5LMNM

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5lmnM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5lmnM02
4JI0M 1PM5A 4DV7M 2E5LM 3TWMA 3T1YM 4LF5M 4JI7M 4JI3M 3GP1A 1XMOM 1Z5BA 5ITRA 2UUAM 1K3WA 2XZUA 5ITXE 4G4QA 3SATA 5FLXS 4DUZM 3U6PA 3TWLA 3U6MA 1L2CA 3JAMS 4YHHM 1PJIA 1Q39A 3JR4A 3GPPA 5BR8M 3GPUA 4DR4M 1IBLM 4DV4M 3GO8A 4DR7M 2F5QA 4DV1M 1HR0M 1KFVA 2UU9M 3J81S 1L2BA 2OQ4A 2UXDM 4NXNM 3SARA 4CISA 1N33M 5IT9S 4ITQA 3JR5A 3SASA 2ZM6M 4LFAM 2HKJA 1TDHA 1L2DA 1K3XA 3T1HM 4LF7M 1K82A 4JYAM 1IBKM 1Z5AA 4DR5M 1Z5CA 1J5EM 1L1TA 1MU5A 3GPXA 5ITYA 3J80S 4B3TM 2UXBM 4DV3M 2EA0A 1Q3CA 4LFCM 1R2YA 4LF8M 2F5PA 3GQ4A 3TWKA 4X66M 5ITUA 4DV2M 2F5OA 4NRVA 5IWAM 4JV5M 4DR6M 4LF4M 1Z59A 4DR1M 4GKJM 2F5SA 4B3SM 3VK8A 4X64M 3DOAA 4DR2M 4OX9M 4X65M 5LMNM 2VQEM 4GKKM 5ITTA 3GQ5A 4DUYM 3U6CA 4AQYM 3SAVA 3J7AS 4PCZA 1N34M 2F5NA 1PJJA 1Q3BA 3A46A 1TDZA 5ITQA 2OPFA 1EE8A 4LFBM 4PDIA 4LF9M 4B3MM 4JI5M 3U6DA 3SAUA 2XZFA 2UXCM 1N36M 4G4RA 4JI1M 4DV5M 2Q2EB 1XC8A 1HNZM 3U6QA 4DR3M 4DV6M 2UUBM 3U6SA 3A45A 4JI8M 1FJGM 5LMUM 2ZBKB 1L1ZA 4X62M 4G4OA 3W0FA 1N32M 5A2QS 3U6EA 2F4VM 1HNXM 3VK7A 3U6OA 4PD2A 1XNQM 4PDGA 4NXMM 1XNRM 1R2ZA 3U6LA 4G4NA 3SBJA 4B3RM 1IBMM 1I94M 4YY3M 1NNJA 3SAWA 1XMQM 4JI2M 4K0KM 3A42A 3C58A 2UUCM 3GPYA 1HNWM 5ITXA 4JI6M 1MX0A 3GQ3A 4KHPM 4JI4M 4DV0M 2HHHM 3OTOM 4MB7A 4LF6M 4NRWA 2VQFM
chains in the Genus database with same CATH superfamily
3B7ZA 1PM5A 3AFHA 3TWMA 3T1YM 1X37A 2BJWA 2DAEA 2V1CA 1XXHB 4G6ZA 5KPZA 3HU2A 1DO2A 2MJ5B 2XEPA 5DNYA 2CWBA 2CFOA 2OOBA 4UN2B 3C9PA 2QPAA 3E4RA 3HHXA 1LV7A 1E94E 4LGMA 4MGZE 5GKNA 4B7GA 5KPRA 5ITXE 4OVZA 3L26A 4BLCA 3U61A 3U5ZB 3SATA 1HT2E 1GL7A 4LZZA 1GO5A 1VDLA 4B7HA 3SFZA 1HQYE 2JZ1A 2RGHA 3HWSA 2VDBB 1VEGA 1L2CA 1G59A 1IQPA 3I4VA 4YHHM 3RGSA 1PJIA 1Q39A 1YE9A 4XGIA 5BR8M 3GPPA 1PJSA 1QVRA 4DR4M 1AUAA 1IBLM 3FYCA 2JY7A 4MGKE 3R8FA 1XHBA 5FTLA 4B7FA 2XFSA 3K8ZA 1OIZA 4GEWA 2UXDM 4NXNM 3SARA 3U60A 1JR3D 5EQTA 3FUTA 3JR5A 4LFAM 2HKJA 3HKPA 1MN3A 4OU7A 1NHGC 1K3XA 3T1HM 2R45A 4REZA 1JB0F 3K9PA 2DWZB 1PJTA 4WP2A 3UZUA 4DR5M 2DXIA 2DAIA 1MU5A 3HZJA 3GPXA 2CP8A 3J80S 5ITYA 4B3TM 4I81A 4Y28F 4ZPXA 2CHGA 1R2YA 1C1KA 3KVWA 3RGPA 2JWSA 4JV5M 1FNNA 4DR6M 2M5ZA 1ORYB 4QHTA 1Z59A 3KSJA 2XFTA 1OAIA 2F5SA 4B3SM 3VK8A 2KZSA 3GLHB 3DOAA 4X64M 2DAMA 2KNAA 4M0WA 1A5TA 2VQEM 4GKKM 1H6UA 1SXJE 2DENA 3AOGA 3FYDA 3GQ5A 4AQYM 3U6CA 1HNZM 3GLFB 2DWLA 3KS4A 1S3SA 2YNMD 1N34M 3IG5A 2F5NA 1Q3BA 2YR0A 4FCTA 1TDZA 2DI0A 4I4LA 2ZAOA 4M9XA 4QOZC 2RRUA 2EJSA 3D8BA 4JN6A 3PXGA 4B3MM 4MM3B 3ZQJA 4A3VB 2HCBA 3J27B 2FS1A 1OQYA 3CF0A 3U6DA 5C1BA 4LF6M 5EXSA 2XZFA 4FWHA 4R71A 4JI1M 2LHCA 2C9CA 5JI2E 3FTFA 2R18A 4CIZA 1VEJA 1ZAEA 3A98B 2J7OA 2G5GX 1P3QQ 3AJIB 1IXRC 1IXSB 3A45A 2KRUA 1G3IA 4JI8M 3FUUA 5FTJA 3CF6E 4B08A 4I8OA 3U6EA 1SXJA 2MROB 1QAQA 4LGYA 1HNXM 2OO9A 3VDPA 1EFUB 2R46A 1SG9A 3C3DA 3CGWA 3EIEA 3FD9A 1NNUC 3LCUA 3QYEA 1IM2A 4F1IA 4PDGA 3J7BA 3AV0A 5DYGA 1GJTA 1NNJA 3K9OA 4LJ7A 3AKZA 1XMQM 1OKSA 3A42A 3FRIA 3C58A 4K0KM 3GLGA 1QDTA 1QUTA 2UUCM 3D8LA 4QNMA 2LVQD 1HNWM 4JI6M 2ZTCA 2K47A 5FTNA 3QWLA 4IBFA 2HHHM 4NRWA 3SMPA 2CHVA 2HL7A 1E9RA 4JI0M 4DV7M 1NJGA 4JI7M 1XMOM 1DGHB 1L8QA 4KODA 4FWDA 1QQWA 1Z5BA 2KRKA 3EIHA 2J5YA 2KDLA 2L7HA 4Q7JA 4G4QA 3L2AA 3LMMA 5FLXS 7CATA 3K1JA 3GLFE 3QYBA 3W68A 2C5RA 2CV0A 2LVNC 3U6PA 1TGUA 1YLAA 2CRUA 1W5SA 3I04M 1DGHA 3HU3A 3UMMA 4NSOB 2WSCF 2X49A 4P17A 5EJCA 1JR3E 2APLA 4RF1A 3KFUG 1NHWC 1KFVA 3J81S 2EUCA 5EXXA 2OQ4A 2BJVA 4L78A 3AOEC 3T38A 4AG5A 3KP1E 3MK6A 3B7QA 2DWNA 2ZM6M 3LQQA 2AHMA 1Y8GA 4BB9A 1QZEA 4LCBA 2Z4SA 3SMSA 1N77A 4HL4A 1JQJC 1K82A 4FVMA 1R6BX 3B7NA 2LTUA 3UK6A 2DHRA 3W0LB 1XXHA 4IBCA 2LVPC 1ZMVA 2KW0A 3HHWA 2R44A 4LF8M 2F5PA 3GQ4A 2HWJA 4LJ4A 4X66M 2I7NA 1NSFA 3FE3A 4NRVA 1NJFA 5IWAM 3U61B 1QDRA 1TH3A 3FUVA 4GC9A 3UJNA 3B89A 2C9OA 3AOEA 3HJ8A 4FD2A 4GKJM 3VKGA 3ILKA 1SXJD 4L4UA 4DR2M 4OX9M 2JZ0A 3IG8A 2Y20A 1DGFA 1J7KA 3RFWA 4L8RC 4IIWA 3SAVA 3KOXE 1JR3A 3FKEA 4PCZA 1PRBA 1PJJA 2L4FA 2L4EA 2D7HA 1QUSA 5EXTA 1EE8A 1TTEA 4PDIA 4LF9M 4LFBM 2QENA 1XXHE 5FSWA 4IBEA 2DZLA 4DBGB 2JY8A 2J7NA 3GLIE 4QOSA 1N36M 4G4RA 2DWMA 3Q8XA 1N78A 2VF8A 3U6QA 2JUJA 2QHOB 2LHGA 2X4AA 3MHVC 4GIPA 4HEOA 4MGYE 4FCVA 2V1UA 4M9ZA 5KPTA 1FJGM 5LMUM 1XWIA 1E9SA 1WGLA 3B9PA 3K92A 4GITA 1N32M 2R65A 1T43A 3T15A 2CE7A 1GJSA 2H5XA 3PNVA 1SXJC 1V33A 3KOWE 3CTWB 5IZ7D 3H4MA 2EKFA 3KOZE 5EP3A 3K2LA 3U6LA 1E32A 4MH0E 2BWEA 5DYIA 4L16A 4NC6A 3GLIA 3M7GA 2RKOA 1I94M 5L8RF 2CV1A 3KSXA 2QNJA 5KQ8A 2KNZA 4LJ6A 1RU3A 4GC5A 1G4AE 1ZV1A 3ZC7B 2C98A 4L6V6 4JI4M 3LCVB 4ANRA 4MB7A 2OOAA 4AKIA 3GLIB 5BPVA 4LY6A 2K0BX 5C18A 1Q02A 4AKGA 1T3TA 4M9SA 2VIIA 4IBJA 1PGYA 2CV2A 1K3WA 2UUAM 3CF2A 2QBYB 2R0IA 1QYRA 1IY2A 1OIPA 1I4WA 4Z8XA 1IXSA 3GRVA 3LW5F 2QQ8A 1R7RA 2K9DA 3L28A 2Y21A 5IREB 4S12A 4DUZM 3TWLA 2L2DA 4AZFA 1N75A 3RE8A 3JAMS 1TH2A 3BOSA 1WGNA 1GKIA 4HLQA 4W5WA 1G71A 2ZANA 2FE8A 1DGBA 5FTMA 3GPUA 3GO8A 4DR7M 2Y0QA 4D81A 1OFIA 2A5YB 2XGNA 2XLJA 3GLFA 1LTMA 4BBAA 4DV1M 1HR0M 3GRYA 4GH9A 4QNRA 3GLGB 1C7YA 2FOIC 4XBOA 4AI6A 2B3TA 2Y0TA 4LJ9A 3DA1A 1TDHA 3KDSE 1L2DA 3WHLA 4IBBA 2WSEF 4D82A 5FTKA 1F4IA 4IBIA 1Z5CA 2BWBA 1J5EM 1MJGM 1NY5A 3F92A 2EKKA 2EA0A 3I51A 2KA6B 2L6OA 1VG5A 1QAMA 1QAOA 2F5OA 1IN8A 2DVWB 2R4JA 4OVZB 1OFHA 4LF4M 3R9XB 3TPZA 5H37D 3VDUA 4FWGA 2R4EA 4CGYB 2D7EA 1D0LA 2D7GA 1DGGA 2LNHC 2GNOA 3L29A 4QHSA 3M6AA 3LVVA 3SHFA 3TL4X 1IN5A 4LZJA 2G8LA 2W82A 5LMNM 3FUWA 2LVAA 2MR9A 1OTRA 3I4YA 5ITTA 4DUYM 3HJQA 2G3QA 2JP7A 2QP9X 3MMPA 3J7AS 1OJLA 3DFZA 1TH4A 2OPFA 1V34A 1YUBA 4F2LA 3THGA 2KEBA 1WIVA 3TE6A 5JI3E 2ERCA 2CEAA 1ZMUA 2Z4RA 3LQRA 5EP4A 3SAUA 4RKUF 2JY6B 4D80A 2XSZD 4DV5M 4WW0A 3QAUA 4LRSA 4R7GA 3KP0E 3WHKA 2X8AA 4LRTA 2HAKA 3NBXX 4DR3M 2C96A 2UUBM 1IN6A 1HJPA 1VEKA 2O01F 3HJSA 4I5SA 3FUXA 2ZBKB 4XK8F 1Z6TA 4X62M 2V6ZM 3ZH9B 2QSFX 1UFZA 1AIPC 4CJ6A 2F4VM 3U6OA 1XNQM 4MGIE 1NO1A 3SYLA 3VKHA 4G3OA 3GLHA 3VLFB 1R2ZA 1IN7A 1J09A 1IN4A 1ZMWA 3E21A 5EP2A 2EO2A 4G4NA 4B3RM 2FH0A 1IBMM 1G8PA 4KO8A 3SAWA 1W5TA 4JI2M 3PNYA 2BNKA 3L27A 1QZMA 5F3WA 4KT0F 1XB2B 3GPYA 3U60B 2M60A 5ITXA 4DR1M 3MJ5A 1GLNA 3GQ3A 4MGHA 4DV0M 3GRUA 2MH8A 3U5ZA 2L7IA 3HHZA 1DO0A 4RF0A 2VQFM 2H1RA 1BVSA 1KYIA 2E5LM 1OAOC 4LF5M 1G41A 2LXEA 1NY6A 4JI3M 2KNVA 3GP1A 1UM8A 2FNAA 2JY5A 2LBCA 3PVSA 1TF0B 2CHQA 5ITRA 4IBKA 1GABA 1HQCA 4P16A 2KXEA 2XZUA 1GL6A 1QANA 3J2PB 3T6PA 2O25A 3VFDA 3DZDA 2LH0A 4NOOB 2N35A 3KW6A 3BXWA 1SXJB 2O5RA 4PT5A 3U6MA 2DHYA 1PJQA 2K6BA 1D0MA 2DAKA 3FTEA 3GLHE 3JR4A 1YSYA 4DV4M 4GRIA 2FFJA 5KQDA 2DNAA 2F5QA 1VQ1A 4M0DA 5EXPA 3Q8GA 2UU9M 1L2BA 3TQSA 2KZUA 4CISA 1N33M 2R6FA 3KOYE 5IT9S 4ITQA 4II7A 3SASA 2R62A 4GMQA 3FTCA 3HHYA 4L15A 1CUKA 2Z3XA 4LF7M 1IY0A 4WURA 1D0KA 2DKLA 4JYAM 1IBKM 1Z5AA 4JXJA 4EIWA 1V92A 2JXNA 1L1TA 3E46A 4IJEA 2VF7A 3W67A 3SHGB 2UXBM 4DV3M 4LFCM 1Q3CA 2XH9A 4NSRA 2XSZA 3TWKA 2NQ8C 1WR1B 1D2NA 2I7PA 5ITUA 3GLGE 4DV2M 5E26A 1WXQA 2P5TA 4LG2A 2Z7JA 3B74A 3IECA 2C99A 4AW4A 2ZTDA 3NWLA 2LWXA 3IHPA 4X65M 2GQFA 1T6OA 1IXZA 2CUZA 3NBIA 4NL4H 2WZJA 2WSFF 1WHCA 1HT1E 4LJ5A 2L09A 4IJFA 4AKHA 1WJ7A 2LVOC 3FRHA 3UGJA 3A46A 1NV9A 5ITQA 3HX3A 1R4GA 4IBGA 5EP1A 1NVMA 4TUWA 2MGWA 4AG6A 4JI5M 2XF3A 3HY5A 3I01M 4GHAA 1IY1A 3M0EA 3FTDA 1XC8A 2UXCM 3ZCBB 3HU1A 3SC3A 3L25A 4IBDA 3SYKA 2Q2EB 2DZOB 2YQZA 4LJAA 2QBYA 4RNAA 5E6JA 4DV6M 4FCWA 4R3DA 2YFQA 3U6SA 2RGOA 1L1ZA 2Z8YM 1DV0A 4G4OA 1NV8A 1VDDA 3GRRA 3W0FA 5A2QS 2QZ4A 1ZQ9A 2DAGA 1GVNA 2JNHA 1TR8A 3HGIA 4PD2A 3VK7A 4NXMM 1EIJA 1XNRM 1R5LA 4CHTB 1IFYA 5DFLA 2ZAMA 3SBJA 8CATA 3V76A 5KO3A 4YY3M 3BBZA 3C3EA 3KXEC 2KHHA 3AL0C 1MX0A 4LJ8A 4Z6YA 3PFIA 4KHPM 3H4JA 2DZNB 3KS8A 3E9SA 3OTOM 4GHLA 4FW9A 1KSFX 4KLNA 2JA2A 3LVWA 4OW0A 2QCUA
chains in the Genus database with same CATH topology
