1WR1B

The complex sturcture of dsk2p uba with ubiquitin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
58
structure length
58
Chain Sequence
PGISGGGGGILDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Ubiquitin
publication title Structure of the UBA domain of Dsk2p in complex with ubiquitin molecular determinants for ubiquitin recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 19
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2004-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wr1B01
2L4FA 2DAGA 2ZTDA 2LVNC 2L4EA 1NV8A 2G3QA 2K9DA 1YLAA 3GLHE 2JY5A 2QNJA 2KNZA 2QSFX 2KNVA 3B89A 2LVAA 1A5TA 2OO9A 2EKFA 1EFUB 2RRUA 4WP2A 2DI0A 1WGLA 3GLIE 5DFLA 1G3IA 2KNAA 1IFYA 3E21A 2MR9A 2LVOC 4Q7JA 1C7YA 1WHCA 2CWBA 2HWJA 1WGNA 4HEOA 1GO5A 1HT1E 1DV0A 2JZ1A 1OTRA 1E94E 1VDLA 3K9OA 1CUKA 1VQ1A 1XB2B 1G4AE 3FRHA 3MMPA 2JY6B 3F92A 1AIPC 1TR8A 1Y8GA 1R4GA 2DAMA 2LVPC 1T6OA 2DKLA 2KHHA 4UN2B 4GEWA 2EJSA 1OAIA 1P3QQ 2MJ5B 2DZLA 2QHOB 4DBGB 2CP8A 4F2LA 2ZTCA 3LCUA 2DENA 1HQYE 4F1IA 1DO0A 2B3TA 1WR1B 1VG5A 3BBZA 1HJPA 1QZEA 1TTEA 2BWBA 2HAKA 3H4JA 4R71A 3GLFE 2JNHA 1PGYA 1ZMWA 1KYIA 2JY7A 2JP7A 1OKSA 2OOBA 2DAIA 1DO2A 1JR3E 1HT2E 2WZJA 2JUJA 2LVQD 1OQYA 1VEJA 2BWEA 1Q02A 1ZMVA 3E46A 2K0BX 2LTUA 1NV9A 1VEGA 3K9PA 4G3OA 2R0IA 2H5XA 2O25A 1BVSA 5JI2E 2DHYA 2LBCA 1V92A 1IXSA 1VEKA 1T43A 1ZV1A 1MN3A 1WJ7A 2JZ0A 2L2DA 2EKKA 1SG9A 3GLGE 2OOAA 3T6PA 1F4IA 1UFZA 1ZMUA 1WIVA 1IM2A 2JY8A 1G41A 3FE3A 2MROB 3LCVB 2MGWA 3FRIA 2DNAA 2DAKA 3IHPA 3IECA 1XXHE 2DAEA
chains in the Genus database with same CATH superfamily
3A45A 3L26A 3GQ4A 1LTMA 2L4FA 2WSCF 1SXJD 4IBCA 3U5ZB 4XGIA 5KPRA 2DAGA 2ZTDA 1N77A 4FWGA 4I5SA 3NBXX 3VK7A 1TDHA 5ITYA 1G59A 3L27A 1GABA 2RRUA 4HL4A 1TGUA 4NOOB 2HHHM 3HJQA 1L8QA 5ITUA 1JR3A 1JB0F 1I4WA 2CE7A 2MR9A 5DYGA 3U60A 3KS8A 3IG8A 2K47A 4GMQA 5C1BA 3KSJA 1DV0A 4DV0M 1IN6A 1MX0A 1E94E 1OTRA 4Z8XA 1VQ1A 3E9SA 3D8BA 4JI4M 1XB2B 3KOYE 5IREB 2JY6B 4R3DA 3SHGB 1J09A 3ZCBB 1V33A 5ITXA 5E6JA 2DAMA 4LJ4A 2F5OA 3MK6A 2BNKA 2RGOA 4I81A 4M0WA 5EP4A 4D81A 5EP2A 3BOSA 3PNVA 4LJ9A 5H37D 1GL6A 2DZNB 4UN2B 4GEWA 3TL4X 4GHLA 1P3QQ 2GQFA 3CTWB 3J80S 3AOEC 2QHOB 3EIEA 1IBMM 2XFTA 5EP1A 3GLGB 2QQ8A 1PJJA 4X65M 3HU1A 2MH8A 2Y0TA 4PDIA 2R46A 1NO1A 4GC5A 4DV1M 1T3TA 2D7HA 3AJIB 3R8FA 1D2NA 1HJPA 2R62A 5FTLA 4GIPA 4NRWA 3T15A 2CHVA 1OJLA 3AOGA 3J2PB 1TTEA 4ANRA 3GPPA 2O01F 3UMMA 3KXEC 2QENA 1IQPA 4R71A 3GLFE 1XXHB 1Z5AA 1PGYA 1ZAEA 4WW0A 5FTKA 2R45A 3SAUA 2UUAM 2QP9X 3IG5A 5IZ7D 4TUWA 4REZA 1DO2A 4LF4M 4B08A 1OQYA 3SYKA 1SXJC 3MJ5A 2JXNA 2BWEA 4NSRA 1G8PA 1ZMVA 4B7GA 3PNYA 3A98B 4LF9M 1PRBA 3FYDA 2DWNA 4MGZE 1AUAA 2XZUA 1E9SA 2KDLA 