1VEGA

Solution structure of rsgi ruh-012, a uba domain from mouse cdna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
83
structure length
83
Chain Sequence
GSSGSSGNPHMWWLQDADPENNSRQASPSQESINQLVYMGFDTVVAEAALRVFGGNVQLAAQTLAHHGGSLPPDLQFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEDD8 ultimate buster-1
publication title Solution Structure of RSGI RUH-012, a UBA Domain from Mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 10
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1vegA01
1Y8GA 2KNZA 3LCVB 1KYIA 1VQ1A 2DAIA 1G41A 1QZEA 2L2DA 2DAGA 1VEJA 1EFUB 3GLIE 3FE3A 3FRIA 2DAEA 2DI0A 3K9OA 2JZ0A 1CUKA 1GO5A 1OAIA 3F92A 2DZLA 1WIVA 1Q02A 1IM2A 1VDLA 1HT1E 2QHOB 2R0IA 1DV0A 2DKLA 2CP8A 2B3TA 2DNAA 4HEOA 2DHYA 3K9PA 1WR1B 1BVSA 2JY8A 2OOBA 5JI2E 1A5TA 1DO0A 3T6PA 2K9DA 1YLAA 2DAKA 1TTEA 3E46A 4F1IA 1OKSA 2L4EA 1IFYA 3E21A 3FRHA 1G4AE 1VG5A 2KHHA 1HQYE 1JR3E 2G3QA 2MGWA 1C7YA 2HWJA 2ZTDA 2LVNC 3IECA 1WGLA 2MROB 2H5XA 1NV9A 1T6OA 1VEGA 1HJPA 1OTRA 2QNJA 1PGYA 2DENA 2HAKA 2L4FA 3GLHE 4F2LA 1AIPC 2BWEA 4Q7JA 2JY7A 1WJ7A 1HT2E 2DAMA 1V92A 1NV8A 4GEWA 2BWBA 2LBCA 1T43A 1ZMWA 2JY5A 5DFLA 2OO9A 2KNAA 1WHCA 1XB2B 1XXHE 4G3OA 2LVOC 3LCUA 4UN2B 2CWBA 4DBGB 1DO2A 1OQYA 2LVPC 1IXSA 2MR9A 3B89A 2K0BX 4R71A 2OOAA 1MN3A 3H4JA 2MJ5B 1ZV1A 2LTUA 2O25A 2RRUA 1P3QQ 2JP7A 3MMPA 3IHPA 1SG9A 2EKFA 1TR8A 2JY6B 2JUJA 2JNHA 1F4IA 3GLFE 2ZTCA 1ZMVA 1G3IA 2EJSA 2WZJA 2JZ1A 3GLGE 2KNVA 1R4GA 4WP2A 1UFZA 2LVQD 2QSFX 3BBZA 1VEKA 1WGNA 2EKKA 2LVAA 1ZMUA 1E94E
chains in the Genus database with same CATH superfamily
1KSFX 2L09A 2DAIA 3CF0A 4LG2A 1QZEA 4JI6M 2L6OA 3M0EA 1W5SA 2DAEA 1K3WA 4I81A 4LY6A 2WSCF 3FUWA 3AKZA 2HKJA 2KDLA 2JZ0A 1QDTA 2DHRA 1TH3A 2KRUA 1OFIA 2J5YA 3KVWA 4IBJA 2QHOB 1HT1E 4Y28F 4IBFA 2CP8A 2EUCA 2DNAA 3KS8A 4JI1M 4P16A 3K9PA 3VK7A 3QYEA 4PDGA 2JY8A 1R7RA 1DGHA 3CTWB 1NHWC 2XZUA 3HKPA 1XMOM 1GLNA 3A98B 1ORYB 2K9DA 4L8RC 4LGMA 4M0WA 3KFUG 3FUUA 2XSZD 1T3TA 4F1IA 1OKSA 1PJTA 4M9ZA 3E9SA 3ILKA 3E4RA 5EXSA 2LHGA 3SAVA 3KSJA 3M6AA 2KXEA 3DA1A 3Q8XA 4Z6YA 1HQYE 3FUVA 1LV7A 2ERCA 3A42A 5LMNM 3MK6A 3U6SA 1KFVA 2UUAM 1N33M 1WGLA 4RNAA 1Z6TA 4FWDA 2Z7JA 3U6EA 3L2AA 2HCBA 3HHZA 5EXPA 3I04M 3NBXX 1QAQA 1SXJD 3RFWA 4F2LA 1AIPC 2BJVA 5DYGA 5FTJA 1DGBA 2XFSA 4FWHA 4GEWA 2LBCA 4I8OA 1T43A 1NNUC 1PJIA 4JYAM 3HJSA 5C1BA 2ZANA 2FH0A 4X62M 3PNVA 2M60A 2R6FA 2RGOA 1XXHE 2KZSA 4B7GA 1TF0B 3GPUA 4LJ8A 1V34A 4UN2B 2R44A 3GQ3A 3GPXA 1Z5AA 4DR1M 2QBYA 4PT5A 2VQEM 2VIIA 2ZAMA 5ITXA 3U6PA 1QUTA 4MGKE 1XXHB 2RRUA 3U60B 1QAOA 2M5ZA 2F5PA 4AKGA 3AOEA 1OFHA 1ZQ9A 5E26A 4P17A 3M7GA 1WXQA 1XMQM 1PRBA 2FS1A 3B9PA 3GRUA 2JUJA 3HU2A 3GO8A 1AUAA 3I4YA 1QANA 