1HNWM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hnwM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hnwM02
3W0FA 4JI3M 1L1TA 4DUYM 3SAUA 3A42A 5LMUM 2OPFA 1Q39A 3OTOM 1NNJA 3GPXA 1IBMM 1XNRM 4G4RA 4G4NA 2E5LM 4AQYM 3U6OA 5ITQA 2UXCM 4PDIA 3SBJA 5ITTA 4DR3M 2VQEM 1XNQM 4B3RM 4LF6M 4X65M 4KHPM 4JYAM 4DV1M 4YY3M 5FLXS 2F5NA 4B3TM 1HNZM 4JI8M 3T1YM 2F5SA 4JI7M 4PDGA 3VK7A 3U6PA 3U6SA 1K82A 4LF4M 5ITUA 4NRVA 1R2YA 4JI5M 1FJGM 4ITQA 3DOAA 4G4OA 4G4QA 4DV6M 3TWKA 4LFCM 2ZM6M 3JAMS 1PJJA 2UU9M 4X66M 3J7AS 3GPPA 1IBLM 1HNXM 1HNWM 3GQ5A 4DR5M 4LF5M 1Q3CA 3U6MA 4CISA 4JI4M 3JR5A 3GP1A 2Q2EB 3J80S 4DV2M 4DV4M 2F5OA 1MX0A 1Z5BA 3VK8A 1TDZA 3SATA 3GQ4A 1R2ZA 2F4VM 3A45A 1EE8A 1PM5A 1L2DA 5A2QS 2EA0A 1MU5A 3U6CA 2XZUA 1L2BA 4PD2A 4DR4M 4LF7M 3GPUA 3T1HM 4MB7A 4LFBM 4GKKM 3GPYA 4JI6M 4DV5M 3U6LA 3C58A 4DR1M 3JR4A 2UXBM 3SASA 4DUZM 4JV5M 2OQ4A 5LMNM 1XMQM 1Z5AA 2ZBKB 4LF8M 2HKJA 1L1ZA 4B3MM 4JI0M 2F5PA 1J5EM 1N32M 4NXMM 3TWLA 1N33M 2HHHM 3TWMA 1Z59A 5BR8M 3A46A 3U6QA 4NRWA 4OX9M 2F5QA 2UUBM 5ITXE 4LF9M 1K3WA 2VQFM 4NXNM 3GO8A 1L2CA 4GKJM 4PCZA 1KFVA 4K0KM 4LFAM 4DV7M 4B3SM 3U6DA 4DR2M 1PJIA 1Q3BA 1TDHA 3GQ3A 3SARA 1N34M 2XZFA 1XC8A 4YHHM 4X64M 1IBKM 1Z5CA 5IT9S 4DR7M 4DV3M 4X62M 4DV0M 1I94M 2UXDM 5ITYA 5ITRA 5ITXA 5IWAM 4JI1M 3SAVA 1N36M 1HR0M 1K3XA 1XMOM 3SAWA 2UUAM 3U6EA 2UUCM 4JI2M 3J81S 4DR6M
chains in the Genus database with same CATH superfamily
1ORYB 4AZFA 2DAMA 4JI3M 3ZC7B 2EKKA 2I7NA 1L1TA 1GJTA 3J27B 2WSFF 3U61A 3MK6A 4L16A 4REZA 2R4EA 4AI6A 2LWXA 1W5SA 1E9SA 2VDBB 4G4RA 4LG2A 3CTWB 4AQYM 3U6OA 5ITQA 1NV8A 4PDIA 2KNAA 4MGHA 2FH0A 2J7NA 5ITTA 3U5ZB 1XNQM 4OVZB 3HKPA 3K1JA 4LF6M 2D7HA 4HEOA 4KHPM 1D0KA 1NSFA 2CHGA 3WHKA 1JB0F 4YY3M 4P16A 1FNNA 2EO2A 1V92A 2C9CA 2L6OA 3KW6A 3UGJA 2F5NA 5KPRA 4JI7M 3MHVC 4FW9A 2DWNA 3KDSE 1NY5A 1K82A 4IJEA 4Q7JA 4NRVA 3ZCBB 3HHXA 2Y0QA 2C9OA 3DOAA 3GLIB 1BVSA 1SG9A 2CRUA 2MR9A 3HX3A 4M0DA 2R44A 4A3VB 3TWKA 5JI2E 1GLNA 5IREB 3KP0E 4L6V6 4RF0A 1IN4A 1AUAA 2OOAA 4LCBA 1XHBA 2EUCA 1IBLM 4MGKE 5KPZA 3EIEA 4FWHA 4GHLA 1Q3CA 1VEGA 3L26A 2WSEF 5C1BA 2K0BX 2R45A 3L27A 2YR0A 1HT2E 2EKFA 5EXSA 4DV4M 1E32A 3QYEA 1MX0A 1QQWA 4Z6YA 1YLAA 3LQQA 4RF1A 3FUTA 2C96A 3GQ4A 3A45A 1R2ZA 3FRHA 2XH9A 4FD2A 3UK6A 3CF2A 2R4JA 4LJ9A 2DZLA 2R46A 3QYBA 4OW0A 1L2BA 2X49A 1GVNA 2KRUA 4LF7M 2VIIA 4LRSA 4L8RC 3PFIA 3GPYA 1HQYE 2ZAMA 3U6LA 2DAGA 1IN7A 3AKZA 1OIZA 2DXIA 3KOZE 1GL7A 3AOEC 2ZBKB 4LF8M 2RKOA 4IIWA 3TWLA 1WR1B 3B7ZA 1CUKA 2ZANA 3KSJA 4RNAA 2D7GA 1QDTA 1H6UA 3WHLA 4FWDA 1EFUB 4KODA 4OX9M 2Z4SA 1VG5A 3PNYA 4LJ4A 4D81A 2V6ZM 2LXEA 4PCZA 2HWJA 4MGYE 2FNAA 4B3SM 2JXNA 3THGA 7CATA 5EXXA 4DR2M 3KSXA 3U60B 4RKUF 4B7FA 2KHHA 3GQ3A 1PRBA 2OOBA 5KQDA 1IXSA 5EP2A 3PXGA 4YHHM 1SXJA 1NO1A 5E26A 1HQCA 2FFJA 5IT9S 2HCBA 5KO3A 2DVWB 1TTEA 2O01F 4X62M 4DV0M 1NHGC 3IECA 2XEPA 4D80A 4JI1M 3SHGB 1DO2A 3KVWA 2JWSA 1X37A 1XXHB 4G6ZA 3SAWA 1PJTA 2DZNB 2UUAM 3BOSA 3U6EA 2UUCM 1R4GA 3J81S 3AL0C 1OJLA 3M6AA 1VEJA 3W68A 3CF0A 2MGWA 3C9PA 2O5RA 3UJNA 1DGGA 3L25A 4DUYM 4LGYA 1IXZA 3A42A 4AW4A 5BPVA 3OTOM 1AIPC 3GRUA 1IBMM 4WW0A 4F1IA 1XNRM 2JZ0A 4G4NA 2Y0TA 2LHCA 5H37D 1UM8A 3I04M 2DKLA 3L29A 2QZ4A 2D7EA 1A5TA 3SBJA 4AKHA 2JP7A 2Z8YM 2ZTDA 3DFZA 1E9RA 1HJPA 4NOOB 4LJ6A 1C7YA 4JYAM 1D0LA 2CV2A 2QPAA 3FTFA 2XLJA 3HU3A 4MGZE 3GLGE 5FLXS 2J7OA 1HNZM 1GL6A 2JA2A 3U6SA 5DYGA 4WURA 4LF4M 5ITUA 4KO8A 1IM2A 1NNUC 3GRRA 5EXTA 2L2DA 1R2YA 4JI5M 3HY5A 3W0LB 2L09A 2CEAA 2ERCA 4CGYB 4G4OA 3FTDA 4G4QA 3U5ZA 1QAOA 1C1KA 2ZM6M 3NBIA 2VF8A 2UU9M 3KOWE 1MJGM 3J7AS 1G41A 1WGNA 1GJSA 3SMPA 3FTEA 1TH3A 2WZJA 1DGBA 1W5TA 2QENA 1PGYA 1IXSB 1VEKA 2CV1A 4QOSA 1RU3A 3J80S 1N77A 4I8OA 3HJQA 2KZUA 4GMQA 3HZJA 3T15A 2F4VM 4MGIE 3GLFA 1PJSA 1EE8A 2L7HA 3Q8GA 3GLFB 1PM5A 3FKEA 2DZOB 3HHWA 1MU5A 4PD2A 4DR4M 1R7RA 3CF6E 5KQ8A 3GPUA 1R5LA 2LTUA 4GRIA 4MB7A 1QUSA 4LFBM 4GKKM 2J5YA 1J7KA 