1HNWM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hnwM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hnwM02
3U6LA 4DV6M 4JI7M 4JYAM 1PM5A 4JI3M 1PJIA 4PDIA 1R2ZA 3A46A 4MB7A 4DR1M 4LF5M 5FLXS 1IBLM 4LFAM 3JR4A 4DR7M 4NXMM 3GPYA 4B3SM 1L2BA 2UUCM 1Z5BA 3GPUA 1PJJA 4OX9M 1N32M 3VK8A 3SARA 3DOAA 4NRVA 1I94M 4LF6M 1NNJA 2E5LM 4YHHM 5IWAM 4X62M 3GO8A 5ITYA 1IBKM 5A2QS 4X66M 5BR8M 2F5SA 4DR6M 5ITUA 2ZBKB 1HNZM 3W0FA 2OPFA 3J7AS 4B3TM 2UUBM 3C58A 2UXDM 4G4NA 3T1YM 1L2CA 1XMOM 1MU5A 1Z5CA 2HKJA 4DR3M 3GP1A 4DUYM 3J80S 2F5NA 4X65M 4DR5M 1KFVA 3U6SA 4GKKM 4LFCM 3A42A 1HNWM 4B3RM 3SATA 1N34M 3JAMS 5LMUM 2F5QA 4DV0M 4PCZA 2ZM6M 3VK7A 1L2DA 4B3MM 1K3XA 4LFBM 4JV5M 2VQFM 3T1HM 4K0KM 4DV1M 1HNXM 1TDHA 2OQ4A 3SAVA 1Q3CA 1HR0M 3A45A 2F5PA 3TWLA 1Q39A 1Q3BA 5ITXA 4PDGA 4DR4M 3GQ4A 4G4QA 1K82A 5ITRA 3JR5A 4LF8M 2F5OA 5IT9S 4JI1M 1TDZA 1MX0A 4G4OA 4JI6M 3GPPA 4YY3M 2VQEM 4DV7M 3TWMA 5ITXE 1L1ZA 4CISA 4JI5M 4DV5M 3U6DA 4DV4M 1N33M 3GPXA 3SBJA 2Q2EB 2EA0A 1L1TA 3U6QA 1EE8A 2HHHM 4DV2M 3OTOM 4JI8M 4LF9M 4JI0M 4JI2M 3U6MA 3U6PA 1FJGM 2UXCM 2XZUA 1R2YA 4X64M 1XNRM 3GQ3A 3SASA 2F4VM 2UUAM 3GQ5A 5LMNM 1Z59A 3SAWA 4KHPM 4LF4M 4AQYM 1J5EM 4NXNM 4PD2A 1N36M 2UXBM 4LF7M 4DV3M 1XNQM 3TWKA 2UU9M 1XC8A 4NRWA 2XZFA 4JI4M 3U6CA 3U6EA 4GKJM 4G4RA 4ITQA 5ITQA 3J81S 3SAUA 4DR2M 1Z5AA 1XMQM 3U6OA 5ITTA 4DUZM 1K3WA 1IBMM
chains in the Genus database with same CATH superfamily
4FWHA 1QYRA 4DV6M 2LVNC 3HU3A 2VF7A 2B3TA 4A3VB 4Z6YA 4LCBA 1PM5A 4XGIA 4IBJA 1R2ZA 2Z4SA 2CHQA 2BJWA 1KSFX 2KNAA 1Y8GA 1GKIA 3ILKA 5EP2A 5C18A 3JR4A 2DI0A 3SHGB 3KP1E 4NXMM 2O5RA 2ERCA 4L4UA 3KS4A 1E9RA 4MGHA 1Z5BA 3GPUA 2CV1A 2ZANA 2O25A 2UUCM 1XB2B 2LVOC 1IFYA 3B74A 1NHGC 3TPZA 2LXEA 2JNHA 3KSJA 2BWEA 2KXEA 3NWLA 3M6AA 3U61A 3MJ5A 4MGYE 3I51A 2V1UA 2JA2A 2YFQA 5IWAM 3KOWE 1NV8A 3GRYA 4BB9A 1OTRA 3D8LA 5BR8M 2F5SA 3HJQA 2JY7A 1P3QQ 1IN6A 3E21A 5IREB 3HKPA 2LHGA 1Z6TA 3AV0A 3HJ8A 4G4NA 1F4IA 1XXHB 5FTMA 1KYIA 1MU5A 1H6UA 1C7YA 2C5RA 4X65M 4LGYA 3U6SA 4F2LA 4GIPA 4IBKA 4D82A 5LMUM 2DXIA 1QAQA 1OFHA 2FS1A 4FCWA 4LFBM 3KOYE 2VQFM 2LBCA 4WP2A 2FH0A 3PXGA 4KODA 1OKSA 3NBXX 1IN5A 3L2AA 3FTEA 1Q3BA 1YSYA 3GQ4A 2CE7A 3PNYA 2LVAA 4Z8XA 5KPZA 3FD9A 3KFUG 2DKLA 4LF8M 2F5OA 2D7GA 1QZMA 4LZZA 1D0KA 2LVPC 3SMPA 3FRHA 5ITXE 4TUWA 3VDPA 2MJ5B 3UK6A 4M0WA 1XXHE 3RGPA 1WJ7A 1D2NA 4D81A 2HL7A 3B9PA 3LW5F 4I81A 4LJ4A 3SBJA 2MROB 2CFOA 2V6ZM 2Q2EB 2DENA 3LMMA 5DYGA 4W5WA 2R62A 3UJNA 4DV2M 4JI8M 1AUAA 3FE3A 2GQFA 4BLCA 1SG9A 4RF0A 3V76A 2XZUA 4GEWA 2LWXA 1VQ1A 2DZNB 2HAKA 3CF0A 2UUAM 1TR8A 3VLFB 1BVSA 1Z59A 1YE9A 2G8LA 4AQYM 3CF6E 4NXNM 1C1KA 3EIHA 1QUTA 3LQQA 2CEAA 1JR3E 2QHOB 5EXXA 2LNHC 1XC8A 2FE8A 2UU9M 3KS8A 2K6BA 1G4AE 2X49A 4BBAA 1TH4A 2XZFA 3GLIA 3THGA 1OJLA 3D8BA 3K1JA 4ZPXA 4ITQA 4GKJM 3J27B 4JXJA 1NY5A 2ZAOA 1IXRC 3A98B 1CUKA 4AKHA 3SFZA 3U6OA 3HGIA 3E9SA 1K3WA 1ZQ9A 1VG5A 2OO9A 4B7FA 3DA1A 2EKFA 3RGSA 3T15A 3VFDA 3HU1A 4L15A 4AZFA 1PJIA 1QZEA 3GLGA 2DWZB 3A46A 2Z4RA 4HL4A 1D0LA 4LJ8A 1TTEA 2KA6B 4FCVA 4MB7A 4LRSA 3LQRA 3J7BA 3SMSA 4MH0E 1N77A 2VF8A 1IBLM 4LFAM 1WHCA 3K8ZA 2I7NA 1IN4A 3GPYA 4B3SM 3K9OA 4HLQA 3U60A 4GC9A 2JWSA 5C1BA 3HHWA 2DHYA 2L7HA 1IY0A 1PJJA 4OX9M 3HJSA 3KOXE 1G71A 3BOSA 3VK8A 2CHGA 1R4GA 1EFUB 1IXZA 1SXJB 2RRUA 2Y0QA 4KO8A 4YHHM 3ZC7B 3GO8A 2KW0A 1V92A 1DGHB 1DO0A 1IBKM 3GRUA 2Y0TA 2MR9A 3J2PB 5ITUA 2LH0A 2EO2A 4LJ6A 2DWLA 3W0FA 3TQSA 1W5TA 2OPFA 1S3SA 2AHMA 4LGMA 3GLFA 4II7A 2R45A 3BXWA 4B3TM 1L2CA 4LJ5A 3HHYA 3SHFA 3UZUA 4IBEA 1XMOM 4GITA 2HCBA 2HKJA 3QYEA 2R44A 2WSFF 4GKKM 3A42A 1TH2A 2C98A 1UM8A 3LVWA 1R6BX 1N34M 2XFTA 4PCZA 1XWIA 1ZMUA 1QAOA 1SXJE 3MK6A 1JR3A 4DV1M 2OQ4A 3PFIA 3K9PA 5KO3A 3U5ZB 4AI6A 3A45A 3VKGA 3LCUA 1OIPA 1V34A 3E46A 4PDGA 4DR4M 4Q7JA 2C99A 1L8QA 2L4EA 1NO1A 3F92A 4GH9A 2Z3XA 1QANA 2DZOB 5IT9S 4PT5A 1TDZA 3I4YA 1TGUA 1WR1B 4GMQA 4YY3M 5DNYA 2VQEM 3TWMA 1LTMA 