4DV0M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv0M02
4JI3M 1R2ZA 1J5EM 1N33M 4DV4M 3TWKA 1PJIA 3OTOM 4MB7A 5ITQA 4CISA 4LF8M 3GQ4A 3U6DA 2F5OA 4DV1M 4DV6M 5ITYA 3U6QA 2EA0A 2UUCM 3GO8A 4LF7M 1N36M 4G4OA 1Q39A 5LMUM 2OPFA 3T1YM 2VQFM 1XC8A 1Z5CA 1NNJA 2UU9M 1HR0M 5IWAM 1K82A 3A46A 5LMNM 1TDHA 4LF6M 1K3XA 4PCZA 1I94M 1XMOM 2UXDM 4JI4M 3J81S 2F5SA 3T1HM 2F4VM 1Q3CA 5BR8M 1HNZM 2VQEM 4G4NA 3U6LA 3TWLA 2XZUA 4DV3M 1Z5AA 4PD2A 4LFAM 4X66M 4DV5M 4LF5M 4PDIA 3GPYA 3U6OA 3U6CA 3GPXA 2HHHM 4NRWA 4DR1M 2OQ4A 3DOAA 4X65M 2E5LM 3W0FA 2F5QA 4JI1M 4G4RA 1IBMM 3SATA 5FLXS 4DR5M 3U6MA 2HKJA 4LFBM 1L1ZA 2ZM6M 5ITTA 4DV0M 3U6SA 4G4QA 1Q3BA 4B3MM 3GQ3A 4JI8M 4DUYM 3JR4A 3TWMA 4DV7M 2UUAM 4JI5M 4NXNM 4LF9M 1L2DA 4LF4M 4JYAM 3SAUA 3SAWA 1PM5A 1EE8A 4DR2M 1L1TA 1MX0A 4DUZM 4JI2M 1L2BA 4NXMM 3SBJA 3VK8A 4DR4M 2UXBM 5ITRA 4X62M 4B3RM 4B3SM 4JI0M 1KFVA 4OX9M 4GKJM 5IT9S 4YHHM 5ITXA 3J80S 4B3TM 5ITXE 2UUBM 2UXCM 1IBKM 2F5NA 4K0KM 1K3WA 4PDGA 4JI7M 1Z5BA 1PJJA 4YY3M 3U6PA 2Q2EB 5A2QS 3SAVA 1N34M 1N32M 3U6EA 3A42A 3GPPA 4ITQA 3SARA 1FJGM 2F5PA 2ZBKB 1Z59A 4AQYM 1IBLM 4JI6M 1MU5A 1XMQM 3GQ5A 1HNXM 1XNRM 4KHPM 1L2CA 5ITUA 3JR5A 3SASA 4LFCM 1XNQM 4X64M 4JV5M 2XZFA 3GP1A 3JAMS 3VK7A 4DR3M 1HNWM 3J7AS 3C58A 4GKKM 4DR6M 4DV2M 1TDZA 4NRVA 3A45A 4DR7M 1R2YA 3GPUA
chains in the Genus database with same CATH superfamily
5KQ8A 3VDPA 4IJEA 1WIVA 2GNOA 5DFLA 1PJIA 3HHWA 1PRBA 2H1RA 3MK6A 4MB7A 1QQWA 3AL0C 2J7NA 3IG5A 3GLGA 3VLFB 4LF8M 3GQ4A 3U6DA 1LTMA 2JY7A 4DV1M 2CV1A 2R0IA 2UUCM 4LCBA 3C3DA 2DAEA 2DAMA 1QAQA 2LTUA 3I04M 4GITA 2EUCA 3GRRA 3GRVA 4OVZB 3L26A 1WGNA 2GQFA 1G59A 4GC5A 2OOAA 1WHCA 3KW6A 3L29A 1T3TA 1F4IA 4RNAA 1QAMA 1IXRC 1QZMA 3HU1A 3M7GA 1GJSA 2I7NA 1DO2A 5FTKA 1NHWC 4D82A 3J81S 3HU3A 3GLFB 1Q3CA 2KEBA 3KOWE 2VQEM 2NQ8C 4KT0F 5EXPA 2C99A 3SMPA 1JB0F 2Y0TA 1FNNA 2XH9A 3GRYA 5F3WA 3HJ8A 2KA6B 1XXHB 4CJ6A 2VF7A 3LVVA 2R44A 2OQ4A 5EXTA 5IZ7D 1KSFX 2XSZD 4X65M 2QSFX 2F5QA 3CF6E 4G4RA 5EQTA 5FLXS 4DR5M 2HKJA 4UN2B 3FTFA 1TTEA 1OIPA 5ITTA 1L8QA 4XBOA 1IN5A 1Q3BA 3FUUA 3GQ3A 1IFYA 4G3OA 1HT1E 2YR0A 2QPAA 4LJ7A 4AKIA 2DKLA 1A5TA 4FCVA 3JR4A 2Z4RA 3GLGE 4L16A 4NXNM 4M0DA 2DAGA 1PM5A 3KVWA 4DR2M 1MX0A 2JUJA 2APLA 3B9PA 4LRTA 3D8LA 1VDLA 2CP8A 3DFZA 3FE3A 4B3SM 4CGYB 2BNKA 4LJ5A 1IY1A 4B3TM 4Y28F 2Y0QA 4MH0E 3QWLA 2UXCM 2CFOA 1G71A 4FWHA 2HL7A 2MH8A 1Z5BA 1ZQ9A 5EXSA 3U5ZA 2EKFA 3AOGA 3GPPA 4REZA 1AIPC 2K9DA 2DZNB 1SXJE 4D81A 2F5PA 1OKSA 5DYIA 2VF8A 4BB9A 2RGOA 4II7A 1HNXM 2M60A 4AKGA 2B3TA 4OW0A 1AUAA 2R65A 3HWSA 1L2CA 2JZ0A 3SASA 4LFCM 1XNQM 3V76A 2DXIA 2FE8A 3ZC7B 3RFWA 1ZV1A 2L7HA 3J7AS 2DAKA 4KLNA 3RGSA 3QAUA 3C58A 3K9OA 4NC6A 3SMSA 2QBYB 4MGIE 3K92A 4DV2M 1J09A 1R7RA 1G4AE 3A45A 3I51A 3HHZA 3PNYA 2QBYA 3GPUA 3M0EA 4JI3M 2Y20A 3U60B 5L8RF 1R2ZA 1GL7A 4DV4M 2C98A 2CRUA 3OTOM 3FRHA 2C9CA 4AKHA 4CISA 2N35A 5JI3E 2Y21A 4MGKE 2KDLA 2LVPC 2F5OA 1T6OA 3J27B 2EA0A 3GLHB 3D8BA 3TPZA 3HKPA 1ZMWA 3I4VA 2FH0A 3KSXA 3VDUA 5KPZA 3UZUA 1D2NA 1TH4A 4RKUF 1N78A 2X8AA 2H5XA 4HL4A 2CWBA 4Z8XA 3T1YM 3FKEA 1Z5CA 4ANRA 3AV0A 2WZJA 2UU9M 1OFIA 2XFSA 3AOEA 1HR0M 1Y8GA 4QOZC 4KO8A 2CV0A 5LMNM 4LF6M 2EJSA 4PCZA 3ZQJA 1I94M 5FTMA 3PVSA 1XMOM 2UXDM 4JI4M 5FTNA 4R71A 1IN7A 2DWNA 4HEOA 3T1HM 2JY6B 1DGBA 2F4VM 3EIEA 1LV7A 3RE8A 2XZUA 3TWLA 4R3DA 4RF0A 2QENA 5E26A 2KNVA 4PD2A 4TUWA 2ERCA 1GLNA 4D80A 3T6PA 3E9SA 5JI2E 2C96A 4LJ8A 3HHXA 3KP1E 2O25A 4WP2A 2HHHM 1IXZA 2L4EA 4XK8F 1OQYA 3IECA 4JI1M 1EFUB 1QZEA 3KFUG 2R62A 3GLIE 2ZANA 1IBMM 1ZAEA 2LHGA 3WHLA 4BBAA 3U6MA 4LFBM 1HJPA 2FS1A 1L1ZA 2ZM6M 1GVNA 1YSYA 2QQ8A 3CGWA 3FTEA 4L4UA 2R18A 3QYBA 4JXJA 1HQCA 3THGA 3GLGB 2Z7JA 4AZFA 2G8LA 3TWMA 1N75A 2UUAM 4QHTA 2Z4SA 4JI5M 3LQQA 1OIZA 3L27A 2FNAA 1PJQA 4RF1A 5EP4A 1L1TA 3GRUA 2YQZA 4DUZM 4JI2M 4B7GA 1L2BA 3HGIA 3SBJA 2XSZA 3HY5A 3VK8A 2UXBM 1WGLA 3CTWB 3UK6A 4EIWA 2CHQA 3MHVC 5ITRA 2D7EA 3Q8XA 