1WR1B

The complex sturcture of dsk2p uba with ubiquitin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
58
structure length
58
Chain Sequence
PGISGGGGGILDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the UBA domain of Dsk2p in complex with ubiquitin molecular determinants for ubiquitin recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Ubiquitin
total genus 19
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2004-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wr1B01
2KHHA 2KNVA 1VEGA 2ZTCA 3FRHA 2KNAA 2JZ0A 4HEOA 4GEWA 1OTRA 1WR1B 2CWBA 1G41A 2ZTDA 2LVAA 1QZEA 1PGYA 2LVPC 3K9OA 1Q02A 2QNJA 2EKFA 1DV0A 2LBCA 3GLGE 1WHCA 1DO2A 1HJPA 1ZMVA 2DZLA 3LCUA 1A5TA 1V92A 1OAIA 2HAKA 2JY6B 1HQYE 1T43A 1MN3A 1BVSA 1OKSA 2QHOB 1WJ7A 2MROB 2R0IA 4Q7JA 1ZMUA 1AIPC 1WGNA 1EFUB 2MR9A 2LVQD 2B3TA 2KNZA 4F1IA 2BWBA 2EKKA 3B89A 1XXHE 2OOBA 1NV9A 1GO5A 2JY8A 1F4IA 3E46A 2RRUA 1TR8A 1XB2B 2HWJA 1P3QQ 2DAGA 2O25A 2OOAA 2DNAA 2L4EA 1HT2E 2JY5A 2K9DA 3FRIA 3K9PA 1R4GA 2JUJA 1WGLA 3GLHE 3IECA 1VEKA 1VQ1A 4UN2B 4R71A 2JP7A 3BBZA 2DAEA 1IM2A 5DFLA 2DENA 2L2DA 2BWEA 3E21A 3MMPA 1VDLA 4F2LA 4WP2A 1VG5A 1WIVA 1YLAA 1IFYA 2MJ5B 1C7YA 4DBGB 2CP8A 1CUKA 2EJSA 2DHYA 3FE3A 2WZJA 3GLFE 2DI0A 2H5XA 1ZMWA 2LTUA 1E94E 2LVOC 3IHPA 3GLIE 2JZ1A 1ZV1A 2G3QA 2L4FA 1G3IA 3LCVB 4G3OA 1KYIA 1JR3E 1Y8GA 1NV8A 2JY7A 1DO0A 2DAIA 2DAMA 3T6PA 2LVNC 2DAKA 2DKLA 1G4AE 1UFZA 2JNHA 3H4JA 1SG9A 1VEJA 1HT1E 2OO9A 2K0BX 5JI2E 1TTEA 2MGWA 1T6OA 3F92A 1IXSA 1OQYA 2QSFX
chains in the Genus database with same CATH superfamily
2KHHA 1GVNA 4IBFA 4PT5A 4D82A 1NY5A 2L7HA 3THGA 3L27A 3GPYA 4W5WA 5KPZA 1D0MA 2APLA 2D7HA 1SXJB 2ZTCA 2KNAA 2XEPA 4LJ5A 4NRWA 3UK6A 1OTRA 4XGIA 3JAMS 2P5TA 2ZTDA 2HCBA 3H4MA 3PNVA 1D0KA 2LVPC 2UUAM 1Q02A 1KFVA 3GLIB 2J7OA 2BJWA 3QYEA 3V76A 3JR4A 4MGKE 2EKFA 3J7BA 4OU7A 3GQ4A 1IN4A 1DV0A 1XMOM 3C58A 2F5NA 3VK8A 3KOXE 2XSZA 2LXEA 3K8ZA 3FUTA 3L2AA 2CE7A 4IBKA 3I51A 1XC8A 4B3SM 3SAVA 3MK6A 4WURA 1N34M 4JI1M 4X64M 2L09A 1N78A 4DV1M 5ITTA 1FJGM 2QHOB 1DGBA 2M60A 2VIIA 4GMQA 2CRUA 3FTCA 3SATA 4FWHA 3A46A 3KVWA 2KA6B 2Z7JA 4PD2A 4FWGA 2XZFA 2L7IA 1RU3A 4DV2M 1XXHE 2KEBA 3SARA 1NV9A 1LV7A 4L16A 5KQ8A 1R7RA 3DA1A 4MGYE 1IN7A 1TR8A 3EIHA 4X62M 1G8PA 2C9OA 3ZQJA 4DV0M 2QPAA 3A45A 1Z59A 3W68A 2DAGA 2BNKA 1HT2E 2JY5A 3NBXX 1IBKM 3K9PA 3TWKA 4IIWA 1W5SA 1WGLA 3GLHE 3IECA 4IBEA 1VQ1A 5EXSA 3BBZA 2V1UA 4LY6A 2DAEA 3ZCBB 1GABA 2FH0A 2ZAOA 5DFLA 4BBAA 1QUTA 2L6OA 1PJIA 1I4WA 2UUCM 2DENA 2BWEA 4IBDA 2JWSA 3DFZA 2V1CA 4D81A 2CHGA 1VG5A 4DR5M 1IXRC 3AOEA 4LCBA 4MGZE 5FTKA 1OIZA 4M0DA 3SHFA 1C1KA 2O5RA 3PFIA 1IN6A 3J7AS 2XGNA 2RKOA 2CP8A 4QNMA 5FTMA 3KOWE 