2Z4RA

Crystal structure of domain iii from the thermotoga maritima replication initiation protein dnaa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
240
Chain Sequence
TPLNPDYTFENFVVGPGNSFAYHAALEVAKHPGRYNPLFIYGGVGLGKTHLLQSIGNYVVQNEPDLRVMYITSEKFLNDLVDSMKEGKLNEFREKYRKKVDILLIDDVQFLIGKTGVQTELFHTFNELHDSGKQIVICSDREPQKLSEFQDRLVSRFQMGLVAKLEPPDEETRKSIARKMLEIEHGELPEEVLNFVAENVDDNLRRLRGAIIKLLVYKETTGKEVDLKEAILLLKDFIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosomal replication initiator protein dnaA
publication title A Common Mechanism for the ATP-DnaA-dependent Formation of Open Complexes at the Replication Origin
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein
total genus 86
structure length 240
sequence length 240
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00308 Bac_DnaA Bacterial dnaA protein
A PF08299 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix
A PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2z4rA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2z4rA01
2V7QA 1NLYA 1ZIOA 1DPFA 4XSGA 5DI9A 1XX6A 1G5TA 4H1UA 5B2ZA 2D7CA 4B48A 4EJSA 1F3OA 3P32A 1O3YA 2QBYB 1KI7A 1G6OA 1GKYA 1EG7A 2BJWA 3NH6A 5FBRB 3QBTA 3K0FA 4C0SA 2QBYA 1UKYA 2YYZA 4MUAA 1NBMA 2J46A 3DMNA 2OESA 5CDFE 5EP2A 2GDJA 1Z22A 3HU3A 3PXGA 2AX4A 5JI3E 1WRBA 2CNWA 3TBKA 4D26A 3GJ3A 2GAOA 4V0MA 4TYNA 5KDDA 5JHGB 2CLCX 4Q7LA 5KSYA 2R6DA 5FH9A 1VECA 2LCFA 4TL6A 4GPTA 1EFCA 1T5IA 3CWQA 4NYMQ 3AF1A 1IXZA 3K0SA 1ZYUA 2OXCA 1Y3AA 4XWAA 3HYRA 3CNOA 2PZGA 5TDHA 5E7IA 4YMUA 4LY6A 2C77A 2F9LA 4OI2A 4LJ9A 2YOFA 2IT1A 4O25A 4YLGA 4EKDA 3EC2A 3A1UA 4MGIR 5GVSA 2PJZA 2ZRJA 3GFOA 4EPTA 4IRUB 1VYVA 3HU2A 1P2SA 1TADA 2VHQA 2YC2C 4L15A 4M1WA 4C0HA 4QL3A 1UAAA 4DCVA 2WJIA 1R5NA 3QG5A 2IYSA 2GF0A 1W0KD 3GPLA 3A37A 3TIFA 3QKRB 1SXJA 3G5UA 3KKMA 3ZLJA 4EJSC 1IAQA 4NL4H 4TQUS 1XPOA 2OLJA 1K5GA 1JNYA 4NPHA 4C2TA 2GNOA 2H92A 3H84A 4JLJA 3VR5A 2RGXA 2ZRFA 2HCJB 3GJ5A 4C0QC 1YZUA 1KYIA 4WAUA 2QEQA 5FI1B 2J7PA 3U7EB 5HTKA 2JIZA 4P4SB 4KVAA 5CB6A 3KQLA 1OV4A 1KY3A 2EQBA 2IL1A 1QVRA 3WNDA 4HB2A 5CK4A 3WNCA 4XIGS 3QE0A 1ZC4A 3AVQA 3Q5EA 5H8WA 1GAJA 1W46A 2H18A 2VF8A 3QKTA 4G1UC 4A0FA 4KHZA 4D2IA 4A1FA 4BEBA 2ZRMA 3U7FB 5GADl 1G7RA 1FFHA 2PJRA 1E99A 2JEOA 3L0OA 4DBLC 3EPJA 1GKIA 2ZJZA 2ZJAA 4NTZA 1L4UA 2O5VA 1N2CE 4P3YA 4V03A 1PUIA 3DHWC 1I4LD 4PSAA 5E95A 3PV0A 1L8QA 1W2HA 3AP2A 3RHFA 1KMHB 1W4BA 2Q21A 3Q72A 3ZJYA 1QHSA 1Z6YA 2QT0A 2DR3A 3SJAA 3VR3A 1M74A 4C0BA 2FSIA 4DSOA 5BYJA 1E0AA 3T35A 2ZITA 4G5GA 1RJ9A 1C1KA 2W0SA 3BGWA 2AWNA 4MH0R 4KAXA 4WXPA 4FI3C 1ZM4A 3DL0A 4BRUA 3C14C 4FMDF 4V0NA 3U44B 2C95A 2IA5A 3X2SA 4DLVA 1KOFA 4MKFA 2JATA 2R9VA 1W4CA 5JI2E 4GT1A 4MRSA 3U60B 4QGHA 2CE2X 3U44A 2ANCA 3A8TA 3K9GA 4HAUA 2BDTA 4HUQB 4QBGB 1VG8A 4QHYA 3WMEA 4ASUD 4TYYA 4Q18A 4TQAA 4PC7A 4DVGA 2NTYC 2OAQ1 4TWZA 5FUXA 3UIEA 1XD8A 4M1KA 3UMSA 2ZRKA 1QF9A 4AKHA 4HUQA 4C3ZA 3RWMB 1J7KA 2ZETA 3U3JA 3OIYA 4OHZA 4A36A 2ZIAA 2V3CC 2FN4A 3GJ4A 4UJ5A 3R20A 1ZNWA 2F3TA 2YWFA 3IHWA 1T91A 2G77B 1II8B 3QEJA 4D4JA 3RDPA 3CX6A 2XTZA 2ZQ5A 1N3BA 4HEJA 3NKVA 1ZCBA 1KAOA 3AVOA 4LYHA 4O3MA 1OT3A 3K09A 1KI9A 3SYLA 4D81A 4I81A 1ZNYA 5EUQB 5HKKD 1G4AE 3CW2A 1N5IA 3OIUA 3UANA 1U81A 1G9XA 2HJGA 1ZM9A 3OAAD 4RD2A 4KLNA 2QPAA 3UK6A 2ATVA 2A5JA 5KPDA 5DHFA 5FOWA 2ODNA 2AN9A 1Q22A 2XX3A 2ZE7A 1P75A 4DSTA 1NNEA 2QRZA 3CRW1 3UXMA 2O8CB 1P4SA 4PAOA 3NDBB 2F1HA 2WMNB 621PA 2NOAA 1Z83A 2QE7A 1G7SA 2WSSA 1EFHA 3EXAA 4ZCIA 3ADDA 2O8CA 3DKVA 4A9AA 1TQ4A 2H1LA 1KI1A 1XXHE 2C5LA 1G20E 3ADKA 2GCPA 1PVOA 2YOGA 4DIEA 1NLZA 5EE3A 2WMOB 3E2IA 4URZR 4XTRA 4HAVA 721PA 2A5GA 3CBQA 2ZM5A 1AIPA 3B85A 5LB4A 4CIDA 4CGZA 3E70C 2RGBA 6Q21A 2D2EA 1KK2A 1XPRA 3T1TA 2WBLC 3G0HA 1U9IA 4OBEA 4LJ8A 1G7TA 5CYOA 4IOJA 4ZPXA 2ZR7A 3ZS8A 1UEIA 5JJIA 3PG5A 3K09C 2CL7X 4S35A 1XTKA 1N0VC 3GJ0A 3VX4A 3GP8A 3TVDA 2YV5A 5EXPA 2ZR9A 4B6EA 3KXKA 1BIFA 1XZPA 1W36D 4YQFA 1OXUA 4B75A 1G8YA 3PFIA 1GKUB 4JZKA 2RH5A 1SKQA 4KBFA 4AYXA 1E9SA 1RYFA 4QJ3A 1X3SA 3RVBA 2PT7A 3EZ2A 4W5HA 2QORA 4L16A 1KK3A 3GQBA 4QOSA 4LV8B 4UNRA 2ZAOA 3LWNA 4U7DA 1YZTA 3CPHA 2WHXA 1OHHD 2A30A 2JASA 1BYIA 3EWAA 2ZSFA 2EFEB 4IXMA 4QBIA 1OIVA 1S9HA 2ZJ8A 4PHTA 4PO1A 3X1YA 5JBQA 3SR0A 5EE0A 2C98A 2BBWA 3RC8A 3ASZA 4PPGA 4LRWA 1W49A 4LBVA 3I5YA 3SBEA 5BWMA 4A8JB 2KSQA 5TXGA 4YXWD 1WBDA 4U00A 1FP7A 2NZJA 2XZLA 3AVXA 3ZDQA 2JJ1D 1T3LA 4RCYA 1BMFD 2P6UA 4JVNA 4PAMA 3SJZA 1VKJA 4Q7MB 2X2FA 1S0UA 4WOPA 4JLPA 4DT1B 1U9IC 1MT0A 3DO6A 3CM0A 3V4RA 2XSZD 3DZDA 3T1VA 4IKEA 2ZUBA 3B1WA 1UFQA 1RIFA 3B2EA 2DBYA 3LLMA 3NBFA 1JEEA 2CL6X 5CDFA 4NMMA 2G83A 2ZR0A 2ERXA 4HAWA 3RS5A 4B47A 4EPWA 3ZZ0A 1KAGA 4N0DA 3U61B 2REOA 1KI6B 4BRWA 1BS1A 3F3YA 1FUUA 2O8EB 4V0KA 4LJ5A 4HZIA 1UBGA 1BOFA 2F1IA 3PITA 4DEYA 3EWSA 5CM9C 2GJSA 3UKDA 3WNBA 3TKLA 5DI3B 1P72A 4MYHA 3KXIA 1F5NA 1YZKA 1H8EA 4RKFA 2ZRIA 5DI3A 1CJVC 1CEEA 4TL8A 4HATA 4JKYA 1E9DA 1KMQA 2AL7A 4KLZA 1KK1A 3CPEA 1JALA 4OJQA 3LDAA 4JJZA 1CTQA 3O8CA 4IVRA 1E69A 4A8JC 2ZS9A 3VFDA 3W3ZB 2X77A 1Z47A 1OH7A 1G3RA 4IOKA 2GK7A 2AKYA 3NHAA 3QF7A 1JPNA 3IKJA 5JEDA 5JRJA 4HB4A 2ODBA 1F60A 2FFBA 3AEZA 