4DV0M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title A structural basis for streptomycin resistance
rcsb
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv0M02
3GQ4A 2UUBM 4NRWA 3SAWA 4DV4M 3SATA 4JI8M 4LF8M 4PDIA 3SAVA 4DR7M 3TWLA 4YHHM 1XMOM 5IWAM 4X66M 3GPYA 3U6CA 3SASA 1N34M 1N33M 4JI0M 4B3TM 2VQEM 2EA0A 4AQYM 1K3WA 2Q2EB 1L2DA 1HNZM 4LF9M 1K3XA 3U6LA 1L1TA 4OX9M 3U6MA 1XC8A 5ITXE 4JI2M 1NNJA 1Z5BA 2F5SA 4LFCM 3VK8A 1MX0A 2UUAM 5ITQA 4LF6M 3SBJA 3T1HM 1I94M 3A46A 4DUYM 1N36M 2F4VM 4B3RM 4DR4M 4CISA 3GPUA 4GKJM 5FLXS 3GQ5A 4B3SM 1PJIA 5BR8M 2UXBM 2VQFM 3SARA 2UXDM 1PJJA 4LFBM 4NXNM 4G4OA 3VK7A 1HNXM 4X62M 1HNWM 2HHHM 4DR1M 1XNRM 3GPXA 3JAMS 3GQ3A 3U6QA 3JR4A 4LF4M 2HKJA 2F5QA 4LFAM 4DR6M 1IBKM 4PDGA 1Z5AA 3TWMA 2UU9M 3DOAA 1PM5A 4DR5M 2XZUA 1IBLM 3U6EA 1L1ZA 4JYAM 4JV5M 3GO8A 3U6OA 3T1YM 2F5NA 3W0FA 2F5PA 4B3MM 4K0KM 4KHPM 4DR2M 3U6DA 4DV0M 4DR3M 1TDHA 1R2YA 4JI3M 4X65M 4LF7M 2OQ4A 4G4QA 1Q39A 3A45A 1Q3CA 4ITQA 4JI1M 5ITUA 4DV7M 1HR0M 4PD2A 4JI6M 2OPFA 5ITYA 3J81S 4DV2M 4DV5M 4X64M 4JI7M 1Z59A 4JI5M 1XNQM 3GPPA 2UXCM 4DUZM 5IT9S 3J7AS 4LF5M 1Z5CA 2F5OA 1L2CA 4DV3M 2ZBKB 3U6PA 4NRVA 5ITXA 3GP1A 4GKKM 2E5LM 1KFVA 4DV1M 1N32M 3TWKA 5ITRA 1Q3BA 2ZM6M 4PCZA 5LMNM 3OTOM 4JI4M 3SAUA 2UUCM 1FJGM 5A2QS 4DV6M 1J5EM 2XZFA 3JR5A 1L2BA 5ITTA 1MU5A 1XMQM 1K82A 4MB7A 5LMUM 4G4NA 1TDZA 1EE8A 4NXMM 3A42A 3U6SA 3J80S 1IBMM 1R2ZA 4YY3M 4G4RA 3C58A
chains in the Genus database with same CATH superfamily
3GLGE 3GQ4A 3E21A 3FE3A 3M7GA 1G59A 4KT0F 4AKIA 3IHPA 2P5TA 3PVSA 4D81A 2XLJA 4LF8M 1F4IA 4JI8M 2ZAMA 4F1IA 5H37D 2DVWB 2X8AA 1NVMA 3NBXX 2DWMA 4ZPXA 1XMOM 2FFJA 1P3QQ 5C1BA 3GPYA 4QNMA 2BWEA 3FTFA 4S12A 1YE9A 3HX3A 3SYLA 1W5SA 2Q2EB 3E46A 3HHWA 3PFIA 4OU7A 1SXJA 1JR3E 1D0KA 2M60A 4IBCA 2DHYA 3LCVB 4LGYA 1K3XA 1N78A 2XH9A 4M9XA 2JUJA 4OX9M 1HJPA 2CFOA 2DAIA 4WW0A 1XB2B 1PJSA 4I8OA 2LXEA 5ITXE 2R62A 2H5XA 4LJ5A 1Z5BA 2DZNB 4L78A 2RRUA 5FTLA 3VK8A 4LFCM 1IN7A 4LF6M 5EXSA 3HU1A 3SBJA 1N75A 3HU3A 1LV7A 2QZ4A 1T6OA 4L6V6 1NNUC 1IY0A 4CISA 4L8RC 1QZEA 4GKJM 2K47A 3K9OA 5EXXA 2N35A 1QANA 2XGNA 1D0LA 3PNYA 4M0WA 2UXDM 2L4EA 3LCUA 4RNAA 1OFIA 1R7RA 4G4OA 3VK7A 3DA1A 1HNWM 3UMMA 2DZLA 5BPVA 1G4AE 2DAMA 4B7HA 3GQ3A 4Z6YA 4LF4M 2HKJA 2F5QA 1Z5AA 4XK8F 3F92A 5GKNA 3L28A 2XZUA 4G3OA 2YFQA 4JYAM 3KP0E 3U60A 2LNHC 4JV5M 3GO8A 4B3MM 2EKFA 4CHTB 3W0FA 3T1YM 2R4JA 3FUXA 3K9PA 4DR2M 3H4MA 3KDSE 2FE8A 8CATA 3U6DA 1R4GA 1IXZA 1JR3D 2OQ4A 4HLQA 1Q39A 4JI1M 4I5SA 2L7IA 4IJEA 2EO2A 2G3QA 2L7HA 1T3TA 3B89A 4PD2A 3DFZA 5ITYA 1OJLA 4FWHA 4X64M 3U60B 1DO0A 1NHGC 4IBKA 3MJ5A 3PXGA 3HZJA 4PT5A 1CUKA 2OOBA 3J7AS 1L2CA 3E4RA 4IBGA 3U6PA 1E9SA 5DYGA 1DV0A 4CIZA 3KOYE 2QSFX 1GKIA 4GKKM 4CJ6A 3QWLA 1WGLA 2E5LM 4XGIA 5E6JA 3VLFB 1N32M 3BBZA 3HJQA 3W0LB 2LH0A 4PCZA 1IQPA 5EQTA 2R45A 2DZOB 1PGYA 1QQWA 3SAUA 4M9SA 1HQYE 5A2QS 4DV6M 3C3EA 2DAEA 1VDLA 3SHFA 2A5YB 1K82A 4MB7A 5LMUM 2C5RA 4B7FA 3Q8GA 5KO3A 4OW0A 1VEKA 4NXMM 3J80S 2XFTA 3AFHA 1WXQA 4G4RA 4IBEA 3V76A 2EJSA 4LRSA 3C58A 1IN4A 4EIWA 1JQJC 2Y21A 3CF6E 2CUZA 1DO2A 3SAWA 4DV4M 2J7OA 4P17A 2R46A 2C9CA 4PDIA 3W68A 3KVWA 4JXJA 4OVZA 2D7HA 2KZUA 5DFLA 3NWLA 2H1RA 5IWAM 3SASA 2G8LA 1N34M 2L6OA 4FWDA 2EA0A 1IXRC 4MGHA 2DHRA 3K92A 1DGFA 2KDLA 4FVMA 4GIPA 4GHAA 2X4AA 1QUTA 3K8ZA 4IIWA 3T38A 2KHHA 1L2DA 5IREB 7CATA 2FH0A 5EXTA 1UM8A 3B9PA 3U6LA 2C96A 3VDUA 4D80A 3HHYA 3FUTA 4MGIE 3U6MA 1C1KA 2NQ8C 2V1CA 3GLFA 1XC8A 5KQDA 2FNAA 1NHWC 5FSWA 3VDPA 4Z8XA 3EIHA 3FTDA 3LVWA 4Q7JA 4DUYM 2F4VM 1WGNA 2MROB 3H4JA 3RGPA 4LCBA 4LJAA 4MGKE 3IG5A 2LVQD 3LW5F 4RKUF 2JY5A 1PJIA 2JXNA 3FD9A 3LVVA 4GEWA 3SHGB 3VFDA 3GRRA 1PJJA 2JA2A 5DNYA 1SXJE 2HHHM 4DR1M 1XNRM 3I4YA 3JAMS 2B3TA 1TF0B 3FTCA 3A98B 4LG2A 2QQ8A 4DR6M 3FUVA 3AV0A 4QHTA 5FTKA 1IBKM 4II7A 3DOAA 4AG6A 4AW4A 1H6UA 2JZ1A 1R6BX 3FRHA 2EKKA 1NJGA 2JZ0A 3U6OA 3R8FA 2F5PA 4ANRA 2LHCA 2JY7A 2L4FA 1SG9A 