1DGHB 2R0IA 1TH3A 3HJ8A 1IY2A 1ZQ9A 1I94M 3FUWA 2M60A 4GH9A 1IXSA 2EO2A 1DGFA 4A3VB 4HLQA 3FD9A 4FCWA 4JI1M 4QOZC 5FTNA 2N35A 4P17A 2FOIC 1SG9A 2FS1A 4S12A 2EA0A 1UFZA 2NQ8C 4LCBA 2VF8A 4EIWA 2XZFA 3W0FA 3ZQJA 1NY5A 1WIVA 3SAVA 3U61A 2YNMD 2DWLA 3CF6E 5EQTA 1IM2A 2JY8A 4ZPXA 3B7ZA 4M0DA 3LW5F 3FTEA 1WXQA 3VDUA 3VLFB 3LCVB 3LVVA 3SAWA 4LRSA 1SXJE 3HU3A 1R2YA 2LXEA 4FVMA 3TWMA 4L15A 2Y21A 2DWMA 4LZZA 3FTFA 1L2BA 1HNXM 4JI3M 3RFWA 2LVNC 4PDGA 1NV8A 2J7NA 5EXXA 1YLAA 3GLHE 2QNJA 2CEAA 3GLFA 3VDPA 3B89A 2LVAA 2FE8A 1A5TA 4MGKE 3JR4A 2KEBA 4OX9M 3GLIE 1IFYA 2RGHA 1G3IA 2KNAA 5DFLA 1IBLM 4X66M 1NJGA 1YE9A 2H1RA 4D80A 1L2CA 5DYIA 4AKHA 2EUCA 2LVOC 3AOEA 3UGJA 4MH0E 1NHWC 2L7HA 2HWJA 3GRVA 4HEOA 2XSZA 3FUTA 1GO5A 4AI6A 1HT1E 2JZ1A 3L28A 1VDLA 2YFQA 3DZDA 4WURA 4OVZA 1TF0B 4NRVA 1J7KA 1E9RA 1Z6TA 3MMPA 3M0EA 1R2ZA 5EJCA 1NSFA 4LF7M 1LV7A 5FTMA 1Y8GA 2AHMA 4LFBM 3C58A 1C1KA 4K0KM 1PJIA 4II7A 1HR0M 1XC8A 5F3WA 4B3RM 2C96A 2CUZA 2KHHA 4DR2M 3DA1A 4ITQA 1IXRC 3SBJA 4DV5M 2MJ5B 2X4AA 2C98A 2DZLA 3W68A 2ZAMA 3FTDA 1PM5A 1XMOM 2XEPA 5A2QS 3SMPA 4CJ6A 1RU3A 1SXJA 2ERCA 1JR3D 2R65A 3GRUA 4CHTB 4KODA 2OPFA 3BBZA 2G8LA 1EE8A 2M5ZA 3U6DA 3TWKA 3M6AA 3KFUG 1KSFX 1N75A 3AL0C 3L29A 1YUBA 3GLHA 2YR0A 3MHVC 3C3DA 3LMMA 3DOAA 1DGBA 3CGWA 3HKPA 4LGMA 4PT5A 2X8AA 2F5SA 2QBYA 3I4VA 4AKGA 4FCTA 1ZMWA 1KYIA 2JY7A 3HHZA 2ZBKB 2C5RA 2A5YB 2JP7A 1OKSA 3U6SA 2KA6B 3FTCA 2UU9M 1VDDA 3GLIA 1OIPA 3HZJA 1IXZA 4YHHM 4LJ7A 3E4RA 4W5WA 1HT2E 2C9OA 2BJWA 2KRUA 4QOSA 5E26A 2Q2EB 3L2AA 1VEJA 3GPXA 1QQWA 4B3TM 4LY6A 1XMQM 4BB9A 2D7GA 3GPYA 1Q02A 2K6BA 3PXGA 2K0BX 4DV4M 1QAOA 4MGYE 3LQQA 4FD2A 2ZAOA 5ITQA 4G3OA 5FLXS 4OW0A 2H5XA 1EIJA 2I7PA 5JI2E 4L16A 2V1UA 3HWSA 5IT9S 2D7EA 4LJ5A 3HHYA 1WJ7A 2JZ0A 4JI6M 2CV0A 2L2DA 1D0KA 1QUTA 2EKKA 4XK8F 1D0MA 2Z7JA 3GLGE 2OOAA 2VIIA 3U6QA 3TPZA 4IIWA 1ZMUA 2Z8YM 4IBIA 2KZUA 2CHQA 3AV0A 1Z5CA 2VF7A 2WSFF 2VDBB 3KOZE 3SHFA 3TE6A 3U5ZA 4B3MM 2KRKA 4LZJA 2MGWA 3DFZA 3QYEA 4L4UA 4NL4H 4FCVA 4MB7A 3RGSA 3UZUA 2Z3XA 2XFSA 2DNAA 4IJFA 4RNAA 1IY0A 2BJVA 4X64M 1XXHE 2DAEA 4QNMA 4LFAM 1DGGA 3T1HM 5GKNA 5IWAM 2L4EA 1XNRM 2DZOB 4G4RA 2X49A 1N36M 2UXBM 2JY5A 2KNZA 3B7QA 4FWDA 2CFOA 1NNUC 2XLJA 2OO9A 4LJAA 3J27B 3GRRA 2EKFA 4IBEA 1EFUB 1H6UA 2P5TA 4CIZA 1IBKM 3L25A 3E21A 2UXDM 1IN7A 3THGA 4AKIA 4AZFA 1R6BX 4IBKA 4JI7M 1C7YA 3HJSA 3U6PA 2CRUA 2CWBA 1WGNA 3B9PA 3K9OA 1QAMA 2L09A 1CUKA 3HY5A 4G6ZA 3WHKA 3V76A 3FRHA 3LVWA 4GKJM 3U60B 1TR8A 3ILKA 1KFVA 1R4GA 4QNRA 3ZH9B 3CF0A 1NNJA 1QAQA 2LVPC 4GKKM 1OFIA 4L8RC 3VKHA 1T6OA 3WHLA 2F4VM 4IBGA 4DUZM 3B74A 3KVWA 2Y20A 1Q3CA 2DKLA 3KDSE 3Q8GA 2XF3A 3U6MA 1TH2A 3GLGA 2R6FA 2F5QA 1OFHA 1JQJC 4JYAM 2XGNA 3LQRA 