1CUKA 3L26A 4GC5A 4MGHA 4XBOA 2EJSA 4LFBM 4JI8M 3AL0C 4LZZA 1VDDA 3RFWA 2FOIC 3PNYA 4LJ8A 4PDGA 4JYAM 5KO3A 4M9ZA 1GLNA 3SMSA 2LTUA 1E94E 5EP2A 1R2ZA 3VKGA 4DR1M 2DWMA 4KO8A 1Z6TA 1J7KA 1T3TA 1GL7A 3GPXA 2UXDM 1KYIA 3LVVA 4XK8F 1H6UA 4TUWA 4FD2A 1TH3A 3LQRA 1E9SA 4FW9A 1JQJC 4R3DA 5FLXS 5FTNA 1UFZA 1V34A 3GLFB 4D80A 2YR0A 3I4YA 3HJQA 5L8RF 4NXMM 1NHGC 3H4JA 4S12A 4L4UA 1Z5AA 1GKIA 3FYDA 2MGWA 3QAUA 2XFSA 3GRRA 4X65M 3FUXA 3HHYA 3J2PB 4L78A 3FTEA 2LNHC 5LMUM 3LMMA 3FUVA 1DGFA 3B7QA 1GJTA 4Z6YA 2KNVA 1VEGA 3UGJA 2J5YA 2X4AA 3FRHA 3GLHA 4P16A 2YNMD 2GNOA 5IWAM 4LF4M 3KS8A 2DWNA 2CWBA 4REZA 1G41A 2R46A 2LVAA 1QZEA 2LHCA 3TQSA 1NJFA 4I81A 1QVRA 4G4RA 1QAQA 1PJTA 2X49A 2AHMA 3BXWA 3TWMA 2LBCA 3GP1A 1WHCA 2DZLA 1YUBA 1DGGA 1V92A 4GITA 3NWLA 4LGMA 3U5ZB 1QQWA 2V6ZM 4GKKM 2XLJA 3KP1E 4DR3M 1HQYE 1TH4A 3VDPA 2O01F 3SYLA 4Z8XA 3FUWA 4L8RC 1WJ7A 5ITUA 2R4JA 1AIPC 2DZOB 1IN5A 3KOYE 2VQFM 2MR9A 1QDTA 4AZFA 2UU9M 3E4RA 4B3TM 2B3TA 5KPTA 3GLGB 4AW4A 4F1IA 4LF9M 4OVZA 3B89A 3U60A 2GQFA 1E9RA 2ZAMA 2ZANA 4ANRA 1GO5A 1HR0M 1N77A 3PVSA 2XSZD 2FNAA 3E46A 4GRIA 2RRUA 3Q8XA 4KHPM 3PXGA 1YE9A 2CV0A 3Q8GA 1L8QA 1P3QQ 2CEAA 2HWJA 2LH0A 4OVZB 5EJCA 4A3VB 3GPUA 1HNWM 1Z5CA 3LVWA 3U5ZA 3GRYA 2DHRA 4UN2B 4KLNA 4R71A 2JP7A 4JN6A 2ERCA 5C18A 3W0LB 5EXXA 2QQ8A 1XNRM 1LTMA 1Q3CA 3FTFA 4NSRA 1HNZM 1TF0B 4EIWA 3VKHA 2KDLA 3LW5F 3WHLA 2L2DA 3ZH9B 1V33A 1PJQA 5JI3E 1G59A 4M9XA 4F2LA 4WP2A 1Q39A 1E32A 4BLCA 2MH8A 4AKGA 4KODA 2FS1A 1OFHA 1C7YA 3U6OA 1DGHB 4HL4A 4CIZA 2VF7A 4RF0A 4MGIE 3HJSA 4CJ6A 2R18A 2Z4RA 5BPVA 2XZUA 3CF0A 2DHYA 2W82A 2LWXA 1PJJA 4JI3M 1G71A 2DZNB 1QZMA 3HU2A 2LVOC 1QUSA 3B74A 4DV7M 2C98A 3B9PA 2JZ1A 4LF7M 3GQ5A 1QDRA 2QZ4A 2L4FA 1G3IA 3C9PA 3DZDA 5DYGA 3K2LA 3LCVB 4JI7M 1JR3E 3KXEC 2HHHM 3GLIA 4DR6M 4NSOB 1GJSA 1NVMA 2JY7A 2WSCF 4IJEA 4NRVA 5GKNA 4JI6M 5EXPA 4GHLA 1L1TA 2ZM6M 3MJ5A 4QHTA 4KT0F 2DKLA 2N35A 3HU1A 5KPRA 2CHVA 4JI4M 4FCVA 1XNQM 1IY2A 4M0WA 2C9CA 1TDHA 2K0BX 1TTEA 1WXQA 1NJGA 3I4VA 3GLGA 3KSXA 3T15A 2QP9X 2WSEF 3L29A 4LJ7A 4L6V6 2Z3XA 2LHGA 1L2DA 3KDSE 3QYBA 2CV2A 2QBYB 2R65A 2R62A 2EUCA 4LF6M 3RGSA 2JZ0A 1IN8A 4DR7M 1QANA 4GEWA 1WR1B 2C5RA 1IXSB 3GQ3A 4NC6A 1PGYA 3A42A 4ITQA 2QNJA 3U6CA 2KRUA 4LFAM 4AG5A 4MH0E 3SMPA 2CUZA 1OIPA 3EIEA 4IBGA 3SASA 1PJSA 3GLFA 4IBJA 1HJPA 1ZMVA 3VDUA 2E5LM 2XH9A 1A5TA 2QCUA 2Z8YM 3TL4X 1OAIA 3L25A 4RNAA 5FTJA 1XHBA 2JXNA 1IY0A 3K92A 2UXCM 3I04M 5ITRA 2CFOA 3B7NA 4LFCM 1NNUC 3GRUA 3HHWA 4FCTA 5EP4A 2MROB 4Q7JA 3GPPA 3T38A 1ZMUA 1WGNA 5FTLA 2KZSA 2HKJA 3D8LA 3W0FA 1I94M 2ZBKB 1TDZA 2BJVA 2YFQA 2KNZA 3A98B 2BWBA 1J5EM 4LJ4A 1HQCA 1S3SA 1R5LA 2JY8A 1F4IA 2I7PA 4Y28F 2F5OA 4QOZC 2Q2EB 4CHTB 3J81S 