1VEGA

Solution structure of rsgi ruh-012, a uba domain from mouse cdna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
83
structure length
83
Chain Sequence
GSSGSSGNPHMWWLQDADPENNSRQASPSQESINQLVYMGFDTVVAEAALRVFGGNVQLAAQTLAHHGGSLPPDLQFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of RSGI RUH-012, a UBA Domain from Mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords NEDD8 ultimate buster-1
total genus 10
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vegA01
1WGNA 1T43A 2DNAA 4G3OA 1VQ1A 2DAGA 2K0BX 1WHCA 3FRHA 3IECA 3H4JA 2L4FA 2CWBA 1MN3A 3F92A 2CP8A 2L4EA 2EJSA 1HQYE 1VG5A 1OAIA 1ZV1A 2QSFX 2DKLA 1QZEA 2R0IA 2HWJA 4HEOA 1V92A 1HJPA 1IFYA 2LVOC 3GLIE 2DHYA 1VDLA 1C7YA 4F2LA 3GLFE 1G41A 1DV0A 2LTUA 2L2DA 2MGWA 2QNJA 3IHPA 2MROB 3K9OA 1NV8A 2QHOB 2KNZA 1WIVA 4F1IA 2BWEA 1A5TA 1AIPC 1HT1E 1DO2A 3GLHE 2KNAA 1KYIA 2K9DA 2JNHA 1ZMWA 2JY7A 2ZTCA 1TR8A 4GEWA 1BVSA 2JY5A 3BBZA 4UN2B 2DI0A 1T6OA 2DAKA 2KNVA 1PGYA 1TTEA 2JY8A 3LCUA 2ZTDA 2OO9A 3K9PA 2EKKA 3MMPA 2WZJA 3E46A 4R71A 1ZMVA 1JR3E 3B89A 2DZLA 1GO5A 2BWBA 4DBGB 1OTRA 1XB2B 2KHHA 3E21A 2DAMA 4WP2A 1VEJA 1Q02A 3LCVB 2LBCA 1YLAA 2JZ1A 2B3TA 2DENA 2G3QA 1G3IA 5DFLA 1E94E 1OKSA 2RRUA 1ZMUA 2OOBA 1WR1B 2EKFA 5JI2E 1OQYA 1WJ7A 2JY6B 1IXSA 1DO0A 2O25A 1CUKA 1R4GA 1Y8GA 2H5XA 2LVPC 3T6PA 2HAKA 3FE3A 2OOAA 1WGLA 1G4AE 2LVQD 1XXHE 2DAEA 1UFZA 1IM2A 2JP7A 2JZ0A 1EFUB 2DAIA 1P3QQ 2LVNC 2MJ5B 1VEKA 1NV9A 2MR9A 2LVAA 1HT2E 1VEGA 1SG9A 2JUJA 4Q7JA 1F4IA 3GLGE 3FRIA
chains in the Genus database with same CATH superfamily
2DNAA 3GLHA 4GKJM 1K3WA 2VQEM 4JXJA 2VQFM 3FRHA 3FTDA 5EP4A 4PDGA 1XMQM 2L4FA 5EP2A 2CWBA 1MN3A 3F92A 2L4EA 5FTLA 3GRVA 1UM8A 1LTMA 4IJEA 2R46A 1YE9A 2DZNB 2FNAA 4B3SM 1OAIA 3JAMS 1PJIA 2Y0TA 4X62M 2QSFX 1G8PA 2CHGA 3U61A 2HWJA 5FTMA 4L6V6 4D82A 4LF5M 1V92A 3OTOM 1XNRM 3QYEA 2D7HA 2LVOC 1IFYA 1KSFX 2WSFF 2XLJA 3C9PA 4NXMM 1GABA 5EQTA 3SYKA 3U60B 4Z6YA 4F2LA 4YHHM 1FNNA 1K82A 3EIHA 4DV3M 3D8LA 3A45A 2C99A 1OFIA 1Z5AA 4IBEA 2C96A 2XZUA 3CF2A 4M9SA 3E4RA 2MROB 3IHPA 3WHLA 2QBYA 3K9OA 2DWLA 1QDRA 3SASA 3FTCA 4YY3M 5FLXS 4G6ZA 4OW0A 2VF8A 3KDSE 3T1YM 1MU5A 1A5TA 1HT1E 5EJCA 4BBAA 3HU3A 2Z8YM 2C9CA 3MJ5A 4DUYM 1I4WA 2Y20A 3SHGB 4MM3B 4DV0M 1PJTA 4NRWA 4GIPA 3BXWA 4IBDA 4LG2A 1XMOM 4MB7A 2Y21A 1JB0F 2RGHA 1T6OA 3HHYA 4FVMA 2UUBM 1EIJA 1IXRC 2LWXA 3K9PA 3MMPA 4NRVA 3KFUG 3EIEA 4B7FA 1R2YA 1QVRA 1SXJB 3TWMA 4G4NA 4LFCM 3J27B 4GKKM 3E21A 3LVVA 4EIWA 3U5ZB 2DAMA 4W5WA 1R7RA 1IXZA 4LJAA 2CE7A 2DWMA 3FUVA 3IG5A 5EXTA 5ITTA 1JQJC 1LV7A 3QWLA 1XXHB 3Q8GA 2XGNA 3U6QA 5DFLA 1G3IA 3U6EA 3SARA 4AG5A 2D7GA 1E94E 1TDHA 4XGIA 5C1BA 2X4AA 4RF1A 1JR3D 1WR1B 5EP1A 1WJ7A 