1HNWM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hnwM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hnwM02
1KFVA 3SASA 4G4QA 4OX9M 4G4NA 1Q3CA 3SBJA 4KHPM 2VQEM 2OQ4A 1TDZA 1I94M 1N33M 3GPYA 3VK8A 5ITRA 1N36M 4JI1M 3U6EA 5ITXA 2UXDM 4DUYM 4YY3M 3W0FA 1K3WA 4LFAM 4DR3M 4PCZA 3JR5A 3SATA 1PM5A 3A46A 4LF9M 4DUZM 4LFCM 1EE8A 4DV6M 1PJIA 4JI8M 5LMUM 1Z5AA 2F5SA 5LMNM 3SAVA 2HHHM 2OPFA 1MU5A 4B3MM 4B3SM 4K0KM 4DR5M 3VK7A 5A2QS 1IBMM 1XC8A 1L1TA 1HNXM 2F5PA 3J80S 4NRVA 5IWAM 1R2YA 4DR2M 1XMOM 3GPXA 4AQYM 1IBKM 2UU9M 4ITQA 4DV2M 1L2BA 1R2ZA 5ITXE 4DV3M 3T1YM 4LF5M 3U6CA 1N32M 4NXMM 4LF6M 4NRWA 2VQFM 1K3XA 4JI7M 4MB7A 4DR4M 4PD2A 4PDIA 4DR6M 4DR1M 1Z5CA 2F5NA 4G4RA 4JI6M 2EA0A 3SAUA 4YHHM 2F5OA 2UXCM 3U6MA 2F5QA 3GPPA 5ITQA 1HR0M 5ITUA 5FLXS 2F4VM 1L2DA 5ITYA 3GP1A 4DV1M 4LF8M 4GKKM 1J5EM 2HKJA 3OTOM 1MX0A 4G4OA 3U6LA 1XNQM 4JV5M 2ZBKB 3JR4A 2UUCM 1K82A 1HNZM 3C58A 3GQ4A 4DV5M 5IT9S 1XNRM 3U6PA 3GQ3A 4JI4M 4JI3M 3GPUA 1L1ZA 3SARA 2Q2EB 1Z59A 3J81S 3T1HM 3U6DA 1Q3BA 5BR8M 2XZFA 1L2CA 3U6QA 3DOAA 1XMQM 1N34M 2XZUA 3U6SA 4JI5M 3JAMS 2E5LM 4LFBM 3SAWA 2UXBM 1FJGM 3TWLA 1PJJA 4X62M 4DV4M 4DV7M 4GKJM 3GQ5A 4LF7M 1NNJA 3TWMA 4NXNM 2UUBM 4LF4M 4PDGA 4CISA 3A42A 1Q39A 4X65M 2ZM6M 4JI2M 3U6OA 2UUAM 1HNWM 4B3RM 5ITTA 1IBLM 4JI0M 3J7AS 3GO8A 4JYAM 4DR7M 3TWKA 1TDHA 1Z5BA 4X64M 4X66M 3A45A 4DV0M 4B3TM
chains in the Genus database with same CATH superfamily
1R6BX 1HJPA 3C3EA 4OX9M 1KSFX 1AIPC 3GLGA 1NO1A 2R0IA 3QAUA 4D81A 2HL7A 2Z3XA 2DVWB 3ZC7B 3VK8A 5FTNA 1N33M 3FTCA 3E4RA 4L16A 1N36M 4JI1M 1W5TA 2EKKA 2UXDM 4IBKA 2DZLA 5KPRA 4IBCA 1TH2A 1K3WA 4I81A 4W5WA 1GABA 4PCZA 1HT1E 1TH4A 4NC6A 5E6JA 3SATA 2KNZA 1PM5A 4M0DA 3A46A 2OO9A 4DUZM 2CV1A 3B7QA 4LFCM 1NNUC 3KDSE 1JR3E 3L29A 1XHBA 2XGNA 4JI8M 1Z5AA 4LG2A 2HHHM 4IJEA 3QYBA 3HJQA 4B3MM 4B3SM 1EIJA 1IN5A 3SHGB 4DR5M 3CGWA 3CF0A 2CHQA 3FUWA 2FFJA 2F5PA 1HT2E 1BVSA 4NRVA 1WXQA 5IWAM 1G8PA 3K9PA 3VFDA 4DR2M 2DKLA 1GJSA 5DYGA 3Q8XA 4LJ6A 4OU7A 4QHSA 2BJVA 1WGLA 1QZEA 4LF5M 3I04M 2KHHA 3HZJA 4WW0A 4LF6M 5EJCA 1IXSB 1QUSA 4L4UA 4NL4H 2Y20A 4CGYB 2VQFM 2YR0A 3U61A 1K3XA 3VDPA 1QZMA 4JI7M 2LVPC 2EO2A 4IJFA 4NSRA 1NHWC 2QZ4A 1Y8GA 2CRUA 2DNAA 1QAOA 3SAUA 1GVNA 4UN2B 3BOSA 4GITA 3U6MA 1ZMUA 1XXHB 4GHAA 4OW0A 3B7NA 2N35A 2KRUA 1HR0M 5H37D 2MH8A 5ITUA 3R8FA 3EIEA 1KYIA 4M9SA 2M60A 5EXPA 1TF0B 3MMPA 2BWBA 2R62A 1YUBA 3IG8A 2O25A 1QDTA 1QUTA 4I8OA 4GKKM 2M5ZA 3VDUA 1QVRA 5FTJA 3OTOM 3HHXA 5EXSA 2EKFA 3NBIA 2VDBB 2Y0TA 1ZMWA 2AHMA 3KP1E 1LV7A 1VQ1A 3I4VA 3RGSA 5KQDA 3GQ4A 4DV5M 4B7FA 5FSWA 3GQ3A 2O5RA 1NY6A 3DA1A 1GL6A 3L28A 2QPAA 1SXJB 3GRUA 3QYEA 4LJAA 1TGUA 3GLHA 2R4JA 3KOXE 1Q3BA 4IIWA 3KSXA 3R9XB 1L2CA 3DOAA 2FNAA 3E9SA 2Z8YM 2E5LM 5C18A 4DBGB 2UXBM 2KW0A 7CATA 4KLNA 4FWDA 3VKHA 4LGYA 1PRBA 2DAGA 3K2LA 1IN6A 3D8LA 4DV7M 2OOAA 1NNJA 4LGMA 4NXNM 4L8RC 4G6ZA 4R7GA 2K47A 4JI2M 4HLQA 1UM8A 2DENA 1DGHB 2R18A 2UUAM 1HNWM 1YSYA 4B3RM 5C1BA 3E21A 2BJWA 2HWJA 2LVQD 4GRIA 2DZNB 3K1JA 3C9PA 3LCUA 4OVZB 3UJNA 4LZZA 2O01F 3BXWA 2FE8A 2G5GX 1HQCA 3TE6A 2XH9A 4X64M 3Q8GA 4CHTB 2DHRA 2FS1A 3SASA 3HX3A 4G4NA 4KHPM 2L6OA 4R71A 2L2DA 2OQ4A 1I94M 2JA2A 3H4JA 1VG5A 2ZANA 5ITRA 2L4EA 2CUZA 3WHLA 3PNYA 4P16A 5ITXA 3T15A 3U6EA 1IFYA 1SXJD 1X37A 4S12A 1S3SA 1ZV1A 3A98B 3KOWE 2DHYA 4Q7JA 4CJ6A 3JR5A 4AKGA 3KS4A 4M9XA 2BNKA 5JI3E 1XB2B 1C1KA 1IN7A 5DNYA 3U60A 4LF9M 3AOGA 5KQ8A 1PJQA 4WP2A 2DWZB 2V6ZM 1L8QA 1QANA 4K0KM 4GEWA 2OPFA 4RNAA 5A2QS 1XC8A 2L7IA 1HNXM 3J80S 2DWNA 1DGFA 1GKIA 1OFHA 1NJFA 1DGGA 4R3DA 2KXEA 4GC9A 3HU1A 2JUJA 1D0LA 3W0LB 5ITXE 3AV0A 3KS8A 1ORYB 3FUVA 4B7GA 1NHGC 2DAIA 2Z4SA 1N32M 4NXMM 2X49A 2KNAA 4AW4A 3KOZE 1GO5A 2LHCA 2QCUA 3GLIB 1Z6TA 5E26A 4MB7A 2L09A 3IG5A 1SXJC 2EJSA 3FUXA 1Z5CA 3HY5A 1PJTA 4BBAA 1N78A 8CATA 4M9ZA 2D7HA 3GRVA 2F5OA 1TR8A 4TUWA 1T6OA 2ZAMA 3LVVA 5FLXS 3IHPA 2CE7A 2FOIC 3BBZA 3SMSA 5IREB 3GP1A 