4MGKE 2L4FA 4AKIA 3H4MA 2EUCA 1GLNA 4JI5M 2D7EA 4OVZB 2DZLA 3U6DA 1R7RA 1N33M 1WIVA 5JI3E 4L8RC 3I01M 2KHHA 4IJFA 2EA0A 2BNKA 3KSXA 1R5LA 4I8OA 3IHPA 5FTNA 4IBBA 4RKUF 2DNAA 2HHHM 2FNAA 3OTOM 2LTUA 3IG8A 2DAEA 2Y20A 2QSFX 4MGIE 2UXCM 3L25A 1R2YA 1HT1E 1HT2E 1ZMVA 2JZ0A 1JQJC 4JN6A 4KLNA 4AW4A 3GQ5A 2ZAMA 5LMNM 2KNVA 4KHPM 4D80A 3PVSA 3GLHB 2VDBB 1J5EM 4G6ZA 4PD2A 1J09A 1IM2A 2BJVA 4LF7M 3Q8GA 3AOEA 2XLJA 4CIZA 2WZJA 4I4LA 3U6CA 1TF0B 2QBYA 3QAUA 2C96A 2C9CA 3CTWB 3SYLA 4CJ6A 1WGLA 4AG5A 3B89A 4L16A 2EKKA 4NSRA 1Q02A 1RU3A 1PJTA 2XSZA 1V33A 3KW6A 5EXTA 3R8FA 4DUZM 4RNAA 5DYIA 2KRUA 4IBGA 2G3QA 3R9XB 1N78A 3U6LA 1QVRA 2HWJA 3GRVA 4JI7M 4JYAM 5IZ7D 1QUSA 4JI3M 4B7HA 1J7KA 1T6OA 3LVVA 4ANRA 4FCTA 3FUXA 2D7HA 2N35A 2DWNA 4LF5M 2P5TA 3GLHE 4QOSA 4QNRA 5FLXS 4F1IA 4S12A 2GNOA 3DFZA 5EXPA 2M60A 2QENA 2OOAA 1SXJA 3FYCA 1WXQA 3I4VA 4LRTA 4QHSA 3T6PA 4MGZE 2XFSA 2Z7JA 3SARA 1IY1A 1DGHA 4NRVA 1I94M 3HZJA 2CUZA 2JZ1A 1IN7A 4LF6M 4IIWA 4WW0A 1DGFA 2R4EA 1PJQA 2E5LM 1QDTA 3AOGA 4X62M 4GHAA 1X37A 1ZAEA 2JY5A 2ZTDA 2ZBKB 3M7GA 4XK8F 4LZJA 4B08A 4IBIA 4L6V6 1GO5A 2UXDM 2CWBA 1HJPA 3I04M 3T1YM 1Z5CA 3VKHA 4MM3B 4DR3M 3GP1A 1HQCA 4B3MM 2YNMD 1KFVA 4LFCM 1HNWM 3GRRA 1VEGA 3BBZA 3SATA 4IBDA 3JAMS 1OFIA 2R18A 4KT0F 4M0DA 3W67A 2F5QA 4EIWA 2K9DA 2ZM6M 4JV5M 1IQPA 1IY2A 2JY8A 3WHKA 2C9OA 5FTLA 3FTFA 1HNXM 4K0KM 1TDHA 1VDDA 1AIPC 1ZMWA 3CGWA 2G5GX 1Q3CA 1HR0M 2F5PA 3RE8A 5GKNA 5ITXA 1NVMA 4WURA 2JP7A 1K82A 1XXHA 2R65A 2H1RA 2R0IA 4REZA 4CHTB 4NOOB 4JI1M 1TH3A 1MX0A 2ZTCA 2DAIA 3IECA 4JI6M 2L2DA 3EIEA 2J7NA 2X4AA 1YUBA 4Y28F 4FVMA 1FNNA 1T43A 2DHRA 4I5SA 4CGYB 5JI2E 2XF3A 4HEOA 2DVWB 2XEPA 3B7QA 5E26A 3K2LA 2RKOA 3GPXA 3ZQJA 2QNJA 2LHCA 3AFHA 3FUWA 1G8PA 3H4JA 3U6QA 1OQYA 4JI2M 2LVQD 1HQYE 3MHVC 3QYBA 3U6PA 4G3OA 1FJGM 2R46A 3GLHA 5EXSA 2YQZA 5KQ8A 1UFZA 4QNMA 4P16A 3GQ3A 3K92A 3SASA 3KVWA 2F4VM 2VIIA 3SAWA 5DFLA 2RGHA 1N36M 2UXBM 1GL6A 2DAKA 4QHTA 2WSCF 1XNQM 4QOZC 3VDUA 1QAMA 1GL7A 3GLGB 2CRUA 2J5YA 4NRWA 3FRIA 2KZSA 4JI4M 1EIJA 1IXSB 2MH8A 3M0EA 5EJCA 3L28A 4LY6A 5FTJA 4L78A 5E6JA 3SC3A 3TE6A 1IN8A 1D0MA 1NJGA 3FUVA 4OU7A 4NC6A 1Z5AA 3QWLA 1XMQM 4DBGB 3HHXA 3U60B 1PRBA 4R71A 3B7NA 1E32A 2Z8YM 4R7GA 3GLIE 3T38A 2QZ4A 3AKZA 1E94E 2XGNA 3TL4X 5KQDA 1T3TA 2OOBA 3MMPA 4FWGA 4NSOB 3LCVB 3AL0C 4PDIA 5KPRA 2RGOA 1YLAA 2L7IA 3AOEC 2QP9X 2K0BX 1PJSA 1QQWA 4LJ7A 4DR1M 2M5ZA 4IBFA 8CATA 3W0LB 4DR7M 2KDLA 3GLGE 4B7GA 1LV7A 3GLFB 1L2BA 1G41A 3KDSE 2XH9A 1QDRA 1OAOC 1N32M 1ZV1A 2JUJA 1MJGM 3DOAA 1XHBA 2J7OA 5EP1A 1VEJA 3Q8XA 4AG6A 2K47A 4RF1A 3C3DA 1NNJA 2QPAA 2V1CA 2O01F 5KPTA 1JB0F 5ITYA 5A2QS 3FYDA 3HY5A 4X66M 2JXNA 2FOIC 4DR6M 1NSFA 4R3DA 5EP3A 5FSWA 3U61B 5FTKA 1HNZM 1JR3D 3L29A 4M9ZA 1NNUC 3J7AS 2L09A 4UN2B 1NHWC 1I4WA 1SXJC 3KP0E 5EP4A 3RFWA 3C58A 2DAMA 3C9PA 1PGYA 4FD2A 4M9XA 2UUBM 3WHLA 2F5NA 2CHVA 4DUYM 3J80S 4DR5M 4DV7M 1DGGA 4LG2A 4B3RM 3GLFE 4FW9A 3C3EA 2JY6B 4DV0M 1W5SA 4M9SA 2DWMA 3L27A 3L26A 3VK7A 1L2DA 1DO2A 1NJFA 1K3XA 3HU2A 2QQ8A 3HX3A 3T1HM 2BWBA 2NQ8C 4AKGA 1E9SA 1ORYB 5H37D 3SAVA 2CV2A 1DGBA 4OW0A 3SYKA 1Q39A 3TWLA 4NL4H 7CATA 4G4QA 3CF2A 2WSEF 2YR0A 5ITRA 3JR5A 2KZUA 2QCUA 3PNVA 1G3IA 4LJ9A 2H5XA 1MN3A 3DZDA 2X8AA 4G4OA 1NY6A 3GPPA 2CP8A 2I7PA 3UMMA 2CV0A 3HWSA 1GJSA 1L1ZA 1VEKA 4CISA 4DV5M 4DV4M 1GJTA 1WGNA 2A5YB 1OIZA 1G59A 2MGWA 1L1TA 2QBYB 2KEBA 1EE8A 3ZH9B 5L8RF 3U5ZA 2EJSA 4LF9M 4JI0M 3FTCA 2KRKA 3U6MA 4IBCA 3KOZE 2Y21A 3NBIA 2L6OA 4X64M 1XNRM 2APLA 2XSZD 1A5TA 3KXEC 4GRIA 4FWDA 3AJIB 1GABA 3IG5A 3B7ZA 3FUTA 4P17A 3FTDA 1IXSA 4LF4M 2W82A 2DAGA 2R6FA 3HHZA 3W68A 4DV3M 1DV0A 3FUUA 4XBOA 4OVZA 3TWKA 2FFJA 4IJEA 1OAIA 2R4JA 1NV9A 3U6EA 3FKEA 4GHLA 1N75A 4G4RA 5ITQA 1GVNA 2KNZA 3J81S 3SAUA 4GC5A 5BPVA 3E4RA 5F3WA 4DR2M 3UGJA 3GLIB 5EQTA 1SXJD 1VDLA 3ZCBB 5ITTA 1IBMM 4LJAA
chains in the Genus database with same CATH topology
