1HNWM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hnwM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hnwM02
5ITYA 2F5NA 1XC8A 2UXBM 4JYAM 3JR5A 3TWKA 4DV0M 2XZUA 5A2QS 4NXMM 4KHPM 3A42A 3GPPA 3SASA 4LFBM 4DR7M 1Z5CA 4DR2M 4X62M 4DV2M 1XMQM 1L1TA 2XZFA 4LF9M 4DR6M 1HNWM 1IBMM 3J7AS 3DOAA 3T1YM 1L2CA 1R2YA 1PM5A 1MU5A 4B3MM 4JI1M 4NRWA 2F5PA 4JI4M 4LF8M 1XMOM 4G4NA 3A45A 4LF4M 1KFVA 4JI5M 1Q3CA 4PDIA 4LFCM 1HR0M 1IBLM 4B3SM 1J5EM 4CISA 4PDGA 1N33M 4LFAM 4DR5M 2UU9M 4ITQA 3U6LA 3GQ4A 2F5SA 3SBJA 4JI6M 1Q3BA 3GQ3A 3OTOM 1R2ZA 4DV5M 1K3XA 3VK7A 4AQYM 3U6DA 1N36M 3JAMS 4GKKM 4YY3M 5IWAM 3C58A 5LMUM 2OQ4A 4B3TM 3TWLA 4OX9M 2F4VM 4DV6M 3SAWA 4LF7M 2Q2EB 1I94M 4JI7M 3U6QA 5FLXS 1PJJA 2VQEM 3A46A 4JI0M 4JV5M 4DUYM 1Z5BA 2ZM6M 1XNRM 2UUBM 4DV4M 3GPUA 1K3WA 1EE8A 4X64M 4PCZA 5ITQA 3GO8A 1L2BA 4MB7A 4DR1M 5ITRA 3GP1A 3TWMA 4DUZM 1Z5AA 1L1ZA 2UXDM 1FJGM 1Q39A 4YHHM 2OPFA 5ITTA 1MX0A 3J81S 3GPXA 1Z59A 2ZBKB 1NNJA 4DV3M 4DV7M 4K0KM 1PJIA 2UUCM 3W0FA 2HKJA 1HNZM 4DR4M 4GKJM 4X66M 2E5LM 5ITXE 4NRVA 3GQ5A 3SAUA 4JI3M 4LF5M 3J80S 3U6CA 3GPYA 1L2DA 3VK8A 4B3RM 5BR8M 4JI2M 4G4RA 4DR3M 2HHHM 4G4QA 5ITUA 4X65M 5LMNM 3SAVA 3U6OA 3SARA 5ITXA 1TDZA 2UXCM 4JI8M 4LF6M 2UUAM 2F5QA 1HNXM 1XNQM 4PD2A 2VQFM 5IT9S 3JR4A 2EA0A 1K82A 1N34M 3U6PA 1TDHA 4NXNM 4G4OA 2F5OA 1N32M 3U6EA 3U6MA 3SATA 3U6SA 4DV1M 1IBKM 3T1HM
chains in the Genus database with same CATH superfamily
3CF2A 2DZNB 4LJ7A 3JR5A 3TWKA 4KHPM 4B7FA 3M6AA 2QQ8A 3SYKA 4KO8A 1QDTA 2LTUA 4MGYE 1OTRA 2DENA 2RRUA 3A42A 3B7QA 3RGPA 3GPPA 1QZEA 1IN7A 3SASA 4DR7M 4LFBM 1Z5CA 1DV0A 1L8QA 1SXJD 4X62M 5E6JA 2ZTDA 4Q7JA 1XMQM 1DGGA 2W82A 2XZFA 4LF9M 4DR6M 4IBJA 2FOIC 1IBMM 3DOAA 1J7KA 2MJ5B 3IG8A 4IBDA 4GC5A 1AUAA 1ZV1A 4B3MM 1OQYA 3GRYA 3KXEC 4S12A 2C96A 3SYLA 3ZC7B 4AG5A 3A45A 2HL7A 3RGSA 4LZZA 5DYGA 4JI5M 1Q3CA 1SG9A 4PDIA 2D7GA 4B7GA 1AIPC 3HWSA 2JNHA 4GIPA 4WURA 1IBLM 4FVMA 4LFAM 1QYRA 1E9RA 1R7RA 1IY2A 1H6UA 2QPAA 3M7GA 3SBJA 3FUUA 2G5GX 2DKLA 2R46A 1A5TA 2I7NA 5EP1A 1K3XA 3VK7A 1V33A 2LVQD 1GL7A 3T6PA 4OX9M 1N36M 1QZMA 1XWIA 3C58A 2APLA 5LMUM 2C9OA 3LMMA 1DGBA 3LVWA 3TWLA 1NV8A 2Z3XA 2DAMA 3KSXA 1I94M 2KNZA 1IXRC 5EQTA 2R45A 5FTLA 2LVNC 4QOZC 1VEKA 2JY7A 2LVOC 3U6QA 5FLXS 4JV5M 1PGYA 4L6V6 4DUYM 1EIJA 4QNRA 2JY8A 2FS1A 2OOBA 3FUTA 4B08A 1K3WA 3UK6A 3TE6A 1EE8A 4AW4A 2KZUA 4PCZA 3IECA 1GO5A 4CHTB 5ITQA 2N35A 1WGNA 1VDLA 1TGUA 4M9ZA 1IY1A 3E46A 3Q8GA 1WJ7A 2RGOA 4BB9A 3UJNA 3B7NA 2C99A 3H4JA 1FJGM 1VG5A 1W5TA 2M5ZA 3FE3A 4L4UA 4YHHM 1QDRA 3SHFA 5FTJA 1ZMUA 5L8RF 1Q02A 4JN6A 3MJ5A 5EXSA 3HJSA 4FW9A 2R44A 2ZBKB 2Z4SA 1HT2E 2CRUA 1BVSA 2VF8A 1YE9A 3AOEA 1QUSA 3GLHB 4M0DA 4DV3M 1PJIA 2HKJA 4FCVA 2AHMA 2DNAA 4NSRA 4QHTA 1VEJA 4Z8XA 4AG6A 3GLGB 2XFSA 3GQ5A 2D7HA 4KODA 4LF5M 5DNYA 3K1JA 4IBGA 3U61A 5JI2E 2CHQA 2WSCF 3AOGA 4LJ9A 5BR8M 2O25A 4JI2M 4IBKA 4G4RA 2HHHM 2OOAA 4R71A 4LCBA 3SAVA 1TH4A 3KP1E 5EP4A 1IM2A 3FTDA 4CIZA 1TDZA 4LF6M 1XNQM 1HNXM 3UGJA 2FNAA 2EKFA 4L8RC 3JR4A 5DFLA 1K82A 1W5SA 2KNVA 3U6PA 1N34M 4G4OA 1WXQA 1G71A 4AKGA 1KSFX 4GITA 1MJGM 1Y8GA 3U6SA 1NSFA 1IBKM 1D2NA 1V92A 3I51A 2F5NA 3W68A 2OO9A 1R4GA 4JYAM 5FTMA 2JWSA 3GLIB 1DGHA 2CP8A 4IJFA 1IN8A 3IG5A 1YSYA 2YQZA 3MHVC 3NBXX 1Z6TA 3FTCA 5EXXA 3GRVA 1T43A 2CWBA 3E21A 1JR3D 3SMPA 3VKGA 2JZ1A 2R0IA 3HZJA 3AOEC 4D81A 5H37D 2JZ0A 2F5PA 2K6BA 2ZTCA 1VQ1A 1ZQ9A 2YR0A 3RE8A 2R4EA 1GLNA 4I8OA 3DA1A 4NC6A 3T1HM 4LF4M 4OVZB 2L09A 1WIVA 2J7OA 2XEPA 3PVSA 4L16A 4P17A 1J5EM 4PDGA 4FWGA 3TPZA 3KFUG 4AI6A 1TF0B 4DR5M 2LBCA 3PNYA 4W5WA 1PJQA 2CHVA 4NOOB 1PRBA 4JI6M 3NWLA 1E94E 4GHLA 3SC3A 1TH2A 3WHKA 1SXJB 4BLCA 5IWAM 1P3QQ 2H1RA 2OQ4A 1NVMA 3KP0E 3SFZA 4B3TM 2DZOB 5KO3A 1NHWC 4GEWA 2RGHA 3F92A 4LF7M 3TL4X 3HY5A 3V76A 1N77A 2QCUA 2KDLA 4M9SA 2QP9X 4ZPXA 2Z8YM 2I7PA 4KLNA 1D0MA 2DVWB 4IJEA 4M0WA 1GJTA 2LWXA 3ZH9B 2ZM6M 2X8AA 3HU1A 1XNRM 3D8LA 3L29A 5JI3E 4X64M 