1EFUB 2R4EA 4JXJA 2VIIA 3GLIE 4Z8XA 3B89A 3ZH9B 3GLGB 1IXSA 3I4YA 1XNQM 3U6LA 1OTRA 3U5ZA 3MHVC 4Y28F 4ZPXA 2JY8A 3I51A 1IXZA 3GRYA 1J09A 3C58A 3UZUA 2ZTCA 2RGOA 3PVSA 3U6PA 1ZMVA 2JWSA 4NSOB 1I4WA 3FTEA 1E9RA 4JI3M 2QP9X 4FWHA 3KOYE 2CFOA 4D82A 4MGIE 3FD9A 4AZFA 3PXGA 2W82A 4AG5A 3HJSA 2KZUA 4FWGA 4L78A 2LVOC 3ZCBB 3U6SA 2XZUA 1LTMA 5EQTA 1G59A 2A5YB 4LFBM 2ERCA 1FJGM 1OQYA 2C98A 1IXRC 3FUTA 4DV4M 4GKJM 2XEPA 3I01M 4LJ9A 1E9SA 1IY0A 1WGNA 3KSJA 2XSZD 4EIWA 4FCWA 4PDGA 1Q39A 1CUKA 1DO2A 3A42A 3HHWA 4X65M 2QBYA 4REZA 3U6OA 5ITTA 1QDRA 3FTDA 3GRRA 3U61B 1XXHE 3KW6A 3GO8A 1D0KA 1IQPA 2KZSA 2LXEA 4IBGA 3TPZA 3TWKA 4QOSA 1MJGM 1TDHA 1Z5BA 1QAMA 3KFUG 4GHLA 1IY2A 2C5RA 5BPVA 4G4QA 2V1UA 1NSFA 2J7OA 4PT5A 2EUCA 1VEKA 2XFTA 1TDZA 4A3VB 3HHZA 3AFHA 2C99A 2V1CA 2H5XA 4IBDA 3M6AA 4WURA 3GPYA 2VF8A 3DZDA 2K9DA 4DUYM 4XK8F 4CIZA 3PFIA 3KVWA 2X8AA 2QHOB 2JY5A 3W0FA 2R45A 3VKGA 2L4FA 4OVZA 2CV0A 2MROB 3J2PB 1SXJE 3SMPA 3IECA 5EP1A 5L8RF 3FYDA 3SYKA 1PJIA 1NY5A 4FCVA 2H1RA 2F5SA 4BB9A 5LMNM 2KDLA 1MU5A 3VK7A 4L6V6 5JI2E 1IY1A 3MJ5A 1RU3A 4ITQA 1A5TA 4LY6A 4AQYM 1XMOM 4GMQA 5IZ7D 1VEJA 5EXTA 2Z4RA 2CHVA 4MGZE 5FTKA 1L2BA 2DXIA 1D0MA 2GNOA 3T38A 4AI6A 4DV3M 2HAKA 2QSFX 4G3OA 1R5LA 4NOOB 4NRWA 2FH0A 2K0BX 4PD2A 3AOEC 2DAKA 3KXEC 4DR1M 3L25A 1OIPA 4G4RA 2F5NA 2MR9A 4JI6M 3TL4X 1JQJC 4MM3B 1SG9A 2DAEA 1J7KA 1NV9A 2LH0A 3GLFB 2UXCM 2F5QA 4QNMA 2DZOB 4IBBA 3M0EA 2CHGA 4F1IA 3W68A 3HU2A 1TH3A 4JN6A 2YQZA 4HL4A 3B74A 1L2DA 2RRUA 4LJ5A 2JZ1A 4LF8M 1ZQ9A 2RKOA 3RFWA 2HKJA 3GLIA 1P3QQ 5KPZA 3LW5F 4B08A 1VDLA 2BWEA 3HU3A 2R65A 3JR4A 2UUCM 4IBJA 4RF1A 1E32A 1HNZM 4M0WA 3GLFE 2GQFA 1UFZA 1WJ7A 4MGYE 1Q02A 1XNRM 2LTUA 3AL0C 2XSZA 2LBCA 3CF6E 4JI4M 3GPUA 2WSCF 3SYLA 3SARA 5KO3A 1Z59A 4I4LA 2D7EA 5BR8M 4LJ4A 2G8LA 2XZFA 2LVNC 4II7A 1JB0F 2RGHA 2Y21A 3JAMS 4JI5M 1E94E 4IBEA 4AKIA 1TTEA 3L26A 2CEAA 1PJJA 5EP3A 4X62M 3LCVB 4B7HA 1N75A 4LF7M 2MGWA 3TWMA 3FRIA 1G3IA 3TQSA 2UUBM 3K8ZA 2Z7JA 2ZM6M 2I7PA 3RGPA 1C7YA 3MK6A 5DYIA 2Y0QA 2QQ8A 3UMMA 4FD2A 3AOEA 4LRSA 4JI0M 3PNVA 3ZQJA 1XXHA 2B3TA 4DR7M 2G3QA 4XBOA 4F2LA 2HCBA 2APLA 5DFLA 4LCBA 2JP7A 2R6FA 2I7NA 4X66M 1QQWA 3A45A 3L27A 2XLJA 4DV0M 1KFVA 4MGHA 3GLGE 1Q3CA 3CF2A 4GIPA 3B7ZA 3DFZA 3SBJA 2VQEM 1VEGA 3VLFB 1IN8A 1MN3A 3LQRA 4QNRA 3CTWB 3HGIA 1D2NA 4YY3M 1OKSA 3V76A 1ZAEA 3NWLA 1OFIA 3U5ZB 4LFAM 1JR3D 4DR3M 4HEOA 3C3DA 5EP2A 1XWIA 2JY7A 3H4MA 1DV0A 2P5TA 4KODA 1SXJA 2L7HA 2NQ8C 2WSFF 3SHFA 4AG6A 3HWSA 1EE8A 4Z6YA 4DV6M 3AKZA 5LMUM 1DGBA 1VDDA 3QWLA 1DO0A 3SAVA 1R7RA 2KEBA 3W67A 1IBMM 3J7BA 1L1TA 4QOZC 4LJ8A 2XF3A 1NJGA 1R2YA 3GPXA 1IBKM 2WSEF 1V92A 1GLNA 3K9OA 2UU9M 4DV2M 1G71A 2QNJA 1R2ZA 2VF7A 2C9CA 2C96A 1T3TA 4I5SA 4KO8A 1WIVA 3U6CA 3T1YM 1H6UA 1DGHA 2D7GA 1OJLA 1PJSA 1QYRA 2ZTDA 4LZJA 1IM2A 1WHCA 5F3WA 4DR4M 2LVAA 4PDIA 2MJ5B 2XFSA 4DR6M 2QBYB 3FRHA 1FNNA 4LJ7A 2OOBA 3LVWA 1V33A 2KRKA 1GJTA 4RF0A 2CWBA 5GKNA 2EA0A 3FUUA 2K6BA 4YHHM 4AKHA 1G41A 5KPTA 3LMMA 3FYCA 3GPPA 5ITQA 1F4IA 4IBFA 3E46A 2F4VM 3GLHB 5ITYA 4DV1M 1NVMA 2X4AA 3SFZA 4D80A 4FVMA 5EXXA 1PGYA 4LRTA 1MX0A 2JXNA 4G4OA 4JV5M 1OAIA 2J5YA 2JNHA 3AJIB 2R44A 2ZBKB 4QHTA 1WR1B 2CV2A 2YFQA 2DWMA 4FCTA 3THGA 2JY6B 3F92A 1K82A 4FW9A 1G4AE 2JZ0A 3M7GA 4IBIA 3GLFA 3FTFA 5IT9S 2QENA 1YLAA 3KP0E 2C9OA 3J27B 3WHKA 1HQYE 2J7NA 3HJ8A 3T6PA 1L1ZA 4KT0F 4L15A 3GLHE 1R4GA 1NV8A 2Q2EB 4RKUF 3J81S 2LNHC 3T1HM 2DAMA 3U6DA 3LQQA 3UGJA 1OIZA 2YNMD 4GH9A 4XGIA 3U6QA 1IN4A 5EP4A 1V34A 1XMQM 3HHYA 1N34M 1AUAA 1N77A 2CP8A 3RE8A 3NBXX 4BLCA 3SAWA 3SC3A 3TWLA 2R46A 3FKEA 4P17A 5FTMA 1OAOC 3L2AA 4ANRA 3GQ5A 2KNVA 2ZAOA 1GL7A 4LF4M 3EIHA 4CISA 1QAQA 4GC5A 3HKPA 1IBLM 1W5SA 3FE3A 2WZJA 2LHGA 4MH0E 3D8BA 3J7AS 4JYAM 2DI0A 3B9PA 3K92A 3ILKA 1JR3A 2KA6B 1YE9A 5FTLA 3U60B 4MGKE 3UK6A 2DWLA 1T43A 1J5EM 2LWXA 4B3TM
chains in the Genus database with same CATH topology