2KRKA 1E9SA 3KP1E 5E6JA 4D82A 1J5EM 1G3IA 4FVMA 2EJSA 3FTCA 4NC6A 4B3RM 3GLGE 4AKIA 3SMPA 1R5LA 3HZJA 3A46A 2CV0A 1OJLA 3B7NA 1UFZA 3AL0C 4IBGA 2ZM6M 1QUSA 1XXHA 4L6V6 1NHGC 1IY2A 4QNMA 3U60A 3SYKA 3TE6A 4DV5M 4GH9A 4AKHA 3HU3A 3LCVB 2D7EA 1KYIA 1VQ1A 4HL4A 4NSOB 1G41A 2L2DA 4GRIA 4JN6A 3SBJA 3LVWA 3GRYA 4JI4M 3SAWA 3QWLA 3FE3A 5IREB 3W0LB 3OTOM 3U6DA 4B7FA 4NSRA 2X49A 1NSFA 3CF2A 1OAIA 5ITQA 2DZLA 4MH0E 3FTFA 3KSXA 3B74A 5DYIA 3Q8GA 4IBBA 1PJQA 3J27B 3GRRA 3J2PB 3VKGA 3SATA 3L26A 4ZPXA 4ANRA 5FLXS 3I51A 3GP1A 3MHVC 4WW0A 2DWLA 1IBLM 3AFHA 3U6LA 1DO0A 2JWSA 5ITYA 1HNWM 5KPTA 1DGHB 4LJ6A 3ZC7B 4X64M 2P5TA 3LW5F 5IZ7D 2HHHM 1I94M 2QZ4A 4L15A 4XK8F 2H1RA 3VFDA 2OQ4A 1H6UA 1TTEA 3T38A 3D8BA 1HQCA 2O5RA 3GPPA 3UMMA 4G4NA 4OX9M 2HL7A 1IFYA 4AW4A 5KPRA 1ZAEA 4FWGA 1UM8A 4DV7M 4GHLA 3DFZA 3U5ZB 1YE9A 2KHHA 2D7GA 3FUXA 4DUYM 4OU7A 3WHKA 2G3QA 3W67A 1C7YA 4M0DA 3KOXE 2HWJA 2ZTDA 2LVNC 2O01F 3FYDA 1L2DA 2H5XA 1NV9A 3B7QA 3HJ8A 2CUZA 4MB7A 4AG5A 2DWNA 1IY0A 4II7A 3IG5A 2HAKA 3JAMS 4JI2M 2L4FA 1GKIA 2C9CA 4LJ9A 3SHGB 5KO3A 2D7HA 2UU9M 3T1HM 4Q7JA 5BPVA 4LF9M 1HT2E 2DAMA 1V92A 3RE8A 1SXJC 2UXBM 4G6ZA 4WURA 4LCBA 3SASA 1FJGM 3L29A 1YSYA 1L8QA 3T15A 2Z4SA 2XEPA 5FSWA 2OO9A 1XNRM 1XNQM 3C3EA 3CF6E 5ITXE 3U5ZA 2LVOC 3LCUA 1FNNA 1C1KA 5L8RF 5ITRA 1DO2A 2Y20A 2F5OA 2LVPC 2MR9A 3HY5A 3NWLA 2OOAA 4QHTA 3KOYE 4KT0F 2QP9X 3C58A 2QBYB 1ZV1A 1TDZA 4R3DA 3H4MA 2AHMA 1NJGA 1Z59A 4LZJA 1P3QQ 1X37A 4QOSA 2UUCM 4LF5M 4LFBM 1J7KA 2I7NA 4B7HA 2J7OA 2C98A 1Q3CA 4JXJA 1I4WA 3FYCA 4JI5M 3PVSA 5KQDA 3LQQA 2CV2A 2JA2A 2VF8A 4G4OA 2ZTCA 4YY3M 2R4JA 4YHHM 1G59A 4QNRA 4KLNA 1JQJC 3KOWE 1N34M 2WZJA 1D0KA 4RF1A 2KEBA 5JI3E 2N35A 1NY6A 2KNVA 2RKOA 3VDUA 3K2LA 1OIPA 4WP2A 3SFZA 1QAMA 2R46A 4MGYE 5FTLA 2K6BA 4W5WA 2DZOB 3BBZA 1VEKA 4GIPA 5FTNA 4LJ7A 4PCZA 2Z4RA 3U6MA 3J81S 3SC3A 3CGWA 4BLCA 2EKKA 3I4VA 2YQZA 2UXCM 3SMSA 5GKNA 2X8AA 3UGJA 2Y21A 1N75A 3HHWA 1E94E 1Y8GA 2F4VM 4CISA 4DUZM 2R62A 1GABA 3C3DA 4I4LA 2DAGA 1TDHA 1VEJA 2FFJA 3BOSA 3KDSE 4D81A 4DR7M 2R45A 3FRIA 4D80A 3UK6A 4GKJM 4IJFA 3FUTA 5EXTA 3B7ZA 2VF7A 3K9OA 4NXMM 2R18A 1CUKA 3GLIA 1QVRA 1IQPA 1K3XA 3LVVA 4L78A 2DWMA 4KHPM 1GO5A 3F92A 1WIVA 3KS4A 1OIZA 1IM2A 1E32A 1VDLA 2R0IA 8CATA 4NRVA 3LQRA 4NRWA 2CE7A 4LZZA 2YFQA 4GMQA 1N32M 3TWMA 3RGPA 4B3SM 1GL6A 1WR1B 3THGA 1BVSA 1Z5CA 1XWIA 2X4AA 2XF3A 2YR0A 2OOBA 4IBDA 3U6CA 3PFIA 3QAUA 5JI2E 1A5TA 4JI0M 1EE8A 1QQWA 2XH9A 3HU1A 1IXZA 1TH2A 1YLAA 2FOIC 3UZUA 4TUWA 2DAKA 4NL4H 2QPAA 4BB9A 1XC8A 1IN4A 3W0FA 2XSZA 1QZMA 4IBEA 4DR6M 2Q2EB 1V33A 2L4EA 1R2ZA 2WSFF 2LXEA 3SAUA 3PNYA 2E5LM 4X65M 3ZCBB 3E21A 4OVZB 2Z3XA 1NY5A 3FRHA 2WSEF 2ZBKB 1J09A 4K0KM 3HHYA 1GJTA 