5LMNM

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5lmnM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5lmnM02
1Q3BA 4B3SM 4GKKM 3OTOM 4JI7M 4LF8M 4DR1M 3U6SA 3JR5A 3J80S 1N32M 3J7AS 2Q2EB 3U6EA 2F5SA 3GP1A 1L1ZA 4LF9M 4JYAM 4NXNM 1K3XA 4CISA 5ITQA 3TWMA 4LF6M 3SBJA 3U6PA 4JI6M 5ITYA 2XZUA 1KFVA 5ITRA 4DUYM 3T1YM 2F5OA 1Z5AA 4LFBM 3A45A 4YY3M 3GQ3A 2UUAM 4JI5M 4B3RM 3DOAA 2XZFA 2HKJA 3W0FA 1NNJA 2OQ4A 1FJGM 3GPYA 4DV3M 3U6QA 1L1TA 4B3MM 1MU5A 5ITUA 1XMQM 1K3WA 4X65M 1IBKM 3SAWA 5BR8M 3TWLA 1HNXM 4DV7M 5LMUM 4DR7M 3GO8A 2OPFA 4DR5M 3VK7A 1MX0A 1Q3CA 1N36M 1J5EM 4LFCM 3A46A 2E5LM 4DR4M 4JI0M 2VQFM 4DV6M 3SAUA 1HNWM 4KHPM 3SARA 4K0KM 4DR3M 3U6LA 5ITTA 3VK8A 1I94M 4PCZA 4DV1M 4DV2M 4LF4M 1Z59A 4PDGA 4OX9M 4JI3M 4YHHM 4X66M 1R2YA 1L2CA 2ZM6M 2EA0A 1Q39A 3GPUA 4NXMM 3GPXA 4G4OA 5LMNM 4DV4M 1EE8A 4LF7M 1HNZM 2UXDM 4DV5M 4LFAM 3T1HM 4DR6M 5FLXS 4ITQA 1K82A 3TWKA 1IBLM 4JI4M 3C58A 4B3TM 4G4NA 2VQEM 2UUCM 1TDZA 1XC8A 4X64M 5IT9S 1Z5BA 3JR4A 4G4QA 4NRVA 1XNQM 3GQ5A 2F4VM 4X62M 1XMOM 4JI1M 3U6OA 1PJIA 4MB7A 2F5NA 1Z5CA 4GKJM 2F5PA 1N33M 3GPPA 3U6CA 2ZBKB 3J81S 3SASA 3SAVA 1N34M 2UXBM 1XNRM 4G4RA 1R2ZA 1L2DA 3A42A 3JAMS 1IBMM 5ITXE 2HHHM 2UU9M 4JV5M 5A2QS 1L2BA 1TDHA 4AQYM 4DV0M 3SATA 4NRWA 2F5QA 4JI8M 4PDIA 4DUZM 2UUBM 2UXCM 3U6DA 1PJJA 4JI2M 5ITXA 4PD2A 3GQ4A 1HR0M 4DR2M 4LF5M 1PM5A 5IWAM 3U6MA
chains in the Genus database with same CATH superfamily
2DWMA 2JY5A 3FUWA 3KOWE 4NL4H 2DKLA 4UN2B 2VF7A 2QSFX 1SXJA 4GH9A 1OFHA 4DR1M 3AJIB 1OIZA 2Q2EB 1VEKA 3U6EA 3L26A 1L1ZA 1Y8GA 2KEBA 4W5WA 3MHVC 4Q7JA 3FKEA 1R7RA 1JB0F 1NNUC 1WGNA 3KP0E 3GRUA 3HKPA 4JI6M 4M9SA 2XZUA 2HL7A 4DUYM 3RGPA 2F5OA 1N75A 1Z5AA 1QQWA 2XSZD 3E46A 4FWHA 3V76A 5IZ7D 3B9PA 3FTFA 1IN8A 2XEPA 3BOSA 4JI5M 1V92A 3DOAA 1DV0A 1CUKA 2ZTDA 2HKJA 3AKZA 1NV9A 1WJ7A 2A5YB 1FJGM 3U61A 3UMMA 1XXHE 2LVNC 5EP3A 1L1TA 4IBIA 5ITUA 4MM3B 4L15A 5BR8M 4M0DA 2LVAA 4DV7M 2FH0A 3GO8A 2CFOA 2KNAA 2OPFA 1NVMA 1YSYA 1Q3CA 4LFCM 3A46A 2DENA 2E5LM 4DR4M 3AV0A 2X8AA 5EXTA 5FSWA 2FS1A 2OOAA 4A3VB 5ITTA 3U6LA 1IXSB 1AUAA 2LVQD 4DV1M 4DV2M 4LF4M 2DVWB 1E32A 3ZC7B 2LVPC 3TPZA 1TF0B 2FFJA 2LHGA 2K47A 4RF1A 4X66M 4LGMA 4NOOB 1QZEA 2QZ4A 1NJGA 1WGLA 1A5TA 2L7IA 4FCVA 4QNRA 5KO3A 4G4OA 4IIWA 1JR3D 4DV4M 1TH3A 1OJLA 4D82A 2CUZA 1XXHB 3B89A 3HU2A 1XHBA 1ZMWA 5KPRA 1I4WA 4PT5A 4REZA 3PFIA 3I4YA 1QDRA 1WHCA 3TWKA 4IJEA 3UGJA 1H6UA 2DAMA 2ZAOA 3DFZA 3KSXA 3PXGA 1GKIA 2ERCA 3T38A 3I4VA 4LGYA 4BBAA 5E26A 3KOYE 1QYRA 4IBJA 4WW0A 4DBGB 2KA6B 5FTKA 5EXPA 1XC8A 4TUWA 5IT9S 1Z5BA 3FE3A 2JNHA 1C7YA 1SG9A 3CF2A 2L09A 4KLNA 4QHTA 2I7NA 3BBZA 4LJ5A 3FRIA 3GQ5A 3E4RA 3W68A 3AOGA 1XMOM 2EUCA 3U6OA 4NSOB 2F5PA 1GLNA 1NJFA 3GLFB 3GPPA 3PNYA 3KXEC 4P16A 1GJTA 3FTDA 4MGZE 3RE8A 3D8BA 2M5ZA 5GKNA 1TGUA 3L27A 3L25A 2XH9A 3QYBA 2YNMD 5ITXE 4JV5M 4FCTA 1IN5A 4LJ6A 2X4AA 3GRRA 4LJ4A 5EJCA 3MJ5A 4AG5A 4GEWA 4I8OA 4LRTA 3C3EA 2CHVA 1PM5A 2UUBM 3H4JA 3LCVB 4M9ZA 3U6DA 1HQCA 2HAKA 4DR2M 2HHHM 1Q3BA 2V6ZM 4IBBA 3THGA 2FNAA 3HJQA 4B3SM 2G3QA 5FTMA 3OTOM 4LJ9A 4GKKM 1G4AE 3KS4A 4HL4A 1PJTA 3U61B 2C96A 1IM2A 2RRUA 2XFTA 3DA1A 3GRVA 4BLCA 3M7GA 3M6AA 3GLFE 2JY8A 3PVSA 2B3TA 2R4EA 2AHMA 5JI2E 2BNKA 2JXNA 2VIIA 4NXNM 2L4FA 4NSRA 2KRKA 4LF6M 1W5SA 1NHGC 5ITYA 1PGYA 2H1RA 3KW6A 1YE9A 1YUBA 2JY7A 5KQ8A 5H37D 1IY1A 1WXQA 1ZMUA 4YY3M 1T3TA 4LRSA 4MGHA 5F3WA 1VDDA 3E9SA 3GLHE 2D7GA 3K2LA 3QWLA 3GLGE 1ORYB 1NO1A 3BXWA 4DV3M 2W82A 1TR8A 1ZMVA 2Z8YM 4B3MM 1LTMA 2WSFF 1MU5A 1N77A 1XMQM 2M60A 2R18A 1IBKM 1GO5A 2R46A 3SAWA 1G3IA 1T43A 1S3SA 4DR7M 2CEAA 3FUTA 3VK7A 4DR5M 1PJQA 1MX0A 2OOBA 3B7QA 4P17A 3GLIB 4JI0M 3B7ZA 2VQFM 2Y20A 4DV6M 4KHPM 3J7BA 2LXEA 4GIPA 4D81A 3CGWA 2EKKA 1NY6A 2R62A 3VK8A 1I94M 3GLHA 2EKFA 1V34A 1XB2B 3CF6E 2N35A 2DWNA 2DXIA 3FTEA 3UJNA 2K0BX 4KO8A 1IXRC 1OKSA 4YHHM 3HU1A 4AKHA 2R0IA 2C5RA 2R44A 2OO9A 1F4IA 1Q39A 1NSFA 1VG5A 1GVNA 3VDPA 