1VEGA

Solution structure of rsgi ruh-012, a uba domain from mouse cdna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
83
structure length
83
Chain Sequence
GSSGSSGNPHMWWLQDADPENNSRQASPSQESINQLVYMGFDTVVAEAALRVFGGNVQLAAQTLAHHGGSLPPDLQFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords NEDD8 ultimate buster-1
publication title Solution Structure of RSGI RUH-012, a UBA Domain from Mouse cDNA
rcsb
source organism Mus musculus
total genus 10
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vegA01
1CUKA 1ZMVA 2JUJA 2MGWA 3H4JA 2LVPC 3BBZA 5DFLA 2DI0A 2L4FA 1HJPA 1OTRA 4DBGB 1VEKA 1WGNA 2L4EA 1EFUB 2LVQD 2OOAA 2HAKA 1MN3A 1XXHE 2JNHA 1WIVA 2DAIA 1G3IA 3E46A 3K9PA 1NV9A 1AIPC 2H5XA 1Q02A 1WHCA 2R0IA 1WGLA 3GLIE 2DAKA 1R4GA 1SG9A 2LVAA 1Y8GA 2JZ0A 1T43A 3B89A 3FRHA 3FRIA 2EKKA 2L2DA 1BVSA 1VQ1A 2MR9A 3F92A 4R71A 1TTEA 1KYIA 2DHYA 1ZMWA 2EJSA 1HT1E 3MMPA 2DAEA 2MJ5B 3IECA 2HWJA 2JY6B 2DENA 3FE3A 3LCUA 1WR1B 1G41A 1JR3E 2MROB 2KNZA 2JY8A 1C7YA 1YLAA 2JZ1A 2DNAA 1G4AE 1DV0A 2JY7A 1VEGA 2JY5A 2WZJA 5JI2E 3GLFE 2LVOC 1TR8A 4HEOA 3GLGE 4G3OA 3T6PA 2K0BX 1UFZA 1F4IA 1NV8A 2DAGA 4WP2A 2OOBA 1ZV1A 2BWBA 2DAMA 2OO9A 1VG5A 4GEWA 2QSFX 3GLHE 2CWBA 3LCVB 2KNVA 1A5TA 1HT2E 2LBCA 2DZLA 3E21A 1V92A 1IFYA 1VDLA 1WJ7A 1ZMUA 1QZEA 1OAIA 2LVNC 1DO0A 1OKSA 2ZTDA 2DKLA 2B3TA 1T6OA 2G3QA 2O25A 1E94E 3IHPA 1HQYE 3K9OA 2EKFA 2LTUA 1DO2A 4Q7JA 4F2LA 2BWEA 1VEJA 2QHOB 1OQYA 1PGYA 1IM2A 2KHHA 2ZTCA 2K9DA 1P3QQ 1XB2B 1GO5A 2JP7A 2RRUA 4UN2B 2QNJA 1IXSA 4F1IA 2CP8A 2KNAA
chains in the Genus database with same CATH superfamily
3GLFE 2FOIC 2UU9M 1Z5AA 4M0DA 4JI4M 3H4JA 3GLFA 2CHVA 1QUSA 3KS4A 3RGSA 4JI8M 4GIPA 1OTRA 1N34M 2H1RA 1PJQA 3KOWE 1E32A 2L4EA 4QHSA 2LVQD 2OOAA 3AV0A 4LF5M 1G71A 2QPAA 3U6PA 4NC6A 3U6DA 3U5ZB 3UJNA 3SASA 3E46A 4MGYE 1AIPC 3DA1A 1I4WA 4IBGA 1PM5A 3GLIE 2ZBKB 3A98B 2EUCA 2FFJA 4W5WA 5ITXA 1E9RA 2BJWA 3GLFB 1N32M 2JZ0A 4GKKM 4AKIA 3OTOM 4KT0F 2EKKA 3WHKA 2Z3XA 3CF0A 1J09A 1V34A 4P17A 4GMQA 1VQ1A 4LRTA 4GITA 2ZANA 3SAVA 5IZ7D 2DHYA 3HY5A 4FCVA 4L4UA 2QCUA 3U6EA 2HWJA 2G8LA 3KS8A 2L7HA 4LZJA 3VDUA 3KSXA 3T38A 2XZUA 2QZ4A 3FE3A 4RNAA 4PCZA 1E9SA 1WR1B 4JI5M 2UXBM 1NSFA 2N35A 2CHQA 3QYBA 4FD2A 4WW0A 3SYLA 1TDZA 2YQZA 3T15A 1JQJC 1IY2A 3T1HM 4LJ6A 2BNKA 3WHLA 4ZPXA 3LVVA 1J7KA 1Q3BA 1Q39A 1VEGA 2WZJA 3K8ZA 2LVOC 3M6AA 1TR8A 4IBFA 4JI3M 1EE8A 3U6LA 2W82A 4IBIA 4G3OA 3T6PA 2VDBB 1G59A 2K0BX 2C99A 4XGIA 4L78A 2J7OA 2DAGA 5EP3A 4WP2A 3RGPA 3SC3A 8CATA 1ZV1A 1DGFA 4G6ZA 3SHGB 3J80S 5ITRA 1WXQA 5KPTA 3FUVA 3VK8A 4KHPM 2DAMA 4OX9M 2OO9A 4GC9A 1XNRM 2QSFX 2Y0TA 2CWBA 1QDTA 2ZAMA 3I4YA 3LCVB 1R2YA 3PVSA 4AG6A 2UUCM 3FKEA 2LBCA 1YUBA 3LVWA 