2QENA 4NSRA 3AL0C 4REZA 2K6BA 3GLIB 3QYBA 3SMPA 1G59A 3DZDA 1WXQA 2APLA 2LVPC 3T6PA 4BLCA 5LMNM 3U61B 2CHVA 3FE3A 3HHZA 2OOAA 5E6JA 1FJGM 1OFHA 1Z6TA 3HHXA 3TWLA 4DV5M 2F5SA 5KQDA 3KSJA 1UFZA 1XWIA 4IBKA 3FYDA 2CV0A 4Z8XA 2R44A 2FH0A 3KP0E 2JZ0A 3MHVC 2W82A 2MR9A 1NV9A 2LVAA 5ITXA 1GL7A 2LHGA 1V34A 3CTWB 3KW6A 3NWLA 2J5YA 3PNYA 3PNVA 4R3DA 3GLGE 1XC8A 1S3SA 3GQ3A 4GHLA 1N77A 1IN7A 1T43A 1WGNA 2R4EA 5ITQA 2NQ8C 1HQCA 1VQ1A 2DAGA 2K0BX 2KZSA 1T3TA 4DV1M 3R8FA 4B3TM 4OX9M 3H4JA 4QOSA 2XZFA 1GJSA 3T38A 3DFZA 3HKPA 2Z3XA 1HQYE 3AOGA 1TH2A 3SATA 4CJ6A 1G71A 3PVSA 1QZMA 1TGUA 1Z5CA 2DZOB 3UGJA 5BR8M 2DKLA 2JXNA 4OU7A 2R0IA 1SXJA 4HEOA 1W5TA 3SBJA 3GLFA 3J80S 3L2AA 1QUTA 1VDLA 1W5SA 3M7GA 1R5LA 2DWZB 3KSXA 4NOOB 2C5RA 4DR6M 3GLFE 3IG8A 2UU9M 1DV0A 3M0EA 3AOEC 1PM5A 2MGWA 2LHCA 3VFDA 1NNJA 2F4VM 1XXHA 1QYRA 2LXEA 4CGYB 4JI1M 4RF0A 3K8ZA 2D7EA 2EUCA 1R2ZA 3R9XB 1NV8A 4PT5A 2KNZA 4WW0A 5C18A 1L2DA 2JWSA 2BWEA 1IXSB 1QAQA 2XF3A 4LZJA 1HNXM 3KOZE 2V1CA 2VF7A 4LJ5A 3ILKA 1DO2A 2G8LA 2M5ZA 3I4YA 1AUAA 3Q8XA 4GMQA 3GLIA 2KNAA 5DNYA 4DV7M 8CATA 3RGSA 1I94M 5KPZA 1HNWM 5KPRA 1GLNA 4AW4A 2OQ4A 2JNHA 1ZMWA 1NJFA 2JY7A 2ZTCA 3SAWA 4D81A 1OIZA 2QZ4A 3DA1A 4UN2B 2DI0A 1NJGA 2KNVA 1PGYA 1TTEA 4LJ8A 4RKUF 4FWGA 2C9OA 2ZTDA 3U60A 4KODA 2EKKA 3K1JA 1L8QA 3HJQA 4R71A 1NY5A 3K2LA 4JV5M 2DZLA 3FD9A 3KOWE 3UK6A 1XNQM 2OPFA 4DBGB 4MGIE 1RU3A 3SFZA 4QNRA 1OTRA 1XB2B 3DOAA 4DR4M 4DR1M 3HX3A 5KO3A 3LCVB 1NSFA 1V33A 4MGKE 1IBLM 1E9RA 3KOYE 3L28A 2F5PA 2LBCA 4CHTB 3J7AS 3U6DA 2JZ1A 3SMSA 3K92A 2DENA 5ITXE 1ZAEA 4M9ZA 4PCZA 2DVWB 2CV1A 2EA0A 2V6ZM 1OKSA 1C1KA 3THGA 2YFQA 5FTJA 2R6FA 3W0FA 2ZBKB 4G4OA 3JR5A 1OQYA 2JY6B 1Q3BA 5EXSA 1CUKA 3FUUA 1Y8GA 3FYCA 1D0MA 1QUSA 1NY6A 4XBOA 5ITRA 2KZUA 2XEPA 4CISA 2KRKA 1D0KA 3TQSA 4B3RM 2JP7A 3B7ZA 3I04M 4GITA 2XFSA 1X37A 4QNMA 5ITUA 1VEKA 4OVZA 3HU2A 4Q7JA 1HT2E 1VEGA 5IZ7D 4LF8M 4GH9A 4P16A 4L15A 3GLGA 4KLNA 2QCUA 2DWNA 2Z4SA 3HWSA 3B7QA 1Z5BA 3HHWA 4G3OA 4NC6A 4RNAA 5LMUM 4LF9M 1WHCA 2BJWA 5BPVA 3L27A 3IECA 5GKNA 4AQYM 2O5RA 4XK8F 5EP3A 1E9SA 3AKZA 4LZZA 1IN6A 2CP8A 4ANRA 2V1UA 4LF4M 4QOZC 3L26A 3FUXA 1DGGA 1NHGC 3V76A 4FW9A 4DR5M 3UMMA 4G4RA 2LNHC 1L2CA 4LJ7A 2KW0A 4DR3M 4LF7M 2KA6B 3TWKA 4G4QA 1TDZA 4R7GA 1IBKM 5L8RF 1YSYA 4ITQA 2DHYA 2DXIA 4KO8A 3TE6A 3SYLA 2X49A 4GC5A 3U6CA 4AG6A 5EXXA 3FKEA 1MJGM 4JI5M 3J81S 1N78A 2LTUA 2QBYB 2UUCM 2L2DA 4QHTA 2UXDM 3FTEA 2I7NA 1PJQA 5H37D 3U6MA 3NBIA 3H4MA 2XSZD 4M0DA 1PJSA 3T15A 3ZC7B 2UUAM 1GJTA 2QHOB 3J2PB 1NO1A 4F1IA 4IBGA 4JI3M 3ZCBB 1J7KA 1D0LA 1PRBA 2N35A 4L8RC 3FUWA 3VKGA 2CFOA 4A3VB 3GO8A 2O01F 2J7NA 2P5TA 3AV0A 3GLHE 1KYIA 3I51A 3M6AA 1PJJA 4JI4M 1IY0A 1ORYB 2Z4RA 