5LMNM 2QBYB 3VKHA 3TL4X 3R9XB 3SYLA 4B7FA 4LFAM 3T1HM 1VEGA 3A98B 5EP1A 1G59A 2DAKA 4MGIE 1K82A 3DZDA 4R71A 2R65A 3FUVA 1G71A 2CP8A 1D0LA 5DNYA 3C58A 2L6OA 2DZOB 5BPVA 2CV2A 3E21A 3ILKA 2KXEA 4B3TM 2VQEM 3D8LA 4G3OA 4GC9A 3TE6A 1IN7A 2J7OA 1DGBA 2EJSA 3C3DA 2C9OA 2DWZB 1QDTA 3W0LB 8CATA 2BWEA 4OVZB 1MN3A 3B7NA 2F4VM 1W5TA 4JI1M 1EFUB 1PJIA 2F5NA 1Z5CA 4GKJM 1SXJC 2QENA 4WP2A 5DYIA 1XXHA 2YQZA 3SMPA 1E94E 4QOSA 2CRUA 2LVOC 3K8ZA 3J81S 3SAVA 4I81A 1ZV1A 4AW4A 1QAQA 2C9CA 2L7HA 5DYGA 3EIHA 4OU7A 1DGFA 1R2ZA 1J09A 3A42A 1L2DA 2QBYA 4JXJA 2UU9M 3SHGB 4AKGA 1L2BA 3FUUA 4AQYM 4LCBA 1L8QA 2F5QA 3SFZA 2DI0A 3FUXA 3HHXA 4JI2M 2LH0A 4FW9A 1QAMA 4LZZA 3GQ4A 1HR0M 1EIJA 1GJSA 1R5LA 4I5SA 3SHFA 2DZLA 2QP9X 4II7A 3T15A 1N36M 4IBDA 4FVMA 3U6MA 1OAOC 2LBCA 5C1BA 3GRYA 2XLJA 1QANA 2BWBA 4AKIA 2R4JA 4MGKE 2JA2A 1DGGA 1DGHB 5EP2A 3VLFB 3HHYA 3GLGA 2DWLA 4LF8M 4GHAA 3HY5A 1Q02A 3J80S 5EQTA 3L2AA 1JR3A 2CHQA 1UM8A 1N32M 1SXJD 2RKOA 3LQQA 3LVWA 3GP1A 2F5SA 1QZMA 1N78A 4JYAM 3AOEC 2MH8A 1NHWC 4AZFA 1K3XA 3FTCA 5ITQA 3IG8A 3U6PA 2L4EA 1IN6A 5ITRA 4LFBM 4F1IA 3IECA 3KP1E 3NBXX 3GLHB 4RNAA 2MROB 1HT1E 2K9DA 4FD2A 3GQ3A 2UUAM 3LMMA 3NWLA 2XZFA 2Z7JA 4BB9A 2RGHA 1R4GA 2LTUA 4XGIA 4RF0A 3QYEA 2D7HA 4KODA 1C1KA 1FNNA 1GL7A 1K3WA 3IHPA 4GRIA 3SC3A 2VDBB 2WSEF 3TWLA 2R6FA 3HGIA 4OW0A 3KOXE 3R8FA 1D0KA 2QHOB 4LG2A 5JI3E 3SARA 1BVSA 1WIVA 2QQ8A 3J27B 5FTJA 5IREB 1HJPA 1Z59A 3PNVA 4AG6A 4JI3M 3FYDA 4GHLA 4LY6A 5DFLA 1TH4A 2DHRA 2MJ5B 1R2YA 2ZM6M 1L2CA 1DGHA 1TH2A 3GLGB 2EA0A 1Z6TA 3GPUA 4Z6YA 4NXMM 1OQYA 1G41A 3FYCA 3HU3A 3HZJA 1EE8A 3HWSA 4IJFA 3MMPA 3TQSA 4LF7M 7CATA 2UXDM 1OFIA 2V1CA 4LJAA 5FTLA 2LHCA 4DR6M 2C98A 3CF0A 2X49A 1OTRA 2WSCF 5FLXS 4L78A 4F2LA 4ITQA 4L6V6 4CGYB 1IBLM 4R7GA 4M9XA 5E6JA 2LWXA 2R45A 2V1UA 3VFDA 2G8LA 4GMQA 1QUSA 1IFYA 2DZNB 1E9RA 1OIPA 2DAIA 3JR4A 5KQDA 1XNQM 1QAOA 4QOZC 3RFWA 1T6OA 2MR9A 2O01F 4QNMA 4MB7A 2CHGA 2O5RA 2P5TA 5EP4A 3ZQJA 2Y0QA 3F92A 4EIWA 3GLFA 3U60A 3U60B 1N33M 3U6CA 3J2PB 2ZBKB 2GNOA 2XF3A 3LCUA 3B74A 4OVZA 2RGOA 3SASA 4LJ8A 2JWSA 4QHSA 3QAUA 1JR3E 1XNRM 3FRHA 3C9PA 2FOIC 3L29A 3JAMS 3HJ8A 4G6ZA 4I4LA 4RKUF 1YLAA 1VDLA 1IXSA 1TDHA 2C99A 3CTWB 3SATA 2BJVA 4NRWA 2D7EA 1ZQ9A 3I01M 4PDIA 4DUZM 2Z3XA 3U5ZB 4JN6A 2EO2A 1JQJC 2UXCM 1PJJA 5KPZA 2JZ1A 4IBEA 3NBIA 1D0MA 1P3QQ 1HQYE 4LF5M 5IWAM 3Q8GA 2Z4SA 4MH0E 2KNVA 1XWIA 2L2DA 4JI7M 2FE8A 3M0EA 2JZ0A 2XSZA 4L4UA 4XBOA 3U6SA 5EXXA 3VDUA 3JR5A 2O25A 4AI6A 4LJ7A 3J7AS 2DHYA 1DO0A 5C18A 4LF9M 3AL0C 1VQ1A 2BJWA 4L8RC 1RU3A 3IG5A 3RGSA 4CISA 1TTEA 5FTNA 3TWMA 3KS8A 1OAIA 3SBJA 2K6BA 3WHLA 1KFVA 1MJGM 3T1YM 2YR0A 3A45A 1IN4A 4M0WA 3LQRA 4S12A 2CE7A 2QCUA 2DAEA 1GABA 3HX3A 4XK8F 4B3RM 3W0FA 1NNJA 2OQ4A 3W67A 3GPYA 1DO2A 3AFHA 1ZAEA 1UFZA 3U6QA 3I04M 5KPTA 4B08A 4LZJA 3HHZA 2J7NA 3HJSA 4X65M 4FWDA 1HNXM 5LMUM 2JUJA 3ZH9B 2YFQA 3WHKA 3VKGA 1LV7A 1J5EM 2CWBA 2GQFA 3MK6A 4Y28F 3SAUA 3KFUG 1HNWM 2XGNA 1R6BX 2Y21A 3SMSA 2NQ8C 4DR3M 4K0KM 3L28A 2XFSA 4IBGA 4L16A 4D80A 2Z4RA 4PCZA 1IY2A 4PDGA 2HCBA 2KHHA 4OX9M 3ZCBB 2ZAMA 3KSJA 2KW0A 4IBCA 4NC6A 1VEJA 3T6PA 2CV0A 3GPXA 1IXZA 2APLA 4CJ6A 3K9OA 1HNZM 2QPAA 4GC5A 3SYKA 3UZUA 4ANRA 4MGYE 4WURA 4DV5M 2DAGA 2KDLA 5L8RF 4FWGA 1SXJB 2DNAA 2KRUA 1NY5A 1QVRA 3LW5F 2WZJA 3Q8XA 4B7HA 4JI4M 2JP7A 4ZPXA 3FD9A 1G8PA 4G4NA 2KZSA 4HLQA 4B7GA 2QNJA 2UUCM 1PJSA 1TDZA 2I7PA 4X64M 1V33A 4CHTB 1KYIA 1X37A 1J7KA 2VF8A 3I51A 1E9SA 2KZUA 4NRVA 4G4QA 3U5ZA 4IBFA 4X62M 3H4MA 1PRBA 4R3DA 3EIEA 2J5YA 3UK6A 1NV8A 2CV1A 1KSFX 2KNZA 3K9PA 2H5XA 1N34M 2UXBM 3KVWA 3K1JA 4FCWA 2JY6B 4CIZA 3GLIA 3AOEA 4KT0F 3K92A 3GLIE 4G4RA 2MGWA 3HHWA 1GL6A 4HEOA 2ZTCA 1HT2E 1SXJE 1IBMM 2G5GX 3KDSE 5A2QS 4Z8XA 3KOZE 1AIPC 2Y0TA 4DV0M 4GITA 2HWJA 4JI8M 1IQPA 1IY0A 2ZANA 5ITXA 4PD2A 2LNHC 3LVVA 1D2NA 1QUTA 4IBKA 5EXSA 1WR1B
chains in the Genus database with same CATH topology