1G8PA 4JI6M 3HGIA 1I4WA 1YUBA 3C58A 3F92A 2KW0A 3C3DA 2ZAOA 1TH4A 3FRIA 4L15A 3SYLA 2Z7JA 2GQFA 1XMQM 1TGUA 2QBYA 1L1ZA 3AJIB 4JI0M 1QANA 1N32M 4CJ6A 5FTKA 1N33M 4XK8F 4GITA 3TWMA 1Z59A 2M5ZA 5BR8M 2CWBA 4Y28F 5GKNA 2F5QA 2VQFM 4NXNM 3SMSA 4AKIA 3VLFB 2JY6B 4IBDA 1KFVA 1D0MA 5DFLA 3VKGA 2LNHC 3HHZA 1NVMA 2JY5A 1G59A 1Q3BA 3SARA 2AHMA 3M7GA 3RE8A 5DYIA 2XZFA 1XC8A 1N34M 3R9XB 4X64M 4IBJA 1Z5CA 3Q8XA 3GLHA 3KS4A 2LVOC 2RRUA 4PT5A 3B74A 1I94M 1NV9A 2XFTA 2UXDM 1WIVA 5ITYA 5IWAM 4M9ZA 4R3DA 3C3EA 3FE3A 3GLFE 3FYCA 1ZMWA 2LBCA 3IG5A 4XBOA 3DZDA 4OU7A 3KP1E 4DR6M 3FTCA 3FUUA 5E6JA 3VDPA 3W0FA 4M9SA 3ZH9B 3TQSA 2Z3XA 2CE7A 2K9DA 2LVQD 3SYKA 2OPFA 1Q39A 2DI0A 3BBZA 1NNJA 3GLHE 4GHAA 1D2NA 3GPXA 1YSYA 1QAQA 2DENA 3FYDA 4FCWA 2E5LM 3D8BA 3VKHA 3HJ8A 3TL4X 2UXCM 2RGHA 2N35A 1G4AE 1NJGA 3HHYA 4DR3M 1QYRA 2VQEM 3H4MA 1IN5A 3K92A 4B3RM 4WP2A 2P5TA 1SXJB 1ZMVA 1ZV1A 4X65M 1WXQA 1WJ7A 1Z6TA 2Y20A 4UN2B 4DV1M 3AFHA 4M9XA 1DGHA 2HL7A 1L8QA 3SFZA 1N78A 3U61B 3FUWA 4B7GA 3GLGA 3RFWA 3U6PA 2WSCF 1OKSA 1QVRA 1JR3E 1FJGM 1E94E 4NSOB 2APLA 2B3TA 3I4VA 3RGPA 4AKGA 4LFCM 4I4LA 2XFSA 2XSZA 1PJJA 4GEWA 1OFIA 4AG6A 5FTJA 5DNYA 5FSWA 2KZSA 4X66M 4G3OA 3GPPA 3QAUA 2I7PA 3IHPA 4GC9A 1HNXM 3GQ5A 1TF0B 1MN3A 3J2PB 1IY0A 4QNRA 4JI4M 1XWIA 1EIJA 3FUVA 3GP1A 2Q2EB 2RGOA 3JR5A 2W82A 4DV2M 3HJSA 2YNMD 1KSFX 1Z5BA 2XF3A 3QWLA 1DGHB 4KLNA 3CGWA 1V34A 4LGMA 1L2DA 1GKIA 1XXHA 4MH0E 2EA0A 1LV7A 3KOYE 3U6CA 2XZUA 2KNVA 5F3WA 5EP1A 3HU2A 4GH9A 4OVZA 2DHYA 2LVNC 3SC3A 1VDLA 2FS1A 1SXJE 1IY2A 2BJWA 4DV5M 3TE6A 1TH2A 2OO9A 2UXBM 3SASA 3ZQJA 3DA1A 2QQ8A 4DBGB 2DAKA 3GRVA 3MJ5A 2OQ4A 5LMNM 1Z5AA 4JXJA 4IJFA 4B3MM 1XB2B 4IBCA 4L4UA 2MROB 2O25A 1T43A 3NBXX 3HWSA 3A46A 4NRWA 1GO5A 3E4RA 3H4JA 4LF9M 1K3WA 4S12A 4W5WA 3GO8A 1L2CA 3T38A 4KT0F 2V1UA 4K0KM 4LFAM 2QHOB 4I81A 3GLIA 2HAKA 1SXJD 1IQPA 2ZTCA 3J7BA 4IBBA 1TDHA 4JN6A 4CIZA 2XSZD 4JI8M 3GLHB 1IBKM 3GLGB 3FD9A 1IY1A 3K9OA 2FOIC 2X8AA 3HU1A 5IZ7D 3LCUA 4DR7M 2YQZA 4DV3M 2JNHA 2R65A 1S3SA 4IBFA 1XXHE 4LJ7A 5ITXA 4AG5A 5ITRA 2DHRA 4NSRA 3K2LA 1N36M 2BWEA 1XMOM 1TR8A 4ANRA 2CHQA 2CV0A 4XGIA 2QBYB 2JZ1A 3L28A 2NQ8C 4IBKA 3SHFA 5FTLA 4JI2M 3GRYA 3I4YA 2BJVA 4LY6A 1LTMA 2DAIA 4NC6A 3T6PA 3SAUA 3ILKA 5LMUM 4R71A 2KA6B 1Q02A 3B7NA 2R62A 3M0EA 5EJCA 4EIWA 3KFUG 2YFQA 2R0IA 1J09A 3LMMA 1OAIA 2H5XA 2QSFX 1QZMA 2Z4RA 3EIHA 4LJ8A 1OAOC 3VDUA 1UFZA 2GNOA 3UMMA 4TUWA 2CFOA 4LJAA 4NL4H 5L8RF 2DNAA 2LH0A 4CHTB 2C99A 1OIPA 1IN6A 1G3IA 5FTMA 1QZEA 2M60A 4B3TM 2JY8A 4II7A 1DO0A 2QP9X 3T1YM 3TPZA 2F5SA 4M0WA 1OQYA 4PDGA 3VK7A 1KYIA 2VF7A 3KOXE 1VDDA 1IXRC 2K6BA 3W67A 1OTRA 5JI3E 1YE9A 2QCUA 4ITQA 3B89A 2KXEA 2KNZA 4HLQA 3I01M 2LVAA 3RGSA 4DV6M 4FCTA 2XGNA 2JUJA 1WGLA 1DGFA 2G3QA 3MMPA 5FTNA 3JAMS 1QUTA 1NJFA 2CHVA 3BXWA 1ZMUA 3L2AA 4QHSA 1R6BX 2QNJA 2CP8A 4ZPXA 1HNWM 4DR5M 1NY6A 4LF5M 1QDRA 3NWLA 2CUZA 4LJ5A 4MM3B 3R8FA 3B9PA 3U6MA 1IN8A 2BWBA 4CISA 5KPTA 1P3QQ 1QAMA 1ZQ9A 2F5OA 4LZJA 1G71A 3LW5F 4IBIA 2C98A 2FE8A 3VK8A 1TDZA 1VQ1A 3SATA 3E21A 1ZAEA 4R7GA 1DV0A 4I5SA 1NHWC 3UZUA 1V33A 1PJQA 3LVVA 1T6OA 2DAEA 5A2QS 1GABA 3E46A 4FCVA 3LCVB 2KEBA 4QHTA 4F2LA 2KRKA 4GC5A 3K9PA 3D8LA 1SXJC 4LRTA 8CATA 3T1HM 2DWMA 3PVSA 1JQJC 3A98B 3KS8A 3I51A 2L7IA 1IFYA 3LQRA 4DR1M 2DWZB 1WHCA 3FUXA 3JR4A 4HL4A 1F4IA 2R6FA 2Y21A 2A5YB 3KXEC 4DUZM 4JV5M 1JR3A 2HKJA 2F5PA 2BNKA 4B08A 1J5EM 1HT1E 4NXMM 3V76A 2HHHM 4L78A 4QOZC 3K8ZA 4BB9A 2LHGA 4FVMA 4QNMA 3VFDA 3U6QA 2L4EA 4Z8XA 2UUBM 5ITXE 2MJ5B 3AOEA 2MH8A 1JR3D 2C5RA 3AOGA 4B7HA 4GKJM 4GIPA 4IBEA 3E9SA 4DV7M 4LZZA 4P17A 3U6DA 3AV0A 1PJIA 2X4AA 2V1CA 3U60A 5EP4A 1OFHA 2K47A 2JY7A 5EP3A 4FWGA 2LVPC 3IG8A 3GLIE 3PNVA 3LVWA 5EXPA 4D82A 1Y8GA 5EQTA 2R18A 3SAVA 1HR0M 1K3XA 3B7QA 4BBAA 1N75A 2L4FA 4IBGA 4BLCA 2G8LA 1T3TA 2G5GX 5C18A 2EJSA 2H1RA 2DWLA 2KDLA
chains in the Genus database with same CATH topology
