4DV0M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv0M02
1N36M 2UXCM 1K3WA 3VK8A 3GQ4A 4X62M 4K0KM 2F5SA 3SASA 1L2BA 3U6EA 3A42A 4LFBM 1IBKM 5ITUA 3J7AS 1MX0A 3C58A 2HKJA 4DV5M 5ITXA 4LFCM 3U6MA 1HNZM 2UXBM 1NNJA 3GPUA 5ITRA 3GQ3A 3GQ5A 4DUYM 4JYAM 1PM5A 4LF7M 1MU5A 4PD2A 5LMUM 2XZUA 2F5OA 1XMQM 3J81S 4DV2M 2UU9M 2ZM6M 4B3RM 1IBMM 4KHPM 5IWAM 4B3SM 3JR4A 4JI2M 1XNRM 2OQ4A 4YHHM 2F5QA 1N32M 3TWKA 1L2CA 3TWMA 1EE8A 4DV6M 3J80S 4DV4M 4DR3M 3VK7A 1HR0M 3JAMS 4G4NA 2VQEM 3U6SA 5IT9S 4JI5M 4LF6M 4DR7M 3SAUA 1Z5BA 3SAWA 2F5PA 1Z59A 1R2ZA 3T1HM 3TWLA 3SAVA 3T1YM 2UUAM 1PJIA 4NRWA 4NRVA 2UUCM 1R2YA 2VQFM 4LFAM 5ITTA 1TDZA 3U6CA 2ZBKB 5ITXE 3W0FA 4JI1M 5FLXS 2UXDM 4PDGA 4G4RA 4G4QA 1Q39A 3GP1A 3A45A 2F5NA 1Q3CA 2Q2EB 4B3MM 1HNXM 4GKJM 3JR5A 4LF9M 4DR6M 1HNWM 4G4OA 3U6PA 1L1ZA 4JI3M 4YY3M 4DV7M 4LF8M 3U6DA 4X64M 1N34M 1K3XA 4LF5M 4DV0M 5A2QS 4LF4M 1L2DA 4PCZA 2OPFA 4JI7M 2E5LM 4DUZM 3U6LA 3A46A 1J5EM 4GKKM 3GPPA 4MB7A 4DV1M 1IBLM 1XNQM 1I94M 3U6OA 4DV3M 4JI8M 1PJJA 4JV5M 1FJGM 1Z5CA 4JI6M 4DR5M 1K82A 5ITYA 1Z5AA 4B3TM 4NXNM 5LMNM 2XZFA 3SARA 4X65M 4CISA 4NXMM 3GO8A 4OX9M 1TDHA 1N33M 2EA0A 2UUBM 1L1TA 4DR1M 3SATA 1KFVA 3DOAA 4JI0M 4DR2M 3SBJA 2HHHM 4DR4M 3U6QA 1XMOM 4ITQA 4JI4M 2F4VM 4PDIA 5BR8M 4X66M 3OTOM 1Q3BA 5ITQA 4AQYM 1XC8A 3GPXA 3GPYA
chains in the Genus database with same CATH superfamily
2DNAA 3C9PA 3M6AA 4GITA 1N36M 1NHGC 2UXCM 4L15A 3A98B 4AG5A 5FTLA 4X62M 3GLIA 4K0KM 3HHXA 4Q7JA 3SASA 3U6EA 3FTEA 4P17A 3FD9A 4LJ8A 2LWXA 1F4IA 2ZTCA 3DZDA 2UXBM 3QAUA 1XXHE 1D0KA 3NBIA 3GQ5A 1WXQA 5C18A 3I01M 1PM5A 3CF2A 4JYAM 4LF7M 4LZZA 1QZMA 4WP2A 1ZMWA 2DVWB 1QZEA 2CV0A 4W5WA 3T6PA 4I81A 2ZM6M 1DGHB 3KS4A 3NBXX 4GIPA 2KNZA 2VF8A 3HY5A 3SHFA 5KQDA 1HQYE 2X8AA 5IWAM 1EIJA 4B08A 1XNRM 3GLGA 4NL4H 2LVOC 4FCTA 2BNKA 2B3TA 3CF0A 3MHVC 5BPVA 2H5XA 4EIWA 3FTFA 4NSRA 3SMPA 4QHTA 3K2LA 1IXZA 4DBGB 3TE6A 3IHPA 2JY8A 5DYIA 2X49A 3WHKA 1SG9A 2QBYB 3PVSA 5EP1A 3KS8A 1Z5BA 2CUZA 2KZSA 5EQTA 2QCUA 1G8PA 2J5YA 3TWLA 4NC6A 4IJFA 3HJSA 4ANRA 3SAVA 3T1YM 4NRWA 2GQFA 1X37A 2K6BA 2G8LA 2JWSA 8CATA 3FUTA 4M9SA 1OQYA 1TDZA 4FVMA 2C9OA 3K8ZA 1IXSB 2DZOB 1VEJA 3L28A 4M0DA 5FLXS 2CHVA 1ZMVA 4D81A 1VEGA 4PDGA 4G4QA 3FYDA 2DWMA 3GP1A 1TR8A 1UM8A 1SXJE 3B7QA 4I5SA 3KP1E 4B3MM 1HNXM 1G59A 1C1KA 2V1CA 3GLHB 1YE9A 4MGHA 3FYCA 5KO3A 3UMMA 1T6OA 4WURA 3LW5F 3AV0A 4G4OA 4CHTB 1L1ZA 3HX3A 4YY3M 2XFSA 3J27B 3I4VA 2FOIC 3ZH9B 4G3OA 3B89A 4MGZE 5FTNA 2Z4SA 2DKLA 3MK6A 1HQCA 1KYIA 3FUVA 4G6ZA 4PT5A 4R3DA 1AIPC 3LCVB 1YLAA 2EO2A 1J5EM 3B9PA 4CGYB 1NSFA 1NY6A 3KVWA 4MB7A 1IBLM 1XNQM 4AI6A 3U6OA 1QANA 3KW6A 4IJEA 3RE8A 4JI8M 1Q02A 3FE3A 1V92A 1Y8GA 1FJGM 3QYBA 3KOYE 1ZMUA 2QSFX 4KT0F 4LJAA 1TTEA 2HAKA 2CV1A 2XZFA 3MMPA 1E32A 1E9RA 2ZANA 4NXMM 3HGIA 4AKGA 3NWLA 3GO8A 4OVZB 3LVWA 4R7GA 3T15A 2G5GX 1WGNA 3VDPA 2UUBM 2Z7JA 2JY6B 1SXJA 3SATA 2I7NA 3F92A 2HHHM 1DO0A 3QYEA 4B7GA 1HT2E 2YFQA 3R9XB 2O25A 2BWEA 3RFWA 1C7YA 1Q3BA 4LFBM 3GPXA 3MJ5A 1OAOC 3KDSE 4LJ4A 5EXXA 1WGLA 3IECA 1IY0A 2F5SA 1PJSA 2DAKA 1IY1A 2V1UA 1L2BA 1IQPA 1PRBA 2YR0A 3A42A 1NJFA 2CP8A 2QZ4A 2HL7A 3J7AS 2CWBA 3FTCA 1T3TA 3FUUA 3C58A 5KQ8A 1Z6TA 5ITXA 1HNZM 2OOBA 1N77A 3VDUA 5DYGA 1D2NA 4GHLA 2KEBA 1QAQA 3AKZA 1IY2A 2XH9A 1IN4A 4R71A 5E26A 1GO5A 3J81S 2UU9M 4GC5A 3AOEC 4I8OA 1IBMM 3VKGA 3C3EA 2LHCA 1QDTA 2KRUA 1A5TA 4JI2M 1JR3E 3HWSA 3JR4A 2FNAA 2WZJA 2WSCF 3UK6A 3GLIB 4IBIA 4B7HA 2KXEA 2K9DA 2R62A 1SXJD 3L25A 2XSZD 3C3DA 3JAMS 2LBCA 1WIVA 2Y0QA 3U6SA 3PFIA 4L4UA 3T38A 2L2DA 4IBKA 1VG5A 1NHWC 4NSOB 3GLFE 3SAWA 2DXIA 4LRSA 2C5RA 3FTDA 4FCWA 1ZAEA 2AHMA 3THGA 4FWGA 4REZA 1LV7A 4ZPXA 1ZQ9A 3B74A 3RGPA 2DWZB 3I4YA 4P16A 2VQFM 4FW9A 1ZV1A 3GLGB 2VDBB 2D7HA 3H4MA 1D0LA 1IM2A 1QDRA 2XEPA 2Y21A 5IZ7D 