2DWMA 3FUWA 3KOWE 4NL4H 1SXJA 4GH9A 1OFHA 4DR1M 3AJIB 2Q2EB 3U6EA 3L26A 1L1ZA 2KEBA 4W5WA 3MHVC 3FKEA 1R7RA 1NNUC 3KP0E 3GRUA 3HKPA 4JI6M 4M9SA 2XZUA 2HL7A 4DUYM 3RGPA 2F5OA 1N75A 1Z5AA 1QQWA 2XSZD 4FWHA 5IZ7D 3B9PA 3FTFA 1IN8A 2XEPA 3BOSA 4JI5M 3DOAA 3AKZA 2HKJA 2A5YB 1FJGM 3U61A 3UMMA 5EP3A 1L1TA 4IBIA 5ITUA 4MM3B 4L15A 5BR8M 4M0DA 4DV7M 3GO8A 2CFOA 2OPFA 1NVMA 1YSYA 1Q3CA 4LFCM 3A46A 2E5LM 4DR4M 3AV0A 2X8AA 5EXTA 5FSWA 4A3VB 5ITTA 3U6LA 1IXSB 4DV1M 4DV2M 4LF4M 2DVWB 1E32A 3ZC7B 3TPZA 4RF1A 2FFJA 4X66M 2K47A 4LGMA 4NOOB 2QZ4A 1NJGA 2L7IA 4FCVA 4QNRA 5KO3A 4G4OA 4IIWA 1JR3D 4DV4M 1TH3A 1OJLA 4D82A 2CUZA 1XXHB 3HU2A 1XHBA 5KPRA 1I4WA 4PT5A 4REZA 3PFIA 3I4YA 3TWKA 4IJEA 3UGJA 1H6UA 3KSXA 2ZAOA 3DFZA 3PXGA 1GKIA 2ERCA 3T38A 3I4VA 4LGYA 4BBAA 5E26A 3KOYE 1QYRA 4IBJA 4WW0A 2KA6B 5FTKA 5EXPA 1XC8A 4TUWA 5IT9S 1Z5BA 3CF2A 2L09A 4KLNA 4QHTA 2I7NA 4LJ5A 3GQ5A 3E4RA 3AOGA 1XMOM 2EUCA 3U6OA 4NSOB 2F5PA 1GLNA 1NJFA 3GLFB 3GPPA 3PNYA 3KXEC 4P16A 4MGZE 3FTDA 3RE8A 3D8BA 2M5ZA 5GKNA 1TGUA 3L27A 3L25A 2XH9A 2YNMD 5ITXE 4JV5M 4FCTA 1IN5A 4LJ6A 2X4AA 3GRRA 4LJ4A 5EJCA 3MJ5A 4AG5A 4I8OA 4LRTA 2CHVA 1PM5A 2UUBM 4M9ZA 3U6DA 1HQCA 4DR2M 2HHHM 1Q3BA 2V6ZM 4IBBA 3THGA 2FNAA 3HJQA 4B3SM 3OTOM 5FTMA 4GKKM 4LJ9A 1G4AE 3KS4A 4HL4A 3U61B 2C96A 1IM2A 2XFTA 3DA1A 3GRVA 4BLCA 3M7GA 3M6AA 3PVSA 2R4EA 2AHMA 5JI2E 2BNKA 2VIIA 4NXNM 4NSRA 2KRKA 4LF6M 1W5SA 1NHGC 5ITYA 2H1RA 3KW6A 1YE9A 1YUBA 5KQ8A 5H37D 1IY1A 1WXQA 4YY3M 1T3TA 4LRSA 4MGHA 5F3WA 1VDDA 3E9SA 2D7GA 3K2LA 3QWLA 1ORYB 4DV3M 2W82A 4B3MM 1MU5A 1N77A 1XMQM 2M60A 2R18A 1IBKM 2R46A 3SAWA 1G3IA 1S3SA 4DR7M 2CEAA 3FUTA 3VK7A 4DR5M 1MX0A 3GLIB 4JI0M 2VQFM 4DV6M 2Y20A 4KHPM 3J7BA 2LXEA 4GIPA 4D81A 1NY6A 2R62A 3VK8A 1I94M 3GLHA 3CF6E 2DXIA 3FTEA 2DWNA 3UJNA 4KO8A 1IXRC 4YHHM 3HU1A 4AKHA 2C5RA 1Q39A 1NSFA 1GVNA 3VDPA 5LMNM 2QBYB 3VKHA 3TL4X 3R9XB 3SYLA 4B7FA 4LFAM 3T1HM 3A98B 5EP1A 1G59A 4MGIE 1K82A 3DZDA 2R65A 3FUVA 5DNYA 3C58A 2L6OA 2DZOB 5BPVA 2CV2A 4B3TM 3ILKA 2KXEA 2VQEM 3D8LA 4GC9A 3TE6A 1IN7A 2J7OA 1DGBA 3W0LB 2C9OA 2DWZB 8CATA 4OVZB 2F4VM 1W5TA 4JI1M 2F5NA 1PJIA 1Z5CA 4GKJM 1SXJC 2QENA 5DYIA 3SMPA 1XXHA 2YQZA 1E94E 4QOSA 3K8ZA 3J81S 3SAVA 4I81A 4AW4A 1QAQA 2C9CA 2L7HA 5DYGA 3EIHA 4OU7A 1DGFA 1R2ZA 1J09A 3A42A 1L2DA 2QBYA 4JXJA 2UU9M 3SHGB 4AKGA 1L2BA 3FUUA 4AQYM 4LCBA 1L8QA 2F5QA 3SFZA 3FUXA 3HHXA 4JI2M 2LH0A 4FW9A 1QAMA 4LZZA 3GQ4A 1HR0M 3SHFA 4I5SA 2QP9X 4II7A 3T15A 1N36M 4IBDA 4FVMA 3U6MA 5C1BA 2XLJA 3GRYA 1QANA 4AKIA 2R4JA 4MGKE 2JA2A 1DGGA 1DGHB 5EP2A 3VLFB 3HHYA 3GLGA 2DWLA 4LF8M 4GHAA 3J80S 5EQTA 3L2AA 1JR3A 2CHQA 1UM8A 1N32M 1SXJD 2RKOA 3LQQA 3LVWA 3GP1A 2F5SA 1QZMA 1N78A 4JYAM 3AOEC 1K3XA 1NHWC 4AZFA 3FTCA 5ITQA 3IG8A 3U6PA 1IN6A 5ITRA 4LFBM 3KP1E 3GLHB 4RNAA 1HT1E 4FD2A 3GQ3A 2UUAM 3LMMA 3NWLA 2XZFA 2Z7JA 4BB9A 2RGHA 4XGIA 4RF0A 2D7HA 4KODA 1C1KA 1FNNA 1GL7A 1K3WA 4GRIA 3SC3A 3TWLA 3HGIA 4OW0A 3KOXE 3R8FA 4LG2A 5JI3E 3SARA 3J27B 5FTJA 5IREB 1Z59A 3PNVA 4AG6A 4JI3M 3FYDA 4GHLA 4LY6A 1TH4A 2DHRA 1R2YA 1L2CA 2ZM6M 1DGHA 1TH2A 3GLGB 2EA0A 1Z6TA 3GPUA 4Z6YA 4NXMM 1G41A 3FYCA 3HU3A 1EE8A 3HWSA 4IJFA 3TQSA 4LF7M 7CATA 2UXDM 1OFIA 2V1CA 4LJAA 5FTLA 4DR6M 2C98A 3CF0A 2X49A 5FLXS 4L78A 4ITQA 4CGYB 1IBLM 4R7GA 4M9XA 5E6JA 2LWXA 2R45A 2V1UA 3VFDA 2G8LA 4GMQA 2DZNB 1E9RA 3JR4A 5KQDA 1XNQM 1QAOA 4QOZC 3RFWA 4QNMA 4MB7A 2CHGA 2O5RA 2P5TA 5EP4A 3GLFA 2Y0QA 4EIWA 3U60A 3U60B 1N33M 3U6CA 3J2PB 2ZBKB 2XF3A 4OVZA 3SASA 2RGOA 4LJ8A 4QHSA 3QAUA 1XNRM 2FOIC 3L29A 3JAMS 3HJ8A 4G6ZA 4I4LA 2C99A 1TDHA 3CTWB 3SATA 2BJVA 4NRWA 2D7EA 1ZQ9A 4PDIA 4DUZM 2Z3XA 3U5ZB 4JN6A 2EO2A 1JQJC 2UXCM 1PJJA 5KPZA 4IBEA 3NBIA 1HQYE 4LF5M 5IWAM 2Z4SA 4MH0E 1XWIA 4JI7M 2FE8A 3M0EA 2XSZA 4L4UA 4XBOA 3U6SA 5EXXA 3VDUA 3JR5A 4AI6A 4LJ7A 3J7AS 1DO0A 5C18A 4LF9M 3AL0C 2BJWA 4L8RC 3IG5A 3RGSA 4CISA 5FTNA 3TWMA 3KS8A 3SBJA 3WHLA 1KFVA 3T1YM 2YR0A 3A45A 1IN4A 4M0WA 3LQRA 4S12A 2CE7A 2QCUA 