4FWHA 1QYRA 4DV6M 3HU3A 4A3VB 4Z6YA 4LCBA 1PM5A 4XGIA 4IBJA 1R2ZA 2Z4SA 2CHQA 2BJWA 1KSFX 1GKIA 3ILKA 5EP2A 5C18A 3JR4A 3SHGB 4NXMM 3KP1E 2O5RA 2ERCA 4L4UA 3KS4A 1E9RA 4MGHA 1Z5BA 3GPUA 2CV1A 2ZANA 2UUCM 1NHGC 3TPZA 2LXEA 3KSJA 2KXEA 3NWLA 3M6AA 3U61A 3MJ5A 4MGYE 3I51A 2V1UA 2JA2A 2YFQA 5IWAM 3KOWE 3GRYA 4BB9A 3D8LA 5BR8M 2F5SA 3HJQA 1IN6A 5IREB 3HKPA 1Z6TA 3AV0A 3HJ8A 4G4NA 1XXHB 5FTMA 1KYIA 1MU5A 1H6UA 2C5RA 4X65M 4LGYA 3U6SA 4GIPA 4IBKA 4D82A 5LMUM 2DXIA 1QAQA 1OFHA 4LFBM 4FCWA 3KOYE 2VQFM 3PXGA 4KODA 1IN5A 3L2AA 3FTEA 1Q3BA 1YSYA 3GQ4A 2CE7A 3PNYA 4Z8XA 5KPZA 3FD9A 3KFUG 4LF8M 2F5OA 2D7GA 1QZMA 4LZZA 3SMPA 5ITXE 4TUWA 3VDPA 3UK6A 4M0WA 3RGPA 4D81A 1D2NA 2HL7A 3B9PA 4I81A 3SBJA 4LJ4A 2CFOA 2V6ZM 2Q2EB 3LMMA 5DYGA 4W5WA 2R62A 3UJNA 4DV2M 4JI8M 4BLCA 4RF0A 2XZUA 2LWXA 2DZNB 3CF0A 2UUAM 3VLFB 1Z59A 1YE9A 2G8LA 4AQYM 3CF6E 4NXNM 1C1KA 3EIHA 3LQQA 5EXXA 2CEAA 3KS8A 2UU9M 2LNHC 1XC8A 2FE8A 1G4AE 2X49A 4BBAA 1TH4A 2XZFA 3GLIA 3THGA 1OJLA 3D8BA 3K1JA 4ZPXA 4ITQA 4GKJM 3J27B 4JXJA 1NY5A 2ZAOA 1IXRC 3A98B 4AKHA 3SFZA 3U6OA 3HGIA 3E9SA 1K3WA 1ZQ9A 4B7FA 3DA1A 3RGSA 3T15A 3VFDA 3HU1A 4L15A 4AZFA 1PJIA 3GLGA 2DWZB 3A46A 2Z4RA 4HL4A 4LJ8A 2KA6B 4FCVA 4MB7A 4LRSA 3LQRA 3J7BA 3SMSA 4MH0E 1N77A 1IBLM 4LFAM 3K8ZA 2I7NA 1IN4A 3GPYA 4B3SM 4HLQA 3U60A 4GC9A 5C1BA 3HHWA 1PJJA 2L7HA 1IY0A 4OX9M 3HJSA 3KOXE 3BOSA 3VK8A 2CHGA 2Y0QA 1IXZA 1SXJB 4KO8A 4YHHM 3ZC7B 3GO8A 2KW0A 1IBKM 1DGHB 1DO0A 3GRUA 2Y0TA 3J2PB 5ITUA 2LH0A 2EO2A 4LJ6A 2DWLA 3W0FA 3TQSA 1W5TA 2OPFA 1S3SA 2AHMA 4LGMA 3GLFA 4II7A 2R45A 4B3TM 1L2CA 4LJ5A 3HHYA 3SHFA 3UZUA 4IBEA 1XMOM 4GITA 2HCBA 2HKJA 4GKKM 3A42A 1TH2A 2C98A 1UM8A 3LVWA 1R6BX 1N34M 2XFTA 4PCZA 1XWIA 1QAOA 1SXJE 3MK6A 1JR3A 4DV1M 2OQ4A 3PFIA 5KO3A 3U5ZB 4AI6A 3A45A 3VKGA 4PDGA 4DR4M 2C99A 1L8QA 4GH9A 2Z3XA 1QANA 2DZOB 5IT9S 4PT5A 1TDZA 3I4YA 1TGUA 4GMQA 4YY3M 5DNYA 2VQEM 3TWMA 4MGKE 4AKIA 3H4MA 2EUCA 1GLNA 4JI5M 2D7EA 4OVZB 3U6DA 1R7RA 1N33M 5JI3E 4L8RC 4IJFA 2EA0A 2BNKA 3KSXA 4I8OA 5FTNA 4IBBA 2HHHM 2FNAA 3OTOM 3IG8A 2Y20A 2UXCM 4MGIE 3L25A 1R2YA 1HT1E 1HT2E 1JQJC 4JN6A 4KLNA 4AW4A 3GQ5A 2ZAMA 5LMNM 4KHPM 4D80A 3PVSA 3GLHB 1J5EM 4G6ZA 4PD2A 1J09A 1IM2A 2BJVA 4LF7M 3AOEA 2XLJA 4I4LA 3U6CA 2QBYA 3QAUA 2C96A 2C9CA 3CTWB 3SYLA 4AG5A 4L16A 4NSRA 2XSZA 5EXTA 3R8FA 3KW6A 4DUZM 4RNAA 5DYIA 2KRUA 4IBGA 3R9XB 1N78A 3U6LA 1QVRA 3GRVA 4JI7M 4JYAM 5IZ7D 4JI3M 4B7HA 1J7KA 3LVVA 4FCTA 3FUXA 2D7HA 2DWNA 4LF5M 2P5TA 4QOSA 4QNRA 5FLXS 4S12A 3DFZA 5EXPA 2M60A 2QENA 1SXJA 3FYCA 1WXQA 3I4VA 4LRTA 4QHSA 4MGZE 2XFSA 2Z7JA 3SARA 1IY1A 1DGHA 4NRVA 1I94M 2CUZA 1IN7A 4LF6M 4IIWA 4WW0A 1DGFA 2R4EA 2E5LM 3AOGA 4X62M 4GHAA 1X37A 1ZAEA 2ZBKB 3M7GA 4LZJA 4B08A 4IBIA 2UXDM 3T1YM 1Z5CA 3VKHA 4MM3B 4DR3M 3GP1A 1HQCA 4B3MM 2YNMD 1KFVA 4LFCM 1HNWM 3GRRA 3SATA 4IBDA 3JAMS 1OFIA 2R18A 4M0DA 2F5QA 4EIWA 2ZM6M 4JV5M 1IQPA 1IY2A 3WHKA 5FTLA 2C9OA 3FTFA 4K0KM 1HNXM 1TDHA 1VDDA 2G5GX 1Q3CA 1HR0M 2F5PA 3RE8A 5GKNA 5ITXA 1NVMA 4WURA 1K82A 1XXHA 2R65A 2H1RA 4REZA 4CHTB 4NOOB 4JI1M 1TH3A 1MX0A 4JI6M 3EIEA 2J7NA 2X4AA 1YUBA 4DV7M 4FVMA 1FNNA 2DHRA 4I5SA 5JI2E 4CGYB 2XF3A 2DVWB 2XEPA 5E26A 3K2LA 2RKOA 3GPXA 3AFHA 3FUWA 1G8PA 3U6QA 4JI2M 3MHVC 1HQYE 3U6PA 1FJGM 2R46A 3GLHA 5EXSA 2YQZA 5KQ8A 4QNMA 4P16A 3GQ3A 3K92A 3SASA 3KVWA 2F4VM 2VIIA 3SAWA 2RGHA 1N36M 2UXBM 1GL6A 4QHTA 1XNQM 4QOZC 3VDUA 1QAMA 1GL7A 3GLGB 4NRWA 2KZSA 4JI4M 1IXSB 3M0EA 5EJCA 3L28A 4LY6A 5FTJA 4L78A 5E6JA 3SC3A 3TE6A 1IN8A 1NJGA 3FUVA 4OU7A 1Z5AA 3QWLA 1XMQM 3HHXA 3U60B 1E32A 4R7GA 3T38A 2QZ4A 3AKZA 1E94E 2XGNA 3TL4X 5KQDA 1T3TA 4NSOB 3AL0C 4FWGA 4PDIA 5KPRA 2RGOA 2L7IA 3AOEC 2QP9X 1QQWA 4LJ7A 4DR1M 2M5ZA 4IBFA 8CATA 3W0LB 4DR7M 4B7GA 1LV7A 3GLFB 1L2BA 1G41A 3KDSE 2XH9A 1N32M 3DOAA 1XHBA 2J7OA 5EP1A 3Q8XA 4AG6A 2K47A 4RF1A 1NNJA 2QPAA 2V1CA 5KPTA 5ITYA 5A2QS 3FYDA 4X66M 2FOIC 4DR6M 1NSFA 4R3DA 5EP3A 5FSWA 3U61B 5FTKA 1HNZM 1JR3D 3L29A 4M9ZA 1NNUC 3J7AS 2L09A 1NHWC 1I4WA 1SXJC 3KP0E 5EP4A 3RFWA 3C58A 2UUBM 4M9XA 4FD2A 3WHLA 2F5NA 2CHVA 4DUYM 3J80S 4DR5M 1DGGA 4LG2A 4B3RM 4FW9A 4DV0M 1W5SA 4M9SA 2DWMA 3L27A 3L26A 3VK7A 1L2DA 1DO2A 1NJFA 1K3XA 3HU2A 3T1HM 2NQ8C 4AKGA 1E9SA 1ORYB 5H37D 3SAVA 2CV2A 1DGBA 4OW0A 3SYKA 1Q39A 3TWLA 4NL4H 7CATA 4G4QA 3CF2A 2YR0A 5ITRA 3JR5A 2KZUA 2QCUA 3PNVA 1G3IA 4LJ9A 3DZDA 2X8AA 4G4OA 1NY6A 3GPPA 2I7PA 3UMMA 2CV0A 3HWSA 1L1ZA 4CISA 4DV5M 4DV4M 2A5YB 1G59A 1L1TA 2QBYB 2KEBA 1EE8A 3ZH9B 3U5ZA 4LF9M 4JI0M 3FTCA 2KRKA 3U6MA 4IBCA 3KOZE 2Y21A 3NBIA 2L6OA 4X64M 1XNRM 2XSZD 3KXEC 4GRIA 4FWDA 3AJIB 3IG5A 3FUTA 3FTDA 4LF4M 2W82A 3HHZA 4DV3M 3FUUA 4XBOA 4OVZA 3TWKA 2FFJA 4IJEA 2R4JA 3U6EA 3FKEA 4GHLA 1N75A 4G4RA 5ITQA 1GVNA 3J81S 3SAUA 4GC5A 5BPVA 3E4RA 5F3WA 4DR2M 3UGJA 3GLIB 5EQTA 1SXJD 3ZCBB 5ITTA 1IBMM 4LJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6L A;  4DV6 M;  4JI7 M;  4JYA M;  1PM5 A;  4JI3 M;  1PJI A;  4PDI A;  1R2Z A;  3A46 A;  4MB7 A;  4DR1 M;  4LF5 M;  5FLX S;  1IBL M;  4LFA M;  3JR4 A;  4DR7 M;  4NXM M;  3GPY A;  4B3S M;  1L2B A;  2UUC M;  1Z5B A;  3GPU A;  1PJJ A;  4OX9 M;  1N32 M;  3VK8 A;  3SAR A;  3DOA A;  4NRV A;  1I94 M;  4LF6 M;  1NNJ A;  2E5L M;  4YHH M;  5IWA M;  4X62 M;  3GO8 A;  5ITY A;  1IBK M;  5A2Q S;  4X66 M;  5BR8 M;  2F5S A;  4DR6 M;  5ITU A;  2ZBK B;  1HNZ M;  3W0F A;  2OPF A;  3J7A S;  4B3T M;  2UUB M;  3C58 A;  2UXD M;  4G4N A;  3T1Y M;  1L2C A;  1XMO M;  1MU5 A;  1Z5C A;  2HKJ A;  4DR3 M;  3GP1 A;  4DUY M;  3J80 S;  2F5N A;  4X65 M;  4DR5 M;  1KFV A;  3U6S A;  4GKK M;  4LFC M;  3A42 A;  1HNW M;  4B3R M;  3SAT A;  1N34 M;  3JAM S;  5LMU M;  2F5Q A;  4DV0 M;  4PCZ A;  2ZM6 M;  3VK7 A;  1L2D A;  4B3M M;  1K3X A;  4LFB M;  4JV5 M;  2VQF M;  3T1H M;  4K0K M;  4DV1 M;  1HNX M;  1TDH A;  2OQ4 A;  3SAV A;  1Q3C A;  1HR0 M;  3A45 A;  2F5P A;  3TWL A;  1Q39 A;  1Q3B A;  5ITX A;  4PDG A;  4DR4 M;  3GQ4 A;  4G4Q A;  1K82 A;  5ITR A;  3JR5 A;  4LF8 M;  2F5O A;  5IT9 S;  4JI1 M;  1TDZ A;  1MX0 A;  4G4O A;  4JI6 M;  3GPP A;  4YY3 M;  2VQE M;  4DV7 M;  3TWM A;  5ITX E;  1L1Z A;  4CIS A;  4JI5 M;  4DV5 M;  3U6D A;  4DV4 M;  1N33 M;  3GPX A;  3SBJ A;  2Q2E B;  2EA0 A;  1L1T A;  3U6Q A;  1EE8 A;  2HHH M;  4DV2 M;  3OTO M;  4JI8 M;  4LF9 M;  4JI0 M;  4JI2 M;  3U6M A;  3U6P A;  1FJG M;  2UXC M;  2XZU A;  1R2Y A;  4X64 M;  1XNR M;  3GQ3 A;  3SAS A;  2F4V M;  2UUA M;  3GQ5 A;  5LMN M;  1Z59 A;  3SAW A;  4KHP M;  4LF4 M;  4AQY M;  1J5E M;  4NXN M;  4PD2 A;  1N36 M;  2UXB M;  4LF7 M;  4DV3 M;  1XNQ M;  3TWK A;  2UU9 M;  1XC8 A;  4NRW A;  2XZF A;  4JI4 M;  3U6C A;  3U6E A;  4GKJ M;  4G4R A;  4ITQ A;  5ITQ A;  3J81 S;  3SAU A;  4DR2 M;  1Z5A A;  1XMQ M;  3U6O A;  5ITT A;  4DUZ M;  1K3W A;  1IBM M; 
#chains in the Genus database with same CATH topology
 4FWH A;  1QYR A;  4DV6 M;  2LVN C;  3HU3 A;  2VF7 A;  2B3T A;  4A3V B;  4Z6Y A;  4LCB A;  1PM5 A;  4XGI A;  4IBJ A;  1R2Z A;  2Z4S A;  2CHQ A;  2BJW A;  1KSF X;  2KNA A;  1Y8G A;  1GKI A;  3ILK A;  5EP2 A;  5C18 A;  3JR4 A;  2DI0 A;  3SHG B;  3KP1 E;  4NXM M;  2O5R A;  2ERC A;  4L4U A;  3KS4 A;  1E9R A;  4MGH A;  1Z5B A;  3GPU A;  2CV1 A;  2ZAN A;  2O25 A;  2UUC M;  1XB2 B;  2LVO C;  1IFY A;  3B74 A;  1NHG C;  3TPZ A;  2LXE A;  2JNH A;  3KSJ A;  2BWE A;  2KXE A;  3NWL A;  3M6A A;  3U61 A;  3MJ5 A;  4MGY E;  3I51 A;  2V1U A;  2JA2 A;  2YFQ A;  5IWA M;  3KOW E;  1NV8 A;  3GRY A;  4BB9 A;  1OTR A;  3D8L A;  5BR8 M;  2F5S A;  3HJQ A;  2JY7 A;  1P3Q Q;  1IN6 A;  3E21 A;  5IRE B;  3HKP A;  2LHG A;  1Z6T A;  3AV0 A;  3HJ8 A;  4G4N A;  1F4I A;  1XXH B;  5FTM A;  1KYI A;  1MU5 A;  1H6U A;  1C7Y A;  2C5R A;  4X65 M;  4LGY A;  3U6S A;  4F2L A;  4GIP A;  4IBK A;  4D82 A;  5LMU M;  2DXI A;  1QAQ A;  1OFH A;  2FS1 A;  4FCW A;  4LFB M;  3KOY E;  2VQF M;  2LBC A;  4WP2 A;  2FH0 A;  3PXG A;  4KOD A;  1OKS A;  3NBX X;  