1IN4A 1XB2B 3J80S 5ITXE 5H37D 2UUBM 2CE7A 2WSCF 2ZTDA 2LVNC 1IBKM 4IBJA 3R8FA 1K3WA 4JI7M 1QYRA 4L78A 2BJWA 2BJVA 2CUZA 4YY3M 2Q2EB 1GJTA 4NOOB 3SAVA 3U6EA 1J7KA 4FD2A 3CF2A 4KODA 5EP3A 3SARA 1FJGM 2HAKA 4QNRA 2HCBA 3FUXA 1MU5A 1XMQM 4MGHA 1JR3A 1G3IA 3K9PA 1DGHA 3J2PB 5ITUA 3FTCA 3MJ5A 4X64M 3E4RA 4JV5M 4AI6A 3NBIA 2K6BA 2XZFA 1GL6A 4DR3M 1DGHB 1PJSA 3LQRA 1D0KA 2FFJA 4CIZA 4P16A 1JR3E 3WHKA 4DR6M 4ZPXA 4F1IA 3GLIA 4NRVA 3TL4X 5FTJA 4W5WA 5EJCA 3L28A 1GKIA 4HLQA 1NV8A 1R5LA 3UJNA 1QVRA 1J5EM 2KNZA 3FYDA 3TWKA 1N33M 1TGUA 1IXSB 1W5TA 1IY0A 2D7GA 2DZLA 1QDRA 5ITQA 4I81A 2JZ1A 2ZAMA 4MM3B 4DBGB 5GKNA 4QHSA 1MN3A 1UM8A 1VEGA 4MGZE 4DV6M 4FWDA 3U6QA 1DGGA 2R46A 3FUTA 4FW9A 1IXSA 2MR9A 3VKGA 2ZAOA 2YNMD 2DWLA 1OJLA 1NY5A 1YUBA 2JA2A 1OAIA 3KOXE 4GMQA 2MROB 3C9PA 5LMUM 4CHTB 1E32A 2L6OA 4M9ZA 1SXJA 1XC8A 1NHGC 3BOSA 2O5RA 2L7IA 1NNJA 2KXEA 5DYGA 3R9XB 1HT2E 3FUWA 1T43A 5IWAM 1K82A 2KZUA 4IBIA 3SFZA 2JXNA 5KPTA 1K3XA 2Z8YM 1C7YA 2KNAA 1NJFA 5BPVA 2F5SA 1NNUC 1SXJC 2L09A 2R4JA 3LCUA 3A98B 3LVWA 3UMMA 5BR8M 4G4NA 3H4MA 1OFHA 3F92A 1Z6TA 4DV3M 1WXQA 4X66M 3PNVA 3HJSA 1XXHE 3AOEC 3FRIA 4S12A 4PDIA 4DV5M 4LF5M 1EIJA 4GRIA 3QYEA 1E9RA 3GPXA 4LJ4A 4AW4A 4B7FA 5C1BA 4DR1M 2EKKA 2L4FA 3DOAA 3GLHA 2E5LM 4I8OA 1G8PA 1S3SA 2VIIA 2M5ZA 2X4AA 2V1UA 2LBCA 3W67A 1XWIA 3U6SA 1VDDA 2LH0A 1NVMA 2LNHC 3ZCBB 4JI8M 3KSJA 1QUTA 2YFQA 4LRSA 4A3VB 4DUYM 2BWEA 3K1JA 1YLAA 2DI0A 3CF0A 3I01M 5EXXA 4DV7M 3MMPA 4LF4M 3FYCA 5C18A 3SAWA 2DHYA 3HZJA 1EE8A 2P5TA 2K0BX 2LHCA 4FCWA 4FVMA 1VQ1A 4NXMM 4M0WA 1GABA 3U61A 2R4EA 3SYLA 1IN8A 4GH9A 4DR4M 4IBBA 2R45A 4B3RM 3KDSE 1KFVA 4OX9M 1JR3D 2KRKA 1PJTA 3DZDA 4R7GA 1SG9A 1ZMUA 3SC3A 4OU7A 1QDTA 4GC9A 4L8RC 2XFTA 1V33A 2XEPA 3KP0E 4IBGA 4B7HA 2CEAA 1WJ7A 4LJAA 1R4GA 1XXHA 2CHGA 3E46A 1IQPA 3SHFA 2L2DA 3LMMA 3U6PA 5A2QS 2R6FA 4M9XA 1N32M 2DWZB 4XGIA 2XLJA 2DNAA 3SYKA 4AQYM 1IBLM 1QAOA 3E21A 4PT5A 4JI6M 2G3QA 3M6AA 1WR1B 1QANA 3HJQA 4KHPM 3K2LA 3BXWA 3JR5A 3B7QA 3FTDA 4IBDA 4LGYA 1E9SA 1GO5A 3RGPA 4QNMA 3JAMS 2W82A 1HNWM 4WURA 2OO9A 3I4YA 5FTLA 4GEWA 4AG6A 3HHYA 4B08A 4I4LA 1X37A 2J5YA 8CATA 2Z3XA 1E94E 4NSRA 5E6JA 4Z6YA 2DHRA 3KOYE 1I4WA 4IBCA 2DWMA 4DR7M 4IBKA 4NL4H 3L25A 2AHMA 1IN6A 4NSOB 1UFZA 4G6ZA 4QOSA 1DV0A 1ORYB 2JP7A 3HU2A 4L15A 2JY8A 3C3EA 4L6V6 5EP1A 2MJ5B 1SXJD 5ITYA 1TH3A 1TR8A 3GO8A 4JN6A 3W68A 4LF7M 1OTRA 1D0LA 3AFHA 5KQDA 2D7HA 1N36M 3HX3A 4G4OA 4F2LA 2XGNA 3IHPA 5FSWA 1KYIA 1Q39A 3J7BA 3AJIB 2OPFA 2V6ZM 2VQFM 2G5GX 2I7PA 4IBFA 1HQYE 4LZJA 3T15A 3A46A 4FCTA 1TDHA 3VKHA 1ZMVA 3NWLA 4OVZA 2O01F 1XHBA 1RU3A 1R6BX 3FUVA 3U61B 5KO3A 2ZTCA 2WSFF 1HNZM 3U6LA 2LVAA 2DZOB 3Q8GA 3GLFE 1Z5AA 4LFAM 1CUKA 2V1CA 3GPYA 1PGYA 1NSFA 4IIWA 3U6OA 2C9OA 3U60A 1N77A 1SXJB 3U6CA 2DVWB 4NRWA 3IG8A 3K8ZA 1BVSA 3W0FA 3T38A 2QCUA 1QUSA 3SATA 3GLFA 2QP9X 4I5SA 2JNHA 2X49A 3NBXX 1NY6A 5EP2A 4DV0M 3PFIA 4G4QA 4B3MM 4LZZA 2BWBA 1G41A 3B7NA 3B7ZA 3EIHA 3GLHE 2QHOB 2RRUA 1Q02A 2RGHA 3LW5F 1D0MA 3UGJA 1NJGA 3BBZA 3H4JA 4LF9M 2VDBB 1L2DA 2K47A 3VFDA 4JYAM 1VEKA 3SAUA 3AKZA 2OOBA 1VG5A 2WSEF 1MJGM 4MGYE 3B89A 4M9SA 2CV2A 3U5ZB 2KW0A 2QZ4A 2MGWA 1OAOC 3FD9A 1NV9A 4X62M 3DA1A 4JI0M 1YE9A 4GKJM 2DENA 2EO2A 5IT9S 4YHHM 1NO1A 3TE6A 4P17A 5ITXA 2C5RA 5DNYA 2LWXA 4GIPA 4WW0A 2A5YB 3SHGB 2JY5A 4FWGA 2LXEA 2F5NA 4K0KM 4PDGA 2XF3A 1V92A 4GHLA 1PJJA 3B74A 1H6UA 1C1KA 2RKOA 2QNJA 1VEJA 1N34M 1W5SA 1V34A 2LVQD 2KRUA 3A42A 4IBEA 1DGFA 4LJ9A 4ITQA 1Z59A 2ZBKB 1IM2A 3KS8A 2LVOC 1DO0A 3GQ5A 1XNRM 1IY2A 3KOZE 2KZSA 4LG2A 2CHVA 3GLIB 4LY6A 4LJ6A 7CATA 3TQSA 5IREB 3GP1A 2DAIA 3ZH9B 3W0LB 3VK7A 4Q7JA 3ILKA 3KS4A 4BLCA 4LGMA 1JQJC 1TF0B 4IJFA 4AG5A 5KPRA 4GKKM 2FOIC 2JWSA 3L2AA 3LCVB 2J7OA 1P3QQ 1TDZA 4GHAA 3KXEC 3PXGA 2KHHA 2HWJA 1R2YA 1TH2A
chains in the Genus database with same CATH topology