4B3RM 3W0FA 1NNJA 2OQ4A 3GPYA 1DO2A 3AFHA 1ZAEA 3U6QA 5KPTA 3HHZA 4B08A 4LZJA 2J7NA 3HJSA 4X65M 4FWDA 1HNXM 5LMUM 3ZH9B 2YFQA 3WHKA 3VKGA 1LV7A 1J5EM 3MK6A 3SAUA 3KFUG 1HNWM 2XGNA 1R6BX 2Y21A 3SMSA 2NQ8C 4DR3M 4K0KM 3L28A 2XFSA 4IBGA 4L16A 4D80A 2Z4RA 4PCZA 1IY2A 4PDGA 2HCBA 4OX9M 3ZCBB 2ZAMA 3KSJA 2KW0A 4IBCA 2CV0A 3GPXA 1IXZA 1HNZM 2QPAA 4GC5A 3SYKA 3UZUA 4DV5M 4MGYE 4WURA 4FWGA 1SXJB 2KRUA 1NY5A 1QVRA 4B7HA 3Q8XA 4JI4M 4ZPXA 3FD9A 1G8PA 4G4NA 2KZSA 4HLQA 4B7GA 2UUCM 1TDZA 2I7PA 4X64M 4CHTB 1KYIA 1X37A 1J7KA 3I51A 4G4QA 1E9SA 2KZUA 4NRVA 3U5ZA 4IBFA 4X62M 3H4MA 4R3DA 3EIEA 3UK6A 2CV1A 1KSFX 1N34M 2UXBM 3KVWA 3K1JA 4FCWA 3GLIA 3AOEA 3K92A 4G4RA 3HHWA 1GL6A 1HT2E 1SXJE 1IBMM 2G5GX 3KDSE 5A2QS 4Z8XA 3KOZE 2Y0TA 4DV0M 4GITA 4JI8M 1IQPA 1IY0A 2ZANA 5ITXA 4PD2A 2LNHC 3LVVA 1D2NA 4IBKA 5EXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3B A;  4B3S M;  4GKK M;  3OTO M;  4JI7 M;  4LF8 M;  4DR1 M;  3U6S A;  3JR5 A;  3J80 S;  1N32 M;  3J7A S;  2Q2E B;  3U6E A;  2F5S A;  3GP1 A;  1L1Z A;  4LF9 M;  4JYA M;  4NXN M;  1K3X A;  4CIS A;  5ITQ A;  3TWM A;  4LF6 M;  3SBJ A;  3U6P A;  4JI6 M;  5ITY A;  2XZU A;  1KFV A;  5ITR A;  4DUY M;  3T1Y M;  2F5O A;  1Z5A A;  4LFB M;  3A45 A;  4YY3 M;  3GQ3 A;  2UUA M;  4JI5 M;  4B3R M;  3DOA A;  2XZF A;  2HKJ A;  3W0F A;  1NNJ A;  2OQ4 A;  1FJG M;  3GPY A;  4DV3 M;  3U6Q A;  1L1T A;  4B3M M;  1MU5 A;  5ITU A;  1XMQ M;  1K3W A;  4X65 M;  1IBK M;  3SAW A;  5BR8 M;  3TWL A;  1HNX M;  4DV7 M;  5LMU M;  4DR7 M;  3GO8 A;  2OPF A;  4DR5 M;  3VK7 A;  1MX0 A;  1Q3C A;  1N36 M;  1J5E M;  4LFC M;  3A46 A;  2E5L M;  4DR4 M;  4JI0 M;  2VQF M;  4DV6 M;  3SAU A;  1HNW M;  4KHP M;  3SAR A;  4K0K M;  4DR3 M;  3U6L A;  5ITT A;  3VK8 A;  1I94 M;  4PCZ A;  4DV1 M;  4DV2 M;  4LF4 M;  1Z59 A;  4PDG A;  4OX9 M;  4JI3 M;  4YHH M;  4X66 M;  1R2Y A;  1L2C A;  2ZM6 M;  2EA0 A;  1Q39 A;  3GPU A;  4NXM M;  3GPX A;  4G4O A;  5LMN M;  4DV4 M;  1EE8 A;  4LF7 M;  1HNZ M;  2UXD M;  4DV5 M;  4LFA M;  3T1H M;  4DR6 M;  5FLX S;  4ITQ A;  1K82 A;  3TWK A;  1IBL M;  4JI4 M;  3C58 A;  4B3T M;  4G4N A;  2VQE M;  2UUC M;  1TDZ A;  1XC8 A;  4X64 M;  5IT9 S;  1Z5B A;  3JR4 A;  4G4Q A;  4NRV A;  1XNQ M;  3GQ5 A;  2F4V M;  4X62 M;  1XMO M;  4JI1 M;  3U6O A;  1PJI A;  4MB7 A;  2F5N A;  1Z5C A;  4GKJ M;  2F5P A;  1N33 M;  3GPP A;  3U6C A;  2ZBK B;  3J81 S;  3SAS A;  3SAV A;  1N34 M;  2UXB M;  1XNR M;  4G4R A;  1R2Z A;  1L2D A;  3A42 A;  3JAM S;  1IBM M;  5ITX E;  2HHH M;  2UU9 M;  4JV5 M;  5A2Q S;  1L2B A;  1TDH A;  4AQY M;  4DV0 M;  3SAT A;  4NRW A;  2F5Q A;  4JI8 M;  4PDI A;  4DUZ M;  2UUB M;  2UXC M;  3U6D A;  1PJJ A;  4JI2 M;  5ITX A;  4PD2 A;  3GQ4 A;  1HR0 M;  4DR2 M;  4LF5 M;  1PM5 A;  5IWA M;  3U6M A; 
#chains in the Genus database with same CATH topology
 2DWM A;  2JY5 A;  3FUW A;  3KOW E;  4NL4 H;  2DKL A;  4UN2 B;  2VF7 A;  2QSF X;  1SXJ A;  4GH9 A;  1OFH A;  4DR1 M;  3AJI B;  1OIZ A;  2Q2E B;  1VEK A;  3U6E A;  3L26 A;  1L1Z A;  1Y8G A;  2KEB A;  4W5W A;  3MHV C;  4Q7J A;  3FKE A;  1R7R A;  1JB0 F;  1NNU C;  1WGN A;  3KP0 E;  3GRU A;  3HKP A;  4JI6 M;  4M9S A;  2XZU A;  2HL7 A;  4DUY M;  3RGP A;  2F5O A;  1N75 A;  1Z5A A;  1QQW A;  2XSZ D;  3E46 A;  4FWH A;  3V76 A;  5IZ7 D;  3B9P A;  3FTF A;  1IN8 A;  2XEP A;  3BOS A;  4JI5 M;  1V92 A;  3DOA A;  1DV0 A;  1CUK A;  2ZTD A;  2HKJ A;  3AKZ A;  1NV9 A;  1WJ7 A;  2A5Y B;  1FJG M;  3U61 A;  3UMM A;  1XXH E;  2LVN C;  5EP3 A;  1L1T A;  4IBI A;  5ITU A;  4MM3 B;  4L15 A;  5BR8 M;  4M0D A;  2LVA A;  4DV7 M;  2FH0 A;  3GO8 A;  2CFO A;  2KNA A;  2OPF A;  1NVM A;  1YSY A;  1Q3C A;  4LFC M;  3A46 A;  2DEN A;  2E5L M;  4DR4 M;  3AV0 A;  2X8A A;  5EXT A;  5FSW A;  2FS1 A;  2OOA A;  4A3V B;  5ITT A;  3U6L A;  1IXS B;  1AUA A;  2LVQ D;  4DV1 M;  4DV2 M;  4LF4 M;  2DVW B;  1E32 A;  3ZC7 B;  2LVP C;  3TPZ A;  1TF0 