2DAGA 3V76A 4FD2A 2JZ0A 3U5ZB 1N75A 1NJGA 2F5NA 3Q8XA 1R4GA 3ZC7B 2KA6B 3U5ZA 1D0MA 2YNMD 4GKJM 1XHBA 4Y28F 1DGFA 2EJSA 3TL4X 1NO1A 4GC9A 3HHWA 3U60A 5E6JA 3BXWA 2JY7A 4JI3M 5EP4A 1IN7A 1W5SA 2C99A 2JZ1A 2V6ZM 4L6V6 3SYKA 3U6DA 1S3SA 1K3XA 2LTUA 5A2QS 4DV0M 3R8FA 4LF4M 1L2DA 1J7KA 2L4FA 1PJQA 2O5RA 4OW0A 4DUZM 3A46A 1L8QA 3GLFA 3GPPA 4KODA 1XXHA 2EKFA 1NV9A 4DV1M 1I94M 1VEKA 1GLNA 2KHHA 2X4AA 1QUSA 4GEWA 2D7GA 1PJTA 4F2LA 4JI6M 1K82A 1YSYA 1TGUA 2EUCA 2LHGA 2LNHC 3TQSA 1Z5AA 3FKEA 2M60A 4B3TM 1E94E 1XWIA 2QNJA 4L8RC 2CRUA 1DO2A 3L2AA 3VFDA 3Q8GA 3J2PB 4LJ5A 4KLNA 3AOGA 4OX9M 1TDHA 4IBGA 5F3WA 2RKOA 1GJTA 1OAIA 2DENA 2C98A 3E9SA 1L1TA 1KFVA 3PXGA 1W5TA 4DR2M 3SBJA 2XGNA 3E46A 2K0BX 2LXEA 4JI4M 1WHCA 1OFHA 3ZQJA 2K47A 4PDIA 2CEAA 5EXSA 2W82A 3OTOM 4IBCA 3DFZA 4MGIE 1JR3D 1QQWA 2LVNC 3ILKA 2DHYA 3VK8A 4HEOA 3GQ4A 2J7NA 3CGWA 1IN6A 2FS1A 4UN2B 1R7RA 1OTRA 2APLA 4M9XA 3PNYA 5ITUA 3E21A 1MX0A 3K92A 2HKJA 4GRIA 3GRUA 4D80A 3U6MA 1NNJA 3GPUA 3IG5A 2OOAA 5H37D 5ITRA 1SXJB 2VIIA 5FTMA 1V34A 1CUKA 4IBJA 1OJLA 1MU5A 3GRRA 2XSZA 2YQZA 3KOWE 4MH0E 2XZUA 1G71A 2RRUA 4DV2M 1V33A 2VF7A 3EIEA 4RNAA 3FUXA 4MGKE 1GVNA 2DWLA 1VQ1A 2Y0TA 4AZFA 5KPRA 4LG2A 5GKNA 1TF0B 4LZJA 3ZCBB 2OQ4A 4QOSA 3D8LA 4RKUF 3TWKA 4YHHM 1N32M 1YUBA 1EE8A 4DV6M 1HR0M 4DR3M 3M0EA 3KFUG 1GABA 1QUTA 2JNHA 2R44A 2R4EA 2MH8A 3DA1A 3IG8A 5IT9S 2DZLA 2I7PA 2FH0A 2R45A 1JB0F 4Z8XA 2QP9X 1PJIA 3K9PA 3SMSA 2ZTDA 3KOZE 1MJGM 4XGIA 1R2YA 5ITTA 1AUAA 3SFZA 2ZBKB 5EXPA 4LJ9A 4CJ6A 3U6CA 2KNVA 4JI1M 4QOZC 1TH4A 2BJVA 4D82A 3UZUA 4G4RA 4L16A 2BWBA 1Q39A 4I4LA 4XK8F 2J7OA 1P3QQ 3HHYA 4IBBA 3HU1A 1QVRA 1Q3CA 2MJ5B 1PJJA 1G3IA 4TUWA 4BB9A 2OO9A 1G41A 2JUJA 3JR5A 2ZAOA 4LF9M 2HCBA 4DR6M 1DGGA 2L09A 1HNWM 4HL4A 1IFYA 4FCVA 4LGYA 4IIWA 1DV0A 3U6PA 2JP7A 2R18A 3KP0E 5EP2A 4DV7M 3LQQA 4LF8M 2XLJA 1GJSA 4X64M 1N34M 4LF5M 2QPAA 2R6FA 2Z8YM 4PCZA 2A5YB 2MGWA 3I51A 2RGOA 4M9ZA 1TH2A 1WJ7A 2CHQA 4IBDA 2CHGA 3B7NA 3FRIA 4MGYE 2LVPC 3UJNA 4DV3M 1Z5CA 2LVAA 2RGHA 4BLCA 4JV5M 4JN6A 4DR5M 5ITYA 1NVMA 2DHRA 5IREB 2LVQD 2KW0A 1ORYB 4CISA 1RU3A 3SARA 3TPZA 3UGJA 1N78A 3CF6E 3U60B 1JR3A 2L7HA 4GHAA 2KNAA 4B7FA 2Z4RA 5FTKA 2DWNA 1N33M 2CE7A 3W68A 4FWDA 2GNOA 2JA2A 5C1BA 2DAMA 2XF3A 5DNYA 1VDLA 4LY6A 1DGBA 2DI0A 2WSEF 4DR4M 1NV8A 2JY5A 1G4AE 5EP3A 2D7EA 5BR8M 3GLFB 3BBZA 1XXHB 1DGHA 4IBFA 1OKSA 4XBOA 2DAIA 3HU2A 4HLQA 3KXEC 2XFTA 5L8RF 4AG6A 3U61B 2P5TA 3GLHE 2HWJA 3LMMA 1VDDA 2QENA 4QNRA 3U61A 1K3WA 1PGYA 3HJ8A 1JQJC 1IN5A 2DZNB 1IBKM 1E9SA 1XB2B 1UFZA 3LCUA 4DV5M 3H4JA 5JI3E 3AL0C 4LFCM 4LJ6A 1MN3A 1R6BX 1OIZA 4LRTA 4RF0A 3GQ3A 2QBYA 4DUYM 3FUWA 4MM3B 2NQ8C 1IXRC 1OIPA 3HJQA 4PD2A 5LMUM 2F5OA 2MR9A 2QHOB 1XMQM 4B3RM 3HHZA 4KHPM 2CFOA 2DAEA 4QHSA 4II7A 4B3SM 4FWHA 5EJCA 4OU7A 4A3VB 2KRKA 2F5QA 1IXSA 3QWLA 1QYRA 1L2CA 3TWMA 4LJ7A 3W67A 3J80S 4DV4M 3VK7A 2C9CA 2M5ZA 3HKPA 3PNVA 4G4NA 4F1IA 2VQEM 4GH9A 1TH3A 5FTJA 2FE8A 1EFUB 2KDLA 3GLHA 1OFIA 3AJIB 4JI5M 4LF6M 4DR7M 2R65A 1HJPA 3SAUA 2R0IA 2F5PA 1Z59A 3SYLA 1R2ZA 3T1HM 1QAMA 3BOSA 2L7IA 3GRVA 2UUAM 4AKHA 4BBAA 1I4WA 4L78A 4NRVA 2G3QA 1NNUC 4KO8A 4M0WA 2UUCM 3VKHA 3D8BA 3E4RA 4LFAM 4RF1A 4Z6YA 5ITXE 1T43A 2L6OA 3W0FA 2R46A 2UXDM 3SHGB 3A45A 3KSXA 2ZAMA 3HU3A 2BJWA 2Q2EB 3FRHA 3K1JA 3WHLA 1J09A 1GKIA 3AOEA 2WSFF 2Y20A 3LVVA 1H6UA 2N35A 2L4EA 3GRYA 4QNMA 3SC3A 3LQRA 4OVZA 2C96A 2EKKA 2R4JA 3B7ZA 3I04M 4IBEA 1BVSA 3L29A 3GLIE 1NY5A 3AFHA 1WR1B 2OPFA 3W0LB 4JI7M 2E5LM 1QAOA 2LH0A 3U6LA 4GKKM 1KSFX 2ERCA 3EIHA 4GMQA 2FFJA 5FSWA 2QQ8A 3KSJA 4LCBA 2CV2A 4AKIA 1SXJC 4AW4A 4S12A 3L27A 3J7BA 1LTMA 7CATA 4WW0A 2KZUA 4JXJA 4NXNM 4NOOB 5LMNM 4X65M 4LGMA 5JI2E 3VLFB 1HT1E 2H1RA 1FNNA 5EXTA 5KPTA 5KPZA 3L26A 2EA0A 2MROB 3K9OA 3M7GA 4DR1M 3KOXE 3GLGE 5DFLA 3DOAA 4JI0M 4CIZA 3RGSA 3U6QA 1XMOM 3CTWB 4ITQA 1IN8A 1GL7A 2O01F 2Z3XA 2F4VM 1R5LA 3HZJA 4X66M 1GL6A 5ITQA 1XC8A 4AQYM 3GPYA 2JXNA
