5LMNM

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5lmnM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5lmnM02
4DV3M 2F5NA 4PDGA 1N34M 3GPUA 3GQ4A 4DUYM 3J81S 3U6PA 3TWKA 3U6QA 3SBJA 3SATA 1Q39A 3U6DA 3U6SA 2ZBKB 3GP1A 3J80S 4LFAM 2VQFM 3SASA 1XNQM 4DV4M 3U6MA 4JI2M 4GKKM 4DV7M 3GQ5A 4G4OA 1FJGM 4JV5M 2XZFA 1HNZM 4JI5M 1XC8A 4JI8M 4K0KM 2UXDM 1Z5BA 1J5EM 4LF6M 1Z5AA 3A42A 4DUZM 4DR6M 5BR8M 5IT9S 5ITTA 2UXCM 1Q3CA 3VK7A 3JAMS 1HNXM 5ITUA 4DV6M 4DR3M 4YY3M 3VK8A 1IBKM 1Q3BA 1HNWM 4G4NA 4NXMM 4X65M 1IBMM 4JI6M 4JYAM 3GQ3A 1R2ZA 3T1YM 4GKJM 4CISA 4OX9M 2E5LM 4LFCM 3TWLA 1Z59A 5LMUM 4G4QA 5LMNM 2UUAM 1I94M 1HR0M 2OPFA 2Q2EB 3GPXA 5FLXS 4AQYM 3SAUA 1K3XA 3U6CA 1R2YA 5ITQA 1TDHA 2UUCM 4DV2M 4DR7M 4DR5M 2EA0A 1MU5A 3GPPA 1PJIA 4JI1M 2OQ4A 1XMQM 4KHPM 1IBLM 1Z5CA 3J7AS 4LF4M 5ITXE 3C58A 1L2BA 2F5SA 2HKJA 3JR5A 4NXNM 4MB7A 4DR1M 4DR2M 3U6LA 4LF7M 1L2CA 4DV5M 5ITYA 3GO8A 5ITXA 1L1ZA 2UUBM 4LFBM 4YHHM 3SARA 3JR4A 1MX0A 4DV0M 4B3MM 4DV1M 1TDZA 3TWMA 3W0FA 1N32M 2UU9M 5IWAM 4PDIA 3A46A 3GPYA 4JI7M 4LF9M 4NRWA 3T1HM 2F5QA 3OTOM 4PCZA 3SAWA 4LF5M 4X62M 4JI3M 4LF8M 4NRVA 3U6EA 1PM5A 1K82A 3SAVA 4X66M 1EE8A 1N33M 4ITQA 2VQEM 1L1TA 4JI4M 2F4VM 2XZUA 2F5PA 4DR4M 3DOAA 1XMOM 1KFVA 4B3TM 5A2QS 4B3RM 2UXBM 4B3SM 5ITRA 1K3WA 2HHHM 4PD2A 3U6OA 1PJJA 4X64M 1N36M 3A45A 4G4RA 1NNJA 2ZM6M 1L2DA 2F5OA 1XNRM 4JI0M
chains in the Genus database with same CATH superfamily
4DV3M 1S3SA 3ZC7B 2F5NA 1N34M 2CV2A 1SG9A 4M0DA 4F1IA 4DUYM 2DWZB 3L26A 3U6PA 3TWKA 3U6QA 3SBJA 1OFIA 1D0LA 2QBYB 4LZJA 3PVSA 4NC6A 3U6DA 3L27A 2FH0A 4REZA 5EXXA 2HAKA 3GP1A 3U6SA 4LFAM 3SFZA 2C9OA 3UZUA 2XEPA 5KQ8A 1XNQM 1XB2B 3ZH9B 4XBOA 2MJ5B 2CHVA 4RNAA 3L25A 3PNVA 4A3VB 1KSFX 1HQCA 3GLHE 3LCVB 3HHWA 5EJCA 1GKIA 3RE8A 1CUKA 3D8BA 2FNAA 3FRHA 5DYIA 4M0WA 4PT5A 2GQFA 2UXDM 2W82A 2V1UA 3K92A 2D7GA 1ZMUA 2BJVA 4FVMA 5FTMA 3HWSA 4L15A 5IT9S 1XXHE 2KNVA 3PFIA 1ZMWA 2FFJA 2LVOC 3QYBA 1NY6A 2APLA 1VEKA 5GKNA 4L6V6 4GRIA 3FE3A 3KS4A 5JI3E 4G4NA 3AOEA 3FYCA 4X65M 1OQYA 4BBAA 4JYAM 3GLFA 3GQ3A 2V6ZM 3GLIB 4B7HA 4LG2A 1T43A 2E5LM 4QHTA 1PJSA 3BOSA 3KOXE 1Z59A 2I7PA 3J27B 3K2LA 1N77A 3E4RA 5LMNM 1I4WA 3TL4X 3FUXA 4GMQA 2Q2EB 5FLXS 3SAUA 3B7NA 3K9OA 2N35A 1TDHA 5ITQA 2O5RA 3EIEA 2UUCM 1HQYE 3I04M 2R0IA 4DR5M 4LGMA 2JZ0A 3DFZA 3I4VA 4I8OA 1PJIA 2HWJA 2FE8A 2R65A 2DZNB 3AV0A 4KHPM 4GITA 1N78A 2OO9A 2Z3XA 1VG5A 3KS8A 3U5ZA 3WHKA 1OAIA 5E26A 4NXNM 4IIWA 3UK6A 4DR2M 3U60A 3HY5A 4AG6A 4B7GA 2KHHA 4LFBM 4OU7A 4ZPXA 5EP1A 1QAQA 3QYEA 4WW0A 5EXSA 3TQSA 2QHOB 3SYLA 4HL4A 4R7GA 4LRSA 4LGYA 3RGPA 2CFOA 2DHRA 3U61B 2EKFA 2RGHA 1TF0B 3FRIA 3T1HM 5F3WA 4LJ5A 3SC3A 4PCZA 4R3DA 4JI3M 1JR3D 4X62M 4LF8M 1K82A 1NV8A 2KZSA 2YNMD 2OOBA 4CGYB 1J7KA 2C99A 2QSFX 1L1TA 4JI4M 1JQJC 1P3QQ 2X4AA 4LJ9A 1XMOM 2EO2A 1NNUC 4B3RM 4AKHA 2K0BX 1G4AE 3GRUA 3MJ5A 4D82A 4QHSA 2QNJA 3W68A 2JY8A 3DZDA 1DGHB 2ZTDA 1KYIA 3SHFA 4S12A 3AOEC 1R5LA 2C98A 5L8RF 2CHGA 2DZOB 2F5OA 1IN4A 1T3TA 1E9SA 2L2DA 4PDGA 4Z8XA 1V33A 2CWBA 2EKKA 1VDLA 1QVRA 2FOIC 1IN8A 1W5TA 1XXHA 5C1BA 2ZBKB 3J80S 1IN6A 4L8RC 3SASA 1IXSA 1VEJA 3LMMA 2GNOA 2ZANA 3GQ5A 3KP0E 4GIPA 3E46A 2DVWB 1QUSA 4AZFA 7CATA 1PJQA 4G4OA 4KODA 2WZJA 3FD9A 2RKOA 4JXJA 4Y28F 3WHLA 2XZFA 1HNZM 3RFWA 1XC8A 4JI8M 1Y8GA 2MGWA 2XLJA 4K0KM 3GLIE 1HT1E 1J5EM 3UGJA 1Z5AA 2KXEA 2Y21A 1IFYA 5C18A 3VK7A 1WGNA 3IECA 3FUWA 1HNXM 2MR9A 1SXJE 4DV6M 3L2AA 3NBIA 1GLNA 4YY3M 2M60A 4FD2A 1FNNA 1G8PA 2DAGA 1Q3BA 4QNRA 4LY6A 4RF0A 4OW0A 1IN5A 2LTUA 4L4UA 3B9PA 3UMMA 1ZMVA 1XHBA 3KOZE 3T1YM 4GKJM 4W5WA 2DHYA 3IHPA 5EP2A 3I01M 4CISA 1NY5A 5IREB 2Z4RA 1LTMA 3LCUA 3GLFB 5LMUM 1V92A 3HZJA 3LQQA 2HCBA 3CTWB 3HU3A 2LNHC 4IBFA 3J7BA 2QQ8A 4AQYM 3HHZA 2DWNA 5EP4A 2DNAA 3HU2A 3IG5A 4DV2M 2R44A 3VKHA 1BVSA 4CJ6A 2DAMA 1XMQM 2KDLA 2X8AA 4FWGA 1IQPA 3HHYA 1G3IA 1N75A 2Z4SA 3EIHA 5ITXE 4LF4M 3M7GA 3C58A 2F5SA 1DV0A 2KNAA 2HKJA 3CGWA 