5LMNM

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5lmnM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5lmnM02
4K0KM 1MX0A 1IBLM 4LF9M 2OQ4A 3DOAA 4G4OA 1K3XA 4DV2M 4JI4M 3OTOM 3U6MA 4X64M 3GPYA 1PJJA 1N36M 4JI5M 1I94M 3J81S 1L2CA 2UXDM 4DR1M 1NNJA 4LFBM 3T1YM 2XZFA 4LFAM 4LF4M 2UXCM 1J5EM 3W0FA 3SAWA 1Z59A 5FLXS 3SATA 3SASA 2VQEM 1L2BA 1L2DA 1L1ZA 1HR0M 4LF5M 3JR4A 4KHPM 1N33M 4LF7M 3U6SA 2HHHM 4DR4M 4DV6M 5LMNM 4PD2A 1FJGM 4PDIA 1Z5CA 5IWAM 4PDGA 2F4VM 4DUZM 4DV4M 1TDZA 4X66M 4DV1M 2UUCM 4CISA 3U6LA 1Z5BA 1TDHA 3C58A 4DR7M 4NRVA 4DR5M 4JI0M 2F5NA 3VK8A 5ITYA 3J7AS 1L1TA 2UXBM 4JI8M 1HNWM 3GQ3A 4B3TM 5ITXA 2ZBKB 3A45A 1N32M 4JI7M 3SAVA 4OX9M 2EA0A 5ITTA 5ITQA 1XMOM 4NRWA 1R2YA 2Q2EB 4JI3M 5A2QS 1IBMM 1Q3CA 1XNQM 1XNRM 4B3MM 3J80S 4JI6M 1KFVA 2UUBM 2UU9M 3GP1A 4YY3M 2F5OA 2ZM6M 3SBJA 1K3WA 4LF6M 3GPPA 4JV5M 4DV3M 4GKJM 4DUYM 4X62M 4DV0M 4LFCM 3T1HM 4JYAM 2UUAM 4DR6M 3TWMA 4PCZA 3GPUA 1EE8A 3U6QA 5LMUM 1Z5AA 3TWLA 2OPFA 4YHHM 1Q39A 4DV5M 3U6EA 3U6PA 5ITUA 1R2ZA 4LF8M 3SARA 4NXNM 4G4RA 2XZUA 4G4QA 1K82A 3A46A 5BR8M 5ITXE 3U6DA 4B3SM 3JR5A 4ITQA 1N34M 2F5PA 4G4NA 3TWKA 2HKJA 3U6OA 3GQ4A 1Q3BA 4JI2M 4B3RM 4DR3M 3SAUA 5ITRA 1PJIA 4NXMM 4GKKM 1MU5A 3GPXA 2VQFM 3GQ5A 2F5QA 4DV7M 2E5LM 2F5SA 5IT9S 1XMQM 1PM5A 3VK7A 1HNXM 4JI1M 4DR2M 3GO8A 3U6CA 1IBKM 1HNZM 3JAMS 1XC8A 3A42A 4AQYM 4MB7A 4X65M
chains in the Genus database with same CATH superfamily
4F2LA 1MX0A 5EXTA 2D7HA 1IBLM 1IY1A 4LJ8A 2DXIA 3KSXA 4OW0A 4DV2M 3M6AA 2KDLA 5KQDA 3U6MA 2L7HA 4QOZC 5EP3A 2R4JA 3I04M 2A5YB 1IN8A 1UM8A 2JZ0A 3QAUA 2XLJA 4KO8A 1OKSA 5JI3E 3DFZA 2ZANA 2CV0A 4QHTA 3SAWA 3DA1A 1ZMWA 5JI2E 1C7YA 1DV0A 1SXJA 3HHZA 4KHPM 1N33M 2XSZA 1XXHB 3U6SA 4I5SA 4NSOB 4Q7JA 2BJWA 3L25A 1WHCA 4ANRA 3CTWB 4AG5A 4PDGA 3GLFB 1HT1E 1MJGM 2DZNB 2KZSA 3V76A 1TDZA 3SMSA 1XB2B 4CISA 3KDSE 3U5ZA 5GKNA 3LCUA 3HX3A 3IG8A 2DHYA 2X49A 3HZJA 1OFIA 3FTEA 2J5YA 3VK8A 1T6OA 4AG6A 5C1BA 1R4GA 2X8AA 1E9SA 3GQ3A 1NHWC 1VG5A 2G5GX 5ITXA 4CGYB 1D2NA 1NJGA 1XMOM 2Q2EB 4G3OA 2QP9X 3W68A 5A2QS 4R7GA 1XNQM 1XNRM 2KRKA 1IXSA 4FCVA 3J80S 2YQZA 5C18A 3H4JA 4D81A 2UU9M 4YY3M 2BJVA 2DAKA 3HU1A 1OAOC 4LF6M 3FRIA 4GH9A 4DV3M 3HGIA 4DUYM 2DKLA 4FD2A 2JY6B 2LVAA 3AOEA 4JYAM 4AZFA 2DWLA 2R0IA 3U5ZB 5KO3A 4LY6A 2CV2A 4FCWA 2DI0A 2L09A 4PCZA 3PVSA 1Z5AA 2KHHA 3TWLA 4GEWA 3K92A 1OQYA 4NL4H 1Q39A 4B08A 1EIJA 2APLA 1R6BX 4IBCA 4IBEA 1QDTA 1WGNA 4M0DA 5ITUA 3TE6A 1NVMA 1IFYA 3GRVA 1G71A 1AUAA 2JWSA 3GRUA 2XF3A 3FD9A 1ORYB 2P5TA 5BR8M 4IBFA 1OIPA 1H6UA 4M9XA 2HWJA 3AL0C 3HWSA 4IBJA 3RGSA 1DO0A 1GL7A 2D7GA 2DZLA 3KOWE 3U60A 1NV8A 4GHAA 3PNYA 2HKJA 3RGPA 2BWEA 3HJQA 2K9DA 3GLHE 2HL7A 1WJ7A 3QYEA 3B7NA 2DAEA 3U61B 1WXQA 2XGNA 1QYRA 1G8PA 1PJTA 4TUWA 4QNRA 2F5QA 4F1IA 2E5LM 2XFSA 2QENA 4HEOA 3KSJA 3MK6A 2BWBA 4MGIE 2O5RA 2XFTA 3Q8GA 1SXJD 1GO5A 1BVSA 4AKGA 1VEGA 1WIVA 2XSZD 4ZPXA 3LVVA 2RRUA 1YLAA 3GQ5A 2ZTCA 1F4IA 3WHLA 4NSRA 2MGWA 3VLFB 1LV7A 4XBOA 2L2DA 2OQ4A 2EKFA 2GQFA 2C98A 3CF2A 4JI4M 2N35A 3DZDA 3VFDA 4JI5M 2KNAA 1VDDA 1TH4A 2HAKA 3U60B 2KXEA 2I7NA 3F92A 1AIPC 3A98B 1NNJA 4LFAM 4XK8F 2UXCM 1DGHA 3FUUA 1J5EM 1WGLA 1TF0B 3W0FA 3SATA 4FWGA 3E46A 2VQEM 1L2BA 4S12A 4B7HA 1HR0M 3JR4A 1P3QQ 4LF7M 4L16A 1QUSA 1QUTA 4DV6M 4PD2A 2R6FA 3NWLA 2Z4SA 2LVOC 2OOBA 3E21A 2Z4RA 1IY2A 2F4VM 4DUZM 2X4AA 3RE8A 4LGMA 3T6PA 4X66M 3HU3A 1Z5BA 4LJ9A 3PNVA 2LVPC 2QSFX 2MR9A 5EP2A 4DR7M 4KODA 4OVZA 1R7RA 4WURA 2EO2A 3K8ZA 2F5NA 1L8QA 3J7AS 4DBGB 1MN3A 4JI8M 1PJQA 3BXWA 1HNWM 1E94E 2MJ5B 3E9SA 1YUBA 3E4RA 2FOIC 4MGHA 1ZAEA 2ZBKB 8CATA 4IBGA 4B3TM 4JI7M 1N32M 3UK6A 2EA0A 1UFZA 1KSFX 2H1RA 2CUZA 2JXNA 2VF7A 4JI3M 3AKZA 3SC3A 3Q8XA 1IN7A 2R62A 2R18A 2Z7JA 2DNAA 4WW0A 3GP1A 2LHCA 2ZM6M 3SBJA 1DGGA 1K3WA 3W0LB 4GRIA 1IY0A 5FSWA 2KA6B 1QZEA 5FTLA 2EKKA 2CRUA 4GKJM 2HCBA 4L8RC 3GLHB 2KZUA 3GLIE 1TH3A 4L6V6 4DV0M 3B74A 3T1HM 4R3DA 2R45A 2QCUA 2QHOB 