5KQ8A 3VDPA 4IJEA 1PJIA 3HHWA 2H1RA 3MK6A 4MB7A 1QQWA 3AL0C 2J7NA 3IG5A 3GLGA 3VLFB 4LF8M 3GQ4A 3U6DA 4DV1M 2CV1A 2UUCM 4LCBA 4OVZB 1QAQA 4GITA 3L26A 2EUCA 3GRRA 3GRVA 1G59A 4GC5A 3L29A 3KW6A 1T3TA 4RNAA 1QAMA 1IXRC 1QZMA 3HU1A 3M7GA 2I7NA 1DO2A 5FTKA 1NHWC 4D82A 3J81S 3HU3A 3GLFB 1Q3CA 2KEBA 3KOWE 2VQEM 2NQ8C 3SMPA 5EXPA 2C99A 2Y0TA 1FNNA 2XH9A 3GRYA 5F3WA 3HJ8A 2KA6B 1XXHB 3LVVA 2OQ4A 5EXTA 5IZ7D 1KSFX 2XSZD 4X65M 2F5QA 3CF6E 4G4RA 5EQTA 5FLXS 4DR5M 2HKJA 3FTFA 5ITTA 1L8QA 4XBOA 1IN5A 1Q3BA 3FUUA 3GQ3A 1HT1E 2YR0A 2QPAA 4LJ7A 4AKIA 3JR4A 4FCVA 2Z4RA 4L16A 4NXNM 4M0DA 1PM5A 3KVWA 4DR2M 1MX0A 3B9PA 4LRTA 3D8LA 3DFZA 4B3SM 4CGYB 2BNKA 4LJ5A 1IY1A 4B3TM 2Y0QA 4MH0E 3QWLA 2UXCM 2CFOA 4FWHA 2HL7A 1ZQ9A 1Z5BA 5EXSA 3U5ZA 3AOGA 3GPPA 4REZA 4D81A 2DZNB 1SXJE 2F5PA 5DYIA 4BB9A 2RGOA 4II7A 1HNXM 2M60A 4AKGA 4OW0A 2R65A 3HWSA 1L2CA 3SASA 4LFCM 1XNQM 2DXIA 2FE8A 3ZC7B 3RFWA 2L7HA 3J7AS 3RGSA 4KLNA 3QAUA 3C58A 3SMSA 2QBYB 4MGIE 3K92A 4DV2M 1J09A 1R7RA 1G4AE 3A45A 3I51A 3HHZA 3PNYA 2QBYA 3GPUA 3M0EA 4JI3M 2Y20A 3U60B 1R2ZA 1GL7A 4DV4M 2C98A 3OTOM 2C9CA 4AKHA 4CISA 5JI3E 2Y21A 4MGKE 2F5OA 3J27B 2EA0A 3GLHB 3D8BA 3TPZA 3HKPA 3I4VA 3KSXA 3VDUA 5KPZA 3UZUA 1D2NA 1TH4A 1N78A 2X8AA 4HL4A 4Z8XA 3T1YM 3FKEA 1Z5CA 3AV0A 2UU9M 1OFIA 2XFSA 3AOEA 1HR0M 4QOZC 4KO8A 2CV0A 5LMNM 4LF6M 4PCZA 1I94M 5FTMA 3PVSA 1XMOM 2UXDM 4JI4M 5FTNA 1IN7A 2DWNA 3T1HM 2F4VM 1DGBA 3EIEA 1LV7A 3RE8A 2XZUA 3TWLA 4R3DA 4RF0A 2QENA 5E26A 4PD2A 4TUWA 2ERCA 1GLNA 4D80A 5JI2E 3E9SA 2C96A 4LJ8A 3HHXA 3KP1E 2HHHM 1IXZA 4JI1M 3KFUG 2R62A 1IBMM 2ZANA 1ZAEA 3WHLA 4BBAA 3U6MA 4LFBM 1L1ZA 2ZM6M 1GVNA 1YSYA 3FTEA 4L4UA 2R18A 4JXJA 1HQCA 3THGA 3GLGB 2Z7JA 4AZFA 2G8LA 3TWMA 1N75A 2UUAM 4QHTA 2Z4SA 4JI5M 3LQQA 3L27A 2FNAA 4RF1A 5EP4A 1L1TA 3GRUA 2YQZA 4DUZM 4JI2M 4B7GA 1L2BA 3HGIA 3SBJA 2XSZA 3VK8A 2UXBM 3CTWB 3UK6A 4EIWA 5ITRA 2CHQA 3MHVC 2D7EA 3Q8XA 1IN4A 3J80S 5ITXE 5H37D 2UUBM 2CE7A 1IBKM 4IBJA 3R8FA 1K3WA 4JI7M 1QYRA 4L78A 2BJWA 2BJVA 2CUZA 4YY3M 2Q2EB 4NOOB 3SAVA 3U6EA 1J7KA 4FD2A 3CF2A 4KODA 5EP3A 3SARA 1FJGM 4QNRA 2HCBA 3FUXA 1MU5A 1XMQM 4MGHA 1JR3A 1G3IA 1DGHA 3J2PB 5ITUA 3FTCA 3MJ5A 4X64M 3E4RA 4JV5M 4AI6A 3NBIA 2XZFA 1GL6A 4DR3M 1DGHB 3LQRA 2FFJA 3WHKA 4DR6M 4ZPXA 3GLIA 4NRVA 3TL4X 5FTJA 4W5WA 5EJCA 3L28A 1GKIA 4HLQA 3UJNA 1QVRA 1J5EM 1N33M 3FYDA 3TWKA 1TGUA 1IXSB 1W5TA 1IY0A 2D7GA 5ITQA 4I81A 2ZAMA 4MM3B 5GKNA 4QHSA 1UM8A 4MGZE 4DV6M 4FWDA 3U6QA 1DGGA 2R46A 3FUTA 4FW9A 3VKGA 2ZAOA 2YNMD 2DWLA 1OJLA 1NY5A 1YUBA 2JA2A 5LMUM 3KOXE 4GMQA 4CHTB 1E32A 2L6OA 4M9ZA 1SXJA 1XC8A 1NHGC 3BOSA 2O5RA 2L7IA 1NNJA 2KXEA 5DYGA 3R9XB 1HT2E 3FUWA 5IWAM 1K82A 2KZUA 4IBIA 3SFZA 5KPTA 1K3XA 1NJFA 5BPVA 2F5SA 1NNUC 1SXJC 2L09A 2R4JA 3A98B 3LVWA 3UMMA 5BR8M 4G4NA 3H4MA 1OFHA 1Z6TA 4DV3M 1WXQA 4X66M 3PNVA 3HJSA 4DV5M 3AOEC 4S12A 4PDIA 4LF5M 4GRIA 1E9RA 3GPXA 4LJ4A 4AW4A 4B7FA 5C1BA 4DR1M 3DOAA 3GLHA 2E5LM 4I8OA 1G8PA 1S3SA 2VIIA 2M5ZA 2X4AA 2V1UA 1XWIA 3U6SA 1VDDA 2LH0A 1NVMA 2LNHC 3ZCBB 4JI8M 3KSJA 4LRSA 2YFQA 4A3VB 4DUYM 3K1JA 3CF0A 5EXXA 4DV7M 4LF4M 3FYCA 5C18A 3SAWA 1EE8A 2P5TA 4FCWA 4FVMA 4NXMM 4M0WA 3U61A 2R4EA 3SYLA 1IN8A 4GH9A 4DR4M 4IBBA 2R45A 4B3RM 3KDSE 1KFVA 4OX9M 1JR3D 2KRKA 3DZDA 4R7GA 3SC3A 4OU7A 4L8RC 4GC9A 2XFTA 2XEPA 3KP0E 4IBGA 4B7HA 2CEAA 4LJAA 1XXHA 2CHGA 1IQPA 3SHFA 3LMMA 3U6PA 5A2QS 4M9XA 1N32M 2DWZB 4XGIA 2XLJA 3SYKA 4AQYM 1IBLM 1QAOA 4PT5A 4JI6M 3M6AA 1QANA 3HJQA 4KHPM 3K2LA 3JR5A 4LGYA 3FTDA 4IBDA 1E9SA 3RGPA 4QNMA 3JAMS 2W82A 1HNWM 4WURA 5FTLA 3I4YA 4AG6A 3HHYA 4B08A 4I4LA 1X37A 8CATA 2Z3XA 1E94E 4NSRA 5E6JA 4Z6YA 2DHRA 3KOYE 1I4WA 4IBCA 2DWMA 4DR7M 4IBKA 4NL4H 3L25A 2AHMA 1IN6A 4NSOB 4G6ZA 4QOSA 1ORYB 3HU2A 4L15A 5EP1A 1SXJD 5ITYA 1TH3A 3GO8A 4JN6A 4LF7M 3AFHA 5KQDA 2D7HA 1N36M 4G4OA 2XGNA 5FSWA 1KYIA 1Q39A 3J7BA 3AJIB 2OPFA 2V6ZM 2VQFM 2G5GX 2I7PA 4IBFA 1HQYE 4LZJA 3T15A 3A46A 4FCTA 1TDHA 3VKHA 3NWLA 4OVZA 1XHBA 1R6BX 3FUVA 3U61B 5KO3A 1HNZM 3U6LA 2DZOB 