5F3WA 3T15A 3K9PA 1VEGA 4G6ZA 4DR1M 2JXNA 2LH0A 2JY5A 2DAKA 3DZDA 1Z5AA 1L1ZA 2CV1A 2UXDM 4IBIA 4WP2A 1E32A 1Q39A 1QQWA 2XH9A 4LG2A 3FRHA 1NJFA 3J81S 2HWJA 1CUKA 2L7HA 4II7A 3CGWA 1XXHB 1Z59A 1IXZA 3GLHE 1QVRA 1IN5A 1IY0A 3K92A 4XBOA 4K0KM 1F4IA 1NJGA 1WGLA 2CFOA 3GLGE 1HNZM 3KS4A 4RKUF 4G3OA 4DR4M 3K9OA 4LJAA 2KZSA 3HU3A 5ITXE 2E5LM 2XSZD 3SAUA 2L7IA 4JI3M 3FUVA 2JUJA 4RNAA 2LVAA 3GPYA 2KRUA 2CUZA 3GLHA 2JA2A 1L2DA 3LQRA 2VDBB 3VK8A 2KA6B 2L2DA 1QAMA 4HEOA 3SHGB 3AL0C 3KS8A 4G4QA 2VIIA 5ITUA 3GLGA 3ILKA 2QBYB 3HKPA 3U6OA 2O01F 5ITXA 3GLFB 2VQFM 5IT9S 3PXGA 2EA0A 5EXPA 1TDHA 4NXNM 2DI0A 3U5ZA 1IXSA 2O5RA 2L6OA 3U6MA 3SATA 4P16A 2UUAM 2XF3A 2KW0A 2X49A 5ITYA 2UXBM 3HGIA 1XC8A 2DWLA 4A3VB 4LRSA 2CEAA 3L2AA 3HHWA 5A2QS 2DAGA 2K0BX 3GLIE 4NXMM 3KOZE 2M60A 3AKZA 2G3QA 1RU3A 4NSOB 1IQPA 3AJIB 1TR8A 3T38A 2KNAA 1HQYE 4DR2M 3WHLA 3U60B 2DHRA 2GNOA 1IXSB 1HJPA 4LRTA 3U5ZB 2DXIA 1EFUB 1HNWM 3J7AS 3KOXE 2QNJA 3HJ8A 4OU7A 3T1YM 3GLIA 3R9XB 3I4VA 2KXEA 1MN3A 2Y20A 2A5YB 1MU5A 3CTWB 4NRWA 4NL4H 1DGFA 3KOWE 4FWHA 4MGKE 4XGIA 4JI4M 1N75A 2G8LA 3FKEA 1XMOM 1KFVA 4PT5A 3KW6A 4B7HA 4LFCM 1C1KA 1OIPA 2MROB 2EJSA 3CF0A 1HR0M 3B74A 4HLQA 5IREB 4CISA 4MGHA 3KDSE 4Y28F 1OFIA 4LGMA 4LGYA 1C7YA 3GQ4A 2F5SA 2Z4RA 3GQ3A 3OTOM 1R5LA 4OVZA 4DV5M 3W0LB 1SXJE 2FFJA 3AV0A 1G4AE 3VDUA 3W67A 5KPRA 4AZFA 1DO0A 1OIZA 4UN2B 2ZAMA 3LQQA 3QWLA 1LV7A 2K47A 5KPTA 2Y21A 4GMQA 2QZ4A 5EP3A 4DV6M 3SAWA 3MMPA 1D0KA 3E9SA 4R7GA 4L15A 5DYIA 1SXJA 3THGA 2FH0A 1NO1A 2V1UA 4JI7M 1NY5A 4GH9A 4F2LA 4D82A 1PJJA 1TTEA 3A46A 3DFZA 1ORYB 1Z5BA 2C9CA 2UUBM 4I4LA 2R62A 5GKNA 4IBFA 4I5SA 3VDPA 2MR9A 2VF7A 3LVVA 3HHXA 4GRIA 4CJ6A 3GO8A 3VLFB 1L2BA 1QANA 4MB7A 1J09A 2X4AA 2BNKA 3HHYA 3GP1A 4Z6YA 4DUZM 1UM8A 2BJWA 2KHHA 2RKOA 4FD2A 4MH0E 1QAOA 1XXHE 3GPXA 2Y0QA 5EP2A 1ZMWA 2C5RA 5C18A 2MGWA 3M0EA 2GQFA 4F1IA 4MGIE 2R4JA 3IHPA 4R3DA 2HAKA 4GKJM 3BOSA 1E9SA 3C9PA 3HX3A 3J7BA 1NV9A 3HU2A 1S3SA 4NRVA 1WR1B 2WSFF 2XFTA 1YLAA 4QNMA 1XXHA 1OKSA 2R18A 2HCBA 5IZ7D 4B3RM 1HT1E 1NNUC 5C1BA 4DR3M 4ANRA 5LMNM 3VFDA 3QYBA 3MK6A 3GLFE 3SARA 1WHCA 1SXJC 2XSZA 3K2LA 4FCWA 3L26A 4JI8M 2MH8A 2F5QA 2UXCM 2R6FA 1QUTA 4D80A 1I4WA 4LZJA 3PFIA 1GVNA 2F5OA 3FUWA 1JB0F 2QBYA 2V6ZM 1OAOC 2JP7A 3GLFA 2K9DA 1V34A 1XB2B 2DWZB 1T3TA 3NBIA 3B9PA 3J2PB 4CGYB 3KOYE 3L28A 4DV0M 2XZUA 1OAIA 2CV0A 3FTEA 3FUXA 2XLJA 2LNHC 4FWDA 2YNMD 4AKHA 3RFWA 4DV2M 1G3IA 4L78A 1L1TA 2EO2A 1IFYA 1X37A 3I04M 2WSEF 3BBZA 1ZAEA 1L2CA 3VKHA 3A98B 3KSJA 3LCUA 1KYIA 3LCVB 2KRKA 1LTMA 1PM5A 3ZCBB 2JY6B 1UFZA 1R2YA 4JI1M 2Z7JA 4OW0A 3FTFA 4DBGB 2L4EA 1IN4A 4LF8M 3C3DA 4G4NA 3U60A 4IBCA 3C3EA 2DAEA 1ZMVA 2DWNA 3HHZA 2DAIA 4B3SM 4EIWA 1N33M 1PJSA 4BBAA 4M9XA 2LHCA 2UU9M 2FE8A 2J5YA 4ITQA 3U6LA 2LVPC 1HQCA 1FNNA 1Q3BA 4GHAA 3GRRA 4QOSA 1R2ZA 3AFHA 4KT0F 2WZJA 3UZUA 3ZQJA 4AQYM 3U6DA 4IBEA 1JR3E 3R8FA 1GABA 1IN6A 2BJVA 2LXEA 2XGNA 3JAMS 4YY3M 4GKKM 2B3TA 4MM3B 2P5TA 3SMSA 3D8BA 2BWEA 1JQJC 3L27A 2F4VM 3EIEA 2DZLA 2ERCA 2Q2EB 2ZANA 5KQDA 3K8ZA 4FCTA 1OJLA 5EJCA 3TQSA 4IBBA 1JR3A 4RF0A 2D7EA 3EIHA 2LHGA 3FYCA 2VQEM 4JI0M 5KQ8A 2ZAOA 4JXJA 4DV4M 1TH3A 4TUWA 4I81A 5KPZA 4LJ8A 3GPUA 1XHBA 3KVWA 2KEBA 4QHSA 2EKKA 1N78A 2CV2A 4XK8F 1VDDA 3I4YA 1NHGC 3BXWA 5EXTA 3FD9A 1R6BX 5ITRA 3TWMA 2YFQA 3LW5F 1D0LA 3UMMA 1QAQA 1YUBA 5E26A 2CHGA 3J27B 2CE7A 1GKIA 2Y0TA 2OPFA 4REZA 1MX0A 1OFHA 5ITTA 4LJ6A 1G41A 3HJQA 3U61B 2V1CA 3PNVA 1NNJA 3L25A 4DV7M 1PJTA 2UUCM 3W0FA 2C98A 1T6OA 3GRUA 2QHOB 3FRIA 1G8PA 4X66M 5FSWA 3J80S 3B89A 3QAUA 4AKIA 3E4RA 4MGZE 3U6CA 3B7ZA 4WW0A 4GC9A 4LY6A 1GJSA 2R65A 2EUCA 4IIWA 4X65M 1NY6A 2DWMA 3FYDA 4RF1A 2QENA 3H4MA 5FTNA 5FTKA 4LJ5A 2DHYA 5BPVA 3QYEA 4PD2A 2QSFX 2J7NA 1GL6A 4LJ4A 2H5XA 7CATA 1G59A 2L4FA 8CATA 3U6EA 1N32M 1DO2A 1DGHB 3I01M 2BWBA 3Q8XA 2NQ8C 4DV1M 4HL4A 3CF6E
chains in the Genus database with same CATH topology