3FYDA 1WJ7A 2J5YA 2XFSA 3SYKA 3LQQA 4DR3M 1TDHA 3FUWA 1ORYB 2R65A 2KNZA 2ZAOA 3KOWE 4ITQA 5DYIA 3RGSA 1GO5A 3HU2A 4RF1A 4A3VB 5ITUA 1N77A 2XSZD 1HR0M 1QVRA 5EP4A 3L2AA 3J81S 2V1UA 4NC6A 4AZFA 3TQSA 5JI2E 4MGZE 4JI7M 3VKHA 1A5TA 5KPTA 4GMQA 5IT9S 2XSZA 2GNOA 2FS1A 2I7NA 2LTUA 2YR0A 3GLFB 2MGWA 1QAMA 1Z5CA 3EIEA 2F5OA 1GVNA 1J09A 2K0BX 3KS8A 1XXHB 2J7NA 1TGUA 4WURA 4QOZC 5FTMA 1VQ1A 3GLHE 3W67A 2DWZB 2HL7A 3FKEA 2CV2A 5ITRA 1V33A 4IBIA 5LMNM 1E9RA 1L8QA 3UK6A 1DGHB 3OTOM 4REZA 2Z4RA 4FW9A 1UFZA 4GC5A 2UUCM 3GLIE 3GLIA 4FD2A 1ZMWA 2XZFA 3I01M 1KSFX 1L2BA 1D0MA 2ZANA 4IBFA 3GLGA 4LJ9A 1XMQM 2CV1A 2CP8A 1FNNA 2DXIA 3RFWA 1JB0F 1TDZA 4BLCA 2YQZA 3I4VA 3I04M 4HEOA 1YSYA 3D8BA 5L8RF 2VF7A 1IBMM 3KFUG 4YY3M 1DGHA 1EIJA 5JI3E 4AKGA 4P16A 4IBDA 1IY2A 5FTNA 2DNAA 3SMSA 2JWSA 4NRWA 2O5RA 4MGYE 1XXHA 3SAVA 3QAUA 3VKGA 1ZV1A 1Y8GA 2WSCF 4MH0E 1G41A 2JNHA 2X49A 1Z6TA 4R71A 3IG8A 4X66M 1GL7A 3AOEC 1N33M 1TH2A 4G6ZA 3GRYA 2VQEM 4B3TM 4AQYM 4AKHA 1EFUB 1NO1A 2ZTDA 1K3WA 4D82A 1AUAA 3DZDA 5KQ8A 1IY1A 4HL4A 2R0IA 1OIPA 3B74A 4LF9M 1SXJB 1IN8A 2EUCA 1NY5A 3KS4A 1L1TA 2APLA 1GABA 2OO9A 3MHVC 1TH3A 4LGMA 2XF3A 3THGA 2RKOA 1PJTA 2W82A 2F5SA 2R44A 1MX0A 5ITQA 2V6ZM 2VF8A 3J2PB 2QBYB 3BXWA 3FYCA 3JR5A 3T1HM 1E32A 1N36M 4DR4M 3LQRA 4L16A 3GPUA 2D7GA 3B7NA 3NBIA 5EJCA 2KNVA 5FLXS 3ZCBB 1DGBA 2DWLA 1ZMVA 3SARA 3CGWA 2RGHA 4NSOB 3KSXA 3M6AA 4FCWA 5F3WA 3HHZA 1WHCA 1J7KA 3ILKA 3JR4A 4LZJA 3UZUA 3UGJA 1AIPC 4B7GA 1WR1B 1OIZA 1QUSA 2Z7JA 3C3DA 3I51A 3TWMA 2UU9M 1NY6A 2WSFF 4DR5M 1IBLM 1IN6A 3U6EA 3T6PA 1L1ZA 4KHPM 2GQFA 2F5NA 2LWXA 3CF0A 3K1JA 4AI6A 3GLHB 4R3DA 1G71A 3GRVA 1SXJC 3QYEA 4AG5A 2KRKA 2C98A 4X65M 2QHOB 4LJ7A 4LF7M 4G4QA 1Q3CA 4LJ8A 1S3SA 4TUWA 4BBAA 2XEPA 4DV7M 2CHQA 3TPZA 1ZAEA 2JP7A 1QYRA 1NJFA 2MJ5B 4CGYB 4DV5M 1OAIA 2QP9X 3KOZE 1IM2A 2KW0A 2M5ZA 1D2NA 2WSEF 2YNMD 1PJQA 4LZZA 2BJVA 3GPPA 4JI5M 1T43A 2UXCM 2LVPC 4LF5M 2Z4SA 2HWJA 4FCTA 4DV3M 2ZBKB 3AKZA 1XWIA 4GHLA 2C99A 1YLAA 4R7GA 2CWBA 3GP1A 5KPZA 3RE8A 1KFVA 5E26A 4DV1M 2KRUA 1TR8A 2ERCA 1Q3BA 5EP2A 2LHGA 2I7PA 3CF2A 2L2DA 3SMPA 1MN3A 2WZJA 4DBGB 1OAOC 4NSRA 1J5EM 2AHMA 2KEBA 3HGIA 1VEJA 1GJTA 2CHVA 4KODA 2DAKA 2MH8A 5EP3A 5ITTA 2QBYA 4G4NA 4KLNA 2CEAA 3GLIB 2QENA 3A42A 3HY5A 4L4UA 1ZQ9A 2DWNA 2KA6B 1NSFA 1R2ZA 4NL4H 1C7YA 3SC3A 1IXSB 1Q02A 1IN5A 2JY6B 4GITA 2UUBM 2LBCA 3SATA 1ZMUA 4DR7M 4L15A 3TWLA 2ZTCA 1PRBA 3FUUA 4I81A 5FTJA 3U61B 3BOSA 3U5ZA 2JY8A 4LJ4A 4YHHM 3J27B 1QAQA 1OQYA 4OVZB 5KPRA 3MK6A 1DGGA 1G8PA 2VDBB 4IBBA 3GLFE 2R6FA 3U6CA 4JI0M 4WP2A 5EXPA 3UJNA 4M0DA 2QPAA 2QCUA 1I4WA 3QYBA 3T15A 3GLHA 1R5LA 1TH4A 3E9SA 2BNKA 1HNZM 1XXHE 1YUBA 3L29A 2DAGA 1OFHA 1QZMA 2K9DA 5EP1A 3WHLA 3HJSA 2MR9A 4NOOB 4I4LA 2FOIC 2RGOA 3R9XB 4Y28F 4JI2M 1NNJA 5IZ7D 1HT2E 2UUAM 4GH9A 2LVAA 2OOAA 2VIIA 2Y20A 4KO8A 1OTRA 1JR3A 1I94M 3A46A 3AOGA 4B3RM 2HCBA 2O01F 2Y0TA 4XBOA 4W5WA 2HAKA 1SXJD 3TL4X 3GQ5A 5BR8M 4B3SM 2UXBM 1NV9A 2DKLA 2VQFM 1XHBA 2KNAA 3HKPA 4LFBM 4NXNM 3FTEA 2C9OA 2CHGA 1W5TA 1HNXM 4X62M 3KXEC 2DENA 1VDDA 4IJFA 1V92A 3L26A 1QAOA 1NV8A 4M9ZA 3GPXA 3U6QA 3B7ZA 3D8LA 3ZH9B 3AJIB 1QDRA 4LFAM 2O25A 4PDGA 3KP1E 3K2LA 4LJ6A 1V34A 3WHKA 1PM5A 3KOXE 3GRUA 1QDTA 3U5ZB 1IFYA 2G5GX 3U61A 4BB9A 2KXEA 1LTMA 1VEGA 1GL6A 4QHSA 4K0KM 3ZQJA 4F2LA 1G3IA 2LVOC 1BVSA 1GLNA 2DI0A 2QNJA 2BWBA 3HWSA 4FCVA 2R4EA 4DV0M 4JI3M 1R2YA 2Y0QA 3A45A 3MMPA 3LMMA 3GLGB 1VG5A 4LY6A 1RU3A 3ZC7B 3KSJA 5C18A 4QOSA 4JI6M 2OPFA 4DV2M 3AOEA 3IECA 2Z3XA 2KZSA 1Z59A 2R18A 1XNQM 2CRUA 4DUZM 1X37A 3CTWB 3HJ8A 2L09A 1HT1E 1GJSA 3B7QA 3Q8XA 4JN6A 3KW6A 4NRVA 2CE7A 4GRIA 3AL0C 3L25A 3M0EA 5ITXA 3FRIA 4MM3B 1KYIA 2D7EA 3C9PA 3J7BA 4FWGA 3TWKA 4LRTA 2ZM6M 2LVNC 4JI4M 3HHXA 4B08A 2Z8YM 1TTEA 1OKSA 1FJGM 3SFZA 1MJGM 1WIVA 1E94E 4UN2B 4GC9A 1MU5A 3TE6A 2K6BA 3L27A 1EE8A 4RF0A 3PNVA 3U6SA 2CV0A 1IXSA 2BJWA 4IBJA 1HQCA 4QNRA
chains in the Genus database with same CATH topology