1OAOC 3OTOM 4M9SA 1N34M 1GLNA 4DBGB 2CP8A 4F2LA 5LMUM 1IN4A 2ZTCA 1K3XA 4DV7M 2DXIA 2R18A 5EXPA 1K3WA 4F1IA 1DO0A 2B3TA 3I01M 3JR5A 1WR1B 3AFHA 1VG5A 2LNHC 1XXHA 4KO8A 2XSZD 2FFJA 5KPZA 1QZEA 3TWLA 3FUXA 1W5TA 5FTJA 1QUSA 2QZ4A 2BWBA 3KW6A 3GQ5A 1K82A 4DR7M 3J7AS 1NJFA 3D8LA 2LWXA 3A42A 3H4JA 4GC9A 4DR3M 3R9XB 4LF5M 3NWLA 4DR5M 4LJ6A 5ITRA 4DR6M 2ZM6M 2OQ4A 2OOBA 3GQ3A 1UM8A 4CISA 4LFCM 1ORYB 1N32M 2JUJA 2LVQD 1DGHA 4IJEA 4MM3B 4QHTA 3C9PA 4LRTA 1HNZM 4RKUF 1R7RA 3E46A 3VK8A 1NV9A 4DV2M 3K9PA 4BBAA 2HL7A 1YSYA 4AW4A 4LF6M 2LHGA 2Y0QA 4B7HA 4MGHA 1V92A 4PCZA 3GP1A 4AG6A 4JXJA 1ZV1A 1MN3A 3HHXA 3HU2A 4JI0M 4AG5A 2UXCM 1IY1A 3FKEA 3TQSA 1F4IA 2L6OA 1Z5BA 1IXSB 2KZSA 3KOWE 4NC6A 1FJGM 3SMSA 8CATA 4M9XA 2QPAA 4RF0A 1G41A 4PD2A 4DUYM 4G4QA 4XBOA 3I4YA 4B3SM 4MGIE 5KO3A 1XHBA 3UK6A 2FH0A 1GJSA 3U61B 3HHWA 4FW9A 1N33M 3IHPA 3IECA 4X62M 2HAKA 2HCBA 3SARA 2CHGA 3GRYA 4IBDA 2DVWB 2Z4RA 1V34A 2G3QA 2K9DA 3QWLA 3FYCA 2QSFX 3I51A 1MJGM 2KNVA 3GPUA 3C3EA 5ITTA 1QANA 3SATA 3K92A 5KQ8A 4WP2A 3KP1E 2DI0A 3KS4A 1WGLA 3W67A 2YQZA 5EP3A 3K1JA 3NBIA 3KOXE 3U6LA 1D0LA 3GLFB 1IN8A 3H4MA 4I8OA 4R7GA 2LH0A 2O5RA 4IBJA 3HX3A 1N78A 4Q7JA 4JI8M 1WHCA 2KW0A 4G4NA 3VFDA 5EXSA 1Q3BA 2E5LM 1G4AE 3J81S 3F92A 1AIPC 1GVNA 5LMNM 4NXNM 1IN5A 4BLCA 3T1YM 1NVMA 5DNYA 1GJTA 4OVZB 4KLNA 4QHSA 1PJSA 1S3SA 2FNAA 3AKZA 3VKGA 1Z59A 3FUUA 2R4JA 5KPTA 1MU5A 1TH4A 3JAMS 7CATA 1TDZA 2EJSA 3U6EA 1OAIA 2JWSA 2WSEF 5BR8M 3U6OA 4Z6YA 4DV6M 2JA2A 3RE8A 1NHGC 5FSWA 2RKOA 2V6ZM 3LCUA 4Y28F 3SYLA 2DENA 1HQYE 3SFZA 2J7OA 4L78A 1QZMA 3I04M 2DWZB 3UJNA 2VQEM 2C9CA 3HGIA 4GRIA 2CV2A 2UUBM 3BXWA 2V1CA 4JN6A 2VQFM 1QYRA 3Q8XA 4D82A 4I4LA 4P16A 1W5SA 1QDRA 2APLA 1SXJB 3KP0E 3A46A 2W82A 4GHAA 3QAUA 1PJTA 2JNHA 1QVRA 1J5EM 3M7GA 1L2DA 2J5YA 4KT0F 5L8RF 2G5GX 3QYBA 3EIHA 2HKJA 3W0LB 3ZC7B 3GLHB 4IBBA 2R4EA 3GO8A 3SC3A 2DAIA 4LF8M 4YY3M 2QBYB 1JR3E 3K8ZA 2WZJA 4GITA 4IBFA 2GNOA 4LGYA 3RGPA 2F5PA 4JI5M 2C99A 2F5NA 1FNNA 2KXEA 1GKIA 4DR4M 1R5LA 1XWIA 3GLIB 3J7BA 1HQCA 1VEGA 2XH9A 3PFIA 1G71A 1E32A 4RF1A 2UUCM 4NXMM 3U6CA 1Q39A 3T38A 2O25A 5ITXE 1BVSA 2DHRA 5C18A 2DHYA 2LBCA 2R44A 1VEKA 3CF2A 4FWHA 5BPVA 1XNQM 4KHPM 1T43A 2QCUA 2LHCA 1OIZA 4LJ8A 4AQYM 3T6PA 1L1ZA 4JI2M 4B7FA 4NSOB 3SASA 1L1TA 1PJQA 4JV5M 4M9ZA 2CV1A 2L7IA 5JI3E 1HNWM 2I7NA 1QDTA 3FE3A 5EXTA 1GL7A 1X37A 4OU7A 4CGYB 2MROB 4DV3M 3FUVA 2ZANA 3KSXA 3PVSA 3B7NA 5KQDA 4LG2A 3K2LA 4L6V6 3FRIA 4G4OA 4DR1M 2Z4SA 2DAKA 1NY6A 2LTUA
chains in the Genus database with same CATH topology