4IBBA 4DR6M 1Y8GA 3HJSA 1SG9A 2VIIA 2DWNA 5KQ8A 2R65A 2WZJA 1EE8A 3D8BA 3L28A 2OPFA 5LMUM 2Y0QA 1NSFA 2V1CA 3FE3A 3FRHA 3SFZA 4GITA 3QWLA 1HQCA 3KP0E 2FS1A 1OFHA 3SYLA 2LVNC 3K9OA 2YNMD 1R2ZA 2JP7A 3LQRA 4LF8M 1K82A 3KXEC 4I8OA 2ERCA 3A46A 1G59A 1SXJB 2VDBB 1J7KA 1IXRC 3EIHA 2XEPA 3B9PA 4PT5A 4AW4A 2V1UA 4AKIA 2JUJA 2K6BA 2RGHA 5KPTA 3VKGA 4M9ZA 4IBIA 4UN2B 4ITQA 3SYKA 2MH8A 4KT0F 4EIWA 4NC6A 1QZMA 3TWKA 3FTDA 1GKIA 1OJLA 1YSYA 1OTRA 2LBCA 2LNHC 3KVWA 5EP1A 3PXGA 2NQ8C 5IZ7D 1GJSA 1IN4A 4RF1A 3IECA 4DR3M 2J7NA 3KP1E 2JA2A 4CIZA 4IJFA 1D0LA 3GPXA 2LVQD 3KW6A 3NBIA 2R44A 3M7GA 2F5SA 3L26A 3KS8A 2DAMA 2DAIA 2O25A 5IT9S 1XMQM 5DYGA 2WSFF 3RFWA 5BPVA 1HNXM 4MGKE 3FUXA 3GLIA 4LJ5A 3U6CA 1SXJC 5FTMA 2G8LA 1NV9A 4MB7A 4FWDA 3LMMA 4HLQA 1IXSB 4Z8XA 2CP8A 2K47A 2R46A 3DOAA 3T38A 4G4OA 2MROB 2CFOA 1K3XA 2QBYA 1A5TA 1W5SA 1I94M 3B7QA 3J81S 1NY5A 1L2CA 1OAIA 3B7ZA 4DR1M 2UXDM 3I01M 1HQYE 3GLGA 4LJ6A 4LZJA 2JY8A 3SHGB 3T1YM 5F3WA 3UJNA 2WSEF 3VDUA 4LF4M 4LFBM 4AKHA 3C3DA 1TH2A 1Z59A 5FLXS 4LG2A 3FKEA 1L2DA 3ZH9B 1E32A 3GRYA 2QZ4A 3KOXE 4LF5M 5FTKA 4MH0E 2V6ZM 3NBXX 5LMNM 1IM2A 3H4MA 4PDIA 2AHMA 3GLIB 3EIEA 2RKOA 3FUWA 2DENA 2B3TA 3K9PA 2C9CA 4DV4M 3HKPA 2KW0A 5IREB 4DV1M 3U6LA 2JNHA 2M5ZA 2Y21A 4LRTA 3AOEC 1ZMUA 5DFLA 2G3QA 3T15A 4DR5M 4GC5A 1V34A 4BB9A 1W5TA 1L1TA 4KLNA 1C1KA 2FH0A 4RNAA 1V33A 3L27A 4OX9M 4QOSA 2DWMA 4NRWA 3FTFA 3UZUA 1R2YA 2QNJA 3HHXA 1Q3CA 4LZZA 1Q02A 1QAOA 3J2PB 1N78A 1S3SA 2FFJA 2M60A 2L6OA 1PGYA 2F5OA 3ZCBB 4JV5M 4GHLA 1I4WA 2Y20A 4X62M 1OIZA 5EP4A 3SHFA 2CE7A 4LFCM 3CGWA 4MM3B 4GC9A 3ILKA 3LCVB 1QVRA 1YE9A 3PFIA 2J7OA 1DGFA 4M9SA 4LJ4A 1CUKA 3TWMA 3QYBA 3U6QA 1JR3A 1PRBA 3J7BA 4X65M 4YHHM 1WR1B 1XWIA 2EJSA 1Z6TA 2LHGA 3LVWA 3ZQJA 2ZTDA 4MGZE 1HT2E 1ZQ9A 3TL4X 3UMMA 1NY6A 3HJ8A 3C3EA 2C96A 4DV5M 3U6EA 3U6PA 2JY7A 2KEBA 1DGHB 4FWHA 4NXNM 2XZUA 4G4QA 4QNMA 2GNOA 1E9RA 3GLFA 2H5XA 4LJ7A 4LRSA 3TPZA 1D0MA 2XH9A 2CHVA 3BBZA 1G41A 3BOSA 3FYDA 4G6ZA 3U6DA 4MGYE 7CATA 3JR5A 1GL6A 1PJSA 2R4EA 2F5PA 4G4NA 1QAMA 4FCTA 1ZMVA 1QANA 3W67A 3U6OA 3GQ4A 1Q3BA 4JI2M 3THGA 1DO2A 3K1JA 1TGUA 1PJIA 4NXMM 5EXSA 1MU5A 2YR0A 4JXJA 4L4UA 3KS4A 4LJAA 4OVZB 2LXEA 2VQFM 2QPAA 4L15A 1GABA 5EQTA 4IIWA 5FTNA 3CF6E 1PM5A 3VK7A 2JY5A 4W5WA 3AJIB 4A3VB 3GLGE 2K0BX 2DZOB 4RF0A 1XC8A 3A42A 3UGJA 3MJ5A 4REZA 3I4VA 3TQSA 4QHSA 3HU2A 4RKUF 4K0KM 1XHBA 2LTUA 4LF9M 1JQJC 2BNKA 1VQ1A 4II7A 2L7IA 5DNYA 2FE8A 3OTOM 1PJJA 4X64M 1T3TA 3L2AA 3GPYA 2ZAOA 1N36M 3VKHA 3I51A 2CHQA 4LGYA 2DHRA 2O01F 2L4EA 2XZFA 2C5RA 5KPZA 1NNUC 3SASA 4LCBA 3R9XB 3FUVA 5L8RF 4JN6A 1L1ZA 1N75A 2KNVA 2ZAMA 2HHHM 4CHTB 4DR4M 2YFQA 1FJGM 3HHYA 1Z5CA 5IWAM 1GLNA 4NOOB 5EJCA 2KNZA 1GJTA 3D8LA 3L29A 1JB0F 3VDPA 4I81A 2UUCM 4I4LA 1KYIA 1TDHA 2KRUA 4IBDA 3C58A 4OU7A 3U61A 4P17A 2OO9A 4NRVA 3IG5A 1DGBA 4JI0M 2CV1A 1NJFA 5ITYA 2W82A 5DYIA 1JR3D 2EUCA 2UXBM 2WSCF 3J27B 1N77A 3FUTA 3A45A 3SAVA 3SMPA 1EFUB 1ZV1A 5ITQA 5ITTA 3R8FA 1QQWA 3KFUG 2C9OA 1IBMM 1X37A 4B7GA 3FYCA 1JR3E 3MHVC 4D80A 3IHPA 4B3MM 3HHWA 4FVMA 1KFVA 4JI6M 2UUBM 2DVWB 1NHGC 1QAQA 4BBAA 3B89A 1VEKA 2CHGA 4HL4A 3GPPA 4AI6A 1XXHE 1FNNA 2Y0TA 2VF8A 3LQQA 1J09A 4GMQA 3GLFE 5H37D 2JZ1A 2UUAM 2QBYB 1VEJA 5EXPA 4IJEA 3GPUA 1VDLA 1HJPA 2DWZB 4Z6YA 1R5LA 2L4FA 4BLCA 1TR8A 1IXZA 2QQ8A 3C9PA 3ZC7B 3GLGB 3LW5F 4D82A 2I7PA 3SARA 2OOAA 3CF0A 3AV0A 4G4RA 4CJ6A 2CEAA 2Z3XA 2DAGA 2FNAA 4R71A 1IN5A 1IQPA 3GRRA 3MMPA 2LWXA 4IBKA 1SXJE 4B3SM 4L78A 3I4YA 1G4AE 1LTMA 2Z8YM 3FTCA 4Y28F 5E6JA 4B7FA 1N34M 1T43A 3AFHA 3KOZE 4WP2A 2LH0A 3KOYE 1TTEA 4XGIA 1NO1A 5KPRA 2RGOA 4B3RM 1D0KA 2CWBA 3SAUA 3M0EA 5ITRA 4GKKM 3AOGA 3WHKA 3HY5A 4DV7M 2C99A 5EXXA 1QDRA 1G3IA 1XXHA 4GIPA 4JI1M 4DR2M 4P16A 5E26A 4M0WA 3K2LA 3GO8A 1IBKM 1RU3A 1V92A 2D7EA 4FW9A 5FTJA 1GVNA 1HNZM 3JAMS 1IN6A 4AQYM 3GLHA 5ITXE
chains in the Genus database with same CATH topology