1VG5A 3KW6A 1HR0M 2APLA 2DZNB 1JR3E 2MGWA 2G5GX 4XGIA 2LHCA 2L7HA 4DV2M 3FTDA 2R4EA 3FD9A 4I5SA 3VKHA 4LRTA 3BXWA 1G71A 1T6OA 2F5QA 1HJPA 4JI3M 2QNJA 2GQFA 2DENA 3GLHE 3AOEC 2VDBB 2BWEA 4RF0A 4REZA 2MH8A 1TGUA 1WJ7A 3KP0E 4AG6A 3J80S 5A2QS 2BWBA 4LJ4A 3MJ5A 2C5RA 3W68A 3T1YM 4FW9A 1OAOC 2CFOA 3GLHB 1L2BA 2DVWB 4OVZA 2BJWA 4G3OA 3DZDA 3A45A 3L28A 4S12A 5ITUA 1QYRA 1DGGA 2EO2A 2CWBA 4JI7M 4B3MM 1Q3BA 3HWSA 1OQYA 5C18A 3GQ5A 1EIJA 2K0BX 4R7GA 2EA0A 2C96A 2MJ5B 4B08A 5LMUM 2F5SA 1S3SA 1JR3A 3FTEA 1N77A 2JP7A 5EJCA 3KOZE 1IBMM 1SG9A 2EKFA 1TR8A 5IT9S 2UUBM 1HNZM 5EQTA 2L7IA 4DV4M 4MGIE 3GLFE 4HLQA 1ZMVA 4LFAM 3GLHA 1NVMA 4AQYM 2QCUA 4CJ6A 3FKEA 4GC9A 1IXRC 4LJ5A 3KXEC 3TPZA 2BNKA 4GHAA 1IN8A 3U6QA 4AI6A 2CHVA 2LVQD 3GLFB 4JV5M 2QSFX 4GKKM 3K1JA 5BR8M 1WGNA 2LNHC 4IIWA 3L25A 1HNXM 4JI8M 4QOZC 3GPYA 4LFCM 2YNMD 1ZMUA 5FTKA 2UXDM 3K8ZA 5ITTA 2KNZA 3HHXA 1YUBA 3R9XB 4DR5M 2ZAOA 1EFUB 3GLIE 1MX0A 4EIWA 4QHSA 4DR3M 3LMMA 3SYLA 4CGYB 2DI0A 3U61B 4M9SA 2A5YB 2Y0TA 4IBCA 3GLIB 3GLFA 4IJEA 1Q02A 1DV0A 4X66M 1IN6A 2J7NA 3JR4A 2DKLA 1R6BX 4MGZE 2B3TA 4LGYA 4MGHA 1GVNA 3NBIA 3I01M 2DHYA 4HEOA 3PXGA 3ZQJA 1L2CA 2W82A 1GJSA 3V76A 3JR5A 3TQSA 3U6OA 5EP1A 1IBKM 1W5TA 3UJNA 3J7BA 4GC5A 4KODA 4MM3B 3T6PA 1RU3A 2XLJA 3EIHA 4RKUF 3TWKA 1XHBA 4NXNM 4M9XA 3E46A 1IN5A 1VDDA 3C9PA 3U61A 1NNJA 1LTMA 5DNYA 4NOOB 1G8PA 3GQ4A 4LF7M 4LF6M 1PJSA 5F3WA 1G4AE 2V6ZM 3EIEA 2GNOA 3QYBA 4CHTB 3VK8A 5FTMA 2KZUA 4FD2A 3L27A 1L1ZA 1IXSB 3IECA 5EP3A 1SXJE 1D0LA 4IBIA 2MROB 4PDIA 2C99A 4LJAA 2C9OA 3TL4X 5KQ8A 1JR3D 1VEGA 1OTRA 2QQ8A 3RGSA 3HJQA 4G4QA 4ITQA 2CHGA 1PGYA 4FCVA 2DXIA 1QDRA 1SXJB 2JY7A 1Q39A 2FE8A 2V1UA 1NV8A 1ZMWA 2LWXA 2I7PA 4DV3M 2JY5A 2KA6B 4DV0M 3SHFA 1L1TA 2QENA 5DFLA 2XZFA 2XFTA 4L16A 2NQ8C 1N36M 2KNAA 4GITA 4DV1M 1WHCA 1NO1A 1XB2B 4XBOA 2CV1A 2XGNA 4DBGB 4AZFA 4LF8M 3WHLA 1TH4A 4DR4M 1IXSA 3B89A 1Z5BA 3AOGA 4R71A 2DWZB 3GLGB 1MN3A 3DOAA 3GRVA 1PJJA 3H4JA 2G8LA 2LTUA 2O25A 4IBKA 1E9RA 1D2NA 4LRSA 2Z8YM 3ZH9B 2F5NA 4G4RA 1GL7A 2V1CA 3MMPA 3HX3A 4Z8XA 3IHPA 4L4UA 1IY1A 2RGHA 2R65A 1SXJA 2KW0A 4PD2A 1R2YA 3D8LA 2JY6B 2VQFM 4LF4M 1DGFA 4BBAA 4DV6M 4OW0A 2JNHA 2OPFA 4FCTA 1F4IA 3J7AS 5EP4A 3TWLA 7CATA 1NJFA 3K92A 4FCWA 2JZ1A 1PM5A 1JB0F 1R4GA 3HGIA 5H37D 2LH0A 1K82A 2CHQA 3VDPA 1IN7A 2JXNA 5EP2A 5KPZA 4B3TM 4CIZA 3SARA 4A3VB 2K47A 5IWAM 2Y0QA 3IG8A 3GLGA 2CEAA 4KO8A 2FNAA 1MU5A 1D0MA 2LVAA 3AJIB 3AV0A 5EXXA 4DR2M 1N78A 1MJGM 3R8FA 3VLFB 2CRUA
chains in the Genus database with same CATH topology