2L4FA 2DAGA 2ZTDA 2LVNC 2L4EA 1NV8A 2G3QA 2K9DA 1YLAA 3GLHE 2JY5A 2QNJA 2KNZA 2QSFX 2KNVA 3B89A 2LVAA 1A5TA 2OO9A 2EKFA 1EFUB 2RRUA 4WP2A 2DI0A 1WGLA 3GLIE 5DFLA 1G3IA 2KNAA 1IFYA 3E21A 2MR9A 2LVOC 4Q7JA 1C7YA 1WHCA 2CWBA 2HWJA 1WGNA 4HEOA 1GO5A 1HT1E 1DV0A 2JZ1A 1OTRA 1E94E 1VDLA 3K9OA 1CUKA 1VQ1A 1XB2B 1G4AE 3FRHA 3MMPA 2JY6B 3F92A 1AIPC 1TR8A 1Y8GA 1R4GA 2DAMA 2LVPC 1T6OA 2DKLA 2KHHA 4UN2B 4GEWA 2EJSA 1OAIA 1P3QQ 2MJ5B 2DZLA 2QHOB 4DBGB 2CP8A 4F2LA 2ZTCA 3LCUA 2DENA 1HQYE 4F1IA 1DO0A 2B3TA 1WR1B 1VG5A 3BBZA 1HJPA 1QZEA 1TTEA 2BWBA 2HAKA 3H4JA 4R71A 3GLFE 2JNHA 1PGYA 1ZMWA 1KYIA 2JY7A 2JP7A 1OKSA 2OOBA 2DAIA 1DO2A 1JR3E 1HT2E 2WZJA 2JUJA 2LVQD 1OQYA 1VEJA 2BWEA 1Q02A 1ZMVA 3E46A 2K0BX 2LTUA 1NV9A 1VEGA 3K9PA 4G3OA 2R0IA 2H5XA 2O25A 1BVSA 5JI2E 2DHYA 2LBCA 1V92A 1IXSA 1VEKA 1T43A 1ZV1A 1MN3A 1WJ7A 2JZ0A 2L2DA 2EKKA 1SG9A 3GLGE 2OOAA 3T6PA 1F4IA 1UFZA 1ZMUA 1WIVA 1IM2A 2JY8A 1G41A 3FE3A 2MROB 3LCVB 2MGWA 3FRIA 2DNAA 2DAKA 3IHPA 3IECA 1XXHE 2DAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4F A;  2DAG A;  2ZTD A;  2LVN C;  2L4E A;  1NV8 A;  2G3Q A;  2K9D A;  1YLA A;  3GLH E;  2JY5 A;  2QNJ A;  2KNZ A;  2QSF X;  2KNV A;  3B89 A;  2LVA A;  1A5T A;  2OO9 A;  2EKF A;  1EFU B;  2RRU A;  4WP2 A;  2DI0 A;  1WGL A;  3GLI E;  5DFL A;  1G3I A;  2KNA A;  1IFY A;  3E21 A;  2MR9 A;  2LVO C;  4Q7J A;  1C7Y A;  1WHC A;  2CWB A;  2HWJ A;  1WGN A;  4HEO A;  1GO5 A;  1HT1 E;  1DV0 A;  2JZ1 A;  1OTR A;  1E94 E;  1VDL A;  3K9O A;  1CUK A;  1VQ1 A;  1XB2 B;  1G4A E;  3FRH A;  3MMP A;  2JY6 B;  3F92 A;  1AIP C;  1TR8 A;  1Y8G A;  1R4G A;  2DAM A;  2LVP C;  1T6O A;  2DKL A;  2KHH A;  4UN2 B;  4GEW A;  2EJS A;  1OAI A;  1P3Q Q;  2MJ5 B;  2DZL A;  2QHO B;  4DBG B;  2CP8 A;  4F2L A;  2ZTC A;  3LCU A;  2DEN A;  1HQY E;  4F1I A;  1DO0 A;  2B3T A;  1WR1 B;  1VG5 A;  3BBZ A;  1HJP A;  1QZE A;  1TTE A;  2BWB A;  2HAK A;  3H4J A;  4R71 A;  3GLF E;  2JNH A;  1PGY A;  1ZMW A;  1KYI A;  2JY7 A;  2JP7 A;  1OKS A;  2OOB A;  2DAI A;  1DO2 A;  1JR3 E;  1HT2 E;  2WZJ A;  2JUJ A;  2LVQ D;  1OQY A;  1VEJ A;  2BWE A;  1Q02 A;  1ZMV A;  3E46 A;  2K0B X;  2LTU A;  1NV9 A;  1VEG A;  3K9P A;  4G3O A;  2R0I A;  2H5X A;  2O25 A;  1BVS A;  5JI2 E;  2DHY A;  2LBC A;  1V92 A;  1IXS A;  1VEK A;  1T43 A;  1ZV1 A;  1MN3 A;  1WJ7 A;  2JZ0 A;  2L2D A;  2EKK A;  1SG9 A;  3GLG E;  2OOA A;  3T6P A;  1F4I A;  1UFZ A;  1ZMU A;  1WIV A;  1IM2 A;  2JY8 A;  1G41 A;  3FE3 A;  2MRO B;  3LCV B;  2MGW A;  3FRI A;  2DNA A;  2DAK A;  3IHP A;  3IEC A;  1XXH E;  2DAE A; 
#chains in the Genus database with same CATH topology