1R6BX 4OX9M 1KSFX 3GLGA 3QAUA 1N33M 4D81A 2HL7A 2Z3XA 2DVWB 3ZC7B 3VK8A 5FTNA 3FTCA 3E4RA 4L16A 1N36M 4JI1M 1W5TA 2UXDM 4IBKA 5KPRA 4IBCA 1TH2A 1K3WA 4I81A 4W5WA 4PCZA 1HT1E 1TH4A 5E6JA 3SATA 1PM5A 4M0DA 3A46A 4DUZM 2CV1A 4LFCM 1NNUC 3KDSE 3L29A 1XHBA 2XGNA 4JI8M 1Z5AA 4LG2A 2HHHM 4IJEA 4B3MM 3HJQA 4B3SM 1IN5A 3SHGB 4DR5M 3CF0A 2CHQA 3FUWA 2FFJA 2F5PA 1HT2E 4NRVA 5IWAM 1WXQA 4DR2M 1G8PA 3VFDA 5DYGA 3Q8XA 4LJ6A 4OU7A 4QHSA 2BJVA 4LF5M 4WW0A 4LF6M 5EJCA 1IXSB 4NL4H 4L4UA 2VQFM 2Y20A 4CGYB 3U61A 2YR0A 1K3XA 4JI7M 3VDPA 1QZMA 2EO2A 4IJFA 4NSRA 1NHWC 2QZ4A 1QAOA 3SAUA 1GVNA 3BOSA 4GITA 3U6MA 1XXHB 4GHAA 4OW0A 2KRUA 1HR0M 5H37D 3R8FA 5ITUA 3EIEA 1KYIA 4M9SA 2M60A 5EXPA 2R62A 1YUBA 3IG8A 4I8OA 4GKKM 2M5ZA 3VDUA 1QVRA 5FTJA 3OTOM 3HHXA 5EXSA 3NBIA 2Y0TA 2AHMA 3KP1E 1LV7A 3I4VA 3RGSA 5KQDA 3GQ4A 4DV5M 4B7FA 5FSWA 3GQ3A 2O5RA 1NY6A 3DA1A 1GL6A 3L28A 2QPAA 1SXJB 3GRUA 4LJAA 1TGUA 3GLHA 2R4JA 3KOXE 1Q3BA 4IIWA 3KSXA 3R9XB 1L2CA 3DOAA 2FNAA 3E9SA 2E5LM 5C18A 2UXBM 2KW0A 7CATA 4KLNA 4FWDA 3VKHA 4LGYA 4DV7M 3K2LA 1IN6A 3D8LA 1NNJA 4LGMA 4NXNM 4L8RC 4G6ZA 4R7GA 2K47A 4JI2M 4HLQA 1UM8A 1DGHB 2R18A 2UUAM 1HNWM 1YSYA 4B3RM 5C1BA 2BJWA 4GRIA 2DZNB 3K1JA 3UJNA 4OVZB 4LZZA 2FE8A 2G5GX 1HQCA 3TE6A 2XH9A 4X64M 4CHTB 2DHRA 3SASA 4G4NA 4KHPM 2L6OA 2OQ4A 1I94M 2JA2A 2ZANA 5ITRA 2CUZA 3WHLA 3PNYA 4P16A 5ITXA 3T15A 3U6EA 1SXJD 1X37A 4S12A 1S3SA 3A98B 3KOWE 4AKGA 3JR5A 3KS4A 4M9XA 2BNKA 5JI3E 1C1KA 1IN7A 5DNYA 3U60A 4LF9M 3AOGA 5KQ8A 2DWZB 2V6ZM 1L8QA 1QANA 4K0KM 2OPFA 4RNAA 5A2QS 1XC8A 2L7IA 1HNXM 3J80S 2DWNA 1DGFA 1GKIA 1OFHA 1NJFA 1DGGA 4R3DA 2KXEA 4GC9A 3HU1A 3W0LB 5ITXE 3AV0A 3KS8A 1ORYB 3FUVA 4B7GA 1NHGC 2Z4SA 1N32M 4NXMM 2X49A 4AW4A 3KOZE 2QCUA 3GLIB 1Z6TA 5E26A 4MB7A 2L09A 3IG5A 1SXJC 3FUXA 1Z5CA 4BBAA 1N78A 8CATA 4M9ZA 2D7HA 3GRVA 2F5OA 4TUWA 2ZAMA 3LVVA 5FLXS 2CE7A 2FOIC 3SMSA 3GP1A 5IREB 2R4EA 4JXJA 2VIIA 4Z8XA 3GLGB 3ZH9B 3I4YA 1XNQM 3U6LA 3U5ZA 3MHVC 4ZPXA 3I51A 1IXZA 3GRYA 1J09A 3C58A 3UZUA 3PVSA 2RGOA 3U6PA 4NSOB 1I4WA 3FTEA 1E9RA 4JI3M 2QP9X 4FWHA 3KOYE 2CFOA 4D82A 4MGIE 3FD9A 4AZFA 3PXGA 2W82A 4AG5A 3HJSA 2KZUA 4FWGA 4L78A 3ZCBB 3U6SA 2XZUA 5EQTA 1G59A 2A5YB 4LFBM 2ERCA 1FJGM 2C98A 3FUTA 1IXRC 4DV4M 4GKJM 2XEPA 4LJ9A 1E9SA 1IY0A 3KSJA 2XSZD 4EIWA 4FCWA 4PDGA 1Q39A 3A42A 1DO2A 3HHWA 4X65M 2QBYA 4REZA 3U6OA 5ITTA 3FTDA 3GRRA 3U61B 3KW6A 3GO8A 1IQPA 2KZSA 2LXEA 4IBGA 3TPZA 3TWKA 4QOSA 1TDHA 1Z5BA 1QAMA 3KFUG 4GHLA 1IY2A 2C5RA 5BPVA 4G4QA 2V1UA 1NSFA 2J7OA 4PT5A 2EUCA 2XFTA 1TDZA 4A3VB 3HHZA 3AFHA 2C99A 2V1CA 4IBDA 4WURA 3M6AA 3GPYA 3DZDA 4DUYM 3PFIA 3KVWA 2X8AA 3VKGA 3W0FA 2R45A 4OVZA 2CV0A 3J2PB 1SXJE 3SMPA 5EP1A 3FYDA 3SYKA 1PJIA 1NY5A 4FCVA 2H1RA 2F5SA 4BB9A 5LMNM 1MU5A 3VK7A 5JI2E 1IY1A 3MJ5A 4ITQA 4LY6A 4AQYM 1XMOM 4GMQA 5IZ7D 5EXTA 2Z4RA 2CHVA 4MGZE 5FTKA 1L2BA 2DXIA 3T38A 4AI6A 4DV3M 4NOOB 4NRWA 4PD2A 3AOEC 3KXEC 4DR1M 3L25A 2F5NA 4G4RA 4JI6M 3TL4X 1JQJC 4MM3B 3GLFB 1J7KA 2LH0A 2UXCM 2F5QA 4QNMA 2DZOB 4IBBA 3M0EA 2CHGA 3HU2A 1TH3A 4JN6A 2YQZA 4HL4A 1L2DA 4LJ5A 4LF8M 1ZQ9A 2RKOA 3RFWA 2HKJA 3GLIA 5KPZA 4B08A 3HU3A 2R65A 3JR4A 2UUCM 4IBJA 4RF1A 1E32A 1HNZM 4M0WA 4MGYE 1XNRM 3AL0C 2XSZA 3CF6E 4JI4M 3GPUA 3SYLA 3SARA 5KO3A 1Z59A 4I4LA 2D7EA 5BR8M 4LJ4A 2G8LA 2XZFA 4II7A 4JI5M 2RGHA 2Y21A 3JAMS 1E94E 4IBEA 4AKIA 3L26A 2CEAA 1PJJA 5EP3A 4X62M 4B7HA 1N75A 4LF7M 3TWMA 1G3IA 3TQSA 2UUBM 3K8ZA 2Z7JA 2ZM6M 2I7PA 3RGPA 3MK6A 5DYIA 2Y0QA 3UMMA 4FD2A 3AOEA 4LRSA 4JI0M 3PNVA 1XXHA 4DR7M 4XBOA 2HCBA 4LCBA 2I7NA 4X66M 3A45A 1QQWA 3L27A 2XLJA 4DV0M 1KFVA 4MGHA 1Q3CA 3CF2A 4GIPA 3SBJA 3DFZA 2VQEM 3VLFB 1IN8A 3LQRA 4QNRA 3CTWB 3HGIA 1D2NA 4YY3M 1ZAEA 3NWLA 1OFIA 3U5ZB 4LFAM 1JR3D 4DR3M 5EP2A 1XWIA 3H4MA 2P5TA 4KODA 1SXJA 2L7HA 2NQ8C 3SHFA 4AG6A 3HWSA 1EE8A 4Z6YA 4DV6M 3AKZA 5LMUM 1DGBA 1VDDA 3QWLA 1DO0A 3SAVA 1R7RA 2KEBA 1IBMM 3J7BA 1L1TA 4QOZC 4LJ8A 2XF3A 1NJGA 1R2YA 3GPXA 1IBKM 2UU9M 1GLNA 4DV2M 