3GRYA 3V76A 2D7HA 3CF6E 3JR5A 3U6LA 1GO5A 1IY0A 3CF2A 2I7NA 4D80A 2JY7A 2QCUA 3U5ZB 1GJTA 4DV5M 2ZAOA 1L2CA 4AKGA 4NSOB 5KPZA 3UJNA 3GO8A 4II7A 1L1ZA 2BWBA 1MN3A 3U60B 2L09A 3SARA 3JR4A 1QZEA 3GLGE 1G71A 1HJPA 5KQDA 4DV0M 2G3QA 1EFUB 2KRKA 4IBIA 4B3MM 1E94E 3BBZA 1NV9A 3CF0A 2DWMA 3LW5F 4IBCA 3FTFA 5H37D 1AUAA 2EUCA 4NRWA 1GL6A 1LV7A 4LJAA 1VEGA 4L16A 2XF3A 3R8FA 4QOSA 1C7YA 3AL0C 3ZQJA 4IBEA 3SAWA 3E9SA 4LCBA 4LF5M 2KRUA 5DFLA 3HKPA 4KLNA 4NRVA 3U6EA 1PJTA 3T15A 4GHLA 1NJGA 1N33M 3H4MA 2O01F 2XFSA 3VFDA 3VLFB 1NO1A 5DYGA 4DR4M 2FS1A 2VIIA 4M9XA 3DA1A 1QQWA 2KNZA 2JUJA 3C9PA 2UXBM 3F92A 2BNKA 4I5SA 4B3SM 2K47A 4LZZA 3AFHA 1K3WA 2XSZA 4NL4H 1ORYB 1PJJA 4M9ZA 3A45A 3LVWA 3RGSA 1NNJA 4LRTA 3MK6A 3GQ4A 2JA2A 3J81S 1HT2E 2L6OA 1GJSA 3B74A 3SATA 3THGA 1QDTA 3VDPA 3FUVA 2LHGA 4MGZE 1T6OA 3B89A 1QZMA 1IXRC 1SXJA 5BPVA 5KPTA 2K9DA 1D0KA 3U6MA 1XXHB 4GKKM 2CE7A 4NSRA 8CATA 4DV7M 4AKIA 2LHCA 3H4JA 1FJGM 3AJIB 2L4FA 1IXSB 2KZUA 5EQTA 4GHAA 4JI5M 4IBJA 2J7OA 1J09A 4HLQA 1Z5BA 2JXNA 3B7ZA 3FTCA 2DAIA 4DUZM 1WJ7A 5BR8M 3GLHA 1TH2A 5FSWA 5ITTA 5DNYA 2WSFF 1TTEA 3M0EA 2UXCM 1OJLA 4P16A 1JB0F 3JAMS 4I81A 5ITUA 2CV0A 4DR3M 4Q7JA 1YLAA 4MH0E 2R62A 2YFQA 1TR8A 1IBKM 4NXMM 3FKEA 4JI6M 4GC9A 1NHGC 3FUUA 4OVZA 2CV1A 2LXEA 1QAOA 4Z6YA 1JR3E 1WGLA 2VF7A 4R71A 4B7FA 4LFCM 3KXEC 3TWLA 2OOAA 2EJSA 1VQ1A 2KW0A 4NOOB 1YUBA 2UUAM 3B7QA 4L78A 3GPXA 4KO8A 1Q02A 2QENA 1K3XA 1TH3A 3U6CA 1DGBA 2KEBA 5EXTA 2R6FA 2EA0A 1MU5A 4D81A 2WSCF 5JI2E 3GLGA 3D8LA 4AG5A 2RGOA 1QANA 4IBBA 1Z5CA 2CP8A 3PXGA 3J7AS 1EIJA 4FWHA 1UFZA 1UM8A 3TPZA 3SMPA 2ZTCA 1ZV1A 4DR1M 1NHWC 4WURA 1NVMA 4XGIA 4AW4A 1R4GA 2V1CA 1WXQA 4DBGB 2ERCA 1XWIA 2DI0A 2X49A 5ITYA 2H5XA 4QNMA 4CIZA 4YHHM 1TH4A 3NWLA 1OTRA 4IBDA 3HJ8A 4AI6A 1ZQ9A 1MX0A 5IZ7D 4EIWA 4G3OA 4BB9A 4LJ6A 2DAKA 2JNHA 2WSEF 2J7NA 2R4JA 4GEWA 3W0FA 2LVAA 4DV1M 3TWMA 2UU9M 5IWAM 4PDIA 1C1KA 1H6UA 4JI0M 1SXJC 4FCTA 2LH0A 3GPYA 2DXIA 4JI7M 4LF9M 2Y0QA 3SHGB 3HHXA 2CHQA 4MGIE 2F5QA 1L8QA 3TE6A 3OTOM 2R4EA 1PM5A 3M6AA 5FTNA 3QAUA 4BLCA 1DO2A 1QUTA 4X66M 1EE8A 2CRUA 3SAVA 3J2PB 4G6ZA 4IBKA 4P17A 2JP7A 2XZUA 2F5PA 2F4VM 2VDBB 3AOGA 3DOAA 3KOWE 3FUTA 2P5TA 5FTLA 1YE9A 1KFVA 5A2QS 1F4IA 2BJWA 2QZ4A 4MGKE 1NSFA 1OKSA 1IY1A 3ZCBB 4HEOA 3LVVA 3KVWA 5ITRA 4PD2A 2LVNC 3U6OA 3K1JA 4X64M 3SYKA 4G4RA 2ZM6M 1L2DA 1XNRM 2QBYA 3KOYE 1WIVA 2C96A 3I51A 3ILKA 3KW6A 3GPUA 2JWSA 1IN7A 2AHMA 4M9SA 1Q39A 1W5SA 3K9PA 1R7RA 3A98B 2C9CA 2VQFM 2K6BA 3FTEA 1QYRA 3E21A 4DV4M 5E6JA 4JI2M 3GRVA 1E32A 4IBGA 1OIZA 1SXJB 1NJFA 4JV5M 2LWXA 2Z8YM 3Q8XA 3GRRA 2L7IA 3I4YA 1DO0A 1JR3A 1QDRA 2H1RA 4LF6M 4WP2A 2Y20A 2JY5A 3A42A 4DR6M 3C3DA 3L28A 1OIPA 2G8LA 3MHVC 3T6PA 4CHTB 1Q3CA 2CUZA 4IJFA 1D0MA 1X37A 1AIPC 2KA6B 2J5YA 3GLHB 3VK8A 3GLIA 2JY6B 1DGFA 1HNWM 3KSJA 3SMSA 3C3EA 1IXZA 2R18A 2RRUA 1IBMM 4LJ4A 1R2ZA 2VF8A 4MM3B 4OX9M 4ANRA 1IY2A 2C5RA 2A5YB 3Q8GA 3VKGA 4OVZB 4G4QA 2R45A 2L7HA 4FWDA 3FYDA 3KP1E 2LVQD 1I94M 1HR0M 1PGYA 2QPAA 2OPFA 3HJQA 4I4LA 1R6BX 3W0LB 3T38A 1OAOC 2R46A 1R2YA 2YQZA 5KO3A 4DR7M 4MGHA 5FTKA 1DGGA 3GPPA 3QWLA 4XK8F 1Z6TA 2DENA 1D2NA 3GLFE 4JI1M 1IM2A 2OQ4A 4RF1A 4UN2B 1IBLM 3HU1A 3KDSE 1L2BA 3GLGB 3VDUA 4FCVA 4MB7A 2XSZD 3HJSA 4RKUF 2O25A 4LJ7A 5KPRA 4FCWA 4LF7M 2DZLA 2DAEA 1PRBA 2D7EA 2L4EA 4IJEA 5ITXA 1ZAEA 5EP3A 2UUBM 4JN6A 1GABA 4B08A 2G5GX 3KSXA 5EXPA 3U61A 2Z7JA 1GL7A 1SXJD 1TDZA 1OFHA 1QAMA 2NQ8C 1N32M 3FTDA 1WHCA 1MJGM 3BXWA 2LBCA 2MROB 3A46A 4QOZC 5FTJA 1TGUA 2Y0TA 3HX3A 2CEAA 2DKLA 2QP9X 4GC5A 4KT0F 1RU3A 4TUWA 3K8ZA 2DWLA 2XGNA 4FW9A 3L29A 1YSYA 3IG8A 3W67A 3NBXX 2XH9A 1GVNA 1G41A 4ITQA 2VQEM 2ZAMA 4LJ8A 2M5ZA 1DGHA 4MGYE 3R9XB 2JZ1A 4B3TM 2YR0A 2XFTA 3MMPA 1V34A 3LQRA 3PNYA 2HL7A 1G59A 4F2LA 2MH8A 3KFUG 2B3TA 2BWEA 4GH9A 2HHHM 3HGIA 1WR1B 1E9RA 1N36M 1A5TA 1VDDA 2LVPC 3AKZA
chains in the Genus database with same CATH topology