 3A45 A;  3L26 A;  3GQ4 A;  1LTM A;  2L4F A;  2WSC F;  1SXJ D;  4IBC A;  3U5Z B;  4XGI A;  5KPR A;  2DAG A;  2ZTD A;  1N77 A;  4FWG A;  4I5S A;  3NBX X;  3VK7 A;  1TDH A;  5ITY A;  1G59 A;  3L27 A;  1GAB A;  2RRU A;  4HL4 A;  1TGU A;  4NOO B;  2HHH M;  3HJQ A;  1L8Q A;  5ITU A;  1JR3 A;  1JB0 F;  1I4W A;  2CE7 A;  2MR9 A;  5DYG A;  3U60 A;  3KS8 A;  3IG8 A;  2K47 A;  4GMQ A;  5C1B A;  3KSJ A;  1DV0 A;  4DV0 M;  1IN6 A;  1MX0 A;  1E94 E;  1OTR A;  4Z8X A;  1VQ1 A;  3E9S A;  3D8B A;  4JI4 M;  1XB2 B;  3KOY E;  5IRE B;  2JY6 B;  4R3D A;  3SHG B;  1J09 A;  3ZCB B;  1V33 A;  5ITX A;  5E6J A;  2DAM A;  4LJ4 A;  2F5O A;  3MK6 A;  2BNK A;  2RGO A;  4I81 A;  4M0W A;  5EP4 A;  4D81 A;  5EP2 A;  3BOS A;  3PNV A;  4LJ9 A;  5H37 D;  1GL6 A;  2DZN B;  4UN2 B;  4GEW A;  3TL4 X;  4GHL A;  1P3Q Q;  2GQF A;  3CTW B;  3J80 S;  3AOE C;  2QHO B;  3EIE A;  1IBM M;  2XFT A;  5EP1 A;  3GLG B;  2QQ8 A;  1PJJ A;  4X65 M;  3HU1 A;  2MH8 A;  2Y0T A;  4PDI A;  2R46 A;  1NO1 A;  4GC5 A;  4DV1 M;  1T3T A;  2D7H A;  3AJI B;  3R8F A;  1D2N A;  1HJP A;  2R62 A;  5FTL A;  4GIP A;  4NRW A;  3T15 A;  2CHV A;  1OJL A;  3AOG A;  3J2P B;  1TTE A;  4ANR A;  3GPP A;  2O01 F;  3UMM A;  3KXE C;  2QEN A;  1IQP A;  4R71 A;  3GLF E;  1XXH B;  1Z5A A;  1PGY A;  1ZAE A;  4WW0 A;  5FTK A;  2R45 A;  3SAU A;  2UUA M;  2QP9 X;  3IG5 A;  5IZ7 D;  4TUW A;  4REZ A;  1DO2 A;  4LF4 M;  4B08 A;  1OQY A;  3SYK A;  1SXJ C;  3MJ5 A;  2JXN A;  2BWE A;  4NSR A;  1G8P A;  1ZMV A;  4B7G A;  3PNY A;  3A98 B;  4LF9 M;  1PRB A;  3FYD A;  2DWN A;  4MGZ E;  1AUA A;  2XZU A;  1E9S A;  2KDL A;  1DGH B;  2R0I A;  1TH3 A;  3HJ8 A;  1IY2 A;  1ZQ9 A;  1I94 M;  3FUW A;  2M60 A;  4GH9 A;  1IXS A;  2EO2 A;  1DGF A;  4A3V B;  4HLQ A;  3FD9 A;  4FCW A;  4JI1 M;  4QOZ C;  5FTN A;  2N35 A;  4P17 A;  2FOI C;  1SG9 A;  2FS1 A;  4S12 A;  2EA0 A;  1UFZ A;  2NQ8 C;  4LCB A;  2VF8 A;  4EIW A;  2XZF A;  3W0F A;  3ZQJ A;  1NY5 A;  1WIV A;  3SAV A;  3U61 A;  2YNM D;  2DWL A;  3CF6 E;  5EQT A;  1IM2 A;  2JY8 A;  4ZPX A;  3B7Z A;  4M0D A;  3LW5 F;  3FTE A;  1WXQ A;  3VDU A;  3VLF B;  3LCV B;  3LVV A;  3SAW A;  4LRS A;  1SXJ E;  3HU3 A;  1R2Y A;  2LXE A;  4FVM A;  3TWM A;  4L15 A;  2Y21 A;  2DWM A;  4LZZ A;  3FTF A;  1L2B A;  1HNX M;  4JI3 M;  3RFW A;  2LVN C;  4PDG A;  1NV8 A;  2J7N A;  5EXX A;  1YLA A;  3GLH E;  2QNJ A;  2CEA A;  3GLF A;  3VDP A;  3B89 A;  2LVA A;  2FE8 A;  1A5T A;  4MGK E;  3JR4 A;  2KEB A;  4OX9 M;  3GLI E;  1IFY A;  2RGH A;  1G3I A;  2KNA A;  5DFL A;  1IBL M;  4X66 M;  1NJG A;  1YE9 A;  2H1R A;  4D80 A;  1L2C A;  5DYI A;  4AKH A;  2EUC A;  2LVO C;  3AOE A;  3UGJ A;  4MH0 E;  1NHW C;  2L7H A;  2HWJ A;  3GRV A;  4HEO A;  2XSZ A;  3FUT A;  1GO5 A;  4AI6 A;  1HT1 E;  2JZ1 A;  3L28 A;  1VDL A;  2YFQ A;  3DZD A;  4WUR A;  4OVZ A;  1TF0 B;  4NRV A;  1J7K A;  1E9R A;  1Z6T A;  3MMP A;  3M0E A;  1R2Z A;  5EJC A;  