1PM5A 3AFHA 3TWMA 3T1YM 1X37A 2BJWA 2V1CA 1XXHB 4G6ZA 5KPZA 3HU2A 1DO2A 2XEPA 5DNYA 2CFOA 3E4RA 2QPAA 3HHXA 4LGMA 1LV7A 1E94E 4MGZE 5GKNA 4B7GA 5KPRA 5ITXE 3L26A 4OVZA 3U61A 4BLCA 3U5ZB 3SATA 1HT2E 1GL7A 4LZZA 4B7HA 3SFZA 1HQYE 2RGHA 3HWSA 1L2CA 1G59A 1IQPA 3I4VA 4YHHM 3RGSA 1PJIA 1Q39A 1YE9A 4XGIA 5BR8M 3GPPA 1QVRA 4DR4M 1IBLM 3FYCA 3R8FA 4MGKE 1XHBA 5FTLA 4B7FA 2XFSA 3K8ZA 2UXDM 4NXNM 3SARA 3U60A 1JR3D 5EQTA 3FUTA 3JR5A 4LFAM 2HKJA 3HKPA 4OU7A 1NHGC 1K3XA 3T1HM 2R45A 4REZA 2DWZB 3UZUA 4DR5M 2DXIA 1MU5A 3GPXA 5ITYA 3J80S 4B3TM 4I81A 4ZPXA 2CHGA 1R2YA 1C1KA 3KVWA 3RGPA 4JV5M 1FNNA 4DR6M 2M5ZA 1ORYB 4QHTA 1Z59A 3KSJA 2XFTA 2F5SA 4B3SM 3VK8A 2KZSA 3GLHB 3DOAA 4X64M 4M0WA 2VQEM 4GKKM 1H6UA 1SXJE 3AOGA 3FYDA 3GQ5A 4AQYM 3U6CA 1HNZM 3GLFB 2DWLA 3KS4A 1S3SA 2YNMD 1N34M 3IG5A 2F5NA 1Q3BA 2YR0A 4FCTA 1TDZA 4I4LA 4QOZC 2ZAOA 4M9XA 3D8BA 4JN6A 3PXGA 4B3MM 4MM3B 4A3VB 2HCBA 3J27B 3CF0A 3U6DA 5C1BA 4LF6M 5EXSA 2XZFA 4FWHA 4JI1M 5JI2E 2C9CA 3FTFA 2R18A 1ZAEA 3A98B 2J7OA 2G5GX 3AJIB 1IXRC 1IXSB 3A45A 2KRUA 1G3IA 4JI8M 3FUUA 5FTJA 3CF6E 4B08A 4I8OA 3U6EA 1SXJA 4LGYA 1QAQA 1HNXM 3VDPA 2R46A 3EIEA 3FD9A 4PDGA 1NNUC 1IM2A 3J7BA 3AV0A 5DYGA 1NNJA 4LJ7A 3AKZA 1XMQM 4K0KM 3A42A 3C58A 3GLGA 2UUCM 3D8LA 4QNMA 1HNWM 4JI6M 2K47A 5FTNA 3QWLA 4IBFA 2HHHM 4NRWA 3SMPA 2CHVA 2HL7A 1E9RA 4JI0M 4DV7M 1NJGA 4JI7M 1XMOM 1DGHB 1L8QA 4KODA 4FWDA 1QQWA 1Z5BA 2KRKA 3EIHA 2L7HA 4G4QA 3L2AA 3LMMA 5FLXS 7CATA 3K1JA 2C5RA 2CV0A 3U6PA 1TGUA 1W5SA 1DGHA 3HU3A 3UMMA 4NSOB 2X49A 5EJCA 4RF1A 3KFUG 1NHWC 1KFVA 3J81S 2EUCA 5EXXA 2OQ4A 2BJVA 4L78A 3AOEC 3T38A 4AG5A 3KP1E 3MK6A 2DWNA 2ZM6M 3LQQA 2AHMA 4BB9A 4LCBA 3SMSA 2Z4SA 1N77A 1K82A 4HL4A 1JQJC 4FVMA 1R6BX 3UK6A 2DHRA 3W0LB 1XXHA 4IBCA 2KW0A 3HHWA 4LF8M 2F5PA 3GQ4A 4LJ4A 4X66M 2I7NA 1NSFA 4NRVA 1NJFA 5IWAM 3U61B 1TH3A 3FUVA 4GC9A 3UJNA 2C9OA 3AOEA 3HJ8A 4FD2A 4GKJM 3VKGA 3ILKA 1SXJD 4L4UA 4DR2M 4OX9M 3IG8A 2Y20A 1DGFA 1J7KA 3RFWA 4L8RC 4IIWA 3SAVA 3KOXE 1JR3A 3FKEA 4PCZA 1PJJA 2D7HA 5EXTA 1EE8A 4LFBM 4PDIA 4LF9M 2QENA 5FSWA 4IBEA 2J7NA 4QOSA 1N36M 4G4RA 2DWMA 3Q8XA 1N78A 3U6QA 2X4AA 3MHVC 4GIPA 4MGYE 4FCVA 2V1UA 4M9ZA 5KPTA 1FJGM 5LMUM 1XWIA 1E9SA 3B9PA 3K92A 4GITA 1N32M 2R65A 3T15A 2CE7A 3PNVA 1SXJC 3KOWE 3CTWB 5IZ7D 3H4MA 3KOZE 5EP3A 3K2LA 3U6LA 1E32A 4MH0E 5DYIA 4L16A 3GLIA 3M7GA 2RKOA 1I94M 2CV1A 3KSXA 5KQ8A 4LJ6A 4GC5A 1G4AE 3ZC7B 2C98A 4JI4M 4MB7A 4AKIA 3GLIB 5BPVA 4LY6A 5C18A 4AKGA 1T3TA 4M9SA 2VIIA 4IBJA 2CV2A 1K3WA 2UUAM 3CF2A 2QBYB 1QYRA 1IY2A 4Z8XA 1I4WA 3GRVA 1R7RA 3L28A 2Y21A 5IREB 4S12A 4DUZM 3TWLA 4AZFA 1N75A 3RE8A 3JAMS 1TH2A 3BOSA 1GKIA 4HLQA 4W5WA 2ZANA 2FE8A 1DGBA 5FTMA 3GPUA 3GO8A 4DR7M 2Y0QA 4D81A 1OFIA 2A5YB 2XGNA 2XLJA 3GLFA 4DV1M 4BBAA 1HR0M 3GRYA 4GH9A 4QNRA 3GLGB 2FOIC 4XBOA 4AI6A 2Y0TA 4LJ9A 3DA1A 1TDHA 3KDSE 1L2DA 3WHLA 4IBBA 4D82A 5FTKA 4IBIA 1Z5CA 1J5EM 1NY5A 2EA0A 3I51A 2KA6B 2L6OA 1QAMA 1QAOA 2F5OA 1IN8A 2DVWB 2R4JA 4OVZB 1OFHA 4LF4M 3R9XB 3TPZA 5H37D 3VDUA 4FWGA 2R4EA 4CGYB 2D7EA 2D7GA 2LNHC 1DGGA 4QHSA 3L29A 4DR1M 3M6AA 3LVVA 3SHFA 3TL4X 1IN5A 4LZJA 2G8LA 2W82A 5LMNM 3FUWA 3I4YA 5ITTA 4DUYM 3HJQA 2QP9X 3J7AS 1OJLA 3DFZA 1TH4A 2OPFA 1YUBA 3THGA 2KEBA 3TE6A 5JI3E 2ERCA 2CEAA 2Z4RA 3LQRA 5EP4A 3SAUA 4DV5M 4D80A 2XSZD 4WW0A 3QAUA 4LRSA 4R7GA 3KP0E 3WHKA 2X8AA 4LRTA 4DR3M 1XC8A 2C96A 2UUBM 1IN6A 4I5SA 3HJSA 3FUXA 2ZBKB 1Z6TA 4X62M 2V6ZM 3ZH9B 2F4VM 3U6OA 1XNQM 4MGIE 3SYLA 3VKHA 3GLHA 3VLFB 1R2ZA 1IN7A 1J09A 1IN4A 5EP2A 2EO2A 4G4NA 4B3RM 1IBMM 1G8PA 4KO8A 3SAWA 1W5TA 4JI2M 3PNYA 2BNKA 3L27A 1QZMA 5F3WA 3GPYA 3U60B 2M60A 5ITXA 3MJ5A 1GLNA 3GQ3A 4MGHA 4DV0M 3GRUA 3U5ZA 2L7IA 3HHZA 1DO0A 4RF0A 2VQFM 2H1RA 1KYIA 2E5LM 4LF5M 1G41A 2LXEA 1NY6A 4JI3M 3GP1A 1UM8A 2FNAA 3PVSA 2CHQA 5ITRA 4IBKA 1HQCA 4P16A 2KXEA 2XZUA 1GL6A 1QANA 3J2PB 3VFDA 3DZDA 2LH0A 4NOOB 3KW6A 1SXJB 2O5RA 4PT5A 3U6MA 3FTEA 3JR4A 1YSYA 4DV4M 4GRIA 2FFJA 5KQDA 2F5QA 4M0DA 5EXPA 