3GQ4A 1G59A 3M7GA 4AKIA 3PVSA 2P5TA 4D81A 2XLJA 4LF8M 4JI8M 2ZAMA 5H37D 2DVWB 2X8AA 1NVMA 2DWMA 4ZPXA 1XMOM 2FFJA 3GPYA 5C1BA 4QNMA 3FTFA 4S12A 1YE9A 3SYLA 1W5SA 2Q2EB 3HHWA 3PFIA 4OU7A 1SXJA 2M60A 4IBCA 4LGYA 1K3XA 1N78A 2XH9A 4M9XA 4OX9M 2CFOA 4WW0A 4I8OA 2LXEA 5ITXE 2R62A 4LJ5A 4L78A 1Z5BA 2DZNB 5FTLA 4LFCM 3VK8A 1IN7A 4LF6M 5EXSA 3HU1A 3SBJA 1N75A 3HU3A 1LV7A 2QZ4A 1NNUC 1IY0A 4CISA 4L8RC 4GKJM 2K47A 5EXXA 1QANA 2XGNA 3PNYA 4M0WA 2UXDM 4RNAA 1OFIA 1R7RA 4G4OA 3VK7A 3DA1A 1HNWM 3UMMA 5BPVA 1G4AE 4B7HA 3GQ3A 4Z6YA 4LF4M 2HKJA 2F5QA 1Z5AA 5GKNA 3L28A 2XZUA 2YFQA 4JYAM 3KP0E 3U60A 2LNHC 4JV5M 3GO8A 4B3MM 3T1YM 4CHTB 3W0FA 2R4JA 3FUXA 4DR2M 3H4MA 3KDSE 2FE8A 8CATA 3U6DA 1IXZA 1JR3D 2OQ4A 4HLQA 1Q39A 4JI1M 4I5SA 2L7IA 4IJEA 2EO2A 2L7HA 1T3TA 4PD2A 3DFZA 5ITYA 1OJLA 4FWHA 4X64M 3U60B 1DO0A 1NHGC 4IBKA 3MJ5A 3PXGA 4PT5A 3J7AS 1L2CA 3E4RA 4IBGA 3U6PA 1E9SA 5DYGA 3KOYE 1GKIA 4GKKM 2E5LM 3QWLA 4XGIA 5E6JA 3VLFB 1N32M 3HJQA 3W0LB 2LH0A 4PCZA 1IQPA 5EQTA 2R45A 2DZOB 3SAUA 1QQWA 4M9SA 1HQYE 5A2QS 4DV6M 3SHFA 2A5YB 1K82A 4MB7A 5LMUM 2C5RA 4B7FA 5KO3A 4OW0A 4NXMM 3J80S 2XFTA 3AFHA 1WXQA 4G4RA 4IBEA 3C58A 4LRSA 1IN4A 4EIWA 1JQJC 2Y21A 3CF6E 2CUZA 1DO2A 3SAWA 4DV4M 2J7OA 4PDIA 2R46A 2C9CA 3KVWA 4JXJA 4OVZA 2D7HA 2KZUA 3NWLA 2H1RA 5IWAM 3SASA 2G8LA 1N34M 2L6OA 4FWDA 2EA0A 1IXRC 4MGHA 2DHRA 3K92A 1DGFA 4GHAA 4FVMA 4GIPA 2X4AA 3K8ZA 4IIWA 3T38A 1L2DA 5IREB 7CATA 5EXTA 1UM8A 3B9PA 3U6LA 2C96A 3VDUA 4D80A 3HHYA 3FUTA 4MGIE 3U6MA 1C1KA 2NQ8C 2V1CA 3GLFA 1XC8A 5KQDA 2FNAA 1NHWC 5FSWA 3VDPA 4Z8XA 3LVWA 3EIHA 3FTDA 4DUYM 2F4VM 3RGPA 4LCBA 4LJAA 4MGKE 3IG5A 1PJIA 3FD9A 3LVVA 3SHGB 3VFDA 3GRRA 1PJJA 2JA2A 5DNYA 1SXJE 2HHHM 4DR1M 1XNRM 3I4YA 3JAMS 3FTCA 3A98B 4LG2A 4DR6M 3FUVA 3AV0A 4QHTA 5FTKA 1IBKM 4II7A 3DOAA 4AG6A 4AW4A 1H6UA 1R6BX 1NJGA 3U6OA 3R8FA 2F5PA 3FYDA 2XFSA 3SYKA 3LQQA 4DR3M 1TDHA 3FUWA 1ORYB 2R65A 2ZAOA 3KOWE 4ITQA 5DYIA 3RGSA 3HU2A 4RF1A 4A3VB 5ITUA 1N77A 2XSZD 1HR0M 1QVRA 5EP4A 3L2AA 3J81S 2V1UA 3VKHA 4AZFA 3TQSA 5JI2E 4MGZE 4JI7M 5KPTA 4GMQA 5IT9S 2XSZA 2YR0A 2I7NA 3GLFB 1QAMA 1Z5CA 3EIEA 2F5OA 1GVNA 1J09A 3KS8A 1XXHB 2J7NA 1TGUA 4WURA 4QOZC 5FTMA 2DWZB 2HL7A 3FKEA 2CV2A 5ITRA 4IBIA 5LMNM 1E9RA 1L8QA 3UK6A 1DGHB 3OTOM 4REZA 2Z4RA 4FW9A 4GC5A 2UUCM 3GLIA 4FD2A 2XZFA 1KSFX 1L2BA 2ZANA 4IBFA 3GLGA 4LJ9A 1XMQM 2CV1A 2DXIA 1FNNA 3RFWA 1TDZA 4BLCA 2YQZA 3I4VA 1YSYA 3D8BA 1IBMM 3KFUG 4YY3M 1DGHA 4AKGA 5JI3E 4P16A 4IBDA 1IY2A 5FTNA 3SMSA 4NRWA 2O5RA 4MGYE 1XXHA 3SAVA 3QAUA 3VKGA 4MH0E 1G41A 2X49A 1Z6TA 3IG8A 4X66M 1GL7A 3AOEC 1N33M 1TH2A 4G6ZA 3GRYA 2VQEM 4B3TM 4AQYM 4AKHA 1K3WA 4D82A 3DZDA 5KQ8A 1IY1A 4HL4A 4LF9M 1SXJB 1IN8A 2EUCA 1NY5A 3KS4A 1L1TA 4LGMA 3MHVC 1TH3A 3THGA 2XF3A 2RKOA 2W82A 2F5SA 1MX0A 5ITQA 2V6ZM 3J2PB 2QBYB 3FYCA 3T1HM 1E32A 1N36M 4DR4M 3LQRA 4L16A 3GPUA 2D7GA 5EJCA 3NBIA 5FLXS 3ZCBB 1DGBA 2DWLA 3SARA 2RGHA 4NSOB 3KSXA 3M6AA 4FCWA 5F3WA 3HHZA 1J7KA 3ILKA 3JR4A 4LZJA 3UZUA 3UGJA 4B7GA 2Z7JA 3I51A 3TWMA 2UU9M 1NY6A 4DR5M 1IBLM 1IN6A 3U6EA 1L1ZA 4KHPM 2F5NA 2LWXA 3CF0A 3K1JA 4AI6A 3GLHB 4R3DA 3GRVA 4AG5A 1SXJC 2KRKA 2C98A 4X65M 4LJ7A 4LF7M 4G4QA 1Q3CA 4LJ8A 1S3SA 4TUWA 4BBAA 2XEPA 4DV7M 2CHQA 3TPZA 1ZAEA 1QYRA 1NJFA 4CGYB 4DV5M 2QP9X 3KOZE 1IM2A 2KW0A 2M5ZA 1D2NA 2YNMD 4LZZA 4JI5M 2BJVA 3GPPA 2UXCM 4LF5M 2Z4SA 4FCTA 4DV3M 2ZBKB 3AKZA 1XWIA 4GHLA 2C99A 4R7GA 3GP1A 5KPZA 3RE8A 1KFVA 5E26A 4DV1M 2KRUA 2ERCA 1Q3BA 5EP2A 2I7PA 3CF2A 3SMPA 4NSRA 1J5EM 2AHMA 2KEBA 3HGIA 5EP3A 5ITTA 2CHVA 4KODA 3JR5A 2QBYA 4G4NA 4KLNA 2CEAA 3GLIB 2QENA 3A42A 4L4UA 2DWNA 1ZQ9A 2KA6B 1NSFA 1R2ZA 4NL4H 3SC3A 1IXSB 1IN5A 2UUBM 4GITA 3SATA 4DR7M 4L15A 3TWLA 3FUUA 4I81A 5FTJA 3U61B 3BOSA 3U5ZA 4YHHM 4LJ4A 3J27B 1QAQA 4OVZB 5KPRA 3MK6A 1DGGA 1G8PA 4IBBA 3U6CA 4JI0M 5EXPA 3UJNA 4M0DA 2QPAA 2QCUA 1I4WA 3T15A 3GLHA 1TH4A 1HNZM 3E9SA 2BNKA 1YUBA 3L29A 1OFHA 1QZMA 5EP1A 3WHLA 