1R5LA 4IJFA 2R18A 4II7A 2LH0A 5EXPA 3TE6A 5H37D 4DUYM 2KDLA 2XF3A 5ITXE 2C96A 3HJSA 2HHHM 1L1TA 1TDHA 4DV5M 4GKJM 3GPXA 4CJ6A 3UZUA 1PRBA 1QZEA 2KW0A 3U60A 1T6OA 2G3QA 3THGA 4D80A 1TF0B 3B7ZA 4DUZM 2VF7A 4F2LA 4AQYM 3UGJA 3HZJA 3VFDA 1PGYA 2J5YA 3IG5A 3HU2A 5KPZA 3GPPA 1NHGC 3RE8A 2VQFM 4MM3B 2E5LM 1P3QQ 3NWLA 4UN2B 3U6CA 4OVZA 5KO3A 4X66M 3SBJA 2NQ8C 2XSZD 2FS1A 4L6V6 5EP2A 3J81S 2QP9X 3U60B 2X49A 4LF4M 1R6BX 2O01F 3CGWA 1VDDA 3FYDA 3GO8A 2LVPC 3FD9A 3BBZA 4CISA 1Z59A 5DFLA 4ITQA 2L4FA 2R4JA 3QAUA 3BXWA 4DBGB 1VEKA 1NJFA 3KP1E 4B7GA 1WGNA 1TH2A 1ZAEA 2O5RA 2DXIA 2WSFF 1D2NA 2UUAM 5FTJA 2F5NA 3FUTA 4B3SM 3KFUG 3UMMA 4OVZB 5A2QS 2JNHA 3GLIB 1L8QA 2DAIA 3FUWA 4LJ4A 4RF0A 5KPRA 1NY5A 3J7AS 5LMNM 2X4AA 3E9SA 4IBDA 1V33A 4B7HA 2R0IA 1HR0M 4S12A 1OAOC 2ZM6M 1QAQA 1L1ZA 1SG9A 4MGKE 4AW4A 2LVAA 4CGYB 1K3WA 1GLNA 1SXJA 3KOZE 3M0EA 4NXMM 1T43A 3I51A 4REZA 4PDGA 4JI6M 3FUXA 1DGHA 2XEPA 5JI3E 1Q3CA 2R65A 1BVSA 3SAUA 2LHCA 2MR9A 3ZCBB 2VIIA 1LTMA 3DZDA 3KOYE 4I8OA 1NVMA 2APLA 4MGZE 1NY6A 2R62A 1MX0A 1IN6A 2C98A 1HT1E 1XHBA 3MMPA 3T1YM 1N33M 4LJ5A 2QQ8A 3UK6A 1MJGM 1QYRA 2DENA 4B3TM 1Z5CA 1L2CA 4GC5A 5FTNA 1YE9A 2MROB 3TWKA 2DVWB 5IWAM 4QOZC 3C9PA 3SATA 3JR4A 4LF9M 2XZFA 2RGOA 3GRUA 1T3TA 1OJLA 1DGHB 3B7QA 3JR5A 1NNUC 3LQRA 4D82A 4QHTA 4AKGA 1DV0A 4LFBM 1N36M 3HKPA 2LXEA 5FSWA 4GRIA 2GQFA 3L25A 3AOEA 1DGBA 3C3EA 3AFHA 2KEBA 5ITTA 2RKOA 2D7EA 4PD2A 3TPZA 4R7GA 4LF8M 5JI2E 4JXJA 4AG5A 5ITQA 3L26A 3FTFA 1GVNA 1IN4A 2X8AA 1KSFX 2HCBA 4GH9A 4R3DA 3W0FA 3DFZA 3E21A 4EIWA 3U61A 4LJAA 2DWMA 4L8RC 2WSCF 1VDLA 2BJVA 4B08A 5GKNA 1WJ7A 1ZMUA 2Q2EB 1SXJE 1W5SA 2R6FA 1OKSA 1IN5A 2B3TA 3CTWB 1OFHA 3SAWA 1QAOA 3ZH9B 2EKFA 2Z7JA 5KQDA 1DO2A 2D7HA 4QNMA 4X62M 2HL7A 4TUWA 3W67A 2XLJA 1J5EM 4BB9A 1IM2A 3MJ5A 3PNYA 2R46A 2ERCA 3ZQJA 4DV6M 2QENA 4DR1M 2DWLA 4GHAA 3SHFA 1XB2B 3KP0E 2KZSA 2JXNA 3U61B 3VK7A 1PJTA 1XMQM 3B74A 1D0LA 1JR3A 1FNNA 4KO8A 1IXSA 4F1IA 3JAMS 4FWGA 5EP1A 2KNAA 4FCWA 2QBYA 2JUJA 4JI1M 4IIWA 2MGWA 1GL6A 2I7NA 3Q8GA 2FNAA 1W5TA 2L7IA 1XNQM 5ITYA 4JV5M 2VQEM 4DR5M 3A46A 2Z4SA 3GP1A 4LRSA 3ILKA 3HJ8A 3L2AA 4RKUF 3GRRA 2HAKA 3RFWA 5C18A 4JI2M 4CIZA 1IBKM 3SMSA 3M7GA 3MHVC 2RGHA 4NL4H 1WIVA 3J2PB 1G3IA 1D0MA 1Z5BA 1IXSB 3K9PA 1OFIA 2H5XA 3VLFB 4G4RA 4DR3M 4DV3M 4LFCM 1QZMA 2XFSA 4KODA 1OIPA 3W0LB 1WGLA 3AJIB 3NBIA 5ITUA 2QBYB 5E6JA 2UXCM 2DAKA 4KLNA 5BR8M 4P16A 2M60A 4I4LA 5EXXA 3HGIA 3HHWA 1N77A 5EJCA 1Y8GA 1FJGM 2R4EA 3B89A 3FRHA 3HHZA 2CRUA 1IBMM 1KFVA 2UXDM 3PFIA 4B7FA 3SFZA 3HX3A 2OQ4A 3KXEC 4FVMA 3J27B 1IXZA 2LNHC 3F92A 4MGIE 1K82A 3I01M 1TTEA 3A45A 1C1KA 4NSRA 4YHHM 2EJSA 3D8LA 1SXJD 2DAEA 3KVWA 2DWZB 4LJ7A 4RF1A 5FTLA 4DV0M 2F5SA 