M 1IBKM 5IREB 1XB2B 3C9PA 3I4VA 3FKEA 3U6CA 3M0EA 3KOYE 2L09A 4L8RC 3GLIA 2MJ5B 1L8QA 1T43A 3HGIA 8CATA 3U5ZB 2LNHC 4CGYB 1W5TA 2C99A 4LJAA 2R46A 2OO9A 5ITYA 2A5YB 3GPYA 2OQ4A 4DR5M 3A98B 1IXZA 1KSFX 2DHYA 2UUBM 4CISA 2LHCA 5IWAM 3E46A 1TR8A 4S12A 1XMQM 4NC6A 3IECA 4RKUF 2ZANA 4OVZB 2DVWB 4QHTA 1G3IA 5DYIA 1L1ZA 2F5NA 4LJ4A 2ERCA 4GKJM 3ZC7B 3QAUA 4M0WA 2ZTDA 3U6MA 1HNZM 4D81A 2CP8A 3PFIA 2L4FA 1L2BA 2DAGA 2LXEA 4DV2M 1MX0A 2C9OA 3HJQA 4I4LA 3FRIA 1SXJB 3T15A 3WHKA 2VF8A 4RF1A 3SAUA 3TL4X 4G4NA 4L15A 3TE6A 4KLNA 4A3VB 4LFBM 1UFZA 4FWHA 2EA0A 3H4MA 1HQYE 2R4JA 1I94M 2UUAM 3GQ5A 1OQYA 2MR9A 3HJSA 3J27B 2XLJA 5LMNM 1XMOM 2DI0A 1XXHB 2R62A 2X4AA 2J7NA 2RRUA 3FUTA 3KXEC 1NY6A 4AZFA 3KDSE 4JV5M 1Q02A 3MJ5A 4JI8M 1Y8GA 4JI5M 1YSYA
chains in the Genus database with same CATH topology
3UZUA 1UM8A 2Q2EB 2LH0A 3KP0E 2I7PA 1YE9A 3HKPA 5FTMA 4RF0A 4IBFA 3U6PA 1JR3D 4LJ7A 4D82A 4PD2A 3U6OA 1R2YA 1NJGA 3CF2A 3GP1A 2DXIA 1TH2A 1Q3BA 2VIIA 1NJFA 4AG5A 5H37D 2CV2A 4B7GA 4B3RM 1E9SA 1PJJA 3HJ8A 2HHHM 4LZZA 3CF0A 5FLXS 4M9XA 4GHLA 1S3SA 1Z5BA 3Q8XA 4AKGA 4GMQA 2VQEM 4G6ZA 3JR4A 1E94E 4NRWA 4WURA 4NSOB 4AI6A 1IXRC 5BPVA 1SXJD 1N32M 3J80S 3SARA 3PVSA 3R9XB 3EIHA 1K82A 4LGYA 4GC5A 3B9PA 3RGSA 5F3WA 4MH0E 1ZQ9A 2CEAA 2RKOA 2D7EA 1J09A 4HLQA 4MM3B 2D7GA 5C1BA 4LJ6A 2CHVA 2M5ZA 3EIEA 3GLFB 2XFTA 4B3SM 1N75A 1HNXM 4B3TM 3KFUG 3LVWA 1EE8A 3KOXE 1XNRM 4OU7A 4FWDA 3FUXA 3ZCBB 3ZH9B 4L4UA 3SAWA 3KS4A 3SAVA 1XNQM 2ZM6M 2Y21A 5DNYA 2E5LM 5EJCA 2V1UA 1QAQA 1HNWM 3HHWA 3UMMA 4NXNM 1TH3A 4YY3M 1QANA 4LF6M 1GVNA 4PDGA 3FUVA 4B08A 4JI6M 2FE8A 2Z7JA 1NHGC 1ZAEA 2D7HA 2R45A 1QAOA 2XF3A 4IBGA 3UK6A 5C18A 2QBYA 4DUYM 1MU5A 1XWIA 3W0LB 3U5ZA 3L29A 4LF8M 2KRKA 4LCBA 4REZA 3AOEC 2XGNA 3T1HM 2UUCM 4DR4M 1IY2A 5EXSA 4X66M 3J2PB 3A45A 1E32A 2QPAA 3PNYA 3CF6E 1NNJA 2Y0QA 3NBIA 3GRYA 3VLFB 4B3MM 1E9RA 5ITXA 1HT1E 4LZJA 4BLCA 4ITQA 4QNMA 1R2ZA 4LFCM 4KO8A 2DZNB 4NSRA 3OTOM 3TWLA 4IIWA 3GLGB 2I7NA 4LRTA 2KZSA 4GC9A 2KRUA 3AFHA 3GLHB 3AOGA 3FD9A 3UGJA 4FD2A 3BOSA 3U60A 2C5RA 2AHMA 4DR3M 2X8AA 2EUCA 5KQ8A 3FTFA 4G4OA 5IT9S 3SYKA 3K8ZA 3RFWA 5KQDA 3PNVA 2KZUA 2RGOA 3AV0A 4CHTB 4OX9M 2FNAA 1JQJC 3JR5A 1IN8A 1NVMA 4PT5A 3HHZA 1GL7A 2CUZA 2C96A 1IBLM 4LF5M 5EP2A 3IG8A 2VQFM 3SMPA 3U61B 1GL6A 5KPZA 2KW0A 2JA2A 2X49A 3SATA 4P16A 3GRUA 3KP1E 4IBKA 3DA1A 3QWLA 4X64M 4PCZA 5EQTA 3AOEA 3D8BA 4HL4A 5FSWA 3RGPA 2XZFA 1IN5A 2BNKA 4BBAA 4FCTA 2KXEA 4LF4M 5E6JA 3L2AA 1VDDA 3E9SA 4DV1M 4JI4M 4GKKM 2F5PA 3TPZA 1K3WA 2R18A 2R65A 1HQCA 3LVVA 4LFAM 1G41A 3U6LA 2CHGA 3KSJA 1OJLA 3FTEA 1N33M 1TGUA 2V6ZM 4FW9A 4DUZM 2F5OA 1NY5A 1XXHA 2HL7A 4B7HA 5KPTA 2BJWA 1NNUC 4AKHA 2C98A 3R8FA 1KYIA 3DZDA 4GIPA 4JI0M 2G5GX 2HKJA 3SYLA 4X62M 1D2NA 3GRRA 1FNNA 1GLNA 4BB9A 1XC8A 2QZ4A 4I8OA 4JI7M 2XEPA 2UXBM 4MB7A 4NXMM 4I81A 1DGGA 3HU3A 3I51A 1HT2E 4WW0A 4DR2M 2XSZA 1Q3CA 4I5SA 2L7IA 4MGIE 5IZ7D 2P5TA 2ZAOA 3DFZA 5ITTA 3U6SA 4JI3M 1DGHA 1K3XA 4FVMA 4JI1M 3L27A 4JYAM 3GLIB 3CTWB 3FUUA 1WXQA 4IBJA 3SC3A 3T1YM 1IM2A 3MHVC 