1WR1B

The complex sturcture of dsk2p uba with ubiquitin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
58
structure length
58
Chain Sequence
PGISGGGGGILDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the UBA domain of Dsk2p in complex with ubiquitin molecular determinants for ubiquitin recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Ubiquitin
total genus 19
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2004-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wr1B01
1XB2B 2KNAA 1QZEA 2DHYA 2JUJA 3LCUA 2LVQD 1ZMUA 4WP2A 3FRIA 2DAIA 1T43A 2EJSA 1WHCA 2EKFA 1G41A 2LVPC 1HT1E 2OO9A 4R71A 3IECA 1HJPA 2JP7A 3K9PA 2MROB 1G3IA 2JY6B 2JY7A 1HT2E 2KHHA 2K0BX 2MR9A 2L4EA 1VQ1A 2DAKA 2O25A 2WZJA 4F2LA 1BVSA 1IM2A 2LVNC 2RRUA 1VG5A 2BWEA 2QNJA 3GLFE 1KYIA 1AIPC 1NV8A 1GO5A 1HQYE 5DFLA 2OOAA 1NV9A 2L2DA 2OOBA 1WR1B 2R0IA 2DI0A 1ZV1A 3B89A 4UN2B 2JZ1A 3GLIE 2KNZA 2QSFX 1XXHE 2ZTCA 3H4JA 1VEJA 2LVAA 2LVOC 4G3OA 2LBCA 1OTRA 2G3QA 1VEGA 2HWJA 1ZMWA 4F1IA 1IXSA 2JZ0A 2JNHA 2L4FA 4DBGB 2H5XA 4HEOA 1P3QQ 1T6OA 1Q02A 3F92A 3FE3A 1F4IA 1G4AE 2CP8A 1MN3A 4Q7JA 1WGLA 2KNVA 1OAIA 2K9DA 3E46A 1A5TA 2MGWA 2MJ5B 2DAGA 5JI2E 1ZMVA 1C7YA 1WIVA 2DAMA 3T6PA 1DO2A 1SG9A 1DV0A 3GLGE 1PGYA 1TTEA 1DO0A 2JY5A 1WGNA 3MMPA 3IHPA 1V92A 1VEKA 2JY8A 2B3TA 1UFZA 1VDLA 3LCVB 1TR8A 1R4GA 3K9OA 3E21A 1JR3E 1OKSA 1EFUB 3BBZA 3GLHE 1WJ7A 1CUKA 2DNAA 1YLAA 2DKLA 2DENA 1Y8GA 2EKKA 1OQYA 1IFYA 2HAKA 2QHOB 2CWBA 2LTUA 1E94E 2DAEA 2DZLA 3FRHA 4GEWA 2BWBA 2ZTDA
chains in the Genus database with same CATH superfamily
1XB2B 2KNAA 3L29A 4QHTA 4BLCA 2Z4SA 1K3XA 2JUJA 2LVQD 3GPPA 4WP2A 3FRIA 5DNYA 3GRVA 1T43A 4JYAM 3Q8GA 2EJSA 4DR5M 1WHCA 4QNMA 1N78A 3WHKA 3CF0A 2QQ8A 2LVPC 3LQRA 3QYEA 4R71A 5KQDA 4DUZM 3UGJA 3C58A 3K9PA 2JP7A 4KODA 2MROB 5GKNA 1XMOM 4AKHA 3RGPA 2JY6B 4D80A 1DGHB 4CIZA 4FWGA 2C96A 5IT9S 3SMPA 2M60A 3HKPA 2KHHA 3E4RA 4DR3M 3SAWA 1TF0B 1QAQA 4IBFA 3B74A 3PXGA 2VDBB 3FTFA 1E9RA 4GHAA 3LVVA 2C98A 4RF1A 2DAKA 2O25A 1GVNA 3U5ZA 2JWSA 2WSFF 1QZMA 2WZJA 3GLHB 2GNOA 4NC6A 1IM2A 4IBDA 2H1RA 1D2NA 1XMQM 3TWMA 1Z5AA 1QUTA 2F5OA 1VDDA 1HQYE 1RU3A 2F5SA 3W67A 1GO5A 4JI1M 1L2CA 1NY6A 2LHGA 2OOAA 1E32A 1NV9A 3HU1A 4QHSA 1N33M 1WR1B 4M9XA 2UUCM 4NXMM 3GRRA 4B7FA 3GLGB 2OPFA 1Z59A 3HGIA 3QAUA 4B3SM 4MGYE 3A46A 4AKIA 4LF7M 2ZTCA 1MU5A 3FUXA 3KOWE 4NOOB 3FD9A 3B7ZA 2LVAA 1DGGA 1NSFA 2NQ8C 2XSZA 3LVWA 3QWLA 4IBBA 4MM3B 2LH0A 1OTRA 3VLFB 4JI6M 4DR2M 4QNRA 3AOGA 3IG8A 1HNXM 2BJVA 3KSJA 3PNYA 4F1IA 1GL7A 4NSOB 3GPYA 1UM8A 3KXEC 1N77A 1P3QQ 2VF7A 2M5ZA 1T6OA 3W0FA 1MJGM 1Q02A 3FE3A 2JA2A 3T38A 2DWLA 4JN6A 4Q7JA 4JI7M 3U6EA 4IIWA 3TL4X 1G59A 3SHGB 3U60B 3E46A 