1WR1B

The complex sturcture of dsk2p uba with ubiquitin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
58
structure length
58
Chain Sequence
PGISGGGGGILDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Structure of the UBA domain of Dsk2p in complex with ubiquitin molecular determinants for ubiquitin recognition.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 19
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2004-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1wr1B01
1VEJA 1VDLA 3E21A 2OO9A 1Q02A 2K9DA 1XXHE 1F4IA 1NV8A 1HJPA 2KNZA 1G4AE 2JY5A 4F1IA 1VEGA 2EKFA 4UN2B 1MN3A 2LVNC 3K9PA 1E94E 1QZEA 4F2LA 1VEKA 3IECA 1VQ1A 1WGNA 1JR3E 4DBGB 3GLGE 5DFLA 2H5XA 2DAIA 1CUKA 1ZV1A 2K0BX 2ZTCA 2CP8A 1VG5A 2BWEA 2DENA 1IXSA 1ZMVA 3FRIA 1BVSA 1G41A 2L4EA 4Q7JA 3LCUA 1IFYA 2L2DA 1G3IA 2JY7A 1DO2A 1TR8A 2L4FA 2DHYA 1P3QQ 2R0IA 2DI0A 2JY8A 2DZLA 1IM2A 2JZ0A 1WJ7A 2LVOC 2KNAA 1NV9A 2JP7A 2LVAA 2OOBA 2DAKA 2MGWA 1SG9A 3IHPA 2JZ1A 2MR9A 1OAIA 1T6OA 2RRUA 4WP2A 1ZMWA 2JUJA 1Y8GA 2CWBA 2HWJA 2DNAA 4GEWA 4HEOA 3GLFE 1UFZA 1R4GA 1WHCA 2OOAA 1GO5A 3GLHE 1YLAA 2MROB 2DAGA 1HT2E 1OQYA 1TTEA 2HAKA 2JNHA 1KYIA 2LVPC 2G3QA 2LVQD 2JY6B 3H4JA 1XB2B 1ZMUA 1WR1B 2QHOB 3BBZA 3K9OA 2EJSA 2KHHA 2QNJA 3F92A 2QSFX 1HT1E 2O25A 3GLIE 1AIPC 1WIVA 2DAEA 3LCVB 2B3TA 1EFUB 3T6PA 1C7YA 1A5TA 1V92A 2LBCA 1DO0A 1T43A 1OTRA 2LTUA 2WZJA 3MMPA 5JI2E 3FRHA 2DAMA 1OKSA 2ZTDA 1DV0A 2EKKA 2MJ5B 3E46A 1PGYA 2DKLA 4G3OA 3B89A 4R71A 1WGLA 1HQYE 2KNVA 2BWBA 3FE3A
chains in the Genus database with same CATH superfamily
2CEAA 1VDLA 3HWSA 3B9PA 1OJLA 4RF1A 1Q02A 2K47A 5F3WA 4LF4M 4GH9A 1TF0B 1NV8A 1XHBA 2D7EA 4QNMA 5EJCA 5C18A 1QDRA 3U5ZB 3BXWA 3J27B 3I4VA 4CGYB 4F1IA 4KT0F 2VQFM 4M9SA 2LVNC 4LF5M 4BB9A 4FD2A 4F2LA 3GPPA 4DUZM 3UJNA 3GLFA 3KS4A 1VQ1A 4Z8XA 1QVRA 1L1TA 4FCTA 1PJQA 4AG6A 1HR0M 3SMSA 3GLHA 4L4UA 5FTNA 3GPUA 3VLFB 4OX9M 3U6PA 2E5LM 2KZSA 3THGA 3RGPA 1ZQ9A 1K3WA 2XFSA 5IREB 3HY5A 2Y0TA 4JI3M 4FW9A 4B3SM 1D0LA 3LCUA 3TPZA 3KSXA 4YY3M 1HNXM 2XSZD 4LFBM 1E32A 4L16A 2DHYA 2QPAA 1XNRM 2DI0A 2JY8A 3SASA 1GJTA 1WJ7A 2X8AA 3T1HM 2KNAA 1NHGC 4DR1M 2R4JA 3AFHA 3MK6A 1XMQM 3R8FA 1NO1A 2Q2EB 1NNUC 3GRRA 5BPVA 3GLIA 1H6UA 4LJ7A 3UZUA 1DGHB 5EQTA 3CF6E 1IN4A 1KSFX 4IJEA 3SYLA 1XC8A 4QNRA 1T6OA 3KOXE 4PCZA 4DV3M 2JA2A 1ZMWA 4LG2A 1SXJB 4DV0M 3DOAA 4NRVA 1I94M 1JQJC 3B7ZA 5KO3A 4DUYM 4Z6YA 1IBKM 1N33M 1GLNA 5DYGA 1QAMA 4I81A 3SHGB 1UFZA 5EP4A 3T15A 1ORYB 2QQ8A 4BLCA 8CATA 3J7BA 1TDHA 4CISA 2JNHA 3I4YA 2V6ZM 1Q3BA 5LMNM 2O5RA 4AZFA 3C3DA 1VDDA 3J2PB 1N36M 1QYRA 1OIPA 2VDBB 4M0WA 3U60B 3GLFB 4DV1M 2FFJA 1XB2B 1ZMUA 4DR6M 3WHKA 4P17A 3VK8A 3GLHB 3JR5A 4II7A 