2UU9M 1L2BA 3TQSA 2KZUA 4CISA 1N33M 5IT9S 3KOYE 4ITQA 4II7A 3SASA 2R62A 4GMQA 3FTCA 3HHYA 4L15A 2Z3XA 4LF7M 1IY0A 4WURA 4JYAM 1IBKM 1Z5AA 4JXJA 4EIWA 1L1TA 4IJEA 3SHGB 2UXBM 4DV3M 4LFCM 1Q3CA 2XH9A 4NSRA 2XSZA 3TWKA 2NQ8C 2I7PA 1D2NA 5ITUA 4DV2M 5E26A 1WXQA 2P5TA 4LG2A 2Z7JA 4AW4A 2C99A 3NWLA 2LWXA 4X65M 2CUZA 1IXZA 3NBIA 4NL4H 4AKHA 1HT1E 4LJ5A 2L09A 4IJFA 3UGJA 3A46A 5ITQA 4IBGA 5EP1A 1NVMA 4TUWA 4AG6A 4JI5M 2XF3A 4GHAA 1IY1A 3M0EA 3FTDA 2UXCM 3ZCBB 3HU1A 3SC3A 3L25A 4IBDA 3SYKA 2Q2EB 2DZOB 2YQZA 4LJAA 2QBYA 4RNAA 5E6JA 4DV6M 4FCWA 4R3DA 2YFQA 3U6SA 2RGOA 1L1ZA 4G4OA 1VDDA 3GRRA 3W0FA 5A2QS 2QZ4A 1ZQ9A 3VK7A 1GVNA 3HGIA 4PD2A 4NXMM 1XNRM 4CHTB 2ZAMA 3SBJA 8CATA 5KO3A 4YY3M 3KXEC 3AL0C 1MX0A 4LJ8A 4Z6YA 3PFIA 4KHPM 2DZNB 3KS8A 3E9SA 3OTOM 4GHLA 4FW9A 1KSFX 4KLNA 2JA2A 3LVWA 4OW0A 2QCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 M;  1PM5 A;  4DV7 M;  2E5L M;  3TWM A;  3T1Y M;  4LF5 M;  4JI7 M;  4JI3 M;  3GP1 A;  1XMO M;  1Z5B A;  5ITR A;  2UUA M;  1K3W A;  2XZU A;  5ITX E;  4G4Q A;  3SAT A;  5FLX S;  4DUZ M;  3U6P A;  3TWL A;  3U6M A;  1L2C A;  3JAM S;  4YHH M;  1PJI A;  1Q39 A;  3JR4 A;  3GPP A;  5BR8 M;  3GPU A;  4DR4 M;  1IBL M;  4DV4 M;  3GO8 A;  4DR7 M;  2F5Q A;  4DV1 M;  1HR0 M;  1KFV A;  2UU9 M;  3J81 S;  1L2B A;  2OQ4 A;  2UXD M;  4NXN M;  3SAR A;  4CIS A;  1N33 M;  5IT9 S;  4ITQ A;  3JR5 A;  3SAS A;  2ZM6 M;  4LFA M;  2HKJ A;  1TDH A;  1L2D A;  1K3X A;  3T1H M;  4LF7 M;  1K82 A;  4JYA M;  1IBK M;  1Z5A A;  4DR5 M;  1Z5C A;  1J5E M;  1L1T A;  1MU5 A;  3GPX A;  5ITY A;  3J80 S;  4B3T M;  2UXB M;  4DV3 M;  2EA0 A;  1Q3C A;  4LFC M;  1R2Y A;  4LF8 M;  2F5P A;  3GQ4 A;  3TWK A;  4X66 M;  5ITU A;  4DV2 M;  2F5O A;  4NRV A;  5IWA M;  4JV5 M;  4DR6 M;  4LF4 M;  1Z59 A;  4DR1 M;  4GKJ M;  2F5S A;  4B3S M;  3VK8 A;  4X64 M;  3DOA A;  4DR2 M;  4OX9 M;  4X65 M;  5LMN M;  2VQE M;  4GKK M;  5ITT A;  3GQ5 A;  4DUY M;  3U6C A;  4AQY M;  3SAV A;  3J7A S;  4PCZ A;  1N34 M;  2F5N A;  1PJJ A;  1Q3B A;  3A46 A;  1TDZ A;  5ITQ A;  2OPF A;  1EE8 A;  4LFB M;  4PDI A;  4LF9 M;  4B3M M;  4JI5 M;  3U6D A;  3SAU A;  2XZF A;  2UXC M;  1N36 M;  4G4R A;  4JI1 M;  4DV5 M;  2Q2E B;  1XC8 A;  1HNZ M;  3U6Q A;  4DR3 M;  4DV6 M;  2UUB M;  3U6S A;  3A45 A;  4JI8 M;  1FJG M;  5LMU M;  2ZBK B;  1L1Z A;  4X62 M;  4G4O A;  3W0F A;  1N32 M;  5A2Q S;  3U6E A;  2F4V M;  1HNX M;  3VK7 A;  3U6O A;  4PD2 A;  1XNQ M;  4PDG A;  4NXM M;  1XNR M;  1R2Z A;  3U6L A;  4G4N A;  3SBJ A;  4B3R M;  1IBM M;  1I94 M;  4YY3 M;  1NNJ A;  3SAW A;  1XMQ M;  4JI2 M;  4K0K M;  3A42 A;  3C58 A;  2UUC M;  3GPY A;  1HNW M;  5ITX A;  4JI6 M;  1MX0 A;  3GQ3 A;  4KHP M;  4JI4 M;  4DV0 M;  2HHH M;  3OTO M;  4MB7 A;  4LF6 M;  4NRW A;  2VQF M; 
#chains in the Genus database with same CATH topology
 3B7Z A;  1PM5 A;  3AFH A;  3TWM A;  3T1Y M;  1X37 A;  2BJW A;  2DAE A;  2V1C A;  1XXH B;  4G6Z A;  5KPZ A;  3HU2 A;  1DO2 A;  2MJ5 B;  2XEP A;  5DNY A;  2CWB A;  2CFO A;  2OOB A;  4UN2 B;  3C9P A;  2QPA A;  3E4R A;  3HHX A;  1LV7 A;  1E94 E;  4LGM A;  4MGZ E;  5GKN A;  4B7G A;  5KPR A;  5ITX E;  4OVZ A;  3L26 A;  4BLC A;  3U61 A;  3U5Z B;  3SAT A;  1HT2 E;  1GL7 A;  4LZZ A;  1GO5 A;  1VDL A;  4B7H A;  3SFZ A;  1HQY E;  2JZ1 A;  2RGH A;  3HWS A;  2VDB B;  1VEG A;  1L2C A;  1G59 A;  1IQP A;  3I4V A;  4YHH M;  3RGS A;  1PJI A;  1Q39 A;  1YE9 A;  4XGI A;  5BR8 M;  3GPP A;  1PJS A;  1QVR A;  4DR4 M;  1AUA A;  1IBL M;  3FYC A;  2JY7 A;  4MGK E;  3R8F A;  1XHB A;  5FTL A;  4B7F A;  2XFS A;  3K8Z A;  1OIZ A;  4GEW A;  2UXD M;  4NXN M;  3SAR A;  3U60 A;  1JR3 D;  5EQT A;  3FUT A;  3JR5 A;  4LFA M;  2HKJ A;  3HKP A;  1MN3 A;  4OU7 A;  1NHG C;  1K3X A;  3T1H M;  2R45 A;  4REZ A;  1JB0 F;  3K9P A;  2DWZ B;  1PJT A;  4WP2 A;  3UZU A;  4DR5 M;  2DXI A;  2DAI A;  1MU5 A;  3HZJ A;  3GPX A;  2CP8 A;  3J80 S;  5ITY A;  