1WR1B

The complex sturcture of dsk2p uba with ubiquitin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
58
structure length
58
Chain Sequence
b'PGISGGGGGILDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Structure of the UBA domain of Dsk2p in complex with ubiquitin molecular determinants for ubiquitin recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 19
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2004-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wr1B01
2HAKA 2JZ0A 1G4AE 1ZMUA 3B89A 3H4JA 5DFLA 1XB2B 2BWEA 1WGLA 1CUKA 2ZTDA 2JP7A 3E46A 3GLFE 2DNAA 1WJ7A 2KNAA 2JZ1A 1DV0A 3LCVB 1PGYA 2CWBA 1NV9A 2R0IA 2DAMA 2DKLA 2MROB 1VEJA 2DAKA 3E21A 2B3TA 1DO2A 3FE3A 3GLGE 2JY6B 2JY7A 1GO5A 1OQYA 2KNZA 2LBCA 2OOAA 3T6PA 4DBGB 1HJPA 1YLAA 2JUJA 2LVPC 4GEWA 1EFUB 1JR3E 1R4GA 1VG5A 4G3OA 1VDLA 1XXHE 1VEGA 2QHOB 2KHHA 2CP8A 2DAGA 1OKSA 1HT1E 1MN3A 1Y8GA 2MJ5B 2WZJA 2DZLA 1WIVA 2DHYA 1UFZA 4F1IA 2OOBA 2LVNC 2H5XA 4Q7JA 3GLIE 5JI2E 3FRHA 1T43A 1P3QQ 2LVAA 2DAEA 1QZEA 1HT2E 3BBZA 4R71A 3LCUA 2L4FA 1DO0A 2OO9A 2DI0A 4UN2B 1AIPC 2EKFA 4HEOA 1BVSA 1Q02A 1V92A 3FRIA 2O25A 3F92A 1IFYA 3K9OA 2RRUA 2JY5A 2QNJA 1TR8A 2ZTCA 1WR1B 1HQYE 1VEKA 1VQ1A 2K0BX 3MMPA 2JY8A 2LVQD 2L2DA 2HWJA 4WP2A 2EJSA 2K9DA 2G3QA 1T6OA 1KYIA 1IM2A 3K9PA 2EKKA 2BWBA 1OAIA 1WGNA 1ZMWA 4F2LA 1ZMVA 3IHPA 1F4IA 1TTEA 1NV8A 2QSFX 1G3IA 1ZV1A 1WHCA 1SG9A 3IECA 2KNVA 2LVOC 1E94E 2DENA 2L4EA 1OTRA 2MGWA 3GLHE 1IXSA 1G41A 2JNHA 2LTUA 2DAIA 1C7YA 1A5TA 2MR9A
chains in the Genus database with same CATH superfamily
1OJLA 1G4AE 3D8LA 3GLHB 3HWSA 3K1JA 4GMQA 4LF5M 3I04M 1L2BA 3KSJA 4LCBA 4IBCA 1PJSA 1UM8A 1PJQA 2UUAM 4LZJA 4DV7M 4IBBA 2KRKA 1XC8A 2G5GX 3D8BA 2HKJA 3U6LA 4FW9A 1IBKM 3B7NA 2R65A 2KEBA 2R45A 3GLFE 3JAMS 4GC9A 2F5QA 3DFZA 1Z6TA 2KNAA 2XEPA 2JZ1A 3KOXE 3WHKA 3A46A 3LCVB 2X4AA 3KVWA 3TL4X 4L78A 4K0KM 1L8QA 5ITRA 5C1BA 5FTKA 4LF9M 3AOGA 3FUUA 2G8LA 4DUYM 4FWHA 3SMPA 3HJQA 3EIEA 1VEJA 2KRUA 2V6ZM 3GRRA 3I01M 1XWIA 2DAKA 5EP2A 3E21A 2B3TA 4Z6YA 5LMNM 4NXNM 3SBJA 4AZFA 1OFHA 2LBCA 2WSFF 5BPVA 3R8FA 1HJPA 3VK8A 4B7GA 4GEWA 2LHGA 3DA1A 4KODA 4M9SA 3UZUA 4DV0M 1EFUB 1QVRA 2XSZA 3V76A 1R4GA 3GQ5A 4G3OA 1E32A 3DOAA 2F4VM 1VEGA 3J7AS 2DAGA 3FUWA 2CEAA 4GH9A 2FE8A 3HGIA 5EXXA 4AKGA 2DZLA 2CHQA 1XXHB 1G59A 2D7HA 1UFZA 2Y21A 4MGYE 2EA0A 4LGMA 3U6PA 4QOSA 4MGIE 4DV6M 4NSRA 4REZA 1WXQA 3VDPA 4NOOB 5IREB 4M0DA 1FJGM 2C99A 2K6BA 3BBZA 3SFZA 1XNRM 2LH0A 3GPUA 4DV3M 2F5NA 3HHWA 2ZBKB 5FTNA 3W0FA 2AHMA 4A3VB 1MJGM 2FH0A 2VDBB 3B74A 1PRBA 2EKFA 5FTMA 4JI5M 1G8PA 5JI3E 1EE8A 2KW0A 3E4RA 2O25A 3F92A 3HKPA 3K8ZA 4FCWA 1IXRC 1NJFA 2RRUA 1HNXM 4FCVA 1GJSA 5E26A 3ZC7B 