1IBMM 4FVMA 4JI2M 3T38A 4CHTB 4BBAA 2KHHA 3HZJA 4MH0E 3AV0A 1R2YA 2QSFX 1GL7A 2C98A 1HT1E 2O25A 3KS8A 2DAEA 4I5SA 4DV6M 2ZBKB 3CTWB 3K8ZA 2XZFA 2I7PA 2HKJA 2XF3A 2C9CA 2YQZA 2LBCA 2HHHM 5EP2A 4NOOB 1OFIA 2LNHC 3QYEA 1JB0F 3MMPA 4NXMM 3JAMS 2FOIC 1NJGA 4X66M 4REZA 3KP1E 1OKSA 1T3TA 1XWIA 5IWAM 3GLIB 1IN6A 1SXJD 1IXRC 4CIZA 5ITRA 2KDLA 2XZUA 3CF2A 2KW0A 3U6LA 4G3OA 5EXTA 1E9RA 1Z6TA 2MH8A 3SARA 2F5NA 1QAQA 2LWXA 4X62M 2BWBA 1IN8A 3AOGA 1VEJA 5EP1A 1OAOC 4AG5A 4WURA 3B7QA 3M0EA 2DZNB 3K2LA 1IY1A 3ZC7B 3U6EA 3H4MA 1F4IA 1HJPA 3HU2A 1G4AE 4JV5M 4YHHM 1L2DA 4MGYE 2Z7JA 3GPXA 1HNWM 3VFDA 1VEGA 4P16A 5KPRA 1YE9A 2ZAOA 3WHLA 3RGSA 4D81A 2V1UA 1VEKA 2GNOA 1JR3E 3ZCBB 3GLGE 5DFLA 2H5XA 3B74A 1CUKA 1HQCA 2R6FA 1DGHA 4NC6A 2UU9M 2RGOA 2DENA 2UUCM 1BVSA 2Y21A 1D0MA 5ITQA 4IBCA 4LJ9A 2F5QA 2JWSA 2ZANA 1SXJA 4GITA 4LGMA 4QOSA 4LFAM 2AHMA 2CE7A 2OQ4A 2JY7A 2X4AA 3TWLA 4L8RC 3LQRA 2R0IA 1NJFA 2CV0A 3GRYA 4IBBA 3MHVC 2R4EA 4PD2A 3A46A 5ITUA 5EP3A 1D2NA 2JP7A 3PVSA 4IBEA 4DR4M 1R7RA 4FWDA 1PJJA 1PJSA 2MGWA 4GKJM 4LJ4A 1HNZM 4G4NA 3U60A 2UUAM 3HX3A 1NY6A 2R18A 3OTOM 2EA0A 1QAOA 1Z5CA 5KPZA 2F5SA 3FKEA 3A45A 3AOEA 3TWKA 3QWLA 3TWMA 1N77A 2UXDM 4WP2A 2CFOA 1QUTA 1W5SA 1Y8GA 2CWBA 1IN5A 3FUVA 2DNAA 1MU5A 3KVWA 4NSOB 2C99A 1YUBA 5GKNA 4DR7M 5FTKA 4GC9A 4GEWA 3VK7A 2XGNA 3FYDA 3KP0E 4K0KM 3M7GA 1GO5A 1JR3A 5EXPA 1YLAA 4DR5M 4QHSA 3AKZA 1OQYA 2HAKA 3EIEA 2RKOA 3FYCA 3HJQA 4L78A 4OVZA 4AI6A 5A2QS 4MGZE 4S12A 2L09A 3L25A 2QENA 4L6V6 3CF0A 3A42A 2UXCM 2W82A 2WSCF 3HHXA 2DVWB 4B7GA 3KFUG 5JI3E 3C9PA 2YFQA 3HHWA 3BBZA 1J7KA 1X37A 3I04M 1QZMA 3K9OA 1QANA 1D0KA 1NVMA 3FTDA 3KOZE 2EJSA 4I8OA 4KODA 1EE8A 3E9SA 3TL4X 4JI5M 3F92A 3RE8A 4ITQA 2CRUA 3E4RA 1AIPC 3LCVB 2DHRA 1NY5A 5BR8M 3KDSE 1N32M 3TE6A 2Z3XA 1V92A 1WXQA 4GIPA 4MGHA 1T43A 4B3MM 1K82A 4LZZA 2DAMA 2KXEA 3M6AA 2MJ5B 4FWHA 1E9SA 7CATA 2CUZA 3LVVA 3B89A 3HU1A 5EXSA 2QP9X 3D8BA 4FCWA 2KRKA 2CHVA 2L7HA 4R7GA 4AKGA 2BNKA 3T1YM 2C96A 1I4WA 5E26A 4B3RM 2HCBA 3VDUA 1XXHE 2XLJA 4G4QA 3PNVA 4ZPXA 3SATA 5IT9S 2DWMA 4JYAM 4OVZB 5C1BA 4LF7M 2F5OA 2JY5A 2NQ8C 2L6OA 3HHZA 1R5LA 2F5PA 4LRTA 3L27A 2UXBM 4UN2B 5KQDA 3C58A 1MN3A 3DFZA 1QZEA 1GABA 2G5GX 4KLNA 3J7AS 3IECA 2J7OA 2WSEF 3W0FA 3HJ8A 4FWGA 4LGYA 3Q8GA 4PDGA 2F4VM 2DAIA 3FD9A 3GQ3A 2R65A 2Y0QA 1VG5A 2BWEA 4IIWA 1TGUA 1L8QA 4NL4H 4JI0M 1IXSA 2Y20A 4ANRA 2FS1A 3FRIA 1XNQM 2L4EA 4IJFA 2EUCA 3ILKA 2FE8A 4AKHA 1G3IA 2DWZB 4IBKA 2R62A 4RKUF 2L4FA 2BJWA 2KA6B 3IG8A 1P3QQ 2WSFF 2DZLA 4OU7A 3SC3A 4WW0A 5ITXE 3UMMA 1NV9A 4JI4M 2EO2A 2I7NA 5FSWA 3IG5A 4LF9M 2DAKA 4FCVA 1SG9A 3L2AA 5L8RF 2L7IA 3U6QA 2ERCA 1PM5A 3GO8A 3FTCA 2DWLA 3SYKA 1N75A 4L15A 1GJSA 3FUUA 1OAIA 