4B3T M;  4I81 A;  4Y28 F;  4ZPX A;  2CHG A;  1R2Y A;  1C1K A;  3KVW A;  3RGP A;  2JWS A;  4JV5 M;  1FNN A;  4DR6 M;  2M5Z A;  1ORY B;  4QHT A;  1Z59 A;  3KSJ A;  2XFT A;  1OAI A;  2F5S A;  4B3S M;  3VK8 A;  2KZS A;  3GLH B;  3DOA A;  4X64 M;  2DAM A;  2KNA A;  4M0W A;  1A5T A;  2VQE M;  4GKK M;  1H6U A;  1SXJ E;  2DEN A;  3AOG A;  3FYD A;  3GQ5 A;  4AQY M;  3U6C A;  1HNZ M;  3GLF B;  2DWL A;  3KS4 A;  1S3S A;  2YNM D;  1N34 M;  3IG5 A;  2F5N A;  1Q3B A;  2YR0 A;  4FCT A;  1TDZ A;  2DI0 A;  4I4L A;  2ZAO A;  4M9X A;  4QOZ C;  2RRU A;  2EJS A;  3D8B A;  4JN6 A;  3PXG A;  4B3M M;  4MM3 B;  3ZQJ A;  4A3V B;  2HCB A;  3J27 B;  2FS1 A;  1OQY A;  3CF0 A;  3U6D A;  5C1B A;  4LF6 M;  5EXS A;  2XZF A;  4FWH A;  4R71 A;  4JI1 M;  2LHC A;  2C9C A;  5JI2 E;  3FTF A;  2R18 A;  4CIZ A;  1VEJ A;  1ZAE A;  3A98 B;  2J7O A;  2G5G X;  1P3Q Q;  3AJI B;  1IXR C;  1IXS B;  3A45 A;  2KRU A;  1G3I A;  4JI8 M;  3FUU A;  5FTJ A;  3CF6 E;  4B08 A;  4I8O A;  3U6E A;  1SXJ A;  2MRO B;  1QAQ A;  4LGY A;  1HNX M;  2OO9 A;  3VDP A;  1EFU B;  2R46 A;  1SG9 A;  3C3D A;  3CGW A;  3EIE A;  3FD9 A;  1NNU C;  3LCU A;  3QYE A;  1IM2 A;  4F1I A;  4PDG A;  3J7B A;  3AV0 A;  5DYG A;  1GJT A;  1NNJ A;  3K9O A;  4LJ7 A;  3AKZ A;  1XMQ M;  1OKS A;  3A42 A;  3FRI A;  3C58 A;  4K0K M;  3GLG A;  1QDT A;  1QUT A;  2UUC M;  3D8L A;  4QNM A;  2LVQ D;  1HNW M;  4JI6 M;  2ZTC A;  2K47 A;  5FTN A;  3QWL A;  4IBF A;  2HHH M;  4NRW A;  3SMP A;  2CHV A;  2HL7 A;  1E9R A;  4JI0 M;  4DV7 M;  1NJG A;  4JI7 M;  1XMO M;  1DGH B;  1L8Q A;  4KOD A;  4FWD A;  1QQW A;  1Z5B A;  2KRK A;  3EIH A;  2J5Y A;  2KDL A;  2L7H A;  4Q7J A;  4G4Q A;  3L2A A;  3LMM A;  5FLX S;  7CAT A;  3K1J A;  3GLF E;  3QYB A;  3W68 A;  2C5R A;  2CV0 A;  2LVN C;  3U6P A;  1TGU A;  1YLA A;  2CRU A;  1W5S A;  3I04 M;  1DGH A;  3HU3 A;  3UMM A;  4NSO B;  2WSC F;  2X49 A;  4P17 A;  5EJC A;  1JR3 E;  2APL A;  4RF1 A;  3KFU G;  1NHW C;  1KFV A;  3J81 S;  2EUC A;  5EXX A;  2OQ4 A;  2BJV A;  4L78 A;  3AOE C;  3T38 A;  4AG5 A;  3KP1 E;  3MK6 A;  3B7Q A;  2DWN A;  2ZM6 M;  3LQQ A;  2AHM A;  1Y8G A;  4BB9 A;  1QZE A;  4LCB A;  2Z4S A;  3SMS A;  1N77 A;  4HL4 A;  1JQJ C;  1K82 A;  4FVM A;  1R6B X;  3B7N A;  2LTU A;  3UK6 A;  2DHR A;  3W0L B;  1XXH A;  4IBC A;  2LVP C;  1ZMV A;  2KW0 A;  3HHW A;  2R44 A;  4LF8 M;  2F5P A;  3GQ4 A;  2HWJ A;  4LJ4 A;  4X66 M;  2I7N A;  1NSF A;  3FE3 A;  4NRV A;  1NJF A;  5IWA M;  3U61 B;  1QDR A;  1TH3 A;  3FUV A;  4GC9 A;  3UJN A;  3B89 A;  2C9O A;  3AOE A;  3HJ8 A;  4FD2 A;  4GKJ M;  3VKG A;  3ILK A;  1SXJ D;  4L4U A;  4DR2 M;  4OX9 M;  2JZ0 A;  3IG8 A;  2Y20 A;  1DGF A;  1J7K A;  3RFW A;  4L8R C;  4IIW A;  3SAV A;  3KOX E;  1JR3 A;  3FKE A;  4PCZ A;  1PRB A;  1PJJ A;  2L4F A;  2L4E A;  2D7H A;  1QUS A;  5EXT A;  1EE8 A;  1TTE A;  4PDI A;  4LF9 M;  4LFB M;  2QEN A;  1XXH E;  5FSW A;  4IBE A;  2DZL A;  4DBG B;  2JY8 A;  2J7N A;  3GLI E;  4QOS A;  1N36 M;  4G4R A;  2DWM A;  3Q8X A;  1N78 A;  2VF8 A;  3U6Q A;  2JUJ A;  2QHO B;  2LHG A;  2X4A A;  3MHV C;  4GIP A;  4HEO A;  4MGY E;  4FCV A;  2V1U A;  4M9Z A;  5KPT A;  1FJG M;  5LMU M;  1XWI A;  1E9S A;  1WGL A;  3B9P A;  3K92 A;  4GIT A;  1N32 M;  2R65 A;  1T43 A;  3T15 A;  2CE7 A;  1GJS A;  2H5X A;  3PNV A;  1SXJ C;  1V33 A;  3KOW E;  3CTW B;  5IZ7 D;  3H4M A;  2EKF A;  3KOZ E;  5EP3 A;  3K2L A;  3U6L A;  1E32 A;  4MH0 E;  2BWE A;  5DYI A;  4L16 A;  4NC6 A;  3GLI A;  3M7G A;  2RKO A;  1I94 M;  5L8R F;  2CV1 A;  3KSX A;  2QNJ A;  5KQ8 A;  2KNZ A;  4LJ6 A;  1RU3 A;  4GC5 A;  1G4A E;  1ZV1 A;  3ZC7 B;  2C98 A;  4L6V 6;  4JI4 M;  3LCV B;  4ANR A;  4MB7 A;  2OOA A;  4AKI A;  3GLI B;  5BPV A;  4LY6 A;  2K0B X;  5C18 A;  1Q02 A;  4AKG A;  1T3T A;  4M9S A;  2VII A;  4IBJ A;  1PGY A;  2CV2 A;  1K3W A;  2UUA M;  3CF2 A;  2QBY B;  2R0I A;  1QYR A;  1IY2 A;  1OIP A;  1I4W A;  