1Z5AA 4LFAM 2V1CA 3GPYA 4IIWA 1NSFA 3U6OA 3U60A 2C9OA 1N77A 1SXJB 3U6CA 2DVWB 4NRWA 3IG8A 3K8ZA 3W0FA 3T38A 2QCUA 3SATA 3GLFA 2QP9X 4I5SA 2X49A 5EP2A 1NY6A 4DV0M 3PFIA 4G4QA 4B3MM 4LZZA 1G41A 3EIHA 2RGHA 3UGJA 1NJGA 4LF9M 1L2DA 2K47A 3VFDA 4JYAM 3SAUA 3AKZA 4MGYE 4M9SA 2CV2A 3U5ZB 2KW0A 2QZ4A 3FD9A 4X62M 3DA1A 4JI0M 1YE9A 4GKJM 2EO2A 5IT9S 4YHHM 3TE6A 5ITXA 2C5RA 5DNYA 2LWXA 4GIPA 4WW0A 2A5YB 3SHGB 4FWGA 2LXEA 2F5NA 4K0KM 4PDGA 2XF3A 4GHLA 1PJJA 1H6UA 1C1KA 2RKOA 1N34M 1W5SA 3A42A 2KRUA 4IBEA 4LJ9A 1DGFA 4ITQA 1Z59A 2ZBKB 1IM2A 3KS8A 1DO0A 3GQ5A 1XNRM 1IY2A 3KOZE 2KZSA 4LG2A 2CHVA 3GLIB 4LY6A 4LJ6A 7CATA 3TQSA 5IREB 3GP1A 3ZH9B 3W0LB 3VK7A 3ILKA 3KS4A 4BLCA 4LGMA 1JQJC 4GKKM 4IJFA 4AG5A 5KPRA 2FOIC 3L2AA 2J7OA 1TDZA 4GHAA 3KXEC 3PXGA 4P16A 1R2YA 1TH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 M;  1R2Z A;  1J5E M;  1N33 M;  4DV4 M;  3TWK A;  1PJI A;  3OTO M;  4MB7 A;  5ITQ A;  4CIS A;  4LF8 M;  3GQ4 A;  3U6D A;  2F5O A;  4DV1 M;  4DV6 M;  5ITY A;  3U6Q A;  2EA0 A;  2UUC M;  3GO8 A;  4LF7 M;  1N36 M;  4G4O A;  1Q39 A;  5LMU M;  2OPF A;  3T1Y M;  2VQF M;  1XC8 A;  1Z5C A;  1NNJ A;  2UU9 M;  1HR0 M;  5IWA M;  1K82 A;  3A46 A;  5LMN M;  1TDH A;  4LF6 M;  1K3X A;  4PCZ A;  1I94 M;  1XMO M;  2UXD M;  4JI4 M;  3J81 S;  2F5S A;  3T1H M;  2F4V M;  1Q3C A;  5BR8 M;  1HNZ M;  2VQE M;  4G4N A;  3U6L A;  3TWL A;  2XZU A;  4DV3 M;  1Z5A A;  4PD2 A;  4LFA M;  4X66 M;  4DV5 M;  4LF5 M;  4PDI A;  3GPY A;  3U6O A;  3U6C A;  3GPX A;  2HHH M;  4NRW A;  4DR1 M;  2OQ4 A;  3DOA A;  4X65 M;  2E5L M;  3W0F A;  2F5Q A;  4JI1 M;  4G4R A;  1IBM M;  3SAT A;  5FLX S;  4DR5 M;  3U6M A;  2HKJ A;  4LFB M;  1L1Z A;  2ZM6 M;  5ITT A;  4DV0 M;  3U6S A;  4G4Q A;  1Q3B A;  4B3M M;  3GQ3 A;  4JI8 M;  4DUY M;  3JR4 A;  3TWM A;  4DV7 M;  2UUA M;  4JI5 M;  4NXN M;  4LF9 M;  1L2D A;  4LF4 M;  4JYA M;  3SAU A;  3SAW A;  1PM5 A;  1EE8 A;  4DR2 M;  1L1T A;  1MX0 A;  4DUZ M;  4JI2 M;  1L2B A;  4NXM M;  3SBJ A;  3VK8 A;  4DR4 M;  2UXB M;  5ITR A;  4X62 M;  4B3R M;  4B3S M;  4JI0 M;  1KFV A;  4OX9 M;  4GKJ M;  5IT9 S;  4YHH M;  5ITX A;  3J80 S;  4B3T M;  5ITX E;  2UUB M;  2UXC M;  1IBK M;  2F5N A;  4K0K M;  1K3W A;  4PDG A;  4JI7 M;  1Z5B A;  1PJJ A;  4YY3 M;  3U6P A;  2Q2E B;  5A2Q S;  3SAV A;  1N34 M;  1N32 M;  3U6E A;  3A42 A;  3GPP A;  4ITQ A;  3SAR A;  1FJG M;  2F5P A;  2ZBK B;  1Z59 A;  4AQY M;  1IBL M;  4JI6 M;  1MU5 A;  1XMQ M;  3GQ5 A;  1HNX M;  1XNR M;  4KHP M;  1L2C A;  5ITU A;  3JR5 A;  3SAS A;  4LFC M;  1XNQ M;  4X64 M;  4JV5 M;  2XZF A;  3GP1 A;  3JAM S;  3VK7 A;  4DR3 M;  1HNW M;  3J7A S;  3C58 A;  4GKK M;  4DR6 M;  4DV2 M;  1TDZ A;  4NRV A;  3A45 A;  4DR7 M;  1R2Y A;  3GPU A; 
#chains in the Genus database with same CATH topology
 5KQ8 A;  3VDP A;  4IJE A;  1WIV A;  2GNO A;  5DFL A;  1PJI A;  3HHW A;  1PRB A;  2H1R A;  3MK6 A;  4MB7 A;  1QQW A;  3AL0 C;  2J7N A;  3IG5 A;  3GLG A;  3VLF B;  4LF8 M;  3GQ4 A;  3U6D A;  1LTM A;  2JY7 A;  4DV1 M;  2CV1 A;  2R0I A;  2UUC M;  4LCB A;  3C3D A;  2DAE A;  2DAM A;  1QAQ A;  2LTU A;  3I04 M;  4GIT A;  2EUC A;  3GRR A;  3GRV A;  4OVZ B;  3L26 A;  1WGN A;  2GQF A;  1G59 A;  4GC5 A;  2OOA A;  1WHC A;  3KW6 A;  3L29 A;  1T3T A;  1F4I A;  4RNA A;  1QAM A;  1IXR C;  1QZM A;  3HU1 A;  3M7G A;  1GJS A;  2I7N A;  1DO2 A;  5FTK A;  1NHW C;  4D82 A;  3J81 S;  3HU3 A;  3GLF B;  1Q3C A;  2KEB A;  3KOW E;  2VQE M;  2NQ8 C;  4KT0 F;  5EXP A;  2C99 A;  3SMP A;  1JB0 F;  2Y0T A;  1FNN A;  2XH9 A;  3GRY A;  5F3W A;  3HJ8 A;  2KA6 B;  1XXH B;  4CJ6 A;  2VF7 A;  3LVV A;  2R44 A;  2OQ4 A;  5EXT A;  5IZ7 D;  1KSF X;  2XSZ D;  4X65 M;  2QSF X;  2F5Q A;  3CF6 E;  4G4R A;  5EQT A;  5FLX S;  4DR5 M;  2HKJ A;  4UN2 B;  3FTF A;  1TTE A;  1OIP A;  5ITT A;  1L8Q A;  4XBO A;  1IN5 A;  1Q3B A;  3FUU A;  3GQ3 A;  1IFY A;  4G3O A;  1HT1 E;  2YR0 A;  