4DV3M 1S3SA 3ZC7B 2F5NA 1N34M 2CV2A 4M0DA 4DUYM 2DWZB 3L26A 3U6PA 3TWKA 3U6QA 3SBJA 1OFIA 2QBYB 4LZJA 3PVSA 3U6DA 3L27A 4REZA 5EXXA 3GP1A 3U6SA 4LFAM 3SFZA 2C9OA 3UZUA 2XEPA 5KQ8A 1XNQM 3ZH9B 4XBOA 2CHVA 4RNAA 3L25A 3PNVA 4A3VB 1KSFX 1HQCA 3HHWA 5EJCA 1GKIA 3RE8A 3D8BA 5DYIA 2FNAA 4M0WA 4PT5A 2UXDM 2W82A 2V1UA 3K92A 2D7GA 4FVMA 2BJVA 5FTMA 3HWSA 4L15A 5IT9S 3PFIA 2FFJA 1NY6A 5GKNA 4GRIA 3KS4A 5JI3E 4G4NA 3AOEA 3FYCA 4X65M 4BBAA 4JYAM 3GLFA 3GQ3A 2V6ZM 3GLIB 4B7HA 4LG2A 2E5LM 4QHTA 3BOSA 3KOXE 1Z59A 2I7PA 3J27B 3K2LA 1N77A 3E4RA 5LMNM 1I4WA 3TL4X 3FUXA 4GMQA 2Q2EB 5FLXS 3SAUA 5ITQA 1TDHA 2O5RA 3EIEA 2UUCM 1HQYE 4DR5M 4LGMA 3DFZA 3I4VA 4I8OA 1PJIA 2FE8A 2R65A 2DZNB 3AV0A 4KHPM 4GITA 1N78A 2Z3XA 3KS8A 3U5ZA 3WHKA 5E26A 4NXNM 4IIWA 3UK6A 4DR2M 3U60A 4AG6A 4B7GA 4LFBM 4OU7A 4ZPXA 5EP1A 1QAQA 4WW0A 5EXSA 3TQSA 3SYLA 4HL4A 4R7GA 4LRSA 4LGYA 3RGPA 2CFOA 2DHRA 3U61B 2RGHA 3T1HM 5F3WA 4LJ5A 3SC3A 4PCZA 4R3DA 4JI3M 1JR3D 4X62M 4LF8M 1K82A 2KZSA 2YNMD 4CGYB 1J7KA 2C99A 1L1TA 4JI4M 1JQJC 2X4AA 4LJ9A 1XMOM 2EO2A 1NNUC 4B3RM 4AKHA 1G4AE 3GRUA 3MJ5A 4D82A 4QHSA 3DZDA 1DGHB 1KYIA 3SHFA 4S12A 3AOEC 2C98A 2CHGA 2DZOB 2F5OA 1IN4A 1T3TA 1E9SA 4PDGA 4Z8XA 1QVRA 2FOIC 1IN8A 1W5TA 1XXHA 5C1BA 2ZBKB 3J80S 1IN6A 4L8RC 3SASA 3LMMA 2ZANA 3GQ5A 3KP0E 4GIPA 2DVWB 4AZFA 4G4OA 7CATA 4KODA 3FD9A 2RKOA 4JXJA 3WHLA 2XZFA 1HNZM 3RFWA 1XC8A 4JI8M 2XLJA 4K0KM 1HT1E 1J5EM 3UGJA 1Z5AA 2KXEA 2Y21A 5C18A 3VK7A 3FUWA 1HNXM 1SXJE 4DV6M 3L2AA 3NBIA 1GLNA 4YY3M 2M60A 4FD2A 1FNNA 1G8PA 4RF0A 1Q3BA 4QNRA 4LY6A 4OW0A 1IN5A 4L4UA 3B9PA 3UMMA 1XHBA 3KOZE 3T1YM 4GKJM 4W5WA 5EP2A 4CISA 1NY5A 5IREB 2Z4RA 3GLFB 5LMUM 3LQQA 2HCBA 3CTWB 3HU3A 2LNHC 4IBFA 3J7BA 4AQYM 3HHZA 2DWNA 5EP4A 3HU2A 3IG5A 4DV2M 3VKHA 1XMQM 2X8AA 4FWGA 1IQPA 3HHYA 1G3IA 1N75A 2Z4SA 3EIHA 5ITXE 4LF4M 3M7GA 3C58A 2F5SA 2HKJA 3GRYA 3JR5A 2D7HA 3CF6E 3U6LA 1IY0A 3CF2A 2I7NA 4D80A 2QCUA 3U5ZB 1L2CA 4DV5M 2ZAOA 4AKGA 4NSOB 5KPZA 3UJNA 3GO8A 4II7A 1L1ZA 3U60B 2L09A 3SARA 3JR4A 5KQDA 4DV0M 4B3MM 2KRKA 4IBIA 1E94E 3CF0A 2DWMA 4IBCA 3FTFA 5H37D 2EUCA 4NRWA 1LV7A 1GL6A 4LJAA 4L16A 2XF3A 3R8FA 4QOSA 3AL0C 4IBEA 3SAWA 3E9SA 4LCBA 4LF5M 2KRUA 3HKPA 4KLNA 4NRVA 3U6EA 3T15A 4GHLA 1NJGA 1N33M 3H4MA 2XFSA 3VFDA 3VLFB 5DYGA 4DR4M 2VIIA 4M9XA 3DA1A 1QQWA 2UXBM 2BNKA 4I5SA 4B3SM 2K47A 4LZZA 3AFHA 1K3WA 2XSZA 4NL4H 1ORYB 1PJJA 4M9ZA 3A45A 3LVWA 3RGSA 1NNJA 4LRTA 3MK6A 3GQ4A 2JA2A 3J81S 1HT2E 2L6OA 3SATA 3THGA 3VDPA 3FUVA 4MGZE 1QZMA 1IXRC 1SXJA 5BPVA 5KPTA 3U6MA 1XXHB 4GKKM 2CE7A 4NSRA 8CATA 4DV7M 4AKIA 1FJGM 3AJIB 1IXSB 2KZUA 5EQTA 4GHAA 4JI5M 4IBJA 2J7OA 1J09A 4HLQA 1Z5BA 3FTCA 4DUZM 5BR8M 3GLHA 1TH2A 5FSWA 5ITTA 5DNYA 3M0EA 2UXCM 1OJLA 4P16A 2CV0A 3JAMS 4I81A 5ITUA 4DR3M 4MH0E 2R62A 2YFQA 1IBKM 4NXMM 3FKEA 4JI6M 4GC9A 1NHGC 3FUUA 4OVZA 2CV1A 2LXEA 1QAOA 4Z6YA 4B7FA 4LFCM 3KXEC 3TWLA 2KW0A 4NOOB 1YUBA 2UUAM 4L78A 3GPXA 4KO8A 2QENA 1K3XA 1TH3A 3U6CA 1DGBA 2KEBA 5EXTA 2EA0A 1MU5A 4D81A 3GLGA 5JI2E 3D8LA 4AG5A 2RGOA 1QANA 4IBBA 1Z5CA 3PXGA 3J7AS 4FWHA 1UM8A 3TPZA 3SMPA 4DR1M 1NHWC 4WURA 1NVMA 4XGIA 4AW4A 2V1CA 1WXQA 2ERCA 1XWIA 5ITYA 2X49A 4QNMA 4YHHM 1TH4A 3NWLA 4IBDA 3HJ8A 4AI6A 1ZQ9A 1MX0A 5IZ7D 4EIWA 4BB9A 4LJ6A 4DV1M 2J7NA 2R4JA 3W0FA 3TWMA 2UU9M 5IWAM 4PDIA 1C1KA 1H6UA 2DXIA 1SXJC 4FCTA 2LH0A 3GPYA 4JI7M 4LF9M 2Y0QA 3SHGB 3HHXA 2CHQA 4MGIE 2F5QA 1L8QA 3TE6A 3OTOM 2R4EA 1PM5A 3M6AA 5FTNA 3QAUA 4BLCA 1DO2A 3SAVA 4X66M 1EE8A 3J2PB 4G6ZA 4IBKA 2F4VM 2XZUA 2F5PA 3AOGA 3KOWE 3DOAA 3FUTA 2P5TA 5FTLA 1YE9A 1KFVA 5A2QS 2BJWA 2QZ4A 4MGKE 1NSFA 3ZCBB 1IY1A 3LVVA 3KVWA 5ITRA 4PD2A 3U6OA 3K1JA 4X64M 3SYKA 4G4RA 2ZM6M 1L2DA 1XNRM 2QBYA 3KOYE 2C96A 3KW6A 3I51A 3ILKA 3GPUA 1IN7A 2AHMA 4M9SA 1Q39A 1W5SA 1R7RA 3A98B 2C9CA 2VQFM 3FTEA 1QYRA 4DV4M 5E6JA 4JI2M 3GRVA 1E32A 4IBGA 1SXJB 1NJFA 4JV5M 2LWXA 3Q8XA 3GRRA 2L7IA 3I4YA 1DO0A 1JR3A 2H1RA 4LF6M 2Y20A 3A42A 4DR6M 3L28A 2G8LA 3MHVC 4CHTB 