2OCAA 2RB4A 4LRTA 4F4JA 1WB9A 2IC5A 1OXVA 5HPYB 2PEYA 3PCRB 1RYHA 1AQYA 4TSFA 3MUFA 3MJHA 1J90A 1VCNA 3FDIA 1P61B 3VAAA 1HY3A 5EQTA 1IN5A 2BCJQ 2F7SA 2QG6A 3WY9A 3K53A 2HF8A 4RD4A 1VMAA 5E4FA 2ZI4A 5BN4A 1DAHA 3RS7A 3T1QA 4FWHA 2YWEA 3X1WA 1JJ7A 2W2TA 1KI2A 3GEIA 5TY0A 2A9KA 2JLRA 1R0ZA 4HUTA 4UXHA 1KDTA 1EFRD 1Z0KA 2VRWA 1GWNA 5JHHB 1E79A 3LH5A 4M1OA 4NDZA 2J0SA 5D3MA 3W6PA 4F91B 1KTVA 1P2VA 2PX0A 3I8XA 4PANA 4R71A 2AD1A 4IDOA 1LB1B 5CIWA 2FNAA 3U3MA 3GEHA 2IWRA 3FMIA 3DOFA 3RNLA 5E3HA 2CLSA 2HYIC 2RHDA 4Q4HB 1U99A 4NONA 3ZZTA 5GJWC 2R65A 4I1OA 4ERNA 5H68A 3EX7C 3OEHD 4PZYA 4EPXA 4G01B 1Q1BA 1ESMA 1DG1G 2O52A 4KFSA 1E2FA 3OZXA 3QXHA 1IHUA 1W0JA 4TMVA 4CEIB 1JR6A 1JXMA 3SJBA 1COWD 1GL9B 4JVSB 2JDIA 1MRNA 2WJHA 3NIBA 3U3RA 3BH0A 4BFVA 3B8HA 4CEIA 1HTWA 2AXNA 1G16A 2GEDA 4L4UA 1E2JA 4JS0A 4IHQA 2C04A 1N6PA 2FMXA 1N0WA 3C8UA 2P67A 3TE6A 4M0LA 5KHOC 1E1QD 2BMDA 4QHSA 3OFND 1N6HA 3AVUA 4LBYA 4US2R 2QQEA 3KUDA 4Q9HA 2VQSA 4DLWA 2N1BA 2NIPA 3A1WA 2H5EA 1XD2A 5C18A 3SC3A 1Z29A 3A4MA 3SQXA 2XTNA 2KBFA 3PUYA 1L7VC 1TAGA 1NJGA 1V43A 1TQDA 4Q5IA 5L3SB 2F55A 3W3AA 2OSBA 4RFSB 5HE9A 3VKWA 2P5TB 4GNKA 1P3JA 5L3SA 1H8HD 2ECKA 3MAAC 5IT5A 4GL2A 2HLDD 1WA5A 1YZLA 2RGNC 1ZCAA 4F4IA 3KQHA 1X1SA 3LLUA 2FGJA 4XD7D 3J81k 1R0WA 3AUXA 1EWQA 3BH7A 1CJTC 2XNDA 3I61A 3U6KA 3PENA 2X8AA 1Z6GA 1NF3A 2QSYA 3I73A 3W5JA 2G9NA 2QUZA 3WYAA 1NG1A 3O8BA 4MKIA 3CR8A 4NYJR 1OF1A 2OZEA 3TAHA 2FE4A 2FF7A 1TNDA 3JVVA 2VF7A 1M7HA 4B2PA 4JLNA 3AVWA 4JSYA 2IUSA 4M1TA 2N42A 2P65A 3DOEA 2BIFA 1WF3A 1XXHB 4Q03A 3EPKA 4CRWB 4OKSA 5K8IA 2R6FA 2QZ4A 4I1VA 1EFTA 1YE8A 1YZNA 2D06A 3C5CA 1RW4A 1XXHA 4AYWA 4D0NA 5EE9A 1AKYA 4GZMA 4IEEA 1IXSB 3CF2A 3RRMA 3P27A 4NE2A 4Q00A 4YDSA 1CP2A 1ZVQA 3B1YA 4LYAA 2RGAA 2WPDA 3FE2A 4PSVA 3ZS9A 2CCKA 2FH5B 5FTMA 3TUIC 4WZBE 4R7ZA 1O87A 2KRKA 3UWOA 2NMVA 5P21A 1AGPA 1S8FA 4Q02A 4LJ7A 3EPLA 3WMFA 2CLDX 2XAUA 1NVVR 3BH6A 1DE0A 2QPOA 2I4IA 3IPYA 4FD2A 3N70A 1VIYA 2GZHA 4Q1BA 4DJTA 1E2IA 3THYB 5FR2A 1FTSA 3CZQA 3KB1A 4CEJA 4Q7KA 2F3RA 1Z2CA 2FPLA 3AF3A 1LFDB 1HA3A 1JQJC 4OHYA 3FOZA 3THYA 1Y63A 1IY0A 1FP6A 2GVZC 4BPBA 3PVSA 4JLDA 2Z4SA 1T8UA 5EZ6B 1S1MA 5DLQC 2DWZB 4QM7A 3AV0B 4OQXA 1R0XA 2OBLA 4KVGA 4GRAA 5IHPA 1E2PA 3MWLA 3NC0C 1NVXQ 2FWRA 2FFQA 2Z6VA 3PQCA 4NCIA 4R2IA 4FMBB 4IOLA 4EPRA 1Z5ZA 4DLXA 1E2KA 4UNQA 4QKQA 4D25A 4O0MA 5F98A 1MO4A 4KYUA 3TQFA 4EFMA 3C7KA 1SQ5A 1EK0A 2WJYA 3KKOA 4BLPA 3AVVA 2YNMA 3NG1A 1ZW6A 4JBWA 3KJGA 3D31A 3OEEA 5EUMA 2GBLA 1E94E 1H65A 2FSGA 1A82A 3BOSA 2WM9B 4JVLA 3T61A 2JGNA 4IOMA 5EJEA 2DFKB 2W58A 2OBNA 2QY9A 4HI0E 4KYIB 4YONB 4B2IA 1WBBA 3QOFA 4LPSA 4AWXA 1YR8A 2ZRBA 4BFZA 4BLTA 1R6BX 3GJXC 4TTPA 4BFWA 2QNRA 2JIZD 5FBQB 3AQ4A 3U3OA 4LSGA 2O0KA 3B13B 2PBRA 4LV6A 1Z0AA 3VR4A 2ZXUA 2O8BA 2DYKA 4NCJA 1R7RA 2CVHA 1HE1C 4PPNA 4S2EA 1Z28A 3LD9A 1HT1E 3MHVC 1E2QA 2W6ID 4O2LA 2GJ8A 4BFSA 3KJIA 1D2NA 1LTQA 4C4PA 5G53C 1JQLB 4L8GA 3U7GA 5FBLB 1P2UA 2QROA 2G1JA 2F43A 1EX6A 1G4UR 3K0AA 4W7SA 2WWWA 2JJ8A 4DLRA 4AKEA 3TSOA 4LHVA 2J0UB 3H2YA 2EYUA 3LY5A 4KODA 1GSIA 3B9QA 3SFZA 1Z06A 1KI8A 1YR7A 3I32A 3K9HA 4JT4A 3M1IA 4DDTA 3CWZA 1CR0A 2J0UA 1AN0A 3U6BA 4HLDA 4OJKA 1IN6A 1M6NA 2QMOA 2NQ2C 2R6AA 1ODFA 3MWJA 2YC4C 2B7BA 2VHJA 2OT3B 4DCTA 2FOLA 5SZKB 2X1VA 1UKVY 4JYCA 4EPYA 3AVYA 1Z0IA 4BFTA 4PX9A 1HE8B 1IXRC 4Q4JB 3RS4A 2J5XA 2RMKA 2BM1A 4LK2A 1SHKA 5KSOA 3GLHE 1R4AA 2ODWA 5F2EA 1VG9B 1XEWX 2C03A 4Q4JA 1Q3TA 1I4DD 4GZLA 2GEUA 4C0AC 2YVUA 2FG5A 1OH8A 2VEDA 3K0FB 5GJCA 3D7MA 2QN6A 4GI7A 1E6CA 4B6FA 3CONA 4W5JA 1NSFA 3DZ8A 2P0EA 4URWR 4TMKA 3DM5A 3E5HA 2F1RA 2BCGY 3QXJA 2YOHA 1YRBA 2YKGA 2XEXA 4URVR 2XZOA 3U7HB 1UF9A 3PEWA 3REFA 3RRNA 1DAGA 5SZIA 5CJPA 1P2TA 4MUBA 2QM8A 2QRNA 2ZSBA 4DC9A 4FWGA 3QJYA 4NKRA 4HDOB 3P4XA 1TF7A 2GCOB 2R2AA 4QFMA 5C4MA 4NYJQ 3K9NA 4NZYA 3I72A 4P4UA 2D74A 3ZQ6A 2BC9A 4BWYA 2O8DB 4KSCA 1G3MA 4WXRA 4AC9A 5FTKA 2GCOA 3KX2A 5A5GA 1ONBA 5JCPA 2O8DA 4KBGA 1D9ZA 2B92A 4PQRA 4PO8A 2BJVA 2ZYUX 5FL7D 2VBCA 2IXEA 5E7MA 2GXQA 3A4NA 1ZRHA 3KUCA 1SXJB 1P73A 3C15C 1U98A 1BYUA 3LW8A 1G3QA 1SHZA 4UXIA 2WSSD 3W6OA 1QHNA 1M1YE 2QTFA 1S9DA 4FCWA 1KO1A 1W1WA 4TMWA 3WHKA 2ZRNA 1MO6A 2DFLA 3AB3A 4QJ5A 1NN1A 1XMJA 1N6RA 2I3BA 1OPXA 2CK3D 3RC3A 1C4OA 2VYFA 2YHSA 5BXQC 4FW9A 1SVLA 3EIHA 3RABA 2XNSA 1KY2A 2HCBA 4Q48A 4MRRA 1W5SA 2FZ4A 5FUWA 1G41A 4URXR 4EQ6B 1NVVQ 2GK6A 4LX0A 2JA1A 5SZJA 2PCLA 4ZDJA 2Z43A 2VP6A 4EQ6A 3A1VA 1J70A 2EW1A 3I92A 4YMTA 1T3HA 4ZKEA 1YRAA 3JZAA 1YKSA 3Q9LA 1Q20A 3BBPA 4P0TA 1G3IA 3TNFA 1A5TA 3VQTA 3EC1A 4IEIA 3A1SA 5DE3A 3R9WA 1U90A 3QPWA 1Q1QA 2IYRA 2QPTA 2BEJA 3R8FA 5FUYA 3UWKA 4ZV4A 4PR0A 3RSOA 2JJ2A 4PHFA 2SHKA 1A7JA 2C8VA 2NO0A 1JR3E 4A2QA 1E1RD 4TMXA 2IX3A 2A7QA 2HF9A 2OHFA 1U2RA 4R2HA 1B23P 5CM8B 1ZM7A 5B58C 3PEVA 3FPAA 1RJ9B 5IDVA 4LC1A 1NRJB 1FNNA 1SXJC 4UNSA 3DKPA 1E2LA 1GTVA 4PQYA 1G8GA 4A0GA 2BM0A 4D4LA 2O8FA 2R62A 2CL0X 1GRRA 1OIWA 1AQUA 2VH5R 2WWIA 3LBHA 1UDWA 2WIBA 1XNJA 3DMDA 3ZVMA 4Q21A 2YINC 3P26A 1MO5A 2P5SA 2IEYA 4KXFB 4PC6A 3LVQE 2DVWB 3VKGA 2ZAMA 2QMEA 1KZGB 2J1LA 2IBMA 2D3WA 521PA 1KDRA 1D6JA 3LRPA 2JLVA 1GIAA 3KL4A 2NO1A 5FUVA 1GZSA 3AP1A 3HPQA 