4Z8X A;  1IXS A;  3GRV A;  3LW5 F;  2QQ8 A;  1R7R A;  2K9D A;  3L28 A;  2Y21 A;  5IRE B;  4S12 A;  4DUZ M;  3TWL A;  2L2D A;  4AZF A;  1N75 A;  3RE8 A;  3JAM S;  1TH2 A;  3BOS A;  1WGN A;  1GKI A;  4HLQ A;  4W5W A;  1G71 A;  2ZAN A;  2FE8 A;  1DGB A;  5FTM A;  3GPU A;  3GO8 A;  4DR7 M;  2Y0Q A;  4D81 A;  1OFI A;  2A5Y B;  2XGN A;  2XLJ A;  3GLF A;  1LTM A;  4BBA A;  4DV1 M;  1HR0 M;  3GRY A;  4GH9 A;  4QNR A;  3GLG B;  1C7Y A;  2FOI C;  4XBO A;  4AI6 A;  2B3T A;  2Y0T A;  4LJ9 A;  3DA1 A;  1TDH A;  3KDS E;  1L2D A;  3WHL A;  4IBB A;  2WSE F;  4D82 A;  5FTK A;  1F4I A;  4IBI A;  1Z5C A;  2BWB A;  1J5E M;  1MJG M;  1NY5 A;  3F92 A;  2EKK A;  2EA0 A;  3I51 A;  2KA6 B;  2L6O A;  1VG5 A;  1QAM A;  1QAO A;  2F5O A;  1IN8 A;  2DVW B;  2R4J A;  4OVZ B;  1OFH A;  4LF4 M;  3R9X B;  3TPZ A;  5H37 D;  3VDU A;  4FWG A;  2R4E A;  4CGY B;  2D7E A;  1D0L A;  2D7G A;  1DGG A;  2LNH C;  2GNO A;  3L29 A;  4QHS A;  3M6A A;  3LVV A;  3SHF A;  3TL4 X;  1IN5 A;  4LZJ A;  2G8L A;  2W82 A;  5LMN M;  3FUW A;  2LVA A;  2MR9 A;  1OTR A;  3I4Y A;  5ITT A;  4DUY M;  3HJQ A;  2G3Q A;  2JP7 A;  2QP9 X;  3MMP A;  3J7A S;  1OJL A;  3DFZ A;  1TH4 A;  2OPF A;  1V34 A;  1YUB A;  4F2L A;  3THG A;  2KEB A;  1WIV A;  3TE6 A;  5JI3 E;  2ERC A;  2CEA A;  1ZMU A;  2Z4R A;  3LQR A;  5EP4 A;  3SAU A;  4RKU F;  2JY6 B;  4D80 A;  2XSZ D;  4DV5 M;  4WW0 A;  3QAU A;  4LRS A;  4R7G A;  3KP0 E;  3WHK A;  2X8A A;  4LRT A;  2HAK A;  3NBX X;  4DR3 M;  2C96 A;  2UUB M;  1IN6 A;  1HJP A;  1VEK A;  2O01 F;  3HJS A;  4I5S A;  3FUX A;  2ZBK B;  4XK8 F;  1Z6T A;  4X62 M;  2V6Z M;  3ZH9 B;  2QSF X;  1UFZ A;  1AIP C;  4CJ6 A;  2F4V M;  3U6O A;  1XNQ M;  4MGI E;  1NO1 A;  3SYL A;  3VKH A;  4G3O A;  3GLH A;  3VLF B;  1R2Z A;  1IN7 A;  1J09 A;  1IN4 A;  1ZMW A;  3E21 A;  5EP2 A;  2EO2 A;  4G4N A;  4B3R M;  2FH0 A;  1IBM M;  1G8P A;  4KO8 A;  3SAW A;  1W5T A;  4JI2 M;  3PNY A;  2BNK A;  3L27 A;  1QZM A;  5F3W A;  4KT0 F;  1XB2 B;  3GPY A;  3U60 B;  2M60 A;  5ITX A;  4DR1 M;  3MJ5 A;  1GLN A;  3GQ3 A;  4MGH A;  4DV0 M;  3GRU A;  2MH8 A;  3U5Z A;  2L7I A;  3HHZ A;  1DO0 A;  4RF0 A;  2VQF M;  2H1R A;  1BVS A;  1KYI A;  2E5L M;  1OAO C;  4LF5 M;  1G41 A;  2LXE A;  1NY6 A;  4JI3 M;  2KNV A;  3GP1 A;  1UM8 A;  2FNA A;  2JY5 A;  2LBC A;  3PVS A;  1TF0 B;  2CHQ A;  5ITR A;  4IBK A;  1GAB A;  1HQC A;  4P16 A;  2KXE A;  2XZU A;  1GL6 A;  1QAN A;  3J2P B;  3T6P A;  2O25 A;  3VFD A;  3DZD A;  2LH0 A;  4NOO B;  2N35 A;  3KW6 A;  3BXW A;  1SXJ B;  2O5R A;  4PT5 A;  3U6M A;  2DHY A;  1PJQ A;  2K6B A;  1D0M A;  2DAK A;  3FTE A;  3GLH E;  3JR4 A;  1YSY A;  4DV4 M;  4GRI A;  2FFJ A;  5KQD A;  2DNA A;  2F5Q A;  1VQ1 A;  4M0D A;  5EXP A;  3Q8G A;  2UU9 M;  1L2B A;  3TQS A;  2KZU A;  4CIS A;  1N33 M;  2R6F A;  3KOY E;  5IT9 S;  4ITQ A;  4II7 A;  3SAS A;  2R62 A;  4GMQ A;  3FTC A;  3HHY A;  4L15 A;  1CUK A;  2Z3X A;  4LF7 M;  1IY0 A;  4WUR A;  1D0K A;  2DKL A;  4JYA M;  1IBK M;  1Z5A A;  4JXJ A;  4EIW A;  1V92 A;  2JXN A;  1L1T A;  3E46 A;  4IJE A;  2VF7 A;  3W67 A;  3SHG B;  2UXB M;  4DV3 M;  4LFC M;  1Q3C A;  2XH9 A;  4NSR A;  2XSZ A;  3TWK A;  2NQ8 C;  1WR1 B;  1D2N A;  2I7P A;  5ITU A;  3GLG E;  4DV2 M;  5E26 A;  1WXQ A;  2P5T A;  4LG2 A;  2Z7J A;  3B74 A;  3IEC A;  2C99 A;  4AW4 A;  2ZTD A;  3NWL A;  2LWX A;  3IHP A;  4X65 M;  2GQF A;  1T6O A;  1IXZ A;  2CUZ A;  3NBI A;  4NL4 H;  2WZJ A;  2WSF F;  1WHC A;  1HT1 E;  4LJ5 A;  2L09 A;  4IJF A;  4AKH A;  1WJ7 A;  2LVO C;  3FRH A;  3UGJ A;  3A46 A;  1NV9 A;  5ITQ A;  3HX3 A;  1R4G A;  4IBG A;  5EP1 A;  1NVM A;  4TUW A;  2MGW A;  4AG6 A;  4JI5 M;  2XF3 A;  3HY5 A;  3I01 M;  4GHA A;  1IY1 A;  3M0E A;  3FTD A;  1XC8 A;  2UXC M;  3ZCB B;  3HU1 A;  3SC3 A;  3L25 A;  4IBD A;  3SYK A;  2Q2E B;  2DZO B;  2YQZ A;  4LJA A;  2QBY A;  4RNA A;  5E6J A;  4DV6 M;  4FCW A;  4R3D A;  2YFQ A;  3U6S A;  2RGO A;  1L1Z A;  2Z8Y M;  1DV0 A;  4G4O A;  1NV8 A;  1VDD A;  3GRR A;  3W0F A;  5A2Q S;  2QZ4 A;  1ZQ9 A;  2DAG A;  1GVN A;  2JNH A;  1TR8 A;  3HGI A;  4PD2 A;  3VK7 A;  4NXM M;  1EIJ A;  1XNR M;  1R5L A;  4CHT B;  1IFY A;  5DFL A;  2ZAM A;  3SBJ A;  8CAT A;  3V76 A;  5KO3 A;  4YY3 M;  3BBZ A;  3C3E A;  3KXE C;  2KHH A;  3AL0 C;  1MX0 A;  4LJ8 A;  4Z6Y A;  3PFI A;  4KHP M;  3H4J A;  2DZN B;  3KS8 A;  3E9S A;  3OTO M;  4GHL A;  4FW9 A;  1KSF X;  4KLN A;  2JA2 A;  3LVW A;  4OW0 A;  2QCU A; 