B;  2FFJ A;  2LHG A;  2K47 A;  4RF1 A;  4X66 M;  4LGM A;  4NOO B;  1QZE A;  2QZ4 A;  1NJG A;  1WGL A;  1A5T A;  2L7I A;  4FCV A;  4QNR A;  5KO3 A;  4G4O A;  4IIW A;  1JR3 D;  4DV4 M;  1TH3 A;  1OJL A;  4D82 A;  2CUZ A;  1XXH B;  3B89 A;  3HU2 A;  1XHB A;  1ZMW A;  5KPR A;  1I4W A;  4PT5 A;  4REZ A;  3PFI A;  3I4Y A;  1QDR A;  1WHC A;  3TWK A;  4IJE A;  3UGJ A;  1H6U A;  2DAM A;  2ZAO A;  3DFZ A;  3KSX A;  3PXG A;  1GKI A;  2ERC A;  3T38 A;  3I4V A;  4LGY A;  4BBA A;  5E26 A;  3KOY E;  1QYR A;  4IBJ A;  4WW0 A;  4DBG B;  2KA6 B;  5FTK A;  5EXP A;  1XC8 A;  4TUW A;  5IT9 S;  1Z5B A;  3FE3 A;  2JNH A;  1C7Y A;  1SG9 A;  3CF2 A;  2L09 A;  4KLN A;  4QHT A;  2I7N A;  3BBZ A;  4LJ5 A;  3FRI A;  3GQ5 A;  3E4R A;  3W68 A;  3AOG A;  1XMO M;  2EUC A;  3U6O A;  4NSO B;  2F5P A;  1GLN A;  1NJF A;  3GLF B;  3GPP A;  3PNY A;  3KXE C;  4P16 A;  1GJT A;  3FTD A;  4MGZ E;  3RE8 A;  3D8B A;  2M5Z A;  5GKN A;  1TGU A;  3L27 A;  3L25 A;  2XH9 A;  3QYB A;  2YNM D;  5ITX E;  4JV5 M;  4FCT A;  1IN5 A;  4LJ6 A;  2X4A A;  3GRR A;  4LJ4 A;  5EJC A;  3MJ5 A;  4AG5 A;  4GEW A;  4I8O A;  4LRT A;  3C3E A;  2CHV A;  1PM5 A;  2UUB M;  3H4J A;  3LCV B;  4M9Z A;  3U6D A;  1HQC A;  2HAK A;  4DR2 M;  2HHH M;  1Q3B A;  2V6Z M;  4IBB A;  3THG A;  2FNA A;  3HJQ A;  4B3S M;  2G3Q A;  5FTM A;  3OTO M;  4LJ9 A;  4GKK M;  1G4A E;  3KS4 A;  4HL4 A;  1PJT A;  3U61 B;  2C96 A;  1IM2 A;  2RRU A;  2XFT A;  3DA1 A;  3GRV A;  4BLC A;  3M7G A;  3M6A A;  3GLF E;  2JY8 A;  3PVS A;  2B3T A;  2R4E A;  2AHM A;  5JI2 E;  2BNK A;  2JXN A;  2VII A;  4NXN M;  2L4F A;  4NSR A;  2KRK A;  4LF6 M;  1W5S A;  1NHG C;  5ITY A;  1PGY A;  2H1R A;  3KW6 A;  1YE9 A;  1YUB A;  2JY7 A;  5KQ8 A;  5H37 D;  1IY1 A;  1WXQ A;  1ZMU A;  4YY3 M;  1T3T A;  4LRS A;  4MGH A;  5F3W A;  1VDD A;  3E9S A;  3GLH E;  2D7G A;  3K2L A;  3QWL A;  3GLG E;  1ORY B;  1NO1 A;  3BXW A;  4DV3 M;  2W82 A;  1TR8 A;  1ZMV A;  2Z8Y M;  4B3M M;  1LTM A;  2WSF F;  1MU5 A;  1N77 A;  1XMQ M;  2M60 A;  2R18 A;  1IBK M;  1GO5 A;  2R46 A;  3SAW A;  1G3I A;  1T43 A;  1S3S A;  4DR7 M;  2CEA A;  3FUT A;  3VK7 A;  4DR5 M;  1PJQ A;  1MX0 A;  2OOB A;  3B7Q A;  4P17 A;  3GLI B;  4JI0 M;  3B7Z A;  2VQF M;  2Y20 A;  4DV6 M;  4KHP M;  3J7B A;  2LXE A;  4GIP A;  4D81 A;  3CGW A;  2EKK A;  1NY6 A;  2R62 A;  3VK8 A;  1I94 M;  3GLH A;  2EKF A;  1V34 A;  1XB2 B;  3CF6 E;  2N35 A;  2DWN A;  2DXI A;  3FTE A;  3UJN A;  2K0B X;  4KO8 A;  1IXR C;  1OKS A;  4YHH M;  3HU1 A;  4AKH A;  2R0I A;  2C5R A;  2R44 A;  2OO9 A;  1F4I A;  1Q39 A;  1NSF A;  1VG5 A;  1GVN A;  3VDP A;  5LMN M;  2QBY B;  3VKH A;  3TL4 X;  3R9X B;  3SYL A;  4B7F A;  4LFA M;  3T1H M;  1VEG A;  3A98 B;  5EP1 A;  1G59 A;  2DAK A;  4MGI E;  1K82 A;  3DZD A;  4R71 A;  2R65 A;  3FUV A;  1G71 A;  2CP8 A;  1D0L A;  5DNY A;  3C58 A;  2L6O A;  2DZO B;  5BPV A;  2CV2 A;  3E21 A;  3ILK A;  2KXE A;  4B3T M;  2VQE M;  3D8L A;  4G3O A;  4GC9 A;  3TE6 A;  1IN7 A;  2J7O A;  1DGB A;  2EJS A;  3C3D A;  2C9O A;  2DWZ B;  1QDT A;  3W0L B;  8CAT A;  2BWE A;  4OVZ B;  1MN3 A;  3B7N A;  2F4V M;  1W5T A;  4JI1 M;  1EFU B;  1PJI A;  2F5N A;  1Z5C A;  4GKJ M;  1SXJ C;  2QEN A;  4WP2 A;  5DYI A;  1XXH A;  2YQZ A;  3SMP A;  1E94 E;  4QOS A;  2CRU A;  2LVO C;  3K8Z A;  3J81 S;  3SAV A;  4I81 A;  1ZV1 A;  4AW4 A;  1QAQ A;  2C9C A;  2L7H A;  5DYG A;  3EIH A;  4OU7 A;  1DGF A;  1R2Z A;  1J09 A;  3A42 A;  1L2D A;  2QBY A;  4JXJ A;  2UU9 M;  3SHG B;  4AKG A;  1L2B A;  3FUU A;  4AQY M;  4LCB A;  1L8Q A;  2F5Q A;  3SFZ A;  2DI0 A;  3FUX A;  3HHX A;  4JI2 M;  2LH0 A;  4FW9 A;  1QAM A;  4LZZ A;  3GQ4 A;  1HR0 M;  1EIJ A;  1GJS A;  1R5L A;  4I5S A;  3SHF A;  2DZL A;  2QP9 X;  4II7 A;  3T15 A;  1N36 M;  4IBD A;  4FVM A;  3U6M A;  1OAO C;  2LBC A;  5C1B A;  3GRY A;  2XLJ A;  1QAN A;  2BWB A;  4AKI A;  2R4J A;  4MGK E;  2JA2 A;  1DGG A;  1DGH