1MX0A 5EXTA 2D7HA 1IBLM 1IY1A 4LJ8A 2DXIA 3KSXA 4OW0A 4DV2M 3M6AA 5KQDA 3U6MA 2L7HA 4QOZC 5EP3A 2R4JA 2A5YB 1IN8A 1UM8A 3QAUA 2XLJA 4KO8A 5JI3E 3DFZA 2ZANA 2CV0A 4QHTA 3SAWA 3DA1A 5JI2E 1SXJA 3HHZA 4KHPM 1N33M 2XSZA 1XXHB 3U6SA 4I5SA 4NSOB 2BJWA 3L25A 3CTWB 4AG5A 4PDGA 3GLFB 1HT1E 2DZNB 2KZSA 1TDZA 3SMSA 4CISA 3KDSE 3U5ZA 5GKNA 3IG8A 2X49A 1OFIA 3FTEA 3VK8A 4AG6A 5C1BA 2X8AA 1E9SA 3GQ3A 1NHWC 2G5GX 5ITXA 4CGYB 1D2NA 1NJGA 1XMOM 2Q2EB 5A2QS 2QP9X 1XNQM 4R7GA 1XNRM 2KRKA 4FCVA 3J80S 5C18A 2YQZA 4D81A 2UU9M 4YY3M 2BJVA 3HU1A 4LF6M 4GH9A 4DV3M 3HGIA 4DUYM 4FD2A 3AOEA 4JYAM 4AZFA 2DWLA 3U5ZB 5KO3A 4LY6A 2CV2A 4FCWA 2L09A 4PCZA 3PVSA 1Z5AA 3TWLA 3K92A 4NL4H 1Q39A 4B08A 1R6BX 4IBCA 4IBEA 4M0DA 5ITUA 3TE6A 1NVMA 3GRVA 3GRUA 2XF3A 3FD9A 1ORYB 2P5TA 5BR8M 4IBFA 4M9XA 1H6UA 3AL0C 3HWSA 4IBJA 3RGSA 1DO0A 1GL7A 2D7GA 3KOWE 3U60A 4GHAA 3PNYA 2HKJA 3RGPA 3HJQA 2HL7A 3U61B 1WXQA 2XGNA 1QYRA 1G8PA 4TUWA 4QNRA 2F5QA 2E5LM 2XFSA 2QENA 3KSJA 3MK6A 4MGIE 2O5RA 2XFTA 1SXJD 4AKGA 2XSZD 4ZPXA 3LVVA 3GQ5A 3WHLA 4NSRA 3VLFB 1LV7A 4XBOA 2OQ4A 2C98A 3CF2A 4JI4M 3DZDA 3VFDA 4JI5M 1VDDA 1TH4A 3U60B 2KXEA 2I7NA 3A98B 1NNJA 4LFAM 2UXCM 1DGHA 3FUUA 1J5EM 3W0FA 3SATA 4FWGA 2VQEM 1L2BA 4S12A 4B7HA 1HR0M 3JR4A 4LF7M 4L16A 4DV6M 4PD2A 3NWLA 2Z4SA 2Z4RA 1IY2A 2F4VM 4DUZM 2X4AA 3RE8A 4LGMA 4X66M 3HU3A 1Z5BA 4LJ9A 3PNVA 5EP2A 4DR7M 4KODA 4OVZA 1R7RA 4WURA 2EO2A 3K8ZA 2F5NA 1L8QA 3J7AS 4JI8M 1HNWM 1E94E 3E9SA 4MGHA 1YUBA 3E4RA 2FOIC 8CATA 1ZAEA 2ZBKB 4B3TM 4IBGA 4JI7M 1N32M 3UK6A 2EA0A 1KSFX 2H1RA 2CUZA 4JI3M 3AKZA 3SC3A 3Q8XA 1IN7A 2R62A 2R18A 2Z7JA 4WW0A 3GP1A 2ZM6M 3SBJA 1DGGA 1K3WA 3W0LB 4GRIA 1IY0A 5FSWA 2KA6B 5FTLA 4GKJM 2HCBA 4L8RC 3GLHB 2KZUA 4DV0M 1TH3A 3T1HM 4R3DA 2R45A 2QCUA 4IBBA 4DR6M 3HJSA 2VIIA 2DWNA 5KQ8A 2R65A 1EE8A 3D8BA 3L28A 2OPFA 5LMUM 2Y0QA 1NSFA 2V1CA 3SFZA 4GITA 3QWLA 1HQCA 3KP0E 3SYLA 1OFHA 2YNMD 1R2ZA 3LQRA 4LF8M 1K82A 3KXEC 4I8OA 2ERCA 3A46A 1G59A 1SXJB 1IXRC 1J7KA 3EIHA 2XEPA 3B9PA 4PT5A 4AW4A 2V1UA 4AKIA 2RGHA 5KPTA 3VKGA 4M9ZA 4IBIA 4ITQA 3SYKA 4EIWA 1QZMA 3TWKA 3FTDA 1GKIA 1OJLA 1YSYA 2LNHC 5EP1A 3VKHA 3KVWA 3PXGA 2NQ8C 5IZ7D 1IN4A 4RF1A 4DR3M 2J7NA 3KP1E 2JA2A 4IJFA 3GPXA 3KW6A 3NBIA 3M7GA 2F5SA 3L26A 3KS8A 5IT9S 1XMQM 5DYGA 3RFWA 5BPVA 1HNXM 4MGKE 3FUXA 3GLIA 4LJ5A 3U6CA 1SXJC 5FTMA 2G8LA 4MB7A 4FWDA 3LMMA 4HLQA 1IXSB 4Z8XA 2K47A 3DOAA 2R46A 3T38A 4G4OA 1K3XA 2CFOA 2QBYA 1W5SA 1I94M 3J81S 1NY5A 1L2CA 2UXDM 4DR1M 1HQYE 3GLGA 4LJ6A 4LZJA 3SHGB 3T1YM 5F3WA 3UJNA 4LFBM 3VDUA 4LF4M 4AKHA 1TH2A 1Z59A 5FLXS 4LG2A 3FKEA 1L2DA 3ZH9B 1E32A 3GRYA 2QZ4A 3KOXE 4LF5M 5FTKA 4MH0E 2V6ZM 5LMNM 1IM2A 3H4MA 4PDIA 2AHMA 3GLIB 3EIEA 2RKOA 3FUWA 2C9CA 4DV4M 3HKPA 2KW0A 5IREB 4DV1M 3U6LA 2M5ZA 2Y21A 4LRTA 3AOEC 3T15A 4DR5M 4GC5A 4BB9A 1W5TA 1L1TA 4KLNA 1C1KA 4RNAA 3L27A 4OX9M 4QOSA 2DWMA 4NRWA 3FTFA 3UZUA 1R2YA 3HHXA 1Q3CA 4LZZA 1QAOA 3J2PB 1N78A 1S3SA 2FFJA 2M60A 2L6OA 2F5OA 3ZCBB 4JV5M 4GHLA 1I4WA 2Y20A 4X62M 5EP4A 3SHFA 2CE7A 4LFCM 4MM3B 4GC9A 3ILKA 1QVRA 1YE9A 3PFIA 2J7OA 1DGFA 4M9SA 4LJ4A 3TWMA 3U6QA 1JR3A 3J7BA 4X65M 4YHHM 1XWIA 3LVWA 1Z6TA 4MGZE 1HT2E 1ZQ9A 3TL4X 3UMMA 1NY6A 3HJ8A 2C96A 4DV5M 3U6EA 3U6PA 2KEBA 1DGHB 4FWHA 4NXNM 2XZUA 4G4QA 4QNMA 1E9RA 3GLFA 4LJ7A 4LRSA 3TPZA 2XH9A 3FYDA 2CHVA 3BOSA 1G41A 4G6ZA 3U6DA 4MGYE 7CATA 3JR5A 1GL6A 2R4EA 2F5PA 4G4NA 1QAMA 4FCTA 1QANA 3U6OA 3GQ4A 1Q3BA 4JI2M 3THGA 1DO2A 3K1JA 1TGUA 1PJIA 4NXMM 5EXSA 1MU5A 2YR0A 4JXJA 4L4UA 3KS4A 4LJAA 4OVZB 2LXEA 2VQFM 2QPAA 4L15A 5EQTA 4IIWA 5FTNA 3CF6E 1PM5A 3VK7A 4W5WA 3AJIB 4A3VB 2DZOB 4RF0A 1XC8A 3A42A 3UGJA 3MJ5A 4REZA 3I4VA 3TQSA 4QHSA 3HU2A 4K0KM 1XHBA 4LF9M 1JQJC 2BNKA 4II7A 2L7IA 5DNYA 2FE8A 3OTOM 1PJJA 4X64M 1T3TA 3L2AA 3GPYA 2ZAOA 1N36M 3I51A 2CHQA 4LGYA 2DHRA 2XZFA 2C5RA 5KPZA 1NNUC 3SASA 4LCBA 3R9XB 3FUVA 4JN6A 1L1ZA 1N75A 2ZAMA 2HHHM 4CHTB 4DR4M 2YFQA 1FJGM 3HHYA 1Z5CA 5IWAM 1GLNA 4NOOB 5EJCA 3D8LA 3L29A 