2Z4RA

Crystal structure of domain iii from the thermotoga maritima replication initiation protein dnaa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
240
Chain Sequence
TPLNPDYTFENFVVGPGNSFAYHAALEVAKHPGRYNPLFIYGGVGLGKTHLLQSIGNYVVQNEPDLRVMYITSEKFLNDLVDSMKEGKLNEFREKYRKKVDILLIDDVQFLIGKTGVQTELFHTFNELHDSGKQIVICSDREPQKLSEFQDRLVSRFQMGLVAKLEPPDEETRKSIARKMLEIEHGELPEEVLNFVAENVDDNLRRLRGAIIKLLVYKETTGKEVDLKEAILLLKDFIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosomal replication initiator protein dnaA
publication title A Common Mechanism for the ATP-DnaA-dependent Formation of Open Complexes at the Replication Origin
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein
total genus 86
structure length 240
sequence length 240
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00308 Bac_DnaA Bacterial dnaA protein
A PF08299 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix
A PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z4rA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2z4rA01
3KKPA 1VG0B 3W8RA 5H70A 2P0EA 5TXGA 3U4QA 3MMPA 1G3RA 4QXAA 4M1SA 4Z1MA 1YE8A 2WSSD 5EE9A 3ND9A 3MWYW 2ONKA 4PHFA 1GVNB 2P2LA 4MRVA 4A0RA 2FZLA 2GHIA 2IW3A 2H1LA 3EA5A 4A2PA 3DHWC 4EFLA 3TK1A 3EX7C 3W3ZB 3OFND 1OXUA 5IK2A 2GWHA 2C77A 1OYYA 4RFSB 5G3ZA 3A4MA 2ZJAA 1XEWY 1R6BX 3FGNA 4BFUA 3PEUA 1NMXA 3VKGA 1OIWA 1R4AA 2ANCA 1G8YA 2AKAB 2O8BB 1L4YA 2WJVA 3A1SA 3BERA 4DC9A 1T0HB 1VKJA 2GJ9A 2NO1A 2QORA 3EWAA 3N2EA 1W0KD 4HUTA 4L15A 5JRJA 3CBQA 4C7OB 1YR8A 2UZ3A 4OI0A 4B33A 1SVMA 1ZUIA 3C8UA 4DCTA 4A0HA 4BFXA 4JT2A 2NG1A 1KAGA 4Q7LA 2YOGA 4MYTA 1CJUC 2IUSA 4YXWA 4M2LA 3QUSA 3TIFA 4HLCA 5JJKA 1G5PA 1FW6A 5CK4A 4W7SA 5FTLA 4QL3A 1UDWA 3ND8A 1OFHA 4C0JA 1P60A 4V0ME 4X8HA 3OZXA 4D25A 1QG4A 3O8CA 2ZE5A 2QP9X 5SZKB 4N1AA 2BBTA 3CPJB 2H5EA 1VHLA 3IQXA 4TWZA 1V43A 2PZGA 5E95A 2OEPA 5FH9A 1ZD9A 2J41A 4DKXA 3G82C 4TLBA 1HTWA 2QG6A 1F3OA 2PMKA 4PO8A 3TH5A 1CULC 3PITA 1KOFA 4A9AA 3U6KA 1IN8A 1EG7A 1G4UR 1M34E 4JJZA 3OIYA 3BAFA 2IF0A 4JLBA 1KY2A 1JPJA 3M1IA 2KSQA 4JKYA 4X8LA 5GVRA 3ZQJA 2JIZA 3VMFA 3H1TA 3SBEA 2NMVA 2IL1A 2BMFA 3MWJA 3QF4A 1AZTA 3SFVA 3BXZA 1J90A 1MO3A 4HLUC 2J7KA 2ZI5A 1EWRA 1KMQA 3AQ4A 4NYIQ 3I5YA 2IYYA 5LDDC 1YRBA 1GG2A 3ADDA 2AWOA 3LVRE 4PXAA 2V6ZM 4QBFA 5G40A 1ANKA 1B0UA 3AF1A 3CNOA 4YMWA 2CCJA 1MABA 2DR3A 3CRRA 2IUTA 2VBCA 4BE7B 5ELXA 4WXRA 5L3RA 2HYDA 3RYTC 1VYUA 2V9PA 4M9XA 3K0AA 4ZIRB 4Q00A 1TPZA 1VHTA 3OF5A 3U3OA 1E1RA 1LS1A 1KK2A 5L3SB 4G5RA 1XRJA 3UMFA 4DCUA 1GP2A 5KPDA 1F2UA 3KXKA 3QJYA 1R0ZA 1W2HA 5JWRA 1KK0A 2ZREA 3X1ZA 2ODBA 3QENA 3AUYA 3A37A 3VFDA 3T5GA 3U3MA 5JSZA 3P4XA 1N6LA 1YZQA 2VA8A 2RGBA 4M1MA 3Q5EA 1OSNA 2IS4A 2BHRA 2DWPA 1G3IA 3GLIB 2N1BA 4WOPA 3IBGA 4C2UA 1TU3A 2R44A 1N5KA 4YC7A 3KQLA 1XTQA 4TMVA 4D4JA 3AM1A 1W48A 3VX3A 3AVXA 1JEEA 1VYTA 1X86B 3LW8A 1HT2E 4LJ7A 2ATXA 4A82A 3R7WB 3TBKA 3DM9B 4GOJA 2ZR0A 3OFNA 2A5FA 1JQLB 4QKQA 2OFWA 2XXAB 1OXTA 4PQRA 1ZVQA 2ZRJA 1UFQA 3VR5A 4A6PA 5IT5A 2CEAA 2IYTA 3A4NA 4OQMA 2CJWB 2VP0A 3F5FA 5EJEA 4D4KA 3C4JA 4LRSA 3WMGA 1W0KA 4OQFA 3UXMA 3TE6A 1T3HA 1D5CA 2XOKD 3SI7A 1CR1A 1R0XA 5JI3E 2QQ0A 1UBFA 3AVWA 5FBQB 2V6JA 2O0KA 5F3WB 5JI2E 4Q7KA 2CL0X 4XTCS 3RS7A 2O8EB 4D26A 1TU4A 2RGGA 3VU9B 2DWZB 3WP0A 4A3VB 2E9SA 4LJ5A 2OBNA 1MT0A 4YMUA 3PCRB 4LRTA 1C4OA 4P0TA 2WWYA 2ZETA 3CF0A 3UKDA 2N46A 1N2CE 2IXFA 2IYXA 4QBIA 1OH8A 1E0JA 3IO5A 3L0OA 1Z0IA 3PXGA 4HB0A 4AYTA 3LWNA 5DO9A 2ZRMA 2CHVA 3B1WA 3CRVA 3QXSA 3B8HA 1U90A 3MFYA 1BYUA 3NC0C 4Z8XA 1CR4A 1CRQA 4MGYR 1ZM2A 4DVGA 2A3RA 1EX7A 1G8GA 3W6NA 4B75A 1E9FA 1BH2A 5FI1B 4ON9A 1Q22A 1CIPA 4US2R 3EZ9A 1DAFA 2B6HA 2Z4RA 3EZ2A 1D9XA 3MJHA 3KL4A 4DHEA 4IOJA 3GP8A 4TZ0A 1NMYA 1BKDR 2FDCA 3QXCA 4Q21A 2O8FB 5KHOC 3DL0A 4AK9A 1G4AE 2CE7A 1UBGA 1ZUNB 1DG1G 2W6ID 2JLVA 5FUVA 3IKJA 2GXQA 3SFZA 3A1TA 3TUZC 1PLKA 4C2TA 1JAIA 1QG2A 1E79A 1ZW6A 4XWOA 1OJLA 4H9GA 4HZUA 4ZKEA 3A1UA 4C30A 3UANA 3BFXA 2REXB 3GLFB 4PHTA 3WRXC 2W58A 1IQPA 4JLVA 1FMJA 2R6DA 3TLXA 1EFUA 3P27A 2VIIA 4HAYA 1F60A 3VLFB 1N6OA 2XTNA 3K70D 2JLYA 1E1QD 3LAWA 3TNFA 3FTQA 4C3ZA 4XH9B 4B3XA 1YKSA 2EQBA 5EZ5A 3BJIC 2XZLA 4DSOA 4EFNA 3WBKA 4A36A 4GFDA 3G0HA 2WWGA 4QHSA 2JCSA 4YMSA 4XD7D 1J8MF 2DPXA 3VKWA 3F0TA 1HYQA 2C9OA 1Z2CA 1CP2A 3QPUA 4O3MA 5BW8A 2WV9A 3PUVA 1OE0A 4MQBA 1GILA 3PEVA 1AQUA 1UF9A 2X8AA 1MH1A 3TRFA 1QHHA 2OLJA 1P75A 1E9AA 2YINC 1VECA 3NBZC 2P5SA 3MLEA 2JLUA 1YVDA 4AKGA 3T61A 4LJ6A 2ZRCA 2NGRA 2GK6A 1Z83A 1NN3A 4DCNA 2ZJBA 1SXJD 5JFGA 4G3XA 3A6PC 1KDTA 2O5VA 2QRNA 1Z6XA 2VHJA 2G0NA 3FE2A 5GVSA 4CEJB 4GT1A 3GJ7A 3I72A 4TYWA 2H16A 2ONJA 4GZLA 3BFVA 2ZU6A 4US0R 1R0YA 2ZR7A 1RRFA 2QUZA 4KLNA 2QM8A 3MHVC 1RKBA 1VPLA 4JLMA 2V3CC 4W5WA 1DVRA 3ADKA 3KXLA 4EPXA 5FPKA 4G5SA 4NCIA 2WIBA 3DDCA 1N6PA 1DELA 1E2GA 3TVTA 4LBZA 5JWHA 4B3DA 1EESA 2WWFA 2ATVA 4ZCIA 3X1XA 1ZD1A 3ZVLA 4Q02A 5FPHA 3THOA 3JVUA 2GK7A 2GJKA 4JBWA 4U02A 1UJ2A 1VYVA 1W36D 2NZ8A 3I4LA 4IOMA 3KX2A 2FX3A 4B3FX 3CZPA 2XGJA 2ZSBA 4JBXA 2DCUA 2MSDB 1M7GA 3K0SA 3GPLA 1ZRHA 3MAAC 3GLGE 3P1JA 3T35A 2QMEA 4M8NE 4MRRA 4ZKDA 3WYGA 4LWZA 2B7BA 3BC1A 3QE0A 3SZRA 5BXQC 4V02A 