2RRUA 1IY0A 1JR3D 3FTFA 3B7NA 2JUJA 4MB7A 4DV5M 3HGIA 1DGGA 1K3XA 5FTMA 3NBXX 4LJ6A 3GLFE 5EXXA 4IBJA 2J7NA 4R3DA 1NHWC 2N35A 1WHCA 2ZAMA 2OOAA 2UUBM 3GLHE 2K6BA 4CJ6A 3VKHA 2MROB 3HJSA 1N78A 2D7GA 1TTEA 4JI7M 4DV2M 3DZDA 1Q3CA 3UK6A 4NSRA 3MJ5A 3R9XB 1C1KA 4LF8M 2LVQD 5KQ8A 3KOWE 3W0LB 1TH3A 2LHGA 4HLQA 2XEPA 4KO8A 1TH4A 5DNYA 1GVNA 1WR1B 4JXJA 2QHOB 3GRVA 3W67A 1G8PA 1IXSB 1MJGM 3PFIA 1Z5AA 4KHPM 2QNJA 1SXJC 4M9ZA 4NRWA 4EIWA 1Q39A 1WIVA 4JN6A 3GLIE 3U6MA 4JI1M 2B3TA 5E6JA 3VDPA 3T6PA 1IQPA 1C7YA 2QCUA 3GLGA 4DV7M 1OTRA 1OIZA 2FNAA 2WZJA 1L2BA 4M9XA 5LMUM 5JI2E 3LQQA 3LW5F 2ZTDA 1DV0A 2EKKA 1XXHB 3U6CA 2LH0A 2M60A 4IBDA 4IBIA 4NXNM 2ZM6M 4LF6M 2YNMD 3E46A 2Z4RA 3U6OA 2DKLA 3AOEC 3I51A 3SMPA 4B08A 3JR4A 4R71A 5FLXS 4LZJA 2D7HA 5KPTA 3ZH9B 1G59A 1WGLA 1RU3A 3D8LA 3FE3A 4MGKE 4TUWA 2GQFA 4RF0A 2VIIA 3QYBA 3E21A 1W5TA 4DR2M 4JI6M 3RFWA 2OO9A 2K9DA 3GRUA 2XFTA 4DR3M 1QUSA 2KNZA 1PJTA 1KFVA 2P5TA 3K92A 4OW0A 2EKFA 3U61A 3UGJA 1R2ZA 1QQWA 3K9PA 1E94E 3EIHA 3SAUA 1PRBA 3VKGA 1WGNA 3KOYE 3L29A 1GL6A 4Y28F 4B7HA 4DBGB 2XH9A 1ZV1A 2K0BX 2ZTCA 2DXIA 2C9OA 3FTEA 2CP8A 4LCBA 3TQSA 1J5EM 1L2CA 1FNNA 1OFHA 1ZMVA 3L26A 2VQEM 1G71A 2VF7A 4X65M 2C5RA 2QBYA 3K1JA 4B7FA 4D80A 1G41A 4Q7JA 4X64M 1IFYA 4XBOA 2R46A 2L2DA 2M5ZA 3U6SA 1NNJA 1V33A 3GQ4A 1DO2A 1TR8A 2CHQA 3GLGB 1IN7A 2CV2A 4GKKM 4B3TM 1IM2A 2JZ0A 2LVOC 2LXEA 5ITYA 4A3VB 3GQ5A 2HL7A 3KSJA 3GP1A 2R44A 2LVAA 2KRUA 2OOBA 3KXEC 3LMMA 3NBIA 3V76A 1TDZA 2XSZA 2APLA 2R45A 3IHPA 5ITTA 4RNAA 3PNYA 3FUWA 2CV1A 2JZ1A 3SHFA 2MR9A 3SAVA 4LY6A 4W5WA 3DA1A 2VF8A 3SBJA 4GHLA 4GMQA 3NWLA 2HWJA 4M0DA 3ZQJA 3L28A 1ZAEA 4IBGA 2YR0A 4MM3B 1QDTA 2OPFA 3I01M 3Q8XA 4HEOA 1MX0A 3BOSA 1V34A 3SAWA 1R4GA 1N34M 5DYIA 1Z59A 2DAGA 3AJIB 5ITXA 1HT2E 2Z4SA 1IY2A 3HU3A 1KYIA 4LJ5A 4GRIA 1XMOM 4I4LA 2G8LA 2LVPC 2FH0A 2QZ4A 1J09A 3J80S 3HHYA 3PXGA 3U61B 2G3QA 3U5ZA 2JXNA 2O01F 1SXJE 2JY6B 3A98B 4PDIA 1S3SA 3GPYA 1UM8A 3H4JA 4LRSA 2DWNA 1DGBA 4PT5A 1XXHA 2J5YA 4MGIE 1GKIA 2BJVA 4AW4A 1LV7A 3FUTA 4XK8F 1FJGM 3AL0C 3C3EA 2CHGA 5FTLA 1LTMA 1DGFA 3HKPA 5FTJA 5H37D 2H1RA 2QBYB 1YSYA 2Z8YM 3QAUA 4QHTA 4LJAA 1L1ZA 2A5YB 1EFUB 4LJ8A 1A5TA 3U6DA 1DO0A 1R6BX 3FUXA 2X49A 1AUAA 2KEBA 2LTUA 3W68A 4G6ZA 2LHCA 4GHAA 1TH2A 3FRHA 1PJIA 4AKIA 1IBLM 4XGIA 4G4RA 2V1CA 4JI8M 4LFCM 1EIJA 2KZUA 3LVWA 5IZ7D 4D82A 1PGYA 4HL4A 4DV4M 4AQYM 4IBFA 3CGWA 4QOZC 2DZOB 1Z5BA 1IXZA 1NSFA 3SFZA 2RGHA 3J81S 1HQYE 4GC5A 2KNVA 3KW6A 4G4OA
chains in the Genus database with same CATH topology