1Y8GA 2KNZA 3LCVB 1KYIA 1VQ1A 2DAIA 1G41A 1QZEA 2L2DA 2DAGA 1VEJA 1EFUB 3GLIE 3FE3A 3FRIA 2DAEA 2DI0A 3K9OA 2JZ0A 1CUKA 1GO5A 1OAIA 3F92A 2DZLA 1WIVA 1Q02A 1IM2A 1VDLA 1HT1E 2QHOB 2R0IA 1DV0A 2DKLA 2CP8A 2B3TA 2DNAA 4HEOA 2DHYA 3K9PA 1WR1B 1BVSA 2JY8A 2OOBA 5JI2E 1A5TA 1DO0A 3T6PA 2K9DA 1YLAA 2DAKA 1TTEA 3E46A 4F1IA 1OKSA 2L4EA 1IFYA 3E21A 3FRHA 1G4AE 1VG5A 2KHHA 1HQYE 1JR3E 2G3QA 2MGWA 1C7YA 2HWJA 2ZTDA 2LVNC 3IECA 1WGLA 2MROB 2H5XA 1NV9A 1T6OA 1VEGA 1HJPA 1OTRA 2QNJA 1PGYA 2DENA 2HAKA 2L4FA 3GLHE 4F2LA 1AIPC 2BWEA 4Q7JA 2JY7A 1WJ7A 1HT2E 2DAMA 1V92A 1NV8A 4GEWA 2BWBA 2LBCA 1T43A 1ZMWA 2JY5A 5DFLA 2OO9A 2KNAA 1WHCA 1XB2B 1XXHE 4G3OA 2LVOC 3LCUA 4UN2B 2CWBA 4DBGB 1DO2A 1OQYA 2LVPC 1IXSA 2MR9A 3B89A 2K0BX 4R71A 2OOAA 1MN3A 3H4JA 2MJ5B 1ZV1A 2LTUA 2O25A 2RRUA 1P3QQ 2JP7A 3MMPA 3IHPA 1SG9A 2EKFA 1TR8A 2JY6B 2JUJA 2JNHA 1F4IA 3GLFE 2ZTCA 1ZMVA 1G3IA 2EJSA 2WZJA 2JZ1A 3GLGE 2KNVA 1R4GA 4WP2A 1UFZA 2LVQD 2QSFX 3BBZA 1VEKA 1WGNA 2EKKA 2LVAA 1ZMUA 1E94E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8G A;  2KNZ A;  3LCV B;  1KYI A;  1VQ1 A;  2DAI A;  1G41 A;  1QZE A;  2L2D A;  2DAG A;  1VEJ A;  1EFU B;  3GLI E;  3FE3 A;  3FRI A;  2DAE A;  2DI0 A;  3K9O A;  2JZ0 A;  1CUK A;  1GO5 A;  1OAI A;  3F92 A;  2DZL A;  1WIV A;  1Q02 A;  1IM2 A;  1VDL A;  1HT1 E;  2QHO B;  2R0I A;  1DV0 A;  2DKL A;  2CP8 A;  2B3T A;  2DNA A;  4HEO A;  2DHY A;  3K9P A;  1WR1 B;  1BVS A;  2JY8 A;  2OOB A;  5JI2 E;  1A5T A;  1DO0 A;  3T6P A;  2K9D A;  1YLA A;  2DAK A;  1TTE A;  3E46 A;  4F1I A;  1OKS A;  2L4E A;  1IFY A;  3E21 A;  3FRH A;  1G4A E;  1VG5 A;  2KHH A;  1HQY E;  1JR3 E;  2G3Q A;  2MGW A;  1C7Y A;  2HWJ A;  2ZTD A;  2LVN C;  3IEC A;  1WGL A;  2MRO B;  2H5X A;  1NV9 A;  1T6O A;  1VEG A;  1HJP A;  1OTR A;  2QNJ A;  1PGY A;  2DEN A;  2HAK A;  2L4F A;  3GLH E;  4F2L A;  1AIP C;  2BWE A;  4Q7J A;  2JY7 A;  1WJ7 A;  1HT2 E;  2DAM A;  1V92 A;  1NV8 A;  4GEW A;  2BWB A;  2LBC A;  1T43 A;  1ZMW A;  2JY5 A;  5DFL A;  2OO9 A;  2KNA A;  1WHC A;  1XB2 B;  1XXH E;  4G3O A;  2LVO C;  3LCU A;  4UN2 B;  2CWB A;  4DBG B;  1DO2 A;  1OQY A;  2LVP C;  1IXS A;  2MR9 A;  3B89 A;  2K0B X;  4R71 A;  2OOA A;  1MN3 A;  3H4J A;  2MJ5 B;  1ZV1 A;  2LTU A;  2O25 A;  2RRU A;  1P3Q Q;  2JP7 A;  3MMP A;  3IHP A;  1SG9 A;  2EKF A;  1TR8 A;  2JY6 B;  2JUJ A;  2JNH A;  1F4I A;  3GLF E;  2ZTC A;  1ZMV A;  1G3I A;  2EJS A;  2WZJ A;  2JZ1 A;  3GLG E;  2KNV A;  1R4G A;  4WP2 A;  1UFZ A;  2LVQ D;  2QSF X;  3BBZ A;  1VEK A;  1WGN A;  2EKK A;  2LVA A;  1ZMU A;  1E94 E; 
#chains in the Genus database with same CATH topology