3KVWA 4D81A 5FTKA 4KO8A 4I8OA 1C7YA 1TH3A 2DAMA 3D8BA 3E9SA 2A5YB 3HHYA 3T6PA 4FVMA 2CE7A 4PD2A 1XNRM 4FW9A 5F3WA 2F5QA 1FNNA 2R45A 1D0MA 2XF3A 3AV0A 3AOEC 3IHPA 2JY8A 4IBCA 2XZFA 1W5TA 3J27B 2L09A 2QBYB 2C5RA 5E26A 3C9PA 3KOZE 1JR3A 4IBIA 3SAUA 2CV0A 2V1CA 1SXJE 4FWDA 4D82A 2Y21A 4G4QA 2P5TA 4DV1M 1R4GA 4PCZA 2K47A 2YQZA 4M0DA 3SAVA 1C1KA 1QDTA 1R5LA 4L78A 1CUKA 2O5RA 2VF8A 3AFHA 4DV0M 1N36M 2R44A 5ITTA 3T1YM 4AI6A 1Z6TA 1Q3BA 1HNZM 2DENA 2YFQA 4R7GA 5ITRA 1DGHA 2DZOB 1OJLA 1OQYA 3VDPA 3J7AS 1IFYA 4GKKM 1ORYB 1DGFA 1IY0A 3FRHA 1Q39A 4JI0M 1V33A 3TPZA 2YNMD 4AG6A 2ZTDA 3C3DA 4CJ6A 4QOSA 2CHVA 3U61A 4L8RC 3I01M 2DAIA 1TDZA 1D0KA 3HJSA 3V76A 3VK8A 4NRWA 1GL6A 2EKFA 2VQFM 2DWMA 3SYKA 4DV3M 1R2ZA 5C18A 3IECA 2YR0A 1SXJB 1HJPA 3U6CA 2XH9A 4ITQA 2QENA 2JY7A 1G8PA 2EO2A 2VIIA 3KP1E 3SC3A 1HT2E 3SBJA 2R4EA 3KS4A 2MR9A 2L4EA 1GLNA 5EXSA 3GPXA 4K0KM 2RGHA 5ITXA 4DUYM 4OX9M 1PM5A 3R8FA 1QQWA 3GQ4A 2AHMA 1JR3D 3K2LA 8CATA 2KA6B 4FCTA 4JXJA 5ITYA 1TH4A 2R18A 4BBAA 4LCBA 1NY5A 4IJEA 4EIWA 2DWNA 1NNJA 1IXZA 1NNUC 3NBXX 1AIPC 4AZFA 1L1ZA 4M9SA 3ZQJA 3FYCA 2W82A 4LGYA 4WURA 2ERCA 1GJSA 1IY2A 3B7QA 3FYDA 3U6DA 3VKHA 3L27A 2DI0A 5EXPA 3H4MA 2QPAA 5JI3E 5FLXS 2FE8A 4UN2B 4DR6M 4X65M 2O01F 2QSFX 4NL4H 1OIZA 4G3OA 1R7RA 1GJTA 2G5GX 4LZJA 2G3QA 1ZAEA 3MHVC 1YSYA 3M7GA 4LRSA 1VEGA 5ITQA 5ITXE 2DVWB 1ZMWA 4NSRA 3HU3A 1PJTA 2JZ0A 2JNHA 3ZC7B 2L4FA 2UUBM 3JAMS 4LF5M 4IBJA 4I5SA 2QCUA 2QBYA 3EIHA 2CFOA 4LZZA 4QOZC 3F92A 2Z3XA 1F4IA 1MN3A 4I81A 2R4JA 2KNVA 3HHZA 1OAIA 2K9DA 4RF0A 3GLFB 2MGWA 4GH9A 2G8LA 2DAGA 2HKJA 1TDHA 3GLHA 3SYLA 3THGA 3TWLA 1WIVA 4CHTB 4X64M 4REZA 3NBIA 5EXTA 1MX0A 4LF8M 1DO2A 4JV5M 1DV0A 3U6OA 1PGYA 1QUSA 2JY5A 5FTMA 3GPUA 4GMQA 5EP2A 3L26A 2FNAA 1NHGC 1R6BX 1IY1A 3JR4A 1E9SA 3J81S 2OQ4A 1SXJC 3LCVB 4MGKE 1TR8A 2JXNA 4LJAA 2N35A 4B3TM 3DZDA 5C1BA 1IN7A 4Z6YA 1NVMA 3AJIB 1IN4A 1WJ7A 4G6ZA 1NJFA 4MGIE 4L16A 4OVZA 5EQTA 2VQEM 3RE8A 3W68A 3U6LA 2Y0QA 3UZUA 1Y8GA 4JI3M 2ZM6M 3KDSE 3DOAA 1QYRA 4GIPA 3T1HM 3A98B 1IBLM 2J5YA 2CWBA 2LTUA 4XK8F 5EXXA 4ZPXA 1PJSA 4LG2A 5KPTA 2DWZB 2BNKA 2DZNB 2BWBA 2D7GA 4YY3M 2EA0A 2FS1A 2KZUA 2CHGA 3LCUA 1ZMUA 1OAOC 3A42A 4LFCM 4LJ7A 7CATA 2R46A 1L1TA 1G41A 2OO9A 1HT1E 4YHHM 3GLFA 2ZANA 3R9XB 1NHWC 2DHRA 4L4UA 3ILKA 1NO1A 1W5SA 4DV5M 3SMSA 4FCVA 2HHHM 3GP1A 3KSXA 2GQFA 3GRUA 4L6V6 4LRTA 3HHXA 5IREB 5FTLA 1IBMM 3GQ5A 1VQ1A 3HU2A 3PVSA 1N34M 4GKJM 1NJGA 1HNWM 3FTCA 4F2LA 3HX3A 2WSEF 2X8AA 5KPZA 4LJ6A 1PJQA 2D7EA 2KEBA 3M0EA 2RRUA 5A2QS 1VG5A 2XFTA 2CV1A 3L25A 2UXCM 2QNJA 1NV8A 1YUBA 2X4AA 5DFLA 5EJCA 1D0LA 3AOEA 3U6QA 2KRUA 5DYIA 1HR0M 3C3EA 2QP9X 2L2DA 3HHWA 4LF4M 2C9OA 1WXQA 2OOBA 3TQSA 2R0IA 4FCWA 