1Q3CA 2CUZA 4IJFA 3VK8A 1X37A 2KA6B 3GLHB 3GLIA 1DGFA 1HNWM 3KSJA 3SMSA 1IXZA 2R18A 1IBMM 4LJ4A 1R2ZA 4MM3B 4OX9M 1IY2A 2C5RA 2A5YB 3VKGA 4OVZB 4G4QA 2R45A 2L7HA 4FWDA 3FYDA 3KP1E 1I94M 1HR0M 2OPFA 2QPAA 3HJQA 4I4LA 1R6BX 3W0LB 3T38A 1R2YA 2R46A 2YQZA 5KO3A 4DR7M 4MGHA 5FTKA 1DGGA 3GPPA 3QWLA 1Z6TA 1D2NA 4JI1M 1IM2A 2OQ4A 4RF1A 1IBLM 3HU1A 3KDSE 1L2BA 3GLGB 3VDUA 4MB7A 2XSZD 3HJSA 5KPRA 4LJ7A 4FCWA 4LF7M 2D7EA 4IJEA 5ITXA 1ZAEA 5EP3A 2UUBM 4JN6A 4B08A 2G5GX 3KSXA 5EXPA 3U61A 2Z7JA 1GL7A 1SXJD 1TDZA 1OFHA 1QAMA 2NQ8C 1N32M 3FTDA 4QOZC 3A46A 5FTJA 1TGUA 2Y0TA 2CEAA 2QP9X 4GC5A 4TUWA 3K8ZA 2DWLA 2XGNA 4FW9A 3L29A 1YSYA 3IG8A 2XH9A 1GVNA 1G41A 4ITQA 2VQEM 2ZAMA 4LJ8A 2M5ZA 1DGHA 4MGYE 3R9XB 4B3TM 2YR0A 2XFTA 1G59A 3LQRA 3PNYA 2HL7A 3KFUG 4GH9A 2HHHM 3HGIA 1E9RA 1N36M 4FCVA 1VDDA 4JI0M 3AKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 M;  2F5N A;  4PDG A;  1N34 M;  3GPU A;  3GQ4 A;  4DUY M;  3J81 S;  3U6P A;  3TWK A;  3U6Q A;  3SBJ A;  3SAT A;  1Q39 A;  3U6D A;  3U6S A;  2ZBK B;  3GP1 A;  3J80 S;  4LFA M;  2VQF M;  3SAS A;  1XNQ M;  4DV4 M;  3U6M A;  4JI2 M;  4GKK M;  4DV7 M;  3GQ5 A;  4G4O A;  1FJG M;  4JV5 M;  2XZF A;  1HNZ M;  4JI5 M;  1XC8 A;  4JI8 M;  4K0K M;  2UXD M;  1Z5B A;  1J5E M;  4LF6 M;  1Z5A A;  3A42 A;  4DUZ M;  4DR6 M;  5BR8 M;  5IT9 S;  5ITT A;  2UXC M;  1Q3C A;  3VK7 A;  3JAM S;  1HNX M;  5ITU A;  4DV6 M;  4DR3 M;  4YY3 M;  3VK8 A;  1IBK M;  1Q3B A;  1HNW M;  4G4N A;  4NXM M;  4X65 M;  1IBM M;  4JI6 M;  4JYA M;  3GQ3 A;  1R2Z A;  3T1Y M;  4GKJ M;  4CIS A;  4OX9 M;  2E5L M;  4LFC M;  3TWL A;  1Z59 A;  5LMU M;  4G4Q A;  5LMN M;  2UUA M;  1I94 M;  1HR0 M;  2OPF A;  2Q2E B;  3GPX A;  5FLX S;  4AQY M;  3SAU A;  1K3X A;  3U6C A;  1R2Y A;  5ITQ A;  1TDH A;  2UUC M;  4DV2 M;  4DR7 M;  4DR5 M;  2EA0 A;  1MU5 A;  3GPP A;  1PJI A;  4JI1 M;  2OQ4 A;  1XMQ M;  4KHP M;  1IBL M;  1Z5C A;  3J7A S;  4LF4 M;  5ITX E;  3C58 A;  1L2B A;  2F5S A;  2HKJ A;  3JR5 A;  4NXN M;  4MB7 A;  4DR1 M;  4DR2 M;  3U6L A;  4LF7 M;  1L2C A;  4DV5 M;  5ITY A;  3GO8 A;  5ITX A;  1L1Z A;  2UUB M;  4LFB M;  4YHH M;  3SAR A;  3JR4 A;  1MX0 A;  4DV0 M;  4B3M M;  4DV1 M;  1TDZ A;  3TWM A;  3W0F A;  1N32 M;  2UU9 M;  5IWA M;  4PDI A;  3A46 A;  3GPY A;  4JI7 M;  4LF9 M;  4NRW A;  3T1H M;  2F5Q A;  3OTO M;  4PCZ A;  3SAW A;  4LF5 M;  4X62 M;  4JI3 M;  4LF8 M;  4NRV A;  3U6E A;  1PM5 A;  1K82 A;  3SAV A;  4X66 M;  1EE8 A;  1N33 M;  4ITQ A;  2VQE M;  1L1T A;  4JI4 M;  2F4V M;  2XZU A;  2F5P A;  4DR4 M;  3DOA A;  1XMO M;  1KFV A;  4B3T M;  5A2Q S;  4B3R M;  2UXB M;  4B3S M;  5ITR A;  1K3W A;  2HHH M;  4PD2 A;  3U6O A;  1PJJ A;  4X64 M;  1N36 M;  3A45 A;  4G4R A;  1NNJ A;  2ZM6 M;  1L2D A;  2F5O A;  1XNR M;  4JI0 M; 
#chains in the Genus database with same CATH topology
 4DV3 M;  1S3S A;  3ZC7 B;  2F5N A;  1N34 M;  2CV2 A;  1SG9 A;  4M0D A;  4F1I A;  4DUY M;  2DWZ B;  3L26 A;  3U6P A;  3TWK A;  3U6Q A;  3SBJ A;  1OFI A;  1D0L A;  2QBY B;  4LZJ A;  3PVS A;  4NC6 A;  3U6D A;  3L27 A;  2FH0 A;  4REZ A;  5EXX A;  2HAK A;  3GP1 A;  3U6S A;  4LFA M;  3SFZ A;  2C9O A;  3UZU A;  2XEP A;  5KQ8 A;  1XNQ M;  1XB2 B;  3ZH9 B;  4XBO A;  2MJ5 B;  2CHV A;  4RNA A;  3L25 A;  3PNV A;  4A3V B;  1KSF X;  1HQC A;  3GLH E;  3LCV B;  3HHW A;  5EJC A;  1GKI A;  3RE8 A;  1CUK A;  3D8B A;  2FNA A;  3FRH A;  5DYI A;  4M0W A;  4PT5 A;  2GQF A;  2UXD M;  2W82 A;  2V1U A;  3K92 A;  2D7G A;  1ZMU A;  2BJV A;  4FVM A;  5FTM A;  3HWS A;  4L15 A;  5IT9 S;  1XXH E;  2KNV A;  3PFI A;  1ZMW A;  2FFJ A;  2LVO C;  3QYB A;  1NY6 A;  2APL A;  1VEK A;  5GKN A;  4L6V 6;  4GRI A;  3FE3 A;  3KS4 A;  5JI3 E;  4G4N A;  3AOE A;  3FYC A;  4X65 M;  1OQY A;  4BBA A;  4JYA M;  3GLF A;  3GQ3 A;  2V6Z M;  3GLI B;  4B7H A;  4LG2 A;  1T43 A;  2E5L M;  4QHT A;  1PJS A;  3BOS A;  3KOX E;  1Z59 A;  2I7P A;  3J27 B;  3K2L A;  