3SFZA 3TWKA 2CV0A 4QOZC 4JXJA 4B7FA 4LGMA 3GO8A 3A42A 1QAMA 1I4WA 1N77A 1XHBA 2L7HA 2Z4RA 3NWLA 1QVRA 1DO0A 1KFVA 3U6DA 3U6QA 3KSXA 5ITXE 3GPXA 2G8LA 2YFQA 3HHYA 1DGFA 2YNMD 3GPPA 4AG6A 4XGIA 3MK6A 2F5SA 2W82A 2Z4SA 2OPFA 3VKHA 3JAMS 2BJVA 1IQPA 3ILKA 2O5RA 5FTJA 1QZMA 3KOWE 4QNRA 2DWLA 5FTNA 5EP3A 7CATA 3KOZE 2UXCM 4R3DA 3KS8A 2ZAMA 3E4RA 1DGBA 4IJFA 4GHAA 1X37A 4L78A 5LMUM 2M60A 1L2DA 5EXXA 2Z3XA 2L6OA 4IBCA 2YQZA 1L2CA 2QCUA 4YHHM 4MGYE 4FCVA 5EP1A 2DHRA 4GH9A 2CV1A 4DR7M 2XSZD 4AKIA 2V1CA 1Q39A 4OVZA 1C1KA 1NHWC 1T3TA 4FWGA 4IBIA 4IBDA 3GLGA 5FTKA 4D80A 5BR8M 3GRVA 4DV5M 1IXSB 4G4RA 3VFDA 4FCWA 5FTLA 3GLHA 4AQYM 3HU2A 4NL4H 3SASA 3TWMA 3AL0C 4LF7M 4ZPXA 2K47A 3LQQA 4L16A 4MGKE 1SXJC 1PJIA 2YR0A 2RGHA 3GLFA 3C58A 4LF9M 4II7A 4Z8XA 1IN6A 5A2QS 2Y0TA 3VDUA 3AKZA 4KHPM 3FYCA 1R6BX 2C9CA 5JI3E 2ZBKB 1Z6TA 1YUBA 3FTCA 4EIWA 1LV7A 1PM5A 3L26A 2QBYB 1R7RA 4DR6M 3HWSA 3K1JA 3VK7A 2CHQA 4LG2A 4W5WA 4RNAA 4DV0M 4MGHA 2F4VM 4MGZE 3VKGA 3K92A 4NOOB 2UXDM 4X65M 1N34M 1G59A 1TDHA 2QP9X 4QOSA 5ITQA 1SXJA 2KEBA 5EP4A 1IN4A 4KODA 4PDIA 1SXJE 3FYDA 2F5QA 2EO2A 3RE8A 4DR1M 3J7AS 1G8PA 1N36M 3SHFA 1HR0M 2DWZB 2H1RA 3L28A 1OFHA 2QENA 1W5SA 4JI2M 4M0DA 3VDPA 3WHLA 1DGHB 1TDZA 3M6AA 1FJGM 4LRSA 3LQRA 5E26A 3GQ4A 1G4AE 3T38A 1JR3A 3J81S 4LY6A 1IY0A 2R4EA 3FTDA 3M7GA 4GITA 2KA6B 3D8LA 4JN6A 4OW0A 4TUWA 4DV4M 4DV3M 1QYRA 5DYGA 3VK8A 3HHXA 3SBJA 3FUWA 2DWMA 4LJ8A 3IG5A 4K0KM 3DOAA 4IBEA 4Z6YA 3U61A 1Z5CA 3GPUA 3U6EA 1IBMM 3SMSA 5ITUA 1Z5AA 2XH9A 2XZUA 2NQ8C 3HU1A 2CE7A 1IY1A 2FOIC 4LJ9A 3J7BA 1IN7A 4R7GA 3GQ3A 1OFIA 3I4YA 1N78A 3U60B 4IJEA 3SHGB 1TH4A 5EXTA 4NRVA 1NSFA 2Y20A 2J7OA 1GKIA 1ORYB 1Z59A 4DV7M 3TQSA 5KO3A 4GRIA 3PXGA 3THGA 3AJIB 5KPRA 3LMMA 2HCBA 2XFSA 3KVWA 5EXPA 3UJNA 4M9ZA 3A46A 1J5EM 2LWXA 4M9SA 1L1TA 1J7KA 2UU9M 4XBOA 3W0FA 3K2LA 4AW4A 4QHSA 1DO2A 3KW6A 4IBBA 2DZOB 3L25A 5GKNA 5ITRA 4G4QA 1QQWA 5JI2E 2FFJA 2CFOA 2DWNA 1H6UA 4LJ5A 4DV6M 1IBKM 5IREB 3I4VA 3FKEA 3U6CA 3M0EA 3KOYE 2L09A 4L8RC 3GLIA 1L8QA 3HGIA 8CATA 3U5ZB 2LNHC 4CGYB 1W5TA 2C99A 4LJAA 2R46A 5ITYA 2A5YB 3GPYA 2OQ4A 4DR5M 3A98B 1IXZA 1KSFX 2UUBM 4CISA 5IWAM 4S12A 1XMQM 2ZANA 4OVZB 2DVWB 4QHTA 1G3IA 5DYIA 1L1ZA 2F5NA 4LJ4A 2ERCA 4GKJM 3ZC7B 3QAUA 4M0WA 3U6MA 1HNZM 4D81A 3PFIA 1L2BA 2LXEA 4DV2M 1MX0A 2C9OA 3HJQA 4I4LA 3T15A 1SXJB 3WHKA 4RF1A 3SAUA 3TL4X 4G4NA 4L15A 3TE6A 4KLNA 4A3VB 4LFBM 1I94M 4FWHA 2EA0A 3H4MA 1HQYE 2R4JA 2UUAM 3GQ5A 3HJSA 3J27B 2XLJA 5LMNM 1XMOM 1XXHB 2R62A 2X4AA 2J7NA 3FUTA 4AZFA 3KXEC 1NY6A 3KDSE 4JV5M 3MJ5A 4JI8M 4JI5M 1YSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 S;  4G4O A;  2Q2E B;  5IT9 S;  1KFV A;  3U6D A;  3U6Q A;  5ITX E;  3GPX A;  3GPP A;  3U6P A;  4OX9 M;  4DV4 M;  4DV3 M;  2F5S A;  4PD2 A;  2OPF A;  3U6O A;  3JAM S;  1R2Y A;  3GP1 A;  3VK8 A;  3JR5 A;  3SBJ A;  1Q3B A;  4K0K M;  1IBL M;  3DOA A;  2UXC M;  1Z5C A;  4B3R M;  1PJJ A;  3GPU A;  4LF5 M;  2VQF M;  3U6E A;  2HHH M;  1IBM M;  5LMU M;  5ITU A;  5FLX S;  1Z5A A;  1L2D A;  3SAT A;  