3HY5A 3U6SA 4X64M 1KFVA 3KXEC 4GEWA 3T1HM 1BVSA 3HU1A 1IN4A 3TL4X 3ZH9B 2L7IA 2E5LM 2ERCA 3BBZA 2ZANA 5FTKA 2QP9X 3VDPA 3RGPA 4AKIA 4Y28F 3I4VA 1YUBA 1N75A 3GPXA 4P17A 1N36M 2OO9A 2HCBA 4AI6A 2WZJA 2AHMA 4PDIA 1ZMVA 3U5ZA 1JR3E 1QDTA 3AJIB 2F5NA 2ZM6M 3GPYA 2BWBA 4I8OA 2ZAMA 2UXCM 2KHHA 4HL4A 1IY2A 2FOIC 4WP2A 1VEJA 2KRUA 4IBIA 5E26A 4OVZB 4B7HA 4NSOB 3FUTA 5EXPA 4LF6M 5IT9S 2B3TA 4I4LA 4JI6M 1MX0A 4I5SA 3JR4A 3RE8A 2G3QA 2CEAA 2YQZA 5ITYA 5FTNA 4B08A 1DGHB 1NNUC 2XH9A 1NVMA 3GRUA 3WHKA 2FE8A 3RFWA 4DR2M 2RRUA 4TUWA 2UXBM 2OOBA 3LW5F 1IXSA 4FCVA 1DO0A 3GRYA 3HGIA 3SAVA 2FFJA 1QANA 1N34M 1TH3A 2BNKA 4GRIA 5DYIA 5JI3E 2VDBB 2WSEF 3KVWA 3LMMA 3B7NA 4NL4H 4HLQA 3VDUA 2DAEA 1L2BA 1QAMA 1IM2A 3VKHA 2RGOA 1DGBA 4JI7M 1GL6A 3B9PA 3C58A 1EFUB 2DAIA 2I7PA 1N32M 2LVNC 1OIPA 3C3EA 1XHBA 4LJ6A 2JA2A 3GP1A 1J09A 1SG9A 2JUJA 2Y0QA 3GLHB 1TF0B 3I01M 3KOXE 4II7A 4LGYA 4LJ9A 4BB9A 4K0KM 1F4IA 4AKHA 2H1RA 4X66M 4ZPXA 3VK7A 3LQRA 2MH8A 4IBCA 2XFTA 2GQFA 3CGWA 2L09A 2K47A 2X8AA 1Q39A 2VIIA 2EJSA 1VG5A 1ZV1A 2HL7A 4FWDA 3FTFA 4LRSA 3AFHA 1QZEA 3AOEA 3LQQA 1IN8A 1HJPA 4FCWA 1IQPA 3GLIE 2R18A 2CHQA 3L29A 2HKJA 1D2NA 4FCTA 2HHHM 3GRRA 4B7GA 1VDDA 3SHFA 2L7HA 2XSZA 3HZJA 3GPPA 1C7YA 1G41A 4D80A 4JI0M 1J5EM 5FSWA 2EO2A 3PXGA 3KS4A 2QNJA 2KXEA 4DR7M 3PFIA 4FWHA 4S12A 7CATA 2GNOA 1L1ZA 2Z7JA 3SAUA 3LVWA 1WIVA 3QAUA 1SXJC 3BOSA 1AIPC 1EE8A 3UZUA 4DV4M 3W67A 1QAOA 3GLFB 2R65A 3U6LA 2F5QA 4IIWA 4LGMA 1R6BX 1SXJE 2K9DA 3E9SA 4LCBA 4X65M 4IBBA 3TPZA 1HR0M 2QQ8A 1OJLA 3HJSA 4IJFA 5KQ8A 1TR8A 3U6PA 1SXJD 2A5YB 1Z59A 2FS1A 4NXNM 4WURA 2JY5A 1ZQ9A 3D8BA 2ZAOA 3L25A 1JR3A 4L4UA 4KHPM 2DAKA 2R45A 2YR0A 3LCUA 2JY8A 1E32A 3NBXX 2L6OA 3CF6E 1IY1A 4M0WA 3VLFB 4QHSA 4AZFA 1IBMM 4B3MM 2CUZA 3W68A 1OAOC 3E46A 4CIZA 4MH0E 2YNMD 4MGZE 3A42A 3B89A 3KP1E 1H6UA 1GO5A 1HNZM 4AKGA 4LRTA 1K3XA 3J7BA 4JN6A 3CF0A 3SC3A 3KS8A 4M9XA 4MGYE 3A46A 3U6OA 2QPAA 2R62A 1Q02A 3HJ8A 1GVNA 4L78A 3ZQJA 3GQ5A 4GHAA 2WSCF 4DV2M 1QQWA 1L1TA 4JYAM 5KPTA 4DV6M 1YLAA 1GKIA 4LFBM 3B74A 4L16A 1NHWC 2R4JA 1TH4A 2CV2A 4MGHA 4JI8M 2KEBA 5F3WA 1N33M 3GQ4A 3GLGB 2LH0A 2F5OA 3C3DA 3VK8A 5IREB 1DGHA 1ZMUA 4IBJA 2BJVA 2C98A 2CRUA 2RKOA 4PD2A 2EKFA 2Q2EB 5JI2E 4GC9A 5A2QS 2O25A 1R4GA 2G5GX 4JI2M 1DGFA 2H5XA 2DHRA 4FD2A 4KT0F 2HAKA 2M60A 3MK6A 1WGLA 3A98B 1G4AE 2LVQD 1Q3CA 1XXHE 2J7OA 3GPUA 4IBFA 3W0LB 4LY6A 4LFAM 1P3QQ 4LJ4A 2MJ5B 4DUZM 1IN5A 4I81A 2KDLA 5DYGA 3UJNA 3FRIA 5IWAM
chains in the Genus database with same CATH topology