1NSF A;  4LF7 M;  1LV7 A;  5FTM A;  1Y8G A;  2AHM A;  4LFB M;  3C58 A;  1C1K A;  4K0K M;  1PJI A;  4II7 A;  1HR0 M;  1XC8 A;  5F3W A;  4B3R M;  2C96 A;  2CUZ A;  2KHH A;  4DR2 M;  3DA1 A;  4ITQ A;  1IXR C;  3SBJ A;  4DV5 M;  2MJ5 B;  2X4A A;  2C98 A;  2DZL A;  3W68 A;  2ZAM A;  3FTD A;  1PM5 A;  1XMO M;  2XEP A;  5A2Q S;  3SMP A;  4CJ6 A;  1RU3 A;  1SXJ A;  2ERC A;  1JR3 D;  2R65 A;  3GRU A;  4CHT B;  4KOD A;  2OPF A;  3BBZ A;  2G8L A;  1EE8 A;  2M5Z A;  3U6D A;  3TWK A;  3M6A A;  3KFU G;  1KSF X;  1N75 A;  3AL0 C;  3L29 A;  1YUB A;  3GLH A;  2YR0 A;  3MHV C;  3C3D A;  3LMM A;  3DOA A;  1DGB A;  3CGW A;  3HKP A;  4LGM A;  4PT5 A;  2X8A A;  2F5S A;  2QBY A;  3I4V A;  4AKG A;  4FCT A;  1ZMW A;  1KYI A;  2JY7 A;  3HHZ A;  2ZBK B;  2C5R A;  2A5Y B;  2JP7 A;  1OKS A;  3U6S A;  2KA6 B;  3FTC A;  2UU9 M;  1VDD A;  3GLI A;  1OIP A;  3HZJ A;  1IXZ A;  4YHH M;  4LJ7 A;  3E4R A;  4W5W A;  1HT2 E;  2C9O A;  2BJW A;  2KRU A;  4QOS A;  5E26 A;  2Q2E B;  3L2A A;  1VEJ A;  3GPX A;  1QQW A;  4B3T M;  4LY6 A;  1XMQ M;  4BB9 A;  2D7G A;  3GPY A;  1Q02 A;  2K6B A;  3PXG A;  2K0B X;  4DV4 M;  1QAO A;  4MGY E;  3LQQ A;  4FD2 A;  2ZAO A;  5ITQ A;  4G3O A;  5FLX S;  4OW0 A;  2H5X A;  1EIJ A;  2I7P A;  5JI2 E;  4L16 A;  2V1U A;  3HWS A;  5IT9 S;  2D7E A;  4LJ5 A;  3HHY A;  1WJ7 A;  2JZ0 A;  4JI6 M;  2CV0 A;  2L2D A;  1D0K A;  1QUT A;  2EKK A;  4XK8 F;  1D0M A;  2Z7J A;  3GLG E;  2OOA A;  2VII A;  3U6Q A;  3TPZ A;  4IIW A;  1ZMU A;  2Z8Y M;  4IBI A;  2KZU A;  2CHQ A;  3AV0 A;  1Z5C A;  2VF7 A;  2WSF F;  2VDB B;  3KOZ E;  3SHF A;  3TE6 A;  3U5Z A;  4B3M M;  2KRK A;  4LZJ A;  2MGW A;  3DFZ A;  3QYE A;  4L4U A;  4NL4 H;  4FCV A;  4MB7 A;  3RGS A;  3UZU A;  2Z3X A;  2XFS A;  2DNA A;  4IJF A;  4RNA A;  1IY0 A;  2BJV A;  4X64 M;  1XXH E;  2DAE A;  4QNM A;  4LFA M;  1DGG A;  3T1H M;  5GKN A;  5IWA M;  2L4E A;  1XNR M;  2DZO B;  4G4R A;  2X49 A;  1N36 M;  2UXB M;  2JY5 A;  2KNZ A;  3B7Q A;  4FWD A;  2CFO A;  1NNU C;  2XLJ A;  2OO9 A;  4LJA A;  3J27 B;  3GRR A;  2EKF A;  4IBE A;  1EFU B;  1H6U A;  2P5T A;  4CIZ A;  1IBK M;  3L25 A;  3E21 A;  2UXD M;  1IN7 A;  3THG A;  4AKI A;  4AZF A;  1R6B X;  4IBK A;  4JI7 M;  1C7Y A;  3HJS A;  3U6P A;  2CRU A;  2CWB A;  1WGN A;  3B9P A;  3K9O A;  1QAM A;  2L09 A;  1CUK A;  3HY5 A;  4G6Z A;  3WHK A;  3V76 A;  3FRH A;  3LVW A;  4GKJ M;  3U60 B;  1TR8 A;  3ILK A;  1KFV A;  1R4G A;  4QNR A;  3ZH9 B;  3CF0 A;  1NNJ A;  1QAQ A;  2LVP C;  4GKK M;  1OFI A;  4L8R C;  3VKH A;  1T6O A;  3WHL A;  2F4V M;  4IBG A;  4DUZ M;  3B74 A;  3KVW A;  2Y20 A;  1Q3C A;  2DKL A;  3KDS E;  3Q8G A;  2XF3 A;  3U6M A;  1TH2 A;  3GLG A;  2R6F A;  2F5Q