2XZU A;  1L2C A;  4YHH M;  1Z5B A;  4X64 M;  2VQE M;  4PCZ A;  3JR4 A;  4NRW A;  3GQ3 A;  4DR7 M;  1Q39 A;  2XZF A;  1N32 M;  3J80 S;  3SAR A;  1K82 A;  4DV5 M;  5BR8 M;  4NRV A;  4JI5 M;  4G4R A;  1Z59 A;  4DV7 M;  4LF4 M;  4AQY M;  3SAS A;  3TWM A;  1J5E M;  4LF7 M;  3A46 A;  1L1T A;  4DV1 M;  2UU9 M;  4JI4 M;  2F5P A;  4GKK M;  4B3S M;  3W0F A;  1K3W A;  1HNX M;  4B3T M;  1EE8 A;  1PJI A;  1XNR M;  3C58 A;  4LF9 M;  5A2Q S;  3SAW A;  4LFA M;  3SAV A;  1XNQ M;  5ITR A;  3U6L A;  4G4Q A;  4KHP M;  2ZM6 M;  4DV6 M;  1IBK M;  2E5L M;  2ZBK B;  1HNW M;  1N33 M;  3U6C A;  4DUZ M;  2F5O A;  4NXN M;  4YY3 M;  1PM5 A;  4DR3 M;  4LF6 M;  4PDG A;  4DR6 M;  4JI6 M;  4JI0 M;  3VK7 A;  5ITY A;  2HKJ A;  4DUY M;  3GPY A;  1MU5 A;  2OQ4 A;  4X62 M;  4DR5 M;  2UUB M;  4CIS A;  2F4V M;  4DV0 M;  5IWA M;  1XC8 A;  4LF8 M;  1XMQ M;  3T1H M;  2UUC M;  4DR4 M;  2UXD M;  4X65 M;  1N34 M;  4JI7 M;  1L1Z A;  2F5N A;  2UXB M;  4X66 M;  4GKJ M;  3A45 A;  1TDH A;  4MB7 A;  4NXM M;  5ITQ A;  3U6M A;  1HNZ M;  4DR2 M;  1NNJ A;  1Q3C A;  1L2B A;  4PDI A;  4DV2 M;  2F5Q A;  1MX0 A;  4DR1 M;  4B3M M;  5ITX A;  4ITQ A;  3J7A S;  3SAU A;  4G4N A;  1N36 M;  1R2Z A;  1HR0 M;  4LFC M;  5ITT A;  3OTO M;  3TWL A;  3U6S A;  2EA0 A;  1I94 M;  4JI3 M;  2UUA M;  4LFB M;  3GQ5 A;  3A42 A;  1K3X A;  5LMN M;  4JI1 M;  4JI2 M;  1XMO M;  4JYA M;  3T1Y M;  4JV5 M;  1TDZ A;  3TWK A;  4JI8 M;  1FJG M;  3GO8 A;  3GQ4 A; 
#chains in the Genus database with same CATH topology
 3UZU A;  1UM8 A;  2R6F A;  2Q2E B;  2LH0 A;  3KP0 E;  2I7P A;  1YE9 A;  3HKP A;  5FTM A;  4WP2 A;  4RF0 A;  4IBF A;  3U6P A;  1JR3 D;  4LJ7 A;  4D82 A;  4PD2 A;  3U6O A;  1R2Y A;  1NJG A;  3CF2 A;  3GP1 A;  2DXI A;  1TH2 A;  1Q3B A;  2VII A;  1NJF A;  4AG5 A;  2KNV A;  1AUA A;  5H37 D;  3I01 M;  1PGY A;  2CV2 A;  4B7G A;  4B3R M;  1E9S A;  1PJJ A;  4HEO A;  2G3Q A;  3HJ8 A;  2HHH M;  4LZZ A;  3CF0 A;  5FLX S;  4M9X A;  4GHL A;  1S3S A;  2MRO B;  1Z5B A;  1P3Q Q;  1VEJ A;  3Q8X A;  4GMQ A;  4G6Z A;  3JR4 A;  1E94 E;  2VQE M;  4NRW A;  4AKG A;  1YLA A;  4NSO B;  4WUR A;  4AI6 A;  1IXR C;  5BPV A;  1SXJ D;  1N32 M;  3J80 S;  3SAR A;  2R0I A;  3PVS A;  3R9X B;  3EIH A;  1K82 A;  4LGY A;  4GC5 A;  3B9P A;  3RGS A;  5F3W A;  1R4G A;  4MH0 E;  1ZQ9 A;  3BXW A;  2CEA A;  2DKL A;  2RKO A;  2D7E A;  2R44 A;  1J09 A;  4HLQ A;  4MM3 B;  2D7G A;  2VDB B;  5C1B A;  4LJ6 A;  2CHV A;  2M5Z A;  2WSC F;  3EIE A;  1ZMU A;  3GLF B;  2XFT A;  4B3S M;  1N75 A;  1HNX M;  4B3T M;  3KFU G;  3F92 A;  3LVW A;  1EE8 A;  3KOX E;  1XNR M;  4OU7 A;  4FWD A;  3FUX A;  3ZCB B;  3ZH9 B;  4L4U A;  3SAW A;  3KS4 A;  3SAV A;  2QQ8 A;  1XNQ M;  1TF0 B;  2ZM6 M;  2HWJ A;  1V33 A;  2Y21 A;  3T6P A;  2ZTC A;  5DNY A;  2E5L M;  1MJG M;  2BWE A;  1QAQ A;  5EJC A;  2V1U A;  1HNW M;  3HHW A;  3UMM A;  1QUT A;  4UN2 B;  1D0K A;  3B74 A;  1ZV1 A;  2KHH A;  4NXN M;  1TH3 A;  4YY3 M;  2GQF A;  4G3O A;  1QAN A;  4LF6 M;  1GVN A;  4PDG A;  3FUV A;  2MH8 A;  