3B89A 1ZV1A 2CEAA 2RGOA 3ZH9B 2LNHC 2JZ1A 4OW0A 2I7PA 2XEPA 3FUWA 5IZ7D 1XXHE 4G4RA 3H4JA 3ZCBB 2F5NA 2LXEA 1XXHA 1N32M 3WHLA 2LWXA 4LGMA 3GLIB 5KQ8A 1XXHB 2CRUA 1Z5BA 1IN5A 3U5ZB 1IXSA 1Z5CA 1SXJD 4DBGB 3UK6A 4HEOA 3MJ5A 4M9ZA 4OU7A 3UJNA 4PDGA 2XLJA 1G4AE 1WGLA 2UUAM 2RKOA 4FD2A 1K3WA 3FKEA 4IBEA 3K8ZA 2HL7A 1I4WA 1ZMVA 2UXBM 3FUUA 3LW5F 4ANRA 3RGSA 1FJGM 2WSCF 3I04M 3SATA 4I4LA 1SG9A 2Q2EB 2CUZA 2L7IA 4MH0E 4CGYB 4XBOA 1WGNA 2UU9M 3Q8XA 1VEKA 1I94M 2B3TA 2XGNA 5LMNM 3VK7A 1TGUA 4LF9M 1T3TA 4B7HA 1IXSB 3K1JA 2CHQA 3GRYA 3LMMA 4GC5A 1PJJA 2L7HA 4DR4M 1EIJA 4HL4A 3HJ8A 3KS8A 4P16A 2APLA 2C9CA 3HJQA 1JR3E 1OKSA 2EUCA 1EFUB 2KXEA 1OIPA 2K6BA 3GLHE 1XHBA 4Z8XA 2FOIC 5E6JA 1KFVA 3HWSA 2DNAA 3B9PA 4B08A 1YLAA 3J2PB 2XZUA 3J7BA 2EKKA 3L2AA 5KPRA 4AQYM 2J7OA 3RFWA 2R65A 4II7A 1OFIA 4IJFA 3VKGA 2C99A 2DAEA 2DZLA 3EIEA 1SXJA 3I4YA 3BXWA 1AUAA 2D7HA 4W5WA 3MK6A 3PNVA 1QZEA 4M0WA 4JI2M 3PFIA 2DHYA 2FH0A 1JQJC 3NWLA 4GITA 4GRIA 3FUVA 5DYGA 3J80S 1L2DA 2LHCA 5L8RF 3SHFA 5KO3A 4MB7A 2XFSA 1QAMA 4LJ9A 1IN8A 2J7NA 4FWHA 1IBKM 4B3MM 2R6FA 1G3IA 1HQCA 2MH8A 4LJ5A 4DR1M 2Z8YM 4MGZE 1GABA 1DGBA 2K0BX 5EP3A 2KDLA 1S3SA 3QYBA 2I7NA 1IXRC 4LJ8A 5H37D 4DV6M 3CF6E 4PT5A 3W0LB 2R62A 4LFAM 3GO8A 4DV2M 3U6SA 1H6UA 3I51A 3AL0C 1JB0F 1Q3CA 1IN6A 1BVSA 1LV7A 2Z7JA 2LVNC 3CTWB 3KW6A 1QAOA 3KFUG 2X49A 2Z4RA 2BWEA 3LQQA 4S12A 5EP4A 1QANA 1ZQ9A 3GLFE 4GHLA 1KYIA 3U6PA 2L6OA 2KRKA 4AKGA 4X62M 1L8QA 4JI8M 4JI5M 1QDRA 4TUWA 2V6ZM 4Y28F 1J5EM 1OFHA 3VDUA 4CISA 2Y0TA 3TWKA 3SASA 3GLIE 2KNZA 4R3DA 1VEJA 2UXDM 2LVOC 4B7GA 1J7KA 2LBCA 2KZSA 3KOYE 2HWJA 4NRVA 4LFBM 2HCBA 3KP0E 4KT0F 5FTNA 5FTJA 5FSWA 2QZ4A 3I4VA 1KSFX 5BR8M 2H5XA 5LMUM 3TE6A 3DA1A 4LJ4A 4JI4M 1EE8A 4KHPM 5ITUA 4NXNM 2CP8A 3FUTA 1V34A 4G4NA 1R2YA 4HLQA 1XWIA 3K92A 3DFZA 3A45A 4DV7M 1A5TA 4P17A 2MJ5B 4RNAA 1L2BA 3U61B 3CGWA 5JI2E 5BPVA 3L28A 4DV4M 2FFJA 3M6AA 4AW4A 3BOSA 2F4VM 3CF2A 1QVRA 2ZAOA 4WW0A 1G71A 4X66M 3OTOM 3KOXE 2Y20A 5IWAM 3GLGE 1XNQM 2E5LM 1TTEA 1DO0A 4GC9A 3VFDA 1XC8A 3MMPA 1N75A 4AG5A 1V92A 2DXIA 4XGIA 1YE9A 2KW0A 4OVZB 3HY5A 4IBGA 3D8LA 1IQPA 1UFZA 4DR7M 1K82A 1LTMA 4L15A 4MGHA 1VDLA 4B3RM 1J09A 3K9OA 4LY6A 3SFZA 1X37A 3E21A 3HZJA 3UMMA 3JR5A 2ZAMA 3BBZA 3T15A 3B7NA 4PDIA 1GKIA 1PRBA 3GLIA 3GQ3A 3U60A 2F5PA 4KLNA 1PJIA 4G4OA 2V1UA 3AKZA 4RKUF 4LF6M 1TH2A 2BJWA 2DKLA 3SARA 3GLGA 4IBKA 5EP1A 3FTEA 2HAKA 3IG5A 2XSZD 2QHOB 3FTDA 1E94E 4GEWA 2ZBKB 3U6MA 4A3VB 2CV2A 4BB9A
chains in the Genus database with same CATH topology