3CNLA 4FINA 1IJFA 5CYPA 2V6IA 1K5DA 4M1YA 3JVUA 5CLLA 1X1RA 3BC1A 1DAKA 1GRNA 3EPHA 4L5BA 2IYLD 1GFIA 3CRRA 5ANRB 1IQPA 3UG6A 5L3QB 2AFHE 3D3QA 1U8YA 2VPPA 4GDFA 1ZBDA 2P6RA 1Z0FA 5L3QA 5JFGA 2EFDB 2GJ9A 2ZYTX 1T5LA 1KSJA 2GCNA 4AIIA 1OFUX 3FWYA 2RGEA 1NY5A 5SZHB 1CLUA 1ZU4A 1IBRA 1TX4B 3W90A 3HDTA 1NN0A 3A6PC 4ESHA 4PFSA 1U8AA 3EARA 2I1VB 1PLKA 1XRJA 3IPXA 5JLJA 2ZSDA 1F2UB 1CR1A 4QHTA 1KO8A 2WWXA 4J0QA 2RCNA 1ZM2A 2OCBA 821PA 3IQXA 3CX8A 1TUIA 4IFBA 3QVVA 1F2UA 3D6TB 1HT2E 2YWHA 1OE0A 1UBCA 1AZTA 2DWOA 2IS2A 2ZSAA 2X2EA 3SS8A 4B44A 3WP0A 1N6OA 1R0YA 2ZJ2A 1G5PA 4XVQA 1N6IA 1XTIA 2IHYA 2V9PA 2ZJBA 2IUTA 4P32A 2CJWB 3EAQA 4F38A 3VLFB 4O2RA 1XTRA 1NL3A 2XJ4A 1Z6TA 1G64A 2CJWA 1IY1A 1QVAA 3QIAA 4TSFD 3QXSA 2GJKA 4MYCA 4BLRA 3QPVA 2P6NA 1N0UA 3W5IA 3BK7A 2NPFA 3H1TA 4IXNA 2WWGA 2GXAA 3QUSA 1GITA 1VHLA 3W8RA 2KWIA 4EFNA 5CB8A 1M2OB 3R9XA 2P3SA 3LAWA 4RVCA 1W0KA 1OH5A 4FCTA 1CRPA 2JLWA 1DO0A 2ZRDA 4DIDA 2IXGA 4DHEA 5TV2A 1G18A 3TK1A 2XOKD 3F8TA 3FMPB 1N6LA 4RJLA 4RY2A 4B3XA 3CO5A 1Q44A 4PC3A 1TMKA 2HYDA 5FI0B 2EWWA 3B1XA 1JI0A 8OHMA 5HCNA 2A5FA 1KKMA 2DZOB 3NWJA 4JN6A 3AF2A 4QBFA 5GJBA 1E2NA 1ZP6A 1VIAA 5L8VA 3UMRA 4QM6A 5BYKA 2ZYWX 3R7WB 1W47A 4I4LA 2J0VA 3QBVA 3FKQA 4WIAA 3R7WA 1ZUNB 3TH5A 3GLGE 1KSHA 1YHNA 3IEUA 2MSCB 4I99A 4M53A 5KDOA 3CPJB 3EZ7A 3KTAB 2BBSA 2BMEA 2ZI7A 4WVFA 4DLYA 4DDUA 2D62A 4QXAA 3ZD6A 1ZUHA 4M4SA 3ND9A 5UKDA 1BO6A 1LS1A 3KTAA 3GLHA 2ZU0C 4FIDA 2AHOA 4LUCA 1SVOA 5DISB 3LV8A 3U2QA 2A2ZA 2CXXA 1XEWY 4FWDA 3RS0A 1DOAA 1RRFA 3TRFA 2RGCA 4ACBA 5A4JA 4X8OA 3AVTA 1AZSC 1JEDA 3GLIE 1W7AA 4M1MA 1T3SA 4G3XA 4D4MA 1AM4D 2Q9CA 3N2EA 3C41J 4QGGA 2ODEA 1S1CA 4LYJA 5LD2B 1R8SA 3RRYA 4BGDA 2ZI9A 4IW3B 1SKYE 1IN7A 2FZLA 1T8TA 5EE5B 3T5GA 2IYXA 1KSFX 1HQCA 3B5JA 1QG2A 1XJCA 2ZRAA 4EIWA 2PT5A 3CLVA 2VP9A 2Q3HA 2BVNA 2C9YA 3OE7D 1F48A 4XVRA 2ZVPX 4ZDWA 3ZIAD 2FX3A 2XB4A 3LBNA 3MGCA 4UNPA 1Z6AA 2VHUA 1KDPA 4ASUA 4CT4B 3DEFA 4BZPA 4HAXA 3NBYC 2BHRA 2HT1A 3K1JA 5KNCA 1GDDA 4D0GA 4QG7A 5GJVC 2PZEA 3L0PA 4WZAE 4B33A 4AG5A 2FPMA 5AJVB 5E7JA 4AK9A 3TGPA 1E4VA 2NZ8A 1D5CA 1M7BA 2CCGA 4A2PA 421PA 3D8BA 2DCUA 1G7CA 2JCSA 1S4QA 1KJZA 3KJHA 3FKSD 2ZRHA 1SGWA 5C46F 1I2MA 3CB4A 3QXCA 4TZ0A 3F5FA 2D2FA 4TQ9A 2ZANA 3C5HA 5DH9A 1DAEA 3LX8A 4A6XA 4HB0A 2RKOA 3I3SR 2XB2A 1AK2A 2CCJA 1DADA 3NC1C 2B8WA 2PEZA 2Z83A 4YC7A 5HKKA 1U8ZA 3OIWA 1ZUIA 1CF4A 5KTYA 3ZQJA 3EASA 3FHCB 1KI4A 4C9BA 3K70D 5FTNA 3OAAA 3B82A 3DPUA 5LD2C 1GNPA 2QAGA 4JL8A 3EA0A 4NU0A 1OKKD 5DN6D 2FGKA 3LXRA 3THOA 5FPKA 2EYQA 4TTRA 2PX3A 3L2OB 1UKEA 2IXFA 5B64A 3HPRA 1MV5A 1XMIA 2VP4A 2QP9X 3NEYA 3NH9A 1AKEA 5B57C 4UJ3A 4ZIRB 1I4TD 1XZQA 2DWQA 5D3MB 2E1RA 1PV4A 2OEPA 1E32A 1OJLA 2OM2A 3SN6A 1TF5A 1N25A 4ZIRA 4D4KA 2GTPA 4JLVA 4JYBA 4KU4A 1XB2A 4AY2A 1JR3A 1GG2A 4ACAA 1TUEA 5L3RA 4ZKDA 5AJWA 2VSFA 2WVJA 1KO5A 2IS1A 1NVMA 2PCJA 3LX5A 4LC0A 5J4KA 2WAXA 4LHYA 1RRGA 2ZJOA 1NVUQ 2ZI6A 4P31A 2W6JD 3KB2A 4K8OA 3HU1A 1MH1A 3OEED 3QEOA 5FPSA 4A0RA 4RD0A 1R8QA 4B76A 3L0SA 1X86B 2Z0MA 1J8MF 3SE0A 1ZNZA 1G19A 4Q66C 4JLOA 2BMJA 3X1ZA 2W0MA 1LF5A 3Q85A 1XD2B 4EAQA 5IRCD 2AD5A 1OHHA 4LHXA 1J2JA 1BH2A 1NMZA 4W5WA 1DELA 2WTUA 2HUPA 2YWGA 4LBZA 2JLUA 2VIIA 1XCPA 3A58B 4US1R 1JJVA 4YMVA 1ETUA 3HP1A 1NLFA 3FFAA 2FPKA 1M8PA 3QQ5A 3ZD7A 4XWOA 4DDWA 1MABB 4PZZA 3CIOA 4YXWA 1DS6A 2GWHA 3BJIC 3KFXA 1LS6A 5J40A 2VLIA 1VCIA 4DUGD 2JJ1A 1MABA 3WHLA 3GFTA 3MMPA 1E0KA 1UEJA 4JLAA 1BMFA 4A82A 4NBSA 5JS7A 1CRQA 5AUQA 2GAAA 4KJZA 2UZIR 1M34E 3ASYA 5DIFA 5LBIA 2Q3MA 2J7KA 1W5TA 4MGZR 2GJAA 2NO6A 4OHWA 2AWOA 3KZ1E 1G8FA 3IEVA 2XSZA 5AR1A 3UG7A 4C2UA 1SULA 5AK0A 3F0TA 1E9CA 5FBWB 3GLFE 3R8CA 1YVDA 4Q7JB 5IK2D 1TPZA 1WP9A 1ZD9A 2WOOA 2KI5A 2OAP1 3MCAA 4GMDA 4F7WA 3HJNA 2WWHA 2ZE5A 1FTNA 1RE0A 2ERYA 1IONA 2MMGA 4TT3D 3ND8A 3O8DA 4RCZA 4LRSA 4WBSA 2XXAA 1QZMA 2A3RA 5EE1A 5FPHA 2IYUA 2GEVA 5HR5A 3Q7PA 3Q7QA 2CHVA 2IYWA 4JL5A 1Q1EA 2IS4A 1CJUC 2A5DA 2UVQA 4UQOA 3TR0A 2V7QD 5AJXA 4IDPA 1ZAKA 3NXSA 3GJ7A 5EXSA 3AM1A 3UATA 2GRJA 5AUPB 2X19A 2QL6A 3B78A 4MRPA 4XVUA 3NBXX 4M2LA 4Z1MA 2OG2A 4JIMA 1OH6A 1YU9A 3ICEA 1UM8A 1NKTA 1KJYA 5BW8A 4BZQA 2AK3A 2VTKA 3IILA 3OHMA 4OQMA 4RSGA 1NBMD 3LVRE 1GOTA 5CIQA 4Q9JA 4Q9LA 4CEJB 4TLEA 3FFBA 4B3BA 4BECA 1ANKA 2CNWD 4CDGA 4GP6A 3NDPA 1JB1A 4BFUA 4OYHA 5TB5A 3X1XA 2ORIA 1QZXA 1OSNA 2OE2A 4ZI2A 1KJWA 2CDNA 4M21A 3PEYA 5G3ZA 2WICA 4M9XA 1J8YF 1RZ3A 2L0XA 2B6HA 3KJEA 1XP8A 2PLFA 4X8HA 2FV8A 5J47A 1KO4A 1W2GA 4XSHA 1W4RA 1WMSA 5ELXA 1VYTA 3GLGB 1U0LA 3FTQA 3BFKA 1G17A 4DLUA 2HXSA 4DDVA 4MDFA 2XZPA 3T15A 2G1KA 1UBEA 3H0KA 3GLGA 3A4LA 2V55B 1NMYA 3IDQA 1G291 5DYGA 2V6ZM 3IHLA 3GD7A 1OFHA 3L82B 4MGKR 1YZGA 4JVMA 1HEIA 3FMFA 4NYIR 3V00A 1QDEA 1QRAA 1EFRA 2JLYA 1NJFA 2ZUDA 4A6PA 4D0LB 5KNBA 1SXJD 5FOUA 2HT6A 1DAFA 1XD9A 1II9A 5DO9A 3VMFA 1ZMXA 3THWB 2VP2A 3L43A 5KPJA 4E07A 5FTJA 1K6MA 3GLIA 3P1JA 4MITA 4F92B 4K81B 2AR7A 3THWA 2ZROA 2EU8A 4DKXA 4MYUA 2ZJ5A 4A92A 4JBXA 4OQNA 3W8NA 2J7PD 3OEHA 2QAJA 4Q01A 2O8BB 5IF9A 2ZE6A 1AS3A 3U5ZB 5FFMA 2REXB 4M9ZA 3H4MA 2WKRA 3IIKA 2AXPA 1COWA 4PAQA 1E98A 4E22A 1FMLA 3RWOA 3TLXA 4GMXA 1QBKC 2F43B 4B2LA 3K0AB 5JSZA 