1DV0 A;  4B08 A;  4JI6 M;  2FE8 A;  2Z7J A;  1NHG C;  1ZAE A;  2D7H A;  2R45 A;  1QAO A;  2XF3 A;  1VEK A;  4IBG A;  3UK6 A;  5C18 A;  4DUY M;  1MU5 A;  1XWI A;  3W0L B;  3U5Z A;  1F4I A;  2JZ0 A;  3L29 A;  4LF8 M;  2KRK A;  2LVA A;  4LCB A;  3AOE C;  1WIV A;  2XGN A;  4REZ A;  3T1H M;  3B89 A;  2UUC M;  4DR4 M;  3HY5 A;  1IY2 A;  5EXS A;  4X66 M;  3J2P B;  3A45 A;  1E32 A;  3Q8G A;  3QYE A;  2L2D A;  2QPA A;  3PNY A;  3CF6 E;  1NNJ A;  2Y0Q A;  3NBI A;  3GRY A;  1VEG A;  3VLF B;  4B3M M;  1E9R A;  5ITX A;  1HT1 E;  4LZJ A;  4BLC A;  4ITQ A;  4QNM A;  2O25 A;  1R2Z A;  4LFC M;  4KO8 A;  2DZN B;  4NSR A;  3OTO M;  3TWL A;  4IIW A;  3GLG B;  3E21 A;  2I7N A;  1IXS A;  4LRT A;  2KZS A;  1R5L A;  2DNA A;  4GC9 A;  2KRU A;  3AFH A;  3GLH B;  3AOG A;  2JY8 A;  3FD9 A;  1QUS A;  3UGJ A;  4FD2 A;  3BOS A;  3U60 A;  2C5R A;  2AHM A;  2EJS A;  4DR3 M;  2X8A A;  2EUC A;  5KQ8 A;  3FTF A;  4G4O A;  5IT9 S;  3SYK A;  3K8Z A;  3RFW A;  5KQD A;  2J5Y A;  1V92 A;  2KNA A;  3PNV A;  2KZU A;  2RGO A;  3AV0 A;  4CHT B;  4OX9 M;  4GEW A;  2FNA A;  1JQJ C;  3JR5 A;  3C3E A;  1IN8 A;  1NVM A;  1QZE A;  4PT5 A;  1GO5 A;  3HHZ A;  1GL7 A;  2CUZ A;  2C96 A;  1IBL M;  4L6V 6;  1WGN A;  2JY7 A;  4LF5 M;  3B7N A;  5EP2 A;  3IG8 A;  1GJT A;  3SMP A;  2VQF M;  3U61 B;  1GL6 A;  5KPZ A;  2KW0 A;  2JA2 A;  2X49 A;  3SAT A;  4P17 A;  1EIJ A;  4P16 A;  3GRU A;  3KP1 E;  4IBK A;  3DA1 A;  3QWL A;  4X64 M;  4PCZ A;  2DEN A;  3HX3 A;  1PJS A;  5EQT A;  1HJP A;  3AOE A;  3D8B A;  4HL4 A;  5FSW A;  3RGP A;  2XZF A;  1IN5 A;  2BNK A;  1VDL A;  2LVP C;  4BBA A;  4FCT A;  2KXE A;  3QYB A;  1OTR A;  4LF4 M;  5E6J A;  3L2A A;  2K0B X;  1VDD A;  3GLI E;  3HZJ A;  3E9S A;  4DV1 M;  4JI4 M;  4GKK M;  2F5P A;  3TPZ A;  1K3W A;  2R18 A;  2QNJ A;  2R65 A;  1HQC A;  3LVV A;  2LTU A;  4LFA M;  3GLF E;  1G41 A;  3U6L A;  3CGW A;  2HAK A;  2CHG A;  2JZ1 A;  3KSJ A;  1OJL A;  3FTE A;  1N33 M;  1TGU A;  2V6Z M;  4FW9 A;  1CUK A;  4DUZ M;  2F5O A;  1NV8 A;  1NY5 A;  2MGW A;  2EKF A;  1XXH A;  3LW5 F;  2HL7 A;  4B7H A;  2KNZ A;  2BJW A;  1NNU C;  5KPT A;  4AKH A;  2C98 A;  3R8F A;  1XXH E;  1KYI A;  3DZD A;  4GIP A;  4JI0 M;  2LVQ D;  2G5G X;  2HKJ A;  2DAK A;  3SYL A;  4X62 M;  1D2N A;  3GRR A;  1FNN A;  1GLN A;  4BB9 A;  1XC8 A;  2QZ4 A;  4I8O A;  4JI7 M;  2XEP A;  2UXB M;  1BVS A;  2DZL A;  4MB7 A;  3W68 A;  2JY6 B;  4I81 A;  4NXM M;  3K9O A;  1DGG A;  3HU3 A;  3I51 A;  1HT2 E;  4WW0 A;  4DR2 M;  1GAB A;  2EKK A;  2XSZ A;  1Q3C A;  1JR3 E;  1LTM A;  4I5S A;  2L7I A;  1WJ7 A;  2LBC A;  2JNH A;  4MGI E;  5IZ7 D;  2P5T A;  2ZAO A;  3DFZ A;  5ITT A;  3U6S A;  2CWB A;  4JI3 M;  3K9P A;  1DGH A;  1K3X A;  4FVM A;  4JI1 M;  3L27 A;  2JUJ A;  3GLI B;  4JYA M;  3CTW B;  4ANR A;  3FUU A;  1WXQ A;  4IBJ A;  3SC3 A;  3T1Y M;  1IM2 A;  3MHV C;  2JWS A;  3SFZ A;  3TWK A;  2CV0 A;  4JXJ A;  4B7F A;  4LGM A;  1WHC A;  3GO8 A;  3A42 A;  4QOZ C;  1QAM A;  1I4W A;  1N77 A;  1XHB A;  2L7H A;  2Z4R A;  3NWL