4PT5A 2JY6B 4M9XA 5FTMA 4DV2M 2V1UA 3K1JA 1GABA 1JB0F 4X64M 3U6OA 3VKGA 1JR3E 3HU3A 4MGHA 3K92A 2JY8A 7CATA 1QANA 2CE7A 5EXTA 4DV1M 2DNAA 4OU7A 1G4AE 2EO2A 2JY7A 3SYKA 4IBCA 2JY5A 3R8FA 2Y20A 3EIEA 1IN7A 1GKIA 4HEOA 3DOAA 2XSZA 3GRYA 3SMPA 4DR4M 2Z8YM 4LGMA 4ANRA 1UFZA 4G4NA 1PJSA 4XK8F 1NV8A 3CF6E 3U6SA 1F4IA 2DWNA 4WURA 1XXHA 2A5YB 2BWBA 1NNJA 4NSOB 3L27A 2V6ZM 2L09A 2V1CA 2MH8A 1IN8A 4GEWA 4NRVA 2C9CA 2D7GA 2K6BA 4HLQA 1PJIA 3LQQA 2KNVA 1A5TA 1HT2E 2FH0A 3LMMA 2Y21A 4MH0E 1PJJA 1NO1A 1DGGA 1S3SA 1TH4A 2R45A 1SXJB 3NBXX 5KQ8A 2CEAA 3KOXE 3C3DA 2ZAOA 4LJ9A 4FWHA 1OAIA 2LVNC 4B3MM 3HHXA 5BPVA 2EA0A 4B3RM 3HWSA 2O25A 3IHPA 3AOGA 3KSJA 3TWLA 1N78A 2VF8A 4I5SA 2Y0QA 4IJEA 2LTUA 1XXHB 1VEJA 2QHOB 1HNZM 4IBKA 2F5PA 2LHGA 2ZTCA 3GQ4A 1NHWC 1TGUA 2K9DA 4HL4A 5C1BA 1I94M 3A42A 2XGNA 2YFQA 4DR2M 3GPUA 1QDRA 5EP4A 3QWLA 2CP8A 3FRIA 4LF6M 3ZC7B 3TWMA 1CUKA 1ZMVA 1HQCA 1N75A 3CF2A 4IBJA 2C5RA 2UUBM 4JYAM 4AZFA 1G8PA 4A3VB 2XH9A 2DI0A 1GL7A 3GLGA 1LV7A 1HJPA 1D0KA 4M9SA 1JR3D 3HU1A 4D81A 1X37A 1ZQ9A 4M0WA 3K2LA 1ORYB 1EFUB 3FTDA 3PNVA 3E4RA 3U6MA 2F5QA 2DZOB 1MN3A 1XXHE 2R44A 3GLHA 4DV4M 3BOSA 3QYEA 1GJSA 1XMOM 3L29A 1K3XA 1NV9A 4BBAA 1NJGA 1Q02A 3H4MA 1WHCA 1XWIA 2OPFA 4IBEA 1R4GA 2GNOA 3EIHA 1L2DA 3J7BA 5FLXS 3GLGB 3GQ3A 4QNRA 3GRVA 2M5ZA 3U6QA 2JWSA 1HNXM 2DZNB 2L2DA 3Q8XA 4G4QA 3B9PA 5FTKA 4AKHA 2FE8A 4R71A 4G4OA 2Z4RA 3FUUA 4LFAM 3GLHB 3SARA 2C9OA 3W68A 1KYIA 2CV2A 1ZMWA 1QQWA 2WSEF 4FWDA 3R9XB 2G5GX 5DYIA 2MJ5B 4DR6M 4LF7M 4LG2A 3IECA 4M9ZA 5E26A 2DHRA 1TH3A 3L28A 3LCUA 2I7PA 1G41A 2KZUA 3I4VA 1IXRC 1QUTA 3AL0C 4Z6YA 2KNZA 2CFOA 1RU3A 1C7YA 3B7NA 1IQPA 1YLAA 2JZ1A 2K47A 5F3WA 2YR0A 3PXGA 1SXJC 4X65M 3C58A 3HHYA 1R2ZA 2CHGA 1Z6TA 3HJQA 3KW6A 4JN6A 5IREB 3TL4X 3GQ5A 4LZZA 1L2BA 4OW0A 3FYCA 4LY6A 4YY3M 2LWXA 3GLGE 4NRWA 2KRUA 5IT9S 2KRKA 2F4VM 4FCTA 2OOBA 2KA6B 4XBOA 2CUZA 3IG8A 4LJ8A 5EXSA 1VG5A 1IY1A 1QVRA 3FTCA 3GLHE 4NXNM 4I81A 3FTEA 4QOSA 5LMUM 3V76A 4PDIA 3GLIA 2YNMD 2DZLA 4L15A 1IY0A 3GPYA 2J7NA 1EIJA 1MU5A 1V92A 1IFYA 4JI7M 3MK6A 3VKHA 1GJTA 4LCBA 1OIZA 1IBLM 2KXEA 1AUAA 1DO0A 4BLCA 2ZTDA 2DKLA 1UM8A 1E94E 3K9OA 1HQYE 2HKJA 4DR7M 4Z8XA 2CV1A 4JI0M 4Q7JA 3AOEC 3I04M 2BWEA 2P5TA 2F5OA 1OQYA 1HNWM 2XFTA 3AKZA 4Y28F 5DNYA 2CV0A 2KHHA 3VDPA 2AHMA 4IBBA 4GHLA 4K0KM 3KDSE 2L6OA 3D8BA 1QAMA 2JP7A 2RRUA 5DYGA 5L8RF 4MB7A 3U5ZA 1XC8A 1GO5A 4L16A 4LGYA 4CHTB 4FW9A 2QNJA 4AI6A 3TQSA 5EQTA 1R7RA 3LW5F 1H6UA 4NOOB 4DV7M 2JA2A 1YSYA
chains in the Genus database with same CATH topology