1XB2B 2KNAA 1QZEA 2DHYA 2JUJA 3LCUA 2LVQD 1ZMUA 4WP2A 3FRIA 2DAIA 1T43A 2EJSA 1WHCA 2EKFA 1G41A 2LVPC 1HT1E 2OO9A 4R71A 3IECA 1HJPA 2JP7A 3K9PA 2MROB 1G3IA 2JY6B 2JY7A 1HT2E 2KHHA 2K0BX 2MR9A 2L4EA 1VQ1A 2DAKA 2O25A 2WZJA 4F2LA 1BVSA 1IM2A 2LVNC 2RRUA 1VG5A 2BWEA 2QNJA 3GLFE 1KYIA 1AIPC 1NV8A 1GO5A 1HQYE 5DFLA 2OOAA 1NV9A 2L2DA 2OOBA 1WR1B 2R0IA 2DI0A 1ZV1A 3B89A 4UN2B 2JZ1A 3GLIE 2KNZA 2QSFX 1XXHE 2ZTCA 3H4JA 1VEJA 2LVAA 2LVOC 4G3OA 2LBCA 1OTRA 2G3QA 1VEGA 2HWJA 1ZMWA 4F1IA 1IXSA 2JZ0A 2JNHA 2L4FA 4DBGB 2H5XA 4HEOA 1P3QQ 1T6OA 1Q02A 3F92A 3FE3A 1F4IA 1G4AE 2CP8A 1MN3A 4Q7JA 1WGLA 2KNVA 1OAIA 2K9DA 3E46A 1A5TA 2MGWA 2MJ5B 2DAGA 5JI2E 1ZMVA 1C7YA 1WIVA 2DAMA 3T6PA 1DO2A 1SG9A 1DV0A 3GLGE 1PGYA 1TTEA 1DO0A 2JY5A 1WGNA 3MMPA 3IHPA 1V92A 1VEKA 2JY8A 2B3TA 1UFZA 1VDLA 3LCVB 1TR8A 1R4GA 3K9OA 3E21A 1JR3E 1OKSA 1EFUB 3BBZA 3GLHE 1WJ7A 1CUKA 2DNAA 1YLAA 2DKLA 2DENA 1Y8GA 2EKKA 1OQYA 1IFYA 2HAKA 2QHOB 2CWBA 2LTUA 1E94E 2DAEA 2DZLA 3FRHA 4GEWA 2BWBA 2ZTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XB2 B;  2KNA A;  1QZE A;  2DHY A;  2JUJ A;  3LCU A;  2LVQ D;  1ZMU A;  4WP2 A;  3FRI A;  2DAI A;  1T43 A;  2EJS A;  1WHC A;  2EKF A;  1G41 A;  2LVP C;  1HT1 E;  2OO9 A;  4R71 A;  3IEC A;  1HJP A;  2JP7 A;  3K9P A;  2MRO B;  1G3I A;  2JY6 B;  2JY7 A;  1HT2 E;  2KHH A;  2K0B X;  2MR9 A;  2L4E A;  1VQ1 A;  2DAK A;  2O25 A;  2WZJ A;  4F2L A;  1BVS A;  1IM2 A;  2LVN C;  2RRU A;  1VG5 A;  2BWE A;  2QNJ A;  3GLF E;  1KYI A;  1AIP C;  1NV8 A;  1GO5 A;  1HQY E;  5DFL A;  2OOA A;  1NV9 A;  2L2D A;  2OOB A;  1WR1 B;  2R0I A;  2DI0 A;  1ZV1 A;  3B89 A;  4UN2 B;  2JZ1 A;  3GLI E;  2KNZ A;  2QSF X;  1XXH E;  2ZTC A;  3H4J A;  1VEJ A;  2LVA A;  2LVO C;  4G3O A;  2LBC A;  1OTR A;  2G3Q A;  1VEG A;  2HWJ A;  1ZMW A;  4F1I A;  1IXS A;  2JZ0 A;  2JNH A;  2L4F A;  4DBG B;  2H5X A;  4HEO A;  1P3Q Q;  1T6O A;  1Q02 A;  3F92 A;  3FE3 A;  1F4I A;  1G4A E;  2CP8 A;  1MN3 A;  4Q7J A;  1WGL A;  2KNV A;  1OAI A;  2K9D A;  3E46 A;  1A5T A;  2MGW A;  2MJ5 B;  2DAG A;  5JI2 E;  1ZMV A;  1C7Y A;  1WIV A;  2DAM A;  3T6P A;  1DO2 A;  1SG9 A;  1DV0 A;  3GLG E;  1PGY A;  1TTE A;  1DO0 A;  2JY5 A;  1WGN A;  3MMP A;  3IHP A;  1V92 A;  1VEK A;  2JY8 A;  2B3T A;  1UFZ A;  1VDL A;  3LCV B;  1TR8 A;  1R4G A;  3K9O A;  3E21 A;  1JR3 E;  1OKS A;  1EFU B;  3BBZ A;  3GLH E;  1WJ7 A;  1CUK A;  2DNA A;  1YLA A;  2DKL A;  2DEN A;  1Y8G A;  2EKK A;  1OQY A;  1IFY A;  2HAK A;  2QHO B;  2CWB A;  2LTU A;  1E94 E;  2DAE A;  2DZL A;  3FRH A;  4GEW A;  2BWB A;  2ZTD A; 
#chains in the Genus database with same CATH topology