1N77 A;  3E4R A;  5LMN M;  1I4W A;  3TL4 X;  3FUX A;  4GMQ A;  2Q2E B;  5FLX S;  3SAU A;  3B7N A;  3K9O A;  2N35 A;  1TDH A;  5ITQ A;  2O5R A;  3EIE A;  2UUC M;  1HQY E;  3I04 M;  2R0I A;  4DR5 M;  4LGM A;  2JZ0 A;  3DFZ A;  3I4V A;  4I8O A;  1PJI A;  2HWJ A;  2FE8 A;  2R65 A;  2DZN B;  3AV0 A;  4KHP M;  4GIT A;  1N78 A;  2OO9 A;  2Z3X A;  1VG5 A;  3KS8 A;  3U5Z A;  3WHK A;  1OAI A;  5E26 A;  4NXN M;  4IIW A;  3UK6 A;  4DR2 M;  3U60 A;  3HY5 A;  4AG6 A;  4B7G A;  2KHH A;  4LFB M;  4OU7 A;  4ZPX A;  5EP1 A;  1QAQ A;  3QYE A;  4WW0 A;  5EXS A;  3TQS A;  2QHO B;  3SYL A;  4HL4 A;  4R7G A;  4LRS A;  4LGY A;  3RGP A;  2CFO A;  2DHR A;  3U61 B;  2EKF A;  2RGH A;  1TF0 B;  3FRI A;  3T1H M;  5F3W A;  4LJ5 A;  3SC3 A;  4PCZ A;  4R3D A;  4JI3 M;  1JR3 D;  4X62 M;  4LF8 M;  1K82 A;  1NV8 A;  2KZS A;  2YNM D;  2OOB A;  4CGY B;  1J7K A;  2C99 A;  2QSF X;  1L1T A;  4JI4 M;  1JQJ C;  1P3Q Q;  2X4A A;  4LJ9 A;  1XMO M;  2EO2 A;  1NNU C;  4B3R M;  4AKH A;  2K0B X;  1G4A E;  3GRU A;  3MJ5 A;  4D82 A;  4QHS A;  2QNJ A;  3W68 A;  2JY8 A;  3DZD A;  1DGH B;  2ZTD A;  1KYI A;  3SHF A;  4S12 A;  3AOE C;  1R5L A;  2C98 A;  5L8R F;  2CHG A;  2DZO B;  2F5O A;  1IN4 A;  1T3T A;  1E9S A;  2L2D A;  4PDG A;  4Z8X A;  1V33 A;  2CWB A;  2EKK A;  1VDL A;  1QVR A;  2FOI C;  1IN8 A;  1W5T A;  1XXH A;  5C1B A;  2ZBK B;  3J80 S;  1IN6 A;  4L8R C;  3SAS A;  1IXS A;  1VEJ A;  3LMM A;  2GNO A;  2ZAN A;  3GQ5 A;  3KP0 E;  4GIP A;  3E46 A;  2DVW B;  1QUS A;  4AZF A;  7CAT A;  1PJQ A;  4G4O A;  4KOD A;  2WZJ A;  3FD9 A;  2RKO A;  4JXJ A;  4Y28 F;  3WHL A;  2XZF A;  1HNZ M;  3RFW A;  1XC8 A;  4JI8 M;  1Y8G A;  2MGW A;  2XLJ A;  4K0K M;  3GLI E;  1HT1 E;  1J5E M;  3UGJ A;  1Z5A A;  2KXE A;  2Y21 A;  1IFY A;  5C18 A;  3VK7 A;  1WGN A;  3IEC A;  3FUW A;  1HNX M;  2MR9 A;  1SXJ E;  4DV6 M;  3L2A A;  3NBI A;  1GLN A;  4YY3 M;  2M60 A;  4FD2 A;  1FNN A;  1G8P A;  2DAG A;  1Q3B A;  4QNR A;  4LY6 A;  4RF0 A;  4OW0 A;  1IN5 A;  2LTU A;  4L4U A;  3B9P A;  3UMM A;  1ZMV A;  1XHB A;  3KOZ E;  3T1Y M;  4GKJ M;  4W5W A;  2DHY A;  3IHP A;  5EP2 A;  3I01 M;  4CIS A;  1NY5 A;  5IRE B;  2Z4R A;  1LTM A;  3LCU A;  3GLF B;  5LMU M;  1V92 A;  3HZJ A;  3LQQ A;  2HCB A;  3CTW B;  3HU3 A;  2LNH C;  4IBF A;  3J7B A;  2QQ8 A;  4AQY M;  3HHZ A;  2DWN A;  5EP4 A;  2DNA A;  3HU2 A;  3IG5 A;  4DV2 M;  2R44 A;  3VKH A;  1BVS A;  4CJ6 A;  2DAM A;  1XMQ M;  2KDL A;  2X8A A;  4FWG A;  1IQP A;  3HHY A;  1G3I A;  1N75 A;  2Z4S A;  3EIH A;  5ITX E;  4LF4 M;  3M7G A;  3C58 A;  2F5S A;  1DV0 A;  2KNA A;  2HKJ A;  3CGW A;  3GRY A;  3V76 A;  2D7H A;  3CF6 E;  3JR5 A;  3U6L A;  1GO5 A;  1IY0 A;  3CF2 A;  2I7N A;  4D80 A;  2JY7 A;  2QCU A;  3U5Z B;  1GJT A;  4DV5 M;  2ZAO A;  1L2C A;  4AKG A;  4NSO B;  5KPZ A;  3UJN A;  3GO8 A;  4II7 A;  1L1Z A;  2BWB A;  1MN3 A;  3U60 B;  2L09 A;  3SAR A;  3JR4 A;  1QZE A;  3GLG E;  1G71 A;  1HJP A;  5KQD A;  4DV0 M;  2G3Q A;  1EFU B;  2KRK A;  4IBI A;  4B3M M;  1E94 E;  3BBZ A;  1NV9 A;  3CF0 A;  2DWM A;  3LW5 F;  4IBC A;  3FTF A;  5H37 D;  1AUA A;  2EUC A;  4NRW A;  1GL6 A;  1LV7 A;  4LJA A;  1VEG A;  4L16 A;  2XF3 A;  3R8F A;  4QOS A;  1C7Y A;  3AL0 C;  3ZQJ A;  4IBE A;  3SAW A;  3E9S A;  4LCB A;  4LF5 M;  2KRU A;  5DFL A;  3HKP A;  4KLN A;  4NRV A;  3U6E A;  1PJT A;  3T15 A;  4GHL A;  1NJG A;  1N33 M;  3H4M A;  2O01 F;  2XFS A;  3VFD A;  3VLF B;  1NO1 A;  5DYG A;  4DR4 M;  2FS1 A;  2VII A;  4M9X A;  3DA1 A;  1QQW A;  2KNZ A;  2JUJ A;  3C9P A;  2UXB M;  3F92 A;  2BNK A;  4I5S A;  4B3S M;  2K47 A;  4LZZ A;  3AFH A;  1K3W A;  2XSZ A;  4NL4 H;  1ORY B;  1PJJ A;  4M9Z A;  3A45 A;  3LVW A;  3RGS A;  1NNJ A;  4LRT A;  3MK6 A;  3GQ4 A;  2JA2 A;  3J81 S;  1HT2 E;  2L6O A;  1GJS A;  3B74 A;  3SAT A;  3THG A;  1QDT A;  3VDP A;  3FUV A;  2LHG A;  4MGZ E;  1T6O A;  3B89 A;  1QZM A;  1IXR C;  1SXJ A;  