4V0LA 2EFHB 1MKYA 2TMKA 1P62B 2ZU6A 1E1QA 2PLRA 5KYKA 3LBIA 5FBVB 4CEHA 2W00A 1N5LA 3GCGA 4DSNA 3SI7A 4ARZB 3FHOA 1MRSA 1KIMA 3TW8B 5EXTA 2PH1A 3CRQA 3AJIB 1U0HC 4ARZA 3IGFA 4LCBA 5JMTA 1WXQA 1NI3A 3T1OA 2ZVQX 4PTLA 3IBGA 4Q9IA 3BB4A 4EPVA 4JLMA 1H8HA 4KSBA 4HLCA 4C0LA 3NEJA 2GBLC 4JT2A 2CBZA 4BUJA 1NG9A 3LA6A 1N6KA 2IHBA 5JJLA 4PC2A 4KV9A 3Q3JB 2RGGA 4XD7A 2WKQA 4C0JA 2DWPA 1UKZA 3CF6R 1F6BA 2Q0HA 2V6JA 3BE4A 2FJUA 2AKAB 3BXZA 4HYYA 221PA 2IUUA 4AURA 5BN5A 4MA4A 5HZHA 1GRQA 1V5WA 1WDTA 4HAZA 5F9FA 1IN4A 1XCMA 4BFYA 2O0HA 3BERA 3KDSE 4H1VA 2IW3A 4FWTA 2IEZA 1SVKA 2B7CA 1Q12A 5CLQA 5K8LA 1JECA 5KNDA 4DEXA 5BN3A 1TL7C 4OQLA 1EESA 2OBMA 1ZJ6A 2IYZA 2PMDA 2EVWX 4JLBA 4Y0VA 5EZ5A 4ZCMA 5G41A 2H16A 3ECCA 1OFIA 2WJVA 1X8KA 5HCIA 3TJZA 4A4DA 4H9GA 3CH4B 1FW6A 5KDLA 4PQFA 3EZ9A 3CZPA 2G6BA 1NSTA 4DXAA 4X8LA 1II0A 1KNXA 2F1JA 4FMCB 4RKEA 2NO9A 2ZRLA 3B7GA 2REBA 2A78A 4JKIA 1Z0JA 5FR1A 3RS2A 4A3VB 3TUZC 1P9WA 1QHGA 3EIEA 2VL7A 5JWOA 2RAPA 1S96A 2GHIA 5B30A 1P9RA 3QPUA 1KSGA 3L8YA 3X1DA 4RZ2A 4D6PA 1OXSC 2HXYA 3MWKA 1DAMA 1RPZA 4C30A 1W48A 4PPFA 4N3NA 2XITA 4TTQA 1E3MA 2C9OA 3U4QB 1A1VA 5AUNB 2FEMA 2QE7D 1E4YA 2DFNA 2IK8A 1R5BA 1F2TB 3U4QA 2YJTD 5DGXA 1E0SA 3OIVA 4Z8XA 3IQWA 4JJKA 3N5CA 3MD0A 4V02A 2NPIA 3HR8A 4XWKA 3CF0A 1F2TA 2QA5A 4B3DA 2KE5A 3SHWA 4AD8A 5KO2A 3FGNA 3OF5A 4GOKA 4A0HA 3QI2A 2H7VA 4U5XA 5LDDC 2EWVA 4KI0A 4PHHA 1FQKA 4ZO4A 1MOZA 3GMTA 4X8MA 2OFXA 2ZI3A 4IDQA 5FPTA 1FPMA 4BQSA 1OXTA 2C99A 5H1YA 2J45A 2NGRA 2J3EA 3EG5A 4NH0A 3DM9B 4CZ2A 2BKEA 4UXJA 3E1SA 2ANBA 1E2MA 1E0JA 2J87A 1RKBA 4RD1A 1KI3A 1SVMA 2J41A 2B8TA 3B60A 5C1BA 3QKRA 3NBZC 2E9SA 4E03A 5JECA 4OHVA 3KQKA 2ZS8A 3AF0A 4M9SA 3GLFB 2VHTA 5FL3A 2IYTA 2AFIE 4CVNA 4IDHA 1E2EA 2WSMA 5AJZA 3WRXC 1G8PA 4Z51A 4EDHA 3GLFA 2GXSA 1NN5A 4IFEA 1LV7A 1XPUA 1E2HA 1G1MA 5K8UA 4P4SA 1UBFA 4NCKA 4NYIQ 1RVDA 3NVAA 2PZFA 4MGYR 1ZC3A 4ITRC 1E9FA 4NCHA 2W6IA 2VP5A 2O8FB 1P7CA 1QHYA 1VPLA 1CULC 2DHRA 1AS0A 1RRPA 1T0HB 1XU4A 4KCGA 2OUKA 3T34A 1C9KA 3C16C 2UZ3A 3PUWA 4NCNA 1TEVA 1XTSA 3ZZUA 3CRVA 3PUZA 3FHTA 5F9HA 3RRZA 2QSZA 5BQ5A 2RGDA 4V0OA 3TSWA 3EA5A 4KITB 5G40A 4KFTA 4OI0A 1UJ2A 4YDHB 4QNRA 1KMHA 2Z5FA 1ZU5A 4DWJA 3EZ6A 3WXMA 2V1XA 2BOVA 2EFGA 4Q1EA 1XEXB 4LHWA 5J4YA 3I62A 3C4JA 4NP6A 3W9YA 1XDBA 2W2VA 3CKLA 3RLFA 4C7OB 1E2GA 2YZ2A 3VU9B 4POAA 1XEXA 3THXB 1KO7A 3ZVLA 1NKSA 2LWIA 2C96A 5AJYA 4OK3A 1UDXA 4C7OA 2J0QA 4G5SA 3VU9A 3THXA 1G8HA 1KKLA 4N0EA 5DNYB 4ZI3A 4IJMA 1VDZA 4FMDB 2NG1A 1FZQA 1NP6A 1YJ5A 3VR1A 1XTJA 3WYFA 4EFLA 4LJ4A 1IOZA 1R5OA 3BFXA 3IBYA 2WAYA 2F9MA 3CH5A 4JSTA 3GFPA 4DLTA 1H8ED 4PHGA 4DB2A 3DVLA 1GL7A 3CX7A 3TAUA 4BLSA 2QMHA 3MSXA 4Q4AB 2MMCA 3W6NA 2QTHA 2LKDA 2ZJYA 3TR5A 4Q4AA 2HEIA 1YQTA 3KKQA 4ILEA 3R9IA 4TLAA 3VX3A 1IN8A 1II8A 4PO9A 2QI9C 1OFTA 2FFHA 4HAYA 1PJRA 2KJQA 4MRNA 4TMZA 5DYIA 2ORVA 2XJ9A 3AUYA 4LJAA 2GZDA 5HE8A 2GETA 1A2BA 5J4HA 3O8RA 1DTSA 5K8TA 1Q1ZA 3M6AA 1GNRA 1X37A 3QY0A 1E9AA 2ZRGA 1MR3F 3LFUA 5FL7A 4L9WA 4LJ6A 2IYQA 3QG1A 4Q1CA 3ADBA 1DO2A 3PEUA 3RAPR 2FDCA 3TQCA 4N1AA 1QHXA 2E87A 3PR1A 1N5KA 3SZRA 2ASEA 1Z6XA 4LJYA 1WCV1 1Z3IX 1OYWA 1CR2A 1VYUA 3AP3A 4Q4LA 3KQUA 3MG9A 2BEKA 2Z4RA 1CBUA 1VG1A 3W34A 3QKUA 4G5QA 4QC2A 3KW6A 3K0CA 1E79D 3QVUA 2QM7A 4EUNA 1VG0B 1IM2A 2C9CA 2CK3A 3AH8A 1FMJA 1FQJA 4CT5A 2ZE8A 3BS4A 1JR3D 5JS8A 5GVRA 4Q1AA 4TL7A 1ZD8A 4MYTA 121PA 2OO7A 1HH4A 4QGAA 2D7DA 5LPNA 3T06B 3BD9A 1YR6A 1XMVA 4FCVA 1OYYA 3PUXA 1E9BA 1SZPA 1GVNB 1W0JD 3CUEF 1GL6A 3GLHB 1XTQA 3PIRA 2QP3A 2JDID 5F3WB 5CJ2A 2KB0A 4M22A 4G0NA 1KZ7B 4R98A 2IF2A 1Z0DA 2V4ZA 2ZUCA 1JAIA 1X6VA 2J59A 3SDZA 5KUTA 4DCSA 2QGNA 4HDQB 4US0R 4GITA 1UPTA 2K5UA 5EP4A 1OIXA 1U94A 4JBYA 4E5UA 4PSKA 1E1RA 2J9RA 1Z8FA 1NN3A 3BWDD 2C2HA 4DCUA 3B9PA 2VA8A 1NIJA 4F4CA 2BBTA 4HDCA 2WWFA 4P33A 1HURA 2H57A 4AG6A 2ZYVX 3VKHA 1TQ6A 4RFVA 4MKGA 1ELOA 4B71A 4DCNA 3I4LA 3IIMA 3K0CC 4BZXA 1BKDR 5EXXA 3JZMA 1SVWA 4TLBA 4LOAA 4WZ6A 5JWRA 2W2XA 2ZRPA 4A8JA 2GZAA 2QGZA 2XNDD 1K8RA 3H86A 4BLQA 1ZINA 3M0EA 3EIQA 3V4FA 2IF0A 3IUYA 3QF4B 3LQRA 4Q9KA 3ZVRA 5JZVA 1L4YA 2CHQA 1W44A 3B1VA 5C4GB 3ZYCA 4DT1A 3L0IB 1JXOA 4RD3A 4I1SA 3QF4A 4B3CA 4NHOA 1DVRA 3KKNA 2ORWA 2ZPTX 1P6XA 2IWHA 1LW7A 4BEJA 3TW4A 3DDCA 2IS6A 2JAQA 4GFDA 3SEAA 2QQ0A 2ZEJA 2R8RA 1I2DA 2BV3A 4TL9A 4DLSA 2OXRA 5FPYA 5J5CA 1KI6A 4W9MC 4BFXA 1DARA 3MRSA 3TMKA 1EXMA 1CXZA 1G6HA 4DB4A 2O8EA 4D80A 3AKDA 4UKDA 3SYKA 3QNUA 4YMSA 1XEFA 2OV2A 1G3UA 2WPDD 5TMPA 3EZFA 5FOSA 3WP1B 2QAGB 1VCOA 5L3VA 3P4YA 3VNVA 1S2MA 3PUVA 4XJXA 4Z1MD 2ZREA 4WA7A 1XFAA 1QG4A 1T4GA 3MLEA 1N5JA 3AKCA 1OB2A 4BLOA 4LHZA 4KO8A 1FX0B 2B21A 4XTCS 3UMFA 4PPQA 2IYYA 5JRZA 3LNCA 4QJ4A 4E09A 1TTTA 2PMKA 2KBEA 1FX0A 2CVFA 1Q57A 5HZKA 2BMFA 4DSUA 2Q3FA 1S3GA 3ADCA 3S1AB 2HDNB 4Q1DA 4A2WA 1U0JA 4JLKA 1XF9A 4D82A 3FMOB 1PLLA 5JJKA 1UADA 2PL3A 4MQBA 4AI6A 3S1AA 4RZXA 5D3QA 1T6NA 5AWFC 1N6NA 1VTKA 5A0FA 1FOEB 2G88A 3VNUA 4OI4A 4HZUB 2O0JA 3KXLA 1FNMA 1NBME 4CF7A 4YMWA 5JWHA 3OESA 1ZM3A 4GSYA 3REGA 2BKUA 4HZUA 1W36B 4HLQB 2JLSA 4I1UA 4P4TA 2XGJA 1CR4A 2XOKA 3BRWD 4V0ME 4PXAA 2R6GA 4GP7A 3CRMA 2WV9A 4PC1A 2FSFA 2RGNA 2F6RA 1WQ1R 1VCMA 3EW9A 