1R2ZA 2C9CA 2C96A 1T3TA 4I5SA 4KO8A 3U6CA 3T1YM 1H6UA 1DGHA 2D7GA 1OJLA 1QYRA 4LZJA 1IM2A 5F3WA 4DR4M 4PDIA 4DR6M 2XFSA 2QBYB 1FNNA 4LJ7A 3LVWA 2KRKA 4RF0A 2EA0A 4AKHA 5GKNA 3FUUA 4YHHM 1G41A 5KPTA 3LMMA 3FYCA 3GPPA 5ITQA 4IBFA 2F4VM 3GLHB 5ITYA 4DV1M 1NVMA 2X4AA 3SFZA 4D80A 4FVMA 5EXXA 4LRTA 1MX0A 4G4OA 4JV5M 3AJIB 4QHTA 2ZBKB 2CV2A 2YFQA 2DWMA 4FCTA 3THGA 1K82A 4FW9A 1G4AE 3M7GA 4IBIA 3GLFA 5IT9S 3FTFA 2QENA 3KP0E 2C9OA 3J27B 3WHKA 1HQYE 2J7NA 3HJ8A 1L1ZA 4L15A 2Q2EB 3J81S 2LNHC 3T1HM 3U6DA 3LQQA 3UGJA 2YNMD 4GH9A 4XGIA 3U6QA 1IN4A 5EP4A 1XMQM 1N34M 3HHYA 1N77A 3RE8A 4BLCA 3SAWA 3SC3A 3TWLA 2R46A 3FKEA 5FTMA 3L2AA 3GQ5A 2ZAOA 1GL7A 4LF4M 3EIHA 4CISA 1QAQA 4GC5A 3HKPA 1IBLM 1W5SA 4MH0E 3J7AS 3D8BA 4JYAM 3K92A 3B9PA 3ILKA 1JR3A 2KA6B 1YE9A 5FTLA 3U60B 4MGKE 3UK6A 2DWLA 1J5EM 2LWXA 4B3TM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFV A;  3SAS A;  4G4Q A;  4OX9 M;  4G4N A;  1Q3C A;  3SBJ A;  4KHP M;  2VQE M;  2OQ4 A;  1TDZ A;  1I94 M;  1N33 M;  3GPY A;  3VK8 A;  5ITR A;  1N36 M;  4JI1 M;  3U6E A;  5ITX A;  2UXD M;  4DUY M;  4YY3 M;  3W0F A;  1K3W A;  4LFA M;  4DR3 M;  4PCZ A;  3JR5 A;  3SAT A;  1PM5 A;  3A46 A;  4LF9 M;  4DUZ M;  4LFC M;  1EE8 A;  4DV6 M;  1PJI A;  4JI8 M;  5LMU M;  1Z5A A;  2F5S A;  5LMN M;  3SAV A;  2HHH M;  2OPF A;  1MU5 A;  4B3M M;  4B3S M;  4K0K M;  4DR5 M;  3VK7 A;  5A2Q S;  1IBM M;  1XC8 A;  1L1T A;  1HNX M;  2F5P A;  3J80 S;  4NRV A;  5IWA M;  1R2Y A;  4DR2 M;  1XMO M;  3GPX A;  4AQY M;  1IBK M;  2UU9 M;  4ITQ A;  4DV2 M;  1L2B A;  1R2Z A;  5ITX E;  4DV3 M;  3T1Y M;  4LF5 M;  3U6C A;  1N32 M;  4NXM M;  4LF6 M;  4NRW A;  2VQF M;  1K3X A;  4JI7 M;  4MB7 A;  4DR4 M;  4PD2 A;  4PDI A;  4DR6 M;  4DR1 M;  1Z5C A;  2F5N A;  4G4R A;  4JI6 M;  2EA0 A;  3SAU A;  4YHH M;  2F5O A;  2UXC M;  3U6M A;  2F5Q A;  3GPP A;  5ITQ A;  1HR0 M;  5ITU A;  5FLX S;  2F4V M;  1L2D A;  5ITY A;  3GP1 A;  4DV1 M;  4LF8 M;  4GKK M;  1J5E M;  2HKJ A;  3OTO M;  1MX0 A;  4G4O A;  3U6L A;  1XNQ M;  4JV5 M;  2ZBK B;  3JR4 A;  2UUC M;  1K82 A;  1HNZ M;  3C58 A;  3GQ4 A;  4DV5 M;  5IT9 S;  1XNR M;  3U6P A;  3GQ3 A;  4JI4 M;  4JI3 M;  3GPU A;  1L1Z A;  3SAR A;  2Q2E B;  1Z59 A;  3J81 S;  3T1H M;  3U6D A;  1Q3B A;  5BR8 M;  2XZF A;  1L2C A;  3U6Q A;  3DOA A;  1XMQ M;  1N34 M;  2XZU A;  3U6S A;  4JI5 M;  3JAM S;  2E5L M;  4LFB M;  3SAW A;  2UXB M;  1FJG M;  3TWL A;  1PJJ A;  4X62 M;  4DV4 M;  4DV7 M;  4GKJ M;  3GQ5 A;  4LF7 M;  1NNJ A;  3TWM A;  4NXN M;  2UUB M;  4LF4 M;  4PDG A;  4CIS A;  3A42 A;  1Q39 A;  4X65 M;  2ZM6 M;  4JI2 M;  3U6O A;  2UUA M;  1HNW M;  4B3R M;  5ITT A;  1IBL M;  4JI0 M;  3J7A S;  3GO8 A;  4JYA M;  4DR7 M;  3TWK A;  1TDH A;  1Z5B A;  4X64 M;  4X66 M;  3A45 A;  4DV0 M;  4B3T M; 
#chains in the Genus database with same CATH topology
 1R6B X;  1HJP A;  3C3E A;  4OX9 M;  1KSF X;  1AIP C;  3GLG A;  1NO1 A;  2R0I A;  3QAU A;  4D81 A;  2HL7 A;  2Z3X A;  2DVW B;  3ZC7 B;  3VK8 A;  5FTN A;  1N33 M;  3FTC A;  3E4R A;  4L16 A;  1N36 M;  4JI1 M;  1W5T A;  2EKK A;  2UXD M;  4IBK A;  2DZL A;  5KPR A;  4IBC A;  1TH2 A;  1K3W A;  4I81 A;  4W5W A;  1GAB A;  4PCZ A;  1HT1 E;  1TH4 A;  4NC6 A;  5E6J A;  3SAT A;  2KNZ A;  1PM5 A;  4M0D A;  3A46 A;  2OO9 A;  4DUZ M;  2CV1 A;  3B7Q A;  4LFC M;  1NNU C;  3KDS E;  1JR3 E;  3L29 A;  1XHB A;  2XGN A;  4JI8 M;  1Z5A A;  4LG2 A;  2HHH M;  4IJE A;  3QYB A;  3HJQ A;  4B3M M;  4B3S M;  1EIJ A;  1IN5 A;  3SHG B;  4DR5 M;  3CGW A;  3CF0 A;  2CHQ A;  3FUW A;  2FFJ A;  2F5P A;  1HT2 E;  1BVS A;  4NRV A;  1WXQ A;  5IWA M;  1G8P A;  3K9P A;  3VFD A;  4DR2 M;  2DKL A;  1GJS A;  5DYG A;  3Q8X A;  4LJ6 A;  4OU7 A;  4QHS A;  2BJV A;  1WGL A;  1QZE A;  4LF5 M;  3I04 M;  2KHH A;  3HZJ A;  4WW0 A;  4LF6 M;  5EJC A;  1IXS B;  1QUS A;  4L4U A;  4NL4 H;  2Y20 A;  4CGY B;  2VQF M;  2YR0 A;  3U61 A;  1K3X A;  3VDP A;  1QZM A;  