1ORYB 4AZFA 4JI3M 3ZC7B 1L1TA 2I7NA 3J27B 3U61A 3MK6A 4L16A 4REZA 2R4EA 4AI6A 2LWXA 1W5SA 1E9SA 4G4RA 4LG2A 3CTWB 4AQYM 3U6OA 5ITQA 4PDIA 4MGHA 5ITTA 2J7NA 3U5ZB 1XNQM 4OVZB 3HKPA 3K1JA 4LF6M 2D7HA 4KHPM 1NSFA 2CHGA 3WHKA 4YY3M 4P16A 1FNNA 2EO2A 2C9CA 2F5NA 4JI8M 3KW6A 3UGJA 5KPRA 4JI7M 3MHVC 4FW9A 2DWNA 3KDSE 1NY5A 1K82A 4IJEA 4NRVA 3ZCBB 3HHXA 2Y0QA 2C9OA 3DOAA 3GLIB 4M0DA 4A3VB 3TWKA 5JI2E 1GLNA 5IREB 3KP0E 4RF0A 1IN4A 4LCBA 1XHBA 2EUCA 1IBLM 4MGKE 5KPZA 3EIEA 4FWHA 4GHLA 1Q3CA 3L26A 5C1BA 2R45A 3L27A 2YR0A 1HT2E 5EXSA 4DV4M 1E32A 1MX0A 1QQWA 4Z6YA 3LQQA 4RF1A 3FUTA 2C96A 3GQ4A 3A45A 1R2ZA 2XH9A 4FD2A 3UK6A 3CF2A 2R4JA 4LJ9A 1L2BA 2R46A 4OW0A 2X49A 1GVNA 2KRUA 4LF7M 2VIIA 4LRSA 4L8RC 3PFIA 3GPYA 1HQYE 2ZAMA 3U6LA 1IN7A 3AKZA 2DXIA 3KOZE 1GL7A 3AOEC 2ZBKB 4LF8M 2RKOA 4IIWA 3TWLA 4RNAA 2ZANA 3WHLA 3KSJA 2D7GA 1H6UA 4FWDA 4KODA 4OX9M 2Z4SA 3PNYA 4LJ4A 4D81A 2V6ZM 2LXEA 4PCZA 4MGYE 2FNAA 4B3SM 3THGA 7CATA 5EXXA 4DR2M 3KSXA 3U60B 4B7FA 3GQ3A 5KQDA 5EP2A 3PXGA 4YHHM 1SXJA 5E26A 1HQCA 2FFJA 5IT9S 2HCBA 5KO3A 2DVWB 4X62M 4DV0M 1NHGC 2XEPA 4D80A 4JI1M 3SHGB 1DO2A 3KVWA 1X37A 1XXHB 4G6ZA 3SAWA 2DZNB 2UUAM 3BOSA 3U6EA 2UUCM 3J81S 3AL0C 1OJLA 3M6AA 3CF0A 3UJNA 2O5RA 3L25A 1DGGA 4DUYM 4LGYA 1IXZA 3A42A 4AW4A 5BPVA 3OTOM 3GRUA 1IBMM 4WW0A 1XNRM 4G4NA 2Y0TA 5H37D 1UM8A 3L29A 2QZ4A 2D7EA 3SBJA 4AKHA 3DFZA 1E9RA 4NOOB 4LJ6A 4JYAM 2CV2A 2QPAA 3FTFA 2XLJA 3HU3A 4MGZE 5FLXS 2J7OA 1HNZM 1GL6A 2JA2A 3U6SA 5DYGA 4WURA 4LF4M 5ITUA 4KO8A 1IM2A 1NNUC 3GRRA 5EXTA 1R2YA 4JI5M 3W0LB 2L09A 2CEAA 2ERCA 4CGYB 4G4OA 3FTDA 4G4QA 3U5ZA 1QAOA 1C1KA 2ZM6M 3NBIA 2UU9M 3KOWE 3J7AS 1G41A 3SMPA 3FTEA 1TH3A 1DGBA 1W5TA 2QENA 1IXSB 2CV1A 4QOSA 3J80S 1N77A 4I8OA 3HJQA 2KZUA 4GMQA 3T15A 2F4VM 4MGIE 3GLFA 1PM5A 1EE8A 2L7HA 3GLFB 3FKEA 2DZOB 3HHWA 1MU5A 4PD2A 4DR4M 1R7RA 3CF6E 5KQ8A 3GPUA 4GRIA 4LFBM 4MB7A 4GKKM 1J7KA 1G8PA 4JI6M 3HGIA 1I4WA 1YUBA 3C58A 2KW0A 2ZAOA 1TH4A 3SYLA 4L15A 2Z7JA 1XMQM 1TGUA 2QBYA 1L1ZA 3AJIB 4JI0M 1QANA 1N32M 5FTKA 1N33M 4GITA 3TWMA 1Z59A 2M5ZA 5BR8M 5GKNA 2F5QA 2VQFM 4NXNM 3SMSA 4AKIA 3VLFB 4IBDA 1KFVA 3VKGA 2LNHC 3HHZA 1NVMA 1G59A 1Q3BA 3SARA 2AHMA 3M7GA 3RE8A 5DYIA 2XZFA 1XC8A 1N34M 3R9XB 4X64M 4IBJA 1Z5CA 3Q8XA 3GLHA 3KS4A 4PT5A 1I94M 2XFTA 2UXDM 5ITYA 5IWAM 4M9ZA 4R3DA 3FYCA 4XBOA 3IG5A 3DZDA 4OU7A 3KP1E 4DR6M 3FUUA 3FTCA 5E6JA 3VDPA 3W0FA 4M9SA 3ZH9B 3TQSA 2Z3XA 2CE7A 3SYKA 2OPFA 1Q39A 1NNJA 4GHAA 1D2NA 3GPXA 1YSYA 1QAQA 3FYDA 4FCWA 2E5LM 3D8BA 3VKHA 3HJ8A 3TL4X 2UXCM 2RGHA 1G4AE 1NJGA 3HHYA 4DR3M 1QYRA 2VQEM 3H4MA 1IN5A 3K92A 4B3RM 2P5TA 1SXJB 4X65M 1WXQA 2Y20A 1Z6TA 4DV1M 3AFHA 4M9XA 1DGHA 2HL7A 1L8QA 3SFZA 1N78A 3U61B 3FUWA 4B7GA 3GLGA 3RFWA 3U6PA 1QVRA 1FJGM 1E94E 4NSOB 3I4VA 3RGPA 4AKGA 4LFCM 4I4LA 2XFSA 2XSZA 1PJJA 1OFIA 4AG6A 5FTJA 5DNYA 5FSWA 2KZSA 4X66M 3GPPA 3QAUA 2I7PA 4GC9A 1HNXM 3GQ5A 3J2PB 1IY0A 4QNRA 4JI4M 1XWIA 3FUVA 3GP1A 2Q2EB 2RGOA 3JR5A 2W82A 4DV2M 3HJSA 2YNMD 1KSFX 1Z5BA 2XF3A 3QWLA 1DGHB 4KLNA 4LGMA 1L2DA 1GKIA 1XXHA 4MH0E 2EA0A 1LV7A 3KOYE 3U6CA 2XZUA 5F3WA 5EP1A 3HU2A 4GH9A 4OVZA 3SC3A 1SXJE 1IY2A 2BJWA 4DV5M 3TE6A 1TH2A 2UXBM 3SASA 3DA1A 3GRVA 3MJ5A 2OQ4A 5LMNM 1Z5AA 4JXJA 4IJFA 4B3MM 4IBCA 4L4UA 3HWSA 3A46A 4NRWA 3E4RA 4LF9M 1K3WA 4S12A 4W5WA 3GO8A 1L2CA 3T38A 2V1UA 4K0KM 4LFAM 4I81A 3GLIA 1SXJD 1IQPA 4IBBA 3J7BA 4JN6A 1TDHA 2XSZD 3GLHB 1IBKM 3GLGB 3FD9A 1IY1A 2FOIC 2X8AA 3HU1A 5IZ7D 4DR7M 2YQZA 4DV3M 2R65A 4IBFA 1S3SA 4LJ7A 4AG5A 5ITRA 5ITXA 2DHRA 4NSRA 3K2LA 1N36M 1XMOM 2CHQA 2CV0A 4XGIA 2QBYB 3L28A 3SHFA 2NQ8C 4IBKA 5FTLA 4JI2M 3GRYA 3I4YA 2BJVA 4LY6A 3SAUA 3ILKA 5LMUM 2KA6B 4EIWA 3M0EA 2R62A 5EJCA 3KFUG 2YFQA 1J09A 3LMMA 1QZMA 2Z4RA 3EIHA 4LJ8A 3VDUA 3UMMA 4TUWA 2CFOA 4LJAA 4NL4H 2LH0A 4CHTB 2C99A 1IN6A 1G3IA 5FTMA 2M60A 4B3TM 4II7A 1DO0A 2QP9X 3T1YM 3TPZA 2F5SA 4M0WA 4PDGA 3VK7A 1KYIA 3KOXE 1VDDA 1IXRC 5JI3E 1YE9A 2QCUA 4ITQA 2KXEA 4HLQA 3RGSA 4DV6M 