2O25A 2OOAA 2DNAA 4HLQA 2L4EA 3CGWA 5F3WA 2KXEA 3HWSA 1Z5BA 5KQDA 1R4GA 2XFTA 2R44A 1VEKA 3AV0A 3UZUA 2RGHA 3TE6A 3VLFB 4G4OA 3J80S 3OTOM 3SC3A 3JR5A 3GO8A 3FYCA 4NOOB 4R7GA 3E21A 3MMPA 3VK7A 1GL6A 1WIVA 1EIJA 5ITXE 1SXJE 2MJ5B 3CF6E 3C3DA 3HJ8A 4II7A 4L15A 4PCZA 3SAUA 4DR4M 4DBGB 4AKIA 3MHVC 5E26A 4B7HA 3U6EA 3AJIB 2OQ4A 4DR2M 1K3WA 4QNRA 5A2QS 1X37A 1K3XA 4G4QA 3HZJA 4LZJA 2X8AA 2WZJA 1KSFX 3GLFE 2F5SA 4GHAA 4AI6A 1OFIA 3FKEA 2KZUA 4RF1A 3ZC7B 3U6SA 4YHHM 2M5ZA 2H5XA 2FE8A 3IHPA 4LG2A 1MX0A 2Z4SA 1D2NA 3C3EA 2EA0A 3ILKA 1PM5A 2UXBM 3HHXA 2R45A 4OW0A 1DGHA 1SXJC 4JXJA 4JI0M 2Y0TA 3D8BA 4DV4M 1ZAEA 3HY5A 4IBCA 2F5PA 1NV8A 4LJ9A 1DO0A 4K0KM 2F5QA 3B7ZA 2LVNC 1JB0F 4DV3M 1G4AE 3FD9A 2JNHA 1SG9A 1VEJA 1FNNA 2KRKA 2OO9A 1ZQ9A 3M7GA 1XXHB 5JI2E 1T6OA 3RE8A 3U6PA 4LRSA 3CTWB 1QAOA 3KW6A 3HHZA 2CHQA 1IXSA 2Y0QA 4I4LA 4LRTA 1OQYA 5ITYA 2QSFX 5EQTA 1EE8A 3NBIA 1XMQM 2VQEM 3R8FA 1NNJA 1JR3D 1QYRA 2JA2A 4AKHA 3I01M 3KFUG 2R6FA 1N36M 3GRVA 4I8OA 4HEOA 4MM3B 3HU3A 4QOSA 4I5SA 3UJNA 4AQYM 3HX3A 4G6ZA 5EXTA 2I7NA 3TPZA 3K9OA 4BB9A 1L2BA 4AG6A 3K1JA 2HL7A 1MU5A 4B7GA 4B08A 1SXJA 2DWLA 3KP0E 4B3RM 3TWLA 1UM8A 3WHKA 1XWIA 4LF8M 3GLGE 3IG8A 1DO2A 2R4EA 4B7FA 3LCUA 3U6LA 4MB7A 3SHGB 2HAKA 2JY6B 4M9SA 1MN3A 1BVSA 1T43A 4PDIA 1OKSA 3L28A 3U6DA 3KS4A 2VF8A 3HKPA 4YY3M 1L2CA 5LMNM 3AKZA 3LQQA 5C1BA 2R0IA 5IREB 1EFUB 4FWDA 2D7GA 8CATA 4GKJM 2K6BA 2LVQD 1PRBA 2FFJA 4LGYA 5EP3A 1OAOC 4NXNM 1Q3BA 3T1YM 5FSWA 2EKKA 2QENA 4LJAA 2OOBA 5H37D 3DOAA 2D7EA 3KSJA 3SBJA 3SAWA 3AOGA 1XB2B 3FTDA 3GLHB 3E9SA 2K47A 1NY6A 3KOZE 4LF5M 2H1RA 4IJFA 3U60B 3CF2A 1N32M 2K9DA 3FRIA 2F4VM 2JUJA 2A5YB 2VDBB 4DV5M 4DV6M 3T1HM 1IM2A 4IBBA 4JI5M 4IBIA 4GIPA 3U6QA 1VDLA 2UUBM 2G8LA 2XF3A 2EO2A 5ITXA 1R2YA 1W5TA 2RGOA 1YLAA 1K82A 1IFYA 4NL4H 1IQPA 4G4NA 4WW0A 1IY1A 5DYIA 5BR8M 2QBYA 2DWZB 1HNXM 3QWLA 4CISA 1R6BX 3SYKA 1N75A 3AOEC 2C99A 3BOSA 3FE3A 2Y21A 4ZPXA 5IZ7D 4QHSA 3IG5A 2DXIA 2DI0A 3AFHA 5IT9S 1QAMA 1N33M 1ZMWA 1JR3A 2DVWB 4DUZM 4CGYB 3GLIE 1D0LA 1ZV1A 1NSFA 5E6JA 5DNYA 2G3QA 1MJGM 4GH9A 1L1ZA 2Y20A 4FVMA 7CATA 5ITQA 4OX9M 1TH2A 4JV5M 2YQZA 4G3OA 1Y8GA 2CV1A 1NHWC 3J27B 3U61B 3U6MA 1XXHA 4X66M 4LJ6A 3VFDA 3SFZA 2C96A 3FUUA 4RKUF 2NQ8C 1SXJD 2DAIA 2DAMA 2KW0A 4P17A 3T6PA 2DAKA 1NO1A 2WSFF 4JI2M 1IBMM 1AUAA 1TGUA 3M6AA 1IBLM 4GC9A 1OJLA 1IXZA 1HT1E 2OPFA 3U61A 3RGPA 2G5GX 2J7NA 4DUYM 5EP1A 3W67A 3F92A 4B3MM 1ORYB 3M0EA 3UMMA 3R9XB 1J09A 1YSYA 4FCWA 3HGIA
chains in the Genus database with same CATH topology