3K92A 2VQEM 3FUXA 4IBFA 4LJ6A 2DZOB 3NBIA 1Z5BA 7CATA 4P17A 3L25A 3RFWA 2LVQD 4B7HA 3GLHA 2D7GA 4WP2A 4I81A 1QZMA 1GL7A 4G4NA 3PNYA 1KYIA 3L27A 5LMUM 2RGHA 2CHVA 2NQ8C 2DZNB 4XK8F 1HQCA 1NY6A 2CV0A 1QUSA 3HJSA 3L2AA 3M7GA 3NWLA 2J7NA 4KLNA 3SARA 3VDUA 1WHCA 1X37A 3B7ZA 1DGHA 1SG9A 3J2PB 3KDSE 5E6JA 3U6EA 2XZFA 3W0LB 1C7YA 1OTRA 2MH8A 3GLHE 1IXSA 1G41A 2A5YB 2JNHA 2LTUA 4Z8XA 4MGHA 1A5TA 3VKGA 3K2LA 2HAKA 1V33A 5DNYA 2RGOA 4FD2A 3B89A 3KP0E 4HL4A 1JR3D 4PDGA 1QYRA 1TH2A 3H4JA 3KOYE 3AKZA 1TF0B 1PM5A 2BWEA 4CISA 1QAMA 3BOSA 1WGLA 3FTDA 1PJTA 3AV0A 2FOIC 2JP7A 5BR8M 4NRWA 3E46A 4I8OA 3W68A 3C3EA 3C9PA 4X62M 1NHWC 3AOEA 1QANA 5ITQA 1L1TA 3SASA 3GLGA 4II7A 4JI3M 2DNAA 3SMSA 2Z8YM 2Z4SA 2X8AA 1DV0A 8CATA 3SATA 1QDTA 2BJVA 2APLA 2R0IA 1NV9A 4JI6M 2UXCM 2L7IA 3NBXX 4CIZA 3GPPA 1L2CA 2DKLA 4FVMA 3QAUA 4WW0A 1XXHA 1NY5A 1DGGA 4XGIA 2R18A 4CHTB 4L16A 3VLFB 3ZH9B 3ZQJA 1D0LA 1TDHA 2UU9M 1I4WA 2XGNA 1ORYB 4ANRA 4LJ9A 1R2ZA 2Y0QA 2JY6B 3GLGE 3FYDA 4DR3M 4LJ7A 1J5EM 2XFTA 1HNWM 2ZAMA 4NRVA 2F5OA 3IG5A 5ITXE 4DV2M 2W82A 4X65M 3GRYA 1JR3E 4GHLA 1DGHB 5EQTA 2LNHC 1XXHE 2QHOB 2KHHA 2CP8A 1OKSA 3PXGA 1H6UA 1HT1E 1MN3A 1W5SA 4JXJA 1GABA 1IXSB 2XSZD 3AOEC 1WIVA 3CTWB 3FUVA 3UJNA 4LF7M 5KPZA 5EP3A 2Y0TA 4IBDA 5DYGA 2OOBA 3SHFA 3IG8A 4LRTA 2I7NA 1G71A 3Q8XA 2ZM6M 4D81A 3FRHA 1N75A 1T43A 1E9RA 2CHGA 3L29A 5JI2E 1XHBA 2Y20A 3KOWE 4AW4A 4B3RM 1P3QQ 2LVAA 2YR0A 4IIWA 4FCTA 1HT2E 1IBLM 3FD9A 2L4FA 2L7HA 4IBKA 1MU5A 1EIJA 2DVWB 3UGJA 3GLGB 2RKOA 2ERCA 4HEOA 1Q02A 3DZDA 3FRIA 3KSXA 4JI7M 3K9OA 4GITA 3U61A 2YFQA 1J7KA 2JY5A 2ZTCA 1WR1B 1VEKA 2R44A 4BBAA 1VQ1A 2ZAOA 3QYBA 4NSOB 3LVWA 2K0BX 5KPRA 3U6CA 3SAWA 2HHHM 2QBYB 1QAQA 2QP9X 4DR7M 1DGFA 3CF0A 2UXBM 4JI2M 2L2DA 3J27B 4HLQA 4L8RC 4G4RA 2EJSA 4LGYA 2G3QA 1IM2A 3K9PA 3KXEC 1ZAEA 2EKKA 2BWBA 4G4QA 2EUCA 1WGNA 1D2NA 4G6ZA 4D80A 4DV5M 4LF8M 3FTCA 4PD2A 3A98B 2F5PA 1GKIA 1TTEA 1NV8A 3M0EA 3FUTA 3J7BA 2LHCA 2QSFX 2K47A 4FWGA 5EXTA 2DWNA 4JYAM 4LJ5A 3W67A 3KS8A 3FYCA 3IECA 3LQQA 3U6OA 1QUTA 2KNVA 3VFDA 2LVOC 2R62A 2DENA 1LV7A 2R46A 3THGA 3JR4A 1DGBA 3TWMA 1TGUA 2MGWA 2KZSA 1R7RA 1W5TA 2XFSA 3HU2A 4RF0A 2Z3XA 5KQ8A 3H4MA 2C9CA 4G4OA 3PFIA 3SYLA 2MR9A 1NSFA 2JZ0A 2JXNA 3M6AA 4IBIA 4LJAA 4GKKM 1IY0A 1L1ZA 5EJCA 4GC5A 1JQJC 4QNRA 3U6SA 1N32M 4B3TM 4YHHM 1CUKA 1HNZM 2J5YA 2Z4RA 1IN5A 4JN6A 1SXJA 2C5RA 2GNOA 3GLIA 4OX9M 4B3SM 5FLXS 3HJ8A 2OPFA 4L15A 2L6OA 1IN8A 2OQ4A 3I4YA 2R4EA 2DWZB 3U61B 4GRIA 3JR5A 1PGYA 1FNNA 2QCUA 2CWBA 5H37D 1XMOM 3KFUG 4LZZA 2L09A 2J7OA 2O5RA 4B08A 4KHPM 4AI6A 2DWMA 3Q8GA 2UUCM 4DR5M 1N36M 2C96A 1ZQ9A 1TH4A 2CE7A 3AFHA 5F3WA 3HX3A 3R9XB 2M60A 4DR1M 3U6DA 2JY7A 3TPZA 1NO1A 2OOAA 1YLAA 