2QPA A;  4LJ7 A;  4AKI A;  2DKL A;  1A5T A;  4FCV A;  3JR4 A;  2Z4R A;  3GLG E;  4L16 A;  4NXN M;  4M0D A;  2DAG A;  1PM5 A;  3KVW A;  4DR2 M;  1MX0 A;  2JUJ A;  2APL A;  3B9P A;  4LRT A;  3D8L A;  1VDL A;  2CP8 A;  3DFZ A;  3FE3 A;  4B3S M;  4CGY B;  2BNK A;  4LJ5 A;  1IY1 A;  4B3T M;  4Y28 F;  2Y0Q A;  4MH0 E;  3QWL A;  2UXC M;  2CFO A;  1G71 A;  4FWH A;  2HL7 A;  2MH8 A;  1Z5B A;  1ZQ9 A;  5EXS A;  3U5Z A;  2EKF A;  3AOG A;  3GPP A;  4REZ A;  1AIP C;  2K9D A;  2DZN B;  1SXJ E;  4D81 A;  2F5P A;  1OKS A;  5DYI A;  2VF8 A;  4BB9 A;  2RGO A;  4II7 A;  1HNX M;  2M60 A;  4AKG A;  2B3T A;  4OW0 A;  1AUA A;  2R65 A;  3HWS A;  1L2C A;  2JZ0 A;  3SAS A;  4LFC M;  1XNQ M;  3V76 A;  2DXI A;  2FE8 A;  3ZC7 B;  3RFW A;  1ZV1 A;  2L7H A;  3J7A S;  2DAK A;  4KLN A;  3RGS A;  3QAU A;  3C58 A;  3K9O A;  4NC6 A;  3SMS A;  2QBY B;  4MGI E;  3K92 A;  4DV2 M;  1J09 A;  1R7R A;  1G4A E;  3A45 A;  3I51 A;  3HHZ A;  3PNY A;  2QBY A;  3GPU A;  3M0E A;  4JI3 M;  2Y20 A;  3U60 B;  5L8R F;  1R2Z A;  1GL7 A;  4DV4 M;  2C98 A;  2CRU A;  3OTO M;  3FRH A;  2C9C A;  4AKH A;  4CIS A;  2N35 A;  5JI3 E;  2Y21 A;  4MGK E;  2KDL A;  2LVP C;  2F5O A;  1T6O A;  3J27 B;  2EA0 A;  3GLH B;  3D8B A;  3TPZ A;  3HKP A;  1ZMW A;  3I4V A;  2FH0 A;  3KSX A;  3VDU A;  5KPZ A;  3UZU A;  1D2N A;  1TH4 A;  4RKU F;  1N78 A;  2X8A A;  2H5X A;  4HL4 A;  2CWB A;  4Z8X A;  3T1Y M;  3FKE A;  1Z5C A;  4ANR A;  3AV0 A;  2WZJ A;  2UU9 M;  1OFI A;  2XFS A;  3AOE A;  1HR0 M;  1Y8G A;  4QOZ C;  4KO8 A;  2CV0 A;  5LMN M;  4LF6 M;  2EJS A;  4PCZ A;  3ZQJ A;  1I94 M;  5FTM A;  3PVS A;  1XMO M;  2UXD M;  4JI4 M;  5FTN A;  4R71 A;  1IN7 A;  2DWN A;  4HEO A;  3T1H M;  2JY6 B;  1DGB A;  2F4V M;  3EIE A;  1LV7 A;  3RE8 A;  2XZU A;  3TWL A;  4R3D A;  4RF0 A;  2QEN A;  5E26 A;  2KNV A;  4PD2 A;  4TUW A;  2ERC A;  1GLN A;  4D80 A;  3T6P A;  3E9S A;  5JI2 E;  2C96 A;  4LJ8 A;  3HHX A;  3KP1 E;  2O25 A;  4WP2 A;  2HHH M;  1IXZ A;  2L4E A;  4XK8 F;  1OQY A;  3IEC A;  4JI1 M;  1EFU B;  1QZE A;  3KFU G;  2R62 A;  3GLI E;  2ZAN A;  1IBM M;  1ZAE A;  2LHG A;  3WHL A;  4BBA A;  3U6M A;  4LFB M;  1HJP A;  2FS1 A;  1L1Z A;  2ZM6 M;  1GVN A;  1YSY A;  2QQ8 A;  3CGW A;  3FTE A;  4L4U A;  2R18 A;  3QYB A;  4JXJ A;  1HQC A;  3THG A;  3GLG B;  2Z7J A;  4AZF A;  2G8L A;  3TWM A;  1N75 A;  2UUA M;  4QHT A;  2Z4S A;  4JI5 M;  3LQQ A;  1OIZ A;  3L27 A;  2FNA A;  1PJQ A;  4RF1 A;  5EP4 A;  1L1T A;  3GRU A;  2YQZ A;  4DUZ M;  4JI2 M;  4B7G A;  1L2B A;  3HGI A;  3SBJ A;  2XSZ A;  3HY5 A;  3VK8 A;  2UXB M;  1WGL A;  3CTW B;  3UK6 A;  4EIW A;  2CHQ A;  3MHV C;  5ITR A;  2D7E A;  3Q8X A;  1IN4 A;  1XB2 B;  3J80 S;  5ITX E;  5H37 D;  2UUB M;  2CE7 A;  2WSC F;  2ZTD A;  2LVN C;  1IBK M;  4IBJ A;  3R8F A;  1K3W A;  4JI7 M;  1QYR A;  4L78 A;  2BJW A;  2BJV A;  2CUZ A;  4YY3 M;  2Q2E B;  1GJT A;  4NOO B;  3SAV A;  3U6E A;  1J7K A;  4FD2 A;  3CF2 A;  4KOD A;  5EP3 A;  3SAR A;  1FJG M;  2HAK A;  4QNR A;  2HCB A;  3FUX A;  1MU5 A;  1XMQ M;  4MGH A;  1JR3 A;  1G3I A;  3K9P A;  1DGH A;  3J2P B;  5ITU A;  3FTC A;  3MJ5 A;  4X64 M;  3E4R A;  4JV5 M;  4AI6 A;  3NBI A;  2K6B A;  2XZF A;  1GL6 A;  4DR3 M;  1DGH B;  1PJS A;  3LQR A;  1D0K A;  2FFJ A;  4CIZ A;  4P16 A;  1JR3 E;  3WHK A;  4DR6 M;  4ZPX A;  4F1I A;  3GLI A;  4NRV A;  3TL4 X;  5FTJ A;  4W5W A;  5EJC A;  3L28 A;  1GKI A;  4HLQ A;  1NV8 A;  1R5L A;  3UJN A;  1QVR A;  1J5E M;  2KNZ A;  3FYD A;  3TWK A;  1N33 M;  1TGU A;  1IXS B;  1W5T A;  1IY0 A;  2D7G A;  2DZL A;  1QDR A;  5ITQ A;  4I81 A;  2JZ1 A;  2ZAM A;  4MM3 B;  4DBG B;  5GKN A;  4QHS A;  1MN3 A;  1UM8 A;  1VEG A;  4MGZ E;  4DV6 M;  4FWD A;  3U6Q A;  1DGG A;  2R46 A;  3FUT A;  4FW9 A;  1IXS A;  2MR9 A;  3VKG A;  2ZAO A;  2YNM D;  2DWL A;  1OJL A;  1NY5 A;  1YUB A;  2JA2 A;  1OAI A;  3KOX E;  4GMQ A;  2MRO B;  3C9P A;  5LMU M;  4CHT