1IN5 A;  3L2A A;  3FTE A;  1Q3B A;  1YSY A;  3GQ4 A;  2CE7 A;  3PNY A;  2LVA A;  4Z8X A;  5KPZ A;  3FD9 A;  3KFU G;  2DKL A;  4LF8 M;  2F5O A;  2D7G A;  1QZM A;  4LZZ A;  1D0K A;  2LVP C;  3SMP A;  3FRH A;  5ITX E;  4TUW A;  3VDP A;  2MJ5 B;  3UK6 A;  4M0W A;  1XXH E;  3RGP A;  1WJ7 A;  1D2N A;  4D81 A;  2HL7 A;  3B9P A;  3LW5 F;  4I81 A;  4LJ4 A;  3SBJ A;  2MRO B;  2CFO A;  2V6Z M;  2Q2E B;  2DEN A;  3LMM A;  5DYG A;  4W5W A;  2R62 A;  3UJN A;  4DV2 M;  4JI8 M;  1AUA A;  3FE3 A;  2GQF A;  4BLC A;  1SG9 A;  4RF0 A;  3V76 A;  2XZU A;  4GEW A;  2LWX A;  1VQ1 A;  2DZN B;  2HAK A;  3CF0 A;  2UUA M;  1TR8 A;  3VLF B;  1BVS A;  1Z59 A;  1YE9 A;  2G8L A;  4AQY M;  3CF6 E;  4NXN M;  1C1K A;  3EIH A;  1QUT A;  3LQQ A;  2CEA A;  1JR3 E;  2QHO B;  5EXX A;  2LNH C;  1XC8 A;  2FE8 A;  2UU9 M;  3KS8 A;  2K6B A;  1G4A E;  2X49 A;  4BBA A;  1TH4 A;  2XZF A;  3GLI A;  3THG A;  1OJL A;  3D8B A;  3K1J A;  4ZPX A;  4ITQ A;  4GKJ M;  3J27 B;  4JXJ A;  1NY5 A;  2ZAO A;  1IXR C;  3A98 B;  1CUK A;  4AKH A;  3SFZ A;  3U6O A;  3HGI A;  3E9S A;  1K3W A;  1ZQ9 A;  1VG5 A;  2OO9 A;  4B7F A;  3DA1 A;  2EKF A;  3RGS A;  3T15 A;  3VFD A;  3HU1 A;  4L15 A;  4AZF A;  1PJI A;  1QZE A;  3GLG A;  2DWZ B;  3A46 A;  2Z4R A;  4HL4 A;  1D0L A;  4LJ8 A;  1TTE A;  2KA6 B;  4FCV A;  4MB7 A;  4LRS A;  3LQR A;  3J7B A;  3SMS A;  4MH0 E;  1N77 A;  2VF8 A;  1IBL M;  4LFA M;  1WHC A;  3K8Z A;  2I7N A;  1IN4 A;  3GPY A;  4B3S M;  3K9O A;  4HLQ A;  3U60 A;  4GC9 A;  2JWS A;  5C1B A;  3HHW A;  2DHY A;  2L7H A;  1IY0 A;  1PJJ A;  4OX9 M;  3HJS A;  3KOX E;  1G71 A;  3BOS A;  3VK8 A;  2CHG A;  1R4G A;  1EFU B;  1IXZ A;  1SXJ B;  2RRU A;  2Y0Q A;  4KO8 A;  4YHH M;  3ZC7 B;  3GO8 A;  2KW0 A;  1V92 A;  1DGH B;  1DO0 A;  1IBK M;  3GRU A;  2Y0T A;  2MR9 A;  3J2P B;  5ITU A;  2LH0 A;  2EO2 A;  4LJ6 A;  2DWL A;  3W0F A;  3TQS A;  1W5T A;  2OPF A;  1S3S A;  2AHM A;  4LGM A;  3GLF A;  4II7 A;  2R45 A;  3BXW A;  4B3T M;  1L2C A;  4LJ5 A;  3HHY A;  3SHF A;  3UZU A;  4IBE A;  1XMO M;  4GIT A;  2HCB A;  2HKJ A;  3QYE A;  2R44 A;  2WSF F;  4GKK M;  3A42 A;  1TH2 A;  2C98 A;  1UM8 A;  3LVW A;  1R6B X;  1N34 M;  2XFT A;  4PCZ A;  1XWI A;  1ZMU A;  1QAO A;  1SXJ E;  3MK6 A;  1JR3 A;  4DV1 M;  2OQ4 A;  3PFI A;  3K9P A;  5KO3 A;  3U5Z B;  4AI6 A;  3A45 A;  3VKG A;  3LCU A;  1OIP A;  1V34 A;  3E46 A;  4PDG A;  4DR4 M;  4Q7J A;  2C99 A;  1L8Q A;  2L4E A;  1NO1 A;  3F92 A;  4GH9 A;  2Z3X A;  1QAN A;  2DZO B;  5IT9 S;  4PT5 A;  1TDZ A;  3I4Y A;  1TGU A;  1WR1 B;  4GMQ A;  4YY3 M;  5DNY A;  2VQE M;  3TWM A;  1LTM A;  4MGK E;  2L4F A;  4AKI A;  3H4M A;  2EUC A;  1GLN A;  4JI5 M;  2D7E A;  4OVZ B;  2DZL A;  3U6D A;  1R7R A;  1N33 M;  1WIV A;  5JI3 E;  4L8R C;  3I01 M;  2KHH A;  4IJF A;  2EA0 A;  2BNK A;  3KSX A;  1R5L A;  4I8O A;  3IHP A;  5FTN A;  4IBB A;  4RKU F;  2DNA A;  2HHH M;  2FNA A;  3OTO M;  2LTU A;  3IG8 A;  2DAE A;  2Y20 A;  2QSF X;  4MGI E;  2UXC M;  3L25 A;  1R2Y A;  1HT1 E;  1HT2 E;  1ZMV A;  2JZ0 A;  1JQJ C;  4JN6 A;  4KLN A;  4AW4 A;  3GQ5 A;  2ZAM A;  5LMN M;  2KNV A;  4KHP M;  4D80 A;  3PVS A;  3GLH B;  2VDB B;  1J5E M;  4G6Z A;  4PD2 A;  1J09 A;  1IM2 A;  2BJV A;  4LF7 M;  3Q8G A;  3AOE A;  2XLJ A;  4CIZ A;  2WZJ A;  4I4L A;  3U6C A;  1TF0 B;  2QBY A;  3QAU A;  2C96 A;  2C9C A;  3CTW B;  3SYL A;  4CJ6 A;  1WGL A;  4AG5 A;  3B89 A;  4L16 A;  2EKK A;  4NSR A;  1Q02 A;  1RU3 A;  1PJT A;  2XSZ A;  1V33 A;  3KW6 A;  5EXT A;  3R8F A;  4DUZ M;  4RNA A;  5DYI A;  2KRU A;  4IBG A;  2G3Q A;  3R9X B;  1N78 A;  3U6L A;  1QVR A;  2HWJ A;  3GRV A;  4JI7 M;  4JYA M;  5IZ7 D;  1QUS A;  4JI3 M;  4B7H A;  1J7K A;  1T6O A;  3LVV A;  4ANR A;  4FCT A;  3FUX A;  2D7H A;  2N35 A;  2DWN A;  4LF5 M;  2P5T A;  3GLH E;  4QOS A;  4QNR A;  5FLX S;  4F1I A;  4S12 A;  2GNO A;  3DFZ A;  5EXP A;  2M60 A;  2QEN A;  2OOA A;  1SXJ A;  