3VDPA 4I81A 2UUCM 4I4LA 1KYIA 1TDHA 2KRUA 4IBDA 3C58A 4OU7A 3U61A 4NRVA 3IG5A 1DGBA 4JI0M 2CV1A 1NJFA 5ITYA 2W82A 5DYIA 1JR3D 2EUCA 2UXBM 3J27B 1N77A 3FUTA 3A45A 3SAVA 3SMPA 3R8FA 5ITTA 5ITQA 3KFUG 1QQWA 2C9OA 1IBMM 1X37A 4B7GA 3FYCA 3MHVC 4D80A 4B3MM 4JI6M 3HHWA 4FVMA 1KFVA 2UUBM 2DVWB 1NHGC 1QAQA 4BBAA 2CHGA 4HL4A 3GPPA 4AI6A 1FNNA 2Y0TA 3LQQA 1J09A 4GMQA 2UUAM 5H37D 2QBYB 5EXPA 4IJEA 3GPUA 2DWZB 4Z6YA 4BLCA 1IXZA 3GLGB 3ZC7B 4D82A 2I7PA 3SARA 3CF0A 3AV0A 4G4RA 2CEAA 2Z3XA 2FNAA 1IN5A 1IQPA 3GRRA 4IBKA 2LWXA 1SXJE 4B3SM 4L78A 3I4YA 1G4AE 4B7FA 3FTCA 5E6JA 1N34M 3AFHA 3KOZE 2LH0A 3KOYE 4XGIA 5KPRA 2RGOA 4B3RM 3SAUA 3M0EA 5ITRA 4GKKM 3AOGA 3WHKA 4DV7M 2C99A 5EXXA 1G3IA 1XXHA 4GIPA 4JI1M 4DR2M 4P16A 5E26A 4M0WA 3K2LA 3GO8A 1IBKM 2D7EA 4FW9A 5FTJA 1GVNA 1HNZM 3JAMS 1IN6A 4AQYM 3GLHA 5ITXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K M;  1MX0 A;  1IBL M;  4LF9 M;  2OQ4 A;  3DOA A;  4G4O A;  1K3X A;  4DV2 M;  4JI4 M;  3OTO M;  3U6M A;  4X64 M;  3GPY A;  1PJJ A;  1N36 M;  4JI5 M;  1I94 M;  3J81 S;  1L2C A;  2UXD M;  4DR1 M;  1NNJ A;  4LFB M;  3T1Y M;  2XZF A;  4LFA M;  4LF4 M;  2UXC M;  1J5E M;  3W0F A;  3SAW A;  1Z59 A;  5FLX S;  3SAT A;  3SAS A;  2VQE M;  1L2B A;  1L2D A;  1L1Z A;  1HR0 M;  4LF5 M;  3JR4 A;  4KHP M;  1N33 M;  4LF7 M;  3U6S A;  2HHH M;  4DR4 M;  4DV6 M;  5LMN M;  4PD2 A;  1FJG M;  4PDI A;  1Z5C A;  5IWA M;  4PDG A;  2F4V M;  4DUZ M;  4DV4 M;  1TDZ A;  4X66 M;  4DV1 M;  2UUC M;  4CIS A;  3U6L A;  1Z5B A;  1TDH A;  3C58 A;  4DR7 M;  4NRV A;  4DR5 M;  4JI0 M;  2F5N A;  3VK8 A;  5ITY A;  3J7A S;  1L1T A;  2UXB M;  4JI8 M;  1HNW M;  3GQ3 A;  4B3T M;  5ITX A;  2ZBK B;  3A45 A;  1N32 M;  4JI7 M;  3SAV A;  4OX9 M;  2EA0 A;  5ITT A;  5ITQ A;  1XMO M;  4NRW A;  1R2Y A;  2Q2E B;  4JI3 M;  5A2Q S;  1IBM M;  1Q3C A;  1XNQ M;  1XNR M;  4B3M M;  3J80 S;  4JI6 M;  1KFV A;  2UUB M;  2UU9 M;  3GP1 A;  4YY3 M;  2F5O A;  2ZM6 M;  3SBJ A;  1K3W A;  4LF6 M;  3GPP A;  4JV5 M;  4DV3 M;  4GKJ M;  4DUY M;  4X62 M;  4DV0 M;  4LFC M;  3T1H M;  4JYA M;  2UUA M;  4DR6 M;  3TWM A;  4PCZ A;  3GPU A;  1EE8 A;  3U6Q A;  5LMU M;  1Z5A A;  3TWL A;  2OPF A;  4YHH M;  1Q39 A;  4DV5 M;  3U6E A;  3U6P A;  5ITU A;  1R2Z A;  4LF8 M;  3SAR A;  4NXN M;  4G4R A;  2XZU A;  4G4Q A;  1K82 A;  3A46 A;  5BR8 M;  5ITX E;  3U6D A;  4B3S M;  3JR5 A;  4ITQ A;  1N34 M;  2F5P A;  4G4N A;  3TWK A;  2HKJ A;  3U6O A;  3GQ4 A;  1Q3B A;  4JI2 M;  4B3R M;  4DR3 M;  3SAU A;  5ITR A;  1PJI A;  4NXM M;  4GKK M;  1MU5 A;  3GPX A;  2VQF M;  3GQ5 A;  2F5Q A;  4DV7 M;  2E5L M;  2F5S A;  5IT9 S;  1XMQ M;  1PM5 A;  3VK7 A;  1HNX M;  4JI1 M;  4DR2 M;  3GO8 A;  3U6C A;  1IBK M;  1HNZ M;  3JAM S;  1XC8 A;  3A42 A;  4AQY M;  4MB7 A;  4X65 M; 
#chains in the Genus database with same CATH topology
 4F2L A;  1MX0 A;  5EXT A;  2D7H A;  1IBL M;  1IY1 A;  4LJ8 A;  2DXI A;  3KSX A;  4OW0 A;  4DV2 M;  3M6A A;  2KDL A;  5KQD A;  3U6M A;  2L7H A;  4QOZ C;  5EP3 A;  2R4J A;  3I04 M;  2A5Y B;  1IN8 A;  1UM8 A;  2JZ0 A;  3QAU A;  2XLJ A;  4KO8 A;  1OKS A;  5JI3 E;  3DFZ A;  2ZAN A;  2CV0 A;  4QHT A;  3SAW A;  3DA1 A;  1ZMW A;  5JI2 E;  1C7Y A;  1DV0 A;  1SXJ A;  3HHZ A;  4KHP M;  1N33 M;  2XSZ A;  1XXH B;  3U6S A;  4I5S A;  4NSO B;  4Q7J A;  2BJW A;  3L25 A;  1WHC A;  4ANR A;  3CTW B;  4AG5 A;  4PDG A;  3GLF B;  1HT1 E;  1MJG M;  2DZN B;  2KZS A;  3V76 A;  1TDZ A;  3SMS A;  1XB2 B;  4CIS A;  3KDS E;  3U5Z A;  5GKN A;  3LCU A;  3HX3 A;  3IG8 A;  2DHY A;  2X49 A;  3HZJ A;  1OFI A;  3FTE A;  2J5Y A;  3VK8 A;  1T6O A;  4AG6 A;  5C1B A;  1R4G A;  2X8A A;  1E9S A;  3GQ3 A;  1NHW C;  1VG5 A;  2G5G X;  5ITX A;  4CGY B;  1D2N A;  1NJG A;  1XMO M;  2Q2E B;  4G3O A;  2QP9 X;  3W68 A;  5A2Q S;  4R7G A;  1XNQ M;  1XNR M;  2KRK A;  1IXS A;  4FCV A;  3J80 S;  2YQZ A;  5C18 A;  3H4J A;  4D81 A;  2UU9 M;  4YY3 M;  2BJV