2KHHA 2KNVA 1VEGA 2ZTCA 3FRHA 2KNAA 2JZ0A 4HEOA 4GEWA 1OTRA 1WR1B 2CWBA 1G41A 2ZTDA 2LVAA 1QZEA 1PGYA 2LVPC 3K9OA 1Q02A 2QNJA 2EKFA 1DV0A 2LBCA 3GLGE 1WHCA 1DO2A 1HJPA 1ZMVA 2DZLA 3LCUA 1A5TA 1V92A 1OAIA 2HAKA 2JY6B 1HQYE 1T43A 1MN3A 1BVSA 1OKSA 2QHOB 1WJ7A 2MROB 2R0IA 4Q7JA 1ZMUA 1AIPC 1WGNA 1EFUB 2MR9A 2LVQD 2B3TA 2KNZA 4F1IA 2BWBA 2EKKA 3B89A 1XXHE 2OOBA 1NV9A 1GO5A 2JY8A 1F4IA 3E46A 2RRUA 1TR8A 1XB2B 2HWJA 1P3QQ 2DAGA 2O25A 2OOAA 2DNAA 2L4EA 1HT2E 2JY5A 2K9DA 3FRIA 3K9PA 1R4GA 2JUJA 1WGLA 3GLHE 3IECA 1VEKA 1VQ1A 4UN2B 4R71A 2JP7A 3BBZA 2DAEA 1IM2A 5DFLA 2DENA 2L2DA 2BWEA 3E21A 3MMPA 1VDLA 4F2LA 4WP2A 1VG5A 1WIVA 1YLAA 1IFYA 2MJ5B 1C7YA 4DBGB 2CP8A 1CUKA 2EJSA 2DHYA 3FE3A 2WZJA 3GLFE 2DI0A 2H5XA 1ZMWA 2LTUA 1E94E 2LVOC 3IHPA 3GLIE 2JZ1A 1ZV1A 2G3QA 2L4FA 1G3IA 3LCVB 4G3OA 1KYIA 1JR3E 1Y8GA 1NV8A 2JY7A 1DO0A 2DAIA 2DAMA 3T6PA 2LVNC 2DAKA 2DKLA 1G4AE 1UFZA 2JNHA 3H4JA 1SG9A 1VEJA 1HT1E 2OO9A 2K0BX 5JI2E 1TTEA 2MGWA 1T6OA 3F92A 1IXSA 1OQYA 2QSFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHH A;  2KNV A;  1VEG A;  2ZTC A;  3FRH A;  2KNA A;  2JZ0 A;  4HEO A;  4GEW A;  1OTR A;  1WR1 B;  2CWB A;  1G41 A;  2ZTD A;  2LVA A;  1QZE A;  1PGY A;  2LVP C;  3K9O A;  1Q02 A;  2QNJ A;  2EKF A;  1DV0 A;  2LBC A;  3GLG E;  1WHC A;  1DO2 A;  1HJP A;  1ZMV A;  2DZL A;  3LCU A;  1A5T A;  1V92 A;  1OAI A;  2HAK A;  2JY6 B;  1HQY E;  1T43 A;  1MN3 A;  1BVS A;  1OKS A;  2QHO B;  1WJ7 A;  2MRO B;  2R0I A;  4Q7J A;  1ZMU A;  1AIP C;  1WGN A;  1EFU B;  2MR9 A;  2LVQ D;  2B3T A;  2KNZ A;  4F1I A;  2BWB A;  2EKK A;  3B89 A;  1XXH E;  2OOB A;  1NV9 A;  1GO5 A;  2JY8 A;  1F4I A;  3E46 A;  2RRU A;  1TR8 A;  1XB2 B;  2HWJ A;  1P3Q Q;  2DAG A;  2O25 A;  2OOA A;  2DNA A;  2L4E A;  1HT2 E;  2JY5 A;  2K9D A;  3FRI A;  3K9P A;  1R4G A;  2JUJ A;  1WGL A;  3GLH E;  3IEC A;  1VEK A;  1VQ1 A;  4UN2 B;  4R71 A;  2JP7 A;  3BBZ A;  2DAE A;  1IM2 A;  5DFL A;  2DEN A;  2L2D A;  2BWE A;  3E21 A;  3MMP A;  1VDL A;  4F2L A;  4WP2 A;  1VG5 A;  1WIV A;  1YLA A;  1IFY A;  2MJ5 B;  1C7Y A;  4DBG B;  2CP8 A;  1CUK A;  2EJS A;  2DHY A;  3FE3 A;  2WZJ A;  3GLF E;  2DI0 A;  2H5X A;  1ZMW A;  2LTU A;  1E94 E;  2LVO C;  3IHP A;  3GLI E;  2JZ1 A;  1ZV1 A;  2G3Q A;  2L4F A;  1G3I A;  3LCV B;  4G3O A;  1KYI A;  1JR3 E;  1Y8G A;  1NV8 A;  2JY7 A;  1DO0 A;  2DAI A;  2DAM A;  3T6P A;  2LVN C;  2DAK A;  2DKL A;  1G4A E;  1UFZ A;  2JNH A;  3H4J A;  1SG9 A;  1VEJ A;  1HT1 E;  2OO9 A;  2K0B X;  5JI2 E;  1TTE A;  2MGW A;  1T6O A;  3F92 A;  1IXS A;  1OQY A;  2QSF X; 
#chains in the Genus database with same CATH topology