 1XB2 B;  2KNA A;  3L29 A;  4QHT A;  4BLC A;  2Z4S A;  1K3X A;  2JUJ A;  2LVQ D;  3GPP A;  4WP2 A;  3FRI A;  5DNY A;  3GRV A;  1T43 A;  4JYA M;  3Q8G A;  2EJS A;  4DR5 M;  1WHC A;  4QNM A;  1N78 A;  3WHK A;  3CF0 A;  2QQ8 A;  2LVP C;  3LQR A;  3QYE A;  4R71 A;  5KQD A;  4DUZ M;  3UGJ A;  3C58 A;  3K9P A;  2JP7 A;  4KOD A;  2MRO B;  5GKN A;  1XMO M;  4AKH A;  3RGP A;  2JY6 B;  4D80 A;  1DGH B;  4CIZ A;  4FWG A;  2C96 A;  5IT9 S;  3SMP A;  2M60 A;  3HKP A;  2KHH A;  3E4R A;  4DR3 M;  3SAW A;  1TF0 B;  1QAQ A;  4IBF A;  3B74 A;  3PXG A;  2VDB B;  3FTF A;  1E9R A;  4GHA A;  3LVV A;  2C98 A;  4RF1 A;  2DAK A;  2O25 A;  1GVN A;  3U5Z A;  2JWS A;  2WSF F;  1QZM A;  2WZJ A;  3GLH B;  2GNO A;  4NC6 A;  1IM2 A;  4IBD A;  2H1R A;  1D2N A;  1XMQ M;  3TWM A;  1Z5A A;  1QUT A;  2F5O A;  1VDD A;  1HQY E;  1RU3 A;  2F5S A;  3W67 A;  1GO5 A;  4JI1 M;  1L2C A;  1NY6 A;  2LHG A;  2OOA A;  1E32 A;  1NV9 A;  3HU1 A;  4QHS A;  1N33 M;  1WR1 B;  4M9X A;  2UUC M;  4NXM M;  3GRR A;  4B7F A;  3GLG B;  2OPF A;  1Z59 A;  3HGI A;  3QAU A;  4B3S M;  4MGY E;  3A46 A;  4AKI A;  4LF7 M;  2ZTC A;  1MU5 A;  3FUX A;  3KOW E;  4NOO B;  3FD9 A;  3B7Z A;  2LVA A;  1DGG A;  1NSF A;  2NQ8 C;  2XSZ A;  3LVW A;  3QWL A;  4IBB A;  4MM3 B;  2LH0 A;  1OTR A;  3VLF B;  4JI6 M;  4DR2 M;  4QNR A;  3AOG A;  3IG8 A;  1HNX M;  2BJV A;  3KSJ A;  3PNY A;  4F1I A;  1GL7 A;  4NSO B;  3GPY A;  1UM8 A;  3KXE C;  1N77 A;  1P3Q Q;  2VF7 A;  2M5Z A;  1T6O A;  3W0F A;  1MJG M;  1Q02 A;  3FE3 A;  2JA2 A;  3T38 A;  2DWL A;  4JN6 A;  4Q7J A;  4JI7 M;  3U6E A;  4IIW A;  3TL4 X;  1G59 A;  3SHG B;  3U60 B;  3E46 A;  3KVW A;  4D81 A;  5FTK A;  4KO8 A;  4I8O A;  1C7Y A;  1TH3 A;  2DAM A;  3D8B A;  3E9S A;  2A5Y B;  3HHY A;  3T6P A;  4FVM A;  2CE7 A;  4PD2 A;  1XNR M;  4FW9 A;  5F3W A;  2F5Q A;  1FNN A;  2R45 A;  1D0M A;  2XF3 A;  3AV0 A;  3AOE C;  3IHP A;  2JY8 A;  4IBC A;  2XZF A;  1W5T A;  3J27 B;  2L09 A;  2QBY B;  2C5R A;  5E26 A;  3C9P A;  3KOZ E;  1JR3 A;  4IBI A;  3SAU A;  2CV0 A;  2V1C A;  1SXJ E;  4FWD A;  4D82 A;  2Y21 A;  4G4Q A;  2P5T A;  4DV1 M;  1R4G A;  4PCZ A;  2K47 A;  2YQZ A;  4M0D A;  3SAV A;  1C1K A;  1QDT A;  1R5L A;  4L78 A;  1CUK A;  2O5R A;  2VF8 A;  3AFH A;  4DV0 M;  1N36 M;  2R44 A;  5ITT A;  3T1Y M;  4AI6 A;  1Z6T A;  1Q3B A;  1HNZ M;  2DEN A;  2YFQ A;  4R7G A;  5ITR A;  1DGH A;  2DZO B;  1OJL A;  1OQY A;  3VDP A;  3J7A S;  1IFY A;  4GKK M;  1ORY B;  1DGF A;  1IY0 A;  3FRH A;  1Q39 A;  4JI0 M;  1V33 A;  3TPZ A;  2YNM D;  4AG6 A;  2ZTD A;  3C3D A;  4CJ6 A;  4QOS A;  2CHV A;  3U61 A;  4L8R C;  3I01 M;  2DAI A;  1TDZ A;  1D0K A;  3HJS A;  3V76 A;  3VK8 A;  4NRW A;  1GL6 A;  2EKF A;  2VQF M;  2DWM A;  3SYK A;  4DV3 M;  1R2Z A;  5C18 A;  3IEC A;  2YR0 A;  1SXJ B;  1HJP A;  3U6C A;  2XH9 A;  4ITQ A;  2QEN A;  2JY7 A;  1G8P A;  2EO2 A;  2VII A;  3KP1 E;  3SC3 A;  1HT2 E;  3SBJ A;  2R4E A;  