 1KSF X;  2L09 A;  2DAI A;  3CF0 A;  4LG2 A;  1QZE A;  4JI6 M;  2L6O A;  3M0E A;  1W5S A;  2DAE A;  1K3W A;  4I81 A;  4LY6 A;  2WSC F;  3FUW A;  3AKZ A;  2HKJ A;  2KDL A;  2JZ0 A;  1QDT A;  2DHR A;  1TH3 A;  2KRU A;  1OFI A;  2J5Y A;  3KVW A;  4IBJ A;  2QHO B;  1HT1 E;  4Y28 F;  4IBF A;  2CP8 A;  2EUC A;  2DNA A;  3KS8 A;  4JI1 M;  4P16 A;  3K9P A;  3VK7 A;  3QYE A;  4PDG A;  2JY8 A;  1R7R A;  1DGH A;  3CTW B;  1NHW C;  2XZU A;  3HKP A;  1XMO M;  1GLN A;  3A98 B;  1ORY B;  2K9D A;  4L8R C;  4LGM A;  4M0W A;  3KFU G;  3FUU A;  2XSZ D;  1T3T A;  4F1I A;  1OKS A;  1PJT A;  4M9Z A;  3E9S A;  3ILK A;  3E4R A;  5EXS A;  2LHG A;  3SAV A;  3KSJ A;  3M6A A;  2KXE A;  3DA1 A;  3Q8X A;  4Z6Y A;  1HQY E;  3FUV A;  1LV7 A;  2ERC A;  3A42 A;  5LMN M;  3MK6 A;  3U6S A;  1KFV A;  2UUA M;  1N33 M;  1WGL A;  4RNA A;  1Z6T A;  4FWD A;  2Z7J A;  3U6E A;  3L2A A;  2HCB A;  3HHZ A;  5EXP A;  3I04 M;  3NBX X;  1QAQ A;  1SXJ D;  3RFW A;  4F2L A;  1AIP C;  2BJV A;  5DYG A;  5FTJ A;  1DGB A;  2XFS A;  4FWH A;  4GEW A;  2LBC A;  4I8O A;  1T43 A;  1NNU C;  1PJI A;  4JYA M;  3HJS A;  5C1B A;  2ZAN A;  2FH0 A;  4X62 M;  3PNV A;  2M60 A;  2R6F A;  2RGO A;  1XXH E;  2KZS A;  4B7G A;  1TF0 B;  3GPU A;  4LJ8 A;  1V34 A;  4UN2 B;  2R44 A;  3GQ3 A;  3GPX A;  1Z5A A;  4DR1 M;  2QBY A;  4PT5 A;  2VQE M;  2VII A;  2ZAM A;  5ITX A;  3U6P A;  1QUT A;  4MGK E;  1XXH B;  2RRU A;  3U60 B;  1QAO A;  2M5Z A;  2F5P A;  4AKG A;  3AOE A;  1OFH A;  1ZQ9 A;  5E26 A;  4P17 A;  3M7G A;  1WXQ A;  1XMQ M;  1PRB A;  2FS1 A;  3B9P A;  3GRU A;  2JUJ A;  3HU2 A;  3GO8 A;  1AUA A;  3I4Y A;  1QAN A;  2KRK A;  1E9S A;  3KP1 E;  5E6J A;  4D82 A;  1J5E M;  1G3I A;  4FVM A;  2EJS A;  3FTC A;  4NC6 A;  4B3R M;  3GLG E;  4AKI A;  3SMP A;  1R5L A;  3HZJ A;  3A46 A;  2CV0 A;  1OJL A;  3B7N A;  1UFZ A;  3AL0 C;  4IBG A;  2ZM6 M;  1QUS A;  1XXH A;  4L6V 6;  1NHG C;  1IY2 A;  4QNM A;  3U60 A;  3SYK A;  3TE6 A;  4DV5 M;  4GH9 A;  4AKH A;  3HU3 A;  3LCV B;  2D7E A;  1KYI A;  1VQ1 A;  4HL4 A;  4NSO B;  1G41 A;  2L2D A;  4GRI A;  4JN6 A;  3SBJ A;  3LVW A;  3GRY A;  4JI4 M;  3SAW A;  3QWL A;  3FE3 A;  5IRE B;  3W0L B;  3OTO M;  3U6D A;  4B7F A;  4NSR A;  2X49 A;  1NSF A;  3CF2 A;  1OAI A;  5ITQ A;  2DZL A;  4MH0 E;  3FTF A;  3KSX A;  3B74 A;  5DYI A;  3Q8G A;  4IBB A;  1PJQ A;  3J27 B;  3GRR A;  3J2P B;  3VKG A;  3SAT A;  3L26 A;  4ZPX A;  4ANR A;  5FLX S;  3I51 A;  3GP1 A;  3MHV C;  4WW0 A;  2DWL A;  1IBL M;  3AFH A;  3U6L A;  1DO0 A;  2JWS A;  5ITY A;  1HNW M;  5KPT A;  1DGH B;  4LJ6 A;  3ZC7 B;  4X64 M;  2P5T A;  3LW5 F;  5IZ7 D;  2HHH M;  1I94 M;  2QZ4 A;  4L15 A;  4XK8 F;  2H1R A;  3VFD A;  2OQ4 A;  1H6U A;  1TTE A;  3T38 A;  3D8B A;  1HQC A;  2O5R A;  3GPP A;  3UMM A;  4G4N A;  4OX9 M;  2HL7 A;  1IFY A;  4AW4 A;  5KPR A;  1ZAE A;  4FWG A;  1UM8 A;  4DV7 M;  4GHL A;  3DFZ A;  3U5Z B;  1YE9 A;  2KHH A;  2D7G