1LNZA 1QHHB 3WBJA 3TSZA 1YZQA 1Q21A 3VTKA 1XWIA 2H17A 5J4VA 1QHIA 1S3SA 1KGDA 4LWZA 4Z8YA 5EP1A 3M4YA 2QAGC 3WBKA 1QHHA 4TYQA 1T0JB 4DRZA 3LQQA 1A2KC 2WZQA 4M9QA 3BB3A 3BB1A 1RFLA 4B34A 1SVSA 3T12A 1SVIA 2W83A 4Q4HA 1TU4A 2QT1A 3SQWA 1XJQA 2BWJA 2GKSA 4LPKA 2DFTA 1NVWQ 2N46A 2WJGA 1EX7A 4OI1A 5FOTA 3AGQA 4M8NE 1G5RA 2R44A 1AGRA 5CK5A 1RC8A 4JL6A 1SXJE 2OCPA 3RSLA 4C0KA 1P9NA 4Q19A 2P2LA 4QGFA 4B32A 4ZDIA 5KOYA 5JCZA 1AJEA 3UPUA 2QMUA 3ONWA 4HB3A 1M7GA 1TQ2A 2OILA 3K8YA 1Z63A 1OB5A 1OW3B 5G3YA 1GNQA 4LZZA 3I5XA 1L2TA 4K46A 2DPXA 5DSZA 1FUKA 3ETLA 4IDNA 4TMTA 2CHGA 1CJMA 3SFVA 2QU8A 1LVGA 1OLOA 2BBOA 1EGAA 4FXPA 4RFSA 1W36C 4LYFA 1X8JA 3VHXA 4LI0A 1D9XA 3OE7A 2ZS7A 2XXAB 4TZ6A 1DG3A 3A36A 1PLJA 2NO7A 3BAFA 4IVQA 2WOJA 4KFRA 1IY2A 1G21E 3SBDA 3ZIAA 3AF4A 4DZZA 4RZUA 2HJVA 2LKCA 4OL0A 1XBTA 4TLDA 2OFWA 4R9UC 1GUAA 2RHMA 4NYMR 1GILA 3RS3A 4OHXA 1KK0A 1TEXA 1JBKA 2CMKA 1E9RA 2VHCA 2V54A 2OCYC 4ESVA 1YR9A 3L8ZA 2JLZA 2XTMA 3K0EA 2G3YA 2ZSEA 5KSZA 4PZLA 1IJEA 1P60A 4Y0AA 1PZNA 4Z54A 1XMSA 4QRHA 4F93B 2A5YB 1J99A 1GM5A 4IVPA 3FKSA 4LDJA 3VHLB 2C78A 4G5OA 4M1SA 1CKEA 4OK6A 2ZI5A 3GJ8A 3ICQB 3GEEA 3AKEA 1R2QA 4ZDKA 4GBMA 1CIPA 2QTVB 1LF0A 3ZVNA 3MWYW 4RD6A 3K70B 2ONKA 3B6EA 4HLUA 4GOXA 4AKGA 1VHTA 2V8OA 2VP0A 2VSOA 3Q5DA 1XCGB 4KFUA 1KDOA 3IO5A 2D4HA 3SJCA 2GF9A 4BE7B 4II7A 2VO1A 3RYTC 1Q3HA 3MJRA 5DN6A 1OKKA 1WE2A 1D2MA 3SNHA 1A4RA 2DZNB 4MRVA 1Q0UA 5CITA 4L9SA 4TN1A 3O47A 1OXXK 2IYVA 3K9LA 3P20A 3QENA 1GP2A 5TARA 3A1TA 2Q9BA 2GVDC 2DB3A 3MFYA 1JAHA 2ZRCA 1HV8A 3CNNA 4WW0A 4TYWA 3FYHA 2GESA 1US8B 3GLIB 2FA9A 2WIAA 3QXXA 1CJKC 3SYNA 1DEKA 3I8SA 2OFOA 4B35A 1EFUA 3NTUA 1E96A 1C1YA 1MO3A 1CS4C 1LY1A 3I1FA 1US8A 3HYTA 4G5RA 1DAIA 4LV5B 4CW7A 3AVPA 2QP4A 1Z07A 2Q6TA 3T5DA 2GXUA 1SKYB 5FOXA 5J4LA 1Z08A 2CEAA 4QNMA 3HWSA 4Q1FA 2MSDB 3WMGA 5FOVA 2GA8A 1D8TA 1ZNXA 3QKSB 1TF2A 4B3GA 1R10A 4CYMA 2W6JA 3AGPA 3WYGA 5JSZB 4MDEA 2HV8A 3LXXA 4HLUC 4DLZA 2DY1A 3QKSA 4ON9A 3KKPA 4B74A 4RZ3A 4FN5A 3K70C 4CEHB 4QBHA 1T9HA 1D2EA 4B3FX 3LW7A 3VR6A 3OFNA 1E9EA 3FB4A 1CU1A 5H70A 2G0TA 2WKPA 3KFVA 4TLCA 3QSYA 3TUJC 1KHTA 4UNNA 2H8KA 5DHAA 2AK2A 5FTLA 4A15A 1KNQA 4AKIA 1EWRA 1ZIPA 2UKDA 1FL9A 2JJ2D 3IIJA 1HYQA 1ZD1A 4B43A 3PJRA 3LO5A 5AUOB 2FEOA 2ZTSA 5LB2A 3BFVA 4LGMA 3RANA 1X8LA 1TU3A 5JEEA 3CR7A 3AKYA 3TVTA 3N2IA 3KQNA 1PUJA 2WJJA 3ZGXA 1NMXA 4HSEA 5KU1A 4U02A 1XJ0A 2HLDA 3BIFA 4LBWA 2R6CA 4JMPA 4DUGA 3BORA 5TVKA 1ESNA 2CE7A 2EFCB 4TYPA 5C2JB 3ZH9B 3IO3A 2V1UA 1E2DA 1JPJA 2Y8EA 4XOIA 3WRYC 2ONJA 3Q8XB 5M04A 4AYTA 1RRCA 4B73A 2VSXA 4URYR 1AS2A 2JLQA 3SOPA 1NIPA 3U3KA 2ATXA 1HQYE 2I1QA 3SHFA 1P5ZB 2FU5C 5IK2A 4XH9B 2G0NA 1AA9A 5EP3A 2QENA 2MSEB 2Q9AA 1W4AA 2FSHA 4MKHA 4OQFA 4URUR 2JLXA 4Q47A 3HR7A 4TT3A 3FVQA 2FFAA 4ABYA 1HUQA 1DBSA 2OLKA 4GOJA 1NY6A 3V9PA 2WWYA 1B0UA 3B1ZA 5KSPA 4FWIB 4BASA 4OK5A 4ZCLA 4FMCF 1Z2AA 3NHBA 4EJSB 3SU8A 3VR2A 2GILA 3GJ6A 3G82C
chains in the Genus database with same CATH superfamily
1SBIA 1DKQA 4Y6GB 2QBYB 3JPYA 4E13A 4B7CA 3GO8A 1E58A 2PGDA 5CDFE 1Z22A 3HU3A 2JY7A 3DEZA 3I2JA 2NYVA 3EY4A 5DIZA 1PWEA 1Y3AA 1U2SA 4EKDA 1Y3DE 3GFOA 1GZHB 2XDQA 3VU3A 3LA8A 3QVKA 1FFEA 2EW2A 3QJGA 2CDCA 1H6CA 4J7UA 3EOAI 1WB6A 3HXLA 3TRKA 1OLUB 5DBGA 4OMFG 1JIQA 4Y67A 5HKBA 4NFSA 4ARSA 4Z4HA 2Y67A 1ULBA 3RVQA 5ICGA 5H8WA 1GAJA 4BEBA 1FFHA 2OG1A 4WECA 2ZJAA 3DHWC 4K3VA 10MHA 3PJDA 5K09A 4DBVO 2YTZA 5CXUA 2OV8A 3LCMA 5TC4A 5BW4A 1M74A 3GJZA 1E0AA 1RJ9A 3BJRA 3DO8A 3VZBA 5HRCA 1UKAA 4KAXA 3GQ3A 2PFKA 1JNXX 1I1OA 4MKFA 1FDRA 2JF0A 3K1YA 1GZVA 4XW2A 4ASUD 4B3SM 1IBLB 2WYIA 2PLNA 3TZQA 3R7BA 1C4WA 4V24A 3ANSA 5D51S 4E5NA 2XTZA 4CL0A 2J08A 1KI9A 2G7MC 4CQMB 3IELA 3F9CA 4HMPA 1GJRA 5FD8A 4GMFA 1LPBB 5DHFA 3TPZA 1XRSB 4DGSA 1VFPA 4H1TA 4IR7A 1W9MA 5LC1A 4RCVA 4CUJA 4YMHA 4CKWA 1N0IA 4URZR 4G6ZA 4CIDA 1U3DA 2D2EA 1L7PA 4EG5A 3DCNA 2WBLC 1U1CA 3L84A 3ODPA 1XQ1A 4XVHA 5BR4A 3TVDA 1IAVA 1QZ3A 1CZLA 4G25A 1CIVA 1G8YA 2RH5A 1A8HA 4K05A 3WGKA 2WTNA 1GCAA 4LV8B 1RI4A 1JH9A 1NGSA 3R7FA 2Y05A 1DLIA 4A8JB 1NVTA 3CYFA 1BMFD 3D0OA 3OM0A 3UO8B 4P93A 5AO9A 1XRLA 1DJPA 4KQGA 5G4KB 4WFJA 4FC7A 4IKEA 5DGDA 3F1LA 1XF1A 2FKNA 4HAWA 3ONEA 1ULSA 2VK1A 2ID9A 3HI6A 2BI8A 3C9PA 4ARAA 4XKJA 1VRVA 1H23A 2GJSA 3MMXA 1P72A 3S2YA 2J09A 4RKFA 2ZRIA 4D44A 2JK0A 1EJ0A 1EK5A 2I6GA 1RM5A 4HEA1 4O4LA 3LDAA 1P1IA 1MX9A 3TDKA 2W48A 3NHAA 4DQVA 4GE0A 3OOJA 4F4JA 3ITEA 1J90A 2CP8A 4BJ6A 3H11B 2ZI4A 3CB2A 1Z2PX 1SCAA 4OCZA 2YWEA 3I12A 2F17A 4CI0B 2FPPA 3HJSA 2HWKA 1KTVA 2FNAA 1UMBA 3ILKA 1I7NA 5E3HA 3C3XA 3B12A 3OMXA 2J3KA 4K6OA 1EGMB 1SQ6A 1GEGA 3L49A 2JZ0A 1XZ8A 1E2FA 2Y0PA 1DKNA 3F2VA 1GL9B 4BB9A 3W5VA 3B8HA 1ZOSA 1GARA 4I9FA 3U48A 4H7HA 3C8UA 2YIVX 1Z8NA 1KEEB 4LOKA 5F52A 4NK4A 2HHJA 3LW5F 2EBHX 3OPNA 2Z8ZA 2LVQD 1O97C 1P3JA 4GL2A 4X97A 4CR8A 1DCKA 3KQHA 4XD7D 2RHGB 1KZ4A 1LPSA 3G0DA 4Q24A 1L5YA 3CVUA 2I76A 1QHFA 3R0JA 1JWLA 2JPDA 1H42A 1NW6A 1Q19A 5L4SA 4HNHA 1SC9A 1MVOA 2WPDA 5FTMA 4R3DA 5DGCA 4KO1S 3UWOA 2YHUA 4ZVKA 4X00A 4S04A 3L0CA 2JCBA 5EQDA 1S8FA 3DMGA 2WG0A 1FRNA 3G5LA 4Q1BA 1LK5A 1O54A 2GO1A 4X94A 1PNTA 3THYA 1FP6A 4BPBA 5ITZB 2WTEA 5E9QA 3BIWA 