B;  1E32 A;  2L6O A;  4M9Z A;  1SXJ A;  1XC8 A;  1NHG C;  3BOS A;  2O5R A;  2L7I A;  1NNJ A;  2KXE A;  5DYG A;  3R9X B;  1HT2 E;  3FUW A;  1T43 A;  5IWA M;  1K82 A;  2KZU A;  4IBI A;  3SFZ A;  2JXN A;  5KPT A;  1K3X A;  2Z8Y M;  1C7Y A;  2KNA A;  1NJF A;  5BPV A;  2F5S A;  1NNU C;  1SXJ C;  2L09 A;  2R4J A;  3LCU A;  3A98 B;  3LVW A;  3UMM A;  5BR8 M;  4G4N A;  3H4M A;  1OFH A;  3F92 A;  1Z6T A;  4DV3 M;  1WXQ A;  4X66 M;  3PNV A;  3HJS A;  1XXH E;  3AOE C;  3FRI A;  4S12 A;  4PDI A;  4DV5 M;  4LF5 M;  1EIJ A;  4GRI A;  3QYE A;  1E9R A;  3GPX A;  4LJ4 A;  4AW4 A;  4B7F A;  5C1B A;  4DR1 M;  2EKK A;  2L4F A;  3DOA A;  3GLH A;  2E5L M;  4I8O A;  1G8P A;  1S3S A;  2VII A;  2M5Z A;  2X4A A;  2V1U A;  2LBC A;  3W67 A;  1XWI A;  3U6S A;  1VDD A;  2LH0 A;  1NVM A;  2LNH C;  3ZCB B;  4JI8 M;  3KSJ A;  1QUT A;  2YFQ A;  4LRS A;  4A3V B;  4DUY M;  2BWE A;  3K1J A;  1YLA A;  2DI0 A;  3CF0 A;  3I01 M;  5EXX A;  4DV7 M;  3MMP A;  4LF4 M;  3FYC A;  5C18 A;  3SAW A;  2DHY A;  3HZJ A;  1EE8 A;  2P5T A;  2K0B X;  2LHC A;  4FCW A;  4FVM A;  1VQ1 A;  4NXM M;  4M0W A;  1GAB A;  3U61 A;  2R4E A;  3SYL A;  1IN8 A;  4GH9 A;  4DR4 M;  4IBB A;  2R45 A;  4B3R M;  3KDS E;  1KFV A;  4OX9 M;  1JR3 D;  2KRK A;  1PJT A;  3DZD A;  4R7G A;  1SG9 A;  1ZMU A;  3SC3 A;  4OU7 A;  1QDT A;  4GC9 A;  4L8R C;  2XFT A;  1V33 A;  2XEP A;  3KP0 E;  4IBG A;  4B7H A;  2CEA A;  1WJ7 A;  4LJA A;  1R4G A;  1XXH A;  2CHG A;  3E46 A;  1IQP A;  3SHF A;  2L2D A;  3LMM A;  3U6P A;  5A2Q S;  2R6F A;  4M9X A;  1N32 M;  2DWZ B;  4XGI A;  2XLJ A;  2DNA A;  3SYK A;  4AQY M;  1IBL M;  1QAO A;  3E21 A;  4PT5 A;  4JI6 M;  2G3Q A;  3M6A A;  1WR1 B;  1QAN A;  3HJQ A;  4KHP M;  3K2L A;  3BXW A;  3JR5 A;  3B7Q A;  3FTD A;  4IBD A;  4LGY A;  1E9S A;  1GO5 A;  3RGP A;  4QNM A;  3JAM S;  2W82 A;  1HNW M;  4WUR A;  2OO9 A;  3I4Y A;  5FTL A;  4GEW A;  4AG6 A;  3HHY A;  4B08 A;  4I4L A;  1X37 A;  2J5Y A;  8CAT A;  2Z3X A;  1E94 E;  4NSR A;  5E6J A;  4Z6Y A;  2DHR A;  3KOY E;  1I4W A;  4IBC A;  2DWM A;  4DR7 M;  4IBK A;  4NL4 H;  3L25 A;  2AHM A;  1IN6 A;  4NSO B;  1UFZ A;  4G6Z A;  4QOS A;  1DV0 A;  1ORY B;  2JP7 A;  3HU2 A;  4L15 A;  2JY8 A;  3C3E A;  4L6V 6;  5EP1 A;  2MJ5 B;  1SXJ D;  5ITY A;  1TH3 A;  1TR8 A;  3GO8 A;  4JN6 A;  3W68 A;  4LF7 M;  1OTR A;  1D0L A;  3AFH A;  5KQD A;  2D7H A;  1N36 M;  3HX3 A;  4G4O A;  4F2L A;  2XGN A;  3IHP A;  5FSW A;  1KYI A;  1Q39 A;  3J7B A;  3AJI B;  2OPF A;  2V6Z M;  2VQF M;  2G5G X;  2I7P A;  4IBF A;  1HQY E;  4LZJ A;  3T15 A;  3A46 A;  4FCT A;  1TDH A;  3VKH A;  1ZMV A;  3NWL A;  4OVZ A;  2O01 F;  1XHB A;  1RU3 A;  1R6B X;  3FUV A;  3U61 B;  5KO3 A;  2ZTC A;  2WSF F;  1HNZ M;  3U6L A;  2LVA A;  2DZO B;  3Q8G A;  3GLF E;  1Z5A A;  4LFA M;  1CUK A;  2V1C A;  3GPY A;  1PGY A;  1NSF A;  4IIW A;  3U6O A;  2C9O A;  3U60 A;  1N77 A;  1SXJ B;  3U6C A;  2DVW B;  4NRW A;  3IG8 A;  3K8Z A;  1BVS A;  3W0F A;  3T38 A;  2QCU A;  1QUS A;  3SAT A;  3GLF A;  2QP9 X;  4I5S A;  2JNH A;  2X49 A;  3NBX X;  1NY6 A;  5EP2 A;  4DV0 M;  3PFI A;  4G4Q A;  4B3M M;  4LZZ A;  2BWB A;  1G41 A;  3B7N A;  3B7Z A;  3EIH A;  3GLH E;  2QHO B;  2RRU A;  1Q02 A;  2RGH A;  3LW5 F;  1D0M A;  3UGJ A;  1NJG A;  3BBZ A;  3H4J A;  4LF9 M;  2VDB B;  1L2D A;  2K47 A;  3VFD A;  4JYA M;  1VEK A;  3SAU A;  3AKZ A;  2OOB A;  1VG5 A;  2WSE F;  1MJG M;  4MGY E;  3B89 A;  4M9S A;  2CV2 A;  3U5Z B;  2KW0 A;  2QZ4 A;  2MGW A;  1OAO C;  3FD9 A;  1NV9 A;  4X62 M;  3DA1 A;  4JI0 M;  1YE9 A;  4GKJ M;  2DEN A;  2EO2 A;  5IT9 S;  4YHH M;  1NO1 A;  3TE6 A;  4P17 A;  5ITX A;  2C5R A;  5DNY A;  2LWX A;  4GIP A;  4WW0 A;  2A5Y B;  3SHG B;  2JY5 A;  4FWG A;  2LXE A;  2F5N A;  4K0K M;  4PDG A;  2XF3 A;  1V92 A;  4GHL A;  1PJJ A;  3B74 A;  1H6U A;  1C1K A;  2RKO A;  2QNJ A;  1VEJ A;  1N34 M;  1W5S A;  1V34 A;  2LVQ D;  2KRU A;  3A42 A;  4IBE A;  1DGF A;  4LJ9 A;  4ITQ A;  1Z59 A;  2ZBK B;  1IM2 A;  3KS8 A;  2LVO C;  1DO0 A;  3GQ5 A;  1XNR M;  1IY2 A;  3KOZ E;  2KZS A;  4LG2 A;  2CHV A;  3GLI B;  4LY6 A;  4LJ6 A;  7CAT A;  3TQS A;  5IRE B;  3GP1 A;  2DAI A;  3ZH9 B;  3W0L B;  3VK7 A;  4Q7J A;  3ILK A;  3KS4 A;  4BLC A;  4LGM A;  1JQJ C;  1TF0 B;  4IJF A;  4AG5 A;  5KPR A;  4GKK M;  2FOI C;  2JWS A;  3L2A A;  3LCV B;  2J7O A;  1P3Q Q;  1TDZ A;  4GHA A;  3KXE C;  3PXG A;  2KHH A;  2HWJ A;  1R2Y A;  1TH2 A; 