5BPV A;  5KPT A;  2K9D A;  1D0K A;  3U6M A;  1XXH B;  4GKK M;  2CE7 A;  4NSR A;  8CAT A;  4DV7 M;  4AKI A;  2LHC A;  3H4J A;  1FJG M;  3AJI B;  2L4F A;  1IXS B;  2KZU A;  5EQT A;  4GHA A;  4JI5 M;  4IBJ A;  2J7O A;  1J09 A;  4HLQ A;  1Z5B A;  2JXN A;  3B7Z A;  3FTC A;  2DAI A;  4DUZ M;  1WJ7 A;  5BR8 M;  3GLH A;  1TH2 A;  5FSW A;  5ITT A;  5DNY A;  2WSF F;  1TTE A;  3M0E A;  2UXC M;  1OJL A;  4P16 A;  1JB0 F;  3JAM S;  4I81 A;  5ITU A;  2CV0 A;  4DR3 M;  4Q7J A;  1YLA A;  4MH0 E;  2R62 A;  2YFQ A;  1TR8 A;  1IBK M;  4NXM M;  3FKE A;  4JI6 M;  4GC9 A;  1NHG C;  3FUU A;  4OVZ A;  2CV1 A;  2LXE A;  1QAO A;  4Z6Y A;  1JR3 E;  1WGL A;  2VF7 A;  4R71 A;  4B7F A;  4LFC M;  3KXE C;  3TWL A;  2OOA A;  2EJS A;  1VQ1 A;  2KW0 A;  4NOO B;  1YUB A;  2UUA M;  3B7Q A;  4L78 A;  3GPX A;  4KO8 A;  1Q02 A;  2QEN A;  1K3X A;  1TH3 A;  3U6C A;  1DGB A;  2KEB A;  5EXT A;  2R6F A;  2EA0 A;  1MU5 A;  4D81 A;  2WSC F;  5JI2 E;  3GLG A;  3D8L A;  4AG5 A;  2RGO A;  1QAN A;  4IBB A;  1Z5C A;  2CP8 A;  3PXG A;  3J7A S;  1EIJ A;  4FWH A;  1UFZ A;  1UM8 A;  3TPZ A;  3SMP A;  2ZTC A;  1ZV1 A;  4DR1 M;  1NHW C;  4WUR A;  1NVM A;  4XGI A;  4AW4 A;  1R4G A;  2V1C A;  1WXQ A;  4DBG B;  2ERC A;  1XWI A;  2DI0 A;  2X49 A;  5ITY A;  2H5X A;  4QNM A;  4CIZ A;  4YHH M;  1TH4 A;  3NWL A;  1OTR A;  4IBD A;  3HJ8 A;  4AI6 A;  1ZQ9 A;  1MX0 A;  5IZ7 D;  4EIW A;  4G3O A;  4BB9 A;  4LJ6 A;  2DAK A;  2JNH A;  2WSE F;  2J7N A;  2R4J A;  4GEW A;  3W0F A;  2LVA A;  4DV1 M;  3TWM A;  2UU9 M;  5IWA M;  4PDI A;  1C1K A;  1H6U A;  4JI0 M;  1SXJ C;  4FCT A;  2LH0 A;  3GPY A;  2DXI A;  4JI7 M;  4LF9 M;  2Y0Q A;  3SHG B;  3HHX A;  2CHQ A;  4MGI E;  2F5Q A;  1L8Q A;  3TE6 A;  3OTO M;  2R4E A;  1PM5 A;  3M6A A;  5FTN A;  3QAU A;  4BLC A;  1DO2 A;  1QUT A;  4X66 M;  1EE8 A;  2CRU A;  3SAV A;  3J2P B;  4G6Z A;  4IBK A;  4P17 A;  2JP7 A;  2XZU A;  2F5P A;  2F4V M;  2VDB B;  3AOG A;  3DOA A;  3KOW E;  3FUT A;  2P5T A;  5FTL A;  1YE9 A;  1KFV A;  5A2Q S;  1F4I A;  2BJW A;  2QZ4 A;  4MGK E;  1NSF A;  1OKS A;  1IY1 A;  3ZCB B;  4HEO A;  3LVV A;  3KVW A;  5ITR A;  4PD2 A;  2LVN C;  3U6O A;  3K1J A;  4X64 M;  3SYK A;  4G4R A;  2ZM6 M;  1L2D A;  1XNR M;  2QBY A;  3KOY E;  1WIV A;  2C96 A;  3I51 A;  3ILK A;  3KW6 A;  3GPU A;  2JWS A;  1IN7 A;  2AHM A;  4M9S A;  1Q39 A;  1W5S A;  3K9P A;  1R7R A;  3A98 B;  2C9C A;  2VQF M;  2K6B A;  3FTE A;  1QYR A;  3E21 A;  4DV4 M;  5E6J A;  4JI2 M;  3GRV A;  1E32 A;  4IBG A;  1OIZ A;  1SXJ B;  1NJF A;  4JV5 M;  2LWX A;  2Z8Y M;  3Q8X A;  3GRR A;  2L7I A;  3I4Y A;  1DO0 A;  1JR3 A;  1QDR A;  2H1R A;  4LF6 M;  4WP2 A;  2Y20 A;  2JY5 A;  3A42 A;  4DR6 M;  3C3D A;  3L28 A;  1OIP A;  2G8L A;  3MHV C;  3T6P A;  4CHT B;  1Q3C A;  2CUZ A;  4IJF A;  1D0M A;  1X37 A;  1AIP C;  2KA6 B;  2J5Y A;  3GLH B;  3VK8 A;  3GLI A;  2JY6 B;  1DGF A;  1HNW M;  3KSJ A;  3SMS A;  3C3E A;  1IXZ A;  2R18 A;  2RRU A;  1IBM M;  4LJ4 A;  1R2Z A;  2VF8 A;  4MM3 B;  4OX9 M;  4ANR A;  1IY2 A;  2C5R A;  2A5Y B;  3Q8G A;  3VKG A;  4OVZ B;  4G4Q A;  2R45 A;  2L7H A;  4FWD A;  3FYD A;  3KP1 E;  2LVQ D;  1I94 M;  1HR0 M;  1PGY A;  2QPA A;  2OPF A;  3HJQ A;  4I4L A;  1R6B X;  3W0L B;  3T38 A;  1OAO C;  2R46 A;  1R2Y A;  2YQZ A;  5KO3 A;  4DR7 M;  4MGH A;  5FTK A;  1DGG A;  3GPP A;  3QWL A;  4XK8 F;  1Z6T A;  2DEN A;  1D2N A;  3GLF E;  4JI1 M;  1IM2 A;  2OQ4 A;  4RF1 A;  4UN2 B;  1IBL M;  3HU1 A;  3KDS E;  1L2B A;  3GLG B;  3VDU A;  4FCV A;  4MB7 A;  2XSZ D;  3HJS A;  4RKU F;  2O25 A;  4LJ7 A;  5KPR A;  4FCW A;  4LF7 M;  2DZL A;  2DAE A;  1PRB A;  2D7E A;  2L4E A;  4IJE A;  5ITX A;  1ZAE A;  5EP3 A;  2UUB M;  4JN6 A;  1GAB A;  4B08 A;  2G5G X;  3KSX A;  5EXP A;  3U61 A;  2Z7J A;  1GL7 A;  1SXJ D;  1TDZ A;  1OFH A;  1QAM A;  2NQ8 C;  1N32 M;  3FTD A;  1WHC A;  1MJG M;  3BXW A;  2LBC A;  2MRO B;  3A46 A;  4QOZ C;  5FTJ A;  1TGU A;  2Y0T A;  3HX3 A;  2CEA A;  2DKL A;  2QP9 X;  4GC5 A;  4KT0 F;  1RU3 A;  4TUW A;  3K8Z A;  2DWL A;  2XGN A;  4FW9 A;  3L29 A;  1YSY A;  3IG8 A;  3W67 A;  3NBX X;  2XH9 A;  1GVN A;  1G41 A;  4ITQ A;  2VQE M;  2ZAM A;  4LJ8 A;  2M5Z A;  1DGH A;  4MGY E;  3R9X B;  2JZ1 A;  4B3T M;  2YR0 A;  2XFT A;  3MMP A;  1V34 A;  3LQR A;  3PNY A;  2HL7 A;  1G59 A;  4F2L A;  2MH8 A;  3KFU G;  2B3T A;  2BWE A;  4GH9 A;  2HHH M;  3HGI A;  1WR1 B;  1E9R A;  1N36 M;  1A5T A;  1VDD A;  2LVP C;  3AKZ A; 