3HJSA 4NOOB 4I4LA 2FOIC 2RGOA 3R9XB 4JI2M 1NNJA 5IZ7D 1HT2E 2UUAM 4GH9A 2VIIA 2Y20A 4KO8A 1I94M 1JR3A 3A46A 3AOGA 4B3RM 2HCBA 2Y0TA 4XBOA 4W5WA 3TL4X 1SXJD 3GQ5A 4B3SM 5BR8M 2UXBM 2VQFM 1XHBA 3HKPA 4LFBM 4NXNM 3FTEA 2C9OA 2CHGA 1W5TA 1HNXM 4X62M 3KXEC 4IJFA 1VDDA 3L26A 1QAOA 4M9ZA 3GPXA 3U6QA 3D8LA 3ZH9B 3AJIB 4LFAM 4PDGA 3KP1E 3K2LA 4LJ6A 3WHKA 1PM5A 3KOXE 3GRUA 3U5ZB 2G5GX 3U61A 4BB9A 2KXEA 4QHSA 4K0KM 1GL6A 1G3IA 4FCVA 1GLNA 3HWSA 4DV0M 1R2YA 2R4EA 4JI3M 2Y0QA 3A45A 3LMMA 3GLGB 4LY6A 3ZC7B 3KSJA 5C18A 4QOSA 4JI6M 2OPFA 4DV2M 3AOEA 2Z3XA 2KZSA 1Z59A 2R18A 1XNQM 4DUZM 1X37A 3CTWB 3HJ8A 2L09A 1HT1E 3Q8XA 4JN6A 3KW6A 4NRVA 2CE7A 4GRIA 3AL0C 3L25A 3M0EA 5ITXA 4MM3B 1KYIA 2D7EA 4FWGA 3J7BA 3TWKA 2ZM6M 4LRTA 4JI4M 3HHXA 4B08A 1FJGM 3SFZA 1E94E 4GC9A 1MU5A 3TE6A 3L27A 1EE8A 4RF0A 3PNVA 3U6SA 2CV0A 2BJWA 4IBJA 1HQCA 4QNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ4 A;  2UUB M;  4NRW A;  3SAW A;  4DV4 M;  3SAT A;  4JI8 M;  4LF8 M;  4PDI A;  3SAV A;  4DR7 M;  3TWL A;  4YHH M;  1XMO M;  5IWA M;  4X66 M;  3GPY A;  3U6C A;  3SAS A;  1N34 M;  1N33 M;  4JI0 M;  4B3T M;  2VQE M;  2EA0 A;  4AQY M;  1K3W A;  2Q2E B;  1L2D A;  1HNZ M;  4LF9 M;  1K3X A;  3U6L A;  1L1T A;  4OX9 M;  3U6M A;  1XC8 A;  5ITX E;  4JI2 M;  1NNJ A;  1Z5B A;  2F5S A;  4LFC M;  3VK8 A;  1MX0 A;  2UUA M;  5ITQ A;  4LF6 M;  3SBJ A;  3T1H M;  1I94 M;  3A46 A;  4DUY M;  1N36 M;  2F4V M;  4B3R M;  4DR4 M;  4CIS A;  3GPU A;  4GKJ M;  5FLX S;  3GQ5 A;  4B3S M;  1PJI A;  5BR8 M;  2UXB M;  2VQF M;  3SAR A;  2UXD M;  1PJJ A;  4LFB M;  4NXN M;  4G4O A;  3VK7 A;  1HNX M;  4X62 M;  1HNW M;  2HHH M;  4DR1 M;  1XNR M;  3GPX A;  3JAM S;  3GQ3 A;  3U6Q A;  3JR4 A;  4LF4 M;  2HKJ A;  2F5Q A;  4LFA M;  4DR6 M;  1IBK M;  4PDG A;  1Z5A A;  3TWM A;  2UU9 M;  3DOA A;  1PM5 A;  4DR5 M;  2XZU A;  1IBL M;  3U6E A;  1L1Z A;  4JYA M;  4JV5 M;  3GO8 A;  3U6O A;  3T1Y M;  2F5N A;  3W0F A;  2F5P A;  4B3M M;  4K0K M;  4KHP M;  4DR2 M;  3U6D A;  4DV0 M;  4DR3 M;  1TDH A;  1R2Y A;  4JI3 M;  4X65 M;  4LF7 M;  2OQ4 A;  4G4Q A;  1Q39 A;  3A45 A;  1Q3C A;  4ITQ A;  4JI1 M;  5ITU A;  4DV7 M;  1HR0 M;  4PD2 A;  4JI6 M;  2OPF A;  5ITY A;  3J81 S;  4DV2 M;  4DV5 M;  4X64 M;  4JI7 M;  1Z59 A;  4JI5 M;  1XNQ M;  3GPP A;  2UXC M;  4DUZ M;  5IT9 S;  3J7A S;  4LF5 M;  1Z5C A;  2F5O A;  1L2C A;  4DV3 M;  2ZBK B;  3U6P A;  4NRV A;  5ITX A;  3GP1 A;  4GKK M;  2E5L M;  1KFV A;  4DV1 M;  1N32 M;  3TWK A;  5ITR A;  1Q3B A;  2ZM6 M;  4PCZ A;  5LMN M;  3OTO M;  4JI4 M;  3SAU A;  2UUC M;  1FJG M;  5A2Q S;  4DV6 M;  1J5E M;  2XZF A;  3JR5 A;  1L2B A;  5ITT A;  1MU5 A;  1XMQ M;  1K82 A;  4MB7 A;  5LMU M;  4G4N A;  1TDZ A;  1EE8 A;  4NXM M;  3A42 A;  3U6S A;  3J80 S;  1IBM M;  1R2Z A;  4YY3 M;  4G4R A;  3C58 A; 
#chains in the Genus database with same CATH topology
 3GLG E;  3GQ4 A;  3E21 A;  3FE3 A;  3M7G A;  1G59 A;  4KT0 F;  4AKI A;  3IHP A;  2P5T A;  3PVS A;  4D81 A;  2XLJ A;  4LF8 M;  1F4I A;  4JI8 M;  2ZAM A;  4F1I A;  5H37 D;  2DVW B;  2X8A A;  1NVM A;  3NBX X;  2DWM A;  4ZPX A;  1XMO M;  2FFJ A;  1P3Q Q;  5C1B A;  3GPY A;  4QNM A;  2BWE A;  3FTF A;  4S12 A;  1YE9 A;  3HX3 A;  3SYL A;  1W5S A;  2Q2E B;  3E46 A;  3HHW A;  3PFI A;  4OU7 A;  1SXJ A;  1JR3 E;  1D0K A;  2M60 A;  4IBC A;  2DHY A;  3LCV B;  4LGY A;  1K3X A;  1N78 A;  2XH9 A;  4M9X A;  2JUJ A;  4OX9 M;  1HJP A;  2CFO A;  2DAI A;  4WW0 A;  1XB2 B;  1PJS A;  4I8O A;  2LXE A;  5ITX E;  2R62 A;  2H5X A;  4LJ5 A;  1Z5B A;  2DZN B;  4L78 A;  2RRU A;  5FTL A;  3VK8 A;  4LFC M;  1IN7 A;  4LF6 M;  5EXS A;  3HU1 A;  3SBJ A;  1N75 A;  3HU3 A;  1LV7 A;  2QZ4 A;  1T6O A;  4L6V 6;  1NNU C;  1IY0 A;  4CIS A;  4L8R C;  1QZE A;  4GKJ M;  2K47 A;  3K9O A;  5EXX A;  2N35 A;  1QAN A;  2XGN A;  1D0L A;  3PNY A;  4M0W A;  2UXD M;  2L4E A;  3LCU A;  4RNA A;  1OFI A;  1R7R A;  4G4O A;  3VK7 A;  