#chains in the Genus database with same CATH homology
 5KQ8 A;  3VDP A;  4IJE A;  1PJI A;  3HHW A;  2H1R A;  3MK6 A;  4MB7 A;  1QQW A;  3AL0 C;  2J7N A;  3IG5 A;  3GLG A;  3VLF B;  4LF8 M;  3GQ4 A;  3U6D A;  4DV1 M;  2CV1 A;  2UUC M;  4LCB A;  4OVZ B;  1QAQ A;  4GIT A;  3L26 A;  2EUC A;  3GRR A;  3GRV A;  1G59 A;  4GC5 A;  3L29 A;  3KW6 A;  1T3T A;  4RNA A;  1QAM A;  1IXR C;  1QZM A;  3HU1 A;  3M7G A;  2I7N A;  1DO2 A;  5FTK A;  1NHW C;  4D82 A;  3J81 S;  3HU3 A;  3GLF B;  1Q3C A;  2KEB A;  3KOW E;  2VQE M;  2NQ8 C;  3SMP A;  5EXP A;  2C99 A;  2Y0T A;  1FNN A;  2XH9 A;  3GRY A;  5F3W A;  3HJ8 A;  2KA6 B;  1XXH B;  3LVV A;  2OQ4 A;  5EXT A;  5IZ7 D;  1KSF X;  2XSZ D;  4X65 M;  2F5Q A;  3CF6 E;  4G4R A;  5EQT A;  5FLX S;  4DR5 M;  2HKJ A;  3FTF A;  5ITT A;  1L8Q A;  4XBO A;  1IN5 A;  1Q3B A;  3FUU A;  3GQ3 A;  1HT1 E;  2YR0 A;  2QPA A;  4LJ7 A;  4AKI A;  3JR4 A;  4FCV A;  2Z4R A;  4L16 A;  4NXN M;  4M0D A;  1PM5 A;  3KVW A;  4DR2 M;  1MX0 A;  3B9P A;  4LRT A;  3D8L A;  3DFZ A;  4B3S M;  4CGY B;  2BNK A;  4LJ5 A;  1IY1 A;  4B3T M;  2Y0Q A;  4MH0 E;  3QWL A;  2UXC M;  2CFO A;  4FWH A;  2HL7 A;  1ZQ9 A;  1Z5B A;  5EXS A;  3U5Z A;  3AOG A;  3GPP A;  4REZ A;  4D81 A;  2DZN B;  1SXJ E;  2F5P A;  5DYI A;  4BB9 A;  2RGO A;  4II7 A;  1HNX M;  2M60 A;  4AKG A;  4OW0 A;  2R65 A;  3HWS A;  1L2C A;  3SAS A;  4LFC M;  1XNQ M;  2DXI A;  2FE8 A;  3ZC7 B;  3RFW A;  2L7H A;  3J7A S;  3RGS A;  4KLN A;  3QAU A;  3C58 A;  3SMS A;  2QBY B;  4MGI E;  3K92 A;  4DV2 M;  1J09 A;  1R7R A;  1G4A E;  3A45 A;  3I51 A;  3HHZ A;  3PNY A;  2QBY A;  3GPU A;  3M0E A;  4JI3 M;  2Y20 A;  3U60 B;  1R2Z A;  1GL7 A;  4DV4 M;  2C98 A;  3OTO M;  2C9C A;  4AKH A;  4CIS A;  5JI3 E;  2Y21 A;  4MGK E;  2F5O A;  3J27 B;  2EA0 A;  3GLH B;  3D8B A;  3TPZ A;  3HKP A;  3I4V A;  3KSX A;  3VDU A;  5KPZ A;  3UZU A;  1D2N A;  1TH4 A;  1N78 A;  2X8A A;  4HL4 A;  4Z8X A;  3T1Y M;  3FKE A;  1Z5C A;  3AV0 A;  2UU9 M;  1OFI A;  2XFS A;  3AOE A;  1HR0 M;  4QOZ C;  4KO8 A;  2CV0 A;  5LMN M;  4LF6 M;  4PCZ A;  1I94 M;  5FTM A;  3PVS A;  1XMO M;  2UXD M;  4JI4 M;  5FTN A;  1IN7 A;  2DWN A;  3T1H M;  2F4V M;  1DGB A;  3EIE A;  1LV7 A;  3RE8 A;  2XZU A;  3TWL A;  4R3D A;  4RF0 A;  2QEN A;  5E26 A;  4PD2 A;  4TUW A;  2ERC A;  1GLN A;  4D80 A;  5JI2 E;  3E9S A;  2C96 A;  4LJ8 A;  3HHX A;  3KP1 E;  2HHH M;  1IXZ A;  4JI1 M;  3KFU G;  2R62 A;  1IBM M;  2ZAN A;  1ZAE A;  3WHL A;  4BBA A;  3U6M A;  4LFB M;  1L1Z A;  2ZM6 M;  1GVN A;  1YSY A;  3FTE A;  4L4U A;  2R18 A;  4JXJ A;  1HQC A;  3THG A;  3GLG B;  2Z7J A;  4AZF A;  2G8L A;  3TWM A;  1N75 A;  2UUA M;  4QHT A;  2Z4S A;  4JI5 M;  3LQQ A;  3L27 A;  2FNA A;  4RF1 A;  5EP4 A;  1L1T A;  3GRU A;  2YQZ A;  4DUZ M;  4JI2 M;  4B7G A;  1L2B A;  3HGI A;  3SBJ A;  2XSZ A;  3VK8 A;  2UXB M;  3CTW B;  3UK6 A;  4EIW A;  5ITR A;  2CHQ A;  3MHV C;  2D7E A;  3Q8X A;  1IN4 A;  3J80 S;  5ITX E;  5H37 D;  2UUB M;  2CE7 A;  1IBK M;  4IBJ A;  3R8F A;  1K3W A;  4JI7 M;  1QYR A;  4L78 A;  2BJW A;  2BJV A;  2CUZ A;  4YY3 M;  2Q2E B;  4NOO B;  3SAV A;  3U6E A;  1J7K A;  4FD2 A;  3CF2 A;  4KOD A;  5EP3 A;  3SAR A;  1FJG M;  4QNR A;  2HCB A;  3FUX A;  1MU5 A;  1XMQ M;  4MGH A;  1JR3 A;  1G3I A;  1DGH A;  3J2P B;  5ITU A;  3FTC A;  3MJ5 A;  4X64 M;  3E4R A;  4JV5 M;  4AI6 A;  3NBI A;  2XZF A;  1GL6 