2IV2X 2OBLA 4GHWA 2FFQA 1UH5A 3AETA 1FLAA 1E2KA 1EIWA 3HDQA 1MO4A 4C5AA 3LHFA 3KTFA 4I6JA 1EK0A 4K86A 4DR3M 2IPAB 3QPBA 4JROA 4NRDA 2QY9A 1LNSA 3EXHB 4OVZB 2HKJA 1CQIA 5L51A 4GLJA 3BMCB 2JIZD 3I1JA 5KYNA 1SPBS 5FBLB 4QA9A 3U4IA 5AW2A 4LHVA 2J0UB 2Y68A 3CMMA 1AXGA 1C3VA 2H0RA 3N8HA 4B82A 3GELA 1YCDA 4GE3A 4AECA 5GZ6A 3JS5A 1VP3A 1OXKB 1HE8B 3TWMA 3LGXA 2RMKA 1OAKA 3I04A 2XNHA 2O7RA 1HETA 5M29A 4GZLA 2WJAA 5ITUA 3FPKA 3EFOA 2PMWB 3AUFA 1K0UA 2CHFA 2XNJA 3BREA 4W5JA 1NSFA 1H5UA 2PGIA 1JIKA 2B35A 5AHKA 2O3RA 1YRBA 5BOSB 4HPJB 3A1CA 1S2NA 2KEBA 1KRXA 1JFRA 2WHRA 2P9TA 4ZJUA 3RT7A 3WL6A 4BOYA 5JCPA 5J59A 2ZYUX 2IXEA 2IHNA 5LMCA 4IRXA 1TKBA 3I1YA 4IDEA 3C3CA 3FPCA 4AXBA 1YAJA 3VMMA 1GY8A 1RZUA 1PX2A 3QTTA 3Q2IA 4LX0A 4NZNA 4AF8A 3I0NA 2K2QB 4QGSA 3MD9A 1EMDA 4WUVA 1YKSA 3Q9LA 3DDOA 4TMFA 1BEZA 1QGUB 1FFCA 3BUSA 3KYDB 4OAQA 5HK8A 1K6IA 1E1RD 4YLYA 1R12A 2YJGA 3G8BA 3E9QA 3GJTA 2Q28A 1DJMA 2ZUWA 1FQWA 4WLNA 4PPYA 5JNSA 1XNJA 1Y7LA 5BNTA 3NFRA 2XLJA 1KPGA 2X3FA 4GI1A 3KBOA 2O1SA 4B4VA 4BAGA 3JVUA 3C1AA 3OZUA 2BHNA 1CVRA 4GDFA 4A6EA 1DGGA 1CLUA 4YUZA 4FBGA 3W90A 1UKBA 2HSZA 4KXQA 3ASUA 1KO8A 4J0QA 1ZM2A 2JEZA 2ECPA 1UBCA 3A45A 4UE2A 2IS2A 3SS8A 2QE6A 4XPIA 1BWPA 4B3TM 1NXQA 3QXSA 1HNXB 3NXKA 4H6PA 3W78A 2OD7A 4IXNA 3QX3A 3OBIA 4KR2A 4MZDA 4IIBA 1M2OB 4UQLA 1OH5A 5CRIA 2X1LA 3HH8A 4NFYA 1UBMS 1OWOA 2X0RA 3F8TA 2EWWA 4M7RA 1JI0A 3HA2A 5K3CA 3D3NA 3I28A 1GPAA 1TK9A 3L6CA 4IIFA 4ETWA 1BGWA 2B2CA 4LF8B 2UUAB 4BV9A 4CJ6A 4NOKA 1JDUA 1KSHA 1DQSA 2UYQA 2JAUA 3E2MA 3N2GA 1YFZA 1SVOA 3JQFC 2CXXA 1WUYA 4OUDB 2A1TR 3O5AA 5GGXA 4UEJA 4BCDA 1DC4A 5FDFA 4X1IA 3DLHA 2PT5A 1YTLA 2C9YA 2WEKA 2PGXA 5DTMA 2NNWB 2FX3A 3EQ2A 4GUDA 3DOCA 3URMA 1USVA 3KVVA 1M5RA 1VI6A 4K9RA 4HMOA 5MF6A 1M7BA 4OGGA 4A2PA 2H2DA 5EMHA 3KJHA 3PPVA 5C46F 1T6YA 4BC1A 2R1VA 4R31A 4EO7A 4IIVA 4A6XA 4WN9B 4A91A 1T15A 1DADA 3ITDA 3KYJB 2WJ6A 2P6MA 1OILA 4CMEC 3K70D 3F71A 4O2AB 5AJTA 3ZCPA 4EY5A 3OQOA 1CS0B 2C4HA 3RS9A 5HW0A 2IXBA 3NBIA 5JIBA 4IZ6A 4ZJPA 5GONB 1RCUA 5L3RA 4ZKDA 2FOXA 2XVZA 3MN1A 1GTL1 1K3UB 4P31A 4X0EA 4LF5M 2XMBA 2B1RA 1IBKM 3LTNC 1E60A 2AD5A 1ULHA 2XYQA 1Y9ZA 3I9LA 3EXEB 1XCPA 3A58B 1YQEA 2WYUA 5JMWA 2PXHA 2ZAIA 1GNTA 1EP3B 2UZIR 2XT6A 2Q3MA 4ME6A 2PS3A 4AT1A 2AEJA 3H3FA 3HJNA 4W1QA 3WYNA 3EBPA 4DSAA 3OIFA 1V47A 2AV6A 5H80A 4G1CA 4ER0A 3VH4A 5K4AA 5GQSA 4RK0A 5AH0A 2WZJA 4GR9A 4HDAA 2OG2A 4QICA 1GOTA 3LIIA 1Y1LA 3FFBA 1N9KA 4OYHA 4TWAA 1MPXA 4BJHB 3HGIA 4ZHQF 1NQUA 4RPCA 3GLGB 1D7AA 4CMIA 1VM6A 4LXXA 4C2BA 4FT4A 1OFHA 2DFVA 1PJ2A 4MS4B 4GWKA 1Q2XA 2R0IA 2ZUDA 5KNBA 3CNQS 2OVBA 4TXHA 2GPNA 3H4TA 2FQWA 4B4WA 3GLIA 1X80B 4AAYA 2HTFA 2AXPA 4PCZA 1FMLA 3UB4A 1QBKC 1MKYA 1UR5A 1PFUA 3IOYA 1E1QA 5E1BA 3LBIA 5FBVB 4BAUA 4KMMA 4ECAA 1U0HC 5EAIA 5KTTA 3NTLA 3H2BA 4WURA 4KQWA 2ZVQX 4ENQA 2A9PA 3I4VA 3R6GA 4R6XA 1M1XB 3OCWA 1Q1GA 3VPAA 2H07A 4DSZA 3NRJA 2Y0QA 1SH7A 2OO9A 2FMKA 3AW9A 4LXGA 1LTHR 3DL2A 2O0HA 4K0RA 4E5PA 1EDZA 4JLBA 4NENB 4LOHA 1K6EA 1QLHA 1NXWA 3GVHA 4DXAA 1P31A 2YS7A 1M33A 2X8JB 3E1GA 3EIEA 4JQZA 4D6PA 1OXSC 3MWKA 1RPZA 1W48A 2P1DA 3RM3A 2P2DA 1LBEA 4XEHA 4JCOA 4I1YA 2AVNA 2JIOA 2GPSA 3BHIA 1FW8A 4V02A 3H1PA 2FPWA 2Y20A 3GCXA 1FQKA 3X0DA 1K7YA 1FPMA 3T5AA 4FYWA 4YP5A 1NYRA 1ZUWA 3QJ5A 3I6YA 3ZQKA 4DY4A 3SMPA 4HNUA 2E9SA 5A9RA 4Z51A 5FFFA 4IFEA 5CT5A 3G9TA 5A3SA 3GXBA 1SM4A 4OMCA 3FROA 3UH1A 3SY8A 3D4NA 4PYNA 3N6RA 1XTSA 5CLIA 2ZYIA 1SCUA 3GXOA 4KYVA 2Z5FA 2NV6A 1OBOA 1Q5PA 4YAKA 2R97A 1I1NA 1WNFA 3EG9A 1UDXA 2YJ6A 1ZSNA 1JIVA 3V48A 4GKVA 1KKLA 1T6OA 1M6WA 4IMIB 1V8DA 1NP6A 3BFXA 2VVTA 5BMOA 2AZMA 1CDEA 4HH3C 5DT2A 4TWBA 3V76A 4CR7A 1UIMA 1I4OA 2CFIA 1II8A 4PO9A 2QI9C 2X7HA 5I4KA 5DYIA 1U8CB 3H5OA 5H3LA 1QK3A 1QYXA 1JA0A 5ERYA 1A2BA 5J4HA 2CF6A 4A8HA 2WF7A 5K8TA 5ED4A 1CP3A 5LOVF 1DO2A 3JQ7B 1QB8A 5JDIA 4RH0A 1EUZA 4MWEA 1ZIYA 4LJYA 3W1WA 4Q4LA 5MGNA 4AZ0A 2P4EA 3KQUA 1ZMTA 4MVJA 3CUWA 4XWWA 3GRCA 3QFCA 4CT5A 2APLA 1PAUA 2ZE8A 3C6QA 3TQRA 3QVXA 2RSLA 4U7JA 3BXHA 3SM3A 3TL3A 4FCVA 4HDKB 1OIPA 3GLHB 1XTQA 3M3PA 3B38A 2HCTA 1GVNA 2H1IA 2XHZA 3DEJA 4HDQB 4NBNA 5F73A 4JJ4A 2JGJA 5DPMA 3HN6A 5AI6A 4G97A 4XIFA 1ELOA 3V3KA 1CQJA 3IIMA 1QTNA 3M6WA 1WDWB 2CZCA 4G37A 2R6R1 2BGIA 4R3WA 4D0RA 1UC8A 3X1KA 3FVTA 4I55A 3GL9A 1O6BA 1QH8B 2B1IA 3UWPA 4ZHSA 1DVRA 2HWWA 4G5HA 4BEJA 4FIZA 2LVNC 1T6ZA 3DL7A 1NX9A 4U5QA 4GHAA 4X64M 3JARA 1DFIA 1XEFA 3H9QA 2WPDD 4QEKA 1A96A 5L3VA 3T1HB 1I30A 4Z1MD 4UC0A 4RL4A 5L45A 3MLEA 4KQJA 5FT9A 1YDFA 1RKQA 5JRZA 3CZMA 4E09A 4H60A 3LUAA 3AOEC 4Q1DA 2PSFA 2VDJA 2HIMA 5DLYA 3MLBA 1PU2A 1QGDA 2X76A 2X0KA 4HZUB 5JWHA 3FBGA 5FLXS 5FTWA 3GFQA 4HLQB 4GP7A 2Z6QA 3E03A 2J3LA 3CR3C 3VTKA 3W6ZA 3JAMA 2PZ8A 1E4OA 3JQAA 3UC5A 1SWWA 1TU4A 2AMLA 1BE0A 3A1FA 4LSMA 2QTCA 3OTQA 2AF4C 3P2JA 2ZSKA 3HLYA 1KJ9A 2W6CX 4K6CA 1LPAB 3PDCA 4GXRA 5FUQA 1XQ6A 1Y1PA 4RHEA 2XUZA 1XL1A 3A6GA 4PE5B 3I5AA 1MIOA 2QU7A 1JZQA 4GIBA 1SB9A 3GARA 2M6RA 4JP1A 2HHAA 3IFSA 1XBTA 4AZSA 3A10A 3GAFA 2QKYA 3DNPA 1LJLA 4MEAA 1P60A 1TIBA 4Z54A 4LYDA 2C2MA 2C7QA 2VWGA 1G71A 1OV6A 4B8YA 1P9LA 4FYMA 1R2QA 3HKCA 1LF0A 2M98A 4JUBA 3OJWA 2XECA 3N2KA 3RYTC 