4JI7 M;  2LVP C;  2EO2 A;  4IJF A;  4NSR A;  1NHW C;  2QZ4 A;  1Y8G A;  2CRU A;  2DNA A;  1QAO A;  3SAU A;  1GVN A;  4UN2 B;  3BOS A;  4GIT A;  3U6M A;  1ZMU A;  1XXH B;  4GHA A;  4OW0 A;  3B7N A;  2N35 A;  2KRU A;  1HR0 M;  5H37 D;  2MH8 A;  5ITU A;  3R8F A;  3EIE A;  1KYI A;  4M9S A;  2M60 A;  5EXP A;  1TF0 B;  3MMP A;  2BWB A;  2R62 A;  1YUB A;  3IG8 A;  2O25 A;  1QDT A;  1QUT A;  4I8O A;  4GKK M;  2M5Z A;  3VDU A;  1QVR A;  5FTJ A;  3OTO M;  3HHX A;  5EXS A;  2EKF A;  3NBI A;  2VDB B;  2Y0T A;  1ZMW A;  2AHM A;  3KP1 E;  1LV7 A;  1VQ1 A;  3I4V A;  3RGS A;  5KQD A;  3GQ4 A;  4DV5 M;  4B7F A;  5FSW A;  3GQ3 A;  2O5R A;  1NY6 A;  3DA1 A;  1GL6 A;  3L28 A;  2QPA A;  1SXJ B;  3GRU A;  3QYE A;  4LJA A;  1TGU A;  3GLH A;  2R4J A;  3KOX E;  1Q3B A;  4IIW A;  3KSX A;  3R9X B;  1L2C A;  3DOA A;  2FNA A;  3E9S A;  2Z8Y M;  2E5L M;  5C18 A;  4DBG B;  2UXB M;  2KW0 A;  7CAT A;  4KLN A;  4FWD A;  3VKH A;  4LGY A;  1PRB A;  2DAG A;  3K2L A;  1IN6 A;  3D8L A;  4DV7 M;  2OOA A;  1NNJ A;  4LGM A;  4NXN M;  4L8R C;  4G6Z A;  4R7G A;  2K47 A;  4JI2 M;  4HLQ A;  1UM8 A;  2DEN A;  1DGH B;  2R18 A;  2UUA M;  1HNW M;  1YSY A;  4B3R M;  5C1B A;  3E21 A;  2BJW A;  2HWJ A;  2LVQ D;  4GRI A;  2DZN B;  3K1J A;  3C9P A;  3LCU A;  4OVZ B;  3UJN A;  4LZZ A;  2O01 F;  3BXW A;  2FE8 A;  2G5G X;  1HQC A;  3TE6 A;  2XH9 A;  4X64 M;  3Q8G A;  4CHT B;  2DHR A;  2FS1 A;  3SAS A;  3HX3 A;  4G4N A;  4KHP M;  2L6O A;  4R71 A;  2L2D A;  2OQ4 A;  1I94 M;  2JA2 A;  3H4J A;  1VG5 A;  2ZAN A;  5ITR A;  2L4E A;  2CUZ A;  3WHL A;  3PNY A;  4P16 A;  5ITX A;  3T15 A;  3U6E A;  1IFY A;  1SXJ D;  1X37 A;  4S12 A;  1S3S A;  1ZV1 A;  3A98 B;  3KOW E;  2DHY A;  4Q7J A;  4CJ6 A;  3JR5 A;  4AKG A;  3KS4 A;  4M9X A;  2BNK A;  5JI3 E;  1XB2 B;  1C1K A;  1IN7 A;  5DNY A;  3U60 A;  4LF9 M;  3AOG A;  5KQ8 A;  1PJQ A;  4WP2 A;  2DWZ B;  2V6Z M;  1L8Q A;  1QAN A;  4K0K M;  4GEW A;  2OPF A;  4RNA A;  5A2Q S;  1XC8 A;  2L7I A;  1HNX M;  3J80 S;  2DWN A;  1DGF A;  1GKI A;  1OFH A;  1NJF A;  1DGG A;  4R3D A;  2KXE A;  4GC9 A;  3HU1 A;  2JUJ A;  1D0L A;  3W0L B;  5ITX E;  3AV0 A;  3KS8 A;  1ORY B;  3FUV A;  4B7G A;  1NHG C;  2DAI A;  2Z4S A;  1N32 M;  4NXM M;  2X49 A;  2KNA A;  4AW4 A;  3KOZ E;  1GO5 A;  2LHC A;  2QCU A;  3GLI B;  1Z6T A;  5E26 A;  4MB7 A;  2L09 A;  3IG5 A;  1SXJ C;  2EJS A;  3FUX A;  1Z5C A;  3HY5 A;  1PJT A;  4BBA A;  1N78 A;  8CAT A;  4M9Z A;  2D7H A;  3GRV A;  2F5O A;  1TR8 A;  4TUW A;  1T6O A;  2ZAM A;  3LVV A;  5FLX S;  3IHP A;  2CE7 A;  2FOI C;  3BBZ A;  3SMS A;  5IRE B;  3GP1 A;  1EFU B;  2R4E A;  4JXJ A;  2VII A;  3GLI E;  4Z8X A;  3B89 A;  3ZH9 B;  3GLG B;  1IXS A;  3I4Y A;  1XNQ M;  3U6L A;  1OTR A;  3U5Z A;  3MHV C;  4Y28 F;  4ZPX A;  2JY8 A;  3I51 A;  1IXZ A;  3GRY A;  1J09 A;  3C58 A;  3UZU A;  2ZTC A;  2RGO A;  3PVS A;  3U6P A;  1ZMV A;  2JWS A;  4NSO B;  1I4W A;  3FTE A;  1E9R A;  4JI3 M;  2QP9 X;  4FWH A;  3KOY E;  2CFO A;  4D82 A;  4MGI E;  3FD9 A;  4AZF A;  3PXG A;  2W82 A;  4AG5 A;  3HJS A;  2KZU A;  4FWG A;  4L78 A;  2LVO C;  3ZCB B;  3U6S A;  2XZU A;  1LTM A;  5EQT A;  1G59 A;  2A5Y B;  4LFB M;  2ERC A;  1FJG M;  1OQY A;  2C98 A;  1IXR C;  3FUT A;  4DV4 M;  4GKJ M;  2XEP A;  3I01 M;  4LJ9 A;  1E9S A;  1IY0 A;  1WGN A;  3KSJ A;  2XSZ D;  4EIW A;  4FCW A;  4PDG A;  1Q39 A;  1CUK A;  1DO2 A;  3A42 A;  3HHW A;  4X65 M;  2QBY A;  4REZ A;  3U6O A;  5ITT A;  1QDR A;  3FTD A;  3GRR A;  3U61 B;  1XXH E;  3KW6 A;  3GO8 A;  1D0K A;  1IQP A;  2KZS A;  2LXE A;  4IBG A;  3TPZ A;  3TWK A;  4QOS A;  1MJG M;  1TDH A;  1Z5B A;  1QAM A;  3KFU G;  4GHL A;  1IY2 A;  2C5R A;  5BPV A;  4G4Q A;  2V1U A;  1NSF A;  2J7O A;  4PT5 A;  2EUC A;  1VEK A;  2XFT A;  1TDZ A;  4A3V B;  3HHZ A;  3AFH A;  2C99 A;  2V1C A;  2H5X A;  4IBD A;  3M6A A;  4WUR A;  3GPY A;  2VF8 A;  3DZD A;  2K9D A;  4DUY M;  