A;  1QVR A;  1DO0 A;  1OKS A;  2GNO A;  1KFV A;  3U6D A;  3W67 A;  3U6Q A;  3KSX A;  5ITX E;  3GPX A;  2G8L A;  2YFQ A;  3HHY A;  1DGF A;  2YNM D;  3GPP A;  2JP7 A;  1NO1 A;  2OOA A;  4XGI A;  3LCU A;  4AG6 A;  3MK6 A;  2F5S A;  2W82 A;  2Z4S A;  1WR1 B;  2OPF A;  3JAM S;  3VKH A;  2BJV A;  1IQP A;  2JY5 A;  2O5R A;  3ILK A;  5FTJ A;  1QZM A;  3KOW E;  2JXN A;  4QNR A;  2DWL A;  2FS1 A;  3FE3 A;  5FTN A;  5EP3 A;  2DAI A;  7CAT A;  3KOZ E;  2UXC M;  4R3D A;  3KS8 A;  1SG9 A;  2ZAM A;  3E4R A;  2LHG A;  1DGB A;  4IJF A;  4GHA A;  1X37 A;  2Z8Y M;  4L78 A;  5LMU M;  2M60 A;  1L2D A;  5EXX A;  2Z3X A;  2L6O A;  4IBC A;  2YQZ A;  2DAE A;  1OIZ A;  2QCU A;  1L2C A;  4YHH M;  4MGY E;  4FCV A;  3V76 A;  5EP1 A;  2DHR A;  4GH9 A;  2BWB A;  2CV1 A;  4CJ6 A;  4DR7 M;  2XSZ D;  4AKI A;  2V1C A;  1IFY A;  1Q39 A;  4OVZ A;  1C1K A;  1NHW C;  1T3T A;  4FWG A;  1WGL A;  4IBI A;  4IBD A;  3GLG A;  5FTK A;  4D80 A;  5BR8 M;  3GRV A;  4DV5 M;  1IXS B;  1V34 A;  4G4R A;  3VFD A;  4FCW A;  5FTL A;  3GLH A;  1RU3 A;  4AQY M;  3HU2 A;  4NL4 H;  3SAS A;  3TWM A;  3AL0 C;  4LF7 M;  4ZPX A;  2CRU A;  2K47 A;  3LQQ A;  4L16 A;  4MGK E;  4CIZ A;  1SXJ C;  2O01 F;  1PJI A;  2YR0 A;  2RGH A;  3GLF A;  2K6B A;  3C58 A;  4LF9 M;  4II7 A;  4Z8X A;  1IN6 A;  5A2Q S;  2Y0T A;  3B7Q A;  3VDU A;  4XK8 F;  3AKZ A;  4KHP M;  3FYC A;  1R6B X;  2C9C A;  5JI3 E;  1EFU B;  4F2L A;  2ZBK B;  4KT0 F;  1Z6T A;  1YUB A;  1VG5 A;  3FTC A;  4EIW A;  1JB0 F;  1LV7 A;  2WSE F;  1PM5 A;  1GJS A;  3L26 A;  2QBY B;  3B7Z A;  1R7R A;  3C3D A;  4DR6 M;  1QDT A;  2QBY A;  4F1I A;  3HWS A;  3K1J A;  3VK7 A;  2CHQ A;  4LG2 A;  4W5W A;  4RNA A;  4DV0 M;  3BBZ A;  4MGH A;  2F4V M;  4MGZ E;  1TTE A;  2H5X A;  3I04 M;  5L8R F;  3VKG A;  3K92 A;  3IHP A;  4NOO B;  2LVO C;  2UXD M;  2OOB A;  4X65 M;  1N34 M;  1QDR A;  1G59 A;  2N35 A;  2DAM A;  1TDH A;  1D0M A;  2QP9 X;  4QOS A;  1A5T A;  5ITQ A;  1SXJ A;  2KEB A;  1OIP A;  1ZMV A;  2WSF F;  5EP4 A;  1IN4 A;  1D0L A;  4KOD A;  4DBG B;  1SXJ E;  3FYD A;  3H4J A;  4PDI A;  2F5Q A;  2EO2 A;  3RE8 A;  4DR1 M;  3J7A S;  1G8P A;  1N36 M;  3LCV B;  3SHF A;  1HR0 M;  2APL A;  2DWZ B;  2H1R A;  3L28 A;  1OFH A;  2QEN A;  1W5S A;  5DFL A;  1PJT A;  4JI2 M;  4M0D A;  3VDP A;  3WHL A;  1DGH B;  2K9D A;  3M6A A;  1VQ1 A;  1TDZ A;  1FJG M;  4LRS A;  3MMP A;  3LQR A;  5E26 A;  3GQ4 A;  1G4A E;  3T38 A;  1JR3 A;  3FRH A;  3J81 S;  3GLH E;  4LY6 A;  1IY0 A;  1OAI A;  1C7Y A;  2R4E A;  3FTD A;  3M7G A;  4GIT A;  2KA6 B;  3D8L A;  4JN6 A;  4OW0 A;  4TUW A;  4DV4 M;  4DV3 M;  1QYR A;  2WZJ A;  5DYG A;  3VK8 A;  1G71 A;  3HHX A;  3SBJ A;  1NV9 A;  3FUW A;  2DWM A;  4LJ8 A;  3ZQJ A;  3IG5 A;  4K0K M;  4Y28 F;  3DOA A;  4IBE A;  4Z6Y A;  3U61 A;  1Z5C A;  4R71 A;  3GPU A;  3U6E A;  1IBM M;  3SMS A;  5ITU A;  1Z5A A;  2XH9 A;  2XZU A;  2QSF X;  2NQ8 C;  3HU1 A;  2CE7 A;  1IY1 A;  1PJQ A;  2B3T A;  2FOI C;  4LJ9 A;  3J7B A;  1IN7 A;  4R7G A;  3GQ3 A;  1OFI A;  3I4Y A;  