1VEJA 1VDLA 3E21A 2OO9A 1Q02A 2K9DA 1XXHE 1F4IA 1NV8A 1HJPA 2KNZA 1G4AE 2JY5A 4F1IA 1VEGA 2EKFA 4UN2B 1MN3A 2LVNC 3K9PA 1E94E 1QZEA 4F2LA 1VEKA 3IECA 1VQ1A 1WGNA 1JR3E 4DBGB 3GLGE 5DFLA 2H5XA 2DAIA 1CUKA 1ZV1A 2K0BX 2ZTCA 2CP8A 1VG5A 2BWEA 2DENA 1IXSA 1ZMVA 3FRIA 1BVSA 1G41A 2L4EA 4Q7JA 3LCUA 1IFYA 2L2DA 1G3IA 2JY7A 1DO2A 1TR8A 2L4FA 2DHYA 1P3QQ 2R0IA 2DI0A 2JY8A 2DZLA 1IM2A 2JZ0A 1WJ7A 2LVOC 2KNAA 1NV9A 2JP7A 2LVAA 2OOBA 2DAKA 2MGWA 1SG9A 3IHPA 2JZ1A 2MR9A 1OAIA 1T6OA 2RRUA 4WP2A 1ZMWA 2JUJA 1Y8GA 2CWBA 2HWJA 2DNAA 4GEWA 4HEOA 3GLFE 1UFZA 1R4GA 1WHCA 2OOAA 1GO5A 3GLHE 1YLAA 2MROB 2DAGA 1HT2E 1OQYA 1TTEA 2HAKA 2JNHA 1KYIA 2LVPC 2G3QA 2LVQD 2JY6B 3H4JA 1XB2B 1ZMUA 1WR1B 2QHOB 3BBZA 3K9OA 2EJSA 2KHHA 2QNJA 3F92A 2QSFX 1HT1E 2O25A 3GLIE 1AIPC 1WIVA 2DAEA 3LCVB 2B3TA 1EFUB 3T6PA 1C7YA 1A5TA 1V92A 2LBCA 1DO0A 1T43A 1OTRA 2LTUA 2WZJA 3MMPA 5JI2E 3FRHA 2DAMA 1OKSA 2ZTDA 1DV0A 2EKKA 2MJ5B 3E46A 1PGYA 2DKLA 4G3OA 3B89A 4R71A 1WGLA 1HQYE 2KNVA 2BWBA 3FE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEJ A;  1VDL A;  3E21 A;  2OO9 A;  1Q02 A;  2K9D A;  1XXH E;  1F4I A;  1NV8 A;  1HJP A;  2KNZ A;  1G4A E;  2JY5 A;  4F1I A;  1VEG A;  2EKF A;  4UN2 B;  1MN3 A;  2LVN C;  3K9P A;  1E94 E;  1QZE A;  4F2L A;  1VEK A;  3IEC A;  1VQ1 A;  1WGN A;  1JR3 E;  4DBG B;  3GLG E;  5DFL A;  2H5X A;  2DAI A;  1CUK A;  1ZV1 A;  2K0B X;  2ZTC A;  2CP8 A;  1VG5 A;  2BWE A;  2DEN A;  1IXS A;  1ZMV A;  3FRI A;  1BVS A;  1G41 A;  2L4E A;  4Q7J A;  3LCU A;  1IFY A;  2L2D A;  1G3I A;  2JY7 A;  1DO2 A;  1TR8 A;  2L4F A;  2DHY A;  1P3Q Q;  2R0I A;  2DI0 A;  2JY8 A;  2DZL A;  1IM2 A;  2JZ0 A;  1WJ7 A;  2LVO C;  2KNA A;  1NV9 A;  2JP7 A;  2LVA A;  2OOB A;  2DAK A;  2MGW A;  1SG9 A;  3IHP A;  2JZ1 A;  2MR9 A;  1OAI A;  1T6O A;  2RRU A;  4WP2 A;  1ZMW A;  2JUJ A;  1Y8G A;  2CWB A;  2HWJ A;  2DNA A;  4GEW A;  4HEO A;  3GLF E;  1UFZ A;  1R4G A;  1WHC A;  2OOA A;  1GO5 A;  3GLH E;  1YLA A;  2MRO B;  2DAG A;  1HT2 E;  1OQY A;  1TTE A;  2HAK A;  2JNH A;  1KYI A;  2LVP C;  2G3Q A;  2LVQ D;  2JY6 B;  3H4J A;  1XB2 B;  1ZMU A;  1WR1 B;  2QHO B;  3BBZ A;  3K9O A;  2EJS A;  2KHH A;  2QNJ A;  3F92 A;  2QSF X;  1HT1 E;  2O25 A;  3GLI E;  1AIP C;  1WIV A;  2DAE A;  3LCV B;  2B3T A;  1EFU B;  3T6P A;  1C7Y A;  1A5T A;  1V92 A;  2LBC A;  1DO0 A;  1T43 A;  1OTR A;  2LTU A;  2WZJ A;  3MMP A;  5JI2 E;  3FRH A;  2DAM A;  1OKS A;  2ZTD A;  1DV0 A;  2EKK A;  2MJ5 B;  3E46 A;  1PGY A;  2DKL A;  4G3O A;  3B89 A;  4R71 A;  1WGL A;  1HQY E;  2KNV A;  2BWB A;  3FE3 A; 
#chains in the Genus database with same CATH topology