3CF2A 2DZNB 4LJ7A 3JR5A 3TWKA 4KHPM 4B7FA 3M6AA 3SYKA 4KO8A 4MGYE 3RGPA 3A42A 3GPPA 3SASA 1IN7A 4LFBM 4DR7M 1Z5CA 1L8QA 1SXJD 4X62M 5E6JA 1XMQM 1DGGA 2W82A 2XZFA 4LF9M 4DR6M 4IBJA 2FOIC 1IBMM 3DOAA 1J7KA 3IG8A 4IBDA 4GC5A 4B3MM 3GRYA 3KXEC 4S12A 2C96A 3SYLA 3ZC7B 4AG5A 3A45A 2HL7A 3RGSA 4LZZA 5DYGA 4JI5M 1Q3CA 4PDIA 2D7GA 4B7GA 3HWSA 1IBLM 4GIPA 4WURA 4FVMA 4LFAM 1QYRA 1E9RA 1R7RA 1IY2A 1H6UA 2QPAA 3M7GA 3SBJA 3FUUA 2G5GX 5EP1A 2R46A 2I7NA 1K3XA 3VK7A 1GL7A 4OX9M 1N36M 1QZMA 1XWIA 3C58A 5LMUM 2C9OA 3LMMA 1DGBA 3LVWA 3TWLA 2Z3XA 3KSXA 1I94M 1IXRC 5EQTA 2R45A 5FTLA 4QOZC 3U6QA 5FLXS 4JV5M 4DUYM 4QNRA 3FUTA 4B08A 1K3WA 3UK6A 3TE6A 1EE8A 4AW4A 2KZUA 4PCZA 4CHTB 5ITQA 4M9ZA 1TGUA 1IY1A 2RGOA 4BB9A 3UJNA 2C99A 1FJGM 1W5TA 2M5ZA 4L4UA 4YHHM 3SHFA 5FTJA 4JN6A 5EXSA 3MJ5A 3HJSA 4FW9A 2ZBKB 2Z4SA 1HT2E 3AOEA 3GLHB 4M0DA 1YE9A 4DV3M 1PJIA 2HKJA 4FCVA 2AHMA 4NSRA 4QHTA 4Z8XA 3GLGB 4AG6A 1N78A 2XFSA 3GQ5A 2D7HA 4KODA 4LF5M 5DNYA 3K1JA 4IBGA 3U61A 5JI2E 2CHQA 3AOGA 4LJ9A 5BR8M 4JI2M 4IBKA 4G4RA 2HHHM 4LCBA 3SAVA 1TH4A 3KP1E 5EP4A 1IM2A 3FTDA 1TDZA 4LF6M 1XNQM 1HNXM 3UGJA 2FNAA 4L8RC 3JR4A 1K82A 1W5SA 1N34M 3U6PA 4G4OA 1WXQA 4AKGA 1KSFX 4GITA 3U6SA 1NSFA 1IBKM 1D2NA 3I51A 2F5NA 4JYAM 5FTMA 3GLIB 1DGHA 4IJFA 1IN8A 3IG5A 1YSYA 2YQZA 3MHVC 5EXXA 1Z6TA 3FTCA 3GRVA 1JR3D 3SMPA 3VKGA 3AOEC 4D81A 5H37D 2F5PA 1ZQ9A 2YR0A 3RE8A 2R4EA 1GLNA 4I8OA 3DA1A 3T1HM 4LF4M 4OVZB 2L09A 2J7OA 2XEPA 3PVSA 4L16A 1J5EM 4PDGA 4FWGA 3TPZA 3KFUG 4AI6A 4DR5M 3PNYA 4W5WA 2CHVA 4NOOB 4JI6M 3NWLA 1E94E 4GHLA 3SC3A 1TH2A 3WHKA 1SXJB 4BLCA 5IWAM 2H1RA 2OQ4A 1NVMA 3KP0E 3SFZA 4B3TM 2DZOB 5KO3A 1NHWC 2RGHA 4LF7M 3TL4X 1N77A 2QCUA 4M9SA 2QP9X 4ZPXA 2I7PA 4KLNA 2DVWB 4IJEA 4M0WA 2LWXA 3ZH9B 2ZM6M 1XNRM 2X8AA 3HU1A 3D8LA 3L29A 5JI3E 4X64M 5F3WA 3T15A 4G6ZA 4DR1M 2LH0A 3DZDA 1Z5AA 1L1ZA 2CV1A 2UXDM 4IBIA 1E32A 1Q39A 1QQWA 2XH9A 4LG2A 1NJFA 3J81S 2L7HA 4II7A 1XXHB 1Z59A 1IXZA 1QVRA 1IN5A 1IY0A 3K92A 4XBOA 4K0KM 1NJGA 1HNZM 2CFOA 4DR4M 3KS4A 4LJAA 2E5LM 2KZSA 3HU3A 5ITXE 2XSZD 3SAUA 2L7IA 4JI3M 3FUVA 4RNAA 3GPYA 2KRUA 2CUZA 3GLHA 2JA2A 1L2DA 3LQRA 3VK8A 2KA6B 1QAMA 3SHGB 3AL0C 3KS8A 4G4QA 2VIIA 5ITUA 3GLGA 3ILKA 2QBYB 3HKPA 3U6OA 5ITXA 3GLFB 2VQFM 5IT9S 3PXGA 2EA0A 5EXPA 1TDHA 4NXNM 3U5ZA 2O5RA 2L6OA 3U6MA 3SATA 4P16A 2UUAM 2XF3A 2KW0A 2X49A 5ITYA 2UXBM 3HGIA 1XC8A 2DWLA 4A3VB 4LRSA 2CEAA 3L2AA 3HHWA 5A2QS 4NXMM 3KOZE 2M60A 3AKZA 4NSOB 1IQPA 3AJIB 3T38A 1HQYE 4DR2M 3WHLA 3U60B 2DHRA 3U5ZB 1IXSB 2DXIA 4LRTA 1HNWM 3J7AS 3KOXE 3HJ8A 4OU7A 3T1YM 3GLIA 3R9XB 3I4VA 2KXEA 2Y20A 2A5YB 1MU5A 3CTWB 4NRWA 4NL4H 1DGFA 3KOWE 4FWHA 4MGKE 4XGIA 4JI4M 1N75A 2G8LA 3FKEA 1XMOM 1KFVA 4PT5A 3KW6A 4B7HA 4LFCM 1C1KA 3CF0A 1HR0M 4HLQA 5IREB 4CISA 4MGHA 3KDSE 1OFIA 4LGMA 4LGYA 3GQ4A 2F5SA 2Z4RA 3GQ3A 3OTOM 4OVZA 4DV5M 3W0LB 1SXJE 2FFJA 3AV0A 1G4AE 3VDUA 5KPRA 4AZFA 1DO0A 2ZAMA 3LQQA 3QWLA 1LV7A 2K47A 5KPTA 2Y21A 4GMQA 2QZ4A 5EP3A 4DV6M 3SAWA 3E9SA 4R7GA 4L15A 5DYIA 1SXJA 3THGA 2V1UA 4JI7M 1NY5A 4GH9A 4D82A 1PJJA 3A46A 3DFZA 1ORYB 1Z5BA 2C9CA 2UUBM 4I4LA 2R62A 5GKNA 4IBFA 4I5SA 3VDPA 3LVVA 4GRIA 3HHXA 3GO8A 3VLFB 1L2BA 1QANA 4MB7A 1J09A 2X4AA 2BNKA 3HHYA 3GP1A 4Z6YA 4DUZM 1UM8A 2BJWA 2RKOA 4FD2A 4MH0E 1QAOA 3GPXA 2Y0QA 5EP2A 2C5RA 5C18A 3M0EA 4MGIE 2R4JA 4R3DA 4GKJM 3BOSA 1E9SA 3J7BA 4NRVA 3HU2A 1S3SA 2XFTA 4QNMA 1XXHA 2R18A 2HCBA 5IZ7D 4B3RM 1HT1E 1NNUC 5C1BA 4DR3M 5LMNM 3VFDA 3MK6A 3SARA 1SXJC 2XSZA 3K2LA 4FCWA 3L26A 4JI8M 2F5QA 2UXCM 4D80A 1I4WA 4LZJA 3PFIA 1GVNA 2F5OA 3FUWA 2QBYA 2V6ZM 3GLFA 2DWZB 1T3TA 3NBIA 3B9PA 3J2PB 4CGYB 3KOYE 3L28A 4DV0M 2XZUA 3FTEA 2CV0A 3FUXA 2XLJA 2LNHC 4FWDA 2YNMD 4AKHA 3RFWA 4DV2M 1G3IA 4L78A 1L1TA 2EO2A 1X37A 1ZAEA 1L2CA 3VKHA 3A98B 3KSJA 1R2YA 1KYIA 1PM5A 2KRKA 3ZCBB 4JI1M 2Z7JA 4OW0A 3FTFA 4LF8M 1IN4A 4G4NA 3U60A 4IBCA 2DWNA 3HHZA 4B3SM 4EIWA 1N33M 4BBAA 4M9XA 2UU9M 2FE8A 4ITQA 3U6LA 1HQCA 1FNNA 1Q3BA 4GHAA 3GRRA 