3W9YA 2OM2A 3NTUA 2IUUA 3BWDD 2GBLA 1GOTA 2CHGA 1ZYUA 4CZ2A 4D6PA 3RS3A 4BPBA 1G6OA 5SZIA 3TUIC 3B78A 1EFCA 2HF9A 4TSFA 1JR3D 1QZXA 4B76A 1XTKA 2LCFA 4ZDIA 2F9MA 4NCHA 3FHOA 2EYUA 1G1MA 1SVIA 4BFSA 4TYNA 2F1IA 1ZNYA 2FE4A 4LHZA 1X8JA 5AJYA 5JS8A 2OT3B 2ZRKA 2ZYTX 4II7A 3FHTA 5KSZA 1P9WA 2W6IA 4NCNA 4FD2A 4OI4A 1NBMA 2FSFA 1XTJA 3BBPA 3LH5A 4V0LA 2ERXA 2QQEA 2QGNA 3A1WA 2F3RA 2BVNA 3S1AA 4DBLC 1BOFA 4RZUA 3ICQB 4KHZA 4BZPA 4P32A 1UBEA 2IX3A 3U3RA 2PEZA 3U7GA 3FFBA 4GPTA 3NHBA 1QDEA 4NBSA 1AGRA 2A2ZA 3C5HA 5FBLB 4QJ5A 1WBDA 3HYRA 1FX0A 2FGJA 1G17A 2QAJA 2I3BA 2IWRA 3VR2A 4NU0A 2HCBA 4C0HA 2FG5A 1G291 4ACBA 1E2MA 3ZVNA 4MRSA 1N25A 1XPUA 4KXFB 3U7EB 1ZNXA 2CVHA 1TTTA 1E2KA 1W0JA 1YZUA 3GMTA 2ZI3A 4MUBA 2IK8A 5CLQA 2LKDA 5IHPA 3UPUA 2A5YB 1ZC3A 2PMDA 3LV8A 1CR2A 2J0VA 2J9RA 1IONA 4B3BA 1RVDA 4XSGA 1XCGB 3BFKA 4BEJA 4MUAA 4AY2A 1EXMA 1KHTA 4ZDWA 3THWA 2V1XA 1FL9A 2BBOA 1E2EA 3WNDA 1E98A 2PH1A 3IPYA 2XTZA 4IVRA 3EC2A 3ASYA 2KI5A 3K0AB 2J0UA 4QJ3A 4UNNA 1KO8A 2YNMA 4TL6A 3ADCA 2F55A 1SXJA 2HXYA 1OHHA 1G8PA 4RZ2A 2R6FA 3MCAA 3V4FA 2F7SA 4FCVA 3EA0A 2HUPA 1XMSA 1TADA 2PLFA 4OHXA 2FN4A 4JL6A 1SKYE 1T6NA 2CNWA 2HT6A 3TVDA 721PA 4I81A 1G7SA 2D3WA 1KI3A 2JGNA 3LQRA 2WM9B 1UEJA 5KPJA 1FTSA 1XD8A 4GP7A 5A5GA 5JSZB 1PVOA 3EPJA 3BB4A 4UNSA 3CB4A 3ZD6A 1W5SA 3LO5A 4P31A 1KI7A 2DYKA 4IXNA 1WXQA 1CKEA 5CB8A 4DLXA 3EZFA 3SQXA 1XD9A 2W6JA 1E9BA 1LW7A 2BDTA 4V0MA 4XWAA 3WXMA 3QXXA 4P4SB 1KZGB 2GA8A 3TQCA 4TLEA 3QSYA 1AA9A 4Z1MD 1SVSA 2IS1A 1GNPA 4HLQB 2XITA 4DEXA 3SE0A 1NSTA 1U0LA 121PA 3DKVA 3LLUA 1TEVA 4GNKA 4BLQA 3AVOA 1GDDA 2X19A 3CUEF 3AKDA 2OSBA 4A8JA 4XWKA 4GITA 4PO9A 1RRGA 3I8SA 5KO2A 1SVKA 1PV4A 1KDOA 5CJ2A 1FMLA 4KLZA 3RAPR 3H0KA 1V5WA 2HLDA 4O25A 1FNMA 1QHNA 4LRWA 4FMCF 3AVTA 5EXPA 1FP7A 2HDNB 1ESNA 2QEQA 2QMHA 1A2BA 2VTKA 1US8B 4NTZA 4R2IA 3RVBA 1E2HA 1TF5A 3IGFA 3DPUA 3P32A 2QL6A 1Z63A 2ZE7A 5FR2A 2REOA 4HYYA 5LPNA 1A7JA 1H65A 4Z54A 3GFPA 4CVNA 4B48A 4KFSA 1AGPA 3VQTA 2OV2A 1HT1E 2P65A 4LV6A 5FBVB 2WWXA 2QBYA 3KTAB 4R71A 2IYUA 3KB2A 1E4VA 3ZYCA 4LJAA 2CK3A 2WPDD 4YXWD 3TMKA 1G9XA 2WJJA 2ZRBA 5JEDA 3BH0A 4RY2A 3HU3A 3AB3A 3N70A 4PFSA 1PJRA 3OIUA 4ZCMA 5CDFE 4HAVA 4XVRA 3OIVA 3DOFA 1NVUQ 1XD2B 2VLIA 2ORIA 2R62A 1E2JA 2OO7A 5DN6A 2FEOA 2Z6VA 1KI4A 1UKYA 4ZDKA 4F93B 2RGXA 1VG8A 1ZIOA 2QI9C 2ASEA 2LWIA 2ZEJA 3GJ3A 3K0FA 5FUYA 1E2LA 1F2TA 1NRJB 1PUIA 4FCTA 4PC6A 2QT1A 1U9IC 3E1SA 1NKTA 3KKNA 4Q47A 5LD2B 2JIZD 3N2IA 4AIIA 5C1BA 3PQCA 4E03A 4A0FA 4LHYA 1ZJ6A 2BEKA 2AD5A 3LDAA 2P3SA 4G5GA 2IWHA 2PBRA 3M0EA 1Z6TA 2PCJA 3MUFA 1IXRC 2J59A 2WBLC 3AGQA 3K0CA 3MGCA 2Q6TA 3U44A 4DLVA 3GJ5A 4URUR 3R9IA 4GMDA 1ZMXA 1G20E 2YJTD 1QRAA 2GAOA 4FCWA 4W9MC 2ZXUA 2UZIR 2OLKA 821PA 3ZD7A 1RPZA 2YWEA 3FVQA 2B8TA 3K53A 2VPPA 5K8UA 4ABYA 4MKFA 4KJZA 1ZNZA 1KDPA 3CWQA 3QBVA 3RC8A 2EFDB 5F98A 1KK1A 4UXIA 2P6RA 2GEVA 1KJWA 1UPTA 1OXVA 3CH5A 2D62A 2O52A 3FPAA 1YZKA 5EE1A 2QAGA 5DNYB 3QKUA 4TMXA 2DFKB 2WWHA 2ZRAA 2G88A 2WKPA 1W46A 1FNNA 1SHZA 1UDXA 2DBYA 2VF8A 3QPWA 4Q48A 1W1WA 4KITB 4BEBA 4DLYA 1O3YA 3KDSE 2YWHA 5AR1A 2WOJA 4TN1A 3BB3A 2WAXA 5LD2C 4L9SA 1P3JA 2ECKA 1U98A 2JASA 2ZVPX 3QKSA 1G16A 1GKYA 4Q5IA 3I1FA 2FEMA 1KSJA 2HV8A 4NPHA 1X6VA 3RANA 1YZTA 1VDZA 4G01B 4EJSC 5CJPA 5H8WA 2PT5A 1TUEA 1XJQA 5FBWB 1TAGA 5D3MA 3TKLA 3W8NA 3T15A 2ZU0C 1GFIA 3B82A 4EPYA 3EXAA 1E0AA 3U5ZB 4KYIB 5GJBA 2QPTA 1KK3A 2FPKA 2ZJYA 3RS5A 3FKSD 1A1VA 3SJBA 2BJWA 3A4LA 4LDJA 1QHGA 2FPLA 3EPHA 5KSPA 1XPOA 1EFHA 5C4MA 4PAOA 3OESA 2GEDA 4NH0A 1OW3B 5G3YA 1I4LD 4BFYA 5B30A 4F91B 2IYWA 2ZS8A 4N0DA 3VHXA 4HB2A 5FPTA 2EWWA 3PENA 4JBYA 4EFMA 2B8WA 3O8RA 4LX0A 4C0AC 3MJRA 1GKUB 4QFMA 2XNDA 1KSGA 3THXA 3O47A 1XDBA 1OKKA 2XEXA 3VTKA 2QZ4A 2WPDA 4RFVA 2C98A 2GCNA 3SEAA 3GLIE 1WE2A 4F4JA 3AKCA 1KI9A 2OXRA 3DEFA 1J7KA 3VX4A 3SOPA 5CB6A 2OBLA 3BS4A 3K8YA 4TYPA 2ZS7A 1DTSA 3NBFA 4JLAA 1G7TA 2EU8A 4E22A 4I4LA 3X1DA 1NLYA 4S2EA 3T1OA 3VKHA 5DI9A 2ERYA 1TF2A 1FTNA 4D4LA 1JB1A 2ZRDA 3BH7A 1S9HA 2IHBA 4JLDA 2AX4A 1DG3A 1S8FA 1YR6A 1ZIPA 2ZQ5A 3CIOA 4TQAA 1Q12A 2AFIE 4KI0A 4GDFA 4AKHA 1PLJA 4B32A 4A2QA 3SJCA 4C0BA 2GTPA 1G5RA 1KSFX 5J4HA 4ESHA 2VHQA 3JVVA 1E2NA 4Q18A 2IS6A 3L2OB 1NIPA 3EAQA 4A4DA 2BCJQ 4TQ9A 3FMFA 2J3EA 2IT1A 5JCPA 3O8BA 1LV7A 2WAYA 3HP1A 4IDQA 4PC7A 1RYHA 2E87A 5JECA 1W4AA 3PJRA 2V1UA 4RJLA 1GTVA 4MRNA 3W90A 1NY6A 3P26A 4NE2A 3DVLA 1CTQA 3GLHA 1E79D 2FGKA 2WOOA 5H1YA 3THYA 3K70B 2Z0MA 3D3QA 3B1YA 1CJKC 1FX0B 3QEJA 3NHAA 4BZXA 521PA 5J4KA 5AUPB 5KSYA 4MKHA 1DADA 4Q4HA 3REGA 3UWOA 4E07A 2IYSA 4QBGB 5D3QA 1CRPA 2C78A 1GL7A 3IDQA 4F4IA 3O8DA 4QOSA 1G41A 4RSGA 3W5JA 3WMFA 1U99A 1G3QA 2GXAA 2JLZA 2ZRLA 5P21A 4Q4AA 3W6OA 3THWB 2ZI9A 1NVVQ 4M0LA 4JSYA 1NJGA 2EFGA 2VRWA 3HPRA 2DWOA 3C41J 4UNQA 2W00A 3SN6A 1KMHB 1P9RA 2J0UB 1LFDB 5CK5A 5C18A 1HA3A 1SQ5A 4R7ZA 1SXJB 3KQUA 3K9HA 2NPFA 4DIDA 4DB2A 4GOXA 3CW2A 4ITRC 3W6PA 2R65A 3GLGA 1Q3HA 5E4FA 4PZZA 5K8LA 1G8FA 4JSTA 3TAHA 2DFNA 2GESA 2GZAA 4LBWA 2GJ8A 5DHFA 2OFXA 2GAAA 1LTQA 3FKSA 1P2SA 3ECCA 1E9DA 2F3TA 3A1VA 2XB2A 2OCAA 3GLFE 3W34A 2R2AA 3K70C 4PC1A 3ZVRA 4KBGA 3LXRA 1TQ6A 2JATA 3Q9LA 3I61A 1IY1A 3FMPB 2FV8A 