3SHGB 2JUJA 2LVPC 4IJEA 1IN7A 4RF1A 3GO8A 4MB7A 1C1KA 3ILKA 2DXIA 1NHGC 4MGZE 3MHVC 3U5ZB 5IWAM 4M9ZA 4OW0A 4AKHA 4Y28F 4IBEA 2N35A 4LFAM 3LMMA 4R7GA 1VDLA 3CF6E 3RGSA 4MGKE 4P16A 4IJFA 1L2DA 2DWLA 2KXEA 4RKUF 4LY6A 5A2QS 1Y8GA 1SXJC 3J80S 1XMQM 2MJ5B 2WZJA 1JB0F 4EIWA 4KO8A 4B3MM 4F1IA 1Z59A 4JI8M 1J09A 1IBMM 3E9SA 3GQ3A 3VKHA 2LVNC 4WURA 4BB9A 1KSFX 4LJ4A 2QBYA 4CGYB 2FFJA 4DV4M 2LWXA 3MJ5A 4LJ8A 3QWLA 4YY3M 3I4VA 4OVZA 2F5SA 3LVVA 1SXJB 3FTFA 4R71A 3GLIB 1DO0A 4TUWA 2DI0A 2V1UA 4JI1M 4UN2B 5ITYA 3HY5A 3HZJA 4OU7A 3GLFA 1K82A 2QNJA 1TR8A 1T3TA 3WHLA 3HHZA 4M0WA 3GPXA 3HHYA 3VK7A 2BNKA 4JV5M 1Q3CA 3MMPA 3T15A 1F4IA 2JY8A 3GP1A 1E9SA 2HL7A 5DYIA 4DV1M 1K3XA 3B7QA 1V34A 2HWJA 2K9DA 2M5ZA 1GJTA 1OAIA 3AL0C 1ZMWA 1OIPA 4F2LA 1ZMVA 1GL6A 1YUBA 2ZANA 2CV2A 2R4JA 3KS4A 4QHTA 1IN6A 1ZV1A 3GQ4A 2CV1A 3MK6A 2DHRA 2O01F 4PCZA 1E94E 1IY2A 1NVMA 2CUZA 4LF4M 1VDDA 1XNQM 4AG6A 5KQDA 3AJIB 2DAIA 1QAOA 2X49A 4D82A 4XBOA 1ZMUA 2HCBA 2JWSA 2LXEA 1Q3BA 5DFLA 3SAUA 3UMMA 2I7PA 1NNUC 2C98A 1XB2B 4LFBM 1R6BX 1YSYA 1OAOC 1D0MA 2ZTDA 4OVZB 2YNMD 3RGPA 3HHXA 3GPYA 3U6MA 4JI0M 3T38A 3ZCBB 4W5WA 1TH3A 4PT5A 2WSCF 4ZPXA 1TDZA 3U5ZA 5EXSA 3HU1A 2E5LM 2QPAA 1WJ7A 4L4UA 2XF3A 4IBJA 5L8RF 2KDLA 3GLFB 1I94M 1SXJD 4LG2A 3BXWA 2VIIA 3QYEA 4DR6M 1R5LA 5EXPA 3L26A 2DAMA 3OTOM 1S3SA 5GKNA 1HR0M 4DR2M 2MROB 3T1HM 4ITQA 2CFOA 3KW6A 2XZUA 4IBGA 1DO2A 3FE3A 1GO5A 2KA6B 1GVNA 1OQYA 2KNZA 3T6PA 4X64M 2VF7A 4DBGB 4LF6M 2WSEF 3TQSA 5EP4A 5EP1A 1Z5AA 1OIZA 2VF8A 4AKIA 2D7EA 5ITTA 1VG5A 3TE6A 4AQYM 3SAVA 1QDRA 2FNAA 2QZ4A 2VQFM 4NC6A 5IZ7D 1PJJA 3FTEA 3U60A 3KOZE 2KZUA 3L28A 1KFVA 3C58A 2R6FA 2DHYA 4KT0F 4GKJM 4X66M 2Q2EB 4GHAA 3PNVA 2CRUA 1IXZA 3UK6A 1SXJE 2H5XA 1K3WA 4Q7JA 1IQPA 3GLIE 4DR4M 3PVSA 1Q39A 4CJ6A 1D0KA 3B9PA 3CGWA 2DAEA 1QZEA 1PJIA 1RU3A 3LW5F 4S12A 3LCUA 2OO9A 1N33M 4QHSA 4MH0E 1N77A 3U6QA 3RE8A 4RNAA 2H1RA 4PDIA 1AIPC 4LFCM 1BVSA 1V92A 1IFYA 4M9XA 4BLCA 4AG5A 2C9OA 5KO3A 3KP1E 1HQYE 3C3DA 2P5TA 4I5SA 3J81S 3EIHA 2EO2A 4L6V6 4LRSA 5FSWA 3HU3A 4I4LA 5C18A 2YQZA 5ITUA 2FS1A 1NNJA 1N34M 1YE9A 4B7FA 2XH9A 2XLJA 1QQWA 2BJWA 3FKEA 2QENA 3A42A 5FTJA 1T6OA 3TWLA 3I51A 1R2YA 2V1CA 1GLNA 3SC3A 1Z5CA 3IHPA 2JA2A 3GRVA 2Z7JA 1IY1A 1G3IA 3TWKA 3SYKA 4GIPA 5FTLA 4NXMM 4FWDA 2QQ8A 2GQFA 3GRUA 1LTMA 1N78A 3LQRA 1IN4A 5ITXA 2L4EA 4NL4H 3A45A 5KPTA 4DUZM 2UXDM 1NJGA 4QNMA 3U60B 4R3DA 2UUBM 1MX0A 1JR3A 4JI4M 4MM3B 5IT9S 3T1YM 1OFIA 3CF2A 4QOZC 1AUAA
chains in the Genus database with same CATH topology