 2CEA A;  1VDL A;  3HWS A;  3B9P A;  1OJL A;  4RF1 A;  1Q02 A;  2K47 A;  5F3W A;  4LF4 M;  4GH9 A;  1TF0 B;  1NV8 A;  1XHB A;  2D7E A;  4QNM A;  5EJC A;  5C18 A;  1QDR A;  3U5Z B;  3BXW A;  3J27 B;  3I4V A;  4CGY B;  4F1I A;  4KT0 F;  2VQF M;  4M9S A;  2LVN C;  4LF5 M;  4BB9 A;  4FD2 A;  4F2L A;  3GPP A;  4DUZ M;  3UJN A;  3GLF A;  3KS4 A;  1VQ1 A;  4Z8X A;  1QVR A;  1L1T A;  4FCT A;  1PJQ A;  4AG6 A;  1HR0 M;  3SMS A;  3GLH A;  4L4U A;  5FTN A;  3GPU A;  3VLF B;  4OX9 M;  3U6P A;  2E5L M;  2KZS A;  3THG A;  3RGP A;  1ZQ9 A;  1K3W A;  2XFS A;  5IRE B;  3HY5 A;  2Y0T A;  4JI3 M;  4FW9 A;  4B3S M;  1D0L A;  3LCU A;  3TPZ A;  3KSX A;  4YY3 M;  1HNX M;  2XSZ D;  4LFB M;  1E32 A;  4L16 A;  2DHY A;  2QPA A;  1XNR M;  2DI0 A;  2JY8 A;  3SAS A;  1GJT A;  1WJ7 A;  2X8A A;  3T1H M;  2KNA A;  1NHG C;  4DR1 M;  2R4J A;  3AFH A;  3MK6 A;  1XMQ M;  3R8F A;  1NO1 A;  2Q2E B;  1NNU C;  3GRR A;  5BPV A;  3GLI A;  1H6U A;  4LJ7 A;  3UZU A;  1DGH B;  5EQT A;  3CF6 E;  1IN4 A;  1KSF X;  4IJE A;  3SYL A;  1XC8 A;  4QNR A;  1T6O A;  3KOX E;  4PCZ A;  4DV3 M;  2JA2 A;  1ZMW A;  4LG2 A;  1SXJ B;  4DV0 M;  3DOA A;  4NRV A;  1I94 M;  1JQJ C;  3B7Z A;  5KO3 A;  4DUY M;  4Z6Y A;  1IBK M;  1N33 M;  1GLN A;  5DYG A;  1QAM A;  4I81 A;  3SHG B;  1UFZ A;  5EP4 A;  3T15 A;  1ORY B;  2QQ8 A;  4BLC A;  8CAT A;  3J7B A;  1TDH A;  4CIS A;  2JNH A;  3I4Y A;  2V6Z M;  1Q3B A;  5LMN M;  2O5R A;  4AZF A;  3C3D A;  1VDD A;  3J2P B;  1N36 M;  1QYR A;  1OIP A;  2VDB B;  4M0W A;  3U60 B;  3GLF B;  4DV1 M;  2FFJ A;  1XB2 B;  1ZMU A;  4DR6 M;  3WHK A;  4P17 A;  3VK8 A;  3GLH B;  3JR5 A;  4II7 A;  1IBM M;  4FVM A;  4JI2 M;  3T38 A;  4CHT B;  4BBA A;  2KHH A;  3HZJ A;  4MH0 E;  3AV0 A;  1R2Y A;  2QSF X;  1GL7 A;  2C98 A;  1HT1 E;  2O25 A;  3KS8 A;  2DAE A;  4I5S A;  4DV6 M;  2ZBK B;  3CTW B;  3K8Z A;  2XZF A;  2I7P A;  2HKJ A;  2XF3 A;  2C9C A;  2YQZ A;  2LBC A;  2HHH M;  5EP2 A;  4NOO B;  1OFI A;  2LNH C;  3QYE A;  1JB0 F;  3MMP A;  4NXM M;  3JAM S;  2FOI C;  1NJG A;  4X66 M;  4REZ A;  3KP1 E;  1OKS A;  1T3T A;  1XWI A;  5IWA M;  3GLI B;  1IN6 A;  1SXJ D;  1IXR C;  4CIZ A;  5ITR A;  2KDL A;  2XZU A;  3CF2 A;  2KW0 A;  3U6L A;  4G3O A;  5EXT A;  1E9R A;  1Z6T A;  2MH8 A;  3SAR A;  2F5N A;  1QAQ A;  2LWX A;  4X62 M;  2BWB A;  1IN8 A;  3AOG A;  1VEJ A;  5EP1 A;  1OAO C;  4AG5 A;  4WUR A;  3B7Q A;  3M0E A;  2DZN B;  3K2L A;  1IY1 A;  3ZC7 B;  3U6E A;  3H4M A;  1F4I A;  1HJP A;  3HU2 A;  1G4A E;  4JV5 M;  4YHH M;  1L2D A;  4MGY E;  2Z7J A;  3GPX A;  1HNW M;  3VFD A;  1VEG A;  4P16 A;  5KPR A;  1YE9 A;  2ZAO A;  3WHL A;  3RGS A;  4D81 A;  2V1U A;  1VEK A;  2GNO A;  1JR3 E;  3ZCB B;  3GLG E;  5DFL A;  2H5X A;  3B74 A;  1CUK A;  1HQC A;  2R6F A;  1DGH A;  4NC6 A;  2UU9 M;  2RGO A;  2DEN A;  2UUC M;  1BVS A;  2Y21 A;  1D0M A;  5ITQ A;  4IBC A;  4LJ9 A;  2F5Q A;  2JWS A;  2ZAN A;  1SXJ A;  4GIT A;  