1BO6A 2UKDA 4FXPA 4HZIA 3IHLA 3V9PA 4LJ4A 2CE2X 1S96A 1S1CA 1KO1A 1CJMA 4IKEA 2ZI6A 1RZ3A 1TEXA 2RGNA 3K1JA 1XBTA 4FN5A 3WRYC 2WHXA 2CLCX 4ARZA 1H8HD 2HEIA 3NIBA 1R5BA 4LV5B 1LVGA 1NKSA 1S9DA 1QHYA 2ZYUX 3FB4A 3V4RA 1W36B 3R9XA 2OZEA 3Q7PA 1XXHB 3I8XA 2GCOA 3RS4A 1KY3A 2J0SA 3AVQA 3QQ5A 2F43A 1J99A 4BLTA 1T91A 2FSHA 1MO4A 1GAJA 5FUXA 1TQ4A 2QTHA 1XEXA 3FMIA 4DSUA 3D8BA 3K9GA 3RDPA 3RHFA 4KO8A 5AUQA 4DRZA 3UK6A 4L16A 2QGZA 1LY1A 4FMDB 4LPKA 4LBYA 4R98A 2GVDC 4KYUA 4LV8B 1UKVY 4MRPA 4ZI2A 5EP1A 1N6NA 2FWRA 4PPFA 4BGDA 3TSWA 1ODFA 4L8GA 2HYIC 5CIQA 4QG7A 1IM2A 2BKUA 3CM0A 3B9PA 4KFTA 1DEKA 3KJHA 1CS4C 1DBSA 4S35A 4KSBA 1KZ7B 3RNLA 3PFIA 3RSOA 3TSZA 2XJ4A 2QBYB 2J7PD 1R2QA 4JKIA 1R5OA 2NOAA 1ZP6A 5HZHA 4TSFD 5FTNA 1N6KA 2AFHE 3L8YA 4BASA 4NYMR 1Z28A 1NVMA 3TW4A 1DAEA 1NI3A 3KKQA 1HUQA 1Q1ZA 4FI3C 4LPSA 2AK3A 2FFHA 3SJAA 1P62B 4XIGS 2N42A 2D74A 4M9QA 4Q66C 1X1SA 5DH9A 1W36C 1NBMD 3AF4A 3PR1A 3CNLA 3SU8A 5TVKA 3LBHA 4WIAA 5L3QB 2AXPA 1EFTA 4DDWA 3CRMA 5KNDA 4URWR 1U94A 4Y0VA 3BRWD 4UXHA 2FFBA 2YYZA 1GM5A 5BN4A 1E2PA 1DOAA 5EP2A 2ZRNA 4OJQA 2LKCA 4AKIA 1EGAA 2CHQA 2CMKA 3VR3A 2QMUA 4D0NA 1DS6A 3PUWA 4P33A 2BEJA 2JJ8A 1OB2A 4EQ6A 4AYXA 1Z0AA 2XZOA 4EKDA 4K81B 1ZC4A 2CLDX 4V0KA 1HH4A 3AF2A 3L43A 2A5DA 4AI6A 3WYFA 1W0JD 4TTRA 2JJ2A 3REFA 1YZLA 4K8OA 5BQ5A 2HT1A 3Q8XB 3U6BA 5FPYA 1TF7A 4NCJA 2RGCA 3GJ6A 2ZANA 2ZRGA 1MO6A 1ZU4A 2FSIA 1SHKA 1JECA 621PA 3VNVA 1A82A 4C0SA 3UG7A 2IYLD 3U7FB 1S1MA 1KSHA 2ANBA 1Z22A 2GJSA 2ZE8A 3UWKA 3QKTA 2VSFA 1ZAKA 1II8B 1RYFA 1OHHD 3B13B 3Q7QA 1DO2A 2QAGB 3SR0A 3TJZA 1H8EA 4RCYA 3KQKA 1WRBA 3AKYA 1ZM7A 2F1JA 2WWIA 3FMOB 4NYJR 2CNWD 3A58B 2QT0A 2Z5FA 2X77A 2O8CA 4PHGA 1RE0A 4TMKA 4OKSA 5J4VA 1Q1EA 1FQKA 3LFUA 4BZQA 3QKSB 3LNCA 1NL3A 1W47A 3DM5A 3U4QB 4DIEA 5FFMA 3CRQA 4QGFA 2OESA 4PO1A 3M4YA 2W6JD 1H8HA 2ZYWX 3P20A 4F7WA 5CDFA 3NWJA 2ZI7A 5D3MB 1WBBA 2C95A 1A5TA 3FOZA 2EVWX 2R9VA 1ZUHA 5FPSA 4B43A 5FBRB 1K5GA 3AF0A 3MWLA 1GIAA 5E7IA 4TZ6A 5AK0A 4PSKA 2BCGY 4Q4JA 4RD0A 2V6IA 3WHLA 4LHVA 4I1VA 2AXNA 4A92A 1WB9A 4CIDA 2YV5A 3SYKA 1N6RA 2V54A 1FPMA 4LHWA 2VHCA 1T5IA 3H2YA 4W5HA 1CXZA 4HLUA 1R7RA 2BBWA 2W2TA 3GJXC 1U0JA 2HLDD 2QAGC 5JS7A 4OQLA 2V7QA 4URVR 3LRPA 1I4TD 2OE2A 1D2MA 4Q1DA 1GUAA 1Y3AA 3CX7A 3THXB 1JALA 2CCKA 2QM7A 4MDEA 3K0EA 1M8PA 2J7PA 1C1KA 1EWQA 2OHFA 1IN5A 1S3GA 5HCNA 3SBDA 4Q03A 4PANA 2PJRA 1P7CA 1MO5A 4TYYA 1T0JB 2HXSA 4Y0AA 4A2WA 5KUTA 2CXXA 4UXJA 5EUQB 2CK3D 5K8TA 1KTVA 2BMDA 5JRZA 2QENA 2ORVA 2L0XA 3GEHA 3OEED 2FJUA 4LYJA 3QKRA 2F1HA 2G83A 4DDTA 4DLTA 2Q3FA 2X2EA 4AD8A 5EE3A 2PT7A 2D7CA 2VP9A 2Z43A 4NL4H 2DWQA 1NIJA 1W4BA 5DN6D 2QPAA 1DAIA 3E2IA 1HV8A 2KE5A 1Z08A 2CCGA 2DY1A 4J0QA 3CZQA 4RCZA 2FU5C 3ZGXA 2RH5A 3IPXA 3QF4B 1XJ0A 2Q3HA 4KFUA 4BLPA 4X8MA 1R8SA 4LC0A 2OAQ1 2GZHA 5DYIA 2ZRPA 4HUQA 4BFZA 1NN1A 3RWMB 2O0HA 4Z8YA 2PX3A 3DZDA 2QA5A 2VSOA 5FL3A 1WA5A 3CLVA 2BOVA 3C16C 3LW7A 4I1OA 3RS0A 3WNBA 4CDGA 4BFWA 4TL8A 1R0WA 2QMOA 3EIEA 2QSZA 4PSAA 1MABB 3GLHB 2XTMA 5JJLA 1IXSB 2BWJA 4TLDA 2WJYA 2IC5A 4RKFA 2AD1A 2XZPA 2NTYC 4JS0A 1C1YA 1DAKA 5SZHB 3I5XA 1XNJA 3CR8A 4C9BA 5IDVA 3KZ1E 2G9NA 3TR0A 2X2FA 4Q4HB 4CGZA 5UKDA 5L3SA 3T1QA 2BJVA 3EZ7A 5CM8B 2VYFA 3UG6A 4BFTA 4WA7A 3AVVA 1E96A 4M1KA 2W2VA 4GMXA 1YRAA 5JZVA 2PZEA 1F2UB 1QF9A 1E9SA 3LQQA 2RCNA 1KI6A 3KFXA 2Q3MA 2G1JA 2KWIA 2Z83A 2C03A 4YLGA 1DAGA 1E0KA 2ZJ8A 1QBKC 2ZE6A 5EP3A 3RS2A 2RMKA 3E5HA 3TUJC 2RHDA 3GLIA 1I2DA 3GCGA 4M22A 1FZQA 2MSEB 1E2QA 3QF7A 2IF2A 4B2LA 3FYHA 1HEIA 4Q9IA 2WKRA 1N6IA 5DI3A 2GRJA 1XP8A 2GJAA 2D2FA 2GXSA 4G5OA 4E5UA 1WF3A 5TDHA 1ZU5A 4URYR 1GITA 1WCV1 4BLRA 2TMKA 4CEIA 4NDZA 3ASZA 4IJMA 3R9WA 5FTJA 1NF3A 1XF9A 3NH9A 3J81k 4ESVA 1GL6A 1P4SA 4OJKA 2NO9A 1TQ2A 1VCIA 5EE0A 2J46A 1UM8A 4O2LA 4ERNA 4F38A 2CJWA 1RFLA 2ZTSA 3PV0A 2PX0A 4I1SA 3CPHA 4JVLA 4U7DA 5FOWA 2KRKA 4NYJQ 5BYKA 4QGHA 4BLOA 3HU1A 1E94E 1XWIA 1XTSA 4MYCA 4EPWA 2FZ4A 2ZIAA 3H84A 3JZMA 3KJGA 3QVVA 1NP6A 4RD1A 2GNOA 8OHMA 4N3NA 4ARZB 3RWOA 1NVWQ 4HLDA 1RRCA 4B71A 2DZOB 5FOUA 2O8DA 4FWDA 2GCOB 3VU9A 2ODEA 2XNSA 4QHYA 1OV4A 3SHFA 4CEHA 4OK6A 4WAUA 2F43B 1VTKA 2WKQA 4DCSA 4ZO4A 2XNDD 4JVMA 1XEXB 2CBZA 3AUXA 2AHOA 4EPVA 4YMTA 2C5LA 1OKKD 4QM6A 4EUNA 4XJXA 1G3MA 4V03A 4LK2A 5JHHB 3IILA 5CM9C 4TMWA 1D9ZA 3OEEA 1KKMA 4NONA 2VHUA 1QVRA 5EE5B 2QSYA 1N5LA 5DYGA 3SC3A 3N5CA 5F9FA 2ZSEA 3GD7A 5GJVC 5A0FA 2F1RA 1DARA 3OEHA 1YR7A 5BYJA 2XJ9A 1BS1A 1C9KA 2WWWA 3AVYA 2FFQA 2E1RA 1VCMA 1NG1A 1U8AA 3AP2A 3RABA 1XU4A 3QIAA 3KQNA 4RZ3A 1G7RA 5DSZA 3HDTA 2VEDA 1KJYA 3BD9A 2J0QA 2O8FA 3QEOA 4AKEA 4JJKA 3NEJA 2D7DA 1TQDA 3CX8A 1Q0UA 2VL7A 4Q9KA 1OPXA 2JLQA 1U2RA 3RSLA 2CDNA 3UMRA 2VQSA 4OHWA 2G77B 2WJGA 2OCYC 1Z0KA 3Q3JB 4Q4LA 5B2ZA 3V00A 4M9SA 1Q57A 3VR4A 4HZUB 5C4GB 2FH5B 2Z4SA 1OIXA 2OAP1 1W7AA 4EAQA 2IA5A 5DGXA 3GLFA 3H86A 4JLOA 4ZCLA 4PC2A 2IYRA 1JXMA 1K6MA 2OFOA 5DHAA 3G5UA 1XJCA 4PAQA 1UKEA 4AWXA 4KCGA 3C14C 3EW9A 3BIFA 2GF9A 1T8TA 2D06A 1AQYA 1IN4A 4WBSA 5CLLA 4PZYA 4DDUA 1HQYE 1YR9A 4JLKA 3AVPA 4HAUA 2B21A 3B1ZA 2QTFA 1M6NA 4DUGD 4EQ6B 2AWNA 4B74A 1KKLA 4Q1CA 3PIRA 1KO5A 1G18A 1RRPA 4IHQA 4M1TA 2OBMA 3WHKA 2ZUBA 5JWOA 1G5TA 