A;  2DAK A;  3HU1 A;  1OAO C;  4LF6 M;  3FRI A;  4GH9 A;  4DV3 M;  3HGI A;  4DUY M;  2DKL A;  4FD2 A;  2JY6 B;  2LVA A;  3AOE A;  4JYA M;  4AZF A;  2DWL A;  2R0I A;  3U5Z B;  5KO3 A;  4LY6 A;  2CV2 A;  4FCW A;  2DI0 A;  2L09 A;  4PCZ A;  3PVS A;  1Z5A A;  2KHH A;  3TWL A;  4GEW A;  3K92 A;  1OQY A;  4NL4 H;  1Q39 A;  4B08 A;  1EIJ A;  2APL A;  1R6B X;  4IBC A;  4IBE A;  1QDT A;  1WGN A;  4M0D A;  5ITU A;  3TE6 A;  1NVM A;  1IFY A;  3GRV A;  1G71 A;  1AUA A;  2JWS A;  3GRU A;  2XF3 A;  3FD9 A;  1ORY B;  2P5T A;  5BR8 M;  4IBF A;  1OIP A;  1H6U A;  4M9X A;  2HWJ A;  3AL0 C;  3HWS A;  4IBJ A;  3RGS A;  1DO0 A;  1GL7 A;  2D7G A;  2DZL A;  3KOW E;  3U60 A;  1NV8 A;  4GHA A;  3PNY A;  2HKJ A;  3RGP A;  2BWE A;  3HJQ A;  2K9D A;  3GLH E;  2HL7 A;  1WJ7 A;  3QYE A;  3B7N A;  2DAE A;  3U61 B;  1WXQ A;  2XGN A;  1QYR A;  1G8P A;  1PJT A;  4TUW A;  4QNR A;  2F5Q A;  4F1I A;  2E5L M;  2XFS A;  2QEN A;  4HEO A;  3KSJ A;  3MK6 A;  2BWB A;  4MGI E;  2O5R A;  2XFT A;  3Q8G A;  1SXJ D;  1GO5 A;  1BVS A;  4AKG A;  1VEG A;  1WIV A;  2XSZ D;  4ZPX A;  3LVV A;  2RRU A;  1YLA A;  3GQ5 A;  2ZTC A;  1F4I A;  3WHL A;  4NSR A;  2MGW A;  3VLF B;  1LV7 A;  4XBO A;  2L2D A;  2OQ4 A;  2EKF A;  2GQF A;  2C98 A;  3CF2 A;  4JI4 M;  2N35 A;  3DZD A;  3VFD A;  4JI5 M;  2KNA A;  1VDD A;  1TH4 A;  2HAK A;  3U60 B;  2KXE A;  2I7N A;  3F92 A;  1AIP C;  3A98 B;  1NNJ A;  4LFA M;  4XK8 F;  2UXC M;  1DGH A;  3FUU A;  1J5E M;  1WGL A;  1TF0 B;  3W0F A;  3SAT A;  4FWG A;  3E46 A;  2VQE M;  1L2B A;  4S12 A;  4B7H A;  1HR0 M;  3JR4 A;  1P3Q Q;  4LF7 M;  4L16 A;  1QUS A;  1QUT A;  4DV6 M;  4PD2 A;  2R6F A;  3NWL A;  2Z4S A;  2LVO C;  2OOB A;  3E21 A;  2Z4R A;  1IY2 A;  2F4V M;  4DUZ M;  2X4A A;  3RE8 A;  4LGM A;  3T6P A;  4X66 M;  3HU3 A;  1Z5B A;  4LJ9 A;  3PNV A;  2LVP C;  2QSF X;  2MR9 A;  5EP2 A;  4DR7 M;  4KOD A;  4OVZ A;  1R7R A;  4WUR A;  2EO2 A;  3K8Z A;  2F5N A;  1L8Q A;  3J7A S;  4DBG B;  1MN3 A;  4JI8 M;  1PJQ A;  3BXW A;  1HNW M;  1E94 E;  2MJ5 B;  3E9S A;  1YUB A;  3E4R A;  2FOI C;  4MGH A;  1ZAE A;  2ZBK B;  8CAT A;  4IBG A;  4B3T M;  4JI7 M;  1N32 M;  3UK6 A;  2EA0 A;  1UFZ A;  1KSF X;  2H1R A;  2CUZ A;  2JXN A;  2VF7 A;  4JI3 M;  3AKZ A;  3SC3 A;  3Q8X A;  1IN7 A;  2R62 A;  2R18 A;  2Z7J A;  2DNA A;  4WW0 A;  3GP1 A;  2LHC A;  2ZM6 M;  3SBJ A;  1DGG A;  1K3W A;  3W0L B;  4GRI A;  1IY0 A;  5FSW A;  2KA6 B;  1QZE A;  5FTL A;  2EKK A;  2CRU A;  4GKJ M;  2HCB A;  4L8R C;  3GLH B;  2KZU A;  3GLI E;  1TH3 A;  4L6V 6;  4DV0 M;  3B74 A;  3T1H M;  4R3D A;  2R45 A;  2QCU A;  2QHO B;  4IBB A;  4DR6 M;  1Y8G A;  3HJS A;  1SG9 A;  2VII A;  2DWN A;  5KQ8 A;  2R65 A;  2WZJ A;  1EE8 A;  3D8B A;  3L28 A;  2OPF A;  5LMU M;  2Y0Q A;  1NSF A;  2V1C A;  3FE3 A;  3FRH A;  3SFZ A;  4GIT A;  3QWL A;  1HQC A;  3KP0 E;  2FS1 A;  1OFH A;  3SYL A;  2LVN C;  3K9O A;  2YNM D;  1R2Z A;  2JP7 A;  3LQR A;  4LF8 M;  1K82 A;  3KXE C;  4I8O A;  2ERC A;  3A46 A;  1G59 A;  1SXJ B;  2VDB B;  1J7K A;  1IXR C;  3EIH A;  2XEP A;  3B9P A;  4PT5 A;  4AW4 A;  2V1U A;  4AKI A;  2JUJ A;  2K6B A;  2RGH A;  5KPT A;  3VKG A;  4M9Z A;  4IBI A;  4UN2 B;  4ITQ A;  3SYK A;  2MH8 A;  4KT0 F;  4EIW A;  4NC6 A;  1QZM A;  3TWK A;  3FTD A;  1GKI A;  1OJL A;  1YSY A;  1OTR A;  2LBC A;  2LNH C;  3KVW A;  5EP1 A;  3PXG A;  2NQ8 C;  5IZ7 D;  1GJS A;  1IN4 A;  4RF1 A;  3IEC A;  4DR3 M;  2J7N A;  3KP1 E;  2JA2 A;  4CIZ A;  4IJF A;  1D0L A;  3GPX A;  2LVQ D;  3KW6 A;  3NBI A;  2R44 A;  3M7G A;  2F5S A;  3L26 A;  3KS8 A;  2DAM A;  2DAI A;  2O25 A;  5IT9 S;  1XMQ M;  5DYG A;  2WSF F;  3RFW A;  5BPV A;  1HNX M;  4MGK E;  3FUX A;  3GLI A;  4LJ5 A;  3U6C A;  1SXJ C;  5FTM A;  2G8L A;  1NV9 A;  4MB7 A;  4FWD A;  3LMM A;  4HLQ A;  1IXS B;  4Z8X A;  2CP8 A;  2K47 A;  2R46 A;  3DOA A;  3T38 A;  4G4O A;  2MRO B;  2CFO A;  1K3X A;  2QBY A;  1A5T