4DLPA 1HSOA 4KLCA 4M46A 5CA1A 2ZRCA 1HM5A 3COVA 1WCIA 3L02A 5FOXA 4Y2HA 1U0BB 3MJEA 2DJ5A 5AKLA 3ZHRA 2HRDA 1A97A 2W6JA 4DLAA 1WVGA 4M7WA 4KH0A 3NVDA 3LXXA 3TZHA 1BDHA 4RZ3A 1CNFA 3SS7X 3O1IC 1T9HA 4E32A 3FB4A 4LSZA 5FTLA 4A15A 1ZIPA 2ISCA 3FSEA 1P4RA 1EM8B 2GTHA 3GRKA 3CR7A 5LBTA 4E4RA 3IIIA 2R6CA 1FYEA 2PIAA 1ES9A 1NVKA 5M04A 3SOPA 1EFDN 5IK2A 4CF5A 1M2NA 4MKHA 3KZVA 4Q47A 3RIGA 2PX8A 4OM8A 1ZK0A 4Z9AA 4ZCLA 4EG6A 1ESZA 4R1LA 4UTRA 3R0ZA 4DV2B 1X1AA 4ZCQA 4EG8A 4TTSA 4UUAA 1VL1A 1RIIA 5FBRB 2H4FA 3M3HA 4BXOB 3HXMA 3PXGA 5KDDA 3LRXA 4RMJA 2RCYA 3KUXA 1AKTA 3VU0A 2EKQA 3PRYA 4RSRA 4JXJA 1HE3A 5E6JA 1TADA 4UM9D 2H3EA 3KALA 4B80A 3SVTA 3MTGA 5KQSA 1SXJA 5J1TB 1T5OA 4NPHA 2GNOA 3LYUA 3H84A 4Y2YA 3VR5A 1RQGA 1Z82A 3OJ0A 5K3OA 4YN3A 1CD5A 5DEOA 3RTAA 5GMOA 3JR5A 3WZLA 2HA7A 2VF8A 3F9RA 4D2IA 1N5OX 3MZ0A 3RODA 3HXTA 4UEWA 3QEMA 5HUJA 1IZ9A 4LF7B 3VR3A 3MBKA 1ODTC 4C0BA 4WEOA 1VIVA 4XQ0A 3CUUA 2JP7A 4RS3A 1BQEA 2GHRA 5JI2E 1RC0A 4Q18A 4TQAA 5C5CA 3UIEA 1QF9A 4YFVA 2CFOA 1I6WA 3SZ3A 4OHZA 2V3CC 3GJ4A 4AJ4A 2RBKA 3ND7A 3BBLA 5ER6A 1I9CA 4RY9A 3ZDZB 3SD7A 3T3GA 4EEKA 1N5IA 1E1KA 4J1TC 3T3OA 2Z3XA 3K1AB 3OD1A 5BSMA 1GUZA 4DA4A 1P4SA 1ZXLA 3OU2A 2QE7A 1PEKE 2NUAB 1M10A 2UDPA 4KX3A 2GCPA 4RTQA 4A0QA 3MJ5A 4QQKA 4RV4A 3MC1A 4P80A 5EFOA 3RYIB 1N5DA 3T1TA 3EXFA 1U9IA 2ISQA 1D1SA 1LA2A 2VTBB 2OGTA 5I9BA 3H1FA 2XB9A 1BIFA 4QYIB 1R6UA 4BMXA 1I01A 4JDPA 1KDZA 4CIXA 3D1LA 3AXSA 1N32M 1LZLA 2WDPA 2ZIFA 4UTOA 1T1SA 5ES3A 2XZLA 4GEWA 4ZYLA 5JTTA 2YY7A 3O3CA 2VPWA 5EKDA 1NZDA 3FVVA 1RMQA 1I3OA 1KI6B 2QAIA 5IYZA 1IY9A 2PUWA 3QYAA 1SIBE 1MORA 3I53A 5AKEA 3QU4A 1YZKA 4R0MA 2YZ7A 4IVRA 3VFDA 1PZHA 4IOKA 1IHPA 3I30X 4HB4A 2RB4A 2E37A 3OZGA 1O4VA 1G2OA 4KIJA 2UVPA 1IJKA 5M34A 3AFMA 2NP7A 5TY0A 4BUCA 1NAIA 3LQFA 3GVXA 4LQDA 4JBIA 5KNBD 2OC4A 3NOQA 2FRDC 4UAGA 3M2TA 1TT5B 4HO1X 4NVRA 4O1IA 4IGFA 3DLCA 3MA0A 5GJWC 5DGTA 5H68A 2FWJA 4UZSA 3RIYA 3PEEA 3OZXA 4W4TA 1ETHA 3NV9A 4QXPA 1EZ4A 4NARA 1N6PA 1E1QD 2HJSA 1FLVA 3GIDA 4US2R 3G0IA 1VDDA 1W1IA 3KKZA 2ZULA 5LP6C 1YRYE 1JWBB 2MHCA 1YDHA 4RWEA 2HMTA 4L72A 5K3EA 1IXKA 3VGJA 3J2PB 3D81A 1YZLA 4F4IA 2JFPA 1P6QA 2ZYSA 4S12A 3ZX4A 3GF4A 5KYVA 4MUIA 3REQA 3HHWA 1LDBA 2I2WA 2FSVC 1CERA 1ZD3A 1NG1A 4JOQA 2BY4A 3CR8A 4C6TA 1X13A 4QUEA 1FIUA 1Y8QB 4EFKA 1TNDA 1ZWKA 5KTRA 2WSBA 2V5UA 3LC7O 1GDHA 4CF3A 3SHQA 4TS3A 1IXSB 2VN8A 3IQGX 2VF2A 4JR2A 2BW0A 4NI5A 2BFDB 3SFTA 3WQBA 2NMVA 2PTGA 1OT5A 4EP1A 4NJMA 4L9AA 3BH6A 3U4CA 1N36M 2RK4A 3SAUA 3LYAA 1VIYA 2YV1A 1VSTA 1E2IA 2EKZA 2GZHA 5ADUS 1FTSA 4CCAA 1B15A 1FU4A 3DLPX 4X1KB 3JQ8B 1RLOA 4GPZA 2G25A 2I6FA 2QN3A 4ZEMA 2ILVA 3D7RA 1S2DA 3A14A 1QE3A 2R7KA 1WR8A 3KWJA 4RGBA 3SHVA 4HI0E 4YONB 1WBBA 3QOFA 1YR8A 4BFZA 4QUJA 2FKAA 2Z2IA 4RQBA 1OQYA 5KI6A 2VNJA 3RYCB 3DA1A 2GJ8A 3NHYA 4F3NA 2PVPA 4E08A 1KEKA 3TSOA 3M34A 5ITQA 2AUTA 3K9HA 3CISA 4WX2B 4RWZA 4CJXA 1ZIDA 2VHJA 4JYCA 3GWZA 3L1IA 3HVRA 2IVFA 3FHJA 4J1QA 4KH1A 1VG9B 3TSCA 3QVWA 4H7EA 2GEUA 4OW0A 3DV2A 4WKCA 4ITUA 2P0EA 3BDVA 2CEKA 3TNYA 3MUOA 5FA8A 4K9LA 4YCCA 5CJPA 3KVRA 4PLGA 2QRNA 4DC9A 3QJYA 4AROA 4CUKA 3HCRA 4F60A 4H0CA 3FI0A 4H35A 5KKCA 1R3UA 4KBGA 1C4XA 2H4YA 1UBRS 2Z8YM 5KOHB 1RT9A 5JH7A 3LW8A 2UVDA 3E3OA 2WKSA 2JL1A 1W5AA 4QDKA 2PHZA 4MVJD 4HPWA 1NN1A 4PN3A 2Z43A 4J0GA 4BVFA 3I92A 2QRGA 1U65A 2EKBA 3FRHA 3F3MA 1G21A 3I9OA 2VXYA 2EJTA 3SZOA 3QPWA 4KN8A 5BXYA 1XVLA 3NHPA 3PPXA 3DV9A 1B23P 5AT1A 4HOYA 1NRJB 4RGVA 2YICA 2I2XB 3DKPA 3WLQA 3BVPA 2HMUA 4N65A 2F8SA 3ANMA 3I01A 1P7PA 1UDRA 2QN9A 4O02B 1R0RE 3LZ6A 5JASA 1YVEI 2BF4A 2AJLI 3RC9A 1V8OA 4LY9A 1VPDA 1YC5A 4P6VF 1EFAA 5L3QB 2VJMB 5KTMA 2IPOA 1IZYA 2GJ9A 1KSJA 2GCNA 3NAQA 3M5CA 1I0ZA 3HDTA 5IBQA 5D8DA 1YJCA 1W96A 3L05A 4JI2B 4IBIA 3R1IA 3T5MA 1FRVA 3V42A 2W2OA 3QVVA 1HT2E 2XB8A 1L7QA 1RHUA 3VLFB 4L78A 1DKRA 2ST1A 1BGXT 5H37D 2ES4A 1N0UA 1G55A 2C3MA 4WKBA 1Z5BA 2GXAA 4HXEB 4FJ2A 5DNUA 3LAWA 3BZBA 2HQRA 1QM5A 4DIDA 4EB8A 7ABPA 4CIYA 1MC5A 5FI0B 3I4CA 3S3TA 5TJ9A 4I4LA 3JQAD 3HJTA 1JFLA 4ZREA 5KU7A 2BMEA 4XARA 4WVFA 3O26A 4RJKA 1ZUHA 4ZYYA 3HYLA 4Z4QA 3Q88A 2VAVA 5DVZA 1K82A 1YZYA 4QUKA 3RG8A 4YV7A 4KYTA 1KZ6A 2WMDA 2QS9A 2X5NA 4WNAA 5E8RA 3T5BA 3DLTA 4MV0A 5KX5B 1E62A 4MI1A 1USKA 4B33A 1G4HA 2J6CA 2XMPA 2CCGA 5JXGA 3WJ7A 3HU5A 1V92A 1HFJA 1UP6A 5JMOA 2OXEA 3QXCA 1WPXA 2D2FA 4YK7A 1C8VB 3KFLA 3F4KA 3DTVD 1ZG3A 1Z4IA 3FHCB 3BL6A 2CLLB 1Y7HA 5HUQA 4JI7M 1ULAA 1P7ZA 1UKEA 4UJ3A 4Y2UA 3C6XA 2E1RA 1KZHA 1JIIA 1A9RA 2BZGA 3VDXA 1PG0A 2IYAA 3RH0A 1PDVA 4GLFA 1NVMA 2RG7A 3JRXA 5I9LA 2LXNA 5JAZA 2W6JD 3WWEA 5BQ3A 1V3TA 2HO4A 3FUCA 2JEYA 5MN5A 1PWHA 4FLFA 5F7OA 9LDTA 3OHSX 2GYUA 2ZQYA 2Z1DA 4DDWA 1MABB 2GWHA 1X9HA 4EJMA 5AVVA 1CRQA 1ZHFA 4MGEA 3R0QA 1LPOA 4JY7A 1SULA 2IQIA 5IK2D 2WOOA 2VWPA 1KQOA 4PG6A 2CD9A 1L7AA 4HEHA 1D2CA 5COQA 3CZ9A 2BFNA 3KJNA 2HA5A 2QL6A 2JD1A 2VJCA 2ZJ6A 1LPPA 2O7SA 2E85A 3IBCA 3IEIA 4WCFC 3FZGA 2IPMA 3GEMA 4N39A 7REQB 3PEYA 3T9DA 4PFJA 1AOXA 3K31A 4YV2A 1PZXA 4X8HA 5J47A 3MK31 4HN2A 3LUBA 3AB7A 2NVUA 3KHTA 3T15A 3EMKA 2MT9A 1Z17A 1FSSA 2O3UA 1G8KA 1UPAA 4Z0HO 3FMFA 3IOBA 4PLZA 1SXJD 3QTBA 3HHXA 1DAFA 2E21A 3VMFA 