chains in the Genus database with same CATH topology
4GITA 3M6AA 1NHGC 2UXCM 4L15A 3A98B 4AG5A 5FTLA 4X62M 3GLIA 4K0KM 3HHXA 3SASA 3U6EA 3FTEA 3FD9A 4LJ8A 2LWXA 3DZDA 2UXBM 3QAUA 3NBIA 3GQ5A 1WXQA 5C18A 1PM5A 4JYAM 3CF2A 4LF7M 4LZZA 1QZMA 2DVWB 2CV0A 4W5WA 2ZM6M 4I81A 1DGHB 3KS4A 4GIPA 3SHFA 5KQDA 1HQYE 2X8AA 5IWAM 4B08A 1XNRM 3GLGA 4NL4H 4FCTA 2BNKA 3CF0A 3MHVC 5BPVA 3FTFA 4EIWA 4NSRA 3SMPA 4QHTA 3K2LA 1IXZA 3TE6A 5DYIA 2X49A 3WHKA 2QBYB 3PVSA 5EP1A 3KS8A 1Z5BA 2CUZA 2KZSA 5EQTA 2QCUA 1G8PA 3TWLA 4IJFA 3HJSA 3SAVA 3T1YM 4NRWA 1X37A 2G8LA 8CATA 3FUTA 4M9SA 1TDZA 4FVMA 2C9OA 3K8ZA 1IXSB 2DZOB 3L28A 4M0DA 5FLXS 2CHVA 4D81A 4PDGA 4G4QA 3FYDA 2DWMA 3GP1A 1UM8A 1SXJE 4I5SA 3KP1E 4B3MM 1HNXM 1G59A 1C1KA 3GLHB 2V1CA 1YE9A 4MGHA 3FYCA 5KO3A 3UMMA 4WURA 3AV0A 4G4OA 4CHTB 1L1ZA 4YY3M 2XFSA 3J27B 3I4VA 2FOIC 3ZH9B 5FTNA 4MGZE 2Z4SA 3MK6A 1HQCA 1KYIA 3FUVA 4G6ZA 4PT5A 4R3DA 1J5EM 2EO2A 3B9PA 4CGYB 1NSFA 1NY6A 3KVWA 4MB7A 1IBLM 1XNQM 4AI6A 3U6OA 1QANA 3KW6A 4IJEA 3RE8A 4JI8M 1FJGM 3KOYE 4LJAA 2CV1A 2XZFA 1E32A 1E9RA 2ZANA 4NXMM 3HGIA 4AKGA 3NWLA 3GO8A 4OVZB 3LVWA 4R7GA 3T15A 2G5GX 3VDPA 2UUBM 2Z7JA 1SXJA 3SATA 2I7NA 2HHHM 1DO0A 4B7GA 1HT2E 2YFQA 3R9XB 3RFWA 1Q3BA 4LFBM 3GPXA 3MJ5A 3KDSE 4LJ4A 5EXXA 1IY0A 2F5SA 1IY1A 2V1UA 1L2BA 1IQPA 2YR0A 3A42A 1NJFA 2QZ4A 2HL7A 3J7AS 3FTCA 1T3TA 3FUUA 3C58A 5KQ8A 1Z6TA 5ITXA 1HNZM 1N77A 3VDUA 5DYGA 1D2NA 4GHLA 2KEBA 1QAQA 3AKZA 1IY2A 2XH9A 1IN4A 5E26A 3J81S 2UU9M 4GC5A 3AOEC 4I8OA 1IBMM 3VKGA 2KRUA 4JI2M 3HWSA 3JR4A 2FNAA 3UK6A 3GLIB 4IBIA 4B7HA 2KXEA 2R62A 1SXJD 3L25A 2XSZD 3JAMS 2Y0QA 3U6SA 3PFIA 4L4UA 3T38A 4IBKA 1NHWC 4NSOB 3SAWA 2DXIA 4LRSA 2C5RA 3FTDA 4FCWA 1ZAEA 2AHMA 3THGA 4FWGA 4REZA 1LV7A 4ZPXA 1ZQ9A 3RGPA 2DWZB 3I4YA 4P16A 2VQFM 4FW9A 3GLGB 2D7HA 3H4MA 1IM2A 2Y21A 2XEPA 5IZ7D 4FD2A 3U5ZB 1N75A 1NJGA 2F5NA 3Q8XA 3ZC7B 2KA6B 3U5ZA 2YNMD 4GKJM 1XHBA 1DGFA 3TL4X 4GC9A 3HHWA 3U60A 5E6JA 4JI3M 5EP4A 1IN7A 1W5SA 2C99A 2V6ZM 3SYKA 3U6DA 1S3SA 1K3XA 4DV0M 5A2QS 3R8FA 4LF4M 1L2DA 1J7KA 4OW0A 2O5RA 4DUZM 3A46A 1L8QA 3GLFA 3GPPA 4KODA 1XXHA 4DV1M 1I94M 1GLNA 2X4AA 2D7GA 4JI6M 1K82A 1YSYA 1TGUA 2EUCA 2LNHC 3TQSA 1Z5AA 3FKEA 2M60A 4B3TM 1E94E 1XWIA 4L8RC 1DO2A 3L2AA 3VFDA 3J2PB 4LJ5A 4KLNA 3AOGA 4OX9M 1TDHA 4IBGA 5F3WA 2RKOA 3E9SA 1L1TA 2C98A 1KFVA 3PXGA 1W5TA 4DR2M 3SBJA 2XGNA 2LXEA 4JI4M 1OFHA 2K47A 4PDIA 2CEAA 5EXSA 2W82A 3OTOM 4IBCA 3DFZA 4MGIE 1JR3D 1QQWA 3ILKA 3VK8A 3GQ4A 2J7NA 1IN6A 1R7RA 4M9XA 3PNYA 5ITUA 1MX0A 3K92A 2HKJA 4GRIA 3GRUA 4D80A 3U6MA 1NNJA 3GPUA 3IG5A 5H37D 5ITRA 1SXJB 2VIIA 5FTMA 4IBJA 1OJLA 1MU5A 3GRRA 2XSZA 2YQZA 3KOWE 4MH0E 2XZUA 4DV2M 3EIEA 4RNAA 3FUXA 4MGKE 1GVNA 2DWLA 2Y0TA 4AZFA 5KPRA 4LG2A 5GKNA 2OQ4A 4LZJA 3ZCBB 4QOSA 3D8LA 4YHHM 3TWKA 1N32M 1YUBA 1EE8A 4DV6M 1HR0M 4DR3M 3M0EA 3KFUG 2R4EA 3DA1A 3IG8A 5IT9S 2I7PA 2R45A 4Z8XA 2QP9X 1PJIA 3SMSA 3KOZE 4XGIA 1R2YA 5ITTA 3SFZA 3U6CA 2ZBKB 5EXPA 4LJ9A 4QOZC 4JI1M 1TH4A 2BJVA 4D82A 3UZUA 4G4RA 4L16A 3HHYA 1Q39A 4I4LA 2J7OA 4IBBA 3HU1A 1QVRA 1Q3CA 1G3IA 4TUWA 4BB9A 1G41A 3JR5A 2ZAOA 4LF9M 2HCBA 4DR6M 1DGGA 2L09A 1HNWM 4HL4A 4FCVA 4LGYA 4IIWA 3U6PA 2R18A 3KP0E 5EP2A 4DV7M 3LQQA 4LF8M 2XLJA 4X64M 1N34M 4LF5M 2QPAA 4PCZA 2A5YB 3I51A 2RGOA 4M9ZA 1TH2A 2CHQA 4IBDA 3UJNA 2CHGA 4MGYE 4DV3M 1PJJA 4JV5M 1Z5CA 2RGHA 4BLCA 4JN6A 4DR5M 5ITYA 1NVMA 2DHRA 5IREB 2KW0A 1ORYB 4CISA 3SARA 3TPZA 3UGJA 1N78A 3CF6E 3U60B 1JR3A 2L7HA 4GHAA 4B7FA 2Z4RA 5FTKA 2DWNA 1N33M 2CE7A 4FWDA 5C1BA 2JA2A 2XF3A 5DNYA 4LY6A 1DGBA 4DR4M 1G4AE 5EP3A 2D7EA 5BR8M 3GLFB 1XXHB 1DGHA 4IBFA 4XBOA 1N36M 3HU2A 4HLQA 3KXEC 2XFTA 