3DA1 A;  1HNW M;  3UMM A;  2DZL A;  5BPV A;  1G4A E;  2DAM A;  4B7H A;  3GQ3 A;  4Z6Y A;  4LF4 M;  2HKJ A;  2F5Q A;  1Z5A A;  4XK8 F;  3F92 A;  5GKN A;  3L28 A;  2XZU A;  4G3O A;  2YFQ A;  4JYA M;  3KP0 E;  3U60 A;  2LNH C;  4JV5 M;  3GO8 A;  4B3M M;  2EKF A;  4CHT B;  3W0F A;  3T1Y M;  2R4J A;  3FUX A;  3K9P A;  4DR2 M;  3H4M A;  3KDS E;  2FE8 A;  8CAT A;  3U6D A;  1R4G A;  1IXZ A;  1JR3 D;  2OQ4 A;  4HLQ A;  1Q39 A;  4JI1 M;  4I5S A;  2L7I A;  4IJE A;  2EO2 A;  2G3Q A;  2L7H A;  1T3T A;  3B89 A;  4PD2 A;  3DFZ A;  5ITY A;  1OJL A;  4FWH A;  4X64 M;  3U60 B;  1DO0 A;  1NHG C;  4IBK A;  3MJ5 A;  3PXG A;  3HZJ A;  4PT5 A;  1CUK A;  2OOB A;  3J7A S;  1L2C A;  3E4R A;  4IBG A;  3U6P A;  1E9S A;  5DYG A;  1DV0 A;  4CIZ A;  3KOY E;  2QSF X;  1GKI A;  4GKK M;  4CJ6 A;  3QWL A;  1WGL A;  2E5L M;  4XGI A;  5E6J A;  3VLF B;  1N32 M;  3BBZ A;  3HJQ A;  3W0L B;  2LH0 A;  4PCZ A;  1IQP A;  5EQT A;  2R45 A;  2DZO B;  1PGY A;  1QQW A;  3SAU A;  4M9S A;  1HQY E;  5A2Q S;  4DV6 M;  3C3E A;  2DAE A;  1VDL A;  3SHF A;  2A5Y B;  1K82 A;  4MB7 A;  5LMU M;  2C5R A;  4B7F A;  3Q8G A;  5KO3 A;  4OW0 A;  1VEK A;  4NXM M;  3J80 S;  2XFT A;  3AFH A;  1WXQ A;  4G4R A;  4IBE A;  3V76 A;  2EJS A;  4LRS A;  3C58 A;  1IN4 A;  4EIW A;  1JQJ C;  2Y21 A;  3CF6 E;  2CUZ A;  1DO2 A;  3SAW A;  4DV4 M;  2J7O A;  4P17 A;  2R46 A;  2C9C A;  4PDI A;  3W68 A;  3KVW A;  4JXJ A;  4OVZ A;  2D7H A;  2KZU A;  5DFL A;  3NWL A;  2H1R A;  5IWA M;  3SAS A;  2G8L A;  1N34 M;  2L6O A;  4FWD A;  2EA0 A;  1IXR C;  4MGH A;  2DHR A;  3K92 A;  1DGF A;  2KDL A;  4FVM A;  4GIP A;  4GHA A;  2X4A A;  1QUT A;  3K8Z A;  4IIW A;  3T38 A;  2KHH A;  1L2D A;  5IRE B;  7CAT A;  2FH0 A;  5EXT A;  1UM8 A;  3B9P A;  3U6L A;  2C96 A;  3VDU A;  4D80 A;  3HHY A;  3FUT A;  4MGI E;  3U6M A;  1C1K A;  2NQ8 C;  2V1C A;  3GLF A;  1XC8 A;  5KQD A;  2FNA A;  1NHW C;  5FSW A;  3VDP A;  4Z8X A;  3EIH A;  3FTD A;  3LVW A;  4Q7J A;  4DUY M;  2F4V M;  1WGN A;  2MRO B;  3H4J A;  3RGP A;  4LCB A;  4LJA A;  4MGK E;  3IG5 A;  2LVQ D;  3LW5 F;  4RKU F;  2JY5 A;  1PJI A;  2JXN A;  3FD9 A;  3LVV A;  4GEW A;  3SHG B;  3VFD A;  3GRR A;  1PJJ A;  2JA2 A;  5DNY A;  1SXJ E;  2HHH M;  4DR1 M;  1XNR M;  3I4Y A;  3JAM S;  2B3T A;  1TF0 B;  3FTC A;  3A98 B;  4LG2 A;  2QQ8 A;  4DR6 M;  3FUV A;  3AV0 A;  4QHT A;  5FTK A;  1IBK M;  4II7 A;  3DOA A;  4AG6 A;  4AW4 A;  1H6U A;  2JZ1 A;  1R6B X;  3FRH A;  2EKK A;  1NJG A;  2JZ0 A;  3U6O A;  3R8F A;  2F5P A;  4ANR A;  2LHC A;  2JY7 A;  2L4F A;  1SG9 A;  3FYD A;  1WJ7 A;  2J5Y A;  2XFS A;  3SYK A;  3LQQ A;  4DR3 M;  1TDH A;  3FUW A;  1ORY B;  2R65 A;  2KNZ A;  2ZAO A;  3KOW E;  4ITQ A;  5DYI A;  3RGS A;  1GO5 A;  3HU2 A;  4RF1 A;  4A3V B;  5ITU A;  1N77 A;  2XSZ D;  1HR0 M;  1QVR A;  5EP4 A;  3L2A A;  3J81 S;  2V1U A;  4NC6 A;  4AZF A;  3TQS A;  5JI2 E;  4MGZ E;  4JI7 M;  3VKH A;  1A5T A;  5KPT A;  4GMQ A;  5IT9 S;  2XSZ A;  2GNO A;  2FS1 A;  2I7N A;  2LTU A;  2YR0 A;  3GLF B;  2MGW A;  1QAM A;  1Z5C A;  3EIE A;  2F5O A;  1GVN A;  1J09 A;  2K0B X;  3KS8 A;  1XXH B;  2J7N A;  1TGU A;  4WUR A;  4QOZ C;  5FTM A;  1VQ1 A;  3GLH E;  3W67 A;  2DWZ B;  2HL7 A;  3FKE A;  2CV2 A;  5ITR A;  1V33 A;  4IBI A;  5LMN M;  1E9R A;  1L8Q A;  3UK6 A;  1DGH B;  3OTO M;  4REZ A;  2Z4R A;  4FW9 A;  1UFZ A;  4GC5 A;  2UUC M;  3GLI E;  3GLI A;  4FD2 A;  1ZMW A;  2XZF A;  3I01 M;  1KSF X;  1L2B A;  1D0M A;  2ZAN A;  4IBF A;  3GLG A;  4LJ9 A;  1XMQ M;  2CV1 A;  2CP8 A;  1FNN A;  2DXI A;  3RFW A;  1JB0 F;  1TDZ A;  4BLC A;  2YQZ A;  3I4V A;  3I04 M;  4HEO A;  1YSY A;  3D8B A;  5L8R F;  2VF7 A;  1IBM M;  3KFU G;  4YY3 M;  1DGH A;  1EIJ A;  5JI3 E;  4AKG A;  4P16 A;  4IBD A;  1IY2 A;  5FTN A;  2DNA A;  3SMS A;  2JWS A;  4NRW A;  2O5R A;  4MGY E;  1XXH A;  3SAV A;  3QAU A;  3VKG A;  1ZV1 A;  1Y8G A;  2WSC F;  4MH0 E;  1G41 A;  2JNH