2HAKA 2JZ0A 1G4AE 1ZMUA 3B89A 3H4JA 5DFLA 1XB2B 2BWEA 1WGLA 1CUKA 2ZTDA 2JP7A 3E46A 3GLFE 2DNAA 1WJ7A 2KNAA 2JZ1A 1DV0A 3LCVB 1PGYA 2CWBA 1NV9A 2R0IA 2DAMA 2DKLA 2MROB 1VEJA 2DAKA 3E21A 2B3TA 1DO2A 3FE3A 3GLGE 2JY6B 2JY7A 1GO5A 1OQYA 2KNZA 2LBCA 2OOAA 3T6PA 4DBGB 1HJPA 1YLAA 2JUJA 2LVPC 4GEWA 1EFUB 1JR3E 1R4GA 1VG5A 4G3OA 1VDLA 1XXHE 1VEGA 2QHOB 2KHHA 2CP8A 2DAGA 1OKSA 1HT1E 1MN3A 1Y8GA 2MJ5B 2WZJA 2DZLA 1WIVA 2DHYA 1UFZA 4F1IA 2OOBA 2LVNC 2H5XA 4Q7JA 3GLIE 5JI2E 3FRHA 1T43A 1P3QQ 2LVAA 2DAEA 1QZEA 1HT2E 3BBZA 4R71A 3LCUA 2L4FA 1DO0A 2OO9A 2DI0A 4UN2B 1AIPC 2EKFA 4HEOA 1BVSA 1Q02A 1V92A 3FRIA 2O25A 3F92A 1IFYA 3K9OA 2RRUA 2JY5A 2QNJA 1TR8A 2ZTCA 1WR1B 1HQYE 1VEKA 1VQ1A 2K0BX 3MMPA 2JY8A 2LVQD 2L2DA 2HWJA 4WP2A 2EJSA 2K9DA 2G3QA 1T6OA 1KYIA 1IM2A 3K9PA 2EKKA 2BWBA 1OAIA 1WGNA 1ZMWA 4F2LA 1ZMVA 3IHPA 1F4IA 1TTEA 1NV8A 2QSFX 1G3IA 1ZV1A 1WHCA 1SG9A 3IECA 2KNVA 2LVOC 1E94E 2DENA 2L4EA 1OTRA 2MGWA 3GLHE 1IXSA 1G41A 2JNHA 2LTUA 2DAIA 1C7YA 1A5TA 2MR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HAK A;  2JZ0 A;  1G4A E;  1ZMU A;  3B89 A;  3H4J A;  5DFL A;  1XB2 B;  2BWE A;  1WGL A;  1CUK A;  2ZTD A;  2JP7 A;  3E46 A;  3GLF E;  2DNA A;  1WJ7 A;  2KNA A;  2JZ1 A;  1DV0 A;  3LCV B;  1PGY A;  2CWB A;  1NV9 A;  2R0I A;  2DAM A;  2DKL A;  2MRO B;  1VEJ A;  2DAK A;  3E21 A;  2B3T A;  1DO2 A;  3FE3 A;  3GLG E;  2JY6 B;  2JY7 A;  1GO5 A;  1OQY A;  2KNZ A;  2LBC A;  2OOA A;  3T6P A;  4DBG B;  1HJP A;  1YLA A;  2JUJ A;  2LVP C;  4GEW A;  1EFU B;  1JR3 E;  1R4G A;  1VG5 A;  4G3O A;  1VDL A;  1XXH E;  1VEG A;  2QHO B;  2KHH A;  2CP8 A;  2DAG A;  1OKS A;  1HT1 E;  1MN3 A;  1Y8G A;  2MJ5 B;  2WZJ A;  2DZL A;  1WIV A;  2DHY A;  1UFZ A;  4F1I A;  2OOB A;  2LVN C;  2H5X A;  4Q7J A;  3GLI E;  5JI2 E;  3FRH A;  1T43 A;  1P3Q Q;  2LVA A;  2DAE A;  1QZE A;  1HT2 E;  3BBZ A;  4R71 A;  3LCU A;  2L4F A;  1DO0 A;  2OO9 A;  2DI0 A;  4UN2 B;  1AIP C;  2EKF A;  4HEO A;  1BVS A;  1Q02 A;  1V92 A;  3FRI A;  2O25 A;  3F92 A;  1IFY A;  3K9O A;  2RRU A;  2JY5 A;  2QNJ A;  1TR8 A;  2ZTC A;  1WR1 B;  1HQY E;  1VEK A;  1VQ1 A;  2K0B X;  3MMP A;  2JY8 A;  2LVQ D;  2L2D A;  2HWJ A;  4WP2 A;  2EJS A;  2K9D A;  2G3Q A;  1T6O A;  1KYI A;  1IM2 A;  3K9P A;  2EKK A;  2BWB A;  1OAI A;  1WGN A;  1ZMW A;  4F2L A;  1ZMV A;  3IHP A;  1F4I A;  1TTE A;  1NV8 A;  2QSF X;  1G3I A;  1ZV1 A;  1WHC A;  1SG9 A;  3IEC A;  2KNV A;  2LVO C;  1E94 E;  2DEN A;  2L4E A;  1OTR A;  2MGW A;  3GLH E;  1IXS A;  1G41 A;  2JNH A;  2LTU A;  2DAI A;  1C7Y A;  1A5T A;  2MR9 A; 
#chains in the Genus database with same CATH topology