B;  5EP2 A;  3VLF B;  3HHY A;  3GLG A;  2DWL A;  4LF8 M;  4GHA A;  3HY5 A;  1Q02 A;  3J80 S;  5EQT A;  3L2A A;  1JR3 A;  2CHQ A;  1UM8 A;  1N32 M;  1SXJ D;  2RKO A;  3LQQ A;  3LVW A;  3GP1 A;  2F5S A;  1QZM A;  1N78 A;  4JYA M;  3AOE C;  2MH8 A;  1NHW C;  4AZF A;  1K3X A;  3FTC A;  5ITQ A;  3IG8 A;  3U6P A;  2L4E A;  1IN6 A;  5ITR A;  4LFB M;  4F1I A;  3IEC A;  3KP1 E;  3NBX X;  3GLH B;  4RNA A;  2MRO B;  1HT1 E;  2K9D A;  4FD2 A;  3GQ3 A;  2UUA M;  3LMM A;  3NWL A;  2XZF A;  2Z7J A;  4BB9 A;  2RGH A;  1R4G A;  2LTU A;  4XGI A;  4RF0 A;  3QYE A;  2D7H A;  4KOD A;  1C1K A;  1FNN A;  1GL7 A;  1K3W A;  3IHP A;  4GRI A;  3SC3 A;  2VDB B;  2WSE F;  3TWL A;  2R6F A;  3HGI A;  4OW0 A;  3KOX E;  3R8F A;  1D0K A;  2QHO B;  4LG2 A;  5JI3 E;  3SAR A;  1BVS A;  1WIV A;  2QQ8 A;  3J27 B;  5FTJ A;  5IRE B;  1HJP A;  1Z59 A;  3PNV A;  4AG6 A;  4JI3 M;  3FYD A;  4GHL A;  4LY6 A;  5DFL A;  1TH4 A;  2DHR A;  2MJ5 B;  1R2Y A;  2ZM6 M;  1L2C A;  1DGH A;  1TH2 A;  3GLG B;  2EA0 A;  1Z6T A;  3GPU A;  4Z6Y A;  4NXM M;  1OQY A;  1G41 A;  3FYC A;  3HU3 A;  3HZJ A;  1EE8 A;  3HWS A;  4IJF A;  3MMP A;  3TQS A;  4LF7 M;  7CAT A;  2UXD M;  1OFI A;  2V1C A;  4LJA A;  5FTL A;  2LHC A;  4DR6 M;  2C98 A;  3CF0 A;  2X49 A;  1OTR A;  2WSC F;  5FLX S;  4L78 A;  4F2L A;  4ITQ A;  4L6V 6;  4CGY B;  1IBL M;  4R7G A;  4M9X A;  5E6J A;  2LWX A;  2R45 A;  2V1U A;  3VFD A;  2G8L A;  4GMQ A;  1QUS A;  1IFY A;  2DZN B;  1E9R A;  1OIP A;  2DAI A;  3JR4 A;  5KQD A;  1XNQ M;  1QAO A;  4QOZ C;  3RFW A;  1T6O A;  2MR9 A;  2O01 F;  4QNM A;  4MB7 A;  2CHG A;  2O5R A;  2P5T A;  5EP4 A;  3ZQJ A;  2Y0Q A;  3F92 A;  4EIW A;  3GLF A;  3U60 A;  3U60 B;  1N33 M;  3U6C A;  3J2P B;  2ZBK B;  2GNO A;  2XF3 A;  3LCU A;  3B74 A;  4OVZ A;  2RGO A;  3SAS A;  4LJ8 A;  2JWS A;  4QHS A;  3QAU A;  1JR3 E;  1XNR M;  3FRH A;  3C9P A;  2FOI C;  3L29 A;  3JAM S;  3HJ8 A;  4G6Z A;  4I4L A;  4RKU F;  1YLA A;  1VDL A;  1IXS A;  1TDH A;  2C99 A;  3CTW B;  3SAT A;  2BJV A;  4NRW A;  2D7E A;  1ZQ9 A;  3I01 M;  4PDI A;  4DUZ M;  2Z3X A;  3U5Z B;  4JN6 A;  2EO2 A;  1JQJ C;  2UXC M;  1PJJ A;  5KPZ A;  2JZ1 A;  4IBE A;  3NBI A;  1D0M A;  1P3Q Q;  1HQY E;  4LF5 M;  5IWA M;  3Q8G A;  2Z4S A;  4MH0 E;  2KNV A;  1XWI A;  2L2D A;  4JI7 M;  2FE8 A;  3M0E A;  2JZ0 A;  2XSZ A;  4L4U A;  4XBO A;  3U6S A;  5EXX A;  3VDU A;  3JR5 A;  2O25 A;  4AI6 A;  4LJ7 A;  3J7A S;  2DHY A;  1DO0 A;  5C18 A;  4LF9 M;  3AL0 C;  1VQ1 A;  2BJW A;  4L8R C;  1RU3 A;  3IG5 A;  3RGS A;  4CIS A;  1TTE A;  5FTN A;  3TWM A;  3KS8 A;  1OAI A;  3SBJ A;  2K6B A;  3WHL A;  1KFV A;  1MJG M;  3T1Y M;  2YR0 A;  3A45 A;  1IN4 A;  4M0W A;  3LQR A;  4S12 A;  2CE7 A;  2QCU A;  2DAE A;  1GAB A;  3HX3 A;  4XK8 F;  4B3R M;  3W0F A;  1NNJ A;  2OQ4 A;  3W67 A;  3GPY A;  1DO2 A;  3AFH A;  1ZAE A;  1UFZ A;  3U6Q A;  3I04 M;  5KPT A;  4B08 A;  4LZJ A;  3HHZ A;  2J7N A;  3HJS A;  4X65 M;  4FWD A;  1HNX M;  5LMU M;  2JUJ A;  3ZH9 B;  2YFQ A;  3WHK A;  3VKG A;  1LV7 A;  1J5E M;  2CWB A;  2GQF A;  3MK6 A;  4Y28 F;  3SAU A;  3KFU G;  1HNW M;  2XGN A;  1R6B X;  2Y21 A;  3SMS A;  2NQ8 C;  4DR3 M;  4K0K M;  3L28 A;  2XFS A;  4IBG A;  4L16 A;  4D80 A;  2Z4R A;  4PCZ A;  1IY2 A;  4PDG A;  2HCB A;  2KHH A;  4OX9 M;  3ZCB B;  2ZAM A;  3KSJ A;  2KW0 A;  4IBC A;  4NC6 A;  1VEJ A;  3T6P A;  2CV0 A;  3GPX A;  1IXZ A;  2APL A;  4CJ6 A;  3K9O A;  1HNZ M;  2QPA A;  4GC5 A;  3SYK A;  3UZU A;  4ANR A;  4MGY E;  4WUR A;  4DV5 M;  2DAG A;  2KDL A;  5L8R F;  4FWG A;  1SXJ B;  2DNA A;  2KRU A;  1NY5 A;  1QVR A;  3LW5 F;  2WZJ A;  3Q8X A;  4B7H A;  4JI4 M;  2JP7 A;  4ZPX A;  3FD9 A;  1G8P A;  4G4N A;  2KZS A;  4HLQ A;  4B7G A;  2QNJ A;  2UUC M;  1PJS A;  1TDZ A;  2I7P A;  4X64 M;  1V33 A;  4CHT B;  1KYI A;  1X37 A;  1J7K A;  2VF8 A;  3I51 A;  1E9S A;  2KZU A;  4NRV A;  4G4Q A;  3U5Z A;  4IBF A;  4X62 M;  3H4M A;  1PRB A;  4R3D A;  3EIE A;  2J5Y A;  3UK6 A;  1NV8 A;  2CV1 A;  1KSF X;  2KNZ A;  3K9P A;  2H5X A;  1N34 M;  2UXB M;  3KVW A;  3K1J A;  4FCW A;  2JY6 B;  4CIZ A;  3GLI A;  3AOE A;  4KT0 F;  3K92 A;  3GLI E;  4G4R A;  2MGW A;  3HHW A;  1GL6 A;  4HEO A;  2ZTC A;  1HT2 E;  1SXJ E;  1IBM M;  2G5G X;  3KDS E;  5A2Q S;  4Z8X A;  3KOZ E;  1AIP C;  2Y0T A;  4DV0 M;  4GIT A;  2HWJ A;  4JI8 M;  1IQP A;  1IY0 A;  2ZAN A;  5ITX A;  4PD2 A;  2LNH C;  3LVV A;  1D2N A;  1QUT A;  4IBK A;  5EXS A;  1WR1 B; 