3FYC A;  1WXQ A;  3I4V A;  4LRT A;  4QHS A;  3T6P A;  4MGZ E;  2XFS A;  2Z7J A;  3SAR A;  1IY1 A;  1DGH A;  4NRV A;  1I94 M;  3HZJ A;  2CUZ A;  2JZ1 A;  1IN7 A;  4LF6 M;  4IIW A;  4WW0 A;  1DGF A;  2R4E A;  1PJQ A;  2E5L M;  1QDT A;  3AOG A;  4X62 M;  4GHA A;  1X37 A;  1ZAE A;  2JY5 A;  2ZTD A;  2ZBK B;  3M7G A;  4XK8 F;  4LZJ A;  4B08 A;  4IBI A;  4L6V 6;  1GO5 A;  2UXD M;  2CWB A;  1HJP A;  3I04 M;  3T1Y M;  1Z5C A;  3VKH A;  4MM3 B;  4DR3 M;  3GP1 A;  1HQC A;  4B3M M;  2YNM D;  1KFV A;  4LFC M;  1HNW M;  3GRR A;  1VEG A;  3BBZ A;  3SAT A;  4IBD A;  3JAM S;  1OFI A;  2R18 A;  4KT0 F;  4M0D A;  3W67 A;  2F5Q A;  4EIW A;  2K9D A;  2ZM6 M;  4JV5 M;  1IQP A;  1IY2 A;  2JY8 A;  3WHK A;  2C9O A;  5FTL A;  3FTF A;  1HNX M;  4K0K M;  1TDH A;  1VDD A;  1AIP C;  1ZMW A;  3CGW A;  2G5G X;  1Q3C A;  1HR0 M;  2F5P A;  3RE8 A;  5GKN A;  5ITX A;  1NVM A;  4WUR A;  2JP7 A;  1K82 A;  1XXH A;  2R65 A;  2H1R A;  2R0I A;  4REZ A;  4CHT B;  4NOO B;  4JI1 M;  1TH3 A;  1MX0 A;  2ZTC A;  2DAI A;  3IEC A;  4JI6 M;  2L2D A;  3EIE A;  2J7N A;  2X4A A;  1YUB A;  4Y28 F;  4FVM A;  1FNN A;  1T43 A;  2DHR A;  4I5S A;  4CGY B;  5JI2 E;  2XF3 A;  4HEO A;  2DVW B;  2XEP A;  3B7Q A;  5E26 A;  3K2L A;  2RKO A;  3GPX A;  3ZQJ A;  2QNJ A;  2LHC A;  3AFH A;  3FUW A;  1G8P A;  3H4J A;  3U6Q A;  1OQY A;  4JI2 M;  2LVQ D;  1HQY E;  3MHV C;  3QYB A;  3U6P A;  4G3O A;  1FJG M;  2R46 A;  3GLH A;  5EXS A;  2YQZ A;  5KQ8 A;  1UFZ A;  4QNM A;  4P16 A;  3GQ3 A;  3K92 A;  3SAS A;  3KVW A;  2F4V M;  2VII A;  3SAW A;  5DFL A;  2RGH A;  1N36 M;  2UXB M;  1GL6 A;  2DAK A;  4QHT A;  2WSC F;  1XNQ M;  4QOZ C;  3VDU A;  1QAM A;  1GL7 A;  3GLG B;  2CRU A;  2J5Y A;  4NRW A;  3FRI A;  2KZS A;  4JI4 M;  1EIJ A;  1IXS B;  2MH8 A;  3M0E A;  5EJC A;  3L28 A;  4LY6 A;  5FTJ A;  4L78 A;  5E6J A;  3SC3 A;  3TE6 A;  1IN8 A;  1D0M A;  1NJG A;  3FUV A;  4OU7 A;  4NC6 A;  1Z5A A;  3QWL A;  1XMQ M;  4DBG B;  3HHX A;  3U60 B;  1PRB A;  4R71 A;  3B7N A;  1E32 A;  2Z8Y M;  4R7G A;  3GLI E;  3T38 A;  2QZ4 A;  3AKZ A;  1E94 E;  2XGN A;  3TL4 X;  5KQD A;  1T3T A;  2OOB A;  3MMP A;  4FWG A;  4NSO B;  3LCV B;  3AL0 C;  4PDI A;  5KPR A;  2RGO A;  1YLA A;  2L7I A;  3AOE C;  2QP9 X;  2K0B X;  1PJS A;  1QQW A;  4LJ7 A;  4DR1 M;  2M5Z A;  4IBF A;  8CAT A;  3W0L B;  4DR7 M;  2KDL A;  3GLG E;  4B7G A;  1LV7 A;  3GLF B;  1L2B A;  1G41 A;  3KDS E;  2XH9 A;  1QDR A;  1OAO C;  1N32 M;  1ZV1 A;  2JUJ A;  1MJG M;  3DOA A;  1XHB A;  2J7O A;  5EP1 A;  1VEJ A;  3Q8X A;  4AG6 A;  2K47 A;  4RF1 A;  3C3D A;  1NNJ A;  2QPA A;  2V1C A;  2O01 F;  5KPT A;  1JB0 F;  5ITY A;  5A2Q S;  3FYD A;  3HY5 A;  4X66 M;  2JXN A;  2FOI C;  4DR6 M;  1NSF A;  4R3D A;  5EP3 A;  5FSW A;  3U61 B;  5FTK A;  1HNZ M;  1JR3 D;  3L29 A;  4M9Z A;  1NNU C;  3J7A S;  2L09 A;  4UN2 B;  1NHW C;  1I4W A;  1SXJ C;  3KP0 E;  5EP4 A;  3RFW A;  3C58 A;  2DAM A;  3C9P A;  1PGY A;  4FD2 A;  4M9X A;  2UUB M;  3WHL A;  2F5N A;  2CHV A;  4DUY M;  3J80 S;  4DR5 M;  4DV7 M;  1DGG A;  4LG2 A;  4B3R M;  3GLF E;  4FW9 A;  3C3E A;  2JY6 B;  4DV0 M;  1W5S A;  4M9S A;  2DWM A;  3L27 A;  3L26 A;  3VK7 A;  1L2D A;  1DO2 A;  1NJF A;  1K3X A;  3HU2 A;  2QQ8 A;  3HX3 A;  3T1H M;  2BWB A;  2NQ8 C;  4AKG A;  1E9S A;  1ORY B;  5H37 D;  3SAV A;  2CV2 A;  1DGB A;  4OW0 A;  3SYK A;  1Q39 A;  3TWL A;  4NL4 H;  7CAT A;  4G4Q A;  3CF2 A;  2WSE F;  2YR0 A;  5ITR A;  3JR5 A;  2KZU A;  2QCU A;  3PNV A;  1G3I A;  4LJ9 A;  2H5X A;  1MN3 A;  3DZD A;  2X8A A;  4G4O A;  1NY6 A;  3GPP A;  2CP8 A;  2I7P A;  3UMM A;  2CV0 A;  3HWS A;  1GJS A;  1L1Z A;  1VEK A;  4CIS A;  4DV5 M;  4DV4 M;  1GJT A;  1WGN A;  2A5Y B;  1OIZ A;  1G59 A;  2MGW A;  1L1T A;  2QBY B;  2KEB A;  1EE8 A;  3ZH9 B;  5L8R F;  3U5Z A;  2EJS A;  4LF9 M;  4JI0 M;  3FTC A;  2KRK A;  3U6M A;  4IBC A;  3KOZ E;  2Y21 A;  3NBI A;  2L6O A;  4X64 M;  1XNR M;  2APL A;  2XSZ D;  1A5T A;  3KXE C;  4GRI A;  4FWD A;  3AJI B;  1GAB A;  3IG5 A;  3B7Z A;  3FUT A;  4P17 A;  3FTD A;  1IXS A;  4LF4 M;  2W82 A;  2DAG A;  2R6F A;  3HHZ A;  3W68 A;  4DV3 M;  1DV0 A;  3FUU A;  4XBO A;  4OVZ A;  3TWK A;  2FFJ A;  4IJE A;  1OAI A;  2R4J A;  1NV9 A;  3U6E A;  3FKE A;  4GHL A;  1N75 A;  4G4R A;  5ITQ A;  1GVN A;  2KNZ A;  3J81 S;  3SAU A;  4GC5 A;  5BPV A;  3E4R A;  5F3W A;  4DR2 M;  3UGJ A;  3GLI B;  5EQT A;  1SXJ D;  1VDL A;  3ZCB B;  5ITT A;  1IBM M;  4LJA A; 