 1OJL A;  1G4A E;  3D8L A;  3GLH B;  3HWS A;  3K1J A;  4GMQ A;  4LF5 M;  3I04 M;  1L2B A;  3KSJ A;  4LCB A;  4IBC A;  1PJS A;  1UM8 A;  1PJQ A;  2UUA M;  4LZJ A;  4DV7 M;  4IBB A;  2KRK A;  1XC8 A;  2G5G X;  3D8B A;  2HKJ A;  3U6L A;  4FW9 A;  1IBK M;  3B7N A;  2R65 A;  2KEB A;  2R45 A;  3GLF E;  3JAM S;  4GC9 A;  2F5Q A;  3DFZ A;  1Z6T A;  2KNA A;  2XEP A;  2JZ1 A;  3KOX E;  3WHK A;  3A46 A;  3LCV B;  2X4A A;  3KVW A;  3TL4 X;  4L78 A;  4K0K M;  1L8Q A;  5ITR A;  5C1B A;  5FTK A;  4LF9 M;  3AOG A;  3FUU A;  2G8L A;  4DUY M;  4FWH A;  3SMP A;  3HJQ A;  3EIE A;  1VEJ A;  2KRU A;  2V6Z M;  3GRR A;  3I01 M;  1XWI A;  2DAK A;  5EP2 A;  3E21 A;  2B3T A;  4Z6Y A;  5LMN M;  4NXN M;  3SBJ A;  4AZF A;  1OFH A;  2LBC A;  2WSF F;  5BPV A;  3R8F A;  1HJP A;  3VK8 A;  4B7G A;  4GEW A;  2LHG A;  3DA1 A;  4KOD A;  4M9S A;  3UZU A;  4DV0 M;  1EFU B;  1QVR A;  2XSZ A;  3V76 A;  1R4G A;  3GQ5 A;  4G3O A;  1E32 A;  3DOA A;  2F4V M;  1VEG A;  3J7A S;  2DAG A;  3FUW A;  2CEA A;  4GH9 A;  2FE8 A;  3HGI A;  5EXX A;  4AKG A;  2DZL A;  2CHQ A;  1XXH B;  1G59 A;  2D7H A;  1UFZ A;  2Y21 A;  4MGY E;  2EA0 A;  4LGM A;  3U6P A;  4QOS A;  4MGI E;  4DV6 M;  4NSR A;  4REZ A;  1WXQ A;  3VDP A;  4NOO B;  5IRE B;  4M0D A;  1FJG M;  2C99 A;  2K6B A;  3BBZ A;  3SFZ A;  1XNR M;  2LH0 A;  3GPU A;  4DV3 M;  2F5N A;  3HHW A;  2ZBK B;  5FTN A;  3W0F A;  2AHM A;  4A3V B;  1MJG M;  2FH0 A;  2VDB B;  3B74 A;  1PRB A;  2EKF A;  5FTM A;  4JI5 M;  1G8P A;  5JI3 E;  1EE8 A;  2KW0 A;  3E4R A;  2O25 A;  3F92 A;  3HKP A;  3K8Z A;  4FCW A;  1IXR C;  1NJF A;  2RRU A;  1HNX M;  4FCV A;  1GJS A;  5E26 A;  3ZC7 B;  3K92 A;  2VQE M;  3FUX A;  4IBF A;  4LJ6 A;  2DZO B;  3NBI A;  1Z5B A;  7CAT A;  4P17 A;  3L25 A;  3RFW A;  2LVQ D;  4B7H A;  3GLH A;  2D7G A;  4WP2 A;  4I81 A;  1QZM A;  1GL7 A;  4G4N A;  3PNY A;  1KYI A;  3L27 A;  5LMU M;  2RGH A;  2CHV A;  2NQ8 C;  2DZN B;  4XK8 F;  1HQC A;  1NY6 A;  2CV0 A;  1QUS A;  3HJS A;  3L2A A;  3M7G A;  3NWL A;  2J7N A;  4KLN A;  3SAR A;  3VDU A;  1WHC A;  1X37 A;  3B7Z A;  1DGH A;  1SG9 A;  3J2P B;  3KDS E;  5E6J A;  3U6E A;  2XZF A;  3W0L B;  1C7Y A;  1OTR A;  2MH8 A;  3GLH E;  1IXS A;  1G41 A;  2A5Y B;  2JNH A;  2LTU A;  4Z8X A;  4MGH A;  1A5T A;  3VKG A;  3K2L A;  2HAK A;  1V33 A;  5DNY A;  2RGO A;  4FD2 A;  3B89 A;  3KP0 E;  4HL4 A;  1JR3 D;  4PDG A;  1QYR A;  1TH2 A;  3H4J A;  3KOY E;  3AKZ A;  1TF0 B;  1PM5 A;  2BWE A;  4CIS A;  1QAM A;  3BOS A;  1WGL A;  3FTD A;  1PJT A;  3AV0 A;  2FOI C;  2JP7 A;  5BR8 M;  4NRW A;  3E46 A;  4I8O A;  3W68 A;  3C3E A;  3C9P A;  4X62 M;  1NHW C;  3AOE A;  1QAN A;  5ITQ A;  1L1T A;  3SAS A;  3GLG A;  4II7 A;  4JI3 M;  2DNA A;  3SMS A;  2Z8Y M;  2Z4S A;  2X8A A;  1DV0 A;  8CAT A;  3SAT A;  1QDT A;  2BJV A;  2APL A;  2R0I A;  1NV9 A;  4JI6 M;  2UXC M;  2L7I A;  3NBX X;  4CIZ A;  3GPP A;  1L2C A;  2DKL A;  4FVM A;  3QAU A;  