4FCTA 2XGNA 1DGFA 5FTNA 3JAMS 1NJFA 2CHVA 3L2AA 4QHSA 1R6BX 4ZPXA 1HNWM 4DR5M 1NY6A 4LF5M 4LJ5A 3NWLA 2CUZA 4MM3B 3R8FA 3B9PA 3U6MA 1IN8A 4CISA 5KPTA 1QAMA 1ZQ9A 2F5OA 4LZJA 4IBIA 2C98A 2FE8A 3VK8A 1TDZA 3SATA 1ZAEA 4R7GA 4I5SA 1NHWC 3UZUA 3LVVA 5A2QS 4FCVA 2KEBA 4QHTA 2KRKA 4GC5A 4LRTA 3D8LA 1SXJC 8CATA 3T1HM 2DWMA 3PVSA 1JQJC 3A98B 3KS8A 3I51A 2L7IA 3LQRA 4DR1M 2DWZB 3FUXA 3JR4A 4HL4A 2Y21A 2A5YB 3KXEC 4DUZM 4JV5M 1JR3A 2HKJA 2F5PA 2BNKA 4B08A 1J5EM 1HT1E 4NXMM 2HHHM 4L78A 4QOZC 3K8ZA 4BB9A 4FVMA 4QNMA 3VFDA 3U6QA 4Z8XA 2UUBM 5ITXE 3AOEA 1JR3D 2C5RA 3AOGA 4B7HA 4GKJM 4GIPA 4IBEA 3E9SA 4DV7M 4LZZA 3U6DA 3AV0A 1PJIA 2X4AA 2V1CA 3U60A 5EP4A 1OFHA 2K47A 5EP3A 4FWGA 3IG8A 3PNVA 3LVWA 5EXPA 4D82A 5EQTA 2R18A 3SAVA 1HR0M 1K3XA 4BBAA 1N75A 4IBGA 4BLCA 2G8LA 1T3TA 2G5GX 5C18A 2DWLA 2H1RA 2L6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W0F A;  4JI3 M;  1L1T A;  4DUY M;  3SAU A;  3A42 A;  5LMU M;  2OPF A;  1Q39 A;  3OTO M;  1NNJ A;  3GPX A;  1IBM M;  1XNR M;  4G4R A;  4G4N A;  2E5L M;  4AQY M;  3U6O A;  5ITQ A;  2UXC M;  4PDI A;  3SBJ A;  5ITT A;  4DR3 M;  2VQE M;  1XNQ M;  4B3R M;  4LF6 M;  4X65 M;  4KHP M;  4JYA M;  4DV1 M;  4YY3 M;  5FLX S;  2F5N A;  4B3T M;  1HNZ M;  4JI8 M;  3T1Y M;  2F5S A;  4JI7 M;  4PDG A;  3VK7 A;  3U6P A;  3U6S A;  1K82 A;  4LF4 M;  5ITU A;  4NRV A;  1R2Y A;  4JI5 M;  1FJG M;  4ITQ A;  3DOA A;  4G4O A;  4G4Q A;  4DV6 M;  3TWK A;  4LFC M;  2ZM6 M;  3JAM S;  1PJJ A;  2UU9 M;  4X66 M;  3J7A S;  3GPP A;  1IBL M;  1HNX M;  1HNW M;  3GQ5 A;  4DR5 M;  4LF5 M;  1Q3C A;  3U6M A;  4CIS A;  4JI4 M;  3JR5 A;  3GP1 A;  2Q2E B;  3J80 S;  4DV2 M;  4DV4 M;  2F5O A;  1MX0 A;  1Z5B A;  3VK8 A;  1TDZ A;  3SAT A;  3GQ4 A;  1R2Z A;  2F4V M;  3A45 A;  1EE8 A;  1PM5 A;  1L2D A;  5A2Q S;  2EA0 A;  1MU5 A;  3U6C A;  2XZU A;  1L2B A;  4PD2 A;  4DR4 M;  4LF7 M;  3GPU A;  3T1H M;  4MB7 A;  4LFB M;  4GKK M;  3GPY A;  4JI6 M;  4DV5 M;  3U6L A;  3C58 A;  4DR1 M;  3JR4 A;  2UXB M;  3SAS A;  4DUZ M;  4JV5 M;  2OQ4 A;  5LMN M;  1XMQ M;  1Z5A A;  2ZBK B;  4LF8 M;  2HKJ A;  1L1Z A;  4B3M M;  4JI0 M;  2F5P A;  1J5E M;  1N32 M;  4NXM M;  3TWL A;  1N33 M;  2HHH M;  3TWM A;  1Z59 A;  5BR8 M;  3A46 A;  3U6Q A;  4NRW A;  4OX9 M;  2F5Q A;  2UUB M;  5ITX E;  4LF9 M;  1K3W A;  2VQF M;  4NXN M;  3GO8 A;  1L2C A;  4GKJ M;  4PCZ A;  1KFV A;  4K0K M;  4LFA M;  4DV7 M;  4B3S M;  3U6D A;  4DR2 M;  1PJI A;  1Q3B A;  1TDH A;  3GQ3 A;  3SAR A;  1N34 M;  2XZF A;  1XC8 A;  4YHH M;  4X64 M;  1IBK M;  1Z5C A;  5IT9 S;  4DR7 M;  4DV3 M;  4X62 M;  4DV0 M;  1I94 M;  2UXD M;  5ITY A;  5ITR A;  5ITX A;  5IWA M;  4JI1 M;  3SAV A;  1N36 M;  1HR0 M;  1K3X A;  1XMO M;  3SAW A;  2UUA M;  3U6E A;  2UUC M;  4JI2 M;  3J81 S;  4DR6 M; 
#chains in the Genus database with same CATH topology
 1ORY B;  4AZF A;  2DAM A;  4JI3 M;  3ZC7 B;  2EKK A;  2I7N A;  1L1T A;  1GJT A;  3J27 B;  2WSF F;  3U61 A;  3MK6 A;  4L16 A;  4REZ A;  2R4E A;  4AI6 A;  2LWX A;  1W5S A;  1E9S A;  2VDB B;  4G4R A;  4LG2 A;  3CTW B;  4AQY M;  3U6O A;  5ITQ A;  1NV8 A;  4PDI A;  2KNA A;  4MGH A;  2FH0 A;  2J7N A;  5ITT A;  3U5Z B;  1XNQ M;  4OVZ B;  3HKP A;  3K1J A;  4LF6 M;  2D7H A;  4HEO A;  4KHP M;  1D0K A;  1NSF A;  2CHG A;  3WHK A;  1JB0 F;  4YY3 M;  4P16 A;  1FNN A;  2EO2 A;  1V92 A;  2C9C A;  2L6O A;  3KW6 A;  3UGJ A;  2F5N A;  5KPR A;  4JI7 M;  3MHV C;  4FW9 A;  2DWN A;  3KDS E;  1NY5 A;  1K82 A;  4IJE A;  4Q7J A;  4NRV A;  3ZCB B;  3HHX A;  2Y0Q A;  2C9O A;  3DOA A;  3GLI B;  1BVS A;  1SG9 A;  2CRU A;  2MR9 A;  3HX3 A;  4M0D A;  2R44 A;  4A3V B;  3TWK A;  5JI2 E;  1GLN A;  5IRE B;  3KP0 E;  4L6V 6;  4RF0 A;  1IN4 A;  1AUA A;  2OOA A;  4LCB A;  1XHB A;  2EUC A;  1IBL M;  4MGK E;  5KPZ A;  3EIE A;  4FWH A;  4GHL A;  1Q3C A;  1VEG A;  3L26 A;  2WSE F;  5C1B A;  2K0B X;  2R45 A;  3L27 A;  2YR0 A;  1HT2 E;  2EKF A;  