#chains in the Genus database with same CATH homology
 4DV3 M;  1S3S A;  3ZC7 B;  2F5N A;  1N34 M;  2CV2 A;  4M0D A;  4DUY M;  2DWZ B;  3L26 A;  3U6P A;  3TWK A;  3U6Q A;  3SBJ A;  1OFI A;  2QBY B;  4LZJ A;  3PVS A;  3U6D A;  3L27 A;  4REZ A;  5EXX A;  3GP1 A;  3U6S A;  4LFA M;  3SFZ A;  2C9O A;  3UZU A;  2XEP A;  5KQ8 A;  1XNQ M;  3ZH9 B;  4XBO A;  2CHV A;  4RNA A;  3L25 A;  3PNV A;  4A3V B;  1KSF X;  1HQC A;  3HHW A;  5EJC A;  1GKI A;  3RE8 A;  3D8B A;  5DYI A;  2FNA A;  4M0W A;  4PT5 A;  2UXD M;  2W82 A;  2V1U A;  3K92 A;  2D7G A;  4FVM A;  2BJV A;  5FTM A;  3HWS A;  4L15 A;  5IT9 S;  3PFI A;  2FFJ A;  1NY6 A;  5GKN A;  4GRI A;  3KS4 A;  5JI3 E;  4G4N A;  3AOE A;  3FYC A;  4X65 M;  4BBA A;  4JYA M;  3GLF A;  3GQ3 A;  2V6Z M;  3GLI B;  4B7H A;  4LG2 A;  2E5L M;  4QHT A;  3BOS A;  3KOX E;  1Z59 A;  2I7P A;  3J27 B;  3K2L A;  1N77 A;  3E4R A;  5LMN M;  1I4W A;  3TL4 X;  3FUX A;  4GMQ A;  2Q2E B;  5FLX S;  3SAU A;  5ITQ A;  1TDH A;  2O5R A;  3EIE A;  2UUC M;  1HQY E;  4DR5 M;  4LGM A;  3DFZ A;  3I4V A;  4I8O A;  1PJI A;  2FE8 A;  2R65 A;  2DZN B;  3AV0 A;  4KHP M;  4GIT A;  1N78 A;  2Z3X A;  3KS8 A;  3U5Z A;  3WHK A;  5E26 A;  4NXN M;  4IIW A;  3UK6 A;  4DR2 M;  3U60 A;  4AG6 A;  4B7G A;  4LFB M;  4OU7 A;  4ZPX A;  5EP1 A;  1QAQ A;  4WW0 A;  5EXS A;  3TQS A;  3SYL A;  4HL4 A;  4R7G A;  4LRS A;  4LGY A;  3RGP A;  2CFO A;  2DHR A;  3U61 B;  2RGH A;  3T1H M;  5F3W A;  4LJ5 A;  3SC3 A;  4PCZ A;  4R3D A;  4JI3 M;  1JR3 D;  4X62 M;  4LF8 M;  1K82 A;  2KZS A;  2YNM D;  4CGY B;  1J7K A;  2C99 A;  1L1T A;  4JI4 M;  1JQJ C;  2X4A A;  4LJ9 A;  1XMO M;  2EO2 A;  1NNU C;  4B3R M;  4AKH A;  1G4A E;  3GRU A;  3MJ5 A;  4D82 A;  4QHS A;  3DZD A;  1DGH B;  1KYI A;  3SHF A;  4S12 A;  3AOE C;  2C98 A;  2CHG A;  2DZO B;  2F5O A;  1IN4 A;  1T3T A;  1E9S A;  4PDG A;  4Z8X A;  1QVR A;  2FOI C;  1IN8 A;  1W5T A;  1XXH A;  5C1B A;  2ZBK B;  3J80 S;  1IN6 A;  4L8R C;  3SAS A;  3LMM A;  2ZAN A;  3GQ5 A;  3KP0 E;  4GIP A;  2DVW B;  4AZF A;  4G4O A;  7CAT A;  4KOD A;  3FD9 A;  2RKO A;  4JXJ A;  3WHL A;  2XZF A;  1HNZ M;  3RFW A;  1XC8 A;  4JI8 M;  2XLJ A;  4K0K M;  1HT1 E;  1J5E M;  3UGJ A;  1Z5A A;  2KXE A;  2Y21 A;  5C18 A;  3VK7 A;  3FUW A;  1HNX M;  1SXJ E;  4DV6 M;  3L2A A;  3NBI A;  1GLN A;  4YY3 M;  2M60 A;  4FD2 A;  1FNN A;  1G8P A;  4RF0 A;  1Q3B A;  4QNR A;  4LY6 A;  4OW0 A;  1IN5 A;  4L4U A;  3B9P A;  3UMM A;  1XHB A;  3KOZ E;  3T1Y M;  4GKJ M;  4W5W A;  5EP2 A;  4CIS A;  1NY5 A;  5IRE B;  2Z4R A;  3GLF B;  5LMU M;  3LQQ A;  2HCB A;  3CTW B;  3HU3 A;  2LNH C;  4IBF A;  3J7B A;  4AQY M;  3HHZ A;  2DWN A;  5EP4 A;  3HU2 A;  3IG5 A;  4DV2 M;  3VKH A;  1XMQ M;  2X8A A;  4FWG A;  1IQP A;  3HHY A;  1G3I A;  1N75 A;  2Z4S A;  3EIH A;  5ITX E;  4LF4 M;  3M7G A;  3C58 A;  2F5S A;  2HKJ A;  3GRY A;  3JR5 A;  2D7H A;  3CF6 E;  3U6L A;  1IY0 A;  3CF2 A;  2I7N A;  4D80 A;  2QCU A;  3U5Z B;  1L2C A;  4DV5 M;  2ZAO A;  4AKG A;  4NSO B;  5KPZ A;  3UJN A;  3GO8 A;  4II7 A;  1L1Z A;  3U60 B;  2L09 A;  3SAR A;  3JR4 A;  5KQD A;  4DV0 M;  4B3M M;  2KRK A;  4IBI A;  1E94 E;  3CF0 A;  2DWM A;  4IBC A;  3FTF A;  5H37 D;  2EUC A;  4NRW A;  1LV7 A;  1GL6 A;  4LJA A;  4L16 A;  2XF3 A;  3R8F A;  4QOS A;  3AL0 C;  4IBE A;  3SAW A;  3E9S A;  4LCB A;  4LF5 M;  2KRU A;  3HKP A;  4KLN A;  4NRV