3KS4 A;  2MR9 A;  2L4E A;  1GLN A;  5EXS A;  3GPX A;  4K0K M;  2RGH A;  5ITX A;  4DUY M;  4OX9 M;  1PM5 A;  3R8F A;  1QQW A;  3GQ4 A;  2AHM A;  1JR3 D;  3K2L A;  8CAT A;  2KA6 B;  4FCT A;  4JXJ A;  5ITY A;  1TH4 A;  2R18 A;  4BBA A;  4LCB A;  1NY5 A;  4IJE A;  4EIW A;  2DWN A;  1NNJ A;  1IXZ A;  1NNU C;  3NBX X;  1AIP C;  4AZF A;  1L1Z A;  4M9S A;  3ZQJ A;  3FYC A;  2W82 A;  4LGY A;  4WUR A;  2ERC A;  1GJS A;  1IY2 A;  3B7Q A;  3FYD A;  3U6D A;  3VKH A;  3L27 A;  2DI0 A;  5EXP A;  3H4M A;  2QPA A;  5JI3 E;  5FLX S;  2FE8 A;  4UN2 B;  4DR6 M;  4X65 M;  2O01 F;  2QSF X;  4NL4 H;  1OIZ A;  4G3O A;  1R7R A;  1GJT A;  2G5G X;  4LZJ A;  2G3Q A;  1ZAE A;  3MHV C;  1YSY A;  3M7G A;  4LRS A;  1VEG A;  5ITQ A;  5ITX E;  2DVW B;  1ZMW A;  4NSR A;  3HU3 A;  1PJT A;  2JZ0 A;  2JNH A;  3ZC7 B;  2L4F A;  2UUB M;  3JAM S;  4LF5 M;  4IBJ A;  4I5S A;  2QCU A;  2QBY A;  3EIH A;  2CFO A;  4LZZ A;  4QOZ C;  3F92 A;  2Z3X A;  1F4I A;  1MN3 A;  4I81 A;  2R4J A;  2KNV A;  3HHZ A;  1OAI A;  2K9D A;  4RF0 A;  3GLF B;  2MGW A;  4GH9 A;  2G8L A;  2DAG A;  2HKJ A;  1TDH A;  3GLH A;  3SYL A;  3THG A;  3TWL A;  1WIV A;  4CHT B;  4X64 M;  4REZ A;  3NBI A;  5EXT A;  1MX0 A;  4LF8 M;  1DO2 A;  4JV5 M;  1DV0 A;  3U6O A;  1PGY A;  1QUS A;  2JY5 A;  5FTM A;  3GPU A;  4GMQ A;  5EP2 A;  3L26 A;  2FNA A;  1NHG C;  1R6B X;  1IY1 A;  3JR4 A;  1E9S A;  3J81 S;  2OQ4 A;  1SXJ C;  3LCV B;  4MGK E;  1TR8 A;  2JXN A;  4LJA A;  2N35 A;  4B3T M;  3DZD A;  5C1B A;  1IN7 A;  4Z6Y A;  1NVM A;  3AJI B;  1IN4 A;  1WJ7 A;  4G6Z A;  1NJF A;  4MGI E;  4L16 A;  4OVZ A;  5EQT A;  2VQE M;  3RE8 A;  3W68 A;  3U6L A;  2Y0Q A;  3UZU A;  1Y8G A;  4JI3 M;  2ZM6 M;  3KDS E;  3DOA A;  1QYR A;  4GIP A;  3T1H M;  3A98 B;  1IBL M;  2J5Y A;  2CWB A;  2LTU A;  4XK8 F;  5EXX A;  4ZPX A;  1PJS A;  4LG2 A;  5KPT A;  2DWZ B;  2BNK A;  2DZN B;  2BWB A;  2D7G A;  4YY3 M;  2EA0 A;  2FS1 A;  2KZU A;  2CHG A;  3LCU A;  1ZMU A;  1OAO C;  3A42 A;  4LFC M;  4LJ7 A;  7CAT A;  2R46 A;  1L1T A;  1G41 A;  2OO9 A;  1HT1 E;  4YHH M;  3GLF A;  2ZAN A;  3R9X B;  1NHW C;  2DHR A;  4L4U A;  3ILK A;  1NO1 A;  1W5S A;  4DV5 M;  3SMS A;  4FCV A;  2HHH M;  3GP1 A;  3KSX A;  2GQF A;  3GRU A;  4L6V 6;  4LRT A;  3HHX A;  5IRE B;  5FTL A;  1IBM M;  3GQ5 A;  1VQ1 A;  3HU2 A;  3PVS A;  1N34 M;  4GKJ M;  1NJG A;  1HNW M;  3FTC A;  4F2L A;  3HX3 A;  2WSE F;  2X8A A;  5KPZ A;  4LJ6 A;  1PJQ A;  2D7E A;  2KEB A;  3M0E A;  2RRU A;  5A2Q S;  1VG5 A;  2XFT A;  2CV1 A;  3L25 A;  2UXC M;  2QNJ A;  1NV8 A;  1YUB A;  2X4A A;  5DFL A;  5EJC A;  1D0L A;  3AOE A;  3U6Q A;  2KRU A;  5DYI A;  1HR0 M;  3C3E A;  2QP9 X;  2L2D A;  3HHW A;  