A;  1W5S A;  1I94 M;  3B7Q A;  3J81 S;  1NY5 A;  1L2C A;  1OAI A;  3B7Z A;  4DR1 M;  2UXD M;  3I01 M;  1HQY E;  3GLG A;  4LJ6 A;  4LZJ A;  2JY8 A;  3SHG B;  3T1Y M;  5F3W A;  3UJN A;  2WSE F;  3VDU A;  4LF4 M;  4LFB M;  4AKH A;  3C3D A;  1TH2 A;  1Z59 A;  5FLX S;  4LG2 A;  3FKE A;  1L2D A;  3ZH9 B;  1E32 A;  3GRY A;  2QZ4 A;  3KOX E;  4LF5 M;  5FTK A;  4MH0 E;  2V6Z M;  3NBX X;  5LMN M;  1IM2 A;  3H4M A;  4PDI A;  2AHM A;  3GLI B;  3EIE A;  2RKO A;  3FUW A;  2DEN A;  2B3T A;  3K9P A;  2C9C A;  4DV4 M;  3HKP A;  2KW0 A;  5IRE B;  4DV1 M;  3U6L A;  2JNH A;  2M5Z A;  2Y21 A;  4LRT A;  3AOE C;  1ZMU A;  5DFL A;  2G3Q A;  3T15 A;  4DR5 M;  4GC5 A;  1V34 A;  4BB9 A;  1W5T A;  1L1T A;  4KLN A;  1C1K A;  2FH0 A;  4RNA A;  1V33 A;  3L27 A;  4OX9 M;  4QOS A;  2DWM A;  4NRW A;  3FTF A;  3UZU A;  1R2Y A;  2QNJ A;  3HHX A;  1Q3C A;  4LZZ A;  1Q02 A;  1QAO A;  3J2P B;  1N78 A;  1S3S A;  2FFJ A;  2M60 A;  2L6O A;  1PGY A;  2F5O A;  3ZCB B;  4JV5 M;  4GHL A;  1I4W A;  2Y20 A;  4X62 M;  1OIZ A;  5EP4 A;  3SHF A;  2CE7 A;  4LFC M;  3CGW A;  4MM3 B;  4GC9 A;  3ILK A;  3LCV B;  1QVR A;  1YE9 A;  3PFI A;  2J7O A;  1DGF A;  4M9S A;  4LJ4 A;  1CUK A;  3TWM A;  3QYB A;  3U6Q A;  1JR3 A;  1PRB A;  3J7B A;  4X65 M;  4YHH M;  1WR1 B;  1XWI A;  2EJS A;  1Z6T A;  2LHG A;  3LVW A;  3ZQJ A;  2ZTD A;  4MGZ E;  1HT2 E;  1ZQ9 A;  3TL4 X;  3UMM A;  1NY6 A;  3HJ8 A;  3C3E A;  2C96 A;  4DV5 M;  3U6E A;  3U6P A;  2JY7 A;  2KEB A;  1DGH B;  4FWH A;  4NXN M;  2XZU A;  4G4Q A;  4QNM A;  2GNO A;  1E9R A;  3GLF A;  2H5X A;  4LJ7 A;  4LRS A;  3TPZ A;  1D0M A;  2XH9 A;  2CHV A;  3BBZ A;  1G41 A;  3BOS A;  3FYD A;  4G6Z A;  3U6D A;  4MGY E;  7CAT A;  3JR5 A;  1GL6 A;  1PJS A;  2R4E A;  2F5P A;  4G4N A;  1QAM A;  4FCT A;  1ZMV A;  1QAN A;  3W67 A;  3U6O A;  3GQ4 A;  1Q3B A;  4JI2 M;  3THG A;  1DO2 A;  3K1J A;  1TGU A;  1PJI A;  4NXM M;  5EXS A;  1MU5 A;  2YR0 A;  4JXJ A;  4L4U A;  3KS4 A;  4LJA A;  4OVZ B;  2LXE A;  2VQF M;  2QPA A;  4L15 A;  1GAB A;  5EQT A;  4IIW A;  5FTN A;  3CF6 E;  1PM5 A;  3VK7 A;  2JY5 A;  4W5W A;  3AJI B;  4A3V B;  3GLG E;  2K0B X;  2DZO B;  4RF0 A;  1XC8 A;  3A42 A;  3UGJ A;  3MJ5 A;  4REZ A;  3I4V A;  3TQS A;  4QHS A;  3HU2 A;  4RKU F;  4K0K M;  1XHB A;  2LTU A;  4LF9 M;  1JQJ C;  2BNK A;  1VQ1 A;  4II7 A;  2L7I A;  5DNY A;  2FE8 A;  3OTO M;  1PJJ A;  4X64 M;  1T3T A;  3L2A A;  3GPY A;  2ZAO A;  1N36 M;  3VKH A;  3I51 A;  2CHQ A;  4LGY A;  2DHR A;  2O01 F;  2L4E A;  2XZF A;  2C5R A;  5KPZ A;  1NNU C;  3SAS A;  4LCB A;  3R9X B;  3FUV A;  5L8R F;  4JN6 A;  1L1Z A;  1N75 A;  2KNV A;  2ZAM A;  2HHH M;  4CHT B;  4DR4 M;  2YFQ A;  1FJG M;  3HHY A;  1Z5C A;  5IWA M;  1GLN A;  4NOO B;  5EJC A;  2KNZ A;  1GJT A;  3D8L A;  3L29 A;  1JB0 F;  3VDP A;  4I81 A;  2UUC M;  4I4L A;  1KYI A;  1TDH A;  2KRU A;  4IBD A;  3C58 A;  4OU7 A;  3U61 A;  4P17 A;  2OO9 A;  4NRV A;  3IG5 A;  1DGB A;  4JI0 M;  2CV1 A;  1NJF A;  5ITY A;  2W82 A;  5DYI A;  1JR3 D;  2EUC A;  2UXB M;  2WSC F;  3J27 B;  1N77 A;  3FUT A;  3A45 A;  3SAV A;  3SMP A;  1EFU B;  1ZV1 A;  5ITQ A;  5ITT A;  3R8F A;  1QQW A;  3KFU G;  2C9O A;  1IBM M;  1X37 A;  4B7G A;  3FYC A;  1JR3 E;  3MHV C;  4D80 A;  3IHP A;  4B3M M;  3HHW A;  4FVM A;  1KFV A;  4JI6 M;  2UUB M;  2DVW B;  1NHG C;  1QAQ A;  4BBA A;  3B89 A;  1VEK A;  2CHG A;  4HL4 A;  3GPP A;  4AI6 A;  1XXH E;  1FNN A;  2Y0T A;  2VF8 A;  3LQQ A;  1J09 A;  4GMQ A;  3GLF E;  5H37 D;  2JZ1 A;  2UUA M;  2QBY B;  1VEJ A;  5EXP A;  4IJE A;  3GPU A;  1VDL A;  1HJP A;  2DWZ B;  4Z6Y A;  1R5L A;  2L4F A;  4BLC A;  1TR8 A;  1IXZ A;  2QQ8 A;  3C9P A;  3ZC7 B;  3GLG B;  3LW5 F;  4D82 A;  2I7P A;  3SAR A;  2OOA A;  3CF0 A;  3AV0 A;  4G4R A;  4CJ6 A;  2CEA A;  2Z3X A;  2DAG A;  2FNA A;  4R71 A;  1IN5 A;  1IQP A;  3GRR A;  3MMP A;  2LWX A;  4IBK A;  1SXJ E;  4B3S M;  4L78 A;  3I4Y A;  1G4A E;  1LTM A;  2Z8Y M;  3FTC A;  4Y28 F;  5E6J A;  4B7F A;  1N34 M;  1T43 A;  3AFH A;  3KOZ E;  4WP2 A;  2LH0 A;  3KOY E;  1TTE A;  4XGI A;  1NO1 A;  5KPR A;  2RGO A;  4B3R M;  1D0K A;  2CWB A;  3SAU A;  3M0E A;  5ITR A;  4GKK M;  3AOG A;  3WHK A;  3HY5 A;  4DV7 M;  2C99 A;  5EXX A;  1QDR A;  1G3I A;  1XXH A;  4GIP A;  4JI1 M;  4DR2 M;  4P16 A;  5E26 A;  4M0W A;  3K2L A;  3GO8 A;  1IBK M;  1RU3 A;  1V92 A;  2D7E A;  4FW9 A;  5FTJ A;  1GVN A;  1HNZ M;  3JAM S;  1IN6 A;  4AQY M;  3GLH A;  5ITX E; 