4AG6A 3U61B 2P5TA 3LMMA 1VDDA 2QENA 4QNRA 3U61A 1K3WA 3HJ8A 1JQJC 1IN5A 2DZNB 1IBKM 1E9SA 4DV5M 5JI3E 3AL0C 4LFCM 4LJ6A 1R6BX 4LRTA 3GQ3A 4RF0A 2QBYA 4DUYM 3FUWA 4MM3B 2NQ8C 1IXRC 3HJQA 4PD2A 5LMUM 2F5OA 1XMQM 4B3RM 3HHZA 4KHPM 2CFOA 4QHSA 4II7A 4B3SM 4FWHA 5EJCA 4OU7A 4A3VB 2KRKA 2F5QA 3QWLA 1QYRA 1L2CA 3TWMA 4LJ7A 3J80S 4DV4M 3VK7A 2C9CA 2M5ZA 3HKPA 3PNVA 4G4NA 2VQEM 4GH9A 1TH3A 5FTJA 2FE8A 3GLHA 1OFIA 3AJIB 4JI5M 4LF6M 4DR7M 2R65A 3SAUA 2F5PA 1Z59A 3SYLA 1R2ZA 3T1HM 1QAMA 3BOSA 2L7IA 3GRVA 2UUAM 4AKHA 4BBAA 1I4WA 4L78A 4NRVA 4KO8A 1NNUC 4M0WA 2UUCM 3VKHA 3D8BA 3E4RA 4LFAM 4RF1A 4Z6YA 5ITXE 2L6OA 3W0FA 2R46A 2UXDM 3SHGB 3A45A 3KSXA 2ZAMA 3HU3A 2BJWA 2Q2EB 3K1JA 3WHLA 1J09A 1GKIA 3AOEA 2Y20A 3LVVA 1H6UA 3GRYA 3SC3A 4QNMA 3LQRA 4OVZA 2C96A 2R4JA 4IBEA 3L29A 1NY5A 3AFHA 2OPFA 3W0LB 4JI7M 2E5LM 1QAOA 2LH0A 3U6LA 4GKKM 1KSFX 2ERCA 3EIHA 4GMQA 2FFJA 5FSWA 4LCBA 3KSJA 2CV2A 4AKIA 1SXJC 4AW4A 4S12A 3L27A 3J7BA 7CATA 4WW0A 2KZUA 4JXJA 4NXNM 4NOOB 5LMNM 4X65M 4LGMA 5JI2E 3VLFB 1HT1E 2H1RA 1FNNA 5EXTA 5KPTA 5KPZA 3L26A 2EA0A 3M7GA 4DR1M 3KOXE 3DOAA 4JI0M 3RGSA 3U6QA 1XMOM 3CTWB 4ITQA 1IN8A 1GL7A 2Z3XA 2F4VM 4X66M 1GL6A 5ITQA 1XC8A 4AQYM 3GPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 M;  2UXC M;  1K3W A;  3VK8 A;  3GQ4 A;  4X62 M;  4K0K M;  2F5S A;  3SAS A;  1L2B A;  3U6E A;  3A42 A;  4LFB M;  1IBK M;  5ITU A;  3J7A S;  1MX0 A;  3C58 A;  2HKJ A;  4DV5 M;  5ITX A;  4LFC M;  3U6M A;  1HNZ M;  2UXB M;  1NNJ A;  3GPU A;  5ITR A;  3GQ3 A;  3GQ5 A;  4DUY M;  4JYA M;  1PM5 A;  4LF7 M;  1MU5 A;  4PD2 A;  5LMU M;  2XZU A;  2F5O A;  1XMQ M;  3J81 S;  4DV2 M;  2UU9 M;  2ZM6 M;  4B3R M;  1IBM M;  4KHP M;  5IWA M;  4B3S M;  3JR4 A;  4JI2 M;  1XNR M;  2OQ4 A;  4YHH M;  2F5Q A;  1N32 M;  3TWK A;  1L2C A;  3TWM A;  1EE8 A;  4DV6 M;  3J80 S;  4DV4 M;  4DR3 M;  3VK7 A;  1HR0 M;  3JAM S;  4G4N A;  2VQE M;  3U6S A;  5IT9 S;  4JI5 M;  4LF6 M;  4DR7 M;  3SAU A;  1Z5B A;  3SAW A;  2F5P A;  1Z59 A;  1R2Z A;  3T1H M;  3TWL A;  3SAV A;  3T1Y M;  2UUA M;  1PJI A;  4NRW A;  4NRV A;  2UUC M;  1R2Y A;  2VQF M;  4LFA M;  5ITT A;  1TDZ A;  3U6C A;  2ZBK B;  5ITX E;  3W0F A;  4JI1 M;  5FLX S;  2UXD M;  4PDG A;  4G4R A;  4G4Q A;  1Q39 A;  3GP1 A;  3A45 A;  2F5N A;  1Q3C A;  2Q2E B;  4B3M M;  1HNX M;  4GKJ M;  3JR5 A;  4LF9 M;  4DR6 M;  1HNW M;  4G4O A;  3U6P A;  1L1Z A;  4JI3 M;  4YY3 M;  4DV7 M;  4LF8 M;  3U6D A;  4X64 M;  1N34 M;  1K3X A;  4LF5 M;  4DV0 M;  5A2Q S;  4LF4 M;  1L2D A;  4PCZ A;  2OPF A;  4JI7 M;  2E5L M;  4DUZ M;  3U6L A;  3A46 A;  1J5E M;  4GKK M;  3GPP A;  4MB7 A;  4DV1 M;  1IBL M;  1XNQ M;  1I94 M;  3U6O A;  4DV3 M;  4JI8 M;  1PJJ A;  4JV5 M;  1FJG M;  1Z5C A;  4JI6 M;  4DR5 M;  1K82 A;  5ITY A;  1Z5A A;  4B3T M;  4NXN M;  5LMN M;  2XZF A;  3SAR A;  4X65 M;  4CIS A;  4NXM M;  3GO8 A;  4OX9 M;  1TDH A;  1N33 M;  2EA0 A;  2UUB M;  1L1T A;  4DR1 M;  3SAT A;  1KFV A;  3DOA A;  4JI0 M;  4DR2 M;  3SBJ A;  2HHH M;  4DR4 M;  3U6Q A;  1XMO M;  4ITQ A;  4JI4 M;  2F4V M;  4PDI A;  5BR8 M;  4X66 M;  3OTO M;  1Q3B A;  5ITQ A;  4AQY M;  1XC8 A;  3GPX A;  3GPY A; 
#chains in the Genus database with same CATH topology