1OAO C;  1N78 A;  1ZMW A;  3GLG E;  3U60 B;  4IJE A;  1T6O A;  2LVN C;  3SHG B;  1TH4 A;  5EXT A;  2QHO B;  1PRB A;  4NRV A;  1NSF A;  2KDL A;  2Y20 A;  2J7O A;  1GKI A;  1ORY B;  1Z59 A;  1MN3 A;  4DV7 M;  3TQS A;  5KO3 A;  4GRI A;  3PXG A;  3THG A;  2FH0 A;  2L4E A;  3AJI B;  3NBX X;  3LMM A;  5KPR A;  2HCB A;  2XFS A;  3KVW A;  5EXP A;  3UJN A;  4M9Z A;  3A46 A;  1J5E M;  2LWX A;  4M9S A;  1L1T A;  1J7K A;  4Q7J A;  4XBO A;  2UU9 M;  3W0F A;  3K2L A;  4AW4 A;  4QHS A;  1DO2 A;  3KW6 A;  1AIP C;  2DZO B;  4IBB A;  3L25 A;  2VF7 A;  5GKN A;  5ITR A;  4G4Q A;  1QQW A;  5JI2 E;  2FFJ A;  2CFO A;  2DWN A;  1H6U A;  4LJ5 A;  4DV6 M;  1IBK M;  5IRE B;  1XB2 B;  3C9P A;  3I4V A;  3FKE A;  3U6C A;  3M0E A;  3KOY E;  2L09 A;  4L8R C;  3GLI A;  2MJ5 B;  1L8Q A;  1T43 A;  3HGI A;  8CAT A;  3U5Z B;  2LNH C;  4CGY B;  1W5T A;  2C99 A;  4LJA A;  2R46 A;  2OO9 A;  5ITY A;  2A5Y B;  3GPY A;  2OQ4 A;  4DR5 M;  3A98 B;  1IXZ A;  1KSF X;  2DHY A;  2UUB M;  4CIS A;  2LHC A;  5IWA M;  3E46 A;  1TR8 A;  4S12 A;  1XMQ M;  4NC6 A;  3IEC A;  4RKU F;  2ZAN A;  4OVZ B;  2DVW B;  4QHT A;  1G3I A;  5DYI A;  1L1Z A;  2F5N A;  4LJ4 A;  2ERC A;  4GKJ M;  3ZC7 B;  3QAU A;  4M0W A;  2ZTD A;  3U6M A;  1HNZ M;  4D81 A;  2CP8 A;  3PFI A;  2L4F A;  1L2B A;  2DAG A;  2LXE A;  4DV2 M;  1MX0 A;  2C9O A;  3HJQ A;  4I4L A;  3FRI A;  1SXJ B;  3T15 A;  3WHK A;  2VF8 A;  4RF1 A;  3SAU A;  3TL4 X;  4G4N A;  4L15 A;  3TE6 A;  4KLN A;  4A3V B;  4LFB M;  1UFZ A;  4FWH A;  2EA0 A;  3H4M A;  1HQY E;  2R4J A;  1I94 M;  2UUA M;  3GQ5 A;  1OQY A;  2MR9 A;  3HJS A;  3J27 B;  2XLJ A;  5LMN M;  1XMO M;  2DI0 A;  1XXH B;  2R62 A;  2X4A A;  2J7N A;  2RRU A;  3FUT A;  3KXE C;  1NY6 A;  4AZF A;  3KDS E;  4JV5 M;  1Q02 A;  3MJ5 A;  4JI8 M;  1Y8G A;  4JI5 M;  1YSY A; 
#chains in the Genus database with same CATH homology
 3UZU A;  1UM8 A;  2Q2E B;  2LH0 A;  3KP0 E;  2I7P A;  1YE9 A;  3HKP A;  5FTM A;  4RF0 A;  4IBF A;  3U6P A;  1JR3 D;  4LJ7 A;  4D82 A;  4PD2 A;  3U6O A;  1R2Y A;  1NJG A;  3CF2 A;  3GP1 A;  2DXI A;  1TH2 A;  1Q3B A;  2VII A;  1NJF A;  4AG5 A;  5H37 D;  2CV2 A;  4B7G A;  4B3R M;  1E9S A;  1PJJ A;  3HJ8 A;  2HHH M;  4LZZ A;  3CF0 A;  5FLX S;  4M9X A;  4GHL A;  1S3S A;  1Z5B A;  3Q8X A;  4AKG A;  4GMQ A;  2VQE M;  4G6Z A;  3JR4 A;  1E94 E;  4NRW A;  4WUR A;  4NSO B;  4AI6 A;  1IXR C;  5BPV A;  1SXJ D;  1N32 M;  3J80 S;  3SAR A;  3PVS A;  3R9X B;  3EIH A;  1K82 A;  4LGY A;  4GC5 A;  3B9P A;  3RGS A;  5F3W A;  4MH0 E;  1ZQ9 A;  2CEA A;  2RKO A;  2D7E A;  1J09 A;  4HLQ A;  4MM3 B;  2D7G A;  5C1B A;  4LJ6 A;  2CHV A;  2M5Z A;  3EIE A;  3GLF B;  2XFT A;  4B3S M;  1N75 A;  1HNX M;  4B3T M;  3KFU G;  3LVW A;  1EE8 A;  3KOX E;  1XNR M;  4OU7 A;  4FWD A;  3FUX A;  3ZCB B;  3ZH9 B;  4L4U A;  3SAW A;  3KS4 A;  3SAV A;  1XNQ M;  2ZM6 M;  2Y21 A;  5DNY A;  2E5L M;  5EJC A;  2V1U A;  1QAQ A;  1HNW M;  3HHW A;  3UMM A;  4NXN M;  1TH3 A;  4YY3 M;  1QAN A;  4LF6 M;  1GVN A;  4PDG A;  3FUV A;  