5EXS A;  4DV4 M;  1E32 A;  3QYE A;  1MX0 A;  1QQW A;  4Z6Y A;  1YLA A;  3LQQ A;  4RF1 A;  3FUT A;  2C96 A;  3GQ4 A;  3A45 A;  1R2Z A;  3FRH A;  2XH9 A;  4FD2 A;  3UK6 A;  3CF2 A;  2R4J A;  4LJ9 A;  2DZL A;  2R46 A;  3QYB A;  4OW0 A;  1L2B A;  2X49 A;  1GVN A;  2KRU A;  4LF7 M;  2VII A;  4LRS A;  4L8R C;  3PFI A;  3GPY A;  1HQY E;  2ZAM A;  3U6L A;  2DAG A;  1IN7 A;  3AKZ A;  1OIZ A;  2DXI A;  3KOZ E;  1GL7 A;  3AOE C;  2ZBK B;  4LF8 M;  2RKO A;  4IIW A;  3TWL A;  1WR1 B;  3B7Z A;  1CUK A;  2ZAN A;  3KSJ A;  4RNA A;  2D7G A;  1QDT A;  1H6U A;  3WHL A;  4FWD A;  1EFU B;  4KOD A;  4OX9 M;  2Z4S A;  1VG5 A;  3PNY A;  4LJ4 A;  4D81 A;  2V6Z M;  2LXE A;  4PCZ A;  2HWJ A;  4MGY E;  2FNA A;  4B3S M;  2JXN A;  3THG A;  7CAT A;  5EXX A;  4DR2 M;  3KSX A;  3U60 B;  4RKU F;  4B7F A;  2KHH A;  3GQ3 A;  1PRB A;  2OOB A;  5KQD A;  1IXS A;  5EP2 A;  3PXG A;  4YHH M;  1SXJ A;  1NO1 A;  5E26 A;  1HQC A;  2FFJ A;  5IT9 S;  2HCB A;  5KO3 A;  2DVW B;  1TTE A;  2O01 F;  4X62 M;  4DV0 M;  1NHG C;  3IEC A;  2XEP A;  4D80 A;  4JI1 M;  3SHG B;  1DO2 A;  3KVW A;  2JWS A;  1X37 A;  1XXH B;  4G6Z A;  3SAW A;  1PJT A;  2DZN B;  2UUA M;  3BOS A;  3U6E A;  2UUC M;  1R4G A;  3J81 S;  3AL0 C;  1OJL A;  3M6A A;  1VEJ A;  3W68 A;  3CF0 A;  2MGW A;  3C9P A;  2O5R A;  3UJN A;  1DGG A;  3L25 A;  4DUY M;  4LGY A;  1IXZ A;  3A42 A;  4AW4 A;  5BPV A;  3OTO M;  1AIP C;  3GRU A;  1IBM M;  4WW0 A;  4F1I A;  1XNR M;  2JZ0 A;  4G4N A;  2Y0T A;  2LHC A;  5H37 D;  1UM8 A;  3I04 M;  2DKL A;  3L29 A;  2QZ4 A;  2D7E A;  1A5T A;  3SBJ A;  4AKH A;  2JP7 A;  2Z8Y M;  2ZTD A;  3DFZ A;  1E9R A;  1HJP A;  4NOO B;  4LJ6 A;  1C7Y A;  4JYA M;  1D0L A;  2CV2 A;  2QPA A;  3FTF A;  2XLJ A;  3HU3 A;  4MGZ E;  3GLG E;  5FLX S;  2J7O A;  1HNZ M;  1GL6 A;  2JA2 A;  3U6S A;  5DYG A;  4WUR A;  4LF4 M;  5ITU A;  4KO8 A;  1IM2 A;  1NNU C;  3GRR A;  5EXT A;  2L2D A;  1R2Y A;  4JI5 M;  3HY5 A;  3W0L B;  2L09 A;  2CEA A;  2ERC A;  4CGY B;  4G4O A;  3FTD A;  4G4Q A;  3U5Z A;  1QAO A;  1C1K A;  2ZM6 M;  3NBI A;  2VF8 A;  2UU9 M;  3KOW E;  1MJG M;  3J7A S;  1G41 A;  1WGN A;  1GJS A;  3SMP A;  3FTE A;  1TH3 A;  2WZJ A;  1DGB A;  1W5T A;  2QEN A;  1PGY A;  1IXS B;  1VEK A;  2CV1 A;  4QOS A;  1RU3 A;  3J80 S;  1N77 A;  4I8O A;  3HJQ A;  2KZU A;  4GMQ A;  3HZJ A;  3T15 A;  2F4V M;  4MGI E;  3GLF A;  1PJS A;  1EE8 A;  2L7H A;  3Q8G A;  3GLF B;  1PM5 A;  3FKE A;  2DZO B;  3HHW A;  1MU5 A;  4PD2 A;  4DR4 M;  1R7R A;  3CF6 E;  5KQ8 A;  3GPU A;  1R5L A;  2LTU A;  4GRI A;  4MB7 A;  1QUS A;  4LFB M;  4GKK M;  2J5Y A;  1J7K A;  1G8P A;  4JI6 M;  3HGI A;  1I4W A;  1YUB A;  3C58 A;  3F92 A;  2KW0 A;  3C3D A;  2ZAO A;  1TH4 A;  3FRI A;  4L15 A;  3SYL A;  2Z7J A;  2GQF A;  1XMQ M;  1TGU A;  2QBY A;  1L1Z A;  3AJI B;  4JI0 M;  1QAN A;  1N32 M;  4CJ6 A;  5FTK A;  1N33 M;  4XK8 F;  4GIT A;  3TWM A;  1Z59 A;  2M5Z A;  5BR8 M;  2CWB A;  4Y28 F;  5GKN A;  2F5Q A;  2VQF M;  4NXN M;  3SMS A;  4AKI A;  3VLF B;  2JY6 B;  4IBD A;  1KFV A;  1D0M A;  5DFL A;  3VKG A;  2LNH C;  3HHZ A;  1NVM A;  2JY5 A;  1G59 A;  1Q3B A;  3SAR A;  2AHM A;  3M7G A;  3RE8 A;  5DYI A;  2XZF A;  1XC8 A;  1N34 M;  3R9X B;  4X64 M;  4IBJ A;  1Z5C A;  3Q8X A;  3GLH A;  3KS4 A;  2LVO C;  2RRU A;  4PT5 A;  3B74 A;  1I94 M;  1NV9 A;  2XFT A;  2UXD M;  1WIV A;  5ITY A;  5IWA M;  4M9Z A;  4R3D A;  3C3E A;  3FE3 A;  3GLF E;  3FYC A;  1ZMW A;  2LBC A;  3IG5 A;  4XBO A;  3DZD A;  4OU7 A;  3KP1 E;  4DR6 M;  3FTC A;  3FUU A;  5E6J A;  3VDP A;  3W0F A;  4M9S A;  3ZH9 B;  3TQS A;  2Z3X A;  2CE7 A;  2K9D A;  2LVQ D;  3SYK A;  2OPF A;  1Q39 A;  2DI0 A;  3BBZ A;  1NNJ A;  3GLH E;  4GHA A;  1D2N A;  3GPX A;  1YSY A;  1QAQ A;  2DEN A;  3FYD A;  4FCW A;  2E5L M;  3D8B A;  3VKH A;  3HJ8 A;  3TL4 X;  2UXC M;  2RGH A;  2N35 A;  1G4A E;  1NJG A;  3HHY A;  4DR3 M;  1QYR A;  2VQE M;  3H4M A;  