A;  3FUX A;  4DUY M;  4OU7 A;  3WHK A;  2G3Q A;  3W67 A;  1C7Y A;  4M0D A;  3KOX E;  2HWJ A;  2ZTD A;  2LVN C;  2O01 F;  3FYD A;  1L2D A;  2H5X A;  1NV9 A;  3B7Q A;  3HJ8 A;  2CUZ A;  4MB7 A;  4AG5 A;  2DWN A;  1IY0 A;  4II7 A;  3IG5 A;  2HAK A;  3JAM S;  4JI2 M;  2L4F A;  1GKI A;  2C9C A;  4LJ9 A;  3SHG B;  5KO3 A;  2D7H A;  2UU9 M;  3T1H M;  4Q7J A;  5BPV A;  4LF9 M;  1HT2 E;  2DAM A;  1V92 A;  3RE8 A;  1SXJ C;  2UXB M;  4G6Z A;  4WUR A;  4LCB A;  3SAS A;  1FJG M;  3L29 A;  1YSY A;  1L8Q A;  3T15 A;  2Z4S A;  2XEP A;  5FSW A;  2OO9 A;  1XNR M;  1XNQ M;  3C3E A;  3CF6 E;  5ITX E;  3U5Z A;  2LVO C;  3LCU A;  1FNN A;  1C1K A;  5L8R F;  5ITR A;  1DO2 A;  2Y20 A;  2F5O A;  2LVP C;  2MR9 A;  3HY5 A;  3NWL A;  2OOA A;  4QHT A;  3KOY E;  4KT0 F;  2QP9 X;  3C58 A;  2QBY B;  1ZV1 A;  1TDZ A;  4R3D A;  3H4M A;  2AHM A;  1NJG A;  1Z59 A;  4LZJ A;  1P3Q Q;  1X37 A;  4QOS A;  2UUC M;  4LF5 M;  4LFB M;  1J7K A;  2I7N A;  4B7H A;  2J7O A;  2C98 A;  1Q3C A;  4JXJ A;  1I4W A;  3FYC A;  4JI5 M;  3PVS A;  5KQD A;  3LQQ A;  2CV2 A;  2JA2 A;  2VF8 A;  4G4O A;  2ZTC A;  4YY3 M;  2R4J A;  4YHH M;  1G59 A;  4QNR A;  4KLN A;  1JQJ C;  3KOW E;  1N34 M;  2WZJ A;  1D0K A;  4RF1 A;  2KEB A;  5JI3 E;  2N35 A;  1NY6 A;  2KNV A;  2RKO A;  3VDU A;  3K2L A;  1OIP A;  4WP2 A;  3SFZ A;  1QAM A;  2R46 A;  4MGY E;  5FTL A;  2K6B A;  4W5W A;  2DZO B;  3BBZ A;  1VEK A;  4GIP A;  5FTN A;  4LJ7 A;  4PCZ A;  2Z4R A;  3U6M A;  3J81 S;  3SC3 A;  3CGW A;  4BLC A;  2EKK A;  3I4V A;  2YQZ A;  2UXC M;  3SMS A;  5GKN A;  2X8A A;  3UGJ A;  2Y21 A;  1N75 A;  3HHW A;  1E94 E;  1Y8G A;  2F4V M;  4CIS A;  4DUZ M;  2R62 A;  1GAB A;  3C3D A;  4I4L A;  2DAG A;  1TDH A;  1VEJ A;  2FFJ A;  3BOS A;  3KDS E;  4D81 A;  4DR7 M;  2R45 A;  3FRI A;  4D80 A;  3UK6 A;  4GKJ M;  4IJF A;  3FUT A;  5EXT A;  3B7Z A;  2VF7 A;  3K9O A;  4NXM M;  2R18 A;  1CUK A;  3GLI A;  1QVR A;  1IQP A;  1K3X A;  3LVV A;  4L78 A;  2DWM A;  4KHP M;  1GO5 A;  3F92 A;  1WIV A;  3KS4 A;  1OIZ A;  1IM2 A;  1E32 A;  1VDL A;  2R0I A;  8CAT A;  4NRV A;  3LQR A;  4NRW A;  2CE7 A;  4LZZ A;  2YFQ A;  4GMQ A;  1N32 M;  3TWM A;  3RGP A;  4B3S M;  1GL6 A;  1WR1 B;  3THG A;  1BVS A;  1Z5C A;  1XWI A;  2X4A A;  2XF3 A;  2YR0 A;  2OOB A;  4IBD A;  3U6C A;  3PFI A;  3QAU A;  5JI2 E;  1A5T A;  4JI0 M;  1EE8 A;  1QQW A;  2XH9 A;  3HU1 A;  1IXZ A;  1TH2 A;  1YLA A;  2FOI C;  3UZU A;  4TUW A;  2DAK A;  4NL4 H;  2QPA A;  4BB9 A;  1XC8 A;  1IN4 A;  3W0F A;  2XSZ A;  1QZM A;  4IBE A;  4DR6 M;  2Q2E B;  1V33 A;  2L4E A;  1R2Z A;  2WSF F;  2LXE A;  3SAU A;  3PNY A;  2E5L M;  4X65 M;  3ZCB B;  3E21 A;  4OVZ B;  2Z3X A;  1NY5 A;  3FRH A;  