1N3BA 3MWKA 3D31A 1XB2A 2ZITA 3M6AA 4YQFA 1YU9A 2VF7A 5CIWA 1II0A 4H1UA 1AM4D 4D81A 1ZCBA 1VIYA 4RD3A 4BECA 2GDJA 5B58C 1AS3A 1MKYA 2C2HA 5HR5A 1KNQA 1QHHB 3EIHA 3ZH9B 3MG9A 4XVQA 4IW3B 4NHOA 3QG5A 2C8VA 4FWTA 4RKEA 4H1VA 4B2PA 1DE0A 4DSNA 1XFAA 2WTUA 2CL7X 3GFTA 2A5GA 3FHCB 4EDHA 3X2SA 2UVQA 1KGDA 4MITA 2NQ2C 1VCOA 1N6HA 1OYWA 4D2IA 5FOXA 3EPLA 4LOAA 4CEJA 4IFBA 3UATA 2A7QA 4JZKA 3U3KA 1SULA 3C15C 4G1UC 1GRRA 4US1R 1KO4A 4BRWA 1D8TA 5M04A 2ZS9A 1KI2A 4NZYA 4CRWB 3DMDA 1P6XA 4NMMA 2IYZA 1CJVC 1OXXK 3H4MA 5DISB 4EPTA 3LY5A 3K9NA 4OQXA 3UIEA 2JDID 5IF9A 1PUJA 4FINA 4IXMA 2AN9A 3X1YA 2NZJA 3KUCA 4KSCA 1XZQA 1NY5A 2RKOA 4MA4A 3RLFA 3KQHA 4LJYA 5J5CA 2BC9A 3IEUA 3TGPA 4BLSA 3T12A 4Q1AA 4Q4JB 4PAMA 3SQWA 2JA1A 2YHSA 4W5JA 3LVQE 3I32A 1SXJE 1Y63A 4AG5A 2B7CA 4BWYA 4LJ9A 1QVAA 1S2MA 4G0NA 2Q21A 4IVPA 3R8CA 1XEFA 4ASUA 1XPRA 3QG1A 1NG9A 3EIQA 1U8ZA 4TL7A 4TYQA 4GL2A 4IDNA 4DLWA 1B23P 2YC4C 2XB4A 2FSGA 5FOSA 2KJQA 5KOYA 1GRNA 5KSOA 3QY0A 3OE7D 2VHTA 4IOLA 1UAAA 1W4RA 1JPNA 1ZD8A 2YOFA 2DFTA 1BMFD 2NPIA 3AP3A 5CYPA 1UEIA 2DHRA 2A30A 2J45A 3BB1A 4JLJA 4TLAA 3FFAA 5JLJA 1N0WA 2SHKA 1DAMA 4B73A 3HR7A 3IQWA 2NIPA 4Q7JB 3AEZA 5AJZA 2W83A 4I99A 3SDZA 1RIFA 4RVCA 1E69A 1JI0A 1QHXA 3B60A 4XOIA 2J5XA 5E3HA 4URZR 3QKRB 5BN5A 1OT3A 3S1AB 4GI7A 3ZZTA 4QJ4A 3AF3A 2VP4A 4OQNA 1TUIA 3PVSA 1PZNA 5IRCD 1XXHE 4JL5A 2FA9A 5JBQA 1AKEA 1AS2A 4OL0A 5FUWA 1W4CA 1T3LA 3LX8A 5HKKA 1E2IA 4AC9A 3RC3A 4M21A 4DUGA 1OB5A 2AK2A 1XMIA 2MSCB 4A6XA 2ZAMA 4Q9LA 5E7MA 2J1LA 1S3SA 3NEYA 4RD6A 4RZXA 2AKYA 6Q21A 4HUQB 1M2OB 3IIKA 3B5JA 3LXXA 4FWIB 3VR6A 5BWMA 2GBLC 1JR3E 2ZUCA 3RRZA 2H8KA 1N5IA 3VHLB 2Q9AA 4WVFA 3KKMA 1A4RA 3NDPA 1G3UA 3HJNA 5G53C 4Z51A 4JYCA 3B7GA 5J47A 1G64A 1IXZA 1F48A 2G1KA 3CF2A 2JJ2D 2VO1A 3BK7A 4TLCA 2VH5R 1X1RA 5F9HA 2QP3A 3R20A 2ZRHA 4AYWA 3T06B 3T5DA 3EPKA 3NDBB 1COWA 4L5BA 1F6BA 1LB1B 4LC1A 5G41A 4ACAA 2ZI4A 4FW9A 2A9KA 4KODA 2R8RA 3Q85A 2C9CA 1VCNA 2ZSAA 2NO7A 1Z3IX 1IY0A 1FP6A 2H92A 3NH6A 4P3YA 3K09A 4WZAE 3ZVMA 3WP1B 2YWGA 4JIMA 1KI8A 1ZNWA 2KBEA 5TY0A 5TMPA 1KI6B 1K5DA 3BH6A 5EXSA 2RAPA 1XMJA 4B6FA 2PL3A 4HATA 3ZDQA 1LF0A 1MRNA 4Q9JA 3L8ZA 4IVQA 4UNPA 2C96A 1H8ED 4D0GA 1DO0A 1T5LA 4FMCB 4DSTA 3B1XA 2IYVA 4U5XA 1AJEA 1IAQA 5FOVA 4Q1BA 2HJVA 1FQJA 4PX9A 1G7CA 4DLRA 5TARA 3MD0A 4M1YA 2JDIA 1XCPA 2WSSA 1YJ5A 1E3MA 3DOEA 5DI3B 1NN0A 5EUMA 1VG1A 1W5TA 4KAXA 3QNUA 1E9CA 4P4SA 5SZJA 3NBXX 4V0OA 1P2VA 5FL7D 3ZS8A 4DLSA 5JEEA 5J40A 4IOKA 1W44A 4M9ZA 1Z5ZA 4CEIB 5HE9A 4JLNA 4DWJA 1U0HC 3AJIB 4M53A 5J4LA 1OFTA 2DVWB 5C2JB 2WMNB 1I2MA 1P5ZB 3F3YA 4HDQB 4A8JB 1IY2A 3HWSA 4MGIR 2KBFA 3OAAD 1SVWA 1MRSA 2ZSFA 4QNMA 1U8YA 5AUOB 2ZRFA 3W5IA 1U9IA 2QY9A 3CF6R 3QOFA 4O0MA 1T9HA 1SXJC 2XX3A 4HAXA 1JJ7A 1GWNA 3LLMA 4LYAA 3ZJYA 4EPRA 4MKIA 3KUDA 3CONA 4MYUA 2B92A 3OE7A 1US8A 3WNCA 1UBCA 3GJ0A 3QPVA 1MV5A 5DE3A 4Q01A 2YZ2A 3DKPA 2O8DB 1BMFA 2GEUA 2WJHA 3NBYC 2V7QD 4CYMA 3AH8A 4CEHB 4QM7A 2D4HA 2ODWA 1DAHA 1HURA 4AURA 5EQTA 3C7KA 1Q44A 2RGAA 4TL9A 4OK3A 1Z07A 3T1TA 3KTAA 4B34A 4TMTA 2IS2A 1EK0A 1F5NA 2FFAA 5HTKA 1IOZA 1JEDA 4CF7A 5AJWA 1OXSC 1TMKA 1N0UA 5KNBA 4DT1A 4B47A 2RB4A 2ORWA 3B2EA 3FDIA 1XZPA 1SVOA 1XD2A 5GADl 2H57A 2Y8EA 1XCMA 4L4UA 1XEWX 5LB4A 3PUYA 1T3SA 2ZVQX 1OH6A 1NNEA 4B2IA 4PHHA 3ONWA 4A8JC 2YKGA 3WY9A 1FUUA 1KI1A 3K0FB 2ZAOA 1F2TB 2DFLA 4D82A 1HY3A 5F2EA 4OHYA 5B57C 4MGKR 4IFEA 2W2XA 2REBA 3QBTA 1J2JA 4Q7MB 4GP6A 2EW1A 4QGAA 1P61B 2I1QA 1ZM3A 4EJSA 2OG2A 3NKVA 2XSZD 4P4TA 1LS6A 1ESMA 2BIFA 3U44B 5DIFA 3B6EA 5AUNB 5HPYB 1E6CA 3AV0B 2JLWA 2MMCA 2WVJA 1YZGA 5FOTA 1WQ1R 1CF4A 1Q3TA 3QI2A 4GBMA 4M4SA 1X8KA 2GF0A 1MR3F 2R6AA 2H18A 2Q9CA 4C0LA 1II9A 2IXEA 5KDDA 1RW4A 2Q9BA 5TV2A 3LBNA 1GNRA 2YWFA 2YVUA 3F8TA 5JMTA 1E4YA 3B9QA 4RD4A 4PPGA 4JVSB 1JBKA 1KJZA 3EASA 3KJEA 1NLZA 3CNNA 1Z0JA 2ZJOA 4PSVA 3PEWA 1Z6AA 4LGMA 1FUKA 1L4UA 3UMSA 4B3CA 4D0LB 4AG6A 4BRUA 3IBYA 1ELOA 3RRYA 2HF8A 2OCPA 3HR8A 4QC2A 2CLSA 5CYOA 1RJ9A 5HE8A 1JR6A 5HZKA 2XAUA 1IN6A 2FOLA 1G21E 3WMEA 4C4PA 1G6HA 3SJZA 4KVGA 4V0NA 2JEOA 4GZMA 2FNAA 2YOHA 1AN0A 1E2DA 2GETA 5HCIA 1BYIA 1KO7A 3LBIA 4UJ5A 1OH5A 1KYIA 1QHIA 1IJEA 3BGWA 5FL7A 5J4YA 3GEIA 2JAQA 4NKRA 3I73A 1AZSC 5KTYA 1OH7A 5FTKA 1PLLA 2PLRA 3DMNA 4QNRA 4DLUA 1OLOA 3K0CC 2QE7D 3JZAA 5EXXA 4OHVA 2ZR9A 4PQYA 4LYFA 1P73A 2FMXA 3MSXA 3T1VA 1D2NA 3U2QA 2IEYA 1VG9B 4DJTA 3GLHE 2NO6A 4NCKA 3OAAA 4QRHA 3U60B 3CKLA 5GJCA 4RFSA 3C5CA 3KFVA 4YDSA 4FWGA 4IDOA 3TW8B 1XMVA 2QNRA 5JHGB 1Z8FA 2XOKA 4TTQA 4MH0R 1OFIA 1CJTC 2O8BA 1FOEB 2IXGA 4OI2A 3TAUA 4MDFA 2QPOA 1TL7C 4FIDA 2GKSA 2F6RA 3IIMA 1D6JA 4ZV4A 1CR0A 4POAA 5LBIA 1CBUA 1ZINA 4LJ8A 3WBJA 2EYQA 3VAAA 4C7OA 4YMVA 1WP9A 5BN3A 5K8IA 2VSXA 1Z29A 1Q1QA 1E9RA 3CR7A 5C46F 4UJ3A 1KIMA 4D80A 2BM1A 4QGGA 2EWVA 1TNDA 1XTRA 2P67A 4A15A 2G0TA 1AK2A 2BV3A 4B35A 3CX6A 1X37A 4HEJA 4K46A 1S0UA 4C0QC 1R5NA 3HYTA 1W49A 4PC3A 2PCLA 2H7VA 3EZ6A 2PJZA 2OILA 3R8FA 2WMOB 2IEZA 4F92B 3TQFA 1CU1A 1UADA 1J8YF 1NSFA 4ILEA 4D4MA 4ZDJA 2JLSA 4HDCA 4B44A 3AP1A 1YQTA 4CW7A 2ZM5A 3GFOA 1ZCAA 2JLXA 1N5JA 3BOSA 4Q19A 2GXUA 4WW0A 1P2TA 4OK5A 1P9NA 4B3GA 1FFHA 1OFUX 4KV9A 2YC2C 3BORA 