4B08 A;  4JI6 M;  2FE8 A;  2Z7J A;  1NHG C;  1ZAE A;  2D7H A;  2R45 A;  1QAO A;  2XF3 A;  4IBG A;  3UK6 A;  5C18 A;  2QBY A;  4DUY M;  1MU5 A;  1XWI A;  3W0L B;  3U5Z A;  3L29 A;  4LF8 M;  2KRK A;  4LCB A;  4REZ A;  3AOE C;  2XGN A;  3T1H M;  2UUC M;  4DR4 M;  1IY2 A;  5EXS A;  4X66 M;  3J2P B;  3A45 A;  1E32 A;  2QPA A;  3PNY A;  3CF6 E;  1NNJ A;  2Y0Q A;  3NBI A;  3GRY A;  3VLF B;  4B3M M;  1E9R A;  5ITX A;  1HT1 E;  4LZJ A;  4BLC A;  4ITQ A;  4QNM A;  1R2Z A;  4LFC M;  4KO8 A;  2DZN B;  4NSR A;  3OTO M;  3TWL A;  4IIW A;  3GLG B;  2I7N A;  4LRT A;  2KZS A;  4GC9 A;  2KRU A;  3AFH A;  3GLH B;  3AOG A;  3FD9 A;  3UGJ A;  4FD2 A;  3BOS A;  3U60 A;  2C5R A;  2AHM A;  4DR3 M;  2X8A A;  2EUC A;  5KQ8 A;  3FTF A;  4G4O A;  5IT9 S;  3SYK A;  3K8Z A;  3RFW A;  5KQD A;  3PNV A;  2KZU A;  2RGO A;  3AV0 A;  4CHT B;  4OX9 M;  2FNA A;  1JQJ C;  3JR5 A;  1IN8 A;  1NVM A;  4PT5 A;  3HHZ A;  1GL7 A;  2CUZ A;  2C96 A;  1IBL M;  4LF5 M;  5EP2 A;  3IG8 A;  2VQF M;  3SMP A;  3U61 B;  1GL6 A;  5KPZ A;  2KW0 A;  2JA2 A;  2X49 A;  3SAT A;  4P16 A;  3GRU A;  3KP1 E;  4IBK A;  3DA1 A;  3QWL A;  4X64 M;  4PCZ A;  5EQT A;  3AOE A;  3D8B A;  4HL4 A;  5FSW A;  3RGP A;  2XZF A;  1IN5 A;  2BNK A;  4BBA A;  4FCT A;  2KXE A;  4LF4 M;  5E6J A;  3L2A A;  1VDD A;  3E9S A;  4DV1 M;  4JI4 M;  4GKK M;  2F5P A;  3TPZ A;  1K3W A;  2R18 A;  2R65 A;  1HQC A;  3LVV A;  4LFA M;  1G41 A;  3U6L A;  2CHG A;  3KSJ A;  1OJL A;  3FTE A;  1N33 M;  1TGU A;  2V6Z M;  4FW9 A;  4DUZ M;  2F5O A;  1NY5 A;  1XXH A;  2HL7 A;  4B7H A;  5KPT A;  2BJW A;  1NNU C;  4AKH A;  2C98 A;  3R8F A;  1KYI A;  3DZD A;  4GIP A;  4JI0 M;  2G5G X;  2HKJ A;  3SYL A;  4X62 M;  1D2N A;  3GRR A;  1FNN A;  1GLN A;  4BB9 A;  1XC8 A;  2QZ4 A;  4I8O A;  4JI7 M;  2XEP A;  2UXB M;  4MB7 A;  4NXM M;  4I81 A;  1DGG A;  3HU3 A;  3I51 A;  1HT2 E;  4WW0 A;  4DR2 M;  2XSZ A;  1Q3C A;  4I5S A;  2L7I A;  4MGI E;  5IZ7 D;  2P5T A;  2ZAO A;  3DFZ A;  5ITT A;  3U6S A;  4JI3 M;  1DGH A;  1K3X A;  4FVM A;  4JI1 M;  3L27 A;  4JYA M;  3GLI B;  3CTW B;  3FUU A;  1WXQ A;  4IBJ A;  3SC3 A;  3T1Y M;  1IM2 A;  3MHV C;  3SFZ A;  3TWK A;  2CV0 A;  4QOZ C;  4JXJ A;  4B7F A;  4LGM A;  3GO8 A;  3A42 A;  1QAM A;  1I4W A;  1N77 A;  1XHB A;  2L7H A;  2Z4R A;  3NWL A;  1QVR A;  1DO0 A;  1KFV A;  3U6D A;  3U6Q A;  3KSX A;  5ITX E;  3GPX A;  2G8L A;  2YFQ A;  3HHY A;  1DGF A;  2YNM D;  3GPP A;  4AG6 A;  4XGI A;  3MK6 A;  2F5S A;  2W82 A;  2Z4S A;  2OPF A;  3VKH A;  3JAM S;  2BJV A;  1IQP A;  3ILK A;  2O5R A;  5FTJ A;  1QZM A;  3KOW E;  4QNR A;  2DWL A;  5FTN A;  5EP3 A;  7CAT A;  3KOZ E;  2UXC M;  4R3D A;  3KS8 A;  2ZAM A;  3E4R A;  1DGB A;  4IJF A;  4GHA A;  1X37 A;  4L78 A;  5LMU M;  2M60 A;  1L2D A;  5EXX A;  2Z3X A;  2L6O A;  4IBC A;  2YQZ A;  1L2C A;  2QCU A;  4YHH M;  4MGY E;  4FCV A;  5EP1 A;  2DHR A;  4GH9 A;  2CV1 A;  4DR7 M;  2XSZ D;  4AKI A;  2V1C A;  1Q39 A;  4OVZ A;  1C1K A;  1NHW C;  1T3T A;  4FWG A;  4IBI A;  4IBD A;  3GLG A;  