4LF4 M;  2C9O A;  1WXQ A;  2OOB A;  3TQS A;  2R0I A;  4FCW A;  3B89 A;  1ZV1 A;  2CEA A;  2RGO A;  3ZH9 B;  2LNH C;  2JZ1 A;  4OW0 A;  2I7P A;  2XEP A;  3FUW A;  5IZ7 D;  1XXH E;  4G4R A;  3H4J A;  3ZCB B;  2F5N A;  2LXE A;  1XXH A;  1N32 M;  3WHL A;  2LWX A;  4LGM A;  3GLI B;  5KQ8 A;  1XXH B;  2CRU A;  1Z5B A;  1IN5 A;  3U5Z B;  1IXS A;  1Z5C A;  1SXJ D;  4DBG B;  3UK6 A;  4HEO A;  3MJ5 A;  4M9Z A;  4OU7 A;  3UJN A;  4PDG A;  2XLJ A;  1G4A E;  1WGL A;  2UUA M;  2RKO A;  4FD2 A;  1K3W A;  3FKE A;  4IBE A;  3K8Z A;  2HL7 A;  1I4W A;  1ZMV A;  2UXB M;  3FUU A;  3LW5 F;  4ANR A;  3RGS A;  1FJG M;  2WSC F;  3I04 M;  3SAT A;  4I4L A;  1SG9 A;  2Q2E B;  2CUZ A;  2L7I A;  4MH0 E;  4CGY B;  4XBO A;  1WGN A;  2UU9 M;  3Q8X A;  1VEK A;  1I94 M;  2B3T A;  2XGN A;  5LMN M;  3VK7 A;  1TGU A;  4LF9 M;  1T3T A;  4B7H A;  1IXS B;  3K1J A;  2CHQ A;  3GRY A;  3LMM A;  4GC5 A;  1PJJ A;  2L7H A;  4DR4 M;  1EIJ A;  4HL4 A;  3HJ8 A;  3KS8 A;  4P16 A;  2APL A;  2C9C A;  3HJQ A;  1JR3 E;  1OKS A;  2EUC A;  1EFU B;  2KXE A;  1OIP A;  2K6B A;  3GLH E;  1XHB A;  4Z8X A;  2FOI C;  5E6J A;  1KFV A;  3HWS A;  2DNA A;  3B9P A;  4B08 A;  1YLA A;  3J2P B;  2XZU A;  3J7B A;  2EKK A;  3L2A A;  5KPR A;  4AQY M;  2J7O A;  3RFW A;  2R65 A;  4II7 A;  1OFI A;  4IJF A;  3VKG A;  2C99 A;  2DAE A;  2DZL A;  3EIE A;  1SXJ A;  3I4Y A;  3BXW A;  1AUA A;  2D7H A;  4W5W A;  3MK6 A;  3PNV A;  1QZE A;  4M0W A;  4JI2 M;  3PFI A;  2DHY A;  2FH0 A;  1JQJ C;  3NWL A;  4GIT A;  4GRI A;  3FUV A;  5DYG A;  3J80 S;  1L2D A;  2LHC A;  5L8R F;  3SHF A;  5KO3 A;  4MB7 A;  2XFS A;  1QAM A;  4LJ9 A;  1IN8 A;  2J7N A;  4FWH A;  1IBK M;  4B3M M;  2R6F A;  1G3I A;  1HQC A;  2MH8 A;  4LJ5 A;  4DR1 M;  2Z8Y M;  4MGZ E;  1GAB A;  1DGB A;  2K0B X;  5EP3 A;  2KDL A;  1S3S A;  3QYB A;  2I7N A;  1IXR C;  4LJ8 A;  5H37 D;  4DV6 M;  3CF6 E;  4PT5 A;  3W0L B;  2R62 A;  4LFA M;  3GO8 A;  4DV2 M;  3U6S A;  1H6U A;  3I51 A;  3AL0 C;  1JB0 F;  1Q3C A;  1IN6 A;  1BVS A;  1LV7 A;  2Z7J A;  2LVN C;  3CTW B;  3KW6 A;  1QAO A;  3KFU G;  2X49 A;  2Z4R A;  2BWE A;  3LQQ A;  4S12 A;  5EP4 A;  1QAN A;  1ZQ9 A;  3GLF E;  4GHL A;  1KYI A;  3U6P A;  2L6O A;  2KRK A;  4AKG A;  4X62 M;  1L8Q A;  4JI8 M;  4JI5 M;  1QDR A;  4TUW A;  2V6Z M;  4Y28 F;  1J5E M;  1OFH A;  3VDU A;  4CIS A;  2Y0T A;  3TWK A;  3SAS A;  3GLI E;  2KNZ A;  4R3D A;  1VEJ A;  2UXD M;  2LVO C;  4B7G A;  1J7K A;  2LBC A;  2KZS A;  3KOY E;  2HWJ A;  4NRV A;  4LFB M;  2HCB A;  3KP0 E;  4KT0 F;  5FTN A;  5FTJ A;  5FSW A;  2QZ4 A;  3I4V A;  1KSF X;  5BR8 M;  2H5X A;  5LMU M;  3TE6 A;  3DA1 A;  4LJ4 A;  4JI4 M;  1EE8 A;  4KHP M;  5ITU A;  4NXN