1CUKA 1ZMVA 2JUJA 2MGWA 3H4JA 2LVPC 3BBZA 5DFLA 2DI0A 2L4FA 1HJPA 1OTRA 4DBGB 1VEKA 1WGNA 2L4EA 1EFUB 2LVQD 2OOAA 2HAKA 1MN3A 1XXHE 2JNHA 1WIVA 2DAIA 1G3IA 3E46A 3K9PA 1NV9A 1AIPC 2H5XA 1Q02A 1WHCA 2R0IA 1WGLA 3GLIE 2DAKA 1R4GA 1SG9A 2LVAA 1Y8GA 2JZ0A 1T43A 3B89A 3FRHA 3FRIA 2EKKA 2L2DA 1BVSA 1VQ1A 2MR9A 3F92A 4R71A 1TTEA 1KYIA 2DHYA 1ZMWA 2EJSA 1HT1E 3MMPA 2DAEA 2MJ5B 3IECA 2HWJA 2JY6B 2DENA 3FE3A 3LCUA 1WR1B 1G41A 1JR3E 2MROB 2KNZA 2JY8A 1C7YA 1YLAA 2JZ1A 2DNAA 1G4AE 1DV0A 2JY7A 1VEGA 2JY5A 2WZJA 5JI2E 3GLFE 2LVOC 1TR8A 4HEOA 3GLGE 4G3OA 3T6PA 2K0BX 1UFZA 1F4IA 1NV8A 2DAGA 4WP2A 2OOBA 1ZV1A 2BWBA 2DAMA 2OO9A 1VG5A 4GEWA 2QSFX 3GLHE 2CWBA 3LCVB 2KNVA 1A5TA 1HT2E 2LBCA 2DZLA 3E21A 1V92A 1IFYA 1VDLA 1WJ7A 1ZMUA 1QZEA 1OAIA 2LVNC 1DO0A 1OKSA 2ZTDA 2DKLA 2B3TA 1T6OA 2G3QA 2O25A 1E94E 3IHPA 1HQYE 3K9OA 2EKFA 2LTUA 1DO2A 4Q7JA 4F2LA 2BWEA 1VEJA 2QHOB 1OQYA 1PGYA 1IM2A 2KHHA 2ZTCA 2K9DA 1P3QQ 1XB2B 1GO5A 2JP7A 2RRUA 4UN2B 2QNJA 1IXSA 4F1IA 2CP8A 2KNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CUK A;  1ZMV A;  2JUJ A;  2MGW A;  3H4J A;  2LVP C;  3BBZ A;  5DFL A;  2DI0 A;  2L4F A;  1HJP A;  1OTR A;  4DBG B;  1VEK A;  1WGN A;  2L4E A;  1EFU B;  2LVQ D;  2OOA A;  2HAK A;  1MN3 A;  1XXH E;  2JNH A;  1WIV A;  2DAI A;  1G3I A;  3E46 A;  3K9P A;  1NV9 A;  1AIP C;  2H5X A;  1Q02 A;  1WHC A;  2R0I A;  1WGL A;  3GLI E;  2DAK A;  1R4G A;  1SG9 A;  2LVA A;  1Y8G A;  2JZ0 A;  1T43 A;  3B89 A;  3FRH A;  3FRI A;  2EKK A;  2L2D A;  1BVS A;  1VQ1 A;  2MR9 A;  3F92 A;  4R71 A;  1TTE A;  1KYI A;  2DHY A;  1ZMW A;  2EJS A;  1HT1 E;  3MMP A;  2DAE A;  2MJ5 B;  3IEC A;  2HWJ A;  2JY6 B;  2DEN A;  3FE3 A;  3LCU A;  1WR1 B;  1G41 A;  1JR3 E;  2MRO B;  2KNZ A;  2JY8 A;  1C7Y A;  1YLA A;  2JZ1 A;  2DNA A;  1G4A E;  1DV0 A;  2JY7 A;  1VEG A;  2JY5 A;  2WZJ A;  5JI2 E;  3GLF E;  2LVO C;  1TR8 A;  4HEO A;  3GLG E;  4G3O A;  3T6P A;  2K0B X;  1UFZ A;  1F4I A;  1NV8 A;  2DAG A;  4WP2 A;  2OOB A;  1ZV1 A;  2BWB A;  2DAM A;  2OO9 A;  1VG5 A;  4GEW A;  2QSF X;  3GLH E;  2CWB A;  3LCV B;  2KNV A;  1A5T A;  1HT2 E;  2LBC A;  2DZL A;  3E21 A;  1V92 A;  1IFY A;  1VDL A;  1WJ7 A;  1ZMU A;  1QZE A;  1OAI A;  2LVN C;  1DO0 A;  1OKS A;  2ZTD A;  2DKL A;  2B3T A;  1T6O A;  2G3Q A;  2O25 A;  1E94 E;  3IHP A;  1HQY E;  3K9O A;  2EKF A;  2LTU A;  1DO2 A;  4Q7J A;  4F2L A;  2BWE A;  1VEJ A;  2QHO B;  1OQY A;  1PGY A;  1IM2 A;  2KHH A;  2ZTC A;  2K9D A;  1P3Q Q;  1XB2 B;  1GO5 A;  2JP7 A;  2RRU A;  4UN2 B;  2QNJ A;  1IXS A;  4F1I A;  2CP8 A;  2KNA A; 
#chains in the Genus database with same CATH topology