#chains in the Genus database with same CATH homology
 2DWM A;  3FUW A;  3KOW E;  4NL4 H;  1SXJ A;  4GH9 A;  1OFH A;  4DR1 M;  3AJI B;  2Q2E B;  3U6E A;  3L26 A;  1L1Z A;  2KEB A;  4W5W A;  3MHV C;  3FKE A;  1R7R A;  1NNU C;  3KP0 E;  3GRU A;  3HKP A;  4JI6 M;  4M9S A;  2XZU A;  2HL7 A;  4DUY M;  3RGP A;  2F5O A;  1N75 A;  1Z5A A;  1QQW A;  2XSZ D;  4FWH A;  5IZ7 D;  3B9P A;  3FTF A;  1IN8 A;  2XEP A;  3BOS A;  4JI5 M;  3DOA A;  3AKZ A;  2HKJ A;  2A5Y B;  1FJG M;  3U61 A;  3UMM A;  5EP3 A;  1L1T A;  4IBI A;  5ITU A;  4MM3 B;  4L15 A;  5BR8 M;  4M0D A;  4DV7 M;  3GO8 A;  2CFO A;  2OPF A;  1NVM A;  1YSY A;  1Q3C A;  4LFC M;  3A46 A;  2E5L M;  4DR4 M;  3AV0 A;  2X8A A;  5EXT A;  5FSW A;  4A3V B;  5ITT A;  3U6L A;  1IXS B;  4DV1 M;  4DV2 M;  4LF4 M;  2DVW B;  1E32 A;  3ZC7 B;  3TPZ A;  4RF1 A;  2FFJ A;  4X66 M;  2K47 A;  4LGM A;  4NOO B;  2QZ4 A;  1NJG A;  2L7I A;  4FCV A;  4QNR A;  5KO3 A;  4G4O A;  4IIW A;  1JR3 D;  4DV4 M;  1TH3 A;  1OJL A;  4D82 A;  2CUZ A;  1XXH B;  3HU2 A;  1XHB A;  5KPR A;  1I4W A;  4PT5 A;  4REZ A;  3PFI A;  3I4Y A;  3TWK A;  4IJE A;  3UGJ A;  1H6U A;  3KSX A;  2ZAO A;  3DFZ A;  3PXG A;  1GKI A;  2ERC A;  3T38 A;  3I4V A;  4LGY A;  4BBA A;  5E26 A;  3KOY E;  1QYR A;  4IBJ A;  4WW0 A;  2KA6 B;  5FTK A;  5EXP A;  1XC8 A;  4TUW A;  5IT9 S;  1Z5B A;  3CF2 A;  2L09 A;  4KLN A;  4QHT A;  2I7N A;  4LJ5 A;  3GQ5 A;  3E4R A;  3AOG A;  1XMO M;  2EUC A;  3U6O A;  4NSO B;  2F5P A;  1GLN A;  1NJF A;  3GLF B;  3GPP A;  3PNY A;  3KXE C;  4P16 A;  4MGZ E;  3FTD A;  3RE8 A;  3D8B A;  2M5Z A;  5GKN A;  1TGU A;  3L27 A;  3L25 A;  2XH9 A;  2YNM D;  5ITX E;  4JV5 M;  4FCT A;  1IN5 A;  4LJ6 A;  2X4A A;  3GRR A;  4LJ4 A;  5EJC A;  3MJ5 A;  4AG5 A;  4I8O A;  4LRT A;  2CHV A;  1PM5 A;  2UUB M;  4M9Z A;  3U6D A;  1HQC A;  4DR2 M;  2HHH M;  1Q3B A;  2V6Z M;  4IBB A;  3THG A;  2FNA A;  3HJQ A;  4B3S M;  3OTO M;  5FTM A;  4GKK M;  4LJ9 A;  1G4A E;  3KS4 A;  4HL4 A;  3U61 B;  2C96 A;  1IM2 A;  2XFT A;  3DA1 A;  3GRV A;  4BLC A;  3M7G A;  3M6A A;  3PVS A;  2R4E A;  2AHM A;  5JI2 E;  2BNK A;  2VII A;  4NXN M;  4NSR A;  2KRK A;  4LF6 M;  1W5S A;  1NHG C;  5ITY A;  2H1R A;  3KW6 A;  1YE9 A;  1YUB A;  5KQ8 A;  5H37 D;  1IY1 A;  1WXQ A;  4YY3 M;  1T3T A;  4LRS A;  4MGH A;  5F3W A;  1VDD A;  3E9S A;  2D7G A;  3K2L A;  3QWL A;  1ORY B;  4DV3 M;  2W82 A;  4B3M M;  1MU5 A;  1N77 A;  1XMQ M;  2M60 A;  2R18 A;  1IBK M;  2R46 A;  3SAW A;  1G3I A;  1S3S A;  4DR7 M;  2CEA A;  3FUT A;  3VK7 A;  4DR5 M;  1MX0 A;  3GLI B;  4JI0 M;  2VQF M;  4DV6 M;  2Y20 A;  4KHP M;  3J7B A;  2LXE A;  4GIP A;  4D81 A;  1NY6 A;  2R62 A;  3VK8 A;  1I94 M;  3GLH A;  3CF6 E;  2DXI A;  3FTE A;  2DWN A;  3UJN A;  4KO8 A;  1IXR C;  4YHH M;  3HU1 A;  4AKH A;  2C5R A;  1Q39 A;  1NSF A;  1GVN A;  3VDP A;  5LMN M;  2QBY B;  3VKH A;  3TL4 X;  3R9X B;  3SYL A;  4B7F A;  4LFA M;  3T1H M;  3A98 B;  5EP1 A;  1G59 A;  4MGI E;  1K82 A;  3DZD A;  2R65 A;  3FUV A;  5DNY A;  3C58 A;  2L6O A;  2DZO B;  5BPV A;  2CV2 A;  4B3T M;  3ILK A;  2KXE A;  2VQE M;  3D8L A;  4GC9 A;  3TE6 A;  1IN7 A;  2J7O A;  1DGB A;  3W0L B;  2C9O A;  2DWZ B;  8CAT A;  4OVZ B;  2F4V M;  1W5T A;  4JI1 M;  2F5N A;  1PJI A;  1Z5C A;  4GKJ M;  1SXJ C;  2QEN A;  5DYI A;  3SMP A;  1XXH A;  2YQZ A;  1E94 E;  4QOS A;  3K8Z A;  3J81 S;  3SAV