4LGM A;  4QOS A;  4LFA M;  2AHM A;  2CE7 A;  2OQ4 A;  2JY7 A;  2X4A A;  3TWL A;  4L8R C;  3LQR A;  2R0I A;  1NJF A;  2CV0 A;  3GRY A;  4IBB A;  3MHV C;  2R4E A;  4PD2 A;  3A46 A;  5ITU A;  5EP3 A;  1D2N A;  2JP7 A;  3PVS A;  4IBE A;  4DR4 M;  1R7R A;  4FWD A;  1PJJ A;  1PJS A;  2MGW A;  4GKJ M;  4LJ4 A;  1HNZ M;  4G4N A;  3U60 A;  2UUA M;  3HX3 A;  1NY6 A;  2R18 A;  3OTO M;  2EA0 A;  1QAO A;  1Z5C A;  5KPZ A;  2F5S A;  3FKE A;  3A45 A;  3AOE A;  3TWK A;  3QWL A;  3TWM A;  1N77 A;  2UXD M;  4WP2 A;  2CFO A;  1QUT A;  1W5S A;  1Y8G A;  2CWB A;  1IN5 A;  3FUV A;  2DNA A;  1MU5 A;  3KVW A;  4NSO B;  2C99 A;  1YUB A;  5GKN A;  4DR7 M;  5FTK A;  4GC9 A;  4GEW A;  3VK7 A;  2XGN A;  3FYD A;  3KP0 E;  4K0K M;  3M7G A;  1GO5 A;  1JR3 A;  5EXP A;  1YLA A;  4DR5 M;  4QHS A;  3AKZ A;  1OQY A;  2HAK A;  3EIE A;  2RKO A;  3FYC A;  3HJQ A;  4L78 A;  4OVZ A;  4AI6 A;  5A2Q S;  4MGZ E;  4S12 A;  2L09 A;  3L25 A;  2QEN A;  4L6V 6;  3CF0 A;  3A42 A;  2UXC M;  2W82 A;  2WSC F;  3HHX A;  2DVW B;  4B7G A;  3KFU G;  5JI3 E;  3C9P A;  2YFQ A;  3HHW A;  3BBZ A;  1J7K A;  1X37 A;  3I04 M;  1QZM A;  3K9O A;  1QAN A;  1D0K A;  1NVM A;  3FTD A;  3KOZ E;  2EJS A;  4I8O A;  4KOD A;  1EE8 A;  3E9S A;  3TL4 X;  4JI5 M;  3F92 A;  3RE8 A;  4ITQ A;  2CRU A;  3E4R A;  1AIP C;  3LCV B;  2DHR A;  1NY5 A;  5BR8 M;  3KDS E;  1N32 M;  3TE6 A;  2Z3X A;  1V92 A;  1WXQ A;  4GIP A;  4MGH A;  1T43 A;  4B3M M;  1K82 A;  4LZZ A;  2DAM A;  2KXE A;  3M6A A;  2MJ5 B;  4FWH A;  1E9S A;  7CAT A;  2CUZ A;  3LVV A;  3B89 A;  3HU1 A;  5EXS A;  2QP9 X;  3D8B A;  4FCW A;  2KRK A;  2CHV A;  2L7H A;  4R7G A;  4AKG A;  2BNK A;  3T1Y M;  2C96 A;  1I4W A;  5E26 A;  4B3R M;  2HCB A;  3VDU A;  1XXH E;  2XLJ A;  4G4Q A;  3PNV A;  4ZPX A;  3SAT A;  5IT9 S;  2DWM A;  4JYA M;  4OVZ B;  5C1B A;  4LF7 M;  2F5O A;  2JY5 A;  2NQ8 C;  2L6O A;  3HHZ A;  1R5L A;  2F5P A;  4LRT A;  3L27 A;  2UXB M;  4UN2 B;  5KQD A;  3C58 A;  1MN3 A;  3DFZ A;  1QZE A;  1GAB A;  2G5G X;  4KLN A;  3J7A S;  3IEC A;  2J7O A;  2WSE F;  3W0F A;  3HJ8 A;  4FWG A;  4LGY A;  3Q8G A;  4PDG A;  2F4V M;  2DAI A;  3FD9 A;  3GQ3 A;  2R65 A;  2Y0Q A;  1VG5 A;  2BWE A;  4IIW A;  1TGU A;  1L8Q A;  4NL4 H;  4JI0 M;  1IXS A;  2Y20 A;  4ANR A;  2FS1 A;  3FRI A;  1XNQ M;  2L4E A;  4IJF A;  2EUC A;  3ILK A;  2FE8 A;  4AKH A;  1G3I A;  2DWZ B;  4IBK A;  2R62 A;  4RKU F;  2L4F A;  2BJW A;  2KA6 B;  3IG8 A;  1P3Q Q;  2WSF F;  2DZL A;  4OU7 A;  3SC3 A;  4WW0 A;  5ITX E;  3UMM A;  1NV9 A;  4JI4 M;  2EO2 A;  2I7N A;  5FSW A;  3IG5 A;  4LF9 M;  2DAK A;  4FCV A;  1SG9 A;  3L2A A;  5L8R F;  2L7I A;  3U6Q A;  2ERC A;  1PM5 A;  3GO8 A;  3FTC A;  