#chains in the Genus database with same CATH homology
 1MX0 A;  5EXT A;  2D7H A;  1IBL M;  1IY1 A;  4LJ8 A;  2DXI A;  3KSX A;  4OW0 A;  4DV2 M;  3M6A A;  5KQD A;  3U6M A;  2L7H A;  4QOZ C;  5EP3 A;  2R4J A;  2A5Y B;  1IN8 A;  1UM8 A;  3QAU A;  2XLJ A;  4KO8 A;  5JI3 E;  3DFZ A;  2ZAN A;  2CV0 A;  4QHT A;  3SAW A;  3DA1 A;  5JI2 E;  1SXJ A;  3HHZ A;  4KHP M;  1N33 M;  2XSZ A;  1XXH B;  3U6S A;  4I5S A;  4NSO B;  2BJW A;  3L25 A;  3CTW B;  4AG5 A;  4PDG A;  3GLF B;  1HT1 E;  2DZN B;  2KZS A;  1TDZ A;  3SMS A;  4CIS A;  3KDS E;  3U5Z A;  5GKN A;  3IG8 A;  2X49 A;  1OFI A;  3FTE A;  3VK8 A;  4AG6 A;  5C1B A;  2X8A A;  1E9S A;  3GQ3 A;  1NHW C;  2G5G X;  5ITX A;  4CGY B;  1D2N A;  1NJG A;  1XMO M;  2Q2E B;  5A2Q S;  2QP9 X;  1XNQ M;  4R7G A;  1XNR M;  2KRK A;  4FCV A;  3J80 S;  5C18 A;  2YQZ A;  4D81 A;  2UU9 M;  4YY3 M;  2BJV A;  3HU1 A;  4LF6 M;  4GH9 A;  4DV3 M;  3HGI A;  4DUY M;  4FD2 A;  3AOE A;  4JYA M;  4AZF A;  2DWL A;  3U5Z B;  5KO3 A;  4LY6 A;  2CV2 A;  4FCW A;  2L09 A;  4PCZ A;  3PVS A;  1Z5A A;  3TWL A;  3K92 A;  4NL4 H;  1Q39 A;  4B08 A;  1R6B X;  4IBC A;  4IBE A;  4M0D A;  5ITU A;  3TE6 A;  1NVM A;  3GRV A;  3GRU A;  2XF3 A;  3FD9 A;  1ORY B;  2P5T A;  5BR8 M;  4IBF A;  4M9X A;  1H6U A;  3AL0 C;  3HWS A;  4IBJ A;  3RGS A;  1DO0 A;  1GL7 A;  2D7G A;  3KOW E;  3U60 A;  4GHA A;  3PNY A;  2HKJ A;  3RGP A;  3HJQ A;  2HL7 A;  3U61 B;  1WXQ A;  2XGN A;  1QYR A;  1G8P A;  4TUW A;  4QNR A;  2F5Q A;  2E5L M;  2XFS A;  2QEN A;  3KSJ A;  3MK6 A;  4MGI E;  2O5R A;  2XFT A;  1SXJ D;  4AKG A;  2XSZ D;  4ZPX A;  3LVV A;  3GQ5 A;  3WHL A;  4NSR A;  3VLF B;  1LV7 A;  4XBO A;  2OQ4 A;  2C98 A;  3CF2 A;  4JI4 M;  3DZD A;  3VFD A;  4JI5 M;  1VDD A;  1TH4 A;  3U60 B;  2KXE A;  2I7N A;  3A98 B;  1NNJ A;  4LFA M;  2UXC M;  1DGH A;  3FUU A;  1J5E M;  3W0F A;  3SAT A;  4FWG A;  2VQE M;  1L2B A;  4S12 A;  4B7H A;  1HR0 M;  3JR4 A;  4LF7 M;  4L16 A;  4DV6 M;  4PD2 A;  3NWL A;  2Z4S A;  2Z4R A;  1IY2 A;  2F4V M;  4DUZ M;  2X4A A;  3RE8 A;  4LGM A;  4X66 M;  3HU3 A;  1Z5B A;  4LJ9 A;  3PNV A;  5EP2 A;  4DR7 M;  4KOD A;  4OVZ A;  1R7R A;  4WUR A;  2EO2 A;  3K8Z A;  2F5N A;  1L8Q A;  3J7A S;  4JI8 M;  1HNW M;  1E94 E;  3E9S A;  4MGH A;  1YUB A;  3E4R A;  2FOI C;  8CAT A;  1ZAE A;  2ZBK B;  4B3T M;  4IBG A;  4JI7 M;  1N32 M;  3UK6 A;  2EA0 A;  1KSF X;  2H1R A;  2CUZ A;  4JI3 M;  3AKZ A;  3SC3 A;  3Q8X A;  1IN7 A;  2R62 A;  2R18 A;  2Z7J A;  4WW0 A;  3GP1 A;  2ZM6 M;  3SBJ A;  1DGG A;  1K3W A;  3W0L B;  4GRI A;  1IY0 A;  5FSW A;  2KA6 B;  5FTL A;  4GKJ M;  2HCB A;  4L8R C;  3GLH B;  2KZU A;  4DV0 M;  1TH3 A;  3T1H M;  4R3D A;  2R45 A;  2QCU A;  4IBB A;  4DR6 M;  3HJS A;  2VII A;  2DWN A;  5KQ8 A;  2R65 A;  1EE8 A;  3D8B A;  3L28 A;  2OPF A;  5LMU M;  2Y0Q A;  1NSF A;  2V1C A;  3SFZ A;  4GIT A;  3QWL A;  1HQC A;  3KP0 E;  3SYL A;  1OFH A;  2YNM D;  1R2Z A;  3LQR A;  4LF8 M;  1K82 A;  3KXE C;  4I8O A;  2ERC A;  3A46 A;  1G59 A;  1SXJ B;  1IXR C;  1J7K A;  3EIH A;  2XEP A;  3B9P A;  4PT5 A;  4AW4 A;  2V1U A;  4AKI A;  2RGH A;  5KPT A;  3VKG A;  4M9Z A;  4IBI A;  4ITQ A;  3SYK A;  4EIW A;  1QZM A;  3TWK A;  3FTD A;  1GKI A;  1OJL A;  1YSY A;  2LNH C;  5EP1 A;  3VKH A;  3KVW A;  3PXG A;  2NQ8 C;  5IZ7 D;  1IN4 A;  4RF1 A;  4DR3 M;  2J7N A;  3KP1 E;  2JA2 A;  4IJF A;  3GPX