A;  2X49 A;  1Z6T A;  4R71 A;  3IG8 A;  4X66 M;  1GL7 A;  3AOE C;  1N33 M;  1TH2 A;  4G6Z A;  3GRY A;  2VQE M;  4B3T M;  4AQY M;  4AKH A;  1EFU B;  1NO1 A;  2ZTD A;  1K3W A;  4D82 A;  1AUA A;  3DZD A;  5KQ8 A;  1IY1 A;  4HL4 A;  2R0I A;  1OIP A;  3B74 A;  4LF9 M;  1SXJ B;  1IN8 A;  2EUC A;  1NY5 A;  3KS4 A;  1L1T A;  2APL A;  1GAB A;  2OO9 A;  3MHV C;  1TH3 A;  4LGM A;  2XF3 A;  3THG A;  2RKO A;  1PJT A;  2W82 A;  2F5S A;  2R44 A;  1MX0 A;  5ITQ A;  2V6Z M;  2VF8 A;  3J2P B;  2QBY B;  3BXW A;  3FYC A;  3JR5 A;  3T1H M;  1E32 A;  1N36 M;  4DR4 M;  3LQR A;  4L16 A;  3GPU A;  2D7G A;  3B7N A;  3NBI A;  5EJC A;  2KNV A;  5FLX S;  3ZCB B;  1DGB A;  2DWL A;  1ZMV A;  3SAR A;  3CGW A;  2RGH A;  4NSO B;  3KSX A;  3M6A A;  4FCW A;  5F3W A;  3HHZ A;  1WHC A;  1J7K A;  3ILK A;  3JR4 A;  4LZJ A;  3UZU A;  3UGJ A;  1AIP C;  4B7G A;  1WR1 B;  1OIZ A;  1QUS A;  2Z7J A;  3C3D A;  3I51 A;  3TWM A;  2UU9 M;  1NY6 A;  2WSF F;  4DR5 M;  1IBL M;  1IN6 A;  3U6E A;  3T6P A;  1L1Z A;  4KHP M;  2GQF A;  2F5N A;  2LWX A;  3CF0 A;  3K1J A;  4AI6 A;  3GLH B;  4R3D A;  1G71 A;  3GRV A;  1SXJ C;  3QYE A;  4AG5 A;  2KRK A;  2C98 A;  4X65 M;  2QHO B;  4LJ7 A;  4LF7 M;  4G4Q A;  1Q3C A;  4LJ8 A;  1S3S A;  4TUW A;  4BBA A;  2XEP A;  4DV7 M;  2CHQ A;  3TPZ A;  1ZAE A;  2JP7 A;  1QYR A;  1NJF A;  2MJ5 B;  4CGY B;  4DV5 M;  1OAI A;  2QP9 X;  3KOZ E;  1IM2 A;  2KW0 A;  2M5Z A;  1D2N A;  2WSE F;  2YNM D;  1PJQ A;  4LZZ A;  2BJV A;  3GPP A;  4JI5 M;  1T43 A;  2UXC M;  2LVP C;  4LF5 M;  2Z4S A;  2HWJ A;  4FCT A;  4DV3 M;  2ZBK B;  3AKZ A;  1XWI A;  4GHL A;  2C99 A;  1YLA A;  4R7G A;  2CWB A;  3GP1 A;  5KPZ A;  3RE8 A;  1KFV A;  5E26 A;  4DV1 M;  2KRU A;  1TR8 A;  2ERC A;  1Q3B A;  5EP2 A;  2LHG A;  2I7P A;  3CF2 A;  2L2D A;  3SMP A;  1MN3 A;  2WZJ A;  4DBG B;  1OAO C;  4NSR A;  1J5E M;  2AHM A;  2KEB A;  3HGI A;  1VEJ A;  1GJT A;  2CHV A;  4KOD A;  2DAK A;  2MH8 A;  5EP3 A;  5ITT A;  2QBY A;  4G4N A;  4KLN A;  2CEA A;  3GLI B;  2QEN A;  3A42 A;  3HY5 A;  4L4U A;  1ZQ9 A;  2DWN A;  2KA6 B;  1NSF A;  1R2Z A;  4NL4 H;  1C7Y A;  3SC3 A;  1IXS B;  1Q02 A;  1IN5 A;  2JY6 B;  4GIT A;  2UUB M;  2LBC A;  3SAT A;  1ZMU A;  4DR7 M;  4L15 A;  3TWL A;  2ZTC A;  1PRB A;  3FUU A;  4I81 A;  5FTJ A;  3U61 B;  3BOS A;  3U5Z A;  2JY8 A;  4LJ4 A;  4YHH M;  3J27 B;  1QAQ A;  1OQY A;  4OVZ B;  5KPR A;  3MK6 A;  1DGG A;  1G8P A;  2VDB B;  4IBB A;  3GLF E;  2R6F A;  3U6C A;  4JI0 M;  4WP2 A;  5EXP A;  3UJN A;  4M0D A;  2QPA A;  2QCU A;  1I4W A;  3QYB A;  3T15 A;  3GLH A;  1R5L A;  1TH4 A;  3E9S A;  2BNK A;  1HNZ M;  1XXH E;  1YUB A;  3L29 A;  2DAG A;  1OFH A;  1QZM A;  2K9D A;  5EP1 A;  3WHL A;  3HJS A;  2MR9 A;  4NOO B;  4I4L A;  2FOI C;  2RGO A;  3R9X B;  4Y28 F;  4JI2 M;  1NNJ A;  5IZ7 D;  1HT2 E;  2UUA M;  4GH9 A;  2LVA A;  2OOA A;  2VII A;  2Y20 A;  4KO8 A;  1OTR A;  1JR3 A;  1I94 M;  3A46 A;  3AOG A;  4B3R M;  2HCB A;  2O01 F;  2Y0T A;  4XBO A;  4W5W A;  2HAK A;  1SXJ D;  3TL4 X;  3GQ5 A;  5BR8 M;  4B3S M;  2UXB M;  1NV9 A;  2DKL A;  2VQF M;  1XHB A;  2KNA A;  3HKP A;  4LFB M;  4NXN M;  3FTE A;  2C9O A;  2CHG A;  1W5T A;  1HNX M;  4X62 M;  3KXE C;  2DEN A;  1VDD A;  4IJF A;  1V92 A;  3L26 A;  1QAO A;  1NV8 A;  4M9Z A;  3GPX A;  3U6Q A;  3B7Z A;  3D8L A;  3ZH9 B;  3AJI B;  1QDR A;  4LFA M;  2O25 A;  4PDG A;  3KP1 E;  3K2L A;  4LJ6 A;  1V34 A;  3WHK A;  1PM5 A;  3KOX E;  3GRU A;  1QDT A;  3U5Z B;  1IFY A;  2G5G X;  3U61 A;  4BB9 A;  2KXE A;  1LTM A;  1VEG A;  1GL6 A;  4QHS A;  4K0K M;  3ZQJ A;  4F2L A;  1G3I A;  2LVO C;  1BVS A;  1GLN A;  2DI0 A;  2QNJ A;  2BWB A;  3HWS A;  4FCV A;  2R4E A;  4DV0 M;  4JI3 M;  1R2Y A;  2Y0Q A;  3A45 A;  3MMP A;  3LMM A;  3GLG B;  1VG5 A;  4LY6 A;  1RU3 A;  3ZC7 B;  3KSJ A;  5C18 A;  4QOS A;  4JI6 M;  2OPF A;  4DV2 M;  3AOE A;  3IEC A;  2Z3X A;  2KZS A;  1Z59 A;  2R18 A;  1XNQ M;  2CRU A;  4DUZ M;  1X37 A;  3CTW B;  3HJ8 A;  2L09 A;  1HT1 E;  1GJS A;  3B7Q A;  3Q8X A;  4JN6 A;  3KW6 A;  4NRV A;  2CE7 A;  4GRI A;  3AL0 C;  3L25 A;  3M0E A;  5ITX A;  3FRI A;  4MM3 B;  1KYI A;  2D7E A;  3C9P A;  3J7B A;  4FWG A;  3TWK A;  4LRT A;  2ZM6 M;  2LVN C;  4JI4 M;  3HHX A;  4B08 A;  2Z8Y M;  1TTE A;  1OKS A;  1FJG M;  3SFZ A;  1MJG M;  1WIV A;  1E94 E;  4UN2 B;  4GC9 A;  1MU5 A;  3TE6 A;  2K6B A;  3L27 A;  1EE8 A;  4RF0 A;  3PNV A;  3U6S A;  2CV0 A;  1IXS A;  2BJW A;  4IBJ A;  1HQC A;  4QNR A; 