2WSE F;  2ZBK B;  1J09 A;  4K0K M;  3HHY A;  1GJT A;  1VG5 A;  3KW6 A;  1HR0 M;  2APL A;  2DZN B;  1JR3 E;  2MGW A;  2G5G X;  4XGI A;  2LHC A;  2L7H A;  4DV2 M;  3FTD A;  2R4E A;  3FD9 A;  4I5S A;  3VKH A;  4LRT A;  3BXW A;  1G71 A;  1T6O A;  2F5Q A;  1HJP A;  4JI3 M;  2QNJ A;  2GQF A;  2DEN A;  3GLH E;  3AOE C;  2VDB B;  2BWE A;  4RF0 A;  4REZ A;  2MH8 A;  1TGU A;  1WJ7 A;  3KP0 E;  4AG6 A;  3J80 S;  5A2Q S;  2BWB A;  4LJ4 A;  3MJ5 A;  2C5R A;  3W68 A;  3T1Y M;  4FW9 A;  1OAO C;  2CFO A;  3GLH B;  1L2B A;  2DVW B;  4OVZ A;  2BJW A;  4G3O A;  3DZD A;  3A45 A;  3L28 A;  4S12 A;  5ITU A;  1QYR A;  1DGG A;  2EO2 A;  2CWB A;  4JI7 M;  4B3M M;  1Q3B A;  3HWS A;  1OQY A;  5C18 A;  3GQ5 A;  1EIJ A;  2K0B X;  4R7G A;  2EA0 A;  2C96 A;  2MJ5 B;  4B08 A;  5LMU M;  2F5S A;  1S3S A;  1JR3 A;  3FTE A;  1N77 A;  2JP7 A;  5EJC A;  3KOZ E;  1IBM M;  1SG9 A;  2EKF A;  1TR8 A;  5IT9 S;  2UUB M;  1HNZ M;  5EQT A;  2L7I A;  4DV4 M;  4MGI E;  3GLF E;  4HLQ A;  1ZMV A;  4LFA M;  3GLH A;  1NVM A;  4AQY M;  2QCU A;  4CJ6 A;  3FKE A;  4GC9 A;  1IXR C;  4LJ5 A;  3KXE C;  3TPZ A;  2BNK A;  4GHA A;  1IN8 A;  3U6Q A;  4AI6 A;  2CHV A;  2LVQ D;  3GLF B;  4JV5 M;  2QSF X;  4GKK M;  3K1J A;  5BR8 M;  1WGN A;  2LNH C;  4IIW A;  3L25 A;  1HNX M;  4JI8 M;  4QOZ C;  3GPY A;  4LFC M;  2YNM D;  1ZMU A;  5FTK A;  2UXD M;  3K8Z A;  5ITT A;  2KNZ A;  3HHX A;  1YUB A;  3R9X B;  4DR5 M;  2ZAO A;  1EFU B;  3GLI E;  1MX0 A;  4EIW A;  4QHS A;  4DR3 M;  3LMM A;  3SYL A;  4CGY B;  2DI0 A;  3U61 B;  4M9S A;  2A5Y B;  2Y0T A;  4IBC A;  3GLI B;  3GLF A;  4IJE A;  1Q02 A;  1DV0 A;  4X66 M;  1IN6 A;  2J7N A;  3JR4 A;  2DKL A;  1R6B X;  4MGZ E;  2B3T A;  4LGY A;  4MGH A;  1GVN A;  3NBI A;  3I01 M;  2DHY A;  4HEO A;  3PXG A;  3ZQJ A;  1L2C A;  2W82 A;  1GJS A;  3V76 A;  3JR5 A;  3TQS A;  3U6O A;  5EP1 A;  1IBK M;  1W5T A;  3UJN A;  3J7B A;  4GC5 A;  4KOD A;  4MM3 B;  3T6P A;  1RU3 A;  2XLJ A;  3EIH A;  4RKU F;  3TWK A;  1XHB A;  4NXN M;  4M9X A;  3E46 A;  1IN5 A;  1VDD A;  3C9P A;  3U61 A;  1NNJ A;  1LTM A;  5DNY A;  4NOO B;  1G8P A;  3GQ4 A;  4LF7 M;  4LF6 M;  1PJS A;  5F3W A;  1G4A E;  2V6Z M;  3EIE A;  2GNO A;  3QYB A;  4CHT B;  3VK8 A;  5FTM A;  2KZU A;  4FD2 A;  3L27 A;  1L1Z A;  1IXS B;  3IEC A;  5EP3 A;  1SXJ E;  1D0L A;  4IBI A;  2MRO B;  4PDI A;  2C99 A;  4LJA A;  2C9O A;  3TL4 X;  5KQ8 A;  1JR3 D;  1VEG A;  1OTR A;  2QQ8 A;  3RGS A;  3HJQ A;  4G4Q A;  4ITQ A;  2CHG A;  1PGY A;  4FCV A;  2DXI A;  1QDR A;  1SXJ B;  2JY7 A;  1Q39 A;  2FE8 A;  2V1U A;  1NV8 A;  1ZMW A;  2LWX A;  2I7P A;  4DV3 M;  2JY5 A;  2KA6 B;  4DV0 M;  3SHF A;  1L1T A;  2QEN A;  5DFL A;  2XZF A;  