 2KHH A;  1GVN A;  4IBF A;  4PT5 A;  4D82 A;  1NY5 A;  2L7H A;  3THG A;  3L27 A;  3GPY A;  4W5W A;  5KPZ A;  1D0M A;  2APL A;  2D7H A;  1SXJ B;  2ZTC A;  2KNA A;  2XEP A;  4LJ5 A;  4NRW A;  3UK6 A;  1OTR A;  4XGI A;  3JAM S;  2P5T A;  2ZTD A;  2HCB A;  3H4M A;  3PNV A;  1D0K A;  2LVP C;  2UUA M;  1Q02 A;  1KFV A;  3GLI B;  2J7O A;  2BJW A;  3QYE A;  3V76 A;  3JR4 A;  4MGK E;  2EKF A;  3J7B A;  4OU7 A;  3GQ4 A;  1IN4 A;  1DV0 A;  1XMO M;  3C58 A;  2F5N A;  3VK8 A;  3KOX E;  2XSZ A;  2LXE A;  3K8Z A;  3FUT A;  3L2A A;  2CE7 A;  4IBK A;  3I51 A;  1XC8 A;  4B3S M;  3SAV A;  3MK6 A;  4WUR A;  1N34 M;  4JI1 M;  4X64 M;  2L09 A;  1N78 A;  4DV1 M;  5ITT A;  1FJG M;  2QHO B;  1DGB A;  2M60 A;  2VII A;  4GMQ A;  2CRU A;  3FTC A;  3SAT A;  4FWH A;  3A46 A;  3KVW A;  2KA6 B;  2Z7J A;  4PD2 A;  4FWG A;  2XZF A;  2L7I A;  1RU3 A;  4DV2 M;  1XXH E;  2KEB A;  3SAR A;  1NV9 A;  1LV7 A;  4L16 A;  5KQ8 A;  1R7R A;  3DA1 A;  4MGY E;  1IN7 A;  1TR8 A;  3EIH A;  4X62 M;  1G8P A;  2C9O A;  3ZQJ A;  4DV0 M;  2QPA A;  3A45 A;  1Z59 A;  3W68 A;  2DAG A;  2BNK A;  1HT2 E;  2JY5 A;  3NBX X;  1IBK M;  3K9P A;  3TWK A;  4IIW A;  1W5S A;  1WGL A;  3GLH E;  3IEC A;  4IBE A;  1VQ1 A;  5EXS A;  3BBZ A;  2V1U A;  4LY6 A;  2DAE A;  3ZCB B;  1GAB A;  2FH0 A;  2ZAO A;  5DFL A;  4BBA A;  1QUT A;  2L6O A;  1PJI A;  1I4W A;  2UUC M;  2DEN A;  2BWE A;  4IBD A;  2JWS A;  3DFZ A;  2V1C A;  4D81 A;  2CHG A;  1VG5 A;  4DR5 M;  1IXR C;  3AOE A;  4LCB A;  4MGZ E;  5FTK A;  1OIZ A;  4M0D A;  3SHF A;  1C1K A;  2O5R A;  3PFI A;  1IN6 A;  3J7A S;  2XGN A;  2RKO A;  2CP8 A;  4QNM A;  5FTM A;  3KOW E;  1CUK A;  3L26 A;  4GC5 A;  4MGH A;  4XBO A;  2EJS A;  4LFB M;  4JI8 M;  3AL0 C;  4LZZ A;  1VDD A;  3RFW A;  2FOI C;  3PNY A;  4LJ8 A;  4PDG A;  4JYA M;  5KO3 A;  4M9Z A;  1GLN A;  3SMS A;  2LTU A;  1E94 E;  5EP2 A;  1R2Z A;  3VKG A;  4DR1 M;  2DWM A;  4KO8 A;  1Z6T A;  1J7K A;  1T3T A;  1GL7 A;  3GPX A;  2UXD M;  1KYI A;  3LVV A;  4XK8 F;  1H6U A;  4TUW A;  4FD2 A;  1TH3 A;  3LQR A;  1E9S A;  4FW9 A;  1JQJ C;  4R3D A;  5FLX S;  5FTN A;  1UFZ A;  1V34 A;  3GLF B;  4D80 A;  2YR0 A;  3I4Y A;  3HJQ A;  5L8R F;  4NXM M;  1NHG C;  3H4J A;  4S12 A;  4L4U A;  1Z5A A;  1GKI A;  3FYD A;  2MGW A;  3QAU A;  2XFS A;  3GRR A;  4X65 M;  3FUX A;  3HHY A;  3J2P B;  4L78 A;  3FTE A;  2LNH C;  5LMU M;  3LMM A;  3FUV A;  1DGF A;  3B7Q A;  1GJT A;  4Z6Y A;  2KNV A;  1VEG A;  3UGJ A;  2J5Y A;  2X4A A;  3FRH A;  3GLH A;  4P16 A;  2YNM D;  2GNO A;  5IWA M;  4LF4 M;  3KS8 A;  2DWN A;  2CWB A;  4REZ A;  1G41 A;  2R46 A;  2LVA A;  1QZE A;  2LHC A;  3TQS A;  1NJF A;  4I81 A;  1QVR A;  4G4R A;  1QAQ A;  1PJT A;  2X49 A;  2AHM A;  3BXW A;  3TWM A;  2LBC A;  3GP1 A;  1WHC A;  2DZL A;  1YUB A;  1DGG A;  1V92 A;  4GIT A;  3NWL A;  4LGM A;  3U5Z B;  1QQW A;  2V6Z M;  4GKK M;  2XLJ A;  3KP1 E;  4DR3 M;  1HQY E;  1TH4 A;  3VDP A;  