 2DNA A;  3C9P A;  3M6A A;  4GIT A;  1N36 M;  1NHG C;  2UXC M;  4L15 A;  3A98 B;  4AG5 A;  5FTL A;  4X62 M;  3GLI A;  4K0K M;  3HHX A;  4Q7J A;  3SAS A;  3U6E A;  3FTE A;  4P17 A;  3FD9 A;  4LJ8 A;  2LWX A;  1F4I A;  2ZTC A;  3DZD A;  2UXB M;  3QAU A;  1XXH E;  1D0K A;  3NBI A;  3GQ5 A;  1WXQ A;  5C18 A;  3I01 M;  1PM5 A;  3CF2 A;  4JYA M;  4LF7 M;  4LZZ A;  1QZM A;  4WP2 A;  1ZMW A;  2DVW B;  1QZE A;  2CV0 A;  4W5W A;  3T6P A;  4I81 A;  2ZM6 M;  1DGH B;  3KS4 A;  3NBX X;  4GIP A;  2KNZ A;  2VF8 A;  3HY5 A;  3SHF A;  5KQD A;  1HQY E;  2X8A A;  5IWA M;  1EIJ A;  4B08 A;  1XNR M;  3GLG A;  4NL4 H;  2LVO C;  4FCT A;  2BNK A;  2B3T A;  3CF0 A;  3MHV C;  5BPV A;  2H5X A;  4EIW A;  3FTF A;  4NSR A;  3SMP A;  4QHT A;  3K2L A;  1IXZ A;  4DBG B;  3TE6 A;  3IHP A;  2JY8 A;  5DYI A;  2X49 A;  3WHK A;  1SG9 A;  2QBY B;  3PVS A;  5EP1 A;  3KS8 A;  1Z5B A;  2CUZ A;  2KZS A;  5EQT A;  2QCU A;  1G8P A;  2J5Y A;  3TWL A;  4NC6 A;  4IJF A;  3HJS A;  4ANR A;  3SAV A;  3T1Y M;  4NRW A;  2GQF A;  1X37 A;  2K6B A;  2G8L A;  2JWS A;  8CAT A;  3FUT A;  4M9S A;  1OQY A;  1TDZ A;  4FVM A;  2C9O A;  3K8Z A;  1IXS B;  2DZO B;  1VEJ A;  3L28 A;  4M0D A;  5FLX S;  2CHV A;  1ZMV A;  4D81 A;  1VEG A;  4PDG A;  4G4Q A;  3FYD A;  2DWM A;  3GP1 A;  1TR8 A;  1UM8 A;  1SXJ E;  3B7Q A;  4I5S A;  3KP1 E;  4B3M M;  1HNX M;  1G59 A;  1C1K A;  2V1C A;  3GLH B;  1YE9 A;  4MGH A;  3FYC A;  5KO3 A;  3UMM A;  1T6O A;  4WUR A;  3LW5 F;  3AV0 A;  4G4O A;  4CHT B;  1L1Z A;  3HX3 A;  4YY3 M;  2XFS A;  3J27 B;  3I4V A;  2FOI C;  3ZH9 B;  4G3O A;  3B89 A;  4MGZ E;  5FTN A;  2Z4S A;  2DKL A;  3MK6 A;  1HQC A;  1KYI A;  3FUV A;  4G6Z A;  4PT5 A;  4R3D A;  1AIP C;  3LCV B;  1YLA A;  2EO2 A;  1J5E M;  3B9P A;  4CGY B;  1NSF A;  1NY6 A;  3KVW A;  4MB7 A;  1IBL M;  1XNQ M;  4AI6 A;  3U6O A;  1QAN A;  3KW6 A;  4IJE A;  3RE8 A;  4JI8 M;  1Q02 A;  3FE3 A;  1V92 A;  1Y8G A;  1FJG M;  3QYB A;  3KOY E;  1ZMU A;  2QSF X;  4KT0 F;  4LJA A;  1TTE A;  2HAK A;  2CV1 A;  2XZF A;  3MMP A;  1E32 A;  1E9R A;  2ZAN A;  4NXM M;  3HGI A;  4AKG A;  3NWL A;  3GO8 A;  4OVZ B;  3LVW A;  4R7G A;  3T15 A;  2G5G X;  1WGN A;  3VDP A;  2UUB M;  2Z7J A;  2JY6 B;  1SXJ A;  3SAT A;  2I7N A;  3F92 A;  2HHH M;  1DO0 A;  3QYE A;  4B7G A;  1HT2 E;  2YFQ A;  3R9X B;  2O25 A;  2BWE A;  3RFW A;  1C7Y A;  1Q3B A;  4LFB M;  3GPX A;  3MJ5 A;  1OAO C;  3KDS E;  4LJ4 A;  5EXX A;  1WGL A;  3IEC A;  1IY0 A;  2F5S A;  1PJS A;  2DAK A;  1IY1 A;  2V1U A;  1L2B A;  1IQP A;  1PRB A;  2YR0 A;  3A42 A;  1NJF A;  2CP8 A;  2QZ4 A;  2HL7 A;  3J7A S;  2CWB A;  3FTC A;  1T3T A;  3FUU A;  3C58 A;  5KQ8 A;  1Z6T A;  5ITX A;  1HNZ M;  2OOB A;  1N77 A;  3VDU A;  5DYG A;  1D2N A;  4GHL A;  2KEB A;  1QAQ A;  3AKZ A;  1IY2 A;  2XH9 A;  1IN4 A;  4R71 A;  5E26 A;  1GO5 A;  3J81 S;  2UU9 M;  4GC5 A;  3AOE C;  4I8O A;  1IBM M;  3VKG A;  3C3E A;  2LHC A;  1QDT A;  2KRU A;  1A5T A;  4JI2 M;  1JR3 E;  3HWS A;  3JR4 A;  2FNA A;  2WZJ A;  2WSC F;  3UK6 A;  3GLI B;  4IBI A;  4B7H A;  2KXE A;  2K9D A;  2R62 A;  1SXJ D;  3L25 A;  2XSZ D;  3C3D A;  3JAM S;  2LBC A;  1WIV A;  2Y0Q A;  3U6S A;  3PFI A;  4L4U A;  3T38 A;  2L2D A;  4IBK A;  1VG5 A;  1NHW C;  4NSO B;  3GLF E;  3SAW A;  2DXI A;  4LRS A;  2C5R A;  3FTD A;  4FCW A;  1ZAE A;  2AHM A;  3THG A;  4FWG A;  4REZ A;  1LV7 A;  4ZPX A;  1ZQ9 A;  3B74 A;  3RGP A;  2DWZ B;  3I4Y A;  4P16 A;  2VQF M;  4FW9 A;  1ZV1 A;  3GLG B;  2VDB B;  2D7H A;  3H4M A;  1D0L A;  1IM2 A;  1QDR A;  2XEP A;  2Y21 A;  5IZ7 D;  2DAG A;  3V76 A;  4FD2 A;  2JZ0 A;  3U5Z B;  1N75 A;  1NJG A;  2F5N A;  3Q8X A;  1R4G A;  3ZC7 B;  2KA6 B;  3U5Z A;  1D0M A;  2YNM D;  4GKJ M;  1XHB A;  4Y28 F;  1DGF A;  2EJS A;  3TL4 X;  1NO1 A;  4GC9 A;  3HHW A;  3U60 A;  5E6J A;  3BXW A;  2JY7 A;  4JI3 M;  5EP4 A;  1IN7 A;  1W5S A;  2C99 A;  2JZ1 A;  2V6Z M;  4L6V 6;  3SYK A;  3U6D A;  1S3S A;  1K3X A;  2LTU A;  5A2Q S;  4DV0 M;  3R8F A;  4LF4 M;  1L2D A;  1J7K A;  2L4F A;  1PJQ A;  2O5R A;  4OW0 A;  4DUZ M;  3A46 A;  1L8Q A;  3GLF A;  3GPP A;  4KOD A;  1XXH A;  2EKF A;  1NV9 A;  4DV1 M;  1I94 M;  1VEK A;  1GLN A;  2KHH A;  2X4A A;  1QUS A;  4GEW A;  2D7G A;  1PJT A;  4F2L A;  4JI6 M;  1K82 A;  1YSY A;  1TGU A;  2EUC A;  2LHG A;  2LNH C;  3TQS A;  1Z5A