A;  3KW6 A;  3NBI A;  3M7G A;  2F5S A;  3L26 A;  3KS8 A;  5IT9 S;  1XMQ M;  5DYG A;  3RFW A;  5BPV A;  1HNX M;  4MGK E;  3FUX A;  3GLI A;  4LJ5 A;  3U6C A;  1SXJ C;  5FTM A;  2G8L A;  4MB7 A;  4FWD A;  3LMM A;  4HLQ A;  1IXS B;  4Z8X A;  2K47 A;  3DOA A;  2R46 A;  3T38 A;  4G4O A;  1K3X A;  2CFO A;  2QBY A;  1W5S A;  1I94 M;  3J81 S;  1NY5 A;  1L2C A;  2UXD M;  4DR1 M;  1HQY E;  3GLG A;  4LJ6 A;  4LZJ A;  3SHG B;  3T1Y M;  5F3W A;  3UJN A;  4LFB M;  3VDU A;  4LF4 M;  4AKH A;  1TH2 A;  1Z59 A;  5FLX S;  4LG2 A;  3FKE A;  1L2D A;  3ZH9 B;  1E32 A;  3GRY A;  2QZ4 A;  3KOX E;  4LF5 M;  5FTK A;  4MH0 E;  2V6Z M;  5LMN M;  1IM2 A;  3H4M A;  4PDI A;  2AHM A;  3GLI B;  3EIE A;  2RKO A;  3FUW A;  2C9C A;  4DV4 M;  3HKP A;  2KW0 A;  5IRE B;  4DV1 M;  3U6L A;  2M5Z A;  2Y21 A;  4LRT A;  3AOE C;  3T15 A;  4DR5 M;  4GC5 A;  4BB9 A;  1W5T A;  1L1T A;  4KLN A;  1C1K A;  4RNA A;  3L27 A;  4OX9 M;  4QOS A;  2DWM A;  4NRW A;  3FTF A;  3UZU A;  1R2Y A;  3HHX A;  1Q3C A;  4LZZ A;  1QAO A;  3J2P B;  1N78 A;  1S3S A;  2FFJ A;  2M60 A;  2L6O A;  2F5O A;  3ZCB B;  4JV5 M;  4GHL A;  1I4W A;  2Y20 A;  4X62 M;  5EP4 A;  3SHF A;  2CE7 A;  4LFC M;  4MM3 B;  4GC9 A;  3ILK A;  1QVR A;  1YE9 A;  3PFI A;  2J7O A;  1DGF A;  4M9S A;  4LJ4 A;  3TWM A;  3U6Q A;  1JR3 A;  3J7B A;  4X65 M;  4YHH M;  1XWI A;  3LVW A;  1Z6T A;  4MGZ E;  1HT2 E;  1ZQ9 A;  3TL4 X;  3UMM A;  1NY6 A;  3HJ8 A;  2C96 A;  4DV5 M;  3U6E A;  3U6P A;  2KEB A;  1DGH B;  4FWH A;  4NXN M;  2XZU A;  4G4Q A;  4QNM A;  1E9R A;  3GLF A;  4LJ7 A;  4LRS A;  3TPZ A;  2XH9 A;  3FYD A;  2CHV A;  3BOS A;  1G41 A;  4G6Z A;  3U6D A;  4MGY E;  7CAT A;  3JR5 A;  1GL6 A;  2R4E A;  2F5P A;  4G4N A;  1QAM A;  4FCT A;  1QAN A;  3U6O A;  3GQ4 A;  1Q3B A;  4JI2 M;  3THG A;  1DO2 A;  3K1J A;  1TGU A;  1PJI A;  4NXM M;  5EXS A;  1MU5 A;  2YR0 A;  4JXJ A;  4L4U A;  3KS4 A;  4LJA A;  4OVZ B;  2LXE A;  2VQF M;  2QPA A;  4L15 A;  5EQT A;  4IIW A;  5FTN A;  3CF6 E;  1PM5 A;  3VK7 A;  4W5W A;  3AJI B;  4A3V B;  2DZO B;  4RF0 A;  1XC8 A;  3A42 A;  3UGJ A;  3MJ5 A;  4REZ A;  3I4V A;  3TQS A;  4QHS A;  3HU2 A;  4K0K M;  1XHB A;  4LF9 M;  1JQJ C;  2BNK A;  4II7 A;  2L7I A;  5DNY A;  2FE8 A;  3OTO M;  1PJJ A;  4X64 M;  1T3T A;  3L2A A;  3GPY A;  2ZAO A;  1N36 M;  3I51 A;  2CHQ A;  4LGY A;  2DHR A;  2XZF A;  2C5R A;  5KPZ A;  1NNU C;  3SAS A;  4LCB A;  3R9X B;  3FUV A;  4JN6 A;  1L1Z A;  1N75 A;  2ZAM A;  2HHH M;  4CHT B;  4DR4 M;  2YFQ A;  1FJG M;  3HHY A;  1Z5C A;  5IWA M;  1GLN A;  4NOO B;  5EJC A;  3D8L A;  3L29 A;  3VDP A;  4I81 A;  2UUC M;  4I4L A;  1KYI A;  1TDH A;  2KRU A;  4IBD A;  3C58 A;  4OU7 A;  3U61 A;  4NRV A;  3IG5 A;  1DGB A;  4JI0 M;  2CV1 A;  1NJF A;  5ITY A;  2W82 A;  5DYI A;  1JR3 D;  2EUC A;  2UXB M;  3J27 B;  1N77 A;  3FUT A;  3A45 A;  3SAV A;  3SMP A;  3R8F A;  5ITT A;  5ITQ A;  3KFU G;  1QQW A;  2C9O A;  1IBM M;  1X37 A;  4B7G A;  3FYC A;  3MHV C;  4D80 A;  4B3M M;  4JI6 M;  3HHW A;  4FVM A;  1KFV A;  2UUB M;  2DVW B;  1NHG C;  1QAQ A;  4BBA A;  2CHG A;  4HL4 A;  3GPP A;  4AI6 A;  1FNN A;  2Y0T A;  3LQQ A;  1J09 A;  4GMQ A;  2UUA M;  5H37 D;  2QBY B;  5EXP A;  4IJE A;  3GPU A;  2DWZ B;  4Z6Y A;  4BLC A;  1IXZ A;  3GLG B;  3ZC7 B;  4D82 A;  2I7P A;  3SAR A;  3CF0 A;  3AV0 A;  4G4R A;  2CEA A;  2Z3X A;  2FNA A;  1IN5 A;  1IQP A;  3GRR A;  4IBK A;  2LWX A;  1SXJ E;  4B3S M;  4L78 A;  3I4Y A;  1G4A E;  4B7F A;  3FTC A;  5E6J A;  1N34 M;  3AFH A;  3KOZ E;  2LH0 A;  3KOY E;  4XGI A;  5KPR A;  2RGO A;  4B3R M;  3SAU A;  3M0E A;  5ITR A;  4GKK M;  3AOG A;  3WHK A;  4DV7 M;  2C99 A;  5EXX A;  1G3I A;  1XXH A;  4GIP A;  4JI1 M;  4DR2 M;  4P16 A;  5E26 A;  4M0W A;  3K2L A;  3GO8 A;  1IBK M;  2D7E A;  4FW9 A;  5FTJ A;  1GVN A;  1HNZ M;  3JAM S;  1IN6 A;  4AQY M;  3GLH A;  5ITX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...