1WGNA 1T43A 2DNAA 4G3OA 1VQ1A 2DAGA 2K0BX 1WHCA 3FRHA 3IECA 3H4JA 2L4FA 2CWBA 1MN3A 3F92A 2CP8A 2L4EA 2EJSA 1HQYE 1VG5A 1OAIA 1ZV1A 2QSFX 2DKLA 1QZEA 2R0IA 2HWJA 4HEOA 1V92A 1HJPA 1IFYA 2LVOC 3GLIE 2DHYA 1VDLA 1C7YA 4F2LA 3GLFE 1G41A 1DV0A 2LTUA 2L2DA 2MGWA 2QNJA 3IHPA 2MROB 3K9OA 1NV8A 2QHOB 2KNZA 1WIVA 4F1IA 2BWEA 1A5TA 1AIPC 1HT1E 1DO2A 3GLHE 2KNAA 1KYIA 2K9DA 2JNHA 1ZMWA 2JY7A 2ZTCA 1TR8A 4GEWA 1BVSA 2JY5A 3BBZA 4UN2B 2DI0A 1T6OA 2DAKA 2KNVA 1PGYA 1TTEA 2JY8A 3LCUA 2ZTDA 2OO9A 3K9PA 2EKKA 3MMPA 2WZJA 3E46A 4R71A 1ZMVA 1JR3E 3B89A 2DZLA 1GO5A 2BWBA 4DBGB 1OTRA 1XB2B 2KHHA 3E21A 2DAMA 4WP2A 1VEJA 1Q02A 3LCVB 2LBCA 1YLAA 2JZ1A 2B3TA 2DENA 2G3QA 1G3IA 5DFLA 1E94E 1OKSA 2RRUA 1ZMUA 2OOBA 1WR1B 2EKFA 5JI2E 1OQYA 1WJ7A 2JY6B 1IXSA 1DO0A 2O25A 1CUKA 1R4GA 1Y8GA 2H5XA 2LVPC 3T6PA 2HAKA 3FE3A 2OOAA 1WGLA 1G4AE 2LVQD 1XXHE 2DAEA 1UFZA 1IM2A 2JP7A 2JZ0A 1EFUB 2DAIA 1P3QQ 2LVNC 2MJ5B 1VEKA 1NV9A 2MR9A 2LVAA 1HT2E 1VEGA 1SG9A 2JUJA 4Q7JA 1F4IA 3GLGE 3FRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGN A;  1T43 A;  2DNA A;  4G3O A;  1VQ1 A;  2DAG A;  2K0B X;  1WHC A;  3FRH A;  3IEC A;  3H4J A;  2L4F A;  2CWB A;  1MN3 A;  3F92 A;  2CP8 A;  2L4E A;  2EJS A;  1HQY E;  1VG5 A;  1OAI A;  1ZV1 A;  2QSF X;  2DKL A;  1QZE A;  2R0I A;  2HWJ A;  4HEO A;  1V92 A;  1HJP A;  1IFY A;  2LVO C;  3GLI E;  2DHY A;  1VDL A;  1C7Y A;  4F2L A;  3GLF E;  1G41 A;  1DV0 A;  2LTU A;  2L2D A;  2MGW A;  2QNJ A;  3IHP A;  2MRO B;  3K9O A;  1NV8 A;  2QHO B;  2KNZ A;  1WIV A;  4F1I A;  2BWE A;  1A5T A;  1AIP C;  1HT1 E;  1DO2 A;  3GLH E;  2KNA A;  1KYI A;  2K9D A;  2JNH A;  1ZMW A;  2JY7 A;  2ZTC A;  1TR8 A;  4GEW A;  1BVS A;  2JY5 A;  3BBZ A;  4UN2 B;  2DI0 A;  1T6O A;  2DAK A;  2KNV A;  1PGY A;  1TTE A;  2JY8 A;  3LCU A;  2ZTD A;  2OO9 A;  3K9P A;  2EKK A;  3MMP A;  2WZJ A;  3E46 A;  4R71 A;  1ZMV A;  1JR3 E;  3B89 A;  2DZL A;  1GO5 A;  2BWB A;  4DBG B;  1OTR A;  1XB2 B;  2KHH A;  3E21 A;  2DAM A;  4WP2 A;  1VEJ A;  1Q02 A;  3LCV B;  2LBC A;  1YLA A;  2JZ1 A;  2B3T A;  2DEN A;  2G3Q A;  1G3I A;  5DFL A;  1E94 E;  1OKS A;  2RRU A;  1ZMU A;  2OOB A;  1WR1 B;  2EKF A;  5JI2 E;  1OQY A;  1WJ7 A;  2JY6 B;  1IXS A;  1DO0 A;  2O25 A;  1CUK A;  1R4G A;  1Y8G A;  2H5X A;  2LVP C;  3T6P A;  2HAK A;  3FE3 A;  2OOA A;  1WGL A;  1G4A E;  2LVQ D;  1XXH E;  2DAE A;  1UFZ A;  1IM2 A;  2JP7 A;  2JZ0 A;  1EFU B;  2DAI A;  1P3Q Q;  2LVN C;  2MJ5 B;  1VEK A;  1NV9 A;  2MR9 A;  2LVA A;  1HT2 E;  1VEG A;  1SG9 A;  2JUJ A;  4Q7J A;  1F4I A;  3GLG E;  3FRI A; 
#chains in the Genus database with same CATH topology