#chains in the Genus database with same CATH homology
 3GQ4 A;  1G59 A;  3M7G A;  4AKI A;  3PVS A;  2P5T A;  4D81 A;  2XLJ A;  4LF8 M;  4JI8 M;  2ZAM A;  5H37 D;  2DVW B;  2X8A A;  1NVM A;  2DWM A;  4ZPX A;  1XMO M;  2FFJ A;  3GPY A;  5C1B A;  4QNM A;  3FTF A;  4S12 A;  1YE9 A;  3SYL A;  1W5S A;  2Q2E B;  3HHW A;  3PFI A;  4OU7 A;  1SXJ A;  2M60 A;  4IBC A;  4LGY A;  1K3X A;  1N78 A;  2XH9 A;  4M9X A;  4OX9 M;  2CFO A;  4WW0 A;  4I8O A;  2LXE A;  5ITX E;  2R62 A;  4LJ5 A;  4L78 A;  1Z5B A;  2DZN B;  5FTL A;  4LFC M;  3VK8 A;  1IN7 A;  4LF6 M;  5EXS A;  3HU1 A;  3SBJ A;  1N75 A;  3HU3 A;  1LV7 A;  2QZ4 A;  1NNU C;  1IY0 A;  4CIS A;  4L8R C;  4GKJ M;  2K47 A;  5EXX A;  1QAN A;  2XGN A;  3PNY A;  4M0W A;  2UXD M;  4RNA A;  1OFI A;  1R7R A;  4G4O A;  3VK7 A;  3DA1 A;  1HNW M;  3UMM A;  5BPV A;  1G4A E;  4B7H A;  3GQ3 A;  4Z6Y A;  4LF4 M;  2HKJ A;  2F5Q A;  1Z5A A;  5GKN A;  3L28 A;  2XZU A;  2YFQ A;  4JYA M;  3KP0 E;  3U60 A;  2LNH C;  4JV5 M;  3GO8 A;  4B3M M;  3T1Y M;  4CHT B;  3W0F A;  2R4J A;  3FUX A;  4DR2 M;  3H4M A;  3KDS E;  2FE8 A;  8CAT A;  3U6D A;  1IXZ A;  1JR3 D;  2OQ4 A;  4HLQ A;  1Q39 A;  4JI1 M;  4I5S A;  2L7I A;  4IJE A;  2EO2 A;  2L7H A;  1T3T A;  4PD2 A;  3DFZ A;  5ITY A;  1OJL A;  4FWH A;  4X64 M;  3U60 B;  1DO0 A;  1NHG C;  4IBK A;  3MJ5 A;  3PXG A;  4PT5 A;  3J7A S;  1L2C A;  3E4R A;  4IBG A;  3U6P A;  1E9S A;  5DYG A;  3KOY E;  1GKI A;  4GKK M;  2E5L M;  3QWL A;  4XGI A;  5E6J A;  3VLF B;  1N32 M;  3HJQ A;  3W0L B;  2LH0 A;  4PCZ A;  1IQP A;  5EQT A;  2R45 A;  2DZO B;  3SAU A;  1QQW A;  4M9S A;  1HQY E;  5A2Q S;  4DV6 M;  3SHF A;  2A5Y B;  1K82 A;  4MB7 A;  5LMU M;  2C5R A;  4B7F A;  5KO3 A;  4OW0 A;  4NXM M;  3J80 S;  2XFT A;  3AFH A;  1WXQ A;  4G4R A;  4IBE A;  3C58 A;  4LRS A;  1IN4 A;  4EIW A;  1JQJ C;  2Y21 A;  3CF6 E;  2CUZ A;  1DO2 A;  3SAW A;  4DV4 M;  2J7O A;  4PDI A;  2R46 A;  2C9C A;  3KVW A;  4JXJ A;  4OVZ A;  2D7H A;  2KZU A;  3NWL A;  2H1R A;  5IWA M;  3SAS A;  2G8L A;  1N34 M;  2L6O A;  4FWD A;  2EA0 A;  1IXR C;  4MGH A;  2DHR A;  3K92 A;  1DGF A;  4GHA A;  4FVM A;  4GIP A;  2X4A A;  3K8Z A;  4IIW A;  3T38 A;  1L2D A;  5IRE B;  7CAT A;  5EXT A;  1UM8 A;  3B9P A;  3U6L A;  2C96 A;  3VDU A;  4D80 A;  3HHY A;  3FUT A;  4MGI E;  3U6M A;  1C1K A;  2NQ8 C;  2V1C A;  3GLF A;  1XC8 A;  5KQD A;  2FNA A;  1NHW C;  5FSW A;  3VDP A;  4Z8X A;  3LVW A;  3EIH A;  3FTD A;  4DUY M;  2F4V M;  3RGP A;  4LCB A;  4LJA A;  4MGK E;  3IG5 A;  1PJI A;  3FD9 A;  3LVV A;  3SHG B;  3VFD A;  3GRR A;  1PJJ A;  2JA2 A;  5DNY A;  1SXJ E;  2HHH M;  4DR1 M;  1XNR M;  3I4Y A;  3JAM S;  3FTC A;  3A98 B;  4LG2 A;  4DR6 M;  3FUV A;  3AV0 A;  4QHT A;  5FTK A;  1IBK M;  4II7 A;  3DOA A;  4AG6 A;  4AW4 A;  1H6U A;  1R6B X;  1NJG A;  3U6O A;  3R8F A;  2F5P A;  3FYD A;  2XFS A;  3SYK A;  3LQQ A;  4DR3 M;  1TDH A;  3FUW A;  1ORY B;  2R65 A;  2ZAO A;  3KOW E;  4ITQ A;  5DYI A;  3RGS A;  3HU2 A;  4RF1 A;  4A3V B;  5ITU A;  1N77 A;  2XSZ D;  1HR0 M;  1QVR A;  5EP4 A;  3L2A A;  3J81 S;  2V1U A;  3VKH A;  4AZF A;  3TQS A;  5JI2 E;  4MGZ E;  4JI7 M;  5KPT A;  4GMQ A;  5IT9 S;  2XSZ A;  2YR0 A;  2I7N A;  3GLF B;  1QAM A;  1Z5C A;  3EIE A;  2F5O A;  1GVN A;  1J09 A;  3KS8 A;  1XXH B;  2J7N A;  1TGU A;  4WUR A;  4QOZ C;  5FTM A;  2DWZ B;  2HL7 A;  3FKE A;  