 3GLF E;  2FOI C;  2UU9 M;  1Z5A A;  4M0D A;  4JI4 M;  3H4J A;  3GLF A;  2CHV A;  1QUS A;  3KS4 A;  3RGS A;  4JI8 M;  4GIP A;  1OTR A;  1N34 M;  2H1R A;  1PJQ A;  3KOW E;  1E32 A;  2L4E A;  4QHS A;  2LVQ D;  2OOA A;  3AV0 A;  4LF5 M;  1G71 A;  2QPA A;  3U6P A;  4NC6 A;  3U6D A;  3U5Z B;  3UJN A;  3SAS A;  3E46 A;  4MGY E;  1AIP C;  3DA1 A;  1I4W A;  4IBG A;  1PM5 A;  3GLI E;  2ZBK B;  3A98 B;  2EUC A;  2FFJ A;  4W5W A;  5ITX A;  1E9R A;  2BJW A;  3GLF B;  1N32 M;  2JZ0 A;  4GKK M;  4AKI A;  3OTO M;  4KT0 F;  2EKK A;  3WHK A;  2Z3X A;  3CF0 A;  1J09 A;  1V34 A;  4P17 A;  4GMQ A;  1VQ1 A;  4LRT A;  4GIT A;  2ZAN A;  3SAV A;  5IZ7 D;  2DHY A;  3HY5 A;  4FCV A;  4L4U A;  2QCU A;  3U6E A;  2HWJ A;  2G8L A;  3KS8 A;  2L7H A;  4LZJ A;  3VDU A;  3KSX A;  3T38 A;  2XZU A;  2QZ4 A;  3FE3 A;  4RNA A;  4PCZ A;  1E9S A;  1WR1 B;  4JI5 M;  2UXB M;  1NSF A;  2N35 A;  2CHQ A;  3QYB A;  4FD2 A;  4WW0 A;  3SYL A;  1TDZ A;  2YQZ A;  3T15 A;  1JQJ C;  1IY2 A;  3T1H M;  4LJ6 A;  2BNK A;  3WHL A;  4ZPX A;  3LVV A;  1J7K A;  1Q3B A;  1Q39 A;  1VEG A;  2WZJ A;  3K8Z A;  2LVO C;  3M6A A;  1TR8 A;  4IBF A;  4JI3 M;  1EE8 A;  3U6L A;  2W82 A;  4IBI A;  4G3O A;  3T6P A;  2VDB B;  1G59 A;  2K0B X;  2C99 A;  4XGI A;  4L78 A;  2J7O A;  2DAG A;  5EP3 A;  4WP2 A;  3RGP A;  3SC3 A;  8CAT A;  1ZV1 A;  1DGF A;  4G6Z A;  3SHG B;  3J80 S;  5ITR A;  1WXQ A;  5KPT A;  3FUV A;  3VK8 A;  4KHP M;  2DAM A;  4OX9 M;  2OO9 A;  4GC9 A;  1XNR M;  2QSF X;  2Y0T A;  2CWB A;  1QDT A;  2ZAM A;  3I4Y A;  3LCV B;  1R2Y A;  3PVS A;  4AG6 A;  2UUC M;  3FKE A;  2LBC A;  1YUB A;  3LVW A;  1R5L A;  4IJF A;  2R18 A;  4II7 A;  2LH0 A;  5EXP A;  3TE6 A;  5H37 D;  4DUY M;  2KDL A;  2XF3 A;  5ITX E;  2C96 A;  3HJS A;  2HHH M;  1L1T A;  1TDH A;  4DV5 M;  4GKJ M;  3GPX A;  4CJ6 A;  3UZU A;  1PRB A;  1QZE A;  2KW0 A;  3U60 A;  1T6O A;  2G3Q A;  3THG A;  4D80 A;  1TF0 B;  3B7Z A;  4DUZ M;  2VF7 A;  4F2L A;  4AQY M;  3UGJ A;  3HZJ A;  3VFD A;  1PGY A;  2J5Y A;  3IG5 A;  3HU2 A;  5KPZ A;  3GPP A;  1NHG C;  3RE8 A;  2VQF M;  4MM3 B;  2E5L M;  1P3Q Q;  3NWL A;  4UN2 B;  3U6C A;  4OVZ A;  5KO3 A;  4X66 M;  3SBJ A;  2NQ8 C;  2XSZ D;  2FS1 A;  4L6V 6;  5EP2 A;  3J81 S;  2QP9 X;  3U60 B;  2X49 A;  4LF4 M;  1R6B X;  2O01 F;  3CGW A;  1VDD A;  3FYD A;  3GO8 A;  2LVP C;  3FD9 A;  3BBZ A;  4CIS A;  1Z59 A;  5DFL A;  4ITQ A;  2L4F A;  2R4J A;  3QAU A;  3BXW A;  4DBG B;  1VEK A;  1NJF A;  3KP1 E;  4B7G A;  1WGN A;  1TH2 A;  1ZAE A;  2O5R A;  2DXI A;  2WSF F;  1D2N A;  2UUA M;  5FTJ A;  2F5N A;  3FUT A;  4B3S M;  3KFU G;  3UMM A;  4OVZ B;  5A2Q S;  2JNH A;  3GLI B;  1L8Q A;  2DAI A;  3FUW A;  4LJ4 A;  4RF0 A;  5KPR A;  1NY5 A;  3J7A S;  5LMN M;  2X4A A;  3E9S A;  4IBD A;  1V33 A;  4B7H A;  2R0I A;  1HR0 M;  4S12 A;  1OAO C;  2ZM6 M;  1QAQ A;  1L1Z A;  1SG9 A;  4MGK E;  4AW4 A;  2LVA A;  4CGY B;  1K3W A;  1GLN A;  1SXJ A;  3KOZ E;  3M0E A;  4NXM M;  1T43 A;  3I51 A;  4REZ A;  4PDG A;  4JI6 M;  3FUX A;  1DGH A;  2XEP A;  5JI3 E;  1Q3C A;  2R65 A;  1BVS A;  3SAU A;  2LHC A;  2MR9 A;  3ZCB B;  2VII A;  1LTM A;  3DZD A;  3KOY E;  4I8O A;  1NVM A;  2APL A;  4MGZ E;  1NY6 A;  2R62 A;  1MX0 A;  1IN6 A;  2C98 A;  1HT1 E;  1XHB A;  3MMP A;  3T1Y M;  1N33 M;  4LJ5 A;  2QQ8 A;  3UK6 A;  1MJG M;  1QYR A;  2DEN A;  4B3T M;  1Z5C A;  1L2C A;  4GC5 A;  5FTN A;  1YE9 A;  2MRO B;  3TWK A;  2DVW B;  5IWA M;  4QOZ C;  3C9P A;  3SAT A;  3JR4 A;  4LF9 M;  2XZF A;  2RGO A;  3GRU A;  1T3T A;  1OJL A;  1DGH B;  3B7Q A;  3JR5 A;  1NNU C;  3LQR A;  4D82 A;  4QHT A;  4AKG A;  1DV0 A;  4LFB M;  1N36 M;  3HKP A;  2LXE A;  5FSW A;  4GRI A;  2GQF A;  3L25 A;  3AOE A;  1DGB A;  3C3E A;  3AFH A;  2KEB A;  5ITT A;  2RKO A;  2D7E A;  4PD2 A;  3TPZ A;  4R7G A;  4LF8 M;  5JI2 E;  4JXJ A;  4AG5 A;  5ITQ A;  3L26 A;  3FTF A;  1GVN A;  1IN4 A;  2X8A A;  1KSF X;  2HCB A;  4GH9 A;  4R3D A;  3W0F A;  3DFZ A;  3E21 A;  4EIW A;  3U61 A;  4LJA A;  2DWM A;  4L8R C;  2WSC F;  1VDL A;  2BJV A;  4B08 A;  5GKN A;  1WJ7 A;  1ZMU A;  2Q2E B;  1SXJ E;  1W5S A;  2R6F A;  1OKS A;  1IN5 A;  2B3T A;  3CTW B;  1OFH A;  3SAW A;  1QAO A;  3ZH9 B;  2EKF A;  2Z7J A;  5KQD A;  1DO2 A;  2D7H A;  4QNM A;  4X62 M;  2HL7 A;  4TUW A;  3W67 A;  2XLJ A;  1J5E M;  4BB9 A;  1IM2 A;  3MJ5 A;  3PNY A;  2R46 A;  2ERC A;  3ZQJ A;  4DV6 M;  2QEN A;  4DR1 M;  2DWL A;  4GHA A;  3SHF A;  1XB2 B;  3KP0 E;  2KZS A;  2JXN A;  3U61 B;  3VK7 A;  1PJT A;  1XMQ M;  3B74 A;  1D0L A;  1JR3 A;  1FNN A;  4KO8 A;  1IXS A;  4F1I A;  3JAM S;  4FWG A;  5EP1 A;  2KNA A;  4FCW A;  2QBY A;  2JUJ A;  4JI1 M;  4IIW A;  2MGW A;  1GL6 A;  2I7N A;  3Q8G A;  2FNA A;  1W5T A;  2L7I A;  1XNQ M;  5ITY A;  4JV5 M;  2VQE M;  4DR5 M;  3A46 A;  2Z4S A;  3GP1 A;  4LRS A;  3ILK A;  3HJ8 A;  3L2A A;  4RKU F;  3GRR A;  2HAK A;  3RFW A;  5C18 A;  4JI2 M;  4CIZ A;  1IBK M;  3SMS A;  3M7G A;  3MHV C;  2RGH A;  4NL4 H;  1WIV A;  3J2P B;  1G3I A;  1D0M A;  1Z5B A;  1IXS B;  3K9P A;  1OFI A;  2H5X A;  3VLF B;  4G4R A;  4DR3 M;  4DV3 M;  4LFC M;  1QZM A;  2XFS A;  4KOD A;  1OIP A;  3W0L B;  1WGL A;  3AJI B;  3NBI A;  5ITU A;  2QBY B;  5E6J A;  2UXC M;  2DAK A;  4KLN A;  5BR8 M;  4P16 A;  2M60 A;  4I4L A;  5EXX A;  3HGI A;  3HHW A;  1N77 A;  5EJC A;  1Y8G A;  1FJG M;  2R4E A;  3B89 A;  3FRH A;  3HHZ A;  2CRU A;  1IBM M;  1KFV A;  2UXD M;  3PFI A;  4B7F A;  3SFZ A;  3HX3 A;  2OQ4 A;  3KXE C;  4FVM A;  3J27 B;  1IXZ A;  2LNH C;  3F92 A;  4MGI E;  1K82 A;  3I01 M;  1TTE A;  3A45 A;  1C1K A;  4NSR A;  4YHH M;  2EJS A;  3D8L A;  1SXJ D;  2DAE A;  3KVW A;  2DWZ B;  4LJ7 A;  4RF1 A;  5FTL A;  4DV0 M;  2F5S A;  4PT5 A;  2JY6 B;  4M9X A;  5FTM A;  4DV2 M;  2V1U A;  3K1J A;  1GAB A;  1JB0 F;  4X64 M;  3U6O A;  3VKG A;  1JR3 E;  3HU3 A;  4MGH A;  3K92 A;  2JY8 A;  7CAT A;  1QAN A;  2CE7 A;  5EXT A;  4DV1 M;  2DNA A;  4OU7 A;  1G4A E;  2EO2 A;  2JY7 A;  3SYK A;  4IBC A;  2JY5 A;  3R8F A;  2Y20 A;  3EIE A;  1IN7 A;  1GKI A;  4HEO A;  3DOA A;  2XSZ A;  3GRY A;  3SMP A;  4DR4 M;  2Z8Y M;  4LGM A;  4ANR A;  1UFZ A;  4G4N A;  1PJS A;  4XK8 F;  1NV8 A;  3CF6 E;  3U6S A;  1F4I A;  2DWN A;  4WUR A;  1XXH A;  2A5Y B;  2BWB A;  1NNJ A;  4NSO B;  3L27 A;  2V6Z M;  2L09 A;  2V1C A;  2MH8 A;  1IN8 A;  4GEW A;  4NRV A;  2C9C A;  2D7G A;  2K6B A;  4HLQ A;  1PJI A;  3LQQ A;  2KNV A;  1A5T A;  1HT2 E;  2FH0 A;  3LMM A;  2Y21 A;  4MH0 E;  1PJJ A;  1NO1 A;  1DGG A;  1S3S A;  1TH4 A;  2R45 A;  1SXJ B;  3NBX X;  5KQ8 A;  2CEA A;  3KOX E;  3C3D A;  2ZAO A;  4LJ9 A;  4FWH A;  1OAI A;  2LVN C;  4B3M M;  3HHX A;  5BPV A;  2EA0 A;  4B3R M;  3HWS A;  2O25 A;  3IHP A;  3AOG A;  3KSJ A;  3TWL A;  1N78 A;  2VF8 A;  4I5S A;  2Y0Q A;  4IJE A;  2LTU A;  1XXH B;  1VEJ A;  2QHO B;  1HNZ M;  4IBK A;  2F5P A;  2LHG A;  2ZTC A;  3GQ4 A;  1NHW C;  1TGU A;  2K9D A;  4HL4 A;  5C1B A;  1I94 M;  3A42 A;  2XGN A;  2YFQ A;  4DR2 M;  3GPU A;  1QDR A;  5EP4 A;  3QWL A;  2CP8 A;  3FRI A;  4LF6 M;  3ZC7 B;  3TWM A;  1CUK A;  1ZMV A;  1HQC A;  1N75 A;  3CF2 A;  4IBJ A;  2C5R A;  2UUB M;  4JYA M;  4AZF A;  1G8P A;  4A3V B;  2XH9 A;  2DI0 A;  1GL7 A;  3GLG A;  1LV7 A;  1HJP A;  1D0K A;  4M9S A;  1JR3 D;  3HU1 A;  4D81 A;  1X37 A;  1ZQ9 A;  4M0W A;  3K2L A;  1ORY B;  1EFU B;  3FTD A;  3PNV A;  3E4R A;  3U6M A;  2F5Q A;  2DZO B;  1MN3 A;  1XXH E;  2R44 A;  3GLH A;  4DV4 M;  3BOS A;  3QYE A;  1GJS A;  1XMO M;  3L29 A;  1K3X A;  1NV9 A;  4BBA A;  1NJG A;  1Q02 A;  3H4M A;  1WHC A;  1XWI A;  2OPF A;  4IBE A;  1R4G A;  2GNO A;  3EIH A;  1L2D A;  3J7B A;  5FLX S;  3GLG B;  3GQ3 A;  4QNR A;  3GRV A;  2M5Z A;  3U6Q A;  2JWS A;  1HNX M;  2DZN B;  2L2D A;  3Q8X A;  4G4Q A;  3B9P A;  5FTK A;  4AKH A;  2FE8 A;  4R71 A;  4G4O A;  2Z4R A;  3FUU A;  4LFA M;  3GLH B;  3SAR A;  2C9O A;  3W68 A;  1KYI A;  2CV2 A;  1ZMW A;  1QQW A;  2WSE F;  4FWD A;  3R9X B;  2G5G X;  5DYI A;  2MJ5 B;  4DR6 M;  4LF7 M;  4LG2 A;  3IEC A;  4M9Z A;  5E26 A;  2DHR A;  1TH3 A;  3L28 A;  3LCU A;  2I7P A;  1G41 A;  2KZU A;  3I4V A;  1IXR C;  1QUT A;  3AL0 C;  4Z6Y A;  2KNZ A;  2CFO A;  1RU3 A;  1C7Y A;  3B7N A;  1IQP A;  1YLA A;  2JZ1 A;  2K47 A;  5F3W A;  2YR0 A;  3PXG A;  1SXJ C;  4X65 M;  3C58 A;  3HHY A;  1R2Z A;  2CHG A;  1Z6T A;  3HJQ A;  3KW6 A;  4JN6 A;  5IRE B;  3TL4 