4XK8 F;  4CIZ A;  3PFI A;  3KVW A;  2X8A A;  2QHO B;  2JY5 A;  3W0F A;  2R45 A;  3VKG A;  2L4F A;  4OVZ A;  2CV0 A;  2MRO B;  3J2P B;  1SXJ E;  3SMP A;  3IEC A;  5EP1 A;  5L8R F;  3FYD A;  3SYK A;  1PJI A;  1NY5 A;  4FCV A;  2H1R A;  2F5S A;  4BB9 A;  5LMN M;  2KDL A;  1MU5 A;  3VK7 A;  4L6V 6;  5JI2 E;  1IY1 A;  3MJ5 A;  1RU3 A;  4ITQ A;  1A5T A;  4LY6 A;  4AQY M;  1XMO M;  4GMQ A;  5IZ7 D;  1VEJ A;  5EXT A;  2Z4R A;  2CHV A;  4MGZ E;  5FTK A;  1L2B A;  2DXI A;  1D0M A;  2GNO A;  3T38 A;  4AI6 A;  4DV3 M;  2HAK A;  2QSF X;  4G3O A;  1R5L A;  4NOO B;  4NRW A;  2FH0 A;  2K0B X;  4PD2 A;  3AOE C;  2DAK A;  3KXE C;  4DR1 M;  3L25 A;  1OIP A;  4G4R A;  2F5N A;  2MR9 A;  4JI6 M;  3TL4 X;  1JQJ C;  4MM3 B;  1SG9 A;  2DAE A;  1J7K A;  1NV9 A;  2LH0 A;  3GLF B;  2UXC M;  2F5Q A;  4QNM A;  2DZO B;  4IBB A;  3M0E A;  2CHG A;  4F1I A;  3W68 A;  3HU2 A;  1TH3 A;  4JN6 A;  2YQZ A;  4HL4 A;  3B74 A;  1L2D A;  2RRU A;  4LJ5 A;  2JZ1 A;  4LF8 M;  1ZQ9 A;  2RKO A;  3RFW A;  2HKJ A;  3GLI A;  1P3Q Q;  5KPZ A;  3LW5 F;  4B08 A;  1VDL A;  2BWE A;  3HU3 A;  2R65 A;  3JR4 A;  2UUC M;  4IBJ A;  4RF1 A;  1E32 A;  1HNZ M;  4M0W A;  3GLF E;  2GQF A;  1UFZ A;  1WJ7 A;  4MGY E;  1Q02 A;  1XNR M;  2LTU A;  3AL0 C;  2XSZ A;  2LBC A;  3CF6 E;  4JI4 M;  3GPU A;  2WSC F;  3SYL A;  3SAR A;  5KO3 A;  1Z59 A;  4I4L A;  2D7E A;  5BR8 M;  4LJ4 A;  2G8L A;  2XZF A;  2LVN C;  4II7 A;  1JB0 F;  2RGH A;  2Y21 A;  3JAM S;  4JI5 M;  1E94 E;  4IBE A;  4AKI A;  1TTE A;  3L26 A;  2CEA A;  1PJJ A;  5EP3 A;  4X62 M;  3LCV B;  4B7H A;  1N75 A;  4LF7 M;  2MGW A;  3TWM A;  3FRI A;  1G3I A;  3TQS A;  2UUB M;  3K8Z A;  2Z7J A;  2ZM6 M;  2I7P A;  3RGP A;  1C7Y A;  3MK6 A;  5DYI A;  2Y0Q A;  2QQ8 A;  3UMM A;  4FD2 A;  3AOE A;  4LRS A;  4JI0 M;  3PNV A;  3ZQJ A;  1XXH A;  2B3T A;  4DR7 M;  2G3Q A;  4XBO A;  4F2L A;  2HCB A;  2APL A;  5DFL A;  4LCB A;  2JP7 A;  2R6F A;  2I7N A;  4X66 M;  1QQW A;  3A45 A;  3L27 A;  2XLJ A;  4DV0 M;  1KFV A;  4MGH A;  3GLG E;  1Q3C A;  3CF2 A;  4GIP A;  3B7Z A;  3DFZ A;  3SBJ A;  2VQE M;  1VEG A;  3VLF B;  1IN8 A;  1MN3 A;  3LQR A;  4QNR A;  3CTW B;  3HGI A;  1D2N A;  4YY3 M;  1OKS A;  3V76 A;  1ZAE A;  3NWL A;  1OFI A;  3U5Z B;  4LFA M;  1JR3 D;  4DR3 M;  4HEO A;  3C3D A;  5EP2 A;  1XWI A;  2JY7 A;  3H4M A;  1DV0 A;  2P5T A;  4KOD A;  1SXJ A;  2L7H A;  2NQ8 C;  2WSF F;  3SHF A;  4AG6 A;  3HWS A;  1EE8 A;  4Z6Y A;  4DV6 M;  3AKZ A;  5LMU M;  1DGB A;  1VDD A;  3QWL A;  1DO0 A;  3SAV A;  1R7R A;  2KEB A;  3W67 A;  1IBM M;  3J7B A;  1L1T A;  4QOZ C;  4LJ8 A;  2XF3 A;  1NJG A;  1R2Y A;  3GPX A;  1IBK M;  2WSE F;  1V92 A;  1GLN A;  3K9O A;  2UU9 M;  4DV2 M;  1G71 A;  2QNJ A;  1R2Z A;  2VF7 A;  2C9C A;  2C96 A;  1T3T A;  4I5S A;  4KO8 A;  1WIV A;  3U6C A;  3T1Y M;  1H6U A;  1DGH A;  2D7G A;  1OJL A;  1PJS A;  1QYR A;  2ZTD A;  4LZJ A;  1IM2 A;  1WHC A;  5F3W A;  4DR4 M;  2LVA A;  4PDI A;  2MJ5 B;  2XFS A;  4DR6 M;  2QBY B;  3FRH A;  1FNN A;  4LJ7 A;  2OOB A;  3LVW A;  1V33 A;  2KRK A;  1GJT A;  4RF0 A;  2CWB A;  5GKN A;  2EA0 A;  3FUU A;  2K6B A;  4YHH M;  4AKH A;  1G41 A;  5KPT A;  3LMM A;  3FYC A;  3GPP A;  5ITQ A;  1F4I A;  4IBF A;  3E46 A;  2F4V M;  3GLH B;  5ITY A;  4DV1 M;  1NVM A;  2X4A A;  3SFZ A;  4D80 A;  4FVM A;  5EXX A;  1PGY A;  4LRT A;  1MX0 A;  2JXN A;  4G4O A;  4JV5 M;  1OAI A;  2J5Y A;  2JNH A;  3AJI B;  2R44 A;  2ZBK B;  4QHT A;  1WR1 B;  2CV2 A;  2YFQ A;  2DWM A;  4FCT A;  3THG A;  2JY6 B;  3F92 A;  1K82 A;  4FW9 A;  1G4A E;  2JZ0 A;  3M7G A;  4IBI A;  3GLF A;  3FTF A;  5IT9 S;  2QEN A;  1YLA A;  3KP0 E;  2C9O A;  3J27 B;  3WHK A;  1HQY E;  2J7N A;  3HJ8 A;  3T6P A;  1L1Z A;  4KT0 F;  4L15 A;  3GLH E;  1R4G A;  1NV8 A;  2Q2E B;  4RKU F;  3J81 S;  2LNH C;  3T1H M;  2DAM A;  3U6D A;  3LQQ A;  3UGJ A;  1OIZ A;  2YNM D;  4GH9 A;  4XGI A;  3U6Q A;  1IN4 A;  5EP4 A;  1V34 A;  1XMQ M;  3HHY A;  1N34 M;  1AUA A;  1N77 A;  2CP8 A;  3RE8 A;  3NBX X;  4BLC A;  3SAW A;  3SC3 A;  3TWL A;  2R46 A;  3FKE A;  4P17 A;  5FTM A;  1OAO C;  3L2A A;  4ANR A;  3GQ5 A;  2KNV A;  2ZAO A;  1GL7 A;  4LF4 M;  3EIH A;  4CIS A;  1QAQ A;  4GC5 A;  3HKP A;  1IBL M;  1W5S A;  3FE3 A;  2WZJ A;  2LHG A;  4MH0 E;  3D8B A;  3J7A S;  4JYA M;  2DI0 A;  3B9P A;  3K92 A;  3ILK A;  1JR3 A;  2KA6 B;  1YE9 A;  5FTL A;  3U60 B;  4MGK E;  3UK6 A;  2DWL A;  1T43 A;  1J5E M;  2LWX A;  4B3T M; 