4WW0 A;  1XXH A;  1NY5 A;  1DGG A;  4XGI A;  2R18 A;  4CHT B;  4L16 A;  3VLF B;  3ZH9 B;  3ZQJ A;  1D0L A;  1TDH A;  2UU9 M;  1I4W A;  2XGN A;  1ORY B;  4ANR A;  4LJ9 A;  1R2Z A;  2Y0Q A;  2JY6 B;  3GLG E;  3FYD A;  4DR3 M;  4LJ7 A;  1J5E M;  2XFT A;  1HNW M;  2ZAM A;  4NRV A;  2F5O A;  3IG5 A;  5ITX E;  4DV2 M;  2W82 A;  4X65 M;  3GRY A;  1JR3 E;  4GHL A;  1DGH B;  5EQT A;  2LNH C;  1XXH E;  2QHO B;  2KHH A;  2CP8 A;  1OKS A;  3PXG A;  1H6U A;  1HT1 E;  1MN3 A;  1W5S A;  4JXJ A;  1GAB A;  1IXS B;  2XSZ D;  3AOE C;  1WIV A;  3CTW B;  3FUV A;  3UJN A;  4LF7 M;  5KPZ A;  5EP3 A;  2Y0T A;  4IBD A;  5DYG A;  2OOB A;  3SHF A;  3IG8 A;  4LRT A;  2I7N A;  1G71 A;  3Q8X A;  2ZM6 M;  4D81 A;  3FRH A;  1N75 A;  1T43 A;  1E9R A;  2CHG A;  3L29 A;  5JI2 E;  1XHB A;  2Y20 A;  3KOW E;  4AW4 A;  4B3R M;  1P3Q Q;  2LVA A;  2YR0 A;  4IIW A;  4FCT A;  1HT2 E;  1IBL M;  3FD9 A;  2L4F A;  2L7H A;  4IBK A;  1MU5 A;  1EIJ A;  2DVW B;  3UGJ A;  3GLG B;  2RKO A;  2ERC A;  4HEO A;  1Q02 A;  3DZD A;  3FRI A;  3KSX A;  4JI7 M;  3K9O A;  4GIT A;  3U61 A;  2YFQ A;  1J7K A;  2JY5 A;  2ZTC A;  1WR1 B;  1VEK A;  2R44 A;  4BBA A;  1VQ1 A;  2ZAO A;  3QYB A;  4NSO B;  3LVW A;  2K0B X;  5KPR A;  3U6C A;  3SAW A;  2HHH M;  2QBY B;  1QAQ A;  2QP9 X;  4DR7 M;  1DGF A;  3CF0 A;  2UXB M;  4JI2 M;  2L2D A;  3J27 B;  4HLQ A;  4L8R C;  4G4R A;  2EJS A;  4LGY A;  2G3Q A;  1IM2 A;  3K9P A;  3KXE C;  1ZAE A;  2EKK A;  2BWB A;  4G4Q A;  2EUC A;  1WGN A;  1D2N A;  4G6Z A;  4D80 A;  4DV5 M;  4LF8 M;  3FTC A;  4PD2 A;  3A98 B;  2F5P A;  1GKI A;  1TTE A;  1NV8 A;  3M0E A;  3FUT A;  3J7B A;  2LHC A;  2QSF X;  2K47 A;  4FWG A;  5EXT A;  2DWN A;  4JYA M;  4LJ5 A;  3W67 A;  3KS8 A;  3FYC A;  3IEC A;  3LQQ A;  3U6O A;  1QUT A;  2KNV A;  3VFD A;  2LVO C;  2R62 A;  2DEN A;  1LV7 A;  2R46 A;  3THG A;  3JR4 A;  1DGB A;  3TWM A;  1TGU A;  2MGW A;  2KZS A;  1R7R A;  1W5T A;  2XFS A;  3HU2 A;  4RF0 A;  2Z3X A;  5KQ8 A;  3H4M A;  2C9C A;  4G4O A;  3PFI A;  3SYL A;  2MR9 A;  1NSF A;  2JZ0 A;  2JXN A;  3M6A A;  4IBI A;  4LJA A;  4GKK M;  1IY0 A;  1L1Z A;  5EJC A;  4GC5 A;  1JQJ C;  4QNR A;  3U6S A;  1N32 M;  4B3T M;  4YHH M;  1CUK A;  1HNZ M;  2J5Y A;  2Z4R A;  1IN5 A;  4JN6 A;  1SXJ A;  2C5R A;  2GNO A;  3GLI A;  4OX9 M;  4B3S M;  5FLX S;  3HJ8 A;  2OPF A;  4L15 A;  2L6O A;  1IN8 A;  2OQ4 A;  3I4Y A;  2R4E A;  2DWZ B;  3U61 B;  4GRI A;  3JR5 A;  1PGY A;  1FNN A;  2QCU A;  2CWB A;  5H37 D;  1XMO M;  3KFU G;  4LZZ A;  2L09 A;  2J7O A;  2O5R A;  4B08 A;  4KHP M;  4AI6 A;  2DWM A;  3Q8G A;  2UUC M;  4DR5 M;  1N36 M;  2C96 A;  1ZQ9 A;  1TH4 A;  2CE7 A;  3AFH A;  5F3W A;  3HX3 A;  3R9X B;  