4PTLA 3OEHD 1Z2AA 3TR5A 4LZZA 4WZ6A 2V55B 1IJFA 4WXPA 1M74A 3PG5A 2G6BA 2QU8A 3LD9A 2GVZC 3CO5A 1NLFA 2CL6X 4HDOB 4JLPA 4ZI3A 2W0SA 2A5JA 4XSHA 1QHSA 2F9LA 2AR7A 5JJIA 2HCJB 4PR0A 4KBFA 3SHWA 1JJVA 2XSZA 4KFRA 2WZQA 1YZNA 1I4DD 4NYMQ 5FI0B 4Q1EA 1A2KC 3EARA 4Q1FA 3QXJA 1Q21A 4HAWA 5EZ6B 5FR1A 1M1YE 2ZPTX 1TX4B 1XX6A 2BMEA 3L0SA 3K9LA 4XTRA 4DCVA 4GSYA 3IEVA 5KDLA 4DXAA 1ETUA 2V8OA 1AIPA 3D6TB 3EG5A 3CPEA 3NXSA 3THYB 1E1QA 4LI0A 4L9WA 1P72A 3A8TA 1KAOA 4LSGA 2C04A 2RGEA 3D7MA 4ZIRA 4TT3D 1R8QA 3KW6A 1SGWA 3LX5A 3EWSA 1VMAA 4XD7A 4BFVA 1GL9B 2OCBA 2VP5A 2VP2A 2ZJZA 3IO3A 3P4YA 2P6UA 2WSMA 2O0JA 3CH4B 3KXIA 3LA6A 3ZIAD 4IDHA 2IBMA 4Q4AB 2V4ZA 5B64A 3ICEA 1ZM9A 1Z0DA 1NJFA 2JJ1D 2K5UA 1QZMA 4R9UC 1KMHA 1S4QA 1RC8A 1E32A 4OBEA 4N0EA 4XVUA 1HQCA 2PZFA 4OI1A 4FWHA 4GRAA 5FTMA 3GLGB 2J87A 4IRUB 1WMSA 1LF5A 3ZZUA 3ADBA 2QE7A 3AKEA 1R10A 3NC1C 4BQSA 5KNCA 1W2GA 4IEEA 3R7WA 2JLRA 2IYQA 4DEYA 3SYLA 1VIAA 2QRZA 4JL8A 4JYBA 1L8QA 4OYHA 1EX6A 2XXAA 2BMJA 1ZBDA 4F4CA 1NN5A 4LCBA 4CT5A 1Z47A 2EFCB 1Z6YA 1EFRD 4JVNA 5DLQC 4E09A 3I62A 4OHZA 4MYHA 1SVLA 1MOZA 2ZJ2A 3KKOA 2Q0HA 3CWZA 3ZQ6A 1IBRA 3A36A 1M7HA 1Q20A 3EC1A 2RHMA 1N0VC 4YONB 1WDTA 1JXOA 5E7JA 4WZBE 1LNZA 2VP6A 4BUJA 3SYNA 3GJ8A 1K8RA 1E0SA 1E2FA 4DDVA 2GZDA 2DB3A 1NVXQ 4X8OA 4TTPA 2IHYA 3CRW1 5LB2A 5L8VA 1XXHA 2O8EA 4M1WA 3QVUA 4ZPXA 3L0PA 3BE4A 2MMGA 1AKYA 4PQFA 1SKQA 3OIWA 4UKDA 4A1FA 3RRMA 1M7BA 4LYHA 4JN6A 5IK2D 2FPMA 3AVUA 4LBVA 3RRNA 4LHXA 3Q72A 3L0IB 3NG1A 1X3SA 1DPFA 3FWYA 5ANRB 3GEEA 2P5TB 1GKIA 3B85A 4KU4A 4NP6A 4U00A 1BIFA 3TSOA 3K09C 5AWFC 3OHMA 1UKZA 1YHNA 4TQUS 4PPNA 3HU2A 5AJVB 4QHTA 1T8UA 2GCPA 1Q1BA 3X1WA 4DZZA 4ASUD 1CLUA 1JR3A 2GILA 4HB4A 4IEIA 3ZLJA 2QROA 4URXR 4DB4A 1Z06A 4LY6A 1ZM4A 2BM0A 4I1UA 4PZLA 2W0MA 2EFEB 2ZRIA 4A0GA 2A78A 4P4UA 4R2HA 1Z6GA 3GJ4A 1XTIA 3I3SR 1IN7A 1O87A 4NYIR 2FF7A 3FKQA 4QBHA 3PUXA 4DT1B 4UQOA 2EFHB 1GRQA 4LUCA 2RGNC 4JT4A 5JCZA 4UNRA 2R6CA 4HSEA 3I92A 4IDPA 1L7VC 4M1OA 1U81A 4RD2A 4HI0E 5EXTA 4KVAA 3Q5DA 1CEEA 5KU1A 1E9EA 4Q9HA 2QP4A 1SKYB 5L3QA 2QTVB 1JNYA 4TMZA 3AGPA 4PPQA 5EP4A 4FMDF 3L82B 5CITA 3DO6A 3GQBA 1GZSA 1HE8B 1HE1C 1P2UA 4FMBB 4O2RA 3VNUA 4TT3A 2X1VA 2OUKA 1KNXA 1ONBA 4CT4B 1T4GA 3VR1A 3PUZA 5HKKD 1SZPA 4HB3A 1IHUA 3IHWA 4G5QA 3SNHA 1KDRA 4EJSB 5A4JA 2BKEA 3KB1A 1NVVR 3ZIAA 3ZS9A 2I4IA 3U61B 2RGDA 3IUYA 3U3JA 2WJIA 221PA 1NMZA 1G19A 2P6NA 4GOKA 2DZNB 3PEYA 2JJ1A 5KDOA 4DLZA 3E70C 1OF1A 1OIVA 2ZUDA 4MGZR 2ZYVX 3KJIA 2C99A 3ETLA 4JMPA 2I1VB 3MRSA 4EIWA 4YDHB 1GNQA 3W3AA 1JAHA 5H68A 2OXCA 3B1VA 3U7HB 4HAZA 2ODNA 3QXHA 421PA 3IIJA 3NVAA 4C0KA 1GSIA 1NBME 2PEYA 5TB5A 3WYAA 2G3YA 3SS8A 1COWD 1E1RD 2H17A 1Z0FA 1II8A 5AJXA 3ZZ0A 2D2EA 1E99A 2WIAA 2QN6A 2ZJ5A 2C9YA 2AL7A 1L2TA 2WICA 1JQJC 3DZ8A 4MKGA 1J70A 1RJ9B 1EFRA 5KYKA 2KB0A 1D2EA 2R6GA 3HPQA 2HJGA 1AS0A 2O8CB 5GJWC 2BBSA 1X8LA 2ZSDA 5L3VA 2ZROA 2CVFA 4B6EA 2NO0A 1G8HA 3T34A
chains in the Genus database with same CATH superfamily
5FWYB 3OZ7A 4RFLA 4UCFA 4QD3A 5KBYA 2FZLA 3EX7C 1PJQA 3HA5A 4EUEA 1AO0A 4LQDA 1FK8A 1X1DA 2WJVA 1JIXA 3J80A 2ACVA 2QORA 1X7ZA 3REQB 2ZIFA 1TD9A 4A0HA 1Z5UA 3IUBA 2O1WA 4JT2A 5B55A 1Q7GA 4J75A 5BSFA 4X6UA 1G5PA 3G7NA 3C7TA 3OZXA 3IQXA 2PMKA 4C78A 1KOFA 7AT1A 1T8SA 3FTEA 2E18A 3VMFA 2YMLA 3OX4A 4UVDA 2I4NA 1SOAA 3VH1A 4BJ5A 1WXWA 2C7GA 4Y2GA 3EIUA 3ETJA 4ND1A 3UF0A 3DNFA 1QG6A 3AF1A 4WURA 1GU7A 3FVWA 4S05A 1GQSA 4C07A 1ZVVA 2J4CA 3FYCA 1SXHA 4QQ8A 4MVJD 1KMIY 1F2UA 2PRSA 4CKEA 5JWRA 1KK0A 2ZREA 1RZRD 3B70A 2RGBA 1OSNA 3T54A 1MJ5A 5F3RA 2B1QA 1X86B 1N9GB 1HT2E 4P9NA 5K3BA 4ZFNA 4GOJA 1M0SA 4M8KA 1L2CA 3U1BA 4UBKA 2ZRJA 2NU9B 3PX7A 4K9QA 2LVBA 3PE4A 5DYYA 4D4KA 1JVBA 4TS4A 2GYVA 3K1TA 4UEWA 1QH1B 1HL3A 3GXBA 2ABWA 1OOEA 4O59O 3RI3A 3R7BA 5CPBA 2UVPA 3C2QA 4NDAA 4B75A 2ZIZA 1ZR4A 1LDGA 3QXCA 5IWAB 4NBRA 4DA9A 4LFAM 5E9QA 2ZKIA 4CQLA 4G5FA 1UMBA 1HYGA 4YUAA 3KOZA 3LAWA 4PGFA 3PVZA 5IBPA 5KVQA 3C3CA 3OHPA 1E18A 4O3MA 3ILHA 1AQUA 4AICA 1QHHA 1T4CA 4CV1A 3PXDA 5K1ZA 1WDLA 2IE8A 3P2MA 2VHJA 4ZC1A 1THTA 2I76A 2H16A 2ONJA 4GZLA 3COSA 5HIMA 1VPLA 4D9BA 3DSRA 5G0UA 4LBZA 5TEWA 2XTJA 2G06A 3LQFA 1UXOA 1I7QB 3MWDA 3T38A 4CIWA 3RHSA 3P1JA 1ZJ5A 3I5MA 3O03A 4GW3A 2HHHB 3GLRA 4G41A 4RHTA 3Q3EA 4GUDA 3OSZA 4V02A 3TQSA 3BZBA 1ZYUA 2RBEA 5TEVA 5BR8M 3LUPA 2H5XA 3EXFB 2ZYTX 1NYRA 3OQ6A 2EFJA 4G3OA 1IEVA 1GAQA 3L1IA 3PTAA 2BFCA 4BZPA 1BXGB 5B5SA 5KYXA 3MCZA 3RAEC 3C5HA 5B4VA 4EEZA 1V8BA 5LZ7A 1FS4A 2R68A 1ZNXA 2G8LA 1T43A 2IK8A 1RADA 3O84A 2AG6A 1CR2A 3QOWA 2JW5A 2P9CA 3RVDA 3CKYA 4ZO8A 3L05A 1L9XA 4NBKA 4Z4CA 2V1XA 2CWWA 3I05A 1K9SA 2CWDA 3ASYA 2C0QA 2OPBA 5B36A 4TL6A 3LPLA 4B7UA 2R6FA 2ZSHA 2P8JA 2R00C 1DWOA 4D42A 4CISA 4OGLA 2OENG 2O01F 3NHMA 1SKYE 1T6NA 3WFJA 721PA 5IFLA 4ZT3A 1ODLA 1QQBA 4HDAA 3W79A 3ZD6A 3IDFA 3E21A 1WXQA 1SUBA 1MEJA 4RLHA 2L4EA 1W76A 3MM4A 1PEKE 2RHJA 3GDGA 1EQAA 1YRYE 4BLQA 4LXQA 1TCUA 4L4SA 3RTCA 4ZN6A 2OB2A 1LBEA 4RULA 3E2MA 3VAZA 3DPUA 3P32A 2ECOA 5GINE 1L4HA 3QFFA 1QRUA 3GJYA 1I24A 3MUEA 4PN7A 3HJSA 2UVPB 2EC5A 3OIUA 3GEDA 4YGYA 3V8VA 3QEAZ 1NVUQ 1K3WA 4QQKA 3KVYA 3T4PA 1Z12A 4RF0A 2RGXA 5KVVA 1AKQA 4TV8A 