1IN5 A;  3K92 A;  4B3R M;  4WP2 A;  2P5T A;  1SXJ B;  1ZMV A;  1ZV1 A;  4X65 M;  1WXQ A;  1WJ7 A;  1Z6T A;  2Y20 A;  4UN2 B;  4DV1 M;  3AFH A;  4M9X A;  1DGH A;  2HL7 A;  1L8Q A;  3SFZ A;  1N78 A;  3U61 B;  3FUW A;  4B7G A;  3GLG A;  3RFW A;  3U6P A;  2WSC F;  1OKS A;  1QVR A;  1JR3 E;  1FJG M;  1E94 E;  4NSO B;  2APL A;  2B3T A;  3I4V A;  3RGP A;  4AKG A;  4LFC M;  4I4L A;  2XFS A;  2XSZ A;  1PJJ A;  4GEW A;  1OFI A;  4AG6 A;  5FTJ A;  5DNY A;  5FSW A;  2KZS A;  4X66 M;  4G3O A;  3GPP A;  3QAU A;  2I7P A;  3IHP A;  4GC9 A;  1HNX M;  3GQ5 A;  1TF0 B;  1MN3 A;  3J2P B;  1IY0 A;  4QNR A;  4JI4 M;  1XWI A;  1EIJ A;  3FUV A;  3GP1 A;  2Q2E B;  2RGO A;  3JR5 A;  2W82 A;  4DV2 M;  3HJS A;  2YNM D;  1KSF X;  1Z5B A;  2XF3 A;  3QWL A;  1DGH B;  4KLN A;  3CGW A;  1V34 A;  4LGM A;  1L2D A;  1GKI A;  1XXH A;  4MH0 E;  2EA0 A;  1LV7 A;  3KOY E;  3U6C A;  2XZU A;  2KNV A;  5F3W A;  5EP1 A;  3HU2 A;  4GH9 A;  4OVZ A;  2DHY A;  2LVN C;  3SC3 A;  1VDL A;  2FS1 A;  1SXJ E;  1IY2 A;  2BJW A;  4DV5 M;  3TE6 A;  1TH2 A;  2OO9 A;  2UXB M;  3SAS A;  3ZQJ A;  3DA1 A;  2QQ8 A;  4DBG B;  2DAK A;  3GRV A;  3MJ5 A;  2OQ4 A;  5LMN M;  1Z5A A;  4JXJ A;  4IJF A;  4B3M M;  1XB2 B;  4IBC A;  4L4U A;  2MRO B;  2O25 A;  1T43 A;  3NBX X;  3HWS A;  3A46 A;  4NRW A;  1GO5 A;  3E4R A;  3H4J A;  4LF9 M;  1K3W A;  4S12 A;  4W5W A;  3GO8 A;  1L2C A;  3T38 A;  4KT0 F;  2V1U A;  4K0K M;  4LFA M;  2QHO B;  4I81 A;  3GLI A;  2HAK A;  1SXJ D;  1IQP A;  2ZTC A;  3J7B A;  4IBB A;  1TDH A;  4JN6 A;  4CIZ A;  2XSZ D;  4JI8 M;  3GLH B;  1IBK M;  3GLG B;  3FD9 A;  1IY1 A;  3K9O A;  2FOI C;  2X8A A;  3HU1 A;  5IZ7 D;  3LCU A;  4DR7 M;  2YQZ A;  4DV3 M;  2JNH A;  2R65 A;  1S3S A;  4IBF A;  1XXH E;  4LJ7 A;  5ITX A;  4AG5 A;  5ITR A;  2DHR A;  4NSR A;  3K2L A;  1N36 M;  2BWE A;  1XMO M;  1TR8 A;  4ANR A;  2CHQ A;  2CV0 A;  4XGI A;  2QBY B;  2JZ1 A;  3L28 A;  2NQ8 C;  4IBK A;  3SHF A;  5FTL A;  4JI2 M;  3GRY A;  3I4Y A;  2BJV A;  4LY6 A;  1LTM A;  2DAI A;  4NC6 A;  3T6P A;  3SAU A;  3ILK A;  5LMU M;  4R71 A;  2KA6 B;  1Q02 A;  3B7N A;  2R62 A;  3M0E A;  5EJC A;  4EIW A;  3KFU G;  2YFQ A;  2R0I A;  1J09 A;  3LMM A;  1OAI A;  2H5X A;  2QSF X;  1QZM A;  2Z4R A;  3EIH A;  4LJ8 A;  1OAO C;  3VDU A;  1UFZ A;  2GNO A;  3UMM A;  4TUW A;  2CFO A;  4LJA A;  4NL4 H;  5L8R F;  2DNA A;  2LH0 A;  4CHT B;  2C99 A;  1OIP A;  1IN6 A;  1G3I A;  5FTM A;  1QZE A;  2M60 A;  4B3T M;  2JY8 A;  4II7 A;  1DO0 A;  2QP9 X;  3T1Y M;  3TPZ A;  2F5S A;  4M0W A;  1OQY A;  4PDG A;  3VK7 A;  1KYI A;  2VF7 A;  3KOX E;  1VDD A;  1IXR C;  2K6B A;  3W67 A;  1OTR A;  5JI3 E;  1YE9 A;  2QCU A;  4ITQ A;  3B89 A;  2KXE A;  2KNZ A;  4HLQ A;  3I01 M;  2LVA A;  3RGS A;  4DV6 M;  4FCT A;  2XGN A;  2JUJ A;  1WGL A;  1DGF A;  2G3Q A;  3MMP A;  5FTN A;  3JAM S;  1QUT A;  1NJF A;  2CHV A;  3BXW A;  1ZMU A;  3L2A A;  4QHS A;  1R6B X;  2QNJ A;  2CP8 A;  4ZPX A;  1HNW M;  4DR5 M;  1NY6 A;  4LF5 M;  1QDR A;  3NWL A;  2CUZ A;  4LJ5 A;  4MM3 B;  3R8F A;  3B9P A;  3U6M A;  1IN8 A;  2BWB A;  4CIS A;  5KPT A;  1P3Q Q;  1QAM A;  1ZQ9 A;  2F5O A;  4LZJ A;  1G71 A;  3LW5 F;  4IBI A;  2C98 A;  2FE8 A;  3VK8 A;  1TDZ A;  1VQ1 A;  3SAT A;  3E21 A;  1ZAE A;  4R7G A;  1DV0 A;  4I5S A;  1NHW C;  3UZU A;  1V33 A;  1PJQ A;  3LVV A;  1T6O A;  2DAE A;  5A2Q S;  1GAB A;  3E46 A;  4FCV A;  3LCV B;  2KEB A;  4QHT A;  4F2L A;  2KRK A;  4GC5 A;  3K9P A;  3D8L A;  1SXJ C;  4LRT A;  8CAT A;  3T1H M;  2DWM A;  3PVS A;  1JQJ C;  3A98 B;  3KS8 A;  3I51 A;  2L7I A;  1IFY A;  3LQR A;  4DR1 M;  2DWZ B;  1WHC A;  3FUX A;  3JR4 A;  4HL4 A;  1F4I A;  2R6F A;  2Y21 A;  2A5Y B;  3KXE C;  4DUZ M;  4JV5 M;  1JR3 A;  2HKJ A;  2F5P A;  2BNK A;  4B08 A;  1J5E M;  1HT1 E;  4NXM M;  3V76 A;  2HHH M;  4L78 A;  4QOZ C;  3K8Z A;  4BB9 A;  2LHG A;  4FVM A;  4QNM A;  3VFD A;  3U6Q A;  2L4E A;  4Z8X A;  2UUB M;  5ITX E;  2MJ5 B;  3AOE A;  2MH8 A;  1JR3 D;  2C5R A;  3AOG A;  4B7H A;  4GKJ M;  4GIP A;  4IBE A;  3E9S A;  4DV7 M;  4LZZ A;  4P17 A;  3U6D A;  3AV0 A;  1PJI A;  2X4A A;  2V1C A;  3U60 A;  5EP4 A;  1OFH A;  2K47 A;  2JY7 A;  5EP3 A;  4FWG A;  2LVP C;  3IG8 A;  3GLI E;  3PNV A;  3LVW A;  5EXP A;  4D82 A;  1Y8G A;  5EQT A;  2R18 A;  3SAV A;  1HR0 M;  1K3X A;  3B7Q A;  4BBA A;  1N75 A;  2L4F A;  4IBG A;  4BLC A;  2G8L A;  1T3T A;  2G5G X;  5C18 A;  2EJS A;  2H1R A;  2DWL A;  2KDL A; 