#chains in the Genus database with same CATH homology
 1R6B X;  4OX9 M;  1KSF X;  3GLG A;  3QAU A;  1N33 M;  4D81 A;  2HL7 A;  2Z3X A;  2DVW B;  3ZC7 B;  3VK8 A;  5FTN A;  3FTC A;  3E4R A;  4L16 A;  1N36 M;  4JI1 M;  1W5T A;  2UXD M;  4IBK A;  5KPR A;  4IBC A;  1TH2 A;  1K3W A;  4I81 A;  4W5W A;  4PCZ A;  1HT1 E;  1TH4 A;  5E6J A;  3SAT A;  1PM5 A;  4M0D A;  3A46 A;  4DUZ M;  2CV1 A;  4LFC M;  1NNU C;  3KDS E;  3L29 A;  1XHB A;  2XGN A;  4JI8 M;  1Z5A A;  4LG2 A;  2HHH M;  4IJE A;  4B3M M;  3HJQ A;  4B3S M;  1IN5 A;  3SHG B;  4DR5 M;  3CF0 A;  2CHQ A;  3FUW A;  2FFJ A;  2F5P A;  1HT2 E;  4NRV A;  5IWA M;  1WXQ A;  4DR2 M;  1G8P A;  3VFD A;  5DYG A;  3Q8X A;  4LJ6 A;  4OU7 A;  4QHS A;  2BJV A;  4LF5 M;  4WW0 A;  4LF6 M;  5EJC A;  1IXS B;  4NL4 H;  4L4U A;  2VQF M;  2Y20 A;  4CGY B;  3U61 A;  2YR0 A;  1K3X A;  4JI7 M;  3VDP A;  1QZM A;  2EO2 A;  4IJF A;  4NSR A;  1NHW C;  2QZ4 A;  1QAO A;  3SAU A;  1GVN A;  3BOS A;  4GIT A;  3U6M A;  1XXH B;  4GHA A;  4OW0 A;  2KRU A;  1HR0 M;  5H37 D;  3R8F A;  5ITU A;  3EIE A;  1KYI A;  4M9S A;  2M60 A;  5EXP A;  2R62 A;  1YUB A;  3IG8 A;  4I8O A;  4GKK M;  2M5Z A;  3VDU A;  1QVR A;  5FTJ A;  3OTO M;  3HHX A;  5EXS A;  3NBI A;  2Y0T A;  2AHM A;  3KP1 E;  1LV7 A;  3I4V A;  3RGS A;  5KQD A;  3GQ4 A;  4DV5 M;  4B7F A;  5FSW A;  3GQ3 A;  2O5R A;  1NY6 A;  3DA1 A;  1GL6 A;  3L28 A;  2QPA A;  1SXJ B;  3GRU A;  4LJA A;  1TGU A;  3GLH A;  2R4J A;  3KOX E;  1Q3B A;  4IIW A;  3KSX A;  3R9X B;  1L2C A;  3DOA A;  2FNA A;  3E9S A;  2E5L M;  5C18 A;  2UXB M;  2KW0 A;  7CAT A;  4KLN A;  4FWD A;  3VKH A;  4LGY A;  4DV7 M;  3K2L A;  1IN6 A;  3D8L A;  1NNJ A;  4LGM A;  4NXN M;  4L8R C;  4G6Z A;  4R7G A;  2K47 A;  4JI2 M;  4HLQ A;  1UM8 A;  1DGH B;  2R18 A;  2UUA M;  1HNW M;  1YSY A;  4B3R M;  5C1B A;  2BJW A;  4GRI A;  2DZN B;  3K1J A;  3UJN A;  4OVZ B;  4LZZ A;  2FE8 A;  2G5G X;  1HQC A;  3TE6 A;  2XH9 A;  4X64 M;  4CHT B;  2DHR A;  3SAS A;  4G4N A;  4KHP M;  2L6O A;  2OQ4 A;  1I94 M;  2JA2 A;  2ZAN A;  5ITR A;  2CUZ A;  3WHL A;  3PNY A;  4P16 A;  5ITX A;  3T15 A;  3U6E A;  1SXJ D;  1X37 A;  4S12 A;  1S3S A;  3A98 B;  3KOW E;  4AKG A;  3JR5 A;  3KS4 A;  4M9X A;  2BNK A;  5JI3 E;  1C1K A;  1IN7 A;  5DNY A;  3U60 A;  4LF9 M;  3AOG A;  5KQ8 A;  2DWZ B;  2V6Z M;  1L8Q A;  1QAN A;  4K0K M;  2OPF A;  4RNA A;  5A2Q S;  1XC8 A;  2L7I A;  1HNX M;  3J80 S;  2DWN A;  1DGF A;  1GKI A;  1OFH A;  1NJF A;  1DGG A;  4R3D A;  2KXE A;  4GC9 A;  3HU1 A;  3W0L B;  5ITX E;  3AV0 A;  3KS8 A;  1ORY B;  3FUV A;  4B7G A;  1NHG C;  2Z4S A;  1N32 M;  4NXM M;  2X49 A;  4AW4 A;  3KOZ E;  2QCU A;  3GLI B;  1Z6T A;  5E26 A;  4MB7 A;  2L09 A;  3IG5 A;  1SXJ C;  3FUX A;  1Z5C A;  4BBA A;  1N78 A;  8CAT A;  4M9Z A;  2D7H A;  3GRV A;  2F5O A;  4TUW A;  2ZAM A;  3LVV A;  5FLX S;  2CE7 A;  2FOI C;  3SMS A;  3GP1 A;  5IRE B;  2R4E A;  4JXJ A;  2VII A;  4Z8X A;  3GLG B;  3ZH9 B;  3I4Y A;  1XNQ M;  3U6L A;  3U5Z A;  3MHV C;  4ZPX A;  3I51 A;  1IXZ A;  3GRY A;  1J09 A;  3C58 A;  3UZU A;  3PVS A;  2RGO A;  3U6P A;  4NSO B;  1I4W A;  3FTE A;  1E9R A;  4JI3 M;  2QP9 X;  4FWH A;  3KOY E;  2CFO A;  4D82 A;  4MGI E;  3FD9 A;  4AZF A;  3PXG A;  2W82 A;  4AG5 A;  3HJS A;  2KZU A;  4FWG A;  4L78 A;  3ZCB B;  3U6S A;  2XZU A;  5EQT A;  1G59 A;  2A5Y B;  4LFB M;  2ERC A;  1FJG M;  