2O01 F;  3SYL A;  4Z8X A;  3FUW A;  4L8R C;  1WJ7 A;  5ITU A;  2R4J A;  1AIP C;  2DZO B;  1IN5 A;  3KOY E;  2VQF M;  2MR9 A;  1QDT A;  4AZF A;  2UU9 M;  3E4R A;  4B3T M;  2B3T A;  5KPT A;  3GLG B;  4AW4 A;  4F1I A;  4LF9 M;  4OVZ A;  3B89 A;  3U60 A;  2GQF A;  1E9R A;  2ZAM A;  2ZAN A;  4ANR A;  1GO5 A;  1HR0 M;  1N77 A;  3PVS A;  2XSZ D;  2FNA A;  3E46 A;  4GRI A;  2RRU A;  3Q8X A;  4KHP M;  3PXG A;  1YE9 A;  2CV0 A;  3Q8G A;  1L8Q A;  1P3Q Q;  2CEA A;  2HWJ A;  2LH0 A;  4OVZ B;  5EJC A;  4A3V B;  3GPU A;  1HNW M;  1Z5C A;  3LVW A;  3U5Z A;  3GRY A;  2DHR A;  4UN2 B;  4KLN A;  4R71 A;  2JP7 A;  4JN6 A;  2ERC A;  5C18 A;  3W0L B;  5EXX A;  2QQ8 A;  1XNR M;  1LTM A;  1Q3C A;  3FTF A;  4NSR A;  1HNZ M;  1TF0 B;  4EIW A;  3VKH A;  2KDL A;  3LW5 F;  3WHL A;  2L2D A;  3ZH9 B;  1V33 A;  1PJQ A;  5JI3 E;  1G59 A;  4M9X A;  4F2L A;  4WP2 A;  1Q39 A;  1E32 A;  4BLC A;  2MH8 A;  4AKG A;  4KOD A;  2FS1 A;  1OFH A;  1C7Y A;  3U6O A;  1DGH B;  4HL4 A;  4CIZ A;  2VF7 A;  4RF0 A;  4MGI E;  3HJS A;  4CJ6 A;  2R18 A;  2Z4R A;  5BPV A;  2XZU A;  3CF0 A;  2DHY A;  2W82 A;  2LWX A;  1PJJ A;  4JI3 M;  1G71 A;  2DZN B;  1QZM A;  3HU2 A;  2LVO C;  1QUS A;  3B74 A;  4DV7 M;  2C98 A;  3B9P A;  2JZ1 A;  4LF7 M;  3GQ5 A;  1QDR A;  2QZ4 A;  2L4F A;  1G3I A;  3C9P A;  3DZD A;  5DYG A;  3K2L A;  3LCV B;  4JI7 M;  1JR3 E;  3KXE C;  2HHH M;  3GLI A;  4DR6 M;  4NSO B;  1GJS A;  1NVM A;  2JY7 A;  2WSC F;  4IJE A;  4NRV A;  5GKN A;  4JI6 M;  5EXP A;  4GHL A;  1L1T A;  2ZM6 M;  3MJ5 A;  4QHT A;  4KT0 F;  2DKL A;  2N35 A;  3HU1 A;  5KPR A;  2CHV A;  4JI4 M;  4FCV A;  1XNQ M;  1IY2 A;  4M0W A;  2C9C A;  1TDH A;  2K0B X;  1TTE A;  1WXQ A;  1NJG A;  3I4V A;  3GLG A;  3KSX A;  3T15 A;  2QP9 X;  2WSE F;  3L29 A;  4LJ7 A;  4L6V 6;  2Z3X A;  2LHG A;  1L2D A;  3KDS E;  3QYB A;  2CV2 A;  2QBY B;  2R65 A;  2R62 A;  2EUC A;  4LF6 M;  3RGS A;  2JZ0 A;  1IN8 A;  4DR7 M;  1QAN A;  4GEW A;  1WR1 B;  2C5R A;  1IXS B;  3GQ3 A;  4NC6 A;  1PGY A;  3A42 A;  4ITQ A;  2QNJ A;  3U6C A;  2KRU A;  4LFA M;  4AG5 A;  4MH0 E;  3SMP A;  2CUZ A;  1OIP A;  3EIE A;  4IBG A;  3SAS A;  1PJS A;  3GLF A;  4IBJ A;  1HJP A;  1ZMV A;  3VDU A;  2E5L M;  2XH9 A;  1A5T A;  2QCU A;  2Z8Y M;  3TL4 X;  1OAI A;  3L25 A;  4RNA A;  5FTJ A;  1XHB A;  2JXN A;  1IY0 A;  3K92 A;  2UXC M;  3I04 M;  5ITR A;  2CFO A;  3B7N A;  4LFC M;  1NNU C;  3GRU A;  3HHW A;  4FCT A;  5EP4 A;  2MRO B;  4Q7J A;  3GPP A;  3T38 A;  1ZMU A;  1WGN A;  5FTL A;  2KZS A;  2HKJ A;  3D8L A;  3W0F A;  1I94 M;  2ZBK B;  1TDZ A;  2BJV A;  2YFQ A;  2KNZ A;  3A98 B;  2BWB A;  1J5E M;  4LJ4 A;  1HQC A;  1S3S A;  1R5L A;  2JY8 A;  1F4I A;  