#chains in the Genus database with same CATH homology
 4FWH A;  1QYR A;  4DV6 M;  3HU3 A;  4A3V B;  4Z6Y A;  4LCB A;  1PM5 A;  4XGI A;  4IBJ A;  1R2Z A;  2Z4S A;  2CHQ A;  2BJW A;  1KSF X;  1GKI A;  3ILK A;  5EP2 A;  5C18 A;  3JR4 A;  3SHG B;  4NXM M;  3KP1 E;  2O5R A;  2ERC A;  4L4U A;  3KS4 A;  1E9R A;  4MGH A;  1Z5B A;  3GPU A;  2CV1 A;  2ZAN A;  2UUC M;  1NHG C;  3TPZ A;  2LXE A;  3KSJ A;  2KXE A;  3NWL A;  3M6A A;  3U61 A;  3MJ5 A;  4MGY E;  3I51 A;  2V1U A;  2JA2 A;  2YFQ A;  5IWA M;  3KOW E;  3GRY A;  4BB9 A;  3D8L A;  5BR8 M;  2F5S A;  3HJQ A;  1IN6 A;  5IRE B;  3HKP A;  1Z6T A;  3AV0 A;  3HJ8 A;  4G4N A;  1XXH B;  5FTM A;  1KYI A;  1MU5 A;  1H6U A;  2C5R A;  4X65 M;  4LGY A;  3U6S A;  4GIP A;  4IBK A;  4D82 A;  5LMU M;  2DXI A;  1QAQ A;  1OFH A;  4LFB M;  4FCW A;  3KOY E;  2VQF M;  3PXG A;  4KOD A;  1IN5 A;  3L2A A;  3FTE A;  1Q3B A;  1YSY A;  3GQ4 A;  2CE7 A;  3PNY A;  4Z8X A;  5KPZ A;  3FD9 A;  3KFU G;  4LF8 M;  2F5O A;  2D7G A;  1QZM A;  4LZZ A;  3SMP A;  5ITX E;  4TUW A;  3VDP A;  3UK6 A;  4M0W A;  3RGP A;  4D81 A;  1D2N A;  2HL7 A;  3B9P A;  4I81 A;  3SBJ A;  4LJ4 A;  2CFO A;  2V6Z M;  2Q2E B;  3LMM A;  5DYG A;  4W5W A;  2R62 A;  3UJN A;  4DV2 M;  4JI8 M;  4BLC A;  4RF0 A;  2XZU A;  2LWX A;  2DZN B;  3CF0 A;  2UUA M;  3VLF B;  1Z59 A;  1YE9 A;  2G8L A;  4AQY M;  3CF6 E;  4NXN M;  1C1K A;  3EIH A;  3LQQ A;  5EXX A;  2CEA A;  3KS8 A;  2UU9 M;  2LNH C;  1XC8 A;  2FE8 A;  1G4A E;  2X49 A;  4BBA A;  1TH4 A;  2XZF A;  3GLI A;  3THG A;  1OJL A;  3D8B A;  3K1J A;  4ZPX A;  4ITQ A;  4GKJ M;  3J27 B;  4JXJ A;  1NY5 A;  2ZAO A;  1IXR C;  3A98 B;  4AKH A;  3SFZ A;  3U6O A;  3HGI A;  3E9S A;  1K3W A;  1ZQ9 A;  4B7F A;  3DA1 A;  3RGS A;  3T15 A;  3VFD A;  3HU1 A;  4L15 A;  4AZF A;  1PJI A;  3GLG A;  2DWZ B;  3A46 A;  2Z4R A;  4HL4 A;  4LJ8 A;  2KA6 B;  4FCV A;  4MB7 A;  4LRS A;  3LQR A;  3J7B A;  3SMS A;  4MH0 E;  1N77 A;  1IBL M;  4LFA M;  3K8Z A;  2I7N A;  1IN4 A;  3GPY A;  4B3S M;  4HLQ A;  3U60 A;  4GC9 A;  5C1B A;  3HHW A;  1PJJ A;  2L7H A;  1IY0 A;  4OX9 M;  3HJS A;  3KOX E;  3BOS A;  3VK8 A;  2CHG A;  2Y0Q A;  1IXZ A;  1SXJ B;  4KO8 A;  4YHH M;  3ZC7 B;  3GO8 A;  2KW0 A;  1IBK M;  1DGH B;  1DO0 A;  3GRU A;  2Y0T A;  3J2P B;  5ITU A;  2LH0 A;  2EO2 A;  4LJ6 A;  2DWL A;  3W0F A;  3TQS A;  1W5T A;  2OPF A;  1S3S A;  2AHM A;  4LGM A;  3GLF A;  4II7 A;  2R45 A;  4B3T M;  1L2C A;  4LJ5 A;  3HHY A;  3SHF A;  3UZU A;  4IBE A;  1XMO M;  4GIT A;  2HCB A;  2HKJ A;  4GKK M;  3A42 A;  1TH2 A;  2C98 A;  1UM8 A;  3LVW A;  1R6B X;  1N34 M;  2XFT A;  4PCZ A;  1XWI A;  1QAO A;  1SXJ E;  3MK6 A;  1JR3 A;  4DV1 M;  2OQ4 A;  3PFI A;  5KO3 A;  3U5Z B;  4AI6 A;  3A45 A;  3VKG A;  4PDG A;  4DR4 M;  2C99 A;  1L8Q A;  4GH9 A;  2Z3X A;  1QAN A;  2DZO B;  5IT9 S;  4PT5 A;  1TDZ A;  3I4Y A;  1TGU A;  4GMQ A;  4YY3 M;  5DNY A;  2VQE M;  3TWM A;  4MGK E;  4AKI A;  3H4M A;  2EUC A;  1GLN A;  4JI5 M;  2D7E A;  4OVZ B;  3U6D A;  1R7R A;  1N33 M;  5JI3 E;  4L8R C;  4IJF A;  2EA0 A;  2BNK A;  3KSX A;  4I8O A;  5FTN A;  4IBB A;  2HHH M;  2FNA A;  3OTO M;  3IG8 A;  2Y20 A;  2UXC M;  4MGI E;  3L25 A;  1R2Y A;  1HT1 E;  1HT2 E;  1JQJ C;  4JN6 A;  4KLN A;  4AW4 A;  3GQ5 A;  2ZAM A;  5LMN M;  4KHP M;  4D80 A;  3PVS A;  3GLH B;  1J5E M;  4G6Z A;  4PD2 A;  1J09 A;  1IM2 A;  2BJV