#chains in the Genus database with same CATH homology
 1ORY B;  4AZF A;  4JI3 M;  3ZC7 B;  1L1T A;  2I7N A;  3J27 B;  3U61 A;  3MK6 A;  4L16 A;  4REZ A;  2R4E A;  4AI6 A;  2LWX A;  1W5S A;  1E9S A;  4G4R A;  4LG2 A;  3CTW B;  4AQY M;  3U6O A;  5ITQ A;  4PDI A;  4MGH A;  5ITT A;  2J7N A;  3U5Z B;  1XNQ M;  4OVZ B;  3HKP A;  3K1J A;  4LF6 M;  2D7H A;  4KHP M;  1NSF A;  2CHG A;  3WHK A;  4YY3 M;  4P16 A;  1FNN A;  2EO2 A;  2C9C A;  2F5N A;  4JI8 M;  3KW6 A;  3UGJ A;  5KPR A;  4JI7 M;  3MHV C;  4FW9 A;  2DWN A;  3KDS E;  1NY5 A;  1K82 A;  4IJE A;  4NRV A;  3ZCB B;  3HHX A;  2Y0Q A;  2C9O A;  3DOA A;  3GLI B;  4M0D A;  4A3V B;  3TWK A;  5JI2 E;  1GLN A;  5IRE B;  3KP0 E;  4RF0 A;  1IN4 A;  4LCB A;  1XHB A;  2EUC A;  1IBL M;  4MGK E;  5KPZ A;  3EIE A;  4FWH A;  4GHL A;  1Q3C A;  3L26 A;  5C1B A;  2R45 A;  3L27 A;  2YR0 A;  1HT2 E;  5EXS A;  4DV4 M;  1E32 A;  1MX0 A;  1QQW A;  4Z6Y A;  3LQQ A;  4RF1 A;  3FUT A;  2C96 A;  3GQ4 A;  3A45 A;  1R2Z A;  2XH9 A;  4FD2 A;  3UK6 A;  3CF2 A;  2R4J A;  4LJ9 A;  1L2B A;  2R46 A;  4OW0 A;  2X49 A;  1GVN A;  2KRU A;  4LF7 M;  2VII A;  4LRS A;  4L8R C;  3PFI A;  3GPY A;  1HQY E;  2ZAM A;  3U6L A;  1IN7 A;  3AKZ A;  2DXI A;  3KOZ E;  1GL7 A;  3AOE C;  2ZBK B;  4LF8 M;  2RKO A;  4IIW A;  3TWL A;  4RNA A;  2ZAN A;  3WHL A;  3KSJ A;  2D7G A;  1H6U A;  4FWD A;  4KOD A;  4OX9 M;  2Z4S A;  3PNY A;  4LJ4 A;  4D81 A;  2V6Z M;  2LXE A;  4PCZ A;  4MGY E;  2FNA A;  4B3S M;  3THG A;  7CAT A;  5EXX A;  4DR2 M;  3KSX A;  3U60 B;  4B7F A;  3GQ3 A;  5KQD A;  5EP2 A;  3PXG A;  4YHH M;  1SXJ A;  5E26 A;  1HQC A;  2FFJ A;  5IT9 S;  2HCB A;  5KO3 A;  2DVW B;  4X62 M;  4DV0 M;  1NHG C;  2XEP A;  4D80 A;  4JI1 M;  3SHG B;  1DO2 A;  3KVW A;  1X37 A;  1XXH B;  4G6Z A;  3SAW A;  2DZN B;  2UUA M;  3BOS A;  3U6E A;  2UUC M;  3J81 S;  3AL0 C;  1OJL A;  3M6A A;  3CF0 A;  3UJN A;  2O5R A;  3L25 A;  1DGG A;  4DUY M;  4LGY A;  1IXZ A;  3A42 A;  4AW4 A;  5BPV A;  3OTO M;  3GRU A;  1IBM M;  4WW0 A;  1XNR M;  4G4N A;  2Y0T A;  5H37 D;  1UM8 A;  3L29 A;  2QZ4 A;  2D7E A;  3SBJ A;  4AKH A;  3DFZ A;  1E9R A;  4NOO B;  4LJ6 A;  4JYA M;  2CV2 A;  2QPA A;  3FTF A;  2XLJ A;  3HU3 A;  4MGZ E;  5FLX S;  2J7O A;  1HNZ M;  1GL6 A;  2JA2 A;  3U6S A;  5DYG A;  4WUR A;  4LF4 M;  5ITU A;  4KO8 A;  1IM2 A;  1NNU C;  3GRR A;  5EXT A;  1R2Y A;  4JI5 M;  3W0L B;  2L09 A;  2CEA A;  2ERC A;  4CGY B;  4G4O A;  3FTD A;  4G4Q A;  3U5Z A;  1QAO A;  1C1K A;  2ZM6 M;  3NBI A;  2UU9 M;  3KOW E;  3J7A S;  1G41 A;  3SMP A;  3FTE A;  1TH3 A;  1DGB A;  1W5T A;  2QEN A;  1IXS B;  2CV1 A;  4QOS A;  3J80 S;  1N77 A;  4I8O A;  3HJQ A;  2KZU A;  4GMQ A;  3T15 A;  2F4V M;  4MGI E;  3GLF A;  1PM5 A;  1EE8 A;  2L7H A;  3GLF B;  3FKE A;  2DZO B;  3HHW A;  1MU5 A;  4PD2 A;  4DR4 M;  1R7R A;  3CF6 E;  5KQ8 A;  3GPU A;  4GRI A;  4LFB M;  4MB7 A;  4GKK M;  1J7K A;  1G8P A;  4JI6 M;  3HGI A;  1I4W A;  1YUB A;  3C58 A;  2KW0 A;  2ZAO A;  1TH4 A;  3SYL A;  4L15 A;  2Z7J A;  1XMQ M;  1TGU A;  2QBY A;  1L1Z A;  3AJI B;  4JI0 M;  1QAN A;  1N32 M;  5FTK A;  1N33 M;  4GIT A;  3TWM A;  1Z59 A;  2M5Z A;  5BR8 M;  5GKN A;  2F5Q A;  2VQF M;  4NXN M;  3SMS A;  4AKI A;  3VLF B;  4IBD A;  1KFV A;  3VKG A;  2LNH C;  3HHZ A;  1NVM A;  1G59 A;  1Q3B A;  3SAR A;  2AHM A;  3M7G A;  3RE8 A;  5DYI A;  2XZF A;  1XC8 