#chains in the Genus database with same CATH homology
 1PM5 A;  3AFH A;  3TWM A;  3T1Y M;  1X37 A;  2BJW A;  2V1C A;  1XXH B;  4G6Z A;  5KPZ A;  3HU2 A;  1DO2 A;  2XEP A;  5DNY A;  2CFO A;  3E4R A;  2QPA A;  3HHX A;  4LGM A;  1LV7 A;  1E94 E;  4MGZ E;  5GKN A;  4B7G A;  5KPR A;  5ITX E;  3L26 A;  4OVZ A;  3U61 A;  4BLC A;  3U5Z B;  3SAT A;  1HT2 E;  1GL7 A;  4LZZ A;  4B7H A;  3SFZ A;  1HQY E;  2RGH A;  3HWS A;  1L2C A;  1G59 A;  1IQP A;  3I4V A;  4YHH M;  3RGS A;  1PJI A;  1Q39 A;  1YE9 A;  4XGI A;  5BR8 M;  3GPP A;  1QVR A;  4DR4 M;  1IBL M;  3FYC A;  3R8F A;  4MGK E;  1XHB A;  5FTL A;  4B7F A;  2XFS A;  3K8Z A;  2UXD M;  4NXN M;  3SAR A;  3U60 A;  1JR3 D;  5EQT A;  3FUT A;  3JR5 A;  4LFA M;  2HKJ A;  3HKP A;  4OU7 A;  1NHG C;  1K3X A;  3T1H M;  2R45 A;  4REZ A;  2DWZ B;  3UZU A;  4DR5 M;  2DXI A;  1MU5 A;  3GPX A;  5ITY A;  3J80 S;  4B3T M;  4I81 A;  4ZPX A;  2CHG A;  1R2Y A;  1C1K A;  3KVW A;  3RGP A;  4JV5 M;  1FNN A;  4DR6 M;  2M5Z A;  1ORY B;  4QHT A;  1Z59 A;  3KSJ A;  2XFT A;  2F5S A;  4B3S M;  3VK8 A;  2KZS A;  3GLH B;  3DOA A;  4X64 M;  4M0W A;  2VQE M;  4GKK M;  1H6U A;  1SXJ E;  3AOG A;  3FYD A;  3GQ5 A;  4AQY M;  3U6C A;  1HNZ M;  3GLF B;  2DWL A;  3KS4 A;  1S3S A;  2YNM D;  1N34 M;  3IG5 A;  2F5N A;  1Q3B A;  2YR0 A;  4FCT A;  1TDZ A;  4I4L A;  4QOZ C;  2ZAO A;  4M9X A;  3D8B A;  4JN6 A;  3PXG A;  4B3M M;  4MM3 B;  4A3V B;  2HCB A;  3J27 B;  3CF0 A;  3U6D A;  5C1B A;  4LF6 M;  5EXS A;  2XZF A;  4FWH A;  4JI1 M;  5JI2 E;  2C9C A;  3FTF A;  2R18 A;  1ZAE A;  3A98 B;  2J7O A;  2G5G X;  3AJI B;  1IXR C;  1IXS B;  3A45 A;  2KRU A;  1G3I A;  4JI8 M;  3FUU A;  5FTJ A;  3CF6 E;  4B08 A;  4I8O A;  3U6E A;  1SXJ A;  4LGY A;  1QAQ A;  1HNX M;  3VDP A;  2R46 A;  3EIE A;  3FD9 A;  4PDG A;  1NNU C;  1IM2 A;  3J7B A;  3AV0 A;  5DYG A;  1NNJ A;  4LJ7 A;  3AKZ A;  1XMQ M;  4K0K M;  3A42 A;  3C58 A;  3GLG A;  2UUC M;  3D8L A;  4QNM A;  1HNW M;  4JI6 M;  2K47 A;  5FTN A;  3QWL A;  4IBF A;  2HHH M;  4NRW A;  3SMP A;  2CHV A;  2HL7 A;  1E9R A;  4JI0 M;  4DV7 M;  1NJG A;  4JI7 M;  1XMO M;  1DGH B;  1L8Q A;  4KOD A;  4FWD A;  1QQW A;  1Z5B A;  2KRK A;  3EIH A;  2L7H A;  4G4Q A;  3L2A A;  3LMM A;  5FLX S;  7CAT A;  3K1J A;  2C5R A;  2CV0 A;  3U6P A;  1TGU A;  1W5S A;  1DGH A;  3HU3 A;  3UMM A;  4NSO B;  2X49 A;  5EJC A;  4RF1 A;  3KFU G;  1NHW C;  1KFV A;  3J81 S;  2EUC A;  5EXX A;  2OQ4 A;  2BJV A;  4L78 A;  3AOE C;  3T38 A;  4AG5 A;  3KP1 E;  3MK6 A;  2DWN A;  2ZM6 M;  3LQQ A;  2AHM A;  4BB9 A;  4LCB A;  3SMS A;  2Z4S A;  1N77 A;  1K82 A;  4HL4 A;  1JQJ C;  4FVM A;  1R6B X;  3UK6 A;  2DHR A;  3W0L B;  1XXH A;  4IBC A;  2KW0 A;  3HHW A;  4LF8 M;  2F5P A;  3GQ4 A;  4LJ4 A;  4X66 M;  2I7N A;  1NSF A;  4NRV A;  1NJF A;  5IWA M;  3U61 B;  1TH3 A;  3FUV A;  4GC9 A;  3UJN A;  2C9O A;  3AOE A;  3HJ8 A;  4FD2 A;  4GKJ M;  3VKG A;  3ILK A;  1SXJ D;  4L4U A;  4DR2 M;  4OX9 M;  3IG8 A;  2Y20 A;  1DGF A;  1J7K A;  3RFW A;  4L8R C;  4IIW A;  3SAV A;  3KOX E;  1JR3 A;  3FKE A;  4PCZ A;  1PJJ A;  2D7H A;  5EXT A;  1EE8 A;  4LFB M;  4PDI A;  4LF9 M;  2QEN A;  5FSW A;  4IBE A;  2J7N A;  4QOS A;  1N36 M;  4G4R A;  2DWM A;  3Q8X A;  1N78 A;  3U6Q A;  2X4A A;  3MHV C;  4GIP A;  4MGY E;  4FCV A;  2V1U A;  4M9Z A;  5KPT A;  1FJG M;  5LMU M;  1XWI A;  1E9S A;  3B9P A;  3K92 