2I7P A;  4Y28 F;  2F5O A;  4QOZ C;  2Q2E B;  4CHT B;  3J81 S;  2O25 A;  2OOA A;  2DNA A;  4HLQ A;  2L4E A;  3CGW A;  5F3W A;  2KXE A;  3HWS A;  1Z5B A;  5KQD A;  1R4G A;  2XFT A;  2R44 A;  1VEK A;  3AV0 A;  3UZU A;  2RGH A;  3TE6 A;  3VLF B;  4G4O A;  3J80 S;  3OTO M;  3SC3 A;  3JR5 A;  3GO8 A;  3FYC A;  4NOO B;  4R7G A;  3E21 A;  3MMP A;  3VK7 A;  1GL6 A;  1WIV A;  1EIJ A;  5ITX E;  1SXJ E;  2MJ5 B;  3CF6 E;  3C3D A;  3HJ8 A;  4II7 A;  4L15 A;  4PCZ A;  3SAU A;  4DR4 M;  4DBG B;  4AKI A;  3MHV C;  5E26 A;  4B7H A;  3U6E A;  3AJI B;  2OQ4 A;  4DR2 M;  1K3W A;  4QNR A;  5A2Q S;  1X37 A;  1K3X A;  4G4Q A;  3HZJ A;  4LZJ A;  2X8A A;  2WZJ A;  1KSF X;  3GLF E;  2F5S A;  4GHA A;  4AI6 A;  1OFI A;  3FKE A;  2KZU A;  4RF1 A;  3ZC7 B;  3U6S A;  4YHH M;  2M5Z A;  2H5X A;  2FE8 A;  3IHP A;  4LG2 A;  1MX0 A;  2Z4S A;  1D2N A;  3C3E A;  2EA0 A;  3ILK A;  1PM5 A;  2UXB M;  3HHX A;  2R45 A;  4OW0 A;  1DGH A;  1SXJ C;  4JXJ A;  4JI0 M;  2Y0T A;  3D8B A;  4DV4 M;  1ZAE A;  3HY5 A;  4IBC A;  2F5P A;  1NV8 A;  4LJ9 A;  1DO0 A;  4K0K M;  2F5Q A;  3B7Z A;  2LVN C;  1JB0 F;  4DV3 M;  1G4A E;  3FD9 A;  2JNH A;  1SG9 A;  1VEJ A;  1FNN A;  2KRK A;  2OO9 A;  1ZQ9 A;  3M7G A;  1XXH B;  5JI2 E;  1T6O A;  3RE8 A;  3U6P A;  4LRS A;  3CTW B;  1QAO A;  3KW6 A;  3HHZ A;  2CHQ A;  1IXS A;  2Y0Q A;  4I4L A;  4LRT A;  1OQY A;  5ITY A;  2QSF X;  5EQT A;  1EE8 A;  3NBI A;  1XMQ M;  2VQE M;  3R8F A;  1NNJ A;  1JR3 D;  1QYR A;  2JA2 A;  4AKH A;  3I01 M;  3KFU G;  2R6F A;  1N36 M;  3GRV A;  4I8O A;  4HEO A;  4MM3 B;  3HU3 A;  4QOS A;  4I5S A;  3UJN A;  4AQY M;  3HX3 A;  4G6Z A;  5EXT A;  2I7N A;  3TPZ A;  3K9O A;  4BB9 A;  1L2B A;  4AG6 A;  3K1J A;  2HL7 A;  1MU5 A;  4B7G A;  4B08 A;  1SXJ A;  2DWL A;  3KP0 E;  4B3R M;  3TWL A;  1UM8 A;  3WHK A;  1XWI A;  4LF8 M;  3GLG E;  3IG8 A;  1DO2 A;  2R4E A;  4B7F A;  3LCU A;  3U6L A;  4MB7 A;  3SHG B;  2HAK A;  2JY6 B;  4M9S A;  1MN3 A;  1BVS A;  1T43 A;  4PDI A;  1OKS A;  3L28 A;  3U6D A;  3KS4 A;  2VF8 A;  3HKP A;  4YY3 M;  1L2C A;  5LMN M;  3AKZ A;  3LQQ A;  5C1B A;  2R0I A;  5IRE B;  1EFU B;  4FWD A;  2D7G A;  8CAT A;  4GKJ M;  2K6B A;  2LVQ D;  1PRB A;  2FFJ A;  4LGY A;  5EP3 A;  1OAO C;  4NXN M;  1Q3B A;  3T1Y M;  5FSW A;  2EKK A;  2QEN A;  4LJA A;  2OOB A;  5H37 D;  3DOA A;  2D7E A;  3KSJ A;  3SBJ A;  3SAW A;  3AOG A;  1XB2 B;  3FTD A;  3GLH B;  3E9S A;  2K47 A;  1NY6 A;  3KOZ E;  4LF5 M;  2H1R A;  4IJF A;  3U60 B;  3CF2 A;  1N32 M;  2K9D A;  3FRI A;  2F4V M;  2JUJ A;  2A5Y B;  2VDB B;  4DV5 M;  4DV6 M;  3T1H M;  1IM2 A;  4IBB A;  4JI5 M;  4IBI A;  4GIP A;  3U6Q A;  1VDL A;  2UUB M;  2G8L A;  2XF3 A;  2EO2 A;  