5FTK A;  4D80 A;  5BR8 M;  3GRV A;  4DV5 M;  1IXS B;  4G4R A;  3VFD A;  4FCW A;  5FTL A;  3GLH A;  4AQY M;  3HU2 A;  4NL4 H;  3SAS A;  3TWM A;  3AL0 C;  4LF7 M;  4ZPX A;  2K47 A;  3LQQ A;  4L16 A;  4MGK E;  1SXJ C;  1PJI A;  2YR0 A;  2RGH A;  3GLF A;  3C58 A;  4LF9 M;  4II7 A;  4Z8X A;  1IN6 A;  5A2Q S;  2Y0T A;  3VDU A;  3AKZ A;  4KHP M;  3FYC A;  1R6B X;  2C9C A;  5JI3 E;  2ZBK B;  1Z6T A;  1YUB A;  3FTC A;  4EIW A;  1LV7 A;  1PM5 A;  3L26 A;  2QBY B;  1R7R A;  4DR6 M;  3HWS A;  3K1J A;  3VK7 A;  2CHQ A;  4LG2 A;  4W5W A;  4RNA A;  4DV0 M;  4MGH A;  2F4V M;  4MGZ E;  3VKG A;  3K92 A;  4NOO B;  2UXD M;  4X65 M;  1N34 M;  1G59 A;  1TDH A;  2QP9 X;  4QOS A;  5ITQ A;  1SXJ A;  2KEB A;  5EP4 A;  1IN4 A;  4KOD A;  4PDI A;  1SXJ E;  3FYD A;  2F5Q A;  2EO2 A;  3RE8 A;  4DR1 M;  3J7A S;  1G8P A;  1N36 M;  3SHF A;  1HR0 M;  2DWZ B;  2H1R A;  3L28 A;  1OFH A;  2QEN A;  1W5S A;  4JI2 M;  4M0D A;  3VDP A;  3WHL A;  1DGH B;  1TDZ A;  3M6A A;  1FJG M;  4LRS A;  3LQR A;  5E26 A;  3GQ4 A;  1G4A E;  3T38 A;  1JR3 A;  3J81 S;  4LY6 A;  1IY0 A;  2R4E A;  3FTD A;  3M7G A;  4GIT A;  2KA6 B;  3D8L A;  4JN6 A;  4OW0 A;  4TUW A;  4DV4 M;  4DV3 M;  1QYR A;  5DYG A;  3VK8 A;  3HHX A;  3SBJ A;  3FUW A;  2DWM A;  4LJ8 A;  3IG5 A;  4K0K M;  3DOA A;  4IBE A;  4Z6Y A;  3U61 A;  1Z5C A;  3GPU A;  3U6E A;  1IBM M;  3SMS A;  5ITU A;  1Z5A A;  2XH9 A;  2XZU A;  2NQ8 C;  3HU1 A;  2CE7 A;  1IY1 A;  2FOI C;  4LJ9 A;  3J7B A;  1IN7 A;  4R7G A;  3GQ3 A;  1OFI A;  3I4Y A;  1N78 A;  3U60 B;  4IJE A;  3SHG B;  1TH4 A;  5EXT A;  4NRV A;  1NSF A;  2Y20 A;  2J7O A;  1GKI A;  1ORY B;  1Z59 A;  4DV7 M;  3TQS A;  5KO3 A;  4GRI A;  3PXG A;  3THG A;  3AJI B;  5KPR A;  3LMM A;  2HCB A;  2XFS A;  3KVW A;  5EXP A;  3UJN A;  4M9Z A;  3A46 A;  1J5E M;  2LWX A;  4M9S A;  1L1T A;  1J7K A;  2UU9 M;  4XBO A;  3W0F A;  3K2L A;  4AW4 A;  4QHS A;  1DO2 A;  3KW6 A;  4IBB A;  2DZO B;  3L25 A;  5GKN A;  5ITR A;  4G4Q A;  1QQW A;  5JI2 E;  2FFJ A;  2CFO A;  2DWN A;  1H6U A;  4LJ5 A;  4DV6 M;  1IBK M;  5IRE B;  3I4V A;  3FKE A;  3U6C A;  3M0E A;  3KOY E;  2L09 A;  4L8R C;  3GLI A;  1L8Q A;  3HGI A;  8CAT A;  3U5Z B;  2LNH C;  4CGY B;  1W5T A;  2C99 A;  4LJA A;  2R46 A;  5ITY A;  2A5Y B;  3GPY A;  2OQ4 A;  4DR5 M;  3A98 B;  1IXZ A;  1KSF X;  2UUB M;  4CIS A;  5IWA M;  4S12 A;  1XMQ M;  2ZAN A;  4OVZ B;  2DVW B;  4QHT A;  1G3I A;  5DYI A;  1L1Z A;  2F5N A;  4LJ4 A;  2ERC A;  4GKJ M;  3ZC7 B;  3QAU A;  4M0W A;  3U6M A;  1HNZ M;  4D81 A;  3PFI A;  1L2B A;  2LXE A;  4DV2 M;  1MX0 A;  2C9O A;  3HJQ A;  4I4L A;  3T15 A;  1SXJ B;  3WHK A;  4RF1 A;  3SAU A;  3TL4 X;  4G4N A;  4L15 A;  3TE6 A;  4KLN A;  4A3V B;  4LFB M;  1I94 M;  4FWH A;  2EA0 A;  3H4M A;  1HQY E;  2R4J A;  2UUA M;  3GQ5 A;  3HJS A;  3J27 B;  2XLJ A;  5LMN M;  1XMO M;  1XXH B;  2R62 A;  2X4A A;  2J7N A;  3FUT A;  4AZF A;  3KXE C;  1NY6 A;  3KDS E;  4JV5 M;  3MJ5 A;  4JI8 M;  4JI5 M;  1YSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...