A;  4GIT A;  1N32 M;  2R65 A;  3T15 A;  2CE7 A;  3PNV A;  1SXJ C;  3KOW E;  3CTW B;  5IZ7 D;  3H4M A;  3KOZ E;  5EP3 A;  3K2L A;  3U6L A;  1E32 A;  4MH0 E;  5DYI A;  4L16 A;  3GLI A;  3M7G A;  2RKO A;  1I94 M;  2CV1 A;  3KSX A;  5KQ8 A;  4LJ6 A;  4GC5 A;  1G4A E;  3ZC7 B;  2C98 A;  4JI4 M;  4MB7 A;  4AKI A;  3GLI B;  5BPV A;  4LY6 A;  5C18 A;  4AKG A;  1T3T A;  4M9S A;  2VII A;  4IBJ A;  2CV2 A;  1K3W A;  2UUA M;  3CF2 A;  2QBY B;  1QYR A;  1IY2 A;  4Z8X A;  1I4W A;  3GRV A;  1R7R A;  3L28 A;  2Y21 A;  5IRE B;  4S12 A;  4DUZ M;  3TWL A;  4AZF A;  1N75 A;  3RE8 A;  3JAM S;  1TH2 A;  3BOS A;  1GKI A;  4HLQ A;  4W5W A;  2ZAN A;  2FE8 A;  1DGB A;  5FTM A;  3GPU A;  3GO8 A;  4DR7 M;  2Y0Q A;  4D81 A;  1OFI A;  2A5Y B;  2XGN A;  2XLJ A;  3GLF A;  4DV1 M;  4BBA A;  1HR0 M;  3GRY A;  4GH9 A;  4QNR A;  3GLG B;  2FOI C;  4XBO A;  4AI6 A;  2Y0T A;  4LJ9 A;  3DA1 A;  1TDH A;  3KDS E;  1L2D A;  3WHL A;  4IBB A;  4D82 A;  5FTK A;  4IBI A;  1Z5C A;  1J5E M;  1NY5 A;  2EA0 A;  3I51 A;  2KA6 B;  2L6O A;  1QAM A;  1QAO A;  2F5O A;  1IN8 A;  2DVW B;  2R4J A;  4OVZ B;  1OFH A;  4LF4 M;  3R9X B;  3TPZ A;  5H37 D;  3VDU A;  4FWG A;  2R4E A;  4CGY B;  2D7E A;  2D7G A;  2LNH C;  1DGG A;  4QHS A;  3L29 A;  4DR1 M;  3M6A A;  3LVV A;  3SHF A;  3TL4 X;  1IN5 A;  4LZJ A;  2G8L A;  2W82 A;  5LMN M;  3FUW A;  3I4Y A;  5ITT A;  4DUY M;  3HJQ A;  2QP9 X;  3J7A S;  1OJL A;  3DFZ A;  1TH4 A;  2OPF A;  1YUB A;  3THG A;  2KEB A;  3TE6 A;  5JI3 E;  2ERC A;  2CEA A;  2Z4R A;  3LQR A;  5EP4 A;  3SAU A;  4DV5 M;  4D80 A;  2XSZ D;  4WW0 A;  3QAU A;  4LRS A;  4R7G A;  3KP0 E;  3WHK A;  2X8A A;  4LRT A;  4DR3 M;  1XC8 A;  2C96 A;  2UUB M;  1IN6 A;  4I5S A;  3HJS A;  3FUX A;  2ZBK B;  1Z6T A;  4X62 M;  2V6Z M;  3ZH9 B;  2F4V M;  3U6O A;  1XNQ M;  4MGI E;  3SYL A;  3VKH A;  3GLH A;  3VLF B;  1R2Z A;  1IN7 A;  1J09 A;  1IN4 A;  5EP2 A;  2EO2 A;  4G4N A;  4B3R M;  1IBM M;  1G8P A;  4KO8 A;  3SAW A;  1W5T A;  4JI2 M;  3PNY A;  2BNK A;  3L27 A;  1QZM A;  5F3W A;  3GPY A;  3U60 B;  2M60 A;  5ITX A;  3MJ5 A;  1GLN A;  3GQ3 A;  4MGH A;  4DV0 M;  3GRU A;  3U5Z A;  2L7I A;  3HHZ A;  1DO0 A;  4RF0 A;  2VQF M;  2H1R A;  1KYI A;  2E5L M;  4LF5 M;  1G41 A;  2LXE A;  1NY6 A;  4JI3 M;  3GP1 A;  1UM8 A;  2FNA A;  3PVS A;  2CHQ A;  5ITR A;  4IBK A;  1HQC A;  4P16 A;  2KXE A;  2XZU A;  1GL6 A;  1QAN A;  3J2P B;  3VFD A;  3DZD A;  2LH0 A;  4NOO B;  3KW6 A;  1SXJ B;  2O5R A;  4PT5 A;  3U6M A;  3FTE A;  3JR4 A;  1YSY A;  4DV4 M;  4GRI A;  2FFJ A;  5KQD A;  2F5Q A;  4M0D A;  5EXP A;  2UU9 M;  1L2B A;  3TQS A;  2KZU A;  4CIS A;  1N33 M;  5IT9 S;  3KOY E;  4ITQ A;  4II7 A;  3SAS A;  2R62 A;  4GMQ A;  3FTC A;  3HHY A;  4L15 A;  2Z3X A;  4LF7 M;  1IY0 A;  4WUR A;  4JYA M;  1IBK M;  1Z5A A;  4JXJ A;  4EIW A;  1L1T A;  4IJE A;  3SHG B;  2UXB M;  4DV3 M;  4LFC M;  1Q3C A;  2XH9 A;  4NSR A;  2XSZ A;  3TWK A;  2NQ8 C;  2I7P A;  1D2N A;  5ITU A;  4DV2 M;  5E26 A;  1WXQ A;  2P5T A;  4LG2 A;  2Z7J A;  4AW4 A;  2C99 A;  3NWL A;  2LWX A;  4X65 M;  2CUZ A;  1IXZ A;  3NBI A;  4NL4 H;  4AKH A;  1HT1 E;  4LJ5 A;  2L09 A;  4IJF A;  3UGJ A;  3A46 A;  5ITQ A;  4IBG A;  5EP1 A;  1NVM A;  4TUW A;  4AG6 A;  4JI5 M;  2XF3 A;  4GHA A;  1IY1 A;  3M0E A;  3FTD A;  2UXC M;  3ZCB B;  3HU1 A;  3SC3 A;  3L25 A;  4IBD A;  3SYK A;  2Q2E B;  2DZO B;  2YQZ A;  4LJA A;  2QBY A;  4RNA A;  5E6J A;  4DV6 M;  4FCW A;  4R3D A;  2YFQ A;  3U6S A;  2RGO A;  1L1Z A;  4G4O A;  1VDD A;  3GRR A;  3W0F A;  5A2Q S;  2QZ4 A;  1ZQ9 A;  3VK7 A;  1GVN A;  3HGI A;  4PD2 A;  4NXM M;  1XNR M;  4CHT B;  2ZAM A;  3SBJ A;  8CAT A;  5KO3 A;  4YY3 M;  3KXE C;  3AL0 C;  1MX0 A;  4LJ8 A;  4Z6Y A;  3PFI A;  4KHP M;  2DZN B;  3KS8 A;  3E9S A;  3OTO M;  4GHL A;  4FW9 A;  1KSF X;  4KLN A;  2JA2 A;  3LVW A;  4OW0 A;  2QCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...