2C98 A;  3FUT A;  1IXR C;  4DV4 M;  4GKJ M;  2XEP A;  4LJ9 A;  1E9S A;  1IY0 A;  3KSJ A;  2XSZ D;  4EIW A;  4FCW A;  4PDG A;  1Q39 A;  3A42 A;  1DO2 A;  3HHW A;  4X65 M;  2QBY A;  4REZ A;  3U6O A;  5ITT A;  3FTD A;  3GRR A;  3U61 B;  3KW6 A;  3GO8 A;  1IQP A;  2KZS A;  2LXE A;  4IBG A;  3TPZ A;  3TWK A;  4QOS A;  1TDH A;  1Z5B A;  1QAM A;  3KFU G;  4GHL A;  1IY2 A;  2C5R A;  5BPV A;  4G4Q A;  2V1U A;  1NSF A;  2J7O A;  4PT5 A;  2EUC A;  2XFT A;  1TDZ A;  4A3V B;  3HHZ A;  3AFH A;  2C99 A;  2V1C A;  4IBD A;  4WUR A;  3M6A A;  3GPY A;  3DZD A;  4DUY M;  3PFI A;  3KVW A;  2X8A A;  3VKG A;  3W0F A;  2R45 A;  4OVZ A;  2CV0 A;  3J2P B;  1SXJ E;  3SMP A;  5EP1 A;  3FYD A;  3SYK A;  1PJI A;  1NY5 A;  4FCV A;  2H1R A;  2F5S A;  4BB9 A;  5LMN M;  1MU5 A;  3VK7 A;  5JI2 E;  1IY1 A;  3MJ5 A;  4ITQ A;  4LY6 A;  4AQY M;  1XMO M;  4GMQ A;  5IZ7 D;  5EXT A;  2Z4R A;  2CHV A;  4MGZ E;  5FTK A;  1L2B A;  2DXI A;  3T38 A;  4AI6 A;  4DV3 M;  4NOO B;  4NRW A;  4PD2 A;  3AOE C;  3KXE C;  4DR1 M;  3L25 A;  2F5N A;  4G4R A;  4JI6 M;  3TL4 X;  1JQJ C;  4MM3 B;  3GLF B;  1J7K A;  2LH0 A;  2UXC M;  2F5Q A;  4QNM A;  2DZO B;  4IBB A;  3M0E A;  2CHG A;  3HU2 A;  1TH3 A;  4JN6 A;  2YQZ A;  4HL4 A;  1L2D A;  4LJ5 A;  4LF8 M;  1ZQ9 A;  2RKO A;  3RFW A;  2HKJ A;  3GLI A;  5KPZ A;  4B08 A;  3HU3 A;  2R65 A;  3JR4 A;  2UUC M;  4IBJ A;  4RF1 A;  1E32 A;  1HNZ M;  4M0W A;  4MGY E;  1XNR M;  3AL0 C;  2XSZ A;  3CF6 E;  4JI4 M;  3GPU A;  3SYL A;  3SAR A;  5KO3 A;  1Z59 A;  4I4L A;  2D7E A;  5BR8 M;  4LJ4 A;  2G8L A;  2XZF A;  4II7 A;  4JI5 M;  2RGH A;  2Y21 A;  3JAM S;  1E94 E;  4IBE A;  4AKI A;  3L26 A;  2CEA A;  1PJJ A;  5EP3 A;  4X62 M;  4B7H A;  1N75 A;  4LF7 M;  3TWM A;  1G3I A;  3TQS A;  2UUB M;  3K8Z A;  2Z7J A;  2ZM6 M;  2I7P A;  3RGP A;  3MK6 A;  5DYI A;  2Y0Q A;  3UMM A;  4FD2 A;  3AOE A;  4LRS A;  4JI0 M;  3PNV A;  1XXH A;  4DR7 M;  4XBO A;  2HCB A;  4LCB A;  2I7N A;  4X66 M;  3A45 A;  1QQW A;  3L27 A;  2XLJ A;  4DV0 M;  1KFV A;  4MGH A;  1Q3C A;  3CF2 A;  4GIP A;  3SBJ A;  3DFZ A;  2VQE M;  3VLF B;  1IN8 A;  3LQR A;  4QNR A;  3CTW B;  3HGI A;  1D2N A;  4YY3 M;  1ZAE A;  3NWL A;  1OFI A;  3U5Z B;  4LFA M;  1JR3 D;  4DR3 M;  5EP2 A;  1XWI A;  3H4M A;  2P5T A;  4KOD A;  1SXJ A;  2L7H A;  2NQ8 C;  3SHF A;  4AG6 A;  3HWS A;  1EE8 A;  4Z6Y A;  4DV6 M;  3AKZ A;  5LMU M;  1DGB A;  1VDD A;  3QWL A;  1DO0 A;  3SAV A;  1R7R A;  2KEB A;  1IBM M;  3J7B A;  1L1T A;  4QOZ C;  4LJ8 A;  2XF3 A;  1NJG A;  1R2Y A;  3GPX A;  1IBK M;  2UU9 M;  1GLN A;  4DV2 M;  1R2Z A;  2C9C A;  2C96 A;  1T3T A;  4I5S A;  4KO8 A;  3U6C A;  3T1Y M;  1H6U A;  1DGH A;  2D7G A;  1OJL A;  1QYR A;  4LZJ A;  1IM2 A;  5F3W A;  4DR4 M;  4PDI A;  4DR6 M;  2XFS A;  2QBY B;  1FNN A;  4LJ7 A;  3LVW A;  2KRK A;  4RF0 A;  2EA0 A;  4AKH A;  5GKN A;  3FUU A;  4YHH M;  1G41 A;  5KPT A;  3LMM A;  3FYC A;  3GPP A;  5ITQ A;  4IBF A;  2F4V M;  3GLH B;  5ITY A;  4DV1 M;  1NVM A;  2X4A A;  3SFZ A;  4D80 A;  4FVM A;  5EXX A;  4LRT A;  1MX0 A;  4G4O A;  4JV5 M;  3AJI B;  4QHT A;  2ZBK B;  2CV2 A;  2YFQ A;  2DWM A;  4FCT A;  3THG A;  1K82 A;  4FW9 A;  1G4A E;  3M7G A;  4IBI A;  3GLF A;  5IT9 S;  3FTF A;  2QEN A;  3KP0 E;  2C9O A;  3J27 B;  3WHK A;  1HQY E;  2J7N A;  3HJ8 A;  1L1Z A;  4L15 A;  2Q2E B;  3J81 S;  2LNH C;  3T1H M;  3U6D A;  3LQQ A;  3UGJ A;  2YNM D;  4GH9 A;  4XGI A;  3U6Q A;  1IN4 A;  5EP4 A;  1XMQ M;  1N34 M;  3HHY A;  1N77 A;  3RE8 A;  4BLC A;  3SAW A;  3SC3 A;  3TWL A;  2R46 A;  3FKE A;  5FTM A;  3L2A A;  3GQ5 A;  2ZAO A;  1GL7 A;  4LF4 M;  3EIH A;  4CIS A;  1QAQ A;  4GC5 A;  3HKP A;  1IBL M;  1W5S A;  4MH0 E;  3J7A S;  3D8B A;  4JYA M;  3K92 A;  3B9P A;  3ILK A;  1JR3 A;  2KA6 B;  1YE9 A;  5FTL A;  3U60 B;  4MGK E;  3UK6 A;  2DWL A;  1J5E M;  2LWX A;  4B3T M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...