2AYXA 4AIIA 2HGZA 2J7NA 3TLGA 1Z6TA 1PG5A 1ZK0A 4CQLB 1PG0A 4HKTA 5F35A 1ZIDA 1UP7A 4ABYA 4KN6A 1AGNA 1SBIA 5T6BA 5TJ9A 1PFYA 2GOYA 2JH3A 4D9CA 3KAQA 4HFNA 4W1PA 1P1HA 4R3UC 2PU5A 1KSJA 3QVGA 2VF4X 4IO0A 3IVCA 4PG4A 1X1QA 1A1VA 1VL8A 4OLHA 1FDRA 1V7QA 4OAQA 4RQAA 5TPWA 1Z3CA 4HB2A 2WG1A 3O8RA 3SQMA 1U28C 4R4JA 4QOEA 3O47A 4I1IA 2LVNC 3H6HA 4WNCA 2HHAA 3RE8A 3SEAA 2D2VA 4OKIA 3LYAA 1ZSNA 2OBLA 4DR3M 4FGJA 4YFYA 1TF2A 5KTOA 3X1KA 1PQUA 1B0AA 1DG3A 1WKBA 2AX4A 2XVMA 3V42A 2Q1XA 3VR5H 4GDFA 4KI0A 4B32A 5KTPA 4A2QA 3NCTA 4FGKA 3DV2A 3V8RA 3T4XA 3VDQA 2PLNA 4K0KB 1NIPA 4TWBA 2P79A 2J9YB 5AK6A 1DDIA 5KYXB 1JLMA 4LXXA 1NY6A 4ETMA 1YFLA 3O8OA 5J4KA 2VOEA 1SIBE 4E07A 2X1HA 3R4CA 3G5MA 4XZ3A 3AFHA 5IKXA 2JLZA 4GICA 4M0LA 3W1WA 3HBMA 4JB0A 1JG2A 1OZ0A 3MLAA 2O3UA 4CG1A 1TLFA 3K0HA 5C7IO 2GZAA 2A0KA 3DZBA 3ECCA 2F3TA 1VKNA 1D0SA 4FHGA 4DQUA 1W581 1YE5A 2ZIXA 5BR1A 3W9BA 4I9GA 3KJZA 2C5FA 2UZAA 4X7PA 4KBGA 1Y6ZA 1FRFS 2UKDA 1BO6A 4Z4HA 1TEXA 3I52A 3GZNB 5IT4A 5EJ6A 3G5AA 2GO7A 4YRAA 2CLCX 2Q45A 2XCRB 3A3KA 2HEIA 3H9BA 1SBHA 2LTUA 2FSHA 4YCMA 4WKGA 2O7SA 4R1TA 2Y1DA 4AM8A 3P0EA 5G2OA 4HD8A 2FWRA 4PPFA 4EFKA 3QX7A 1ODFA 2J48A 3B9PA 2VQ6A 1Y8GA 3PF8A 3QBJA 2ZPAA 3FM9A 2A86A 4DUYB 2NOAA 4TSFD 1LLCA 3TPCA 3TX2A 1N6KA 2MJLA 3GFQA 2OTCA 3WL6A 3NLLA 1TCBA 4MVJM 4LZWA 1M66A 3LS2A 5EJ5A 1Y9JA 4CIAA 2WZDA 4RMIA 4CUZA 2X0KA 5M5BA 2CMKA 3TL3A 3AHCA 4F06A 2QR3A 3GVXA 2LHCA 3TLGB 4ZCQA 3L4KA 3WO1A 2VT6A 3PDCA 3AF2A 3LT4A 4AI6A 2F17A 4J2OA 4C0WA 4URFA 4G1FA 5GZ3A 1BEUB 3LSYA 621PA 1Z5AA 4MW6A 4B80A 2R86A 1KAQA 3Q7QA 2WWIA 1NMQA 3QYFA 4B4VA 3AY6A 2O8CA 3K9CA 5B6PA 2WR8A 3H7AA 1N8NA 2FWBA 3QVGB 1E62A 4GKJB 1T26A 4QGFA 1OLUA 4KQJA 5ILGA 3MEQA 2MSKA 5FPSA 4J7CA 2QN3A 1TDJA 2LDBA 1ZDMA 1E7YA 4Q4JA 2V6IA 3WL3A 1V7ZA 3ETNA 5AP9A 3EZLA 2QJWA 3SYKA 1PT9A 1F0YA 3CNHA 6GPBA 5IUKC 2BBWA 5B53A 2HLDD 5ALPA 1VXRA 3VDUA 3H9UA 3H8JA 3KYDB 1EWQA 1QLWA 3WAJA 2PJRA 3N5KA 1X94A 5BWOA 4X64M 3PX3A 1UP4A 2VBGA 4MB7A 3R2JA 1XRPA 2L0XA 1UJ5A 1QUSA 1NE7A 3IX7A 3ZHBA 2GBFA 4NL4H 3E2IA 4F72A 1HV8A 3HNRA 4TM8A 1WVIA 5JU6A 3QPAA 3AHGA 3SC2B 4X8MA 3NMUF 1W9MA 1FP2A 3NIDB 5EJ7A 4Z8YA 4LZNA 2DSTA 4M88A 3VJRA 3LW7A 1O5IA 3EIEA 4QU8A 1PFVA 3W5VA 3UJ8A 4HPWA 4BMNA 2G9NA 5L3SA 3ESRA 3U7JA 3EZ7A 5CM8B 5GV8A 3I12A 3HS3A 3LQQA 1KI6A 2XI4A 3W4KA 2PQ2A 3WOHA 4E11A 4QOJA 1XOIA 4YUYA 4C4OA 1UK8A 4G5OA 3S2ZA 4Z0TA 4D3SA 4IJMA 4ESVA 1XF9A 1T0IA 2ZIXB 3OQHA 2AMYA 5F64A 3HABA 1FLDA 5WRFA 1QFMA 5BYKA 1S01A 4LVCA 4I55A 2PH5A 1XWIA 2G4LA 1PZFA 1I51A 3D0RA 1W88B 3Q3IA 5ES4B 4MV9A 3LP8A 4H08A 1BHO1 2HA0A 4OXQA 4KOEC 4RAQA 4MI1A 2C5LA 4HH4A 4TMWA 2ENWA 1OI2A 1QZZA 2EX1A 4GD3Q 4RH3A 3TCNA 3PNMA 2YY7A 3KS9A 4LF9B 3AI7A 2YWCA 2QW8A 1TQDA 2GZ1A 2JHFA 4D9MA 5GONF 2GPNA 4AL4A 7MDHA 1W7AA 3E5NA 2ORYA 3H86A 2XE7A 3M6UA 2IYRA 5DHAA 3ENWA 1OBFO 2I2WA 2AWNA 4M1TA 5TPZD 1N3BA 1DP4A 2HTFA 3CNEA 3PXUA 3RKUA 4RD3A 3UV7A 4NHOA 3PICA 5EIOA 4H1VA 2Q4BA 5EG5A 3FSRA 3FCAA 4HF7A 5IBRA 4AJNA 1UPUA 2X9GA 1B2LA 1N8TA 4US1R 2FW6A 5KTNA 2ZJ0A 2Z56A 1JFSA 4IZOA 4LZJA 3H4MA 1N2JA 4PBTA 1BDBA 1RI1A 3V6MA 3QEMA 1DGGA 3ONVA 4X3CA 2ZZNA 4Q4JB 2M98A 5D01A 2QVBA 3LKVA 3I32A 4BYGA 2RI1A 3PL1A 2NV0A 3ESCA 3QYJA 4GL2A 5K6AC 4Q05A 1HLDA 3JAKA 4ZYYA 3A6LA 2YOFA 4TXMA 3P2EA 3RTEA 5DM0A 5K20A 3OEWA 1FYDA 4Y2SA 3M4XA 4XOIA 3DUFA 4URZR 5BN5A 1SPBS 3ZZTA 1HBJA 4D9FA 4MWSA 2VUUA 5LIPA 3NV9A 1EWVA 2GPSA 1O89A 2HMUA 4Q37A 2LCIA 2ZAMA 2KHZA 1NFRA 1ZIXA 2AKYA 4KQ9A 3BJRA 3SIWA 2X5NA 3FAKA 1IZ0A 3GFFA 5G53C 4FFNA 3PNQA 1NF9A 1UJBA 4PDGA 1HZZC 2DPGA 4LC1A 4KODA 1KQ3A 1XQ9A 1A9TA 3NDRA 4B3HA 3Q85A 3OJFA 4P3YA 4XIJA 4JWTA 2YWGA 1ZI9A 5TMPA 1KI6B 3EQ2A 1YL6A 1SN7A 2X0EA 1S3IA 1AJEA 2CHEA 2QMZA 4DLRA 2QE6A 2CBGA 4M1YA 1XCPA 5DHUA 1YJ5A 1NQVA 3OA2A 2R3SA 4TKMA 5K0JA 4ZU1X 3KAJA 2V74B 2WKWA 1QIGA 2GNPA 1GZVA 4MGIR 1SVWA 2PQ6A 1MRSA 1U8YA 2QY9A 2XMSA 3QOFA 5DPMA 3PC7A 3UH1A 1XCLA 3GJ0A 3E9DA 2D4HA 3D2LA 4G5YA 2MU1A 5EQTA 1YDMA 1Z07A 1D2AA 1T9ZA 1TCVA 4TMTA 4EG4A 1IOZA 4ZMSA 1OXSC 3MJSA 3D8NA 4HS9A 4R2WA 2P9QA 4XE5A 1AUOA 1BHQ1 2GBCA 1KAHA 3PUYA 2ZVQX 5CT8A 2V58A 2Z2JA 2JD1A 2VS1A 3PE3A 1FJGM 5KYYA 3T4UA 2W2XA 2PRJA 3M4JA 1TA9A 4HY3A 3GA5A 5HIJA 1P1FA 3WWDA 2I1QA 1BJKA 3UMYA 2WABA 1KJJA 4NC6A 1G60A 4GBMA 2GF0A 3RNOA 1KY4A 2IXEA 3CS3A 3ZDFA 1QE3A 1GNRA 1ZJZA 4F1WA 2V5AA 4OJTA 4RD4A 5DNYA 1BRMA 2Y76A 3H2GA 3AHIA 1H5QA 5HS4A 4DV5M 4V0NA 5K8CA 1AN0A 2JAOA 4I4TF 2CYBA 3F1KA 4X6YA 3O7WA 5EYPB 1XF1A 2YHIA 1ZH0A 5EXXA 5JMPA 2F3SA 1X1TA 4IXTA 4BJ1A 4IJWA 2RD2A 5CA1A 1DKUA 3TFQA 4QPCA 4MH0R 1G38A 5IX8A 1FUIA 2QPOA 1L5HB 4POAA 2JCXA 5DSXA 1CNMA 5K8IA 5EIBD 3K8OE 1TNDA 3VTZA 4HWRA 1R5NA 2B4QA 3RYIB 1IBLB 1EX1A 5HBRA 4LECA 3WFIA 1XPJA 5AJUA 4DHWA 3JAKB 2D0DA 3HB0A 2CXPA 2HY7A 4LZZA 4WZ6A 2G17A 2ZYDA 1VDDA 2F9LA 1XI2A 3DUFB 3AWIA 1IVNA 3VPHA 2VAMA 1Y7HA 4Q1FA 1N9KA 1OY1A 1TX4B 5ERGB 3EG5A 3CPEA 3WNZA 2O2ZA 3OD5A 3S27A 2RGEA 1R0SA 1SGWA 4G0MA 1KZ6A 3RT9A 2X3UA 3QVMA 5AXCA 4TVKA 4ZOAA 1A4XA 2O8VA 3QE9Y 1QZMA 1EJ2A 9GPBA 1JHDA 2HEGA 3UOWA 1XZHA 3ADBA 2QE7A 4JSRA 2XRYA 4DV7B 5ELLA 3R7WA 2PGNA 4B79A 1SU7A 4FKBA 3S68A 3GH1A 3PXAA 3ZKAA 