A;  4LF7 M;  3AOE A;  2XLJ A;  4I4L A;  3U6C A;  2QBY A;  3QAU A;  2C96 A;  2C9C A;  3CTW B;  3SYL A;  4AG5 A;  4L16 A;  4NSR A;  2XSZ A;  5EXT A;  3R8F A;  3KW6 A;  4DUZ M;  4RNA A;  5DYI A;  2KRU A;  4IBG A;  3R9X B;  1N78 A;  3U6L A;  1QVR A;  3GRV A;  4JI7 M;  4JYA M;  5IZ7 D;  4JI3 M;  4B7H A;  1J7K A;  3LVV A;  4FCT A;  3FUX A;  2D7H A;  2DWN A;  4LF5 M;  2P5T A;  4QOS A;  4QNR A;  5FLX S;  4S12 A;  3DFZ A;  5EXP A;  2M60 A;  2QEN A;  1SXJ A;  3FYC A;  1WXQ A;  3I4V A;  4LRT A;  4QHS A;  4MGZ E;  2XFS A;  2Z7J A;  3SAR A;  1IY1 A;  1DGH A;  4NRV A;  1I94 M;  2CUZ A;  1IN7 A;  4LF6 M;  4IIW A;  4WW0 A;  1DGF A;  2R4E A;  2E5L M;  3AOG A;  4X62 M;  4GHA A;  1X37 A;  1ZAE A;  2ZBK B;  3M7G A;  4LZJ A;  4B08 A;  4IBI A;  2UXD M;  3T1Y M;  1Z5C A;  3VKH A;  4MM3 B;  4DR3 M;  3GP1 A;  1HQC A;  4B3M M;  2YNM D;  1KFV A;  4LFC M;  1HNW M;  3GRR A;  3SAT A;  4IBD A;  3JAM S;  1OFI A;  2R18 A;  4M0D A;  2F5Q A;  4EIW A;  2ZM6 M;  4JV5 M;  1IQP A;  1IY2 A;  3WHK A;  5FTL A;  2C9O A;  3FTF A;  4K0K M;  1HNX M;  1TDH A;  1VDD A;  2G5G X;  1Q3C A;  1HR0 M;  2F5P A;  3RE8 A;  5GKN A;  5ITX A;  1NVM A;  4WUR A;  1K82 A;  1XXH A;  2R65 A;  2H1R A;  4REZ A;  4CHT B;  4NOO B;  4JI1 M;  1TH3 A;  1MX0 A;  4JI6 M;  3EIE A;  2J7N A;  2X4A A;  1YUB A;  4DV7 M;  4FVM A;  1FNN A;  2DHR A;  4I5S A;  5JI2 E;  4CGY B;  2XF3 A;  2DVW B;  2XEP A;  5E26 A;  3K2L A;  2RKO A;  3GPX A;  3AFH A;  3FUW A;  1G8P A;  3U6Q A;  4JI2 M;  3MHV C;  1HQY E;  3U6P A;  1FJG M;  2R46 A;  3GLH A;  5EXS A;  2YQZ A;  5KQ8 A;  4QNM A;  4P16 A;  3GQ3 A;  3K92 A;  3SAS A;  3KVW A;  2F4V M;  2VII A;  3SAW A;  2RGH A;  1N36 M;  2UXB M;  1GL6 A;  4QHT A;  1XNQ M;  4QOZ C;  3VDU A;  1QAM A;  1GL7 A;  3GLG B;  4NRW A;  2KZS A;  4JI4 M;  1IXS B;  3M0E A;  5EJC A;  3L28 A;  4LY6 A;  5FTJ A;  4L78 A;  5E6J A;  3SC3 A;  3TE6 A;  1IN8 A;  1NJG A;  3FUV A;  4OU7 A;  1Z5A A;  3QWL A;  1XMQ M;  3HHX A;  3U60 B;  1E32 A;  4R7G A;  3T38 A;  2QZ4 A;  3AKZ A;  1E94 E;  2XGN A;  3TL4 X;  5KQD A;  1T3T A;  4NSO B;  3AL0 C;  4FWG A;  4PDI A;  5KPR A;  2RGO A;  2L7I A;  3AOE C;  2QP9 X;  1QQW A;  4LJ7 A;  4DR1 M;  2M5Z A;  4IBF A;  8CAT A;  3W0L B;  4DR7 M;  4B7G A;  1LV7 A;  3GLF B;  1L2B A;  1G41 A;  3KDS E;  2XH9 A;  1N32 M;  3DOA A;  1XHB A;  2J7O A;  5EP1 A;  3Q8X A;  4AG6 A;  2K47 A;  4RF1 A;  1NNJ A;  2QPA A;  2V1C A;  5KPT A;  5ITY A;  5A2Q S;  3FYD A;  4X66 M;  2FOI C;  4DR6 M;  1NSF A;  4R3D A;  5EP3 A;  5FSW A;  3U61 B;  5FTK A;  1HNZ M;  1JR3 D;  3L29 A;  4M9Z A;  1NNU C;  3J7A S;  2L09 A;  1NHW C;  1I4W A;  1SXJ C;  3KP0 E;  5EP4 A;  3RFW A;  3C58 A;  2UUB M;  4M9X A;  4FD2 A;  3WHL A;  2F5N A;  2CHV A;  4DUY M;  3J80 S;  4DR5 M;  1DGG A;  4LG2 A;  4B3R M;  4FW9 A;  4DV0 M;  1W5S A;  4M9S A;  2DWM A;  3L27 A;  3L26 A;  3VK7 A;  1L2D A;  1DO2 A;  1NJF A;  1K3X A;  3HU2 A;  3T1H M;  2NQ8 C;  4AKG A;  1E9S A;  1ORY B;  5H37 D;  3SAV A;  2CV2 A;  1DGB A;  4OW0 A;  3SYK A;  1Q39 A;  3TWL A;  4NL4 H;  7CAT A;  4G4Q A;  3CF2 A;  2YR0 A;  5ITR A;  3JR5 A;  2KZU A;  2QCU A;  3PNV A;  1G3I A;  4LJ9 A;  3DZD A;  2X8A A;  4G4O A;  1NY6 A;  3GPP A;  2I7P A;  3UMM A;  2CV0 A;  3HWS A;  1L1Z A;  4CIS A;  4DV5 M;  4DV4 M;  2A5Y B;  1G59 A;  1L1T A;  2QBY B;  2KEB A;  1EE8 A;  3ZH9 B;  3U5Z A;  4LF9 M;  4JI0 M;  3FTC A;  2KRK A;  3U6M A;  4IBC A;  3KOZ E;  2Y21 A;  3NBI A;  2L6O A;  4X64 M;  1XNR M;  2XSZ D;  3KXE C;  4GRI A;  4FWD A;  3AJI B;  3IG5 A;  3FUT A;  3FTD A;  4LF4 M;  2W82 A;  3HHZ A;  4DV3 M;  3FUU A;  4XBO A;  4OVZ A;  3TWK A;  2FFJ A;  4IJE A;  2R4J A;  3U6E A;  3FKE A;  4GHL A;  1N75 A;  4G4R A;  5ITQ A;  1GVN A;  3J81 S;  3SAU A;  4GC5 A;  5BPV A;  3E4R A;  5F3W A;  4DR2 M;  3UGJ A;  3GLI B;  5EQT A;  1SXJ D;  3ZCB B;  5ITT A;  1IBM M;  4LJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...