4QOSA 1R2ZA 3AFHA 3UZUA 4AQYM 3U6DA 4IBEA 3R8FA 1IN6A 2BJVA 2LXEA 2XGNA 3JAMS 4YY3M 4GKKM 4MM3B 2P5TA 3SMSA 3D8BA 3L27A 1JQJC 2F4VM 3EIEA 2ERCA 2Q2EB 2ZANA 5KQDA 3K8ZA 4FCTA 1OJLA 5EJCA 3TQSA 4IBBA 1JR3A 4RF0A 2D7EA 3EIHA 3FYCA 2VQEM 4JI0M 5KQ8A 2ZAOA 4JXJA 4DV4M 1TH3A 4TUWA 4I81A 5KPZA 4LJ8A 3GPUA 1XHBA 3KVWA 2KEBA 4QHSA 2CV2A 1VDDA 3I4YA 1NHGC 5EXTA 3FD9A 1R6BX 5ITRA 3TWMA 2YFQA 3UMMA 1QAQA 1YUBA 5E26A 2CHGA 3J27B 2CE7A 1GKIA 2Y0TA 2OPFA 4REZA 1MX0A 1OFHA 5ITTA 4LJ6A 1G41A 3HJQA 3U61B 2V1CA 3PNVA 1NNJA 3L25A 4DV7M 2UUCM 3W0FA 2C98A 3GRUA 1G8PA 4X66M 5FSWA 3J80S 3QAUA 4AKIA 3E4RA 4MGZE 3U6CA 4WW0A 4GC9A 4LY6A 2R65A 2EUCA 4IIWA 4X65M 1NY6A 2DWMA 3FYDA 4RF1A 2QENA 3H4MA 5FTNA 5FTKA 4LJ5A 5BPVA 4PD2A 2J7NA 1GL6A 4LJ4A 7CATA 1G59A 8CATA 3U6EA 1N32M 1DO2A 1DGHB 3Q8XA 2NQ8C 4DV1M 4HL4A 3CF6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITY A;  2F5N A;  1XC8 A;  2UXB M;  4JYA M;  3JR5 A;  3TWK A;  4DV0 M;  2XZU A;  5A2Q S;  4NXM M;  4KHP M;  3A42 A;  3GPP A;  3SAS A;  4LFB M;  4DR7 M;  1Z5C A;  4DR2 M;  4X62 M;  4DV2 M;  1XMQ M;  1L1T A;  2XZF A;  4LF9 M;  4DR6 M;  1HNW M;  1IBM M;  3J7A S;  3DOA A;  3T1Y M;  1L2C A;  1R2Y A;  1PM5 A;  1MU5 A;  4B3M M;  4JI1 M;  4NRW A;  2F5P A;  4JI4 M;  4LF8 M;  1XMO M;  4G4N A;  3A45 A;  4LF4 M;  1KFV A;  4JI5 M;  1Q3C A;  4PDI A;  4LFC M;  1HR0 M;  1IBL M;  4B3S M;  1J5E M;  4CIS A;  4PDG A;  1N33 M;  4LFA M;  4DR5 M;  2UU9 M;  4ITQ A;  3U6L A;  3GQ4 A;  2F5S A;  3SBJ A;  4JI6 M;  1Q3B A;  3GQ3 A;  3OTO M;  1R2Z A;  4DV5 M;  1K3X A;  3VK7 A;  4AQY M;  3U6D A;  1N36 M;  3JAM S;  4GKK M;  4YY3 M;  5IWA M;  3C58 A;  5LMU M;  2OQ4 A;  4B3T M;  3TWL A;  4OX9 M;  2F4V M;  4DV6 M;  3SAW A;  4LF7 M;  2Q2E B;  1I94 M;  4JI7 M;  3U6Q A;  5FLX S;  1PJJ A;  2VQE M;  3A46 A;  4JI0 M;  4JV5 M;  4DUY M;  1Z5B A;  2ZM6 M;  1XNR M;  2UUB M;  4DV4 M;  3GPU A;  1K3W A;  1EE8 A;  4X64 M;  4PCZ A;  5ITQ A;  3GO8 A;  1L2B A;  4MB7 A;  4DR1 M;  5ITR A;  3GP1 A;  3TWM A;  4DUZ M;  1Z5A A;  1L1Z A;  2UXD M;  1FJG M;  1Q39 A;  4YHH M;  2OPF A;  5ITT A;  1MX0 A;  3J81 S;  3GPX A;  1Z59 A;  2ZBK B;  1NNJ A;  4DV3 M;  4DV7 M;  4K0K M;  1PJI A;  2UUC M;  3W0F A;  2HKJ A;  1HNZ M;  4DR4 M;  4GKJ M;  4X66 M;  2E5L M;  5ITX E;  4NRV A;  3GQ5 A;  3SAU A;  4JI3 M;  4LF5 M;  3J80 S;  3U6C A;  3GPY A;  1L2D A;  3VK8 A;  4B3R M;  5BR8 M;  4JI2 M;  4G4R A;  4DR3 M;  2HHH M;  4G4Q A;  5ITU A;  4X65 M;  5LMN M;  3SAV A;  3U6O A;  3SAR A;  5ITX A;  1TDZ A;  2UXC M;  4JI8 M;  4LF6 M;  2UUA M;  2F5Q A;  1HNX M;  1XNQ M;  4PD2 A;  2VQF M;  5IT9 S;  3JR4 A;  2EA0 A;  1K82 A;  1N34 M;  3U6P A;  1TDH A;  4NXN M;  4G4O A;  2F5O A;  1N32 M;  3U6E A;  3U6M A;  3SAT A;  3U6S A;  4DV1 M;  1IBK M;  3T1H M; 
#chains in the Genus database with same CATH topology
 3CF2 A;  2DZN B;  4LJ7 A;  3JR5 A;  3TWK A;  4KHP M;  4B7F A;  3M6A A;  2QQ8 A;  3SYK A;  4KO8 A;  1QDT A;  2LTU A;  4MGY E;  1OTR A;  2DEN A;  2RRU A;  3A42 A;  3B7Q A;  3RGP A;  3GPP A;  1QZE A;  1IN7 A;  3SAS A;  4DR7 M;  4LFB M;  1Z5C A;  1DV0 A;  1L8Q A;  1SXJ D;  4X62 M;  5E6J A;  2ZTD A;  4Q7J A;  1XMQ M;  1DGG A;  2W82 A;  2XZF A;  4LF9 M;  4DR6 M;  4IBJ A;  2FOI C;  1IBM M;  3DOA A;  1J7K A;  2MJ5 B;  3IG8 A;  4IBD A;  4GC5 A;  1AUA A;  1ZV1 A;  4B3M M;  1OQY A;  3GRY A;  3KXE C;  4S12 A;  2C96 A;  3SYL A;  3ZC7 B;  4AG5 A;  3A45 A;  2HL7 A;  3RGS A;  4LZZ A;  5DYG A;  4JI5 M;  1Q3C A;  1SG9 A;  4PDI A;  2D7G A;  4B7G A;  1AIP C;  3HWS A;  2JNH A;  4GIP A;  4WUR A;  1IBL M;  4FVM A;  4LFA M;  1QYR A;  1E9R A;  1R7R A;  1IY2 A;  1H6U A;  2QPA A;  3M7G A;  3SBJ A;  3FUU A;  2G5G X;  2DKL A;  2R46 A;  1A5T A;  2I7N A;  5EP1 A;  1K3X A;  3VK7 A;  1V33 A;  2LVQ D;  1GL7 A;  3T6P A;  4OX9 M;  1N36 M;  1QZM A;  1XWI A;  3C58 A;  2APL A;  5LMU M;  2C9O A;  3LMM A;  1DGB A;  3LVW A;  3TWL A;  1NV8 A;  