A;  3FKE A;  2M60 A;  4B3T M;  1E94 E;  1XWI A;  2QNJ A;  4L8R C;  2CRU A;  1DO2 A;  3L2A A;  3VFD A;  3Q8G A;  3J2P B;  4LJ5 A;  4KLN A;  3AOG A;  4OX9 M;  1TDH A;  4IBG A;  5F3W A;  2RKO A;  1GJT A;  1OAI A;  2DEN A;  2C98 A;  3E9S A;  1L1T A;  1KFV A;  3PXG A;  1W5T A;  4DR2 M;  3SBJ A;  2XGN A;  3E46 A;  2K0B X;  2LXE A;  4JI4 M;  1WHC A;  1OFH A;  3ZQJ A;  2K47 A;  4PDI A;  2CEA A;  5EXS A;  2W82 A;  3OTO M;  4IBC A;  3DFZ A;  4MGI E;  1JR3 D;  1QQW A;  2LVN C;  3ILK A;  2DHY A;  3VK8 A;  4HEO A;  3GQ4 A;  2J7N A;  3CGW A;  1IN6 A;  2FS1 A;  4UN2 B;  1R7R A;  1OTR A;  2APL A;  4M9X A;  3PNY A;  5ITU A;  3E21 A;  1MX0 A;  3K92 A;  2HKJ A;  4GRI A;  3GRU A;  4D80 A;  3U6M A;  1NNJ A;  3GPU A;  3IG5 A;  2OOA A;  5H37 D;  5ITR A;  1SXJ B;  2VII A;  5FTM A;  1V34 A;  1CUK A;  4IBJ A;  1OJL A;  1MU5 A;  3GRR A;  2XSZ A;  2YQZ A;  3KOW E;  4MH0 E;  2XZU A;  1G71 A;  2RRU A;  4DV2 M;  1V33 A;  2VF7 A;  3EIE A;  4RNA A;  3FUX A;  4MGK E;  1GVN A;  2DWL A;  1VQ1 A;  2Y0T A;  4AZF A;  5KPR A;  4LG2 A;  5GKN A;  1TF0 B;  4LZJ A;  3ZCB B;  2OQ4 A;  4QOS A;  3D8L A;  4RKU F;  3TWK A;  4YHH M;  1N32 M;  1YUB A;  1EE8 A;  4DV6 M;  1HR0 M;  4DR3 M;  3M0E A;  3KFU G;  1GAB A;  1QUT A;  2JNH A;  2R44 A;  2R4E A;  2MH8 A;  3DA1 A;  3IG8 A;  5IT9 S;  2DZL A;  2I7P A;  2FH0 A;  2R45 A;  1JB0 F;  4Z8X A;  2QP9 X;  1PJI A;  3K9P A;  3SMS A;  2ZTD A;  3KOZ E;  1MJG M;  4XGI A;  1R2Y A;  5ITT A;  1AUA A;  3SFZ A;  2ZBK B;  5EXP A;  4LJ9 A;  4CJ6 A;  3U6C A;  2KNV A;  4JI1 M;  4QOZ C;  1TH4 A;  2BJV A;  4D82 A;  3UZU A;  4G4R A;  4L16 A;  2BWB A;  1Q39 A;  4I4L A;  4XK8 F;  2J7O A;  1P3Q Q;  3HHY A;  4IBB A;  3HU1 A;  1QVR A;  1Q3C A;  2MJ5 B;  1PJJ A;  1G3I A;  4TUW A;  4BB9 A;  2OO9 A;  1G41 A;  2JUJ A;  3JR5 A;  2ZAO A;  4LF9 M;  2HCB A;  4DR6 M;  1DGG A;  2L09 A;  1HNW M;  4HL4 A;  1IFY A;  4FCV A;  4LGY A;  4IIW A;  1DV0 A;  3U6P A;  2JP7 A;  2R18 A;  3KP0 E;  5EP2 A;  4DV7 M;  3LQQ A;  4LF8 M;  2XLJ A;  1GJS A;  4X64 M;  1N34 M;  4LF5 M;  2QPA A;  2R6F A;  2Z8Y M;  4PCZ A;  2A5Y B;  2MGW A;  3I51 A;  2RGO A;  4M9Z A;  1TH2 A;  1WJ7 A;  2CHQ A;  4IBD A;  2CHG A;  3B7N A;  3FRI A;  4MGY E;  2LVP C;  3UJN A;  4DV3 M;  1Z5C A;  2LVA A;  2RGH A;  4BLC A;  4JV5 M;  4JN6 A;  4DR5 M;  5ITY A;  1NVM A;  2DHR A;  5IRE B;  2LVQ D;  2KW0 A;  1ORY B;  4CIS A;  1RU3 A;  3SAR A;  3TPZ A;  3UGJ A;  1N78 A;  3CF6 E;  3U60 B;  1JR3 A;  2L7H A;  4GHA A;  2KNA A;  4B7F A;  2Z4R A;  5FTK A;  2DWN A;  1N33 M;  2CE7 A;  3W68 A;  4FWD A;  2GNO A;  2JA2 A;  5C1B A;  2DAM A;  2XF3 A;  5DNY A;  1VDL A;  4LY6 A;  1DGB A;  2DI0 A;  2WSE F;  4DR4 M;  1NV8 A;  2JY5 A;  1G4A E;  5EP3 A;  2D7E A;  5BR8 M;  3GLF B;  3BBZ A;  1XXH B;  1DGH A;  4IBF A;  1OKS A;  4XBO A;  2DAI A;  3HU2 A;  4HLQ A;  3KXE C;  2XFT A;  5L8R F;  4AG6 A;  3U61 B;  2P5T A;  3GLH E;  2HWJ A;  3LMM A;  1VDD A;  2QEN A;  4QNR A;  3U61 A;  1K3W A;  1PGY A;  3HJ8 A;  1JQJ C;  1IN5 A;  2DZN B;  1IBK M;  1E9S A;  1XB2 B;  1UFZ A;  3LCU A;  4DV5 M;  3H4J A;  5JI3 E;  3AL0 C;  4LFC M;  4LJ6 A;  1MN3 A;  1R6B X;  1OIZ A;  4LRT A;  4RF0 A;  3GQ3 A;  2QBY A;  4DUY M;  3FUW A;  4MM3 B;  2NQ8 C;  1IXR C;  1OIP A;  3HJQ A;  4PD2 A;  5LMU M;  2F5O A;  2MR9 A;  2QHO B;  1XMQ M;  4B3R M;  3HHZ A;  4KHP M;  2CFO A;  2DAE A;  4QHS A;  4II7 A;  4B3S M;  4FWH A;  5EJC A;  4OU7 A;  4A3V B;  2KRK A;  2F5Q A;  1IXS A;  3QWL A;  1QYR A;  1L2C A;  3TWM A;  4LJ7 A;  3W67 A;  3J80 S;  4DV4 M;  3VK7 A;  2C9C A;  2M5Z A;  3HKP A;  3PNV A;  4G4N A;  4F1I A;  2VQE M;  4GH9 A;  1TH3 A;  5FTJ A;  2FE8 A;  1EFU B;  2KDL A;  3GLH A;  1OFI A;  3AJI B;  4JI5 M;  4LF6 M;  4DR7 M;  2R65 A;  1HJP A;  3SAU A;  2R0I A;  2F5P