2XFT A;  4L16 A;  2NQ8 C;  1N36 M;  2KNA A;  4GIT A;  4DV1 M;  1WHC A;  1NO1 A;  1XB2 B;  4XBO A;  2CV1 A;  2XGN A;  4DBG B;  4AZF A;  4LF8 M;  3WHL A;  1TH4 A;  4DR4 M;  1IXS A;  3B89 A;  1Z5B A;  3AOG A;  4R71 A;  2DWZ B;  3GLG B;  1MN3 A;  3DOA A;  3GRV A;  1PJJ A;  3H4J A;  2G8L A;  2LTU A;  2O25 A;  4IBK A;  1E9R A;  1D2N A;  4LRS A;  2Z8Y M;  3ZH9 B;  2F5N A;  4G4R A;  1GL7 A;  2V1C A;  3MMP A;  3HX3 A;  4Z8X A;  3IHP A;  4L4U A;  1IY1 A;  2RGH A;  2R65 A;  1SXJ A;  2KW0 A;  4PD2 A;  1R2Y A;  3D8L A;  2JY6 B;  2VQF M;  4LF4 M;  1DGF A;  4BBA A;  4DV6 M;  4OW0 A;  2JNH A;  2OPF A;  4FCT A;  1F4I A;  3J7A S;  5EP4 A;  3TWL A;  7CAT A;  1NJF A;  3K92 A;  4FCW A;  2JZ1 A;  1PM5 A;  1JB0 F;  1R4G A;  3HGI A;  5H37 D;  2LH0 A;  1K82 A;  2CHQ A;  3VDP A;  1IN7 A;  2JXN A;  5EP2 A;  5KPZ A;  4B3T M;  4CIZ A;  3SAR A;  4A3V B;  2K47 A;  5IWA M;  2Y0Q A;  3IG8 A;  3GLG A;  2CEA A;  4KO8 A;  2FNA A;  1MU5 A;  1D0M A;  2LVA A;  3AJI B;  3AV0 A;  5EXX A;  4DR2 M;  1N78 A;  1MJG M;  3R8F A;  3VLF B;  2CRU A; 
#chains in the Genus database with same CATH homology
 1Y8G A;  2KNZ A;  3LCV B;  1KYI A;  1VQ1 A;  2DAI A;  1G41 A;  1QZE A;  2L2D A;  2DAG A;  1VEJ A;  1EFU B;  3GLI E;  3FE3 A;  3FRI A;  2DAE A;  2DI0 A;  3K9O A;  2JZ0 A;  1CUK A;  1GO5 A;  1OAI A;  3F92 A;  2DZL A;  1WIV A;  1Q02 A;  1IM2 A;  1VDL A;  1HT1 E;  2QHO B;  2R0I A;  1DV0 A;  2DKL A;  2CP8 A;  2B3T A;  2DNA A;  4HEO A;  2DHY A;  3K9P A;  1WR1 B;  1BVS A;  2JY8 A;  2OOB A;  5JI2 E;  1A5T A;  1DO0 A;  3T6P A;  2K9D A;  1YLA A;  2DAK A;  1TTE A;  3E46 A;  4F1I A;  1OKS A;  2L4E A;  1IFY A;  3E21 A;  3FRH A;  1G4A E;  1VG5 A;  2KHH A;  1HQY E;  1JR3 E;  2G3Q A;  2MGW A;  1C7Y A;  2HWJ A;  2ZTD A;  2LVN C;  3IEC A;  1WGL A;  2MRO B;  2H5X A;  1NV9 A;  1T6O A;  1VEG A;  1HJP A;  1OTR A;  2QNJ A;  1PGY A;  2DEN A;  2HAK A;  2L4F A;  3GLH E;  4F2L A;  1AIP C;  2BWE A;  4Q7J A;  2JY7 A;  1WJ7 A;  1HT2 E;  2DAM A;  1V92 A;  1NV8 A;  4GEW A;  2BWB A;  2LBC A;  1T43 A;  1ZMW A;  2JY5 A;  5DFL A;  2OO9 A;  2KNA A;  1WHC A;  1XB2 B;  1XXH E;  4G3O A;  2LVO C;  3LCU A;  4UN2 B;  2CWB A;  4DBG B;  1DO2 A;  1OQY A;  2LVP C;  1IXS A;  2MR9 A;  3B89 A;  2K0B X;  4R71 A;  2OOA A;  1MN3 A;  3H4J A;  2MJ5 B;  1ZV1 A;  2LTU A;  2O25 A;  2RRU A;  1P3Q Q;  2JP7 A;  3MMP A;  3IHP A;  1SG9 A;  2EKF A;  1TR8 A;  2JY6 B;  2JUJ A;  2JNH A;  1F4I A;  3GLF E;  2ZTC A;  1ZMV A;  1G3I A;  2EJS A;  2WZJ A;  2JZ1 A;  3GLG E;  2KNV A;  1R4G A;  4WP2 A;  1UFZ A;  2LVQ D;  2QSF X;  3BBZ A;  1VEK A;  1WGN A;  2EKK A;  2LVA A;  1ZMU A;  1E94 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...