 2DNA A;  3GLH A;  4GKJ M;  1K3W A;  2VQE M;  4JXJ A;  2VQF M;  3FRH A;  3FTD A;  5EP4 A;  4PDG A;  1XMQ M;  2L4F A;  5EP2 A;  2CWB A;  1MN3 A;  3F92 A;  2L4E A;  5FTL A;  3GRV A;  1UM8 A;  1LTM A;  4IJE A;  2R46 A;  1YE9 A;  2DZN B;  2FNA A;  4B3S M;  1OAI A;  3JAM S;  1PJI A;  2Y0T A;  4X62 M;  2QSF X;  1G8P A;  2CHG A;  3U61 A;  2HWJ A;  5FTM A;  4L6V 6;  4D82 A;  4LF5 M;  1V92 A;  3OTO M;  1XNR M;  3QYE A;  2D7H A;  2LVO C;  1IFY A;  1KSF X;  2WSF F;  2XLJ A;  3C9P A;  4NXM M;  1GAB A;  5EQT A;  3SYK A;  3U60 B;  4Z6Y A;  4F2L A;  4YHH M;  1FNN A;  1K82 A;  3EIH A;  4DV3 M;  3D8L A;  3A45 A;  2C99 A;  1OFI A;  1Z5A A;  4IBE A;  2C96 A;  2XZU A;  3CF2 A;  4M9S A;  3E4R A;  2MRO B;  3IHP A;  3WHL A;  2QBY A;  3K9O A;  2DWL A;  1QDR A;  3SAS A;  3FTC A;  4YY3 M;  5FLX S;  4G6Z A;  4OW0 A;  2VF8 A;  3KDS E;  3T1Y M;  1MU5 A;  1A5T A;  1HT1 E;  5EJC A;  4BBA A;  3HU3 A;  2Z8Y M;  2C9C A;  3MJ5 A;  4DUY M;  1I4W A;  2Y20 A;  3SHG B;  4MM3 B;  4DV0 M;  1PJT A;  4NRW A;  4GIP A;  3BXW A;  4IBD A;  4LG2 A;  1XMO M;  4MB7 A;  2Y21 A;  1JB0 F;  2RGH A;  1T6O A;  3HHY A;  4FVM A;  2UUB M;  1EIJ A;  1IXR C;  2LWX A;  3K9P A;  3MMP A;  4NRV A;  3KFU G;  3EIE A;  4B7F A;  1R2Y A;  1QVR A;  1SXJ B;  3TWM A;  4G4N A;  4LFC M;  3J27 B;  4GKK M;  3E21 A;  3LVV A;  4EIW A;  3U5Z B;  2DAM A;  4W5W A;  1R7R A;  1IXZ A;  4LJA A;  2CE7 A;  2DWM A;  3FUV A;  3IG5 A;  5EXT A;  5ITT A;  1JQJ C;  1LV7 A;  3QWL A;  1XXH B;  3Q8G A;  2XGN A;  3U6Q A;  5DFL A;  1G3I A;  3U6E A;  3SAR A;  4AG5 A;  2D7G A;  1E94 E;  1TDH A;  4XGI A;  5C1B A;  2X4A A;  4RF1 A;  1JR3 D;  1WR1 B;  5EP1 A;  1WJ7 A;  2QEN A;  4NSR A;  3AL0 C;  4REZ A;  2K6B A;  3GLI B;  3QYB A;  3SMP A;  1G59 A;  3DZD A;  1WXQ A;  2APL A;  2LVP C;  3T6P A;  4BLC A;  5LMN M;  3U61 B;  2CHV A;  3FE3 A;  3HHZ A;  2OOA A;  5E6J A;  1FJG M;  1OFH A;  1Z6T A;  3HHX A;  3TWL A;  4DV5 M;  2F5S A;  5KQD A;  3KSJ A;  1UFZ A;  1XWI A;  4IBK A;  3FYD A;  2CV0 A;  4Z8X A;  2R44 A;  2FH0 A;  3KP0 E;  2JZ0 A;  3MHV C;  2W82 A;  2MR9 A;  1NV9 A;  2LVA A;  5ITX A;  1GL7 A;  2LHG A;  1V34 A;  3CTW B;  3KW6 A;  3NWL A;  2J5Y A;  3PNY A;  3PNV A;  4R3D A;  3GLG E;  1XC8 A;  1S3S A;  3GQ3 A;  4GHL A;  1N77 A;  1IN7 A;  1T43 A;  1WGN A;  2R4E A;  5ITQ A;  2NQ8 C;  1HQC A;  1VQ1 A;  2DAG A;  2K0B X;  2KZS A;  1T3T A;  4DV1 M;  3R8F A;  4B3T M;  4OX9 M;  3H4J A;  4QOS A;  2XZF A;  1GJS A;  3T38 A;  3DFZ A;  3HKP A;  2Z3X A;  1HQY E;  3AOG A;  1TH2 A;  3SAT A;  4CJ6 A;  1G71 A;  3PVS A;  1QZM A;  1TGU A;  1Z5C A;  2DZO B;  3UGJ A;  5BR8 M;  2DKL A;  2JXN A;  4OU7 A;  2R0I A;  1SXJ A;  4HEO A;  1W5T A;  3SBJ A;  3GLF A;  3J80 S;  3L2A A;  1QUT A;  1VDL A;  1W5S A;  3M7G A;  1R5L A;  2DWZ B;  3KSX A;  4NOO B;  2C5R A;  4DR6 M;  3GLF E;  3IG8 A;  2UU9 M;  1DV0 A;  3M0E A;  3AOE C;  1PM5 A;  2MGW A;  2LHC A;  3VFD A;  1NNJ A;  2F4V M;  1XXH