2M60 A;  4DR1 M;  3U6D A;  2JY7 A;  3TPZ A;  1NO1 A;  2OOA A;  1YLA A;  3SHG B;  2JUJ A;  2LVP C;  4IJE A;  1IN7 A;  4RF1 A;  3GO8 A;  4MB7 A;  1C1K A;  3ILK A;  2DXI A;  1NHG C;  4MGZ E;  3MHV C;  3U5Z B;  5IWA M;  4M9Z A;  4OW0 A;  4AKH A;  4Y28 F;  4IBE A;  2N35 A;  4LFA M;  3LMM A;  4R7G A;  1VDL A;  3CF6 E;  3RGS A;  4MGK E;  4P16 A;  4IJF A;  1L2D A;  2DWL A;  2KXE A;  4RKU F;  4LY6 A;  5A2Q S;  1Y8G A;  1SXJ C;  3J80 S;  1XMQ M;  2MJ5 B;  2WZJ A;  1JB0 F;  4EIW A;  4KO8 A;  4B3M M;  4F1I A;  1Z59 A;  4JI8 M;  1J09 A;  1IBM M;  3E9S A;  3GQ3 A;  3VKH A;  2LVN C;  4WUR A;  4BB9 A;  1KSF X;  4LJ4 A;  2QBY A;  4CGY B;  2FFJ A;  4DV4 M;  2LWX A;  3MJ5 A;  4LJ8 A;  3QWL A;  4YY3 M;  3I4V A;  4OVZ A;  2F5S A;  3LVV A;  1SXJ B;  3FTF A;  4R71 A;  3GLI B;  1DO0 A;  4TUW A;  2DI0 A;  2V1U A;  4JI1 M;  4UN2 B;  5ITY A;  3HY5 A;  3HZJ A;  4OU7 A;  3GLF A;  1K82 A;  2QNJ A;  1TR8 A;  1T3T A;  3WHL A;  3HHZ A;  4M0W A;  3GPX A;  3HHY A;  3VK7 A;  2BNK A;  4JV5 M;  1Q3C A;  3MMP A;  3T15 A;  1F4I A;  2JY8 A;  3GP1 A;  1E9S A;  2HL7 A;  5DYI A;  4DV1 M;  1K3X A;  3B7Q A;  1V34 A;  2HWJ A;  2K9D A;  2M5Z A;  1GJT A;  1OAI A;  3AL0 C;  1ZMW A;  1OIP A;  4F2L A;  1ZMV A;  1GL6 A;  1YUB A;  2ZAN A;  2CV2 A;  2R4J A;  3KS4 A;  4QHT A;  1IN6 A;  1ZV1 A;  3GQ4 A;  2CV1 A;  3MK6 A;  2DHR A;  2O01 F;  4PCZ A;  1E94 E;  1IY2 A;  1NVM A;  2CUZ A;  4LF4 M;  1VDD A;  1XNQ M;  4AG6 A;  5KQD A;  3AJI B;  2DAI A;  1QAO A;  2X49 A;  4D82 A;  4XBO A;  1ZMU A;  2HCB A;  2JWS A;  2LXE A;  1Q3B A;  5DFL A;  3SAU A;  3UMM A;  2I7P A;  1NNU C;  2C98 A;  1XB2 B;  4LFB M;  1R6B X;  1YSY A;  1OAO C;  1D0M A;  2ZTD A;  4OVZ B;  2YNM D;  3RGP A;  3HHX A;  3GPY A;  3U6M A;  4JI0 M;  3T38 A;  3ZCB B;  4W5W A;  1TH3 A;  4PT5 A;  2WSC F;  4ZPX A;  1TDZ A;  3U5Z A;  5EXS A;  3HU1 A;  2E5L M;  2QPA A;  1WJ7 A;  4L4U A;  2XF3 A;  4IBJ A;  5L8R F;  2KDL A;  3GLF B;  1I94 M;  1SXJ D;  4LG2 A;  3BXW A;  2VII A;  3QYE A;  4DR6 M;  1R5L A;  5EXP A;  3L26 A;  2DAM A;  3OTO M;  1S3S A;  5GKN A;  1HR0 M;  4DR2 M;  2MRO B;  3T1H M;  4ITQ A;  2CFO A;  3KW6 A;  2XZU A;  4IBG A;  1DO2 A;  3FE3 A;  1GO5 A;  2KA6 B;  1GVN A;  1OQY A;  2KNZ A;  3T6P A;  4X64 M;  2VF7 A;  4DBG B;  4LF6 M;  2WSE F;  3TQS A;  5EP4 A;  5EP1 A;  1Z5A A;  1OIZ A;  2VF8 A;  4AKI A;  2D7E A;  5ITT A;  1VG5 A;  3TE6 A;  4AQY M;  3SAV A;  1QDR A;  2FNA A;  2QZ4 A;  2VQF M;  4NC6 A;  5IZ7 D;  1PJJ A;  3FTE A;  3U60 A;  3KOZ E;  2KZU A;  3L28 A;  1KFV A;  3C58 A;  2R6F A;  2DHY A;  4KT0 F;  4GKJ M;  4X66 M;  2Q2E B;  4GHA A;  3PNV A;  2CRU A;  1IXZ A;  3UK6 A;  1SXJ E;  2H5X A;  1K3W A;  4Q7J A;  1IQP A;  