A;  1N34 M;  3R9X B;  4X64 M;  4IBJ A;  1Z5C A;  3Q8X A;  3GLH A;  3KS4 A;  4PT5 A;  1I94 M;  2XFT A;  2UXD M;  5ITY A;  5IWA M;  4M9Z A;  4R3D A;  3FYC A;  4XBO A;  3IG5 A;  3DZD A;  4OU7 A;  3KP1 E;  4DR6 M;  3FUU A;  3FTC A;  5E6J A;  3VDP A;  3W0F A;  4M9S A;  3ZH9 B;  3TQS A;  2Z3X A;  2CE7 A;  3SYK A;  2OPF A;  1Q39 A;  1NNJ A;  4GHA A;  1D2N A;  3GPX A;  1YSY A;  1QAQ A;  3FYD A;  4FCW A;  2E5L M;  3D8B A;  3VKH A;  3HJ8 A;  3TL4 X;  2UXC M;  2RGH A;  1G4A E;  1NJG A;  3HHY A;  4DR3 M;  1QYR A;  2VQE M;  3H4M A;  1IN5 A;  3K92 A;  4B3R M;  2P5T A;  1SXJ B;  4X65 M;  1WXQ A;  2Y20 A;  1Z6T A;  4DV1 M;  3AFH A;  4M9X A;  1DGH A;  2HL7 A;  1L8Q A;  3SFZ A;  1N78 A;  3U61 B;  3FUW A;  4B7G A;  3GLG A;  3RFW A;  3U6P A;  1QVR A;  1FJG M;  1E94 E;  4NSO B;  3I4V A;  3RGP A;  4AKG A;  4LFC M;  4I4L A;  2XFS A;  2XSZ A;  1PJJ A;  1OFI A;  4AG6 A;  5FTJ A;  5DNY A;  5FSW A;  2KZS A;  4X66 M;  3GPP A;  3QAU A;  2I7P A;  4GC9 A;  1HNX M;  3GQ5 A;  3J2P B;  1IY0 A;  4QNR A;  4JI4 M;  1XWI A;  3FUV A;  3GP1 A;  2Q2E B;  2RGO A;  3JR5 A;  2W82 A;  4DV2 M;  3HJS A;  2YNM D;  1KSF X;  1Z5B A;  2XF3 A;  3QWL A;  1DGH B;  4KLN A;  4LGM A;  1L2D A;  1GKI A;  1XXH A;  4MH0 E;  2EA0 A;  1LV7 A;  3KOY E;  3U6C A;  2XZU A;  5F3W A;  5EP1 A;  3HU2 A;  4GH9 A;  4OVZ A;  3SC3 A;  1SXJ E;  1IY2 A;  2BJW A;  4DV5 M;  3TE6 A;  1TH2 A;  2UXB M;  3SAS A;  3DA1 A;  3GRV A;  3MJ5 A;  2OQ4 A;  5LMN M;  1Z5A A;  4JXJ A;  4IJF A;  4B3M M;  4IBC A;  4L4U A;  3HWS A;  3A46 A;  4NRW A;  3E4R A;  4LF9 M;  1K3W A;  4S12 A;  4W5W A;  3GO8 A;  1L2C A;  3T38 A;  2V1U A;  4K0K M;  4LFA M;  4I81 A;  3GLI A;  1SXJ D;  1IQP A;  4IBB A;  3J7B A;  4JN6 A;  1TDH A;  2XSZ D;  3GLH B;  1IBK M;  3GLG B;  3FD9 A;  1IY1 A;  2FOI C;  2X8A A;  3HU1 A;  5IZ7 D;  4DR7 M;  2YQZ A;  4DV3 M;  2R65 A;  4IBF A;  1S3S A;  4LJ7 A;  4AG5 A;  5ITR A;  5ITX A;  2DHR A;  4NSR A;  3K2L A;  1N36 M;  1XMO M;  2CHQ A;  2CV0 A;  4XGI A;  2QBY B;  3L28 A;  3SHF A;  2NQ8 C;  4IBK A;  5FTL A;  4JI2 M;  3GRY A;  3I4Y A;  2BJV A;  4LY6 A;  3SAU A;  3ILK A;  5LMU M;  2KA6 B;  4EIW A;  3M0E A;  2R62 A;  5EJC A;  3KFU G;  2YFQ A;  1J09 A;  3LMM A;  1QZM A;  2Z4R A;  3EIH A;  4LJ8 A;  3VDU A;  3UMM A;  4TUW A;  2CFO A;  4LJA A;  4NL4 H;  2LH0 A;  4CHT B;  2C99 A;  1IN6 A;  1G3I A;  5FTM A;  2M60 A;  4B3T M;  4II7 A;  1DO0 A;  2QP9 X;  3T1Y M;  3TPZ A;  2F5S A;  4M0W A;  4PDG A;  3VK7 A;  1KYI A;  3KOX E;  1VDD A;  1IXR C;  5JI3 E;  1YE9 A;  2QCU A;  4ITQ A;  2KXE A;  4HLQ A;  3RGS A;  4DV6 M;  4FCT A;  2XGN A;  1DGF A;  5FTN A;  3JAM S;  1NJF A;  2CHV A;  3L2A A;  4QHS A;  1R6B X;  4ZPX A;  1HNW M;  4DR5 M;  1NY6 A;  4LF5 M;  4LJ5 A;  3NWL A;  2CUZ A;  4MM3 B;  3R8F A;  3B9P A;  3U6M A;  1IN8 A;  4CIS A;  5KPT A;  1QAM A;  1ZQ9 A;  2F5O A;  4LZJ A;  4IBI A;  2C98 A;  2FE8 A;  3VK8 A;  1TDZ A;  3SAT A;  1ZAE A;  4R7G A;  4I5S A;  1NHW C;  3UZU A;  3LVV A;  5A2Q S;  4FCV A;  2KEB A;  4QHT A;  2KRK A;  4GC5 A;  4LRT A;  3D8L A;  1SXJ C;  8CAT A;  3T1H M;  2DWM A;  3PVS A;  1JQJ C;  3A98 B;  3KS8 A;  3I51 A;  2L7I A;  3LQR A;  4DR1 M;  2DWZ B;  3FUX A;  3JR4 A;  4HL4 A;  2Y21 A;  2A5Y B;  3KXE C;  4DUZ M;  4JV5 M;  1JR3 A;  2HKJ A;  2F5P A;  2BNK A;  4B08 A;  1J5E M;  1HT1 E;  4NXM M;  2HHH M;  4L78 A;  4QOZ C;  3K8Z A;  4BB9 A;  4FVM A;  4QNM A;  3VFD A;  3U6Q A;  4Z8X A;  2UUB M;  5ITX E;  3AOE A;  1JR3 D;  2C5R A;  3AOG A;  4B7H A;  4GKJ M;  4GIP A;  4IBE A;  3E9S A;  4DV7 M;  4LZZ A;  3U6D A;  3AV0 A;  1PJI A;  2X4A A;  2V1C A;  3U60 A;  5EP4 A;  1OFH A;  2K47 A;  5EP3 A;  4FWG A;  3IG8 A;  3PNV A;  3LVW A;  5EXP A;  4D82 A;  5EQT A;  2R18 A;  3SAV A;  1HR0 M;  1K3X A;  4BBA A;  1N75 A;  4IBG A;  4BLC A;  2G8L A;  1T3T A;  2G5G X;  5C18 A;  2DWL A;  2H1R A;  2L6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...