2CV2 A;  5ITR A;  4IBI A;  5LMN M;  1E9R A;  1L8Q A;  3UK6 A;  1DGH B;  3OTO M;  4REZ A;  2Z4R A;  4FW9 A;  4GC5 A;  2UUC M;  3GLI A;  4FD2 A;  2XZF A;  1KSF X;  1L2B A;  2ZAN A;  4IBF A;  3GLG A;  4LJ9 A;  1XMQ M;  2CV1 A;  2DXI A;  1FNN A;  3RFW A;  1TDZ A;  4BLC A;  2YQZ A;  3I4V A;  1YSY A;  3D8B A;  1IBM M;  3KFU G;  4YY3 M;  1DGH A;  4AKG A;  5JI3 E;  4P16 A;  4IBD A;  1IY2 A;  5FTN A;  3SMS A;  4NRW A;  2O5R A;  4MGY E;  1XXH A;  3SAV A;  3QAU A;  3VKG A;  4MH0 E;  1G41 A;  2X49 A;  1Z6T A;  3IG8 A;  4X66 M;  1GL7 A;  3AOE C;  1N33 M;  1TH2 A;  4G6Z A;  3GRY A;  2VQE M;  4B3T M;  4AQY M;  4AKH A;  1K3W A;  4D82 A;  3DZD A;  5KQ8 A;  1IY1 A;  4HL4 A;  4LF9 M;  1SXJ B;  1IN8 A;  2EUC A;  1NY5 A;  3KS4 A;  1L1T A;  4LGM A;  3MHV C;  1TH3 A;  3THG A;  2XF3 A;  2RKO A;  2W82 A;  2F5S A;  1MX0 A;  5ITQ A;  2V6Z M;  3J2P B;  2QBY B;  3FYC A;  3T1H M;  1E32 A;  1N36 M;  4DR4 M;  3LQR A;  4L16 A;  3GPU A;  2D7G A;  5EJC A;  3NBI A;  5FLX S;  3ZCB B;  1DGB A;  2DWL A;  3SAR A;  2RGH A;  4NSO B;  3KSX A;  3M6A A;  4FCW A;  5F3W A;  3HHZ A;  1J7K A;  3ILK A;  3JR4 A;  4LZJ A;  3UZU A;  3UGJ A;  4B7G A;  2Z7J A;  3I51 A;  3TWM A;  2UU9 M;  1NY6 A;  4DR5 M;  1IBL M;  1IN6 A;  3U6E A;  1L1Z A;  4KHP M;  2F5N A;  2LWX A;  3CF0 A;  3K1J A;  4AI6 A;  3GLH B;  4R3D A;  3GRV A;  4AG5 A;  1SXJ C;  2KRK A;  2C98 A;  4X65 M;  4LJ7 A;  4LF7 M;  4G4Q A;  1Q3C A;  4LJ8 A;  1S3S A;  4TUW A;  4BBA A;  2XEP A;  4DV7 M;  2CHQ A;  3TPZ A;  1ZAE A;  1QYR A;  1NJF A;  4CGY B;  4DV5 M;  2QP9 X;  3KOZ E;  1IM2 A;  2KW0 A;  2M5Z A;  1D2N A;  2YNM D;  4LZZ A;  4JI5 M;  2BJV A;  3GPP A;  2UXC M;  4LF5 M;  2Z4S A;  4FCT A;  4DV3 M;  2ZBK B;  3AKZ A;  1XWI A;  4GHL A;  2C99 A;  4R7G A;  3GP1 A;  5KPZ A;  3RE8 A;  1KFV A;  5E26 A;  4DV1 M;  2KRU A;  2ERC A;  1Q3B A;  5EP2 A;  2I7P A;  3CF2 A;  3SMP A;  4NSR A;  1J5E M;  2AHM A;  2KEB A;  3HGI A;  5EP3 A;  5ITT A;  2CHV A;  4KOD A;  3JR5 A;  2QBY A;  4G4N A;  4KLN A;  2CEA A;  3GLI B;  2QEN A;  3A42 A;  4L4U A;  2DWN A;  1ZQ9 A;  2KA6 B;  1NSF A;  1R2Z A;  4NL4 H;  3SC3 A;  1IXS B;  1IN5 A;  2UUB M;  4GIT A;  3SAT A;  4DR7 M;  4L15 A;  3TWL A;  3FUU A;  4I81 A;  5FTJ A;  3U61 B;  3BOS A;  3U5Z A;  4YHH M;  4LJ4 A;  3J27 B;  1QAQ A;  4OVZ B;  5KPR A;  3MK6 A;  1DGG A;  1G8P A;  4IBB A;  3U6C A;  4JI0 M;  5EXP A;  3UJN A;  4M0D A;  2QPA A;  2QCU A;  1I4W A;  3T15 A;  3GLH A;  1TH4 A;  1HNZ M;  3E9S A;  2BNK A;  1YUB A;  3L29 A;  1OFH A;  1QZM A;  5EP1 A;  3WHL A;  3HJS A;  4NOO B;  4I4L A;  2FOI C;  2RGO A;  3R9X B;  4JI2 M;  1NNJ A;  5IZ7 D;  1HT2 E;  2UUA M;  4GH9 A;  2VII A;  2Y20 A;  4KO8 A;  1I94 M;  1JR3 A;  3A46 A;  3AOG A;  4B3R M;  2HCB A;  2Y0T A;  4XBO A;  4W5W A;  3TL4 X;  1SXJ D;  3GQ5 A;  4B3S M;  5BR8 M;  2UXB M;  2VQF M;  1XHB A;  3HKP A;  4LFB M;  4NXN M;  3FTE A;  2C9O A;  2CHG A;  1W5T A;  1HNX M;  4X62 M;  3KXE C;  4IJF A;  1VDD A;  3L26 A;  1QAO A;  4M9Z A;  3GPX A;  3U6Q A;  3D8L A;  3ZH9 B;  3AJI B;  4LFA M;  4PDG A;  3KP1 E;  3K2L A;  4LJ6 A;  3WHK A;  1PM5 A;  3KOX E;  3GRU A;  3U5Z B;  2G5G X;  3U61 A;  4BB9 A;  2KXE A;  4QHS A;  4K0K M;  1GL6 A;  1G3I A;  4FCV A;  1GLN A;  3HWS A;  4DV0 M;  1R2Y A;  2R4E A;  4JI3 M;  2Y0Q A;  3A45 A;  3LMM A;  3GLG B;  4LY6 A;  3ZC7 B;  3KSJ A;  5C18 A;  4QOS A;  4JI6 M;  2OPF A;  4DV2 M;  3AOE A;  2Z3X A;  2KZS A;  1Z59 A;  2R18 A;  1XNQ M;  4DUZ M;  1X37 A;  3CTW B;  3HJ8 A;  2L09 A;  1HT1 E;  3Q8X A;  4JN6 A;  3KW6 A;  4NRV A;  2CE7 A;  4GRI A;  3AL0 C;  3L25 A;  3M0E A;  5ITX A;  4MM3 B;  1KYI A;  2D7E A;  4FWG A;  3J7B A;  3TWK A;  2ZM6 M;  4LRT A;  4JI4 M;  3HHX A;  4B08 A;  1FJG M;  3SFZ A;  1E94 E;  4GC9 A;  1MU5 A;  3TE6 A;  3L27 A;  1EE8 A;  4RF0 A;  3PNV A;  3U6S A;  2CV0 A;  2BJW A;  4IBJ A;  1HQC A;  4QNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...