2Z3X A;  2DAM A;  3KSX A;  1I94 M;  2KNZ A;  1IXR C;  5EQT A;  2R45 A;  5FTL A;  2LVN C;  4QOZ C;  1VEK A;  2JY7 A;  2LVO C;  3U6Q A;  5FLX S;  4JV5 M;  1PGY A;  4L6V 6;  4DUY M;  1EIJ A;  4QNR A;  2JY8 A;  2FS1 A;  2OOB A;  3FUT A;  4B08 A;  1K3W A;  3UK6 A;  3TE6 A;  1EE8 A;  4AW4 A;  2KZU A;  4PCZ A;  3IEC A;  1GO5 A;  4CHT B;  5ITQ A;  2N35 A;  1WGN A;  1VDL A;  1TGU A;  4M9Z A;  1IY1 A;  3E46 A;  3Q8G A;  1WJ7 A;  2RGO A;  4BB9 A;  3UJN A;  3B7N A;  2C99 A;  3H4J A;  1FJG M;  1VG5 A;  1W5T A;  2M5Z A;  3FE3 A;  4L4U A;  4YHH M;  1QDR A;  3SHF A;  5FTJ A;  1ZMU A;  5L8R F;  1Q02 A;  4JN6 A;  3MJ5 A;  5EXS A;  3HJS A;  4FW9 A;  2R44 A;  2ZBK B;  2Z4S A;  1HT2 E;  2CRU A;  1BVS A;  2VF8 A;  1YE9 A;  3AOE A;  1QUS A;  3GLH B;  4M0D A;  4DV3 M;  1PJI A;  2HKJ A;  4FCV A;  2AHM A;  2DNA A;  4NSR A;  4QHT A;  1VEJ A;  4Z8X A;  4AG6 A;  3GLG B;  2XFS A;  3GQ5 A;  2D7H A;  4KOD A;  4LF5 M;  5DNY A;  3K1J A;  4IBG A;  3U61 A;  5JI2 E;  2CHQ A;  2WSC F;  3AOG A;  4LJ9 A;  5BR8 M;  2O25 A;  4JI2 M;  4IBK A;  4G4R A;  2HHH M;  2OOA A;  4R71 A;  4LCB A;  3SAV A;  1TH4 A;  3KP1 E;  5EP4 A;  1IM2 A;  3FTD A;  4CIZ A;  1TDZ A;  4LF6 M;  1XNQ M;  1HNX M;  3UGJ A;  2FNA A;  2EKF A;  4L8R C;  3JR4 A;  5DFL A;  1K82 A;  1W5S A;  2KNV A;  3U6P A;  1N34 M;  4G4O A;  1WXQ A;  1G71 A;  4AKG A;  1KSF X;  4GIT A;  1MJG M;  1Y8G A;  3U6S A;  1NSF A;  1IBK M;  1D2N A;  1V92 A;  3I51 A;  2F5N A;  3W68 A;  2OO9 A;  1R4G A;  4JYA M;  5FTM A;  2JWS A;  3GLI B;  1DGH A;  2CP8 A;  4IJF A;  1IN8 A;  3IG5 A;  1YSY A;  2YQZ A;  3MHV C;  3NBX X;  1Z6T A;  3FTC A;  5EXX A;  3GRV A;  1T43 A;  2CWB A;  3E21 A;  1JR3 D;  3SMP A;  3VKG A;  2JZ1 A;  2R0I A;  3HZJ A;  3AOE C;  4D81 A;  5H37 D;  2JZ0 A;  2F5P A;  2K6B A;  2ZTC A;  1VQ1 A;  1ZQ9 A;  2YR0 A;  3RE8 A;  2R4E A;  1GLN A;  4I8O A;  3DA1 A;  4NC6 A;  3T1H M;  4LF4 M;  4OVZ B;  2L09 A;  1WIV A;  2J7O A;  2XEP A;  3PVS A;  4L16 A;  4P17 A;  1J5E M;  4PDG A;  4FWG A;  3TPZ A;  3KFU G;  4AI6 A;  1TF0 B;  4DR5 M;  2LBC A;  3PNY A;  4W5W A;  1PJQ A;  2CHV A;  4NOO B;  1PRB A;  4JI6 M;  3NWL A;  1E94 E;  4GHL A;  3SC3 A;  1TH2 A;  3WHK A;  1SXJ B;  4BLC A;  5IWA M;  1P3Q Q;  2H1R A;  2OQ4 A;  1NVM A;  3KP0 E;  3SFZ A;  4B3T M;  2DZO B;  5KO3 A;  1NHW C;  4GEW A;  2RGH A;  3F92 A;  4LF7 M;  3TL4 X;  3HY5 A;  3V76 A;  1N77 A;  2QCU A;  2KDL A;  4M9S A;  2QP9 X;  4ZPX A;  2Z8Y M;  2I7P A;  4KLN A;  1D0M A;  2DVW B;  4IJE A;  4M0W A;  1GJT A;  2LWX A;  3ZH9 B;  2ZM6 M;  2X8A A;  3HU1 A;  1XNR M;  3D8L A;  3L29 A;  5JI3 E;  4X64 M;  5F3W A;  3T15 A;  3K9P A;  1VEG A;  4G6Z A;  4DR1 M;  2JXN A;  2LH0 A;  2JY5 A;  2DAK A;  3DZD A;  1Z5A A;  1L1Z A;  2CV1 A;  2UXD M;  4IBI A;  4WP2 A;  1E32 A;  1Q39 A;  1QQW A;  2XH9 A;  4LG2 A;  3FRH A;  1NJF A;  3J81 S;  2HWJ A;  1CUK A;  2L7H A;  4II7 A;  3CGW A;  1XXH B;  1Z59 A;  1IXZ A;  3GLH E;  1QVR A;  1IN5 A;  1IY0 A;  3K92 A;  4XBO A;  4K0K M;  1F4I A;  1NJG A;  1WGL A;  2CFO A;  3GLG E;  1HNZ M;  3KS4 A;  4RKU F;  4G3O A;  4DR4 M;  3K9O A;  4LJA A;  2KZS A;  3HU3 A;  5ITX E;  2E5L M;  2XSZ D;  3SAU A;  2L7I A;  4JI3 M;  3FUV A;  2JUJ A;  4RNA A;  2LVA A;  3GPY A;  2KRU A;  2CUZ A;  3GLH A;  2JA2 A;  1L2D A;  3LQR A;  2VDB B;  3VK8 A;  2KA6 B;  2L2D A;  1QAM A;  4HEO A;  3SHG B;  3AL0 C;  3KS8 A;  4G4Q A;  2VII A;  5ITU A;  3GLG A;  3ILK A;  2QBY B;  3HKP A;  3U6O A;  2O01 F;  5ITX A;  3GLF B;  2VQF M;  5IT9 S;  3PXG A;  2EA0 A;  5EXP A;  1TDH A;  4NXN M;  2DI0 A;  3U5Z A;  1IXS A;  2O5R A;  2L6O A;  3U6M A;  3SAT A;  4P16 A;  2UUA M;  2XF3 A;  2KW0 A;  2X49 A;  5ITY A;  2UXB M;  3HGI A;  1XC8 A;  2DWL A;  4A3V B;  4LRS A;  2CEA A;  3L2A A;  3HHW A;  5A2Q S;  2DAG A;  2K0B X;  3GLI E;  4NXM M;  3KOZ E;  2M60 A;  3AKZ A;  2G3Q A;  1RU3 A;  4NSO B;  1IQP A;  3AJI B;  1TR8 A;  3T38 A;  2KNA A;  