2DWL A;  3SYK A;  1N75 A;  4L15 A;  1GJS A;  3FUU A;  1OAI A;  2RRU A;  1IY0 A;  1JR3 D;  3FTF A;  3B7N A;  2JUJ A;  4MB7 A;  4DV5 M;  3HGI A;  1DGG A;  1K3X A;  5FTM A;  3NBX X;  4LJ6 A;  3GLF E;  5EXX A;  4IBJ A;  2J7N A;  4R3D A;  1NHW C;  2N35 A;  1WHC A;  2ZAM A;  2OOA A;  2UUB M;  3GLH E;  2K6B A;  4CJ6 A;  3VKH A;  2MRO B;  3HJS A;  1N78 A;  2D7G A;  1TTE A;  4JI7 M;  4DV2 M;  3DZD A;  1Q3C A;  3UK6 A;  4NSR A;  3MJ5 A;  3R9X B;  1C1K A;  4LF8 M;  2LVQ D;  5KQ8 A;  3KOW E;  3W0L B;  1TH3 A;  2LHG A;  4HLQ A;  2XEP A;  4KO8 A;  1TH4 A;  5DNY A;  1GVN A;  1WR1 B;  4JXJ A;  2QHO B;  3GRV A;  3W67 A;  1G8P A;  1IXS B;  1MJG M;  3PFI A;  1Z5A A;  4KHP M;  2QNJ A;  1SXJ C;  4M9Z A;  4NRW A;  4EIW A;  1Q39 A;  1WIV A;  4JN6 A;  3GLI E;  3U6M A;  4JI1 M;  2B3T A;  5E6J A;  3VDP A;  3T6P A;  1IQP A;  1C7Y A;  2QCU A;  3GLG A;  4DV7 M;  1OTR A;  1OIZ A;  2FNA A;  2WZJ A;  1L2B A;  4M9X A;  5LMU M;  5JI2 E;  3LQQ A;  3LW5 F;  2ZTD A;  1DV0 A;  2EKK A;  1XXH B;  3U6C A;  2LH0 A;  2M60 A;  4IBD A;  4IBI A;  4NXN M;  2ZM6 M;  4LF6 M;  2YNM D;  3E46 A;  2Z4R A;  3U6O A;  2DKL A;  3AOE C;  3I51 A;  3SMP A;  4B08 A;  3JR4 A;  4R71 A;  5FLX S;  4LZJ A;  2D7H A;  5KPT A;  3ZH9 B;  1G59 A;  1WGL A;  1RU3 A;  3D8L A;  3FE3 A;  4MGK E;  4TUW A;  2GQF A;  4RF0 A;  2VII A;  3QYB A;  3E21 A;  1W5T A;  4DR2 M;  4JI6 M;  3RFW A;  2OO9 A;  2K9D A;  3GRU A;  2XFT A;  4DR3 M;  1QUS A;  2KNZ A;  1PJT A;  1KFV A;  2P5T A;  3K92 A;  4OW0 A;  2EKF A;  3U61 A;  3UGJ A;  1R2Z A;  1QQW A;  3K9P A;  1E94 E;  3EIH A;  3SAU A;  1PRB A;  3VKG A;  1WGN A;  3KOY E;  3L29 A;  1GL6 A;  4Y28 F;  4B7H A;  4DBG B;  2XH9 A;  1ZV1 A;  2K0B X;  2ZTC A;  2DXI A;  2C9O A;  3FTE A;  2CP8 A;  4LCB A;  3TQS A;  1J5E M;  1L2C A;  1FNN A;  1OFH A;  1ZMV A;  3L26 A;  2VQE M;  1G71 A;  2VF7 A;  4X65 M;  2C5R A;  2QBY A;  3K1J A;  4B7F A;  4D80 A;  1G41 A;  4Q7J A;  4X64 M;  1IFY A;  4XBO A;  2R46 A;  2L2D A;  2M5Z A;  3U6S A;  1NNJ A;  1V33 A;  3GQ4 A;  1DO2 A;  1TR8 A;  2CHQ A;  3GLG B;  1IN7 A;  2CV2 A;  4GKK M;  4B3T M;  1IM2 A;  2JZ0 A;  2LVO C;  2LXE A;  5ITY A;  4A3V B;  3GQ5 A;  2HL7 A;  3KSJ A;  3GP1 A;  2R44 A;  2LVA A;  2KRU A;  2OOB A;  3KXE C;  3LMM A;  3NBI A;  3V76 A;  1TDZ A;  2XSZ A;  2APL A;  2R45 A;  3IHP A;  5ITT A;  4RNA A;  3PNY A;  3FUW A;  2CV1 A;  2JZ1 A;  3SHF A;  2MR9 A;  3SAV A;  4LY6 A;  4W5W A;  3DA1 A;  2VF8 A;  3SBJ A;  4GHL A;  4GMQ A;  3NWL A;  2HWJ A;  4M0D A;  3ZQJ A;  3L28 A;  1ZAE A;  4IBG A;  2YR0 A;  4MM3 B;  1QDT A;  2OPF A;  3I01 M;  3Q8X A;  4HEO A;  1MX0 A;  3BOS A;  1V34 A;  3SAW A;  1R4G A;  1N34 M;  5DYI A;  1Z59 A;  2DAG