A;  1QYR A;  2LXE A;  4CGY B;  4JI1 M;  4RF0 A;  3K8Z A;  2D7E A;  2EUC A;  1R2Z A;  3R9X B;  1NV8 A;  4PT5 A;  2KNZ A;  4WW0 A;  5C18 A;  1L2D A;  2JWS A;  2BWE A;  1IXS B;  1QAQ A;  2XF3 A;  4LZJ A;  1HNX M;  3KOZ E;  2V1C A;  2VF7 A;  4LJ5 A;  3ILK A;  1DO2 A;  2G8L A;  2M5Z A;  3I4Y A;  1AUA A;  3Q8X A;  4GMQ A;  3GLI A;  2KNA A;  5DNY A;  4DV7 M;  8CAT A;  3RGS A;  1I94 M;  5KPZ A;  1HNW M;  5KPR A;  1GLN A;  4AW4 A;  2OQ4 A;  2JNH A;  1ZMW A;  1NJF A;  2JY7 A;  2ZTC A;  3SAW A;  4D81 A;  1OIZ A;  2QZ4 A;  3DA1 A;  4UN2 B;  2DI0 A;  1NJG A;  2KNV A;  1PGY A;  1TTE A;  4LJ8 A;  4RKU F;  4FWG A;  2C9O A;  2ZTD A;  3U60 A;  4KOD A;  2EKK A;  3K1J A;  1L8Q A;  3HJQ A;  4R71 A;  1NY5 A;  3K2L A;  4JV5 M;  2DZL A;  3FD9 A;  3KOW E;  3UK6 A;  1XNQ M;  2OPF A;  4DBG B;  4MGI E;  1RU3 A;  3SFZ A;  4QNR A;  1OTR A;  1XB2 B;  3DOA A;  4DR4 M;  4DR1 M;  3HX3 A;  5KO3 A;  3LCV B;  1NSF A;  1V33 A;  4MGK E;  1IBL M;  1E9R A;  3KOY E;  3L28 A;  2F5P A;  2LBC A;  4CHT B;  3J7A S;  3U6D A;  2JZ1 A;  3SMS A;  3K92 A;  2DEN A;  5ITX E;  1ZAE A;  4M9Z A;  4PCZ A;  2DVW B;  2CV1 A;  2EA0 A;  2V6Z M;  1OKS A;  1C1K A;  3THG A;  2YFQ A;  5FTJ A;  2R6F A;  3W0F A;  2ZBK B;  4G4O A;  3JR5 A;  1OQY A;  2JY6 B;  1Q3B A;  5EXS A;  1CUK A;  3FUU A;  1Y8G A;  3FYC A;  1D0M A;  1QUS A;  1NY6 A;  4XBO A;  5ITR A;  2KZU A;  2XEP A;  4CIS A;  2KRK A;  1D0K A;  3TQS A;  4B3R M;  2JP7 A;  3B7Z A;  3I04 M;  4GIT A;  2XFS A;  1X37 A;  4QNM A;  5ITU A;  1VEK A;  4OVZ A;  3HU2 A;  4Q7J A;  1HT2 E;  1VEG A;  5IZ7 D;  4LF8 M;  4GH9 A;  4P16 A;  4L15 A;  3GLG A;  4KLN A;  2QCU A;  2DWN A;  2Z4S A;  3HWS A;  3B7Q A;  1Z5B A;  3HHW A;  4G3O A;  4NC6 A;  4RNA A;  5LMU M;  4LF9 M;  1WHC A;  2BJW A;  5BPV A;  3L27 A;  3IEC A;  5GKN A;  4AQY M;  2O5R A;  4XK8 F;  5EP3 A;  1E9S A;  3AKZ A;  4LZZ A;  1IN6 A;  2CP8 A;  4ANR A;  2V1U A;  4LF4 M;  4QOZ C;  3L26 A;  3FUX A;  1DGG A;  1NHG C;  3V76 A;  4FW9 A;  4DR5 M;  3UMM A;  4G4R A;  2LNH C;  1L2C A;  4LJ7 A;  2KW0 A;  4DR3 M;  4LF7 M;  2KA6 B;  3TWK A;  4G4Q A;  1TDZ A;  4R7G A;  1IBK M;  5L8R F;  1YSY A;  4ITQ A;  2DHY A;  2DXI A;  4KO8 A;  3TE6 A;  3SYL A;  2X49 A;  4GC5 A;  3U6C A;  4AG6 A;  5EXX A;  3FKE A;  1MJG M;  4JI5 M;  3J81 S;  1N78 A;  2LTU A;  2QBY B;  2UUC M;  2L2D A;  4QHT A;  2UXD M;  3FTE A;  2I7N A;  1PJQ A;  5H37 D;  3U6M A;  3NBI A;  3H4M A;  2XSZ D;  4M0D A;  1PJS A;  3T15 A;  3ZC7 B;  2UUA M;  1GJT A;  2QHO B;  3J2P B;  1NO1 A;  4F1I A;  4IBG A;  4JI3 M;  3ZCB B;  1J7K A;  1D0L A;  1PRB A;  2N35 A;  4L8R C;  3FUW A;  3VKG A;  2CFO A;  4A3V B;  3GO8 A;  2O01 F;  2J7N A;  2P5T A;  3AV0 A;  