1HQY E;  4DR2 M;  3WHL A;  3U60 B;  2DHR A;  2GNO A;  1IXS B;  1HJP A;  4LRT A;  3U5Z B;  2DXI A;  1EFU B;  1HNW M;  3J7A S;  3KOX E;  2QNJ A;  3HJ8 A;  4OU7 A;  3T1Y M;  3GLI A;  3R9X B;  3I4V A;  2KXE A;  1MN3 A;  2Y20 A;  2A5Y B;  1MU5 A;  3CTW B;  4NRW A;  4NL4 H;  1DGF A;  3KOW E;  4FWH A;  4MGK E;  4XGI A;  4JI4 M;  1N75 A;  2G8L A;  3FKE A;  1XMO M;  1KFV A;  4PT5 A;  3KW6 A;  4B7H A;  4LFC M;  1C1K A;  1OIP A;  2MRO B;  2EJS A;  3CF0 A;  1HR0 M;  3B74 A;  4HLQ A;  5IRE B;  4CIS A;  4MGH A;  3KDS E;  4Y28 F;  1OFI A;  4LGM A;  4LGY A;  1C7Y A;  3GQ4 A;  2F5S A;  2Z4R A;  3GQ3 A;  3OTO M;  1R5L A;  4OVZ A;  4DV5 M;  3W0L B;  1SXJ E;  2FFJ A;  3AV0 A;  1G4A E;  3VDU A;  3W67 A;  5KPR A;  4AZF A;  1DO0 A;  1OIZ A;  4UN2 B;  2ZAM A;  3LQQ A;  3QWL A;  1LV7 A;  2K47 A;  5KPT A;  2Y21 A;  4GMQ A;  2QZ4 A;  5EP3 A;  4DV6 M;  3SAW A;  3MMP A;  1D0K A;  3E9S A;  4R7G A;  4L15 A;  5DYI A;  1SXJ A;  3THG A;  2FH0 A;  1NO1 A;  2V1U A;  4JI7 M;  1NY5 A;  4GH9 A;  4F2L A;  4D82 A;  1PJJ A;  1TTE A;  3A46 A;  3DFZ A;  1ORY B;  1Z5B A;  2C9C A;  2UUB M;  4I4L A;  2R62 A;  5GKN A;  4IBF A;  4I5S A;  3VDP A;  2MR9 A;  2VF7 A;  3LVV A;  3HHX A;  4GRI A;  4CJ6 A;  3GO8 A;  3VLF B;  1L2B A;  1QAN A;  4MB7 A;  1J09 A;  2X4A A;  2BNK A;  3HHY A;  3GP1 A;  4Z6Y A;  4DUZ M;  1UM8 A;  2BJW A;  2KHH A;  2RKO A;  4FD2 A;  4MH0 E;  1QAO A;  1XXH E;  3GPX A;  2Y0Q A;  5EP2 A;  1ZMW A;  2C5R A;  5C18 A;  2MGW A;  3M0E A;  2GQF A;  4F1I A;  4MGI E;  2R4J A;  3IHP A;  4R3D A;  2HAK A;  4GKJ M;  3BOS A;  1E9S A;  3C9P A;  3HX3 A;  3J7B A;  1NV9 A;  3HU2 A;  1S3S A;  4NRV A;  1WR1 B;  2WSF F;  2XFT A;  1YLA A;  4QNM A;  1XXH A;  1OKS A;  2R18 A;  2HCB A;  5IZ7 D;  4B3R M;  1HT1 E;  1NNU C;  5C1B A;  4DR3 M;  4ANR A;  5LMN M;  3VFD A;  3QYB A;  3MK6 A;  3GLF E;  3SAR A;  1WHC A;  1SXJ C;  2XSZ A;  3K2L A;  4FCW A;  3L26 A;  4JI8 M;  2MH8 A;  2F5Q A;  2UXC M;  2R6F A;  1QUT A;  4D80 A;  1I4W A;  4LZJ A;  3PFI A;  1GVN A;  2F5O A;  3FUW A;  1JB0 F;  2QBY A;  2V6Z M;  1OAO C;  2JP7 A;  3GLF A;  2K9D A;  1V34 A;  1XB2 B;  2DWZ B;  1T3T A;  3NBI A;  3B9P A;  3J2P B;  4CGY B;  3KOY E;  3L28 A;  4DV0 M;  2XZU A;  1OAI A;  2CV0 A;  3FTE A;  3FUX A;  2XLJ A;  2LNH C;  4FWD A;  2YNM D;  4AKH A;  3RFW A;  4DV2 M;  1G3I A;  4L78 A;  1L1T A;  2EO2 A;  1IFY A;  1X37 A;  3I04 M;  2WSE F;  3BBZ A;  1ZAE A;  1L2C A;  3VKH A;  3A98 B;  3KSJ A;  3LCU A;  1KYI A;  3LCV B;  2KRK A;  1LTM A;  1PM5 A;  3ZCB B;  2JY6 B;  1UFZ A;  1R2Y A;  4JI1 M;  2Z7J A;  4OW0 A;  3FTF A;  4DBG B;  2L4E A;  1IN4 A;  4LF8 M;  3C3D A;  4G4N A;  3U60 A;  4IBC A;  3C3E A;  2DAE A;  1ZMV A;  2DWN A;  3HHZ A;  2DAI A;  4B3S M;  4EIW A;  1N33 M;  1PJS A;  4BBA A;  4M9X A;  2LHC A;  2UU9 M;  2FE8 A;  2J5Y A;  4ITQ A;  3U6L A;  2LVP C;  1HQC A;  1FNN A;  1Q3B A;  4GHA A;  3GRR A;  4QOS A;  1R2Z A;  3AFH A;  4KT0 F;  2WZJ A;  3UZU A;  3ZQJ A;  4AQY M;  3U6D A;  4IBE A;  1JR3 E;  3R8F A;  1GAB A;  1IN6 A;  2BJV A;  2LXE A;  2XGN A;  3JAM S;  4YY3 M;  4GKK M;  2B3T A;  4MM3 B;  2P5T A;  3SMS A;  3D8B A;  2BWE A;  1JQJ C;  3L27 A;  2F4V M;  3EIE A;  2DZL A;  2ERC A;  2Q2E B;  2ZAN A;  5KQD A;  3K8Z A;  4FCT A;  1OJL A;  5EJC A;  3TQS A;  4IBB A;  1JR3 A;  4RF0 A;  2D7E A;  3EIH A;  2LHG A;  3FYC A;  2VQE M;  4JI0 M;  5KQ8 A;  2ZAO A;  4JXJ A;  4DV4 M;  1TH3 A;  4TUW A;  4I81 A;  5KPZ A;  4LJ8 A;  3GPU A;  1XHB A;  3KVW A;  2KEB A;  4QHS A;  2EKK A;  1N78 A;  2CV2 A;  4XK8 F;  1VDD A;  3I4Y A;  1NHG C;  3BXW A;  5EXT A;  3FD9 A;  1R6B X;  5ITR A;  3TWM A;  2YFQ A;  3LW5 F;  1D0L A;  3UMM A;  1QAQ A;  1YUB A;  5E26 A;  2CHG A;  3J27 B;  2CE7 A;  1GKI A;  2Y0T A;  2OPF A;  4REZ A;  1MX0 A;  1OFH A;  5ITT A;  4LJ6 A;  1G41 A;  3HJQ A;  3U61 B;  2V1C A;  3PNV A;  1NNJ A;  3L25 A;  4DV7 M;  1PJT A;  2UUC M;  3W0F A;  2C98 A;  1T6O A;  3GRU A;  2QHO B;  3FRI A;  1G8P A;  4X66 M;  5FSW A;  3J80 S;  3B89 A;  3QAU A;  4AKI A;  3E4R A;  4MGZ E;  3U6C A;  3B7Z A;  4WW0 A;  4GC9 A;  4LY6 A;  1GJS A;  2R65 A;  2EUC A;  4IIW A;  4X65 M;  1NY6 A;  2DWM A;  3FYD A;  4RF1 A;  2QEN A;  3H4M A;  5FTN A;  5FTK A;  4LJ5 A;  2DHY A;  5BPV A;  3QYE A;  4PD2 A;  2QSF X;  2J7N A;  1GL6 A;  4LJ4 A;  2H5X A;  7CAT A;  1G59 A;  2L4F A;  8CAT A;  3U6E A;  1N32 M;  1DO2 A;  1DGH B;  3I01 M;  2BWB A;  3Q8X A;  2NQ8 C;  4DV1 M;  4HL4 A;  3CF6 E; 