A;  3AJI B;  5ITX A;  1HT2 E;  2Z4S A;  1IY2 A;  3HU3 A;  1KYI A;  4LJ5 A;  4GRI A;  1XMO M;  4I4L A;  2G8L A;  2LVP C;  2FH0 A;  2QZ4 A;  1J09 A;  3J80 S;  3HHY A;  3PXG A;  3U61 B;  2G3Q A;  3U5Z A;  2JXN A;  2O01 F;  1SXJ E;  2JY6 B;  3A98 B;  4PDI A;  1S3S A;  3GPY A;  1UM8 A;  3H4J A;  4LRS A;  2DWN A;  1DGB A;  4PT5 A;  1XXH A;  2J5Y A;  4MGI E;  1GKI A;  2BJV A;  4AW4 A;  1LV7 A;  3FUT A;  4XK8 F;  1FJG M;  3AL0 C;  3C3E A;  2CHG A;  5FTL A;  1LTM A;  1DGF A;  3HKP A;  5FTJ A;  5H37 D;  2H1R A;  2QBY B;  1YSY A;  2Z8Y M;  3QAU A;  4QHT A;  4LJA A;  1L1Z A;  2A5Y B;  1EFU B;  4LJ8 A;  1A5T A;  3U6D A;  1DO0 A;  1R6B X;  3FUX A;  2X49 A;  1AUA A;  2KEB A;  2LTU A;  3W68 A;  4G6Z A;  2LHC A;  4GHA A;  1TH2 A;  3FRH A;  1PJI A;  4AKI A;  1IBL M;  4XGI A;  4G4R A;  2V1C A;  4JI8 M;  4LFC M;  1EIJ A;  2KZU A;  3LVW A;  5IZ7 D;  4D82 A;  1PGY A;  4HL4 A;  4DV4 M;  4AQY M;  4IBF A;  3CGW A;  4QOZ C;  2DZO B;  1Z5B A;  1IXZ A;  1NSF A;  3SFZ A;  2RGH A;  3J81 S;  1HQY E;  4GC5 A;  2KNV A;  3KW6 A;  4G4O A; 
#chains in the Genus database with same CATH homology
 1VEJ A;  1VDL A;  3E21 A;  2OO9 A;  1Q02 A;  2K9D A;  1XXH E;  1F4I A;  1NV8 A;  1HJP A;  2KNZ A;  1G4A E;  2JY5 A;  4F1I A;  1VEG A;  2EKF A;  4UN2 B;  1MN3 A;  2LVN C;  3K9P A;  1E94 E;  1QZE A;  4F2L A;  1VEK A;  3IEC A;  1VQ1 A;  1WGN A;  1JR3 E;  4DBG B;  3GLG E;  5DFL A;  2H5X A;  2DAI A;  1CUK A;  1ZV1 A;  2K0B X;  2ZTC A;  2CP8 A;  1VG5 A;  2BWE A;  2DEN A;  1IXS A;  1ZMV A;  3FRI A;  1BVS A;  1G41 A;  2L4E A;  4Q7J A;  3LCU A;  1IFY A;  2L2D A;  1G3I A;  2JY7 A;  1DO2 A;  1TR8 A;  2L4F A;  2DHY A;  1P3Q Q;  2R0I A;  2DI0 A;  2JY8 A;  2DZL A;  1IM2 A;  2JZ0 A;  1WJ7 A;  2LVO C;  2KNA A;  1NV9 A;  2JP7 A;  2LVA A;  2OOB A;  2DAK A;  2MGW A;  1SG9 A;  3IHP A;  2JZ1 A;  2MR9 A;  1OAI A;  1T6O A;  2RRU A;  4WP2 A;  1ZMW A;  2JUJ A;  1Y8G A;  2CWB A;  2HWJ A;  2DNA A;  4GEW A;  4HEO A;  3GLF E;  1UFZ A;  1R4G A;  1WHC A;  2OOA A;  1GO5 A;  3GLH E;  1YLA A;  2MRO B;  2DAG A;  1HT2 E;  1OQY A;  1TTE A;  2HAK A;  2JNH A;  1KYI A;  2LVP C;  2G3Q A;  2LVQ D;  2JY6 B;  3H4J A;  1XB2 B;  1ZMU A;  1WR1 B;  2QHO B;  3BBZ A;  3K9O A;  2EJS A;  2KHH A;  2QNJ A;  3F92 A;  2QSF X;  1HT1 E;  2O25 A;  3GLI E;  1AIP C;  1WIV A;  2DAE A;  3LCV B;  2B3T A;  1EFU B;  3T6P A;  1C7Y A;  1A5T A;  1V92 A;  2LBC A;  1DO0 A;  1T43 A;  1OTR A;  2LTU A;  2WZJ A;  3MMP A;  5JI2 E;  3FRH A;  2DAM A;  1OKS A;  2ZTD A;  1DV0 A;  2EKK A;  2MJ5 B;  3E46 A;  1PGY A;  2DKL A;  4G3O A;  3B89 A;  4R71 A;  1WGL A;  1HQY E;  2KNV A;  2BWB A;  3FE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...