A;  1OFH A;  1JQJ C;  4JYA M;  2XGN A;  3LQR A;  1OAO C;  3OTO M;  4M9S A;  1N34 M;  1GLN A;  4DBG B;  2CP8 A;  4F2L A;  5LMU M;  1IN4 A;  2ZTC A;  1K3X A;  4DV7 M;  2DXI A;  2R18 A;  5EXP A;  1K3W A;  4F1I A;  1DO0 A;  2B3T A;  3I01 M;  3JR5 A;  1WR1 B;  3AFH A;  1VG5 A;  2LNH C;  1XXH A;  4KO8 A;  2XSZ D;  2FFJ A;  5KPZ A;  1QZE A;  3TWL A;  3FUX A;  1W5T A;  5FTJ A;  1QUS A;  2QZ4 A;  2BWB A;  3KW6 A;  3GQ5 A;  1K82 A;  4DR7 M;  3J7A S;  1NJF A;  3D8L A;  2LWX A;  3A42 A;  3H4J A;  4GC9 A;  4DR3 M;  3R9X B;  4LF5 M;  3NWL A;  4DR5 M;  4LJ6 A;  5ITR A;  4DR6 M;  2ZM6 M;  2OQ4 A;  2OOB A;  3GQ3 A;  1UM8 A;  4CIS A;  4LFC M;  1ORY B;  1N32 M;  2JUJ A;  2LVQ D;  1DGH A;  4IJE A;  4MM3 B;  4QHT A;  3C9P A;  4LRT A;  1HNZ M;  4RKU F;  1R7R A;  3E46 A;  3VK8 A;  1NV9 A;  4DV2 M;  3K9P A;  4BBA A;  2HL7 A;  1YSY A;  4AW4 A;  4LF6 M;  2LHG A;  2Y0Q A;  4B7H A;  4MGH A;  1V92 A;  4PCZ A;  3GP1 A;  4AG6 A;  4JXJ A;  1ZV1 A;  1MN3 A;  3HHX A;  3HU2 A;  4JI0 M;  4AG5 A;  2UXC M;  1IY1 A;  3FKE A;  3TQS A;  1F4I A;  2L6O A;  1Z5B A;  1IXS B;  2KZS A;  3KOW E;  4NC6 A;  1FJG M;  3SMS A;  8CAT A;  4M9X A;  2QPA A;  4RF0 A;  1G41 A;  4PD2 A;  4DUY M;  4G4Q A;  4XBO A;  3I4Y A;  4B3S M;  4MGI E;  5KO3 A;  1XHB A;  3UK6 A;  2FH0 A;  1GJS A;  3U61 B;  3HHW A;  4FW9 A;  1N33 M;  3IHP A;  3IEC A;  4X62 M;  2HAK A;  2HCB A;  3SAR A;  2CHG A;  3GRY A;  4IBD A;  2DVW B;  2Z4R A;  1V34 A;  2G3Q A;  2K9D A;  3QWL A;  3FYC A;  2QSF X;  3I51 A;  1MJG M;  2KNV A;  3GPU A;  3C3E A;  5ITT A;  1QAN A;  3SAT A;  3K92 A;  5KQ8 A;  4WP2 A;  3KP1 E;  2DI0 A;  3KS4 A;  1WGL A;  3W67 A;  2YQZ A;  5EP3 A;  3K1J A;  3NBI A;  3KOX E;  3U6L A;  1D0L A;  3GLF B;  1IN8 A;  3H4M A;  4I8O A;  4R7G A;  2LH0 A;  2O5R A;  4IBJ A;  3HX3 A;  1N78 A;  4Q7J A;  4JI8 M;  1WHC A;  2KW0 A;  4G4N A;  3VFD A;  5EXS A;  1Q3B A;  2E5L M;  1G4A E;  3J81 S;  3F92 A;  1AIP C;  1GVN A;  5LMN M;  4NXN M;  1IN5 A;  4BLC A;  3T1Y M;  1NVM A;  5DNY A;  1GJT A;  4OVZ B;  4KLN A;  4QHS A;  1PJS A;  1S3S A;  2FNA A;  3AKZ A;  3VKG A;  1Z59 A;  3FUU A;  2R4J A;  5KPT A;  1MU5 A;  1TH4 A;  3JAM S;  7CAT A;  1TDZ A;  2EJS A;  3U6E A;  1OAI A;  2JWS A;  2WSE F;  5BR8 M;  3U6O A;  4Z6Y A;  4DV6 M;  2JA2 A;  3RE8 A;  1NHG C;  5FSW A;  2RKO A;  2V6Z M;  3LCU A;  4Y28 F;  3SYL A;  2DEN A;  1HQY E;  3SFZ A;  2J7O A;  4L78 A;  1QZM A;  3I04 M;  2DWZ B;  3UJN A;  2VQE M;  2C9C A;  3HGI A;  4GRI A;  2CV2 A;  2UUB M;  3BXW A;  2V1C A;  4JN6 A;  2VQF M;  1QYR A;  3Q8X A;  4D82 A;  4I4L A;  4P16 A;  1W5S A;  1QDR A;  2APL A;  1SXJ B;  3KP0 E;  3A46 A;  2W82 A;  4GHA A;  3QAU A;  1PJT A;  2JNH A;  1QVR