2MGWA 4FEYA 1L5YA 3FKEA 4QXQA 1U0EA 4AJPA 1K7YA 3DO8A 4WZBE 3UMBA 1RWMA 1FFGA 1SOWA 2Q29A 1DXOA 3L0PA 3OIWA 2R66A 2P5TB 3KM0A 1BIFA 3K09C 3HU2A 1ZVKA 4LYGA 1JR3A 1T5BA 3CVUA 3U37A 4E15A 3URKA 3USZA 4CE6A 2FF7A 3X43A 1Z7GA 4X65M 5EJAA 1L4LA 3AIKA 5AK4A 5C7YA 1TZ2A 3LRXA 3TWKA 3DAPA 5T7BA 1VBMA 1BWPA 3I2JA 3OCWA 1JNYA 3VI3B 5KYYB 1BDJA 5CDHA 1DRUA 4HR7A 1IHUA 3LYLA 2LNHC 1Z34A 3VVMA 1ZRNA 2VJPA 2TSYB 2B5OA 3MTJA 3AW9A 3Q8WA 4L4ZA 1JHOA 2IZ1A 2FTKE 2I2DA 2Z8YM 1NI4A 3OKPA 2XMGA 2FWJA 1IK4A 2HZ7A 4M1SA 1BN6A 2WSSD 3U5TA 1GRCA 2V4MA 4O1MA 2IW3A 2QUBA 3ZNOA 1ECLA 5DTQA 1TR8A 1KIAA 4I5FA 2QXYA 5K51A 2Q3JA 1NVAA 1AE1A 1K8YB 4TOIA 3C6BA 2BPOA 2KXEA 4W7SA 3HSYA 3GQ5A 2BBTA 3WLPA 5FH9A 1ZD9A 5TX7A 4EMBA 5KNBD 4QQNA 4MULA 3TH5A 4A9AA 4CQMD 1CQWA 1CFJA 2IF0A 1VE5A 2KSQA 2A1UB 3VRHA 3NOVA 3PNPA 2JFGA 3L26A 4FC7A 2NPOA 3ENNA 5HBGA 3LQ2A 4X62M 3JYQA 3VDMA 4CQJA 4QBFA 4I7EA 4PTYA 5CFRA 2DR3A 3UYLA 2PZJA 2VBCA 1BW9A 2A88A 4Q00A 3RVNA 1E1RA 5JARA 2A6PA 1W2HA 3TNJA 3EXHC 1NHWA 3VFDA 4RPIA 4OO3A 3WJAA 2VA8A 1K66A 1LVUA 5ABPA 1N5KA 1L8LA 4E5PA 3MD9A 3LW8A 4RDCA 3R7WB 2Z2XA 1YC2A 4RHYA 2WYWA 4GMHA 4NIMA 3ISJA 2EQ5A 2AZDA 4KMMA 4RV9A 1W0KA 4ESEA 1GG5A 4I3HA 1D5CA 3JYPA 1DC3A 4JI5M 3AVWA 2HO4A 3DGFC 5ITSA 1H6BA 2OBNA 4UVHA 4BBPA 3A14A 1L5QA 3H05A 1UPXA 4QBIA 3RGGA 2EJTA 4IRXA 1BMTA 2ZRMA 3FOBA 5DP2A 2A3RA 1EX7A 1G8GA 4MICA 5IAJA 4MSUA 2Z4RA 1U0TA 1D9XA 5BUQA 4FBMA 3N0TA 5K0NA 3C97A 2VJKA 4DA0A 3NONA 4L51A 3IKJA 3SFZA 1PLKA 4C2TA 3ICPA 3WWPA 4L5AA 3MBKA 1ZW6A 3R0ZA 4YAJA 5IVIA 1PNTA 2W6MA 1IQPA 3D6VA 4HSGA 3VC1A 4MINA 4ZAZA 2XTNA 4ZOCA 2BGRA 5DCWA 4CHTA 4NVRA 4B8WA 3ONDA 1BCRA 4JELA 4WGGA 1IUOA 3PEVA 4DR2B 4MYDA 4UM9B 3NUZA 2OHVA 1E9AA 1YWGO 4LJ6A 4FDMA 1PBNA 4DCNA 3BGDA 2ZJBA 3T7CA 4B3SB 1KDTA 3VZDA 2QRNA 5EQDA 1Q0LA 3SZOA 2F4VM 4TYWA 1NI4B 5HJ5A 4WDQA 4MR7B 1GZ6A 2OV3A 5IYZF 1IHPA 3H9CA 4ZQBA 4J3JA 4MK4A 5H59A 3DGEC 4L8RC 2YWRA 3PDJA 3JVUA 5FFNA 3CE9A 3PLRA 1OAOC 3IVXA 4G4GA 2FPUA 2X0DA 5L7YA 1WV1A 4M3NA 4E1AA 2QTCA 3AUUA 3GP5A 5KNCH 1QZEA 3T1YM 4U3JB 4Q9NA 1UL1X 4BPBA 4GXTA 3TUIC 5LOVF 3LY8A 2HF9A 1UQTA 1MAVA 4LHZA 1X8JA 3FHTA 4KQ1A 4X6XA 5JYEA 1V3UA 4JI1M 1JG6A 5F2KA 5K3OA 3U7GA 1L9KA 2ISQA 4JR0A 3BRQA 1XYGA 1F2VA 1TTTA 3ZGZA 1RFGE 3FWNA 2YFHA 2ST1A 3EVNA 3WICA 1XCGB 3RYCA 2YR0A 4H4DA 1N5DA 2JHAA 5EMMA 1GA6A 4Y67A 1R0LA 2I6SA 2PYIA 4L5CA 1K27A 2VI5A 1ST2A 2J6BA 1YVUA 1NBAA 1G8PA 2OQRA 1XELA 2Z1MA 3B7ZA 1FYEA 1H1DA 4OLBA 5IJXA 2CNWA 4XVCA 2D3WA 5KCMA 4PRKA 1H4SA 1I6WA 4PDIA 5KYUA 4XW2A 2DYKA 5MHTA 4LCEA 5AK3A 1T8PA 3QX3A 4O4LF 1UEXC 4XDHA 3AM3A 3WXMA 4YRCA 2APJA 1VKHA 5KQ8A 2W2LA 3O74A 1USVA 2YRFA 4NCAA 4EUHA 4UTVA 1EGQA 5BWBA 4JJGA 1Y8ZA 5KO2A 4RF2A 2D7JA 4CM7A 3ZLBA 3AVTA 1H23A 2X9QA 1L5NA 1W5EA 4CIYA 4XWGA 4B48A 3IUNA 2WQZA 3ILSA 3LUCA 2QBYA 1E4VA 3SQOA 2ZRBA 4PYMA 2PS1A 4DSZA 2MSLA 4ES6A 2VLIA 4CLEA 1OBCA 1RACA 4MGZE 5CMLA 5B37A 4HQFA 1VG8A 2R4EA 3KL2A 5DGDA 4E03A 5K4GA 3GL9A 1I2ZA 3Q7EA 2YS6A 2D1RA 1IXRC 3K0CA 3QY9A 3PGMA 4FCWA 2PZKA 2YWEA 3DZGA 3FVQA 4CHTB 5JVDB 2UYGA 5F98A 4P7JA 3ACCA 1BCRB 4L9AA 2WWHA 4N54A 2H1WA 1A95A 3BRCA 2B3DA 4CJXA 2UAGA 5TSDA 4BEBA 5JCOC 3G89A 1DV2A 2WOJA 1IFXA 5KVCA 4DOMA 5LD2C 4GPIB 3GLTA 3I1FA 1VDZA 5F12A 3OZBA 5DMHA 1YDEA 3IIEA 4KYIB 4HDMB 4O33A 1AKMA 1JEQA 1QHGA 1KBZA 4G56A 4LF6B 1QGUB 1F7UA 1GGJA 1KORA 2PR2A 4NATA 3B8EA 2O23A 2B82A 3WLMA 2E3JA 4E5MA 4E7OA 5A3SA 3KOYA 4J1TA 3DEFA 4QTXA 4YYZA 1DXYA 4ZEVA 3X1DA 1Y8QA 1K5HA 1IEWA 3WE7A 4D4LA 3BH7A 4XPIA 2IHBA 2AFIE 2YIMA 3LI2A 3VO9A 1YMUA 3CZ4A 4ND3A 4GX0A 4L73A 2WI8A 1U3DA 2GH1A 1NVDA 3DOOA 4K9RA 1WMAA 2NACA 2C5BA 2FW0A 1JHRA 1GTVA 5A7HA 3A28A 5ALTA 3THYA 1YB2A 1IM8A 1DCFA 2JCBA 4C6HA 1OLSA 3LHFA 2HDWA 3MTEA 4A26A 2RKBA 3ROQA 3W5JA 3HHZA 4C4ZA 1Y5RA 3IKTA 5DZSA 2PUGA 3C6YA 3QOXA 1UWCA 3CSSA 1KMHB 4C2BA 4GIBA 4O8ZA 3TAHA 3PU6A 2M32A 4PINA 1ZN7A 3L4JA 4ZICA 1BDMA 5BNIA 3GLFE 3ADOA 5HQJA 2R2AA 5I7HA 1MVLA 4IF4A 3UT6A 2PMCA 5CEEA 3KPVA 1GABA 4LJ4A 2PRYA 1CJMA 2WHRA 3H19A 5ALOA 3PSHA 1N2OA 3ND6A 1Z26A 3H8SA 5LCXA 1XEXA 3ZWNA 1N2SA 3AO0B 4UMEA 3TLEA 3LG2A 4YWJA 4UUOA 3FNIA 5EP1A 1N6NA 4M1QA 3BQNB 1NBWB 3RSOA 2QBYB 4MDYA 4YAWA 3Q40A 1SY7A 5C5IA 1P62B 1EP3B 2IFTA 2Z2IA 2N42A 4W1SA 4QIHA 3NR2A 5TVKA 4MW5A 3DMFA 2AE1A 6REQA 2YYZA 1K88A 3KPUA 2IP2A 2CHQA 5JBIA 3Q7TA 1M0TA 1OB2A 1PV2A 3RARA 3WYFA 2C4KA 1ZY2A 2IGBA 1RI5A 4EATA 3UAYA 5ICGA 4FWBA 2AN4A 5B7QA 4EQZA 2I65A 5JCJA 2RGHA 4RPGA 1CDZA 3GAFA 5AIBA 2GJSA 4J6FA 4WBNB 5CVTA 2WT9A 3KQKA 4F5EA 4N41A 1Z33A 4BNNA 4OJMX 1ADGA 1OASA 3A58B 2JGFA 2HHCA 1WWKA 5FWYA 1UBRS 1TT7A 5CDFA 3ZHUA 1QMPA 1UQRA 2JFYA 2PIDA 2HA2A 4IX9A 5AK0A 1H94A 2LH0A 5ALJA 1PKXA 4LHVA 3PKJA 5KU7A 1SB9A 4L3OA 4QYTA 4LNAA 3REQA 5THQA 1I4TD 2GYUA 1JSZA 5G0SA 4PANA 2OUIA 1LC0A 1DC7A 4TSKA 1Y8QB 2ORVA 4AW9A 4DLTA 4CV3A 1AUXA 3BRWA 1KZHA 2AJ8A 4GLBA 2KE5A 2Z6QA 2CCGA 1O58A 1EVKA 1OWLA 2VP3A 3OJ0A 3RWMB 4DJDC 3ESAA 3CLVA 2C8KA 2Z5GA 3PK0A 4BFWA 1R0WA 1NOJA 2WQ6A 1OLSB 4EW6A 2FSSA 2NV6A 3CEAA 2CMFA 2XNCA 3R6DA 4RELA 2HI0A 1Z0UA 1YRAA 4RIIA 2RCNA 1Z18A 4P22A 1LI7A 3TQOA 4F8JA 3WLTA 2MOKA 2IPLA 4F1KA 3GR6A 1Z7BA 4PEVA 3ZCBB 