3GLH E;  1KYI A;  3I51 A;  3M6A A;  1PJJ A;  4JI4 M;  1IY0 A;  1ORY B;  2Z4R A;  3HY5 A;  3U6S A;  4X64 M;  1KFV A;  3KXE C;  4GEW A;  3T1H M;  1BVS A;  3HU1 A;  1IN4 A;  3TL4 X;  3ZH9 B;  2L7I A;  2E5L M;  2ERC A;  3BBZ A;  2ZAN A;  5FTK A;  2QP9 X;  3VDP A;  3RGP A;  4AKI A;  4Y28 F;  3I4V A;  1YUB A;  1N75 A;  3GPX A;  4P17 A;  1N36 M;  2OO9 A;  2HCB A;  4AI6 A;  2WZJ A;  2AHM A;  4PDI A;  1ZMV A;  3U5Z A;  1JR3 E;  1QDT A;  3AJI B;  2F5N A;  2ZM6 M;  3GPY A;  2BWB A;  4I8O A;  2ZAM A;  2UXC M;  2KHH A;  4HL4 A;  1IY2 A;  2FOI C;  4WP2 A;  1VEJ A;  2KRU A;  4IBI A;  5E26 A;  4OVZ B;  4B7H A;  4NSO B;  3FUT A;  5EXP A;  4LF6 M;  5IT9 S;  2B3T A;  4I4L A;  4JI6 M;  1MX0 A;  4I5S A;  3JR4 A;  3RE8 A;  2G3Q A;  2CEA A;  2YQZ A;  5ITY A;  5FTN A;  4B08 A;  1DGH B;  1NNU C;  2XH9 A;  1NVM A;  3GRU A;  3WHK A;  2FE8 A;  3RFW A;  4DR2 M;  2RRU A;  4TUW A;  2UXB M;  2OOB A;  3LW5 F;  1IXS A;  4FCV A;  1DO0 A;  3GRY A;  3HGI A;  3SAV A;  2FFJ A;  1QAN A;  1N34 M;  1TH3 A;  2BNK A;  4GRI A;  5DYI A;  5JI3 E;  2VDB B;  2WSE F;  3KVW A;  3LMM A;  3B7N A;  4NL4 H;  4HLQ A;  3VDU A;  2DAE A;  1L2B A;  1QAM A;  1IM2 A;  3VKH A;  2RGO A;  1DGB A;  4JI7 M;  1GL6 A;  3B9P A;  3C58 A;  1EFU B;  2DAI A;  2I7P A;  1N32 M;  2LVN C;  1OIP A;  3C3E A;  1XHB A;  4LJ6 A;  2JA2 A;  3GP1 A;  1J09 A;  1SG9 A;  2JUJ A;  2Y0Q A;  3GLH B;  1TF0 B;  3I01 M;  3KOX E;  4II7 A;  4LGY A;  4LJ9 A;  4BB9 A;  4K0K M;  1F4I A;  4AKH A;  2H1R A;  4X66 M;  4ZPX A;  3VK7 A;  3LQR A;  2MH8 A;  4IBC A;  2XFT A;  2GQF A;  3CGW A;  2L09 A;  2K47 A;  2X8A A;  1Q39 A;  2VII A;  2EJS A;  1VG5 A;  1ZV1 A;  2HL7 A;  4FWD A;  3FTF A;  4LRS A;  3AFH A;  1QZE A;  3AOE A;  3LQQ A;  1IN8 A;  1HJP A;  4FCW A;  1IQP A;  3GLI E;  2R18 A;  2CHQ A;  3L29 A;  2HKJ A;  1D2N A;  4FCT A;  2HHH M;  3GRR A;  4B7G A;  1VDD A;  3SHF A;  2L7H A;  2XSZ A;  3HZJ A;  3GPP A;  1C7Y A;  1G41 A;  4D80 A;  4JI0 M;  1J5E M;  5FSW A;  2EO2 A;  3PXG A;  3KS4 A;  2QNJ A;  2KXE A;  4DR7 M;  3PFI A;  4FWH A;  4S12 A;  7CAT A;  2GNO A;  1L1Z A;  2Z7J A;  3SAU A;  3LVW A;  1WIV A;  3QAU A;  1SXJ C;  3BOS A;  1AIP C;  1EE8 A;  3UZU A;  4DV4 M;  3W67 A;  1QAO A;  3GLF B;  2R65 A;  3U6L A;  2F5Q A;  4IIW A;  4LGM A;  1R6B X;  1SXJ E;  2K9D A;  3E9S A;  4LCB A;  4X65 M;  4IBB A;  3TPZ A;  1HR0 M;  2QQ8 A;  1OJL A;  3HJS A;  4IJF A;  5KQ8 A;  1TR8 A;  3U6P A;  1SXJ D;  2A5Y B;  1Z59 A;  2FS1 A;  4NXN M;  4WUR A;  2JY5 A;  1ZQ9 A;  3D8B A;  2ZAO A;  3L25 A;  1JR3 A;  4L4U A;  4KHP M;  2DAK A;  2R45 A;  2YR0 A;  3LCU A;  2JY8 A;  1E32 A;  3NBX X;  2L6O A;  3CF6 E;  1IY1 A;  4M0W A;  3VLF B;  4QHS A;  4AZF A;  