A;  3U6E A;  3T15 A;  4GHL A;  1NJG A;  1N33 M;  3H4M A;  2XFS A;  3VFD A;  3VLF B;  5DYG A;  4DR4 M;  2VII A;  4M9X A;  3DA1 A;  1QQW A;  2UXB M;  2BNK A;  4I5S A;  4B3S M;  2K47 A;  4LZZ A;  3AFH A;  1K3W A;  2XSZ A;  4NL4 H;  1ORY B;  1PJJ A;  4M9Z A;  3A45 A;  3LVW A;  3RGS A;  1NNJ A;  4LRT A;  3MK6 A;  3GQ4 A;  2JA2 A;  3J81 S;  1HT2 E;  2L6O A;  3SAT A;  3THG A;  3VDP A;  3FUV A;  4MGZ E;  1QZM A;  1IXR C;  1SXJ A;  5BPV A;  5KPT A;  3U6M A;  1XXH B;  4GKK M;  2CE7 A;  4NSR A;  8CAT A;  4DV7 M;  4AKI A;  1FJG M;  3AJI B;  1IXS B;  2KZU A;  5EQT A;  4GHA A;  4JI5 M;  4IBJ A;  2J7O A;  1J09 A;  4HLQ A;  1Z5B A;  3FTC A;  4DUZ M;  5BR8 M;  3GLH A;  1TH2 A;  5FSW A;  5ITT A;  5DNY A;  3M0E A;  2UXC M;  1OJL A;  4P16 A;  2CV0 A;  3JAM S;  4I81 A;  5ITU A;  4DR3 M;  4MH0 E;  2R62 A;  2YFQ A;  1IBK M;  4NXM M;  3FKE A;  4JI6 M;  4GC9 A;  1NHG C;  3FUU A;  4OVZ A;  2CV1 A;  2LXE A;  1QAO A;  4Z6Y A;  4B7F A;  4LFC M;  3KXE C;  3TWL A;  2KW0 A;  4NOO B;  1YUB A;  2UUA M;  4L78 A;  3GPX A;  4KO8 A;  2QEN A;  1K3X A;  1TH3 A;  3U6C A;  1DGB A;  2KEB A;  5EXT A;  2EA0 A;  1MU5 A;  4D81 A;  3GLG A;  5JI2 E;  3D8L A;  4AG5 A;  2RGO A;  1QAN A;  4IBB A;  1Z5C A;  3PXG A;  3J7A S;  4FWH A;  1UM8 A;  3TPZ A;  3SMP A;  4DR1 M;  1NHW C;  4WUR A;  1NVM A;  4XGI A;  4AW4 A;  2V1C A;  1WXQ A;  2ERC A;  1XWI A;  5ITY A;  2X49 A;  4QNM A;  4YHH M;  1TH4 A;  3NWL A;  4IBD A;  3HJ8 A;  4AI6 A;  1ZQ9 A;  1MX0 A;  5IZ7 D;  4EIW A;  4BB9 A;  4LJ6 A;  4DV1 M;  2J7N A;  2R4J A;  3W0F A;  3TWM A;  2UU9 M;  5IWA M;  4PDI A;  1C1K A;  1H6U A;  2DXI A;  1SXJ C;  4FCT A;  2LH0 A;  3GPY A;  4JI7 M;  4LF9 M;  2Y0Q A;  3SHG B;  3HHX A;  2CHQ A;  4MGI E;  2F5Q A;  1L8Q A;  3TE6 A;  3OTO M;  2R4E A;  1PM5 A;  3M6A A;  5FTN A;  3QAU A;  4BLC A;  1DO2 A;  3SAV A;  4X66 M;  1EE8 A;  3J2P B;  4G6Z A;  4IBK A;  2F4V M;  2XZU A;  2F5P A;  3AOG A;  3KOW E;  3DOA A;  3FUT A;  2P5T A;  5FTL A;  1YE9 A;  1KFV A;  5A2Q S;  2BJW A;  2QZ4 A;  4MGK E;  1NSF A;  3ZCB B;  1IY1 A;  3LVV A;  3KVW A;  5ITR A;  4PD2 A;  3U6O A;  3K1J A;  4X64 M;  3SYK A;  4G4R A;  2ZM6 M;  1L2D A;  1XNR M;  2QBY A;  3KOY E;  2C96 A;  3KW6 A;  3I51 A;  3ILK A;  3GPU A;  1IN7 A;  2AHM A;  4M9S A;  1Q39 A;  1W5S A;  1R7R A;  3A98 B;  2C9C A;  2VQF M;  3FTE A;  1QYR A;  4DV4 M;  5E6J A;  4JI2 M;  3GRV A;  1E32 A;  4IBG A;  1SXJ B;  1NJF A;  4JV5 M;  2LWX A;  3Q8X A;  3GRR A;  2L7I A;  3I4Y A;  1DO0 A;  1JR3 A;  2H1R A;  4LF6 M;  2Y20 A;  3A42 A;  4DR6 M;  3L28 A;  2G8L A;  3MHV C;  4CHT B;  1Q3C A;  2CUZ A;  4IJF A;  3VK8 A;  1X37 A;  2KA6 B;  3GLH B;  3GLI A;  1DGF A;  1HNW M;  3KSJ A;  3SMS A;  1IXZ A;  2R18 A;  1IBM M;  4LJ4 A;  1R2Z A;  4MM3 B;  4OX9 M;  1IY2 A;  2C5R A;  2A5Y B;  3VKG A;  4OVZ B;  4G4Q A;  2R45 A;  2L7H A;  4FWD A;  3FYD A;  3KP1 E;  1I94 M;  1HR0 M;  2OPF A;  2QPA A;  3HJQ A;  4I4L A;  1R6B X;  3W0L B;  3T38 A;  1R2Y A;  2R46 A;  2YQZ A;  5KO3 A;  4DR7 M;  4MGH A;  5FTK A;  1DGG A;  3GPP A;  3QWL A;  1Z6T A;  1D2N A;  4JI1 M;  1IM2 A;  2OQ4 A;  4RF1 A;  1IBL M;  3HU1 A;  3KDS E;  1L2B A;  3GLG B;  3VDU A;  4MB7 A;  2XSZ D;  3HJS A;  5KPR A;  4LJ7 A;  4FCW A;  4LF7 M;  2D7E A;  4IJE A;  5ITX A;  1ZAE A;  5EP3 A;  2UUB M;  4JN6 A;  4B08 A;  2G5G X;  3KSX A;  5EXP A;  3U61 A;  2Z7J A;  1GL7 A;  1SXJ D;  1TDZ A;  1OFH A;  1QAM A;  2NQ8 C;  1N32 M;  3FTD A;  4QOZ C;  3A46 A;  5FTJ A;  1TGU A;  2Y0T A;  2CEA A;  2QP9 X;  4GC5 A;  4TUW A;  3K8Z A;  2DWL A;  2XGN A;  4FW9 A;  3L29 A;  1YSY A;  3IG8 A;  2XH9 A;  1GVN A;  1G41 A;  4ITQ A;  2VQE M;  2ZAM A;  4LJ8 A;  2M5Z A;  1DGH A;  4MGY E;  3R9X B;  4B3T M;  2YR0 A;  2XFT A;  1G59 A;  3LQR A;  3PNY A;  2HL7 A;  3KFU G;  4GH9 A;  2HHH M;  3HGI A;  1E9R A;  1N36 M;  4FCV A;  1VDD A;  4JI0 M;  3AKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...