A;  4I81 A;  4AW4 A;  1QAQ A;  2C9C A;  2L7H A;  5DYG A;  3EIH A;  4OU7 A;  1DGF A;  1R2Z A;  1J09 A;  3A42 A;  1L2D A;  2QBY A;  4JXJ A;  2UU9 M;  3SHG B;  4AKG A;  1L2B A;  3FUU A;  4AQY M;  4LCB A;  1L8Q A;  2F5Q A;  3SFZ A;  3FUX A;  3HHX A;  4JI2 M;  2LH0 A;  4FW9 A;  1QAM A;  4LZZ A;  3GQ4 A;  1HR0 M;  3SHF A;  4I5S A;  2QP9 X;  4II7 A;  3T15 A;  1N36 M;  4IBD A;  4FVM A;  3U6M A;  5C1B A;  2XLJ A;  3GRY A;  1QAN A;  4AKI A;  2R4J A;  4MGK E;  2JA2 A;  1DGG A;  1DGH B;  5EP2 A;  3VLF B;  3HHY A;  3GLG A;  2DWL A;  4LF8 M;  4GHA A;  3J80 S;  5EQT A;  3L2A A;  1JR3 A;  2CHQ A;  1UM8 A;  1N32 M;  1SXJ D;  2RKO A;  3LQQ A;  3LVW A;  3GP1 A;  2F5S A;  1QZM A;  1N78 A;  4JYA M;  3AOE C;  1K3X A;  1NHW C;  4AZF A;  3FTC A;  5ITQ A;  3IG8 A;  3U6P A;  1IN6 A;  5ITR A;  4LFB M;  3KP1 E;  3GLH B;  4RNA A;  1HT1 E;  4FD2 A;  3GQ3 A;  2UUA M;  3LMM A;  3NWL A;  2XZF A;  2Z7J A;  4BB9 A;  2RGH A;  4XGI A;  4RF0 A;  2D7H A;  4KOD A;  1C1K A;  1FNN A;  1GL7 A;  1K3W A;  4GRI A;  3SC3 A;  3TWL A;  3HGI A;  4OW0 A;  3KOX E;  3R8F A;  4LG2 A;  5JI3 E;  3SAR A;  3J27 B;  5FTJ A;  5IRE B;  1Z59 A;  3PNV A;  4AG6 A;  4JI3 M;  3FYD A;  4GHL A;  4LY6 A;  1TH4 A;  2DHR A;  1R2Y A;  1L2C A;  2ZM6 M;  1DGH A;  1TH2 A;  3GLG B;  2EA0 A;  1Z6T A;  3GPU A;  4Z6Y A;  4NXM M;  1G41 A;  3FYC A;  3HU3 A;  1EE8 A;  3HWS A;  4IJF A;  3TQS A;  4LF7 M;  7CAT A;  2UXD M;  1OFI A;  2V1C A;  4LJA A;  5FTL A;  4DR6 M;  2C98 A;  3CF0 A;  2X49 A;  5FLX S;  4L78 A;  4ITQ A;  4CGY B;  1IBL M;  4R7G A;  4M9X A;  5E6J A;  2LWX A;  2R45 A;  2V1U A;  3VFD A;  2G8L A;  4GMQ A;  2DZN B;  1E9R A;  3JR4 A;  5KQD A;  1XNQ M;  1QAO A;  4QOZ C;  3RFW A;  4QNM A;  4MB7 A;  2CHG A;  2O5R A;  2P5T A;  5EP4 A;  3GLF A;  2Y0Q A;  4EIW A;  3U60 A;  3U60 B;  1N33 M;  3U6C A;  3J2P B;  2ZBK B;  2XF3 A;  4OVZ A;  3SAS A;  2RGO A;  4LJ8 A;  4QHS A;  3QAU A;  1XNR M;  2FOI C;  3L29 A;  3JAM S;  3HJ8 A;  4G6Z A;  4I4L A;  2C99 A;  1TDH A;  3CTW B;  3SAT A;  2BJV A;  4NRW A;  2D7E A;  1ZQ9 A;  4PDI A;  4DUZ M;  2Z3X A;  3U5Z B;  4JN6 A;  2EO2 A;  1JQJ C;  2UXC M;  1PJJ A;  5KPZ A;  4IBE A;  3NBI A;  1HQY E;  4LF5 M;  5IWA M;  2Z4S A;  4MH0 E;  1XWI A;  4JI7 M;  2FE8 A;  3M0E A;  2XSZ A;  4L4U A;  4XBO A;  3U6S A;  5EXX A;  3VDU A;  3JR5 A;  4AI6 A;  4LJ7 A;  3J7A S;  1DO0 A;  5C18 A;  4LF9 M;  3AL0 C;  2BJW A;  4L8R C;  3IG5 A;  3RGS A;  4CIS A;  5FTN A;  3TWM A;  3KS8 A;  3SBJ A;  3WHL A;  1KFV A;  3T1Y M;  2YR0 A;  3A45 A;  1IN4 A;  4M0W A;  3LQR A;  4S12 A;  2CE7 A;  2QCU A;  4B3R M;  3W0F A;  1NNJ A;  2OQ4 A;  3GPY A;  1DO2 A;  3AFH A;  1ZAE A;  3U6Q A;  5KPT A;  3HHZ A;  4B08 A;  4LZJ A;  2J7N A;  3HJS A;  4X65 M;  4FWD A;  1HNX M;  5LMU M;  3ZH9 B;  2YFQ A;  3WHK A;  3VKG A;  1LV7 A;  1J5E M;  3MK6 A;  3SAU A;  3KFU G;  1HNW M;  2XGN A;  1R6B X;  2Y21 A;  3SMS A;  2NQ8 C;  4DR3 M;  4K0K M;  3L28 A;  2XFS A;  4IBG A;  4L16 A;  4D80 A;  2Z4R A;  4PCZ A;  1IY2 A;  4PDG A;  2HCB A;  4OX9 M;  3ZCB B;  2ZAM A;  3KSJ A;  2KW0 A;  4IBC A;  2CV0 A;  3GPX A;  1IXZ A;  1HNZ M;  2QPA A;  4GC5 A;  3SYK A;  3UZU A;  4DV5 M;  4MGY E;  4WUR A;  4FWG A;  1SXJ B;  2KRU A;  1NY5 A;  1QVR A;  4B7H A;  3Q8X A;  4JI4 M;  4ZPX A;  3FD9 A;  1G8P A;  4G4N A;  2KZS A;  4HLQ A;  4B7G A;  2UUC M;  1TDZ A;  2I7P A;  4X64 M;  4CHT B;  1KYI A;  1X37 A;  1J7K A;  3I51 A;  4G4Q A;  1E9S A;  2KZU A;  4NRV A;  3U5Z A;  4IBF A;  4X62 M;  3H4M A;  4R3D A;  3EIE A;  3UK6 A;  2CV1 A;  1KSF X;  1N34 M;  2UXB M;  3KVW A;  3K1J A;  4FCW A;  3GLI A;  3AOE A;  3K92 A;  4G4R A;  3HHW A;  1GL6 A;  1HT2 E;  1SXJ E;  1IBM M;  2G5G X;  3KDS E;  5A2Q S;  4Z8X A;  3KOZ E;  2Y0T A;  4DV0 M;  4GIT A;  4JI8 M;  1IQP A;  1IY0 A;  2ZAN A;  5ITX A;  4PD2 A;  2LNH C;  3LVV A;  1D2N A;  4IBK A;  5EXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...