A;  1J5E M;  3M7G A;  1L2D A;  2J5Y A;  4KT0 F;  5L8R F;  2G5G X;  3QYB A;  3EIH A;  2HKJ A;  3W0L B;  3ZC7 B;  3GLH B;  4IBB A;  2R4E A;  3GO8 A;  3SC3 A;  2DAI A;  4LF8 M;  4YY3 M;  2QBY B;  1JR3 E;  3K8Z A;  2WZJ A;  4GIT A;  4IBF A;  2GNO A;  4LGY A;  3RGP A;  2F5P A;  4JI5 M;  2C99 A;  2F5N A;  1FNN A;  2KXE A;  1GKI A;  4DR4 M;  1R5L A;  1XWI A;  3GLI B;  3J7B A;  1HQC A;  1VEG A;  2XH9 A;  3PFI A;  1G71 A;  1E32 A;  4RF1 A;  2UUC M;  4NXM M;  3U6C A;  1Q39 A;  3T38 A;  2O25 A;  5ITX E;  1BVS A;  2DHR A;  5C18 A;  2DHY A;  2LBC A;  2R44 A;  1VEK A;  3CF2 A;  4FWH A;  5BPV A;  1XNQ M;  4KHP M;  1T43 A;  2QCU A;  2LHC A;  1OIZ A;  4LJ8 A;  4AQY M;  3T6P A;  1L1Z A;  4JI2 M;  4B7F A;  4NSO B;  3SAS A;  1L1T A;  1PJQ A;  4JV5 M;  4M9Z A;  2CV1 A;  2L7I A;  5JI3 E;  1HNW M;  2I7N A;  1QDT A;  3FE3 A;  5EXT A;  1GL7 A;  1X37 A;  4OU7 A;  4CGY B;  2MRO B;  4DV3 M;  3FUV A;  2ZAN A;  3KSX A;  3PVS A;  3B7N A;  5KQD A;  4LG2 A;  3K2L A;  4L6V 6;  3FRI A;  4G4O A;  4DR1 M;  2Z4S A;  2DAK A;  1NY6 A;  2LTU A; 
#chains in the Genus database with same CATH homology
 2L4F A;  2DAG A;  2ZTD A;  2LVN C;  2L4E A;  1NV8 A;  2G3Q A;  2K9D A;  1YLA A;  3GLH E;  2JY5 A;  2QNJ A;  2KNZ A;  2QSF X;  2KNV A;  3B89 A;  2LVA A;  1A5T A;  2OO9 A;  2EKF A;  1EFU B;  2RRU A;  4WP2 A;  2DI0 A;  1WGL A;  3GLI E;  5DFL A;  1G3I A;  2KNA A;  1IFY A;  3E21 A;  2MR9 A;  2LVO C;  4Q7J A;  1C7Y A;  1WHC A;  2CWB A;  2HWJ A;  1WGN A;  4HEO A;  1GO5 A;  1HT1 E;  1DV0 A;  2JZ1 A;  1OTR A;  1E94 E;  1VDL A;  3K9O A;  1CUK A;  1VQ1 A;  1XB2 B;  1G4A E;  3FRH A;  3MMP A;  2JY6 B;  3F92 A;  1AIP C;  1TR8 A;  1Y8G A;  1R4G A;  2DAM A;  2LVP C;  1T6O A;  2DKL A;  2KHH A;  4UN2 B;  4GEW A;  2EJS A;  1OAI A;  1P3Q Q;  2MJ5 B;  2DZL A;  2QHO B;  4DBG B;  2CP8 A;  4F2L A;  2ZTC A;  3LCU A;  2DEN A;  1HQY E;  4F1I A;  1DO0 A;  2B3T A;  1WR1 B;  1VG5 A;  3BBZ A;  1HJP A;  1QZE A;  1TTE A;  2BWB A;  2HAK A;  3H4J A;  4R71 A;  3GLF E;  2JNH A;  1PGY A;  1ZMW A;  1KYI A;  2JY7 A;  2JP7 A;  1OKS A;  2OOB A;  2DAI A;  1DO2 A;  1JR3 E;  1HT2 E;  2WZJ A;  2JUJ A;  2LVQ D;  1OQY A;  1VEJ A;  2BWE A;  1Q02 A;  1ZMV A;  3E46 A;  2K0B X;  2LTU A;  1NV9 A;  1VEG A;  3K9P A;  4G3O A;  2R0I A;  2H5X A;  2O25 A;  1BVS A;  5JI2 E;  2DHY A;  2LBC A;  1V92 A;  1IXS A;  1VEK A;  1T43 A;  1ZV1 A;  1MN3 A;  1WJ7 A;  2JZ0 A;  2L2D A;  2EKK A;  1SG9 A;  3GLG E;  2OOA A;  3T6P A;  1F4I A;  1UFZ A;  1ZMU A;  1WIV A;  1IM2 A;  2JY8 A;  1G41 A;  3FE3 A;  2MRO B;  3LCV B;  2MGW A;  3FRI A;  2DNA A;  2DAK A;  3IHP A;  3IEC A;  1XXH E;  2DAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...