A;  1Z59 A;  3SYL A;  1R2Z A;  3T1H M;  1QAM A;  3BOS A;  2L7I A;  3GRV A;  2UUA M;  4AKH A;  4BBA A;  1I4W A;  4L78 A;  4NRV A;  2G3Q A;  1NNU C;  4KO8 A;  4M0W A;  2UUC M;  3VKH A;  3D8B A;  3E4R A;  4LFA M;  4RF1 A;  4Z6Y A;  5ITX E;  1T43 A;  2L6O A;  3W0F A;  2R46 A;  2UXD M;  3SHG B;  3A45 A;  3KSX A;  2ZAM A;  3HU3 A;  2BJW A;  2Q2E B;  3FRH A;  3K1J A;  3WHL A;  1J09 A;  1GKI A;  3AOE A;  2WSF F;  2Y20 A;  3LVV A;  1H6U A;  2N35 A;  2L4E A;  3GRY A;  4QNM A;  3SC3 A;  3LQR A;  4OVZ A;  2C96 A;  2EKK A;  2R4J A;  3B7Z A;  3I04 M;  4IBE A;  1BVS A;  3L29 A;  3GLI E;  1NY5 A;  3AFH A;  1WR1 B;  2OPF A;  3W0L B;  4JI7 M;  2E5L M;  1QAO A;  2LH0 A;  3U6L A;  4GKK M;  1KSF X;  2ERC A;  3EIH A;  4GMQ A;  2FFJ A;  5FSW A;  2QQ8 A;  3KSJ A;  4LCB A;  2CV2 A;  4AKI A;  1SXJ C;  4AW4 A;  4S12 A;  3L27 A;  3J7B A;  1LTM A;  7CAT A;  4WW0 A;  2KZU A;  4JXJ A;  4NXN M;  4NOO B;  5LMN M;  4X65 M;  4LGM A;  5JI2 E;  3VLF B;  1HT1 E;  2H1R A;  1FNN A;  5EXT A;  5KPT A;  5KPZ A;  3L26 A;  2EA0 A;  2MRO B;  3K9O A;  3M7G A;  4DR1 M;  3KOX E;  3GLG E;  5DFL A;  3DOA A;  4JI0 M;  4CIZ A;  3RGS A;  3U6Q A;  1XMO M;  3CTW B;  4ITQ A;  1IN8 A;  1GL7 A;  2O01 F;  2Z3X A;  2F4V M;  1R5L A;  3HZJ A;  4X66 M;  1GL6 A;  5ITQ A;  1XC8 A;  4AQY M;  3GPY A;  2JXN A; 
#chains in the Genus database with same CATH homology
 4GIT A;  3M6A A;  1NHG C;  2UXC M;  4L15 A;  3A98 B;  4AG5 A;  5FTL A;  4X62 M;  3GLI A;  4K0K M;  3HHX A;  3SAS A;  3U6E A;  3FTE A;  3FD9 A;  4LJ8 A;  2LWX A;  3DZD A;  2UXB M;  3QAU A;  3NBI A;  3GQ5 A;  1WXQ A;  5C18 A;  1PM5 A;  4JYA M;  3CF2 A;  4LF7 M;  4LZZ A;  1QZM A;  2DVW B;  2CV0 A;  4W5W A;  2ZM6 M;  4I81 A;  1DGH B;  3KS4 A;  4GIP A;  3SHF A;  5KQD A;  1HQY E;  2X8A A;  5IWA M;  4B08 A;  1XNR M;  3GLG A;  4NL4 H;  4FCT A;  2BNK A;  3CF0 A;  3MHV C;  5BPV A;  3FTF A;  4EIW A;  4NSR A;  3SMP A;  4QHT A;  3K2L A;  1IXZ A;  3TE6 A;  5DYI A;  2X49 A;  3WHK A;  2QBY B;  3PVS A;  5EP1 A;  3KS8 A;  1Z5B A;  2CUZ A;  2KZS A;  5EQT A;  2QCU A;  1G8P A;  3TWL A;  4IJF A;  3HJS A;  3SAV A;  3T1Y M;  4NRW A;  1X37 A;  2G8L A;  8CAT A;  3FUT A;  4M9S A;  1TDZ A;  4FVM A;  2C9O A;  3K8Z A;  1IXS B;  2DZO B;  3L28 A;  4M0D A;  5FLX S;  2CHV A;  4D81 A;  4PDG A;  4G4Q A;  3FYD A;  2DWM A;  3GP1 A;  1UM8 A;  1SXJ E;  4I5S A;  3KP1 E;  4B3M M;  1HNX M;  1G59 A;  1C1K A;  3GLH B;  2V1C A;  1YE9 A;  4MGH A;  3FYC A;  5KO3 A;  3UMM A;  4WUR A;  3AV0 A;  4G4O A;  4CHT B;  1L1Z A;  4YY3 M;  2XFS A;  3J27 B;  3I4V A;  2FOI C;  3ZH9 B;  5FTN A;  4MGZ E;  2Z4S A;  3MK6 A;  1HQC A;  1KYI A;  3FUV A;  4G6Z A;  4PT5 A;  4R3D A;  1J5E M;  2EO2 A;  3B9P A;  4CGY B;  1NSF A;  1NY6 A;  3KVW A;  4MB7 A;  1IBL M;  1XNQ M;  4AI6 A;  3U6O A;  1QAN A;  3KW6 A;  4IJE A;  3RE8 A;  4JI8 M;  1FJG M;  3KOY E;  4LJA A;  2CV1 A;  2XZF A;  1E32 A;  1E9R A;  2ZAN A;  4NXM M;  3HGI A;  4AKG A;  3NWL A;  3GO8 A;  4OVZ B;  3LVW A;  4R7G A;  3T15 A;  2G5G X;  3VDP A;  2UUB M;  2Z7J A;  1SXJ A;  3SAT A;  2I7N A;  2HHH M;  1DO0 A;  4B7G A;  1HT2 E;  2YFQ A;  3R9X B;  3RFW A;  1Q3B A;  4LFB M;  3GPX A;  3MJ5 A;  3KDS E;  4LJ4 A;  5EXX A;  1IY0 A;  2F5S A;  1IY1 A;  2V1U A;  1L2B A;  1IQP A;  2YR0 A;  3A42 A;  1NJF A;  2QZ4 A;  2HL7 A;  3J7A S;  3FTC A;  1T3T A;  3FUU A;  3C58 A;  5KQ8 A;  1Z6T A;  5ITX A;  1HNZ M;  1N77 A;  3VDU A;  5DYG A;  1D2N A;  4GHL A;  2KEB A;  1QAQ A;  3AKZ A;  1IY2 A;  2XH9 A;  1IN4 A;  5E26 A;  3J81 S;  2UU9 M;  4GC5 A;  3AOE C;  4I8O A;  1IBM M;  3VKG A;  2KRU A;  4JI2 M;  3HWS A;  3JR4 A;  2FNA A;  3UK6 A;  3GLI B;  4IBI A;  4B7H A;  2KXE A;  2R62 A;  1SXJ D;  3L25 A;  2XSZ D;  3JAM S;  2Y0Q A;  3U6S A;  3PFI A;  4L4U A;  