A;  4DR3 M;  1DGH B;  3LQR A;  2FFJ A;  3WHK A;  4DR6 M;  4ZPX A;  3GLI A;  4NRV A;  3TL4 X;  5FTJ A;  4W5W A;  5EJC A;  3L28 A;  1GKI A;  4HLQ A;  3UJN A;  1QVR A;  1J5E M;  1N33 M;  3FYD A;  3TWK A;  1TGU A;  1IXS B;  1W5T A;  1IY0 A;  2D7G A;  5ITQ A;  4I81 A;  2ZAM A;  4MM3 B;  5GKN A;  4QHS A;  1UM8 A;  4MGZ E;  4DV6 M;  4FWD A;  3U6Q A;  1DGG A;  2R46 A;  3FUT A;  4FW9 A;  3VKG A;  2ZAO A;  2YNM D;  2DWL A;  1OJL A;  1NY5 A;  1YUB A;  2JA2 A;  5LMU M;  3KOX E;  4GMQ A;  4CHT B;  1E32 A;  2L6O A;  4M9Z A;  1SXJ A;  1XC8 A;  1NHG C;  3BOS A;  2O5R A;  2L7I A;  1NNJ A;  2KXE A;  5DYG A;  3R9X B;  1HT2 E;  3FUW A;  5IWA M;  1K82 A;  2KZU A;  4IBI A;  3SFZ A;  5KPT A;  1K3X A;  1NJF A;  5BPV A;  2F5S A;  1NNU C;  1SXJ C;  2L09 A;  2R4J A;  3A98 B;  3LVW A;  3UMM A;  5BR8 M;  4G4N A;  3H4M A;  1OFH A;  1Z6T A;  4DV3 M;  1WXQ A;  4X66 M;  3PNV A;  3HJS A;  4DV5 M;  3AOE C;  4S12 A;  4PDI A;  4LF5 M;  4GRI A;  1E9R A;  3GPX A;  4LJ4 A;  4AW4 A;  4B7F A;  5C1B A;  4DR1 M;  3DOA A;  3GLH A;  2E5L M;  4I8O A;  1G8P A;  1S3S A;  2VII A;  2M5Z A;  2X4A A;  2V1U A;  1XWI A;  3U6S A;  1VDD A;  2LH0 A;  1NVM A;  2LNH C;  3ZCB B;  4JI8 M;  3KSJ A;  4LRS A;  2YFQ A;  4A3V B;  4DUY M;  3K1J A;  3CF0 A;  5EXX A;  4DV7 M;  4LF4 M;  3FYC A;  5C18 A;  3SAW A;  1EE8 A;  2P5T A;  4FCW A;  4FVM A;  4NXM M;  4M0W A;  3U61 A;  2R4E A;  3SYL A;  1IN8 A;  4GH9 A;  4DR4 M;  4IBB A;  2R45 A;  4B3R M;  3KDS E;  1KFV A;  4OX9 M;  1JR3 D;  2KRK A;  3DZD A;  4R7G A;  3SC3 A;  4OU7 A;  4L8R C;  4GC9 A;  2XFT A;  2XEP A;  3KP0 E;  4IBG A;  4B7H A;  2CEA A;  4LJA A;  1XXH A;  2CHG A;  1IQP A;  3SHF A;  3LMM A;  3U6P A;  5A2Q S;  4M9X A;  1N32 M;  2DWZ B;  4XGI A;  2XLJ A;  3SYK A;  4AQY M;  1IBL M;  1QAO A;  4PT5 A;  4JI6 M;  3M6A A;  1QAN A;  3HJQ A;  4KHP M;  3K2L A;  3JR5 A;  4LGY A;  3FTD A;  4IBD A;  1E9S A;  3RGP A;  4QNM A;  3JAM S;  2W82 A;  1HNW M;  4WUR A;  5FTL A;  3I4Y A;  4AG6 A;  3HHY A;  4B08 A;  4I4L A;  1X37 A;  8CAT A;  2Z3X A;  1E94 E;  4NSR A;  5E6J A;  4Z6Y A;  2DHR A;  3KOY E;  1I4W A;  4IBC A;  2DWM A;  4DR7 M;  4IBK A;  4NL4 H;  3L25 A;  2AHM A;  1IN6 A;  4NSO B;  4G6Z A;  4QOS A;  1ORY B;  3HU2 A;  4L15 A;  5EP1 A;  1SXJ D;  5ITY A;  1TH3 A;  3GO8 A;  4JN6 A;  4LF7 M;  3AFH A;  5KQD A;  2D7H A;  1N36 M;  4G4O A;  2XGN A;  5FSW A;  1KYI A;  1Q39 A;  3J7B A;  3AJI B;  2OPF A;  2V6Z M;  2VQF M;  2G5G X;  2I7P A;  4IBF A;  1HQY E;  4LZJ A;  3T15 A;  3A46 A;  4FCT A;  1TDH A;  3VKH A;  3NWL A;  4OVZ A;  1XHB A;  1R6B X;  3FUV A;  3U61 B;  5KO3 A;  1HNZ M;  3U6L A;  2DZO B;  1Z5A A;  4LFA M;  2V1C A;  3GPY A;  4IIW A;  1NSF A;  3U6O A;  3U60 A;  2C9O A;  1N77 A;  1SXJ B;  3U6C A;  2DVW B;  4NRW A;  3IG8 A;  3K8Z A;  3W0F A;  3T38 A;  2QCU A;  3SAT A;  3GLF A;  2QP9 X;  4I5S A;  2X49 A;  5EP2 A;  1NY6 A;  4DV0 M;  3PFI A;  4G4Q A;  4B3M M;  4LZZ A;  1G41 A;  3EIH A;  2RGH A;  3UGJ A;  1NJG A;  4LF9 M;  1L2D A;  2K47 A;  3VFD A;  4JYA M;  3SAU A;  3AKZ A;  4MGY E;  4M9S A;  2CV2 A;  3U5Z B;  2KW0 A;  2QZ4 A;  3FD9 A;  4X62 M;  3DA1 A;  4JI0 M;  1YE9 A;  4GKJ M;  2EO2 A;  5IT9 S;  4YHH M;  3TE6 A;  5ITX A;  2C5R A;  5DNY A;  2LWX A;  4GIP A;  4WW0 A;  2A5Y B;  3SHG B;  4FWG A;  2LXE A;  2F5N A;  4K0K M;  4PDG A;  2XF3 A;  4GHL A;  1PJJ A;  1H6U A;  1C1K A;  2RKO A;  1N34 M;  1W5S A;  3A42 A;  2KRU A;  4IBE A;  4LJ9 A;  1DGF A;  4ITQ A;  1Z59 A;  2ZBK B;  1IM2 A;  3KS8 A;  1DO0 A;  3GQ5 A;  1XNR M;  1IY2 A;  3KOZ E;  2KZS A;  4LG2 A;  2CHV A;  3GLI B;  4LY6 A;  4LJ6 A;  7CAT A;  3TQS A;  5IRE B;  3GP1 A;  3ZH9 B;  3W0L B;  3VK7 A;  3ILK A;  3KS4 A;  4BLC A;  4LGM A;  1JQJ C;  4GKK M;  4IJF A;  4AG5 A;  5KPR A;  2FOI C;  3L2A A;  2J7O A;  1TDZ A;  4GHA A;  3KXE C;  3PXG A;  4P16 A;  1R2Y A;  1TH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...