M;  2CP8 A;  3FUT A;  1V34 A;  4G4N A;  1R2Y A;  4HLQ A;  1XWI A;  3K92 A;  3DFZ A;  3A45 A;  4DV7 M;  1A5T A;  4P17 A;  2MJ5 B;  4RNA A;  1L2B A;  3U61 B;  3CGW A;  5JI2 E;  5BPV A;  3L28 A;  4DV4 M;  2FFJ A;  3M6A A;  4AW4 A;  3BOS A;  2F4V M;  3CF2 A;  1QVR A;  2ZAO A;  4WW0 A;  1G71 A;  4X66 M;  3OTO M;  3KOX E;  2Y20 A;  5IWA M;  3GLG E;  1XNQ M;  2E5L M;  1TTE A;  1DO0 A;  4GC9 A;  3VFD A;  1XC8 A;  3MMP A;  1N75 A;  4AG5 A;  1V92 A;  2DXI A;  4XGI A;  1YE9 A;  2KW0 A;  4OVZ B;  3HY5 A;  4IBG A;  3D8L A;  1IQP A;  1UFZ A;  4DR7 M;  1K82 A;  1LTM A;  4L15 A;  4MGH A;  1VDL A;  4B3R M;  1J09 A;  3K9O A;  4LY6 A;  3SFZ A;  1X37 A;  3E21 A;  3HZJ A;  3UMM A;  3JR5 A;  2ZAM A;  3BBZ A;  3T15 A;  3B7N A;  4PDI A;  1GKI A;  1PRB A;  3GLI A;  3GQ3 A;  3U60 A;  2F5P A;  4KLN A;  1PJI A;  4G4O A;  2V1U A;  3AKZ A;  4RKU F;  4LF6 M;  1TH2 A;  2BJW A;  2DKL A;  3SAR A;  3GLG A;  4IBK A;  5EP1 A;  3FTE A;  2HAK A;  3IG5 A;  2XSZ D;  2QHO B;  3FTD A;  1E94 E;  4GEW A;  2ZBK B;  3U6M A;  4A3V B;  2CV2 A;  4BB9 A; 
#chains in the Genus database with same CATH homology
 1XB2 B;  2KNA A;  1QZE A;  2DHY A;  2JUJ A;  3LCU A;  2LVQ D;  1ZMU A;  4WP2 A;  3FRI A;  2DAI A;  1T43 A;  2EJS A;  1WHC A;  2EKF A;  1G41 A;  2LVP C;  1HT1 E;  2OO9 A;  4R71 A;  3IEC A;  1HJP A;  2JP7 A;  3K9P A;  2MRO B;  1G3I A;  2JY6 B;  2JY7 A;  1HT2 E;  2KHH A;  2K0B X;  2MR9 A;  2L4E A;  1VQ1 A;  2DAK A;  2O25 A;  2WZJ A;  4F2L A;  1BVS A;  1IM2 A;  2LVN C;  2RRU A;  1VG5 A;  2BWE A;  2QNJ A;  3GLF E;  1KYI A;  1AIP C;  1NV8 A;  1GO5 A;  1HQY E;  5DFL A;  2OOA A;  1NV9 A;  2L2D A;  2OOB A;  1WR1 B;  2R0I A;  2DI0 A;  1ZV1 A;  3B89 A;  4UN2 B;  2JZ1 A;  3GLI E;  2KNZ A;  2QSF X;  1XXH E;  2ZTC A;  3H4J A;  1VEJ A;  2LVA A;  2LVO C;  4G3O A;  2LBC A;  1OTR A;  2G3Q A;  1VEG A;  2HWJ A;  1ZMW A;  4F1I A;  1IXS A;  2JZ0 A;  2JNH A;  2L4F A;  4DBG B;  2H5X A;  4HEO A;  1P3Q Q;  1T6O A;  1Q02 A;  3F92 A;  3FE3 A;  1F4I A;  1G4A E;  2CP8 A;  1MN3 A;  4Q7J A;  1WGL A;  2KNV A;  1OAI A;  2K9D A;  3E46 A;  1A5T A;  2MGW A;  2MJ5 B;  2DAG A;  5JI2 E;  1ZMV A;  1C7Y A;  1WIV A;  2DAM A;  3T6P A;  1DO2 A;  1SG9 A;  1DV0 A;  3GLG E;  1PGY A;  1TTE A;  1DO0 A;  2JY5 A;  1WGN A;  3MMP A;  3IHP A;  1V92 A;  1VEK A;  2JY8 A;  2B3T A;  1UFZ A;  1VDL A;  3LCV B;  1TR8 A;  1R4G A;  3K9O A;  3E21 A;  1JR3 E;  1OKS A;  1EFU B;  3BBZ A;  3GLH E;  1WJ7 A;  1CUK A;  2DNA A;  1YLA A;  2DKL A;  2DEN A;  1Y8G A;  2EKK A;  1OQY A;  1IFY A;  2HAK A;  2QHO B;  2CWB A;  2LTU A;  1E94 E;  2DAE A;  2DZL A;  3FRH A;  4GEW A;  2BWB A;  2ZTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...