4IEFB 4F1KA 1K6MA 2QIPA 2R96A 3THWA 2EKPA 2DP4E 4Q01A 5BRJA 1JAYA 4B2LA 2EFHB 1V1JA 3PPYA 1RU3A 1R6TA 3C6MA 3QI7A 4CEHA 3SI7A 1SOMA 3UMJA 1IHDA 2HLPA 3TW8B 2HJWA 5JMTA 2GJ4A 4Q9IA 5DBFA 3MUEA 3VR3D 4PIMA 3WYDA 4C0LA 1NG9A 4P3PA 2LDBA 2J85A 4P84A 4PC2A 2B2NA 2RGGA 1UK7A 4JHLA 2WKQA 2BSQA 3FOCA 2HMVA 5BN5A 3FTPA 5HZHA 4PAWA 1GPJA 4IBFA 5EJFA 1XQ9A 3Q8XA 4L9RA 1AU9A 1H1DA 2QZPA 5BN3A 1TL7C 2EKKA 2OBMA 1ZJ6A 4JI3B 1JLLB 1OFIA 2DULA 4BB5A 4U7HA 4DMCA 1KS2A 2F62A 2OR3A 2WILA 4MUFA 1WU8A 3S44A 1NSTA 2M5ZA 2M9MA 3EIFA 4QIHA 2V74B 5FB3A 4RKEA 1FDWA 1YS4A 3LJKA 1C1HA 3A9UA 1P9RA 4YUWA 3L8YA 4OSPA 4NZOA 3HJAA 2QE7D 1E4YA 1F2TB 3U4QA 3OIVA 5JZMA 4LVCA 2C57A 2P30A 3OEWA 2EWVA 5BVGB 2C29D 2QY6A 2OFXA 3ESAA 3CNHA 3AC0A 5J58A 5ALKA 3E1SA 3B53X 4JOBA 1EWKA 1MX5A 1OI2A 3T1HM 4HQRA 3MHTA 1HLGA 2VHTA 3WLSA 2X40A 2GXSA 1U8TA 3A9TA 3OQ1A 1XCBA 1RVDA 4DPMA 2PZFA 1O77A 5CB0A 4XEUA 2FSUA 3HYCA 1IJBA 1KAHA 3QVSA 4BBJA 2QSZA 3I2FA 3F5QA 2BONA 1JLRA 4QSHA 4B8ZA 3M6FA 1WP4A 3NOOA 5ITXE 1BXRA 5CXQA 5CD1A 1XEXA 1KO7A 1VLHA 1F9AA 1V41E 4NPCA 4FMDB 4BYMA 3CH5A 3D7LA 4RGQA 4LDRA 1YIDA 2QMHA 3A04A 2DHQA 4HVCA 3SX4A 2C5HA 3SARA 1FTGA 1E1CA 1F7VA 2FK8A 3HY5A 1W25A 1XQYA 3HN2A 2GZDA 5JE8A 4FDLA 4OB6A 3M6AA 3FGZA 1IOWA 1FYWA 2CWBA 3KJZA 2FDCA 4MYDA 1Z3IX 3NBUA 2C58A 3VKFA 3AR6A 3RUEA 1FXSA 2L7HA 4JELA 4MR9A 1ORHA 3PJFA 4RFLA 2D7DA 1MOQA 3DQZA 4NESA 1OYYA 4E0BA 3H1BA 3Q8LA 2KB0A 5AKKA 4ZQGA 4M7OA 4XJVA 4RMHA 2BRUC 1NUAA 1EVIA 5B55A 1Z8FA 1NN3A 3M3DA 4QPZA 4MROA 2ALJA 1NA5A 2ZSJA 4WSOA 4TLBA 4JGGA 3SIXA 1Y3IA 1ZMUA 1K8RA 5EWJA 1ZINA 4WERA 3QF4B 2FCRA 3L92A 4CDMA 4AMGA 5JZVA 4L5CA 4Q34A 3K71B 2ZBVA 3EGIA 1Q0PA 5AICA 2CVOA 3VYTB 4LJLA 4LA4A 2QQ0A 4M0PA 2X42A 1YFJA 2FR8A 5F7ZA 2G5PA 2AJTA 2QAGB 5CB4F 5B6JA 2YJNA 5FYQA 3QUAA 3EQ7A 1I94M 1FX0B 3IP8A 4XTCS 2HADA 1OI4A 3SPXA 4AICA 4P3XA 4DSUA 2HDNB 4TN5A 1LKZA 4R1OA 3S1AA 5D3QA 1YSYA 4MAAA 3W3AH 1FOEB 3QGMA 3EEQA 4GM0A 1CEYA 3BF7A 1W36B 3I5MA 1T9CA 4OHMA 4PXAA 1T43A 1DL5A 2NVOA 1Q21A 3DE5X 4Z8YA 4EUSA 3WBKA 1QHHA 4EJ2A 2WHPA 4J3NA 3RI3A 2HWUA 4EABA 4ZO7A 1PJAA 3IT1A 4OI1A 5FOTA 1XU7A 5ESDA 3R7AA 2RI0A 2O06A 3LQYA 4CM4B 3LIPA 1XZEA 2ONCA 1RADA 4EG1A 2FN3A 5A6SA 3DZBA 3ETEA 1KRWA 2BUCA 3VHXA 4LI0A 2CN1A 3DZJA 1CLEA 5B3KA 2NU8B 3T0GA 1XLUA 5JQGA 4TX1A 4U2KA 2B2XA 1ZS9A 1T9DA 2XTMA 3IG5A 4CKEA 1IJEA 1F4IA 3PXAA 3BE5A 4P0QB 4FHCA 3GJ8A 3BICA 4PIVA 1KQ3A 2WLTA 1AZWA 4F0JA 2ONKA 3DEKA 4ZALA 3JALA 4KFUA 2D4HA 4II7A 5DW0A 1CUZA 4EJFA 1DIRA 3ZHVA 4BKPA 1XDGA 3QKWA 1HQKA 3L41A 5TMDA 1OXXK 2B69A 1HZJA 2Q9BA 4RV9A 1A04A 4DMLA 3EGDB 2JBAA 2WU4A 1XDWA 3I8SA 1C1YA 3ANXA 3KUKA 1CEQA 3NUQA 1ZNXA 3DA8A 5KYWB 1UZUA 1BE1A 4HLUC 1KQPA 1SBZA 4K03A 1KVUA 1D2EA 3LW7A 2WKPA 3KFVA 2NUBA 3UW3A 1G0OA 3BILA 2HSDA 3A6EA 4HLNA 4ZAGA 3RANA 1U9YA 3N2IA 3KQNA 2BEUB 3GLVA 3R3WA 1E5QA 4JMPA 1NPYA 1ESNA 3ZH9B 1KEUA 2DAIA 5H82A 2YBDA 3OUUA 5BV8A 5G0SA 1NIPA 2IU4A 2FU5C 4G0YA 3DTYA 2G0NA 1AA9A 1PR3A 3VO1A 2HRQA 4ABYA 5HDQA 3KXDA 2IOYA 2X13A 5INTA 2VTVA 3G82C 2V7QA 2C3UA 4RPHA 1PGQA 3NAZA 4R8KA 2JKVA 3GLQA 1DUVG 2BUAA 1Z5CA 2X7XA 2B5WA 1XNHA 3DMNA 1Z75A 5JI3E 3K2BA 5BSRA 3OFKA 2O4UX 2EEZA 1ONPA 2AEEA 4HRXA 3ZE0B 3ILSA 2ZUUA 4ZK6A 4EW1A 4PZPA 3KWMA 1V1RB 3R5TA 1P2SA 5SV2A 2NQ8C 5EQFA 2FE8A 4QL3A 1YMUA 3TZBA 5EIOA 2O48X 4HBGA 5B2EA 1ZCJA 4IKOA 3GPLA 5F2KA 3ZLJA 1L5MA 1U0NA 3REOA 4REOA 3R5KA 4J3FA 3ZJUA 3LCCA 2B8EA 3N0WA 1NURA 1SUAA 1JIXA 1RQXA 5KTKA 5AQ1A 3I34X 5AFSA 3V1UA 1XHFA 1KBOA 3DJYA 2ZRMA 3JVDA 2ZDHA 4JI1B 2JEOA 4O08A 1W4BA 3Q72A 3FWNA 1FFSA 3VPDA 1Q15A 2QRVB 2GNAA 4KSYA 4FUQA 4HWKA 1GTZA 3PHCA 3U44B 3AUKA 1W4CA 1UC5B 1J0XO 1GCUA 1E1DA 2ANCA 3MXTA 2BDTA 4HUQB 2AZXA 4PC7A 5FUXA 5JISA 4U2BA 4H3VA 2B4YA 2Y99A 3UPDA 1J0CA 2ZBKB 3JWGA 3UJ9A 2C2YA 3AI3A 3WLEA 3ZV7A 3O4FA 3CTMA 3IALA 2LDXA 1L7RA 2IOHA 2PUJA 2FE1A 3PCXA 3PDIA 3TD6A 4BCCA 1RAIA 4ZCIA 6REQB 4I6EA 1UWVA 1E6MA 5G0VA 2I7PA 4BN5A 4DQXA 5A1JA 5G02A 1ZVMA 5ADHA 3OFVA 1QS0B 4JWKA 3PWKA 2ZXFA 1WZ2A 3VX4A 2GN6A 5LDGA 2PBFA 2Y1XA 2CD7A 1B93A 3ZG6A 3IUMA 2G80A 1C2TA 4MS1B 1QIIA 1KMIY 3EZ2A 5C1OA 2A14A 2P69A 4GXTA 1TAUA 2SICE 3O95A 2Z3VA 1E5LA 3AUUA 4IXMA 1OIVA 2I3ZA 3NOXA 1W49A 3SBEA 2R8ZA 4HVAA 2D5IA 3P45A 3H13A 3NORA 5DM4A 3OZSA 2E0IA 4URHA 4G8JA 3H5RA 5IXJA 2ZUBA 3ER6A 1GNSA 1RIFA 2XIJA 1WSDA 1JEEA 5CX4A 1LLUA 1WCXA 2PTHA 1DV1A 2ERXA 4Q0MA 3OU7A 5HYVA 1CZOA 1O7JA 4M76B 4LJ5A 1UBGA 1BOFA 1BDMA 2BGNA 4E14A 3MPUA 1Q83A 3TLZA 2XT9A 4HATA 1E8MA 3SYMA 3I0ZA 1P1KA 4NU6A 3W3ZB 1GFSA 2GARA 1HF3A 2J9ZB 2MJ5B 1U2ZA 2GF2A 1MAAA 2IC5A 4UBIA 5HPYB 2C2WA 1AQYA 1E2BA 4QVKA 1VI5A 2EBUA 3HA3A 5REQB 4RQTA 3DXYA 5BWNA 3GEIA 1DRUA 5SY6A 4G0ZA 1GWNA 4M1OA 2QZZA 2VSYA 4F91B 3W6PA 5DWVA 2CLSA 1NQTA 5AM3A 2JGDB 4E31A 1FJGM 3SC4A 4NONA 2A3NA 1WXDA 4X45A 1MGOA 3QXHA 5LMNM 4JVSB 3OZFA 4B6PA 5ED0A 1NJ8A 1N33M 2QRPA 3Q0TA 1Y6JA 5KNLA 1X7GA 2Y1FA 4OFBA 1XZIA 2UUPA 2NIPA 2NTEA 1A4XA 3SQXA 1Z29A 2KBFA 3PUYA 3KYIB 4LDQA 1JFSA 3LMKA 1P2DA 2P5TB 1DJLA 5IT5A 4B7GA 1J5XA 4S1OA 5CVDA 3LX4A 1X1SA 4ZZIA 1PK8A 2WHEA 5KC8A 1CY8A 4J90A 2G9ZA 5LLTA 2P90A 1BDJA 1GQYA 1UFOA 1ZGZA 2BSAA 1YI0A 3V7WA 4YO7A 1ISPA