4J7UA 1E59A 3RK0A 1NAHA 1SG0A 2XFSA 1H2HA 4RZSA 5EMLA 3NFRA 2NU9A 1CY0A 2ICAA 1FYFA 4BLOA 4YS6A 3CCCA 4IF6A 1YI1A 3ZHXA 4QARA 4R1LA 3ZWOA 1NNUA 2HBYA 1L5ZA 3RFWA 4B71A 2YY5A 3WB9A 5BR4A 4DCSA 4R1UA 1XEXB 1W5AA 5DBGA 1VI2A 4QM6A 1TMGE 4DCPA 1FYXA 3KFLA 4RYDA 1G3MA 3QZUA 4DUZM 1CYEA 5DYGA 3SC3A 2D5IA 4CR7A 1G2IA 3GD7A 1V47A 1S7GA 3GRFA 2CNLA 5JXWA 2DKNA 3FUWA 3SR3A 4L6AA 5HF6A 4CM8A 3O4HA 1P1KA 2QK4A 4RTJA 3L2AA 4H3VA 2BFNA 3OTOB 4HZUB 1XJCA 1QF7A 2H1OA 3WTBA 3PEEA 5KKCA 3PI7A 2XKAA 4HAUA 1X1CA 1SZDA 3GUHA 3TRJA 4HDRB 5JWOA 3GMIA 4KDFA 5CHYA 1L4EA 3AB8A 4E2XA 1II0A 3UBMA 3ZH9B 3UXYA 4XVQA 1E6MA 5ITZB 4XWYA 2P7IA 1CF9A 2WJZB 1L2DA 5CLHA 1JZTA 2J3HA 2YFKA 2X1LA 4GYJA 4ZODA 2YV3A 1BA2A 4I5IA 1UT6A 2G1PA 1KO4A 4ODIA 2WE8A 5M04A 1FS6A 1CJVC 5ADHA 3BFJA 1VL2A 4EUKA 5GKNA 5I5GA 4OQXA 4I1RA 4S3MA 1SBQA 4KMOA 4N4AA 3U6DA 1UOQA 5KINB 5A7GA 5LZ2A 5JC1A 3WADA 3ENQA 1S2MA 5KZMB 4G0NA 1E8NA 1XEFA 5JY6A 5KSOA 3QY0A 1QYRA 3STHA 1DEHA 2Z1DA 4MVCA 4QT4A 2NPIA 2VDVE 1UEIA 2AEMA 3EXFA 3NT4A 2DMRA 1DAMA 1V48A 1X9HA 4F4HA 3B60A 2DPYA 4E13A 5DWQA 1NQUA 1BXGA 5JBQA 1M10A 2PLWA 1SU6A 3L4BA 4QPNA 4NH4A 2AK2A 4U7FA 2OXIA 2NO5A 4DR7B 2DH6A 2ZYSA 3PHCA 3KVOA 3KTOA 3B7GA 4BNYA 1IXZA 4INZA 4TLCA 1EFLA 3JXEA 4BQIA 1V33A 4RKYA 4JYMA 4OVZB 1OA0A 4KMSA 2BF7A 1SBNE 4PX9A 3IP3A 4QEZA 4YHHB 4R3WA 5JNVA 1W5TA 4UNIA 4BNMA 5A4IS 1DBIA 1A7UA 1P2VA 5DCYA 3IRVA 3NI2A 1IH8A 3GA7A 5I4KA 4Z5XA 5FA8A 1GD1O 3W5IA 1YKGA 3II6X 1W96A 4CMEA 1XVVA 2ALJA 3EEQA 3I0MA 1YQXA 4WOBA 1ZMTA 5SY6A 3WGGA 4QGSA 4Q01A 2JHPA 4EF5A 1YOVA 3MQ2A 5ARBA 4ZVQA 5LJIA 5ESWA 4XQ0A 4TL9A 1DKLA 4YV7A 1EK0A 1Z56C 4PZEA 4IIEA 4ER3A 3INNA 1JHUA 2WF6A 2JAWA 3EBLA 2DPMA 2JGLA 3IVAA 3BWEA 2XRMA 3ZWYA 1UZAA 5JW6A 2V7EA 1DZ3A 4XVHA 2UU9B 1OWPA 1MFZA 4EG7A 4CM8B 3AY7A 3MRXA 3L41A 3ZDRA 4UEJA 1TO6A 3JSAA 2ZBGA 3HZHA 4ZZIA 2Q9CA 1USKA 4PAGA 5KDDA 2YWFA 4GBGA 1G0OA 4RANA 4CMAA 5K0BA 4BKQA 3UMSA 3RRYA 3F6RA 2XAUA 5FLKA 2D7GA 2P68A 1LDMA 2FUCA 1Z5OA 4QYXA 1E20A 4FYXA 2B1JA 2OO5C 5LP6C 1OH7A 4LYYA 1HNWM 5ADWA 3DWFA 4MVJF 2OCXA 2SKEA 1P73A 3MSXA 3NJRA 2PPVA 3RU3A 1CVLA 5GJCA 3UJNA 4OMDA 3EUWA 3TW8B 2PD6A 5A9RA 1Y3FE 4G84A 1NPTO 1EINA 3O6VA 3VOTA 1EBFA 2GKSA 1CR0A 1T24A 1Q11A 2EP8A 1Y6FA 2H7CA 4Q1VA 1ZJJA 4QGGA 1MD9A 3CX6A 2JI8A 1IUPA 1P7ZA 4YP1A 1HDZA 2PCLA 1MB4A 2WZBA 3B89A 1Z8NA 1CU1A 4X1KA 4MW2A 4R54A 1N5JA 4KWEA 4IUDS 4G4SO 5AKXA 3A2MA 2XGGA 3PA8A 3QYEA 3WQQA 3E1GA 2G6BA 2Q5LA 3UJ6A 3GDHA 3DTVB 1UWKA 2IEBA 5IMBA 4DIKA 3R5FA 3V2GA 4HAWA 3EQ8A 4HRYA 2O54A 3KR1A 4RABA 3V46A 1QO0A 4IIDA 3Q4GA 5ECWA 3VK7A 4NXMM 2BM9A 1PK9A 1YA8A 3JQBA 3FA2A 2P6UA 2JFNA 4KAAA 5C37A 1UBLS 3E0QA 5B64A 2B0CA 3CFYA 1WGNA 2PZFA 1M76A 3TI7A 4H6VA 3BVPA 1EX6A 2J3KA 4I8OA 1X38A 1EFRD 4JVNA 4F6LA 5AT1A 2CEKA 3ZUGA 1JXOA 3GZNA 4C3OB 2IODA 1K8RA 1UANA 4M1WA 2QQGA 3T52A 3RTGA 3I04M 1DMRA 5I9SA 3WRXA 3ZCSA 4TT8A 1DPFA 2CD7A 1YUBA 4KU4A 1Q0QA 5KJ1A 4P36A 4F8YA 3VDRA 1YOVB 2TECE 2BM0A 4DMMA 1EVIA 2ZB7A 4R5HA 3QW4B 1FBTA 1F6DA 2OCGA 5K7SA 4IUBS 4QBHA 4QPJC 1WPGA 1A9PA 4RTRA 4HSEA 2R7MA 1RWWA 4M0UA 3WGQA 3AGPA 3PJGA 1T6XA 3O2NA 3V7FA 4BLVA 8CATA 2OBYA 1HLPA 2A8YA 1D0LA 3LCUA 4P08A 3LECA 2J5RA 2D0OB 1YUMA 1B74A 3EXIA 2WJIA 3S5JA 4RK4A 2XCUA 4D99A 2JJ1A 5KDOA 3FBWA 1JAHA 5EXEA 4FX2A 4KHPM 1AHIA 2DBQA 1JQJC 5LNK1 1OGYA 1AUVA 1B16A 3ZK9A 4CU2A 1T29A 3KKPA 3W8RA 5K6TA 1G3RA 3FSGD 1TYZA 4FNGA 4Z1MA 1JHPA 3OLQA 1WB5A 3I9MA 2WJ3A 5ALGA 5AM3A 3SMQA 5IK2A 1WB6A 2JAHA 2RI6A 1I7SB 1HO3A 5JRJA 5C1IA 2UZ3A 3RG2A 4D9HA 4UM5A 3UV6A 5EJ9A 4D41A 3KYDA 4MYTA 4YRRA 3IL2A 2IXTA 2QB5A 3HHPA 3DT8A 5LU8A 3UUGA 4X1KB 3L1HA 3G82C 4TLBA 1HTWA 1CULC 4JLBA 1TC1A 2JIZA 4KUGA 1S2OA 4RTKA 1ZWLA 3OT4A 3ZLUA 3SC2A 1DQPA 4NS4A 5JLAA 1XA0A 2ZCJA 5FV7A 4XCVA 2AWOA 4G8DA 4GOLD 3B36A 1NUAA 3EQ7A 1DBRA 3EY9A 1VYUA 5FTWA 4HNGA 4Z7NB 4M89A 5HZGA 2Q4TA 3DXFA 3FI0A 2OCKA 3FVVA 3K4PA 3VSEA 3VH2A 3PQ4A 1YIDA 3GLIB 5JBNA 3G23A 4ZEWA 5JO9A 2YRXA 1UFQA 4OQMA 1AZWA 3EIFA 4WASA 4P7KA 3TE6A 3IKLA 5DNUA 1ISGA 1W88A 1FS5A 5KTSA 1J9EA 3FOEC 2V6JA 3KS8A 4ZREA 2C2KA 5G02A 1C50A 4D7AA 3HKCB 3CF0A 2WUFA 5TLSA 3IO5A 1HEUA 3ZJUA 1CRQA 4V0SA 4BZZA 1LPSA 1CPYA 1QYCA 2H1SA 5JH7F 1C3JA 5KHOC 3NDJA 5ICFA 1DG1G 4UMDA 1T35A 3KAKA 1N7HA 1MT3A 4LKOA 5KVAA 3BFXA 1FVOA 2B98A 3P27A 1N6OA 4RZIA 1PR4A 3WBKA 3EXIB 1UFVA 3MA0A 3BCRA 2HR1A 3ORHA 3IDSA 4X66B 5COAA 1LI5A 3FWPA 2P5SA 2IKSA 1SXJD 3OTGA 3OZTA 3HKBB 4GZ3A 3GPPA 2HAEA 4S1OA 2HJ9A 4JOCA 1RRFA 2QM8A 2HU5A 1N2IA 1DLIA 1KDZA 1U8FO 1DVRA 2AFHB 3GBVA 4ZJUA 3FY4A 3CWCA 2ZG6A 3G2NA 4UTRA 2RHRA 3FPGA 1NF8A 2C5EA 3ZXXA 1FX1A 2D2IA 1N9ZA 4IBJA 4JBGA 1H6AA 1VHDA 2PJDA 4QDOA 1A8IA 3HXLA 4G25A 1ZNYA 4B85A 3UW1A 2H3EA 4BDSA 5HJ7A 1MW9X 1GPWB 3I23A 2QUKA 4PHCA 2XT6A 3FHLA 5EKSA 2EZTA 1ATZA 4UCQA 2EJUA 1V6AA 4Y9UA 3ITDA 2FGJA 5LUBA 2IWRA 2I3BA 3WB1A 2CVHA 1Y33E 3UPUA 2PMDA 2GN1A 1IONA 2GASA 1GNVA 1XQ6A 4BZWA 2ONYA 3GRUA 5JO0A 4ZYVA 2P2DA 1SVUA 5LYJF 1PJBA 3S28A 1GVHA 2BY4A 3KWLA 1PVOA 2BRUA 2NTJA 1E1DA 1GPJA 1RP7A 3LCJA 2KDLA 3RLIA 2BDTA 2IEGA 1RQRA 4B3RB 3WGNA 3B7NA 5E4JA 3W3AH 2HNBA 4R16A 4GITA 1S2IA 1FMLA 1NWHA 3H0KA 4O25A 4COKA 3W2GA 2WZJA