X;  3GQ5 A;  4LZZ A;  1L2B A;  4OW0 A;  3FYC A;  4LY6 A;  4YY3 M;  2LWX A;  3GLG E;  4NRW A;  2KRU A;  5IT9 S;  2KRK A;  2F4V M;  4FCT A;  2OOB A;  2KA6 B;  4XBO A;  2CUZ A;  3IG8 A;  4LJ8 A;  5EXS A;  1VG5 A;  1IY1 A;  1QVR A;  3FTC A;  3GLH E;  4NXN M;  4I81 A;  3FTE A;  4QOS A;  5LMU M;  3V76 A;  4PDI A;  3GLI A;  2YNM D;  2DZL A;  4L15 A;  1IY0 A;  3GPY A;  2J7N A;  1EIJ A;  1MU5 A;  1V92 A;  1IFY A;  4JI7 M;  3MK6 A;  3VKH A;  1GJT A;  4LCB A;  1OIZ A;  1IBL M;  2KXE A;  1AUA A;  1DO0 A;  4BLC A;  2ZTD A;  2DKL A;  1UM8 A;  1E94 E;  3K9O A;  1HQY E;  2HKJ A;  4DR7 M;  4Z8X A;  2CV1 A;  4JI0 M;  4Q7J A;  3AOE C;  3I04 M;  2BWE A;  2P5T A;  2F5O A;  1OQY A;  1HNW M;  2XFT A;  3AKZ A;  4Y28 F;  5DNY A;  2CV0 A;  2KHH A;  3VDP A;  2AHM A;  4IBB A;  4GHL A;  4K0K M;  3KDS E;  2L6O A;  3D8B A;  1QAM A;  2JP7 A;  2RRU A;  5DYG A;  5L8R F;  4MB7 A;  3U5Z A;  1XC8 A;  1GO5 A;  4L16 A;  4LGY A;  4CHT B;  4FW9 A;  2QNJ A;  4AI6 A;  3TQS A;  5EQT A;  1R7R A;  3LW5 F;  1H6U A;  4NOO B;  4DV7 M;  2JA2 A;  1YSY A; 
#chains in the Genus database with same CATH homology
 1CUK A;  1ZMV A;  2JUJ A;  2MGW A;  3H4J A;  2LVP C;  3BBZ A;  5DFL A;  2DI0 A;  2L4F A;  1HJP A;  1OTR A;  4DBG B;  1VEK A;  1WGN A;  2L4E A;  1EFU B;  2LVQ D;  2OOA A;  2HAK A;  1MN3 A;  1XXH E;  2JNH A;  1WIV A;  2DAI A;  1G3I A;  3E46 A;  3K9P A;  1NV9 A;  1AIP C;  2H5X A;  1Q02 A;  1WHC A;  2R0I A;  1WGL A;  3GLI E;  2DAK A;  1R4G A;  1SG9 A;  2LVA A;  1Y8G A;  2JZ0 A;  1T43 A;  3B89 A;  3FRH A;  3FRI A;  2EKK A;  2L2D A;  1BVS A;  1VQ1 A;  2MR9 A;  3F92 A;  4R71 A;  1TTE A;  1KYI A;  2DHY A;  1ZMW A;  2EJS A;  1HT1 E;  3MMP A;  2DAE A;  2MJ5 B;  3IEC A;  2HWJ A;  2JY6 B;  2DEN A;  3FE3 A;  3LCU A;  1WR1 B;  1G41 A;  1JR3 E;  2MRO B;  2KNZ A;  2JY8 A;  1C7Y A;  1YLA A;  2JZ1 A;  2DNA A;  1G4A E;  1DV0 A;  2JY7 A;  1VEG A;  2JY5 A;  2WZJ A;  5JI2 E;  3GLF E;  2LVO C;  1TR8 A;  4HEO A;  3GLG E;  4G3O A;  3T6P A;  2K0B X;  1UFZ A;  1F4I A;  1NV8 A;  2DAG A;  4WP2 A;  2OOB A;  1ZV1 A;  2BWB A;  2DAM A;  2OO9 A;  1VG5 A;  4GEW A;  2QSF X;  3GLH E;  2CWB A;  3LCV B;  2KNV A;  1A5T A;  1HT2 E;  2LBC A;  2DZL A;  3E21 A;  1V92 A;  1IFY A;  1VDL A;  1WJ7 A;  1ZMU A;  1QZE A;  1OAI A;  2LVN C;  1DO0 A;  1OKS A;  2ZTD A;  2DKL A;  2B3T A;  1T6O A;  2G3Q A;  2O25 A;  1E94 E;  3IHP A;  1HQY E;  3K9O A;  2EKF A;  2LTU A;  1DO2 A;  4Q7J A;  4F2L A;  2BWE A;  1VEJ A;  2QHO B;  1OQY A;  1PGY A;  1IM2 A;  2KHH A;  2ZTC A;  2K9D A;  1P3Q Q;  1XB2 B;  1GO5 A;  2JP7 A;  2RRU A;  4UN2 B;  2QNJ A;  1IXS A;  4F1I A;  2CP8 A;  2KNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...