1IBM M;  4B3M M;  2CUZ A;  3W68 A;  1OAO C;  3E46 A;  4CIZ A;  4MH0 E;  2YNM D;  4MGZ E;  3A42 A;  3B89 A;  3KP1 E;  1H6U A;  1GO5 A;  1HNZ M;  4AKG A;  4LRT A;  1K3X A;  3J7B A;  4JN6 A;  3CF0 A;  3SC3 A;  3KS8 A;  4M9X A;  4MGY E;  3A46 A;  3U6O A;  2QPA A;  2R62 A;  1Q02 A;  3HJ8 A;  1GVN A;  4L78 A;  3ZQJ A;  3GQ5 A;  4GHA A;  2WSC F;  4DV2 M;  1QQW A;  1L1T A;  4JYA M;  5KPT A;  4DV6 M;  1YLA A;  1GKI A;  4LFB M;  3B74 A;  4L16 A;  1NHW C;  2R4J A;  1TH4 A;  2CV2 A;  4MGH A;  4JI8 M;  2KEB A;  5F3W A;  1N33 M;  3GQ4 A;  3GLG B;  2LH0 A;  2F5O A;  3C3D A;  3VK8 A;  5IRE B;  1DGH A;  1ZMU A;  4IBJ A;  2BJV A;  2C98 A;  2CRU A;  2RKO A;  4PD2 A;  2EKF A;  2Q2E B;  5JI2 E;  4GC9 A;  5A2Q S;  2O25 A;  1R4G A;  2G5G X;  4JI2 M;  1DGF A;  2H5X A;  2DHR A;  4FD2 A;  4KT0 F;  2HAK A;  2M60 A;  3MK6 A;  1WGL A;  3A98 B;  1G4A E;  2LVQ D;  1Q3C A;  1XXH E;  2J7O A;  3GPU A;  4IBF A;  3W0L B;  4LY6 A;  4LFA M;  1P3Q Q;  4LJ4 A;  2MJ5 B;  4DUZ M;  1IN5 A;  4I81 A;  2KDL A;  5DYG A;  3UJN A;  3FRI A;  5IWA M; 
#chains in the Genus database with same CATH homology
 1WGN A;  1T43 A;  2DNA A;  4G3O A;  1VQ1 A;  2DAG A;  2K0B X;  1WHC A;  3FRH A;  3IEC A;  3H4J A;  2L4F A;  2CWB A;  1MN3 A;  3F92 A;  2CP8 A;  2L4E A;  2EJS A;  1HQY E;  1VG5 A;  1OAI A;  1ZV1 A;  2QSF X;  2DKL A;  1QZE A;  2R0I A;  2HWJ A;  4HEO A;  1V92 A;  1HJP A;  1IFY A;  2LVO C;  3GLI E;  2DHY A;  1VDL A;  1C7Y A;  4F2L A;  3GLF E;  1G41 A;  1DV0 A;  2LTU A;  2L2D A;  2MGW A;  2QNJ A;  3IHP A;  2MRO B;  3K9O A;  1NV8 A;  2QHO B;  2KNZ A;  1WIV A;  4F1I A;  2BWE A;  1A5T A;  1AIP C;  1HT1 E;  1DO2 A;  3GLH E;  2KNA A;  1KYI A;  2K9D A;  2JNH A;  1ZMW A;  2JY7 A;  2ZTC A;  1TR8 A;  4GEW A;  1BVS A;  2JY5 A;  3BBZ A;  4UN2 B;  2DI0 A;  1T6O A;  2DAK A;  2KNV A;  1PGY A;  1TTE A;  2JY8 A;  3LCU A;  2ZTD A;  2OO9 A;  3K9P A;  2EKK A;  3MMP A;  2WZJ A;  3E46 A;  4R71 A;  1ZMV A;  1JR3 E;  3B89 A;  2DZL A;  1GO5 A;  2BWB A;  4DBG B;  1OTR A;  1XB2 B;  2KHH A;  3E21 A;  2DAM A;  4WP2 A;  1VEJ A;  1Q02 A;  3LCV B;  2LBC A;  1YLA A;  2JZ1 A;  2B3T A;  2DEN A;  2G3Q A;  1G3I A;  5DFL A;  1E94 E;  1OKS A;  2RRU A;  1ZMU A;  2OOB A;  1WR1 B;  2EKF A;  5JI2 E;  1OQY A;  1WJ7 A;  2JY6 B;  1IXS A;  1DO0 A;  2O25 A;  1CUK A;  1R4G A;  1Y8G A;  2H5X A;  2LVP C;  3T6P A;  2HAK A;  3FE3 A;  2OOA A;  1WGL A;  1G4A E;  2LVQ D;  1XXH E;  2DAE A;  1UFZ A;  1IM2 A;  2JP7 A;  2JZ0 A;  1EFU B;  2DAI A;  1P3Q Q;  2LVN C;  2MJ5 B;  1VEK A;  1NV9 A;  2MR9 A;  2LVA A;  1HT2 E;  1VEG A;  1SG9 A;  2JUJ A;  4Q7J A;  1F4I A;  3GLG E;  3FRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...