3GLI E;  4DR4 M;  3PVS A;  1Q39 A;  4CJ6 A;  1D0K A;  3B9P A;  3CGW A;  2DAE A;  1QZE A;  1PJI A;  1RU3 A;  3LW5 F;  4S12 A;  3LCU A;  2OO9 A;  1N33 M;  4QHS A;  4MH0 E;  1N77 A;  3U6Q A;  3RE8 A;  4RNA A;  2H1R A;  4PDI A;  1AIP C;  4LFC M;  1BVS A;  1V92 A;  1IFY A;  4M9X A;  4BLC A;  4AG5 A;  2C9O A;  5KO3 A;  3KP1 E;  1HQY E;  3C3D A;  2P5T A;  4I5S A;  3J81 S;  3EIH A;  2EO2 A;  4L6V 6;  4LRS A;  5FSW A;  3HU3 A;  4I4L A;  5C18 A;  2YQZ A;  5ITU A;  2FS1 A;  1NNJ A;  1N34 M;  1YE9 A;  4B7F A;  2XH9 A;  2XLJ A;  1QQW A;  2BJW A;  3FKE A;  2QEN A;  3A42 A;  5FTJ A;  1T6O A;  3TWL A;  3I51 A;  1R2Y A;  2V1C A;  1GLN A;  3SC3 A;  1Z5C A;  3IHP A;  2JA2 A;  3GRV A;  2Z7J A;  1IY1 A;  1G3I A;  3TWK A;  3SYK A;  4GIP A;  5FTL A;  4NXM M;  4FWD A;  2QQ8 A;  2GQF A;  3GRU A;  1LTM A;  1N78 A;  3LQR A;  1IN4 A;  5ITX A;  2L4E A;  4NL4 H;  3A45 A;  5KPT A;  4DUZ M;  2UXD M;  1NJG A;  4QNM A;  3U60 B;  4R3D A;  2UUB M;  1MX0 A;  1JR3 A;  4JI4 M;  4MM3 B;  5IT9 S;  3T1Y M;  1OFI A;  3CF2 A;  4QOZ C;  1AUA A; 
#chains in the Genus database with same CATH homology
 2HAK A;  2JZ0 A;  1G4A E;  1ZMU A;  3B89 A;  3H4J A;  5DFL A;  1XB2 B;  2BWE A;  1WGL A;  1CUK A;  2ZTD A;  2JP7 A;  3E46 A;  3GLF E;  2DNA A;  1WJ7 A;  2KNA A;  2JZ1 A;  1DV0 A;  3LCV B;  1PGY A;  2CWB A;  1NV9 A;  2R0I A;  2DAM A;  2DKL A;  2MRO B;  1VEJ A;  2DAK A;  3E21 A;  2B3T A;  1DO2 A;  3FE3 A;  3GLG E;  2JY6 B;  2JY7 A;  1GO5 A;  1OQY A;  2KNZ A;  2LBC A;  2OOA A;  3T6P A;  4DBG B;  1HJP A;  1YLA A;  2JUJ A;  2LVP C;  4GEW A;  1EFU B;  1JR3 E;  1R4G A;  1VG5 A;  4G3O A;  1VDL A;  1XXH E;  1VEG A;  2QHO B;  2KHH A;  2CP8 A;  2DAG A;  1OKS A;  1HT1 E;  1MN3 A;  1Y8G A;  2MJ5 B;  2WZJ A;  2DZL A;  1WIV A;  2DHY A;  1UFZ A;  4F1I A;  2OOB A;  2LVN C;  2H5X A;  4Q7J A;  3GLI E;  5JI2 E;  3FRH A;  1T43 A;  1P3Q Q;  2LVA A;  2DAE A;  1QZE A;  1HT2 E;  3BBZ A;  4R71 A;  3LCU A;  2L4F A;  1DO0 A;  2OO9 A;  2DI0 A;  4UN2 B;  1AIP C;  2EKF A;  4HEO A;  1BVS A;  1Q02 A;  1V92 A;  3FRI A;  2O25 A;  3F92 A;  1IFY A;  3K9O A;  2RRU A;  2JY5 A;  2QNJ A;  1TR8 A;  2ZTC A;  1WR1 B;  1HQY E;  1VEK A;  1VQ1 A;  2K0B X;  3MMP A;  2JY8 A;  2LVQ D;  2L2D A;  2HWJ A;  4WP2 A;  2EJS A;  2K9D A;  2G3Q A;  1T6O A;  1KYI A;  1IM2 A;  3K9P A;  2EKK A;  2BWB A;  1OAI A;  1WGN A;  1ZMW A;  4F2L A;  1ZMV A;  3IHP A;  1F4I A;  1TTE A;  1NV8 A;  2QSF X;  1G3I A;  1ZV1 A;  1WHC A;  1SG9 A;  3IEC A;  2KNV A;  2LVO C;  1E94 E;  2DEN A;  2L4E A;  1OTR A;  2MGW A;  3GLH E;  1IXS A;  1G41 A;  2JNH A;  2LTU A;  2DAI A;  1C7Y A;  1A5T A;  2MR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...