#chains in the Genus database with same CATH homology
 3CF2 A;  2DZN B;  4LJ7 A;  3JR5 A;  3TWK A;  4KHP M;  4B7F A;  3M6A A;  3SYK A;  4KO8 A;  4MGY E;  3RGP A;  3A42 A;  3GPP A;  3SAS A;  1IN7 A;  4LFB M;  4DR7 M;  1Z5C A;  1L8Q A;  1SXJ D;  4X62 M;  5E6J A;  1XMQ M;  1DGG A;  2W82 A;  2XZF A;  4LF9 M;  4DR6 M;  4IBJ A;  2FOI C;  1IBM M;  3DOA A;  1J7K A;  3IG8 A;  4IBD A;  4GC5 A;  4B3M M;  3GRY A;  3KXE C;  4S12 A;  2C96 A;  3SYL A;  3ZC7 B;  4AG5 A;  3A45 A;  2HL7 A;  3RGS A;  4LZZ A;  5DYG A;  4JI5 M;  1Q3C A;  4PDI A;  2D7G A;  4B7G A;  3HWS A;  1IBL M;  4GIP A;  4WUR A;  4FVM A;  4LFA M;  1QYR A;  1E9R A;  1R7R A;  1IY2 A;  1H6U A;  2QPA A;  3M7G A;  3SBJ A;  3FUU A;  2G5G X;  5EP1 A;  2R46 A;  2I7N A;  1K3X A;  3VK7 A;  1GL7 A;  4OX9 M;  1N36 M;  1QZM A;  1XWI A;  3C58 A;  5LMU M;  2C9O A;  3LMM A;  1DGB A;  3LVW A;  3TWL A;  2Z3X A;  3KSX A;  1I94 M;  1IXR C;  5EQT A;  2R45 A;  5FTL A;  4QOZ C;  3U6Q A;  5FLX S;  4JV5 M;  4DUY M;  4QNR A;  3FUT A;  4B08 A;  1K3W A;  3UK6 A;  3TE6 A;  1EE8 A;  4AW4 A;  2KZU A;  4PCZ A;  4CHT B;  5ITQ A;  4M9Z A;  1TGU A;  1IY1 A;  2RGO A;  4BB9 A;  3UJN A;  2C99 A;  1FJG M;  1W5T A;  2M5Z A;  4L4U A;  4YHH M;  3SHF A;  5FTJ A;  4JN6 A;  5EXS A;  3MJ5 A;  3HJS A;  4FW9 A;  2ZBK B;  2Z4S A;  1HT2 E;  3AOE A;  3GLH B;  4M0D A;  1YE9 A;  4DV3 M;  1PJI A;  2HKJ A;  4FCV A;  2AHM A;  4NSR A;  4QHT A;  4Z8X A;  3GLG B;  4AG6 A;  1N78 A;  2XFS A;  3GQ5 A;  2D7H A;  4KOD A;  4LF5 M;  5DNY A;  3K1J A;  4IBG A;  3U61 A;  5JI2 E;  2CHQ A;  3AOG A;  4LJ9 A;  5BR8 M;  4JI2 M;  4IBK A;  4G4R A;  2HHH M;  4LCB A;  3SAV A;  1TH4 A;  3KP1 E;  5EP4 A;  1IM2 A;  3FTD A;  1TDZ A;  4LF6 M;  1XNQ M;  1HNX M;  3UGJ A;  2FNA A;  4L8R C;  3JR4 A;  1K82 A;  1W5S A;  1N34 M;  3U6P A;  4G4O A;  1WXQ A;  4AKG A;  1KSF X;  4GIT A;  3U6S A;  1NSF A;  1IBK M;  1D2N A;  3I51 A;  2F5N A;  4JYA M;  5FTM A;  3GLI B;  1DGH A;  4IJF A;  1IN8 A;  3IG5 A;  1YSY A;  2YQZ A;  3MHV C;  5EXX A;  1Z6T A;  3FTC A;  3GRV A;  1JR3 D;  3SMP A;  3VKG A;  3AOE C;  4D81 A;  5H37 D;  2F5P A;  1ZQ9 A;  2YR0 A;  3RE8 A;  2R4E A;  1GLN A;  4I8O A;  3DA1 A;  3T1H M;  4LF4 M;  4OVZ B;  2L09 A;  2J7O A;  2XEP A;  3PVS A;  4L16 A;  1J5E M;  4PDG A;  4FWG A;  3TPZ A;  3KFU G;  4AI6 A;  4DR5 M;  3PNY A;  4W5W A;  2CHV A;  4NOO B;  4JI6 M;  3NWL A;  1E94 E;  4GHL A;  3SC3 A;  1TH2 A;  3WHK A;  1SXJ B;  4BLC A;  5IWA M;  2H1R A;  2OQ4 A;  1NVM A;  3KP0 E;  3SFZ A;  4B3T M;  2DZO B;  5KO3 A;  1NHW C;  2RGH A;  4LF7 M;  3TL4 X;  1N77 A;  2QCU A;  4M9S A;  2QP9 X;  4ZPX A;  2I7P A;  4KLN A;  2DVW B;  4IJE A;  4M0W A;  2LWX A;  3ZH9 B;  2ZM6 M;  1XNR M;  2X8A A;  3HU1 A;  3D8L A;  3L29 A;  5JI3 E;  4X64 M;  5F3W A;  3T15 A;  4G6Z A;  4DR1 M;  2LH0 A;  3DZD A;  1Z5A A;  1L1Z A;  2CV1 A;  2UXD M;  4IBI A;  1E32 A;  1Q39 A;  1QQW A;  2XH9 A;  4LG2 A;  1NJF A;  3J81 S;  2L7H A;  4II7 A;  1XXH B;  1Z59 A;  1IXZ A;  1QVR A;  1IN5 A;  1IY0 A;  3K92 A;  4XBO A;  4K0K M;  1NJG A;  1HNZ M;  2CFO A;  4DR4 M;  3KS4 A;  4LJA A;  2E5L M;  2KZS A;  3HU3 A;  5ITX E;  2XSZ D;  3SAU A;  2L7I A;  4JI3 M;  3FUV A;  4RNA A;  3GPY A;  2KRU A;  2CUZ A;  3GLH A;  2JA2 A;  1L2D A;  3LQR A;  3VK8 A;  2KA6 B;  1QAM A;  3SHG B;  3AL0 C;  3KS8 A;  4G4Q A;  2VII A;  5ITU A;  3GLG A;  3ILK A;  2QBY