5ITX A;  1R2Y A;  1W5T A;  2RGO A;  1YLA A;  1K82 A;  1IFY A;  4NL4 H;  1IQP A;  4G4N A;  4WW0 A;  1IY1 A;  5DYI A;  5BR8 M;  2QBY A;  2DWZ B;  1HNX M;  3QWL A;  4CIS A;  1R6B X;  3SYK A;  1N75 A;  3AOE C;  2C99 A;  3BOS A;  3FE3 A;  2Y21 A;  4ZPX A;  5IZ7 D;  4QHS A;  3IG5 A;  2DXI A;  2DI0 A;  3AFH A;  5IT9 S;  1QAM A;  1N33 M;  1ZMW A;  1JR3 A;  2DVW B;  4DUZ M;  4CGY B;  3GLI E;  1D0L A;  1ZV1 A;  1NSF A;  5E6J A;  5DNY A;  2G3Q A;  1MJG M;  4GH9 A;  1L1Z A;  2Y20 A;  4FVM A;  7CAT A;  5ITQ A;  4OX9 M;  1TH2 A;  4JV5 M;  2YQZ A;  4G3O A;  1Y8G A;  2CV1 A;  1NHW C;  3J27 B;  3U61 B;  3U6M A;  1XXH A;  4X66 M;  4LJ6 A;  3VFD A;  3SFZ A;  2C96 A;  3FUU A;  4RKU F;  2NQ8 C;  1SXJ D;  2DAI A;  2DAM A;  2KW0 A;  4P17 A;  3T6P A;  2DAK A;  1NO1 A;  2WSF F;  4JI2 M;  1IBM M;  1AUA A;  1TGU A;  3M6A A;  1IBL M;  4GC9 A;  1OJL A;  1IXZ A;  1HT1 E;  2OPF A;  3U61 A;  3RGP A;  2G5G X;  2J7N A;  4DUY M;  5EP1 A;  3W67 A;  3F92 A;  4B3M M;  1ORY B;  3M0E A;  3UMM A;  3R9X B;  1J09 A;  1YSY A;  4FCW A;  3HGI A; 
#chains in the Genus database with same CATH homology
 2KHH A;  2KNV A;  1VEG A;  2ZTC A;  3FRH A;  2KNA A;  2JZ0 A;  4HEO A;  4GEW A;  1OTR A;  1WR1 B;  2CWB A;  1G41 A;  2ZTD A;  2LVA A;  1QZE A;  1PGY A;  2LVP C;  3K9O A;  1Q02 A;  2QNJ A;  2EKF A;  1DV0 A;  2LBC A;  3GLG E;  1WHC A;  1DO2 A;  1HJP A;  1ZMV A;  2DZL A;  3LCU A;  1A5T A;  1V92 A;  1OAI A;  2HAK A;  2JY6 B;  1HQY E;  1T43 A;  1MN3 A;  1BVS A;  1OKS A;  2QHO B;  1WJ7 A;  2MRO B;  2R0I A;  4Q7J A;  1ZMU A;  1AIP C;  1WGN A;  1EFU B;  2MR9 A;  2LVQ D;  2B3T A;  2KNZ A;  4F1I A;  2BWB A;  2EKK A;  3B89 A;  1XXH E;  2OOB A;  1NV9 A;  1GO5 A;  2JY8 A;  1F4I A;  3E46 A;  2RRU A;  1TR8 A;  1XB2 B;  2HWJ A;  1P3Q Q;  2DAG A;  2O25 A;  2OOA A;  2DNA A;  2L4E A;  1HT2 E;  2JY5 A;  2K9D A;  3FRI A;  3K9P A;  1R4G A;  2JUJ A;  1WGL A;  3GLH E;  3IEC A;  1VEK A;  1VQ1 A;  4UN2 B;  4R71 A;  2JP7 A;  3BBZ A;  2DAE A;  1IM2 A;  5DFL A;  2DEN A;  2L2D A;  2BWE A;  3E21 A;  3MMP A;  1VDL A;  4F2L A;  4WP2 A;  1VG5 A;  1WIV A;  1YLA A;  1IFY A;  2MJ5 B;  1C7Y A;  4DBG B;  2CP8 A;  1CUK A;  2EJS A;  2DHY A;  3FE3 A;  2WZJ A;  3GLF E;  2DI0 A;  2H5X A;  1ZMW A;  2LTU A;  1E94 E;  2LVO C;  3IHP A;  3GLI E;  2JZ1 A;  1ZV1 A;  2G3Q A;  2L4F A;  1G3I A;  3LCV B;  4G3O A;  1KYI A;  1JR3 E;  1Y8G A;  1NV8 A;  2JY7 A;  1DO0 A;  2DAI A;  2DAM A;  3T6P A;  2LVN C;  2DAK A;  2DKL A;  1G4A E;  1UFZ A;  2JNH A;  3H4J A;  1SG9 A;  1VEJ A;  1HT1 E;  2OO9 A;  2K0B X;  5JI2 E;  1TTE A;  2MGW A;  1T6O A;  3F92 A;  1IXS A;  1OQY A;  2QSF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...