B;  3HKP A;  3U6O A;  5ITX A;  3GLF B;  2VQF M;  5IT9 S;  3PXG A;  2EA0 A;  5EXP A;  1TDH A;  4NXN M;  3U5Z A;  2O5R A;  2L6O A;  3U6M A;  3SAT A;  4P16 A;  2UUA M;  2XF3 A;  2KW0 A;  2X49 A;  5ITY A;  2UXB M;  3HGI A;  1XC8 A;  2DWL A;  4A3V B;  4LRS A;  2CEA A;  3L2A A;  3HHW A;  5A2Q S;  4NXM M;  3KOZ E;  2M60 A;  3AKZ A;  4NSO B;  1IQP A;  3AJI B;  3T38 A;  1HQY E;  4DR2 M;  3WHL A;  3U60 B;  2DHR A;  3U5Z B;  1IXS B;  2DXI A;  4LRT A;  1HNW M;  3J7A S;  3KOX E;  3HJ8 A;  4OU7 A;  3T1Y M;  3GLI A;  3R9X B;  3I4V A;  2KXE A;  2Y20 A;  2A5Y B;  1MU5 A;  3CTW B;  4NRW A;  4NL4 H;  1DGF A;  3KOW E;  4FWH A;  4MGK E;  4XGI A;  4JI4 M;  1N75 A;  2G8L A;  3FKE A;  1XMO M;  1KFV A;  4PT5 A;  3KW6 A;  4B7H A;  4LFC M;  1C1K A;  3CF0 A;  1HR0 M;  4HLQ A;  5IRE B;  4CIS A;  4MGH A;  3KDS E;  1OFI A;  4LGM A;  4LGY A;  3GQ4 A;  2F5S A;  2Z4R A;  3GQ3 A;  3OTO M;  4OVZ A;  4DV5 M;  3W0L B;  1SXJ E;  2FFJ A;  3AV0 A;  1G4A E;  3VDU A;  5KPR A;  4AZF A;  1DO0 A;  2ZAM A;  3LQQ A;  3QWL A;  1LV7 A;  2K47 A;  5KPT A;  2Y21 A;  4GMQ A;  2QZ4 A;  5EP3 A;  4DV6 M;  3SAW A;  3E9S A;  4R7G A;  4L15 A;  5DYI A;  1SXJ A;  3THG A;  2V1U A;  4JI7 M;  1NY5 A;  4GH9 A;  4D82 A;  1PJJ A;  3A46 A;  3DFZ A;  1ORY B;  1Z5B A;  2C9C A;  2UUB M;  4I4L A;  2R62 A;  5GKN A;  4IBF A;  4I5S A;  3VDP A;  3LVV A;  4GRI A;  3HHX A;  3GO8 A;  3VLF B;  1L2B A;  1QAN A;  4MB7 A;  1J09 A;  2X4A A;  2BNK A;  3HHY A;  3GP1 A;  4Z6Y A;  4DUZ M;  1UM8 A;  2BJW A;  2RKO A;  4FD2 A;  4MH0 E;  1QAO A;  3GPX A;  2Y0Q A;  5EP2 A;  2C5R A;  5C18 A;  3M0E A;  4MGI E;  2R4J A;  4R3D A;  4GKJ M;  3BOS A;  1E9S A;  3J7B A;  4NRV A;  3HU2 A;  1S3S A;  2XFT A;  4QNM A;  1XXH A;  2R18 A;  2HCB A;  5IZ7 D;  4B3R M;  1HT1 E;  1NNU C;  5C1B A;  4DR3 M;  5LMN M;  3VFD A;  3MK6 A;  3SAR A;  1SXJ C;  2XSZ A;  3K2L A;  4FCW A;  3L26 A;  4JI8 M;  2F5Q A;  2UXC M;  4D80 A;  1I4W A;  4LZJ A;  3PFI A;  1GVN A;  2F5O A;  3FUW A;  2QBY A;  2V6Z M;  3GLF A;  2DWZ B;  1T3T A;  3NBI A;  3B9P A;  3J2P B;  4CGY B;  3KOY E;  3L28 A;  4DV0 M;  2XZU A;  3FTE A;  2CV0 A;  3FUX A;  2XLJ A;  2LNH C;  4FWD A;  2YNM D;  4AKH A;  3RFW A;  4DV2 M;  1G3I A;  4L78 A;  1L1T A;  2EO2 A;  1X37 A;  1ZAE A;  1L2C A;  3VKH A;  3A98 B;  3KSJ A;  1R2Y A;  1KYI A;  1PM5 A;  2KRK A;  3ZCB B;  4JI1 M;  2Z7J A;  4OW0 A;  3FTF A;  4LF8 M;  1IN4 A;  4G4N A;  3U60 A;  4IBC A;  2DWN A;  3HHZ A;  4B3S M;  4EIW A;  1N33 M;  4BBA A;  4M9X A;  2UU9 M;  2FE8 A;  4ITQ A;  3U6L A;  1HQC A;  1FNN A;  1Q3B A;  4GHA A;  3GRR A;  4QOS A;  1R2Z A;  3AFH A;  3UZU A;  4AQY M;  3U6D A;  4IBE A;  3R8F A;  1IN6 A;  2BJV A;  2LXE A;  2XGN A;  3JAM S;  4YY3 M;  4GKK M;  4MM3 B;  2P5T A;  3SMS A;  3D8B A;  3L27 A;  1JQJ C;  2F4V M;  3EIE A;  2ERC A;  2Q2E B;  2ZAN A;  5KQD A;  3K8Z A;  4FCT A;  1OJL A;  5EJC A;  3TQS A;  4IBB A;  1JR3 A;  4RF0 A;  2D7E A;  3EIH A;  3FYC A;  2VQE M;  4JI0 M;  5KQ8 A;  2ZAO A;  4JXJ A;  4DV4 M;  1TH3 A;  4TUW A;  4I81 A;  5KPZ A;  4LJ8 A;  3GPU A;  1XHB A;  3KVW A;  2KEB A;  4QHS A;  2CV2 A;  1VDD A;  3I4Y A;  1NHG C;  5EXT A;  3FD9 A;  1R6B X;  5ITR A;  3TWM A;  2YFQ A;  3UMM A;  1QAQ A;  1YUB A;  5E26 A;  2CHG A;  3J27 B;  2CE7 A;  1GKI A;  2Y0T A;  2OPF A;  4REZ A;  1MX0 A;  1OFH A;  5ITT A;  4LJ6 A;  1G41 A;  3HJQ A;  3U61 B;  2V1C A;  3PNV A;  1NNJ A;  3L25 A;  4DV7 M;  2UUC M;  3W0F A;  2C98 A;  3GRU A;  1G8P A;  4X66 M;  5FSW A;  3J80 S;  3QAU A;  4AKI A;  3E4R A;  4MGZ E;  3U6C A;  4WW0 A;  4GC9 A;  4LY6 A;  2R65 A;  2EUC A;  4IIW A;  4X65 M;  1NY6 A;  2DWM A;  3FYD A;  4RF1 A;  2QEN A;  3H4M A;  5FTN A;  5FTK A;  4LJ5 A;  5BPV A;  4PD2 A;  2J7N A;  1GL6 A;  4LJ4 A;  7CAT A;  1G59 A;  8CAT A;  3U6E A;  1N32 M;  1DO2 A;  1DGH B;  3Q8X A;  2NQ8 C;  4DV1 M;  4HL4 A;  3CF6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...