3T38 A;  4IBK A;  1NHW C;  4NSO B;  3SAW A;  2DXI A;  4LRS A;  2C5R A;  3FTD A;  4FCW A;  1ZAE A;  2AHM A;  3THG A;  4FWG A;  4REZ A;  1LV7 A;  4ZPX A;  1ZQ9 A;  3RGP A;  2DWZ B;  3I4Y A;  4P16 A;  2VQF M;  4FW9 A;  3GLG B;  2D7H A;  3H4M A;  1IM2 A;  2Y21 A;  2XEP A;  5IZ7 D;  4FD2 A;  3U5Z B;  1N75 A;  1NJG A;  2F5N A;  3Q8X A;  3ZC7 B;  2KA6 B;  3U5Z A;  2YNM D;  4GKJ M;  1XHB A;  1DGF A;  3TL4 X;  4GC9 A;  3HHW A;  3U60 A;  5E6J A;  4JI3 M;  5EP4 A;  1IN7 A;  1W5S A;  2C99 A;  2V6Z M;  3SYK A;  3U6D A;  1S3S A;  1K3X A;  4DV0 M;  5A2Q S;  3R8F A;  4LF4 M;  1L2D A;  1J7K A;  4OW0 A;  2O5R A;  4DUZ M;  3A46 A;  1L8Q A;  3GLF A;  3GPP A;  4KOD A;  1XXH A;  4DV1 M;  1I94 M;  1GLN A;  2X4A A;  2D7G A;  4JI6 M;  1K82 A;  1YSY A;  1TGU A;  2EUC A;  2LNH C;  3TQS A;  1Z5A A;  3FKE A;  2M60 A;  4B3T M;  1E94 E;  1XWI A;  4L8R C;  1DO2 A;  3L2A A;  3VFD A;  3J2P B;  4LJ5 A;  4KLN A;  3AOG A;  4OX9 M;  1TDH A;  4IBG A;  5F3W A;  2RKO A;  3E9S A;  1L1T A;  2C98 A;  1KFV A;  3PXG A;  1W5T A;  4DR2 M;  3SBJ A;  2XGN A;  2LXE A;  4JI4 M;  1OFH A;  2K47 A;  4PDI A;  2CEA A;  5EXS A;  2W82 A;  3OTO M;  4IBC A;  3DFZ A;  4MGI E;  1JR3 D;  1QQW A;  3ILK A;  3VK8 A;  3GQ4 A;  2J7N A;  1IN6 A;  1R7R A;  4M9X A;  3PNY A;  5ITU A;  1MX0 A;  3K92 A;  2HKJ A;  4GRI A;  3GRU A;  4D80 A;  3U6M A;  1NNJ A;  3GPU A;  3IG5 A;  5H37 D;  5ITR A;  1SXJ B;  2VII A;  5FTM A;  4IBJ A;  1OJL A;  1MU5 A;  3GRR A;  2XSZ A;  2YQZ A;  3KOW E;  4MH0 E;  2XZU A;  4DV2 M;  3EIE A;  4RNA A;  3FUX A;  4MGK E;  1GVN A;  2DWL A;  2Y0T A;  4AZF A;  5KPR A;  4LG2 A;  5GKN A;  2OQ4 A;  4LZJ A;  3ZCB B;  4QOS A;  3D8L A;  4YHH M;  3TWK A;  1N32 M;  1YUB A;  1EE8 A;  4DV6 M;  1HR0 M;  4DR3 M;  3M0E A;  3KFU G;  2R4E A;  3DA1 A;  3IG8 A;  5IT9 S;  2I7P A;  2R45 A;  4Z8X A;  2QP9 X;  1PJI A;  3SMS A;  3KOZ E;  4XGI A;  1R2Y A;  5ITT A;  3SFZ A;  3U6C A;  2ZBK B;  5EXP A;  4LJ9 A;  4QOZ C;  4JI1 M;  1TH4 A;  2BJV A;  4D82 A;  3UZU A;  4G4R A;  4L16 A;  3HHY A;  1Q39 A;  4I4L A;  2J7O A;  4IBB A;  3HU1 A;  1QVR A;  1Q3C A;  1G3I A;  4TUW A;  4BB9 A;  1G41 A;  3JR5 A;  2ZAO A;  4LF9 M;  2HCB A;  4DR6 M;  1DGG A;  2L09 A;  1HNW M;  4HL4 A;  4FCV A;  4LGY A;  4IIW A;  3U6P A;  2R18 A;  3KP0 E;  5EP2 A;  4DV7 M;  3LQQ A;  4LF8 M;  2XLJ A;  4X64 M;  1N34 M;  4LF5 M;  2QPA A;  4PCZ A;  2A5Y B;  3I51 A;  2RGO A;  4M9Z A;  1TH2 A;  2CHQ A;  4IBD A;  3UJN A;  2CHG A;  4MGY E;  4DV3 M;  1PJJ A;  4JV5 M;  1Z5C A;  2RGH A;  4BLC A;  4JN6 A;  4DR5 M;  5ITY A;  1NVM A;  2DHR A;  5IRE B;  2KW0 A;  1ORY B;  4CIS A;  3SAR A;  3TPZ A;  3UGJ A;  1N78 A;  3CF6 E;  3U60 B;  1JR3 A;  2L7H A;  4GHA A;  4B7F A;  2Z4R A;  5FTK A;  2DWN A;  1N33 M;  2CE7 A;  4FWD A;  5C1B A;  2JA2 A;  2XF3 A;  5DNY A;  4LY6 A;  1DGB A;  4DR4 M;  1G4A E;  5EP3 A;  2D7E A;  5BR8 M;  3GLF B;  1XXH B;  1DGH A;  4IBF A;  4XBO A;  1N36 M;  3HU2 A;  4HLQ A;  3KXE C;  2XFT A;  4AG6 A;  3U61 B;  2P5T A;  3LMM A;  1VDD A;  2QEN A;  4QNR A;  3U61 A;  1K3W A;  3HJ8 A;  1JQJ C;  1IN5 A;  2DZN B;  1IBK M;  1E9S A;  4DV5 M;  5JI3 E;  3AL0 C;  4LFC M;  4LJ6 A;  1R6B X;  4LRT A;  3GQ3 A;  4RF0 A;  2QBY A;  4DUY M;  3FUW A;  4MM3 B;  2NQ8 C;  1IXR C;  3HJQ A;  4PD2 A;  5LMU M;  2F5O A;  1XMQ M;  4B3R M;  3HHZ A;  4KHP M;  2CFO A;  4QHS A;  4II7 A;  4B3S M;  4FWH A;  5EJC A;  4OU7 A;  4A3V B;  2KRK A;  2F5Q A;  3QWL A;  1QYR A;  1L2C A;  3TWM A;  4LJ7 A;  3J80 S;  4DV4 M;  3VK7 A;  2C9C A;  2M5Z A;  3HKP A;  3PNV A;  4G4N A;  2VQE M;  4GH9 A;  1TH3 A;  5FTJ A;  2FE8 A;  3GLH A;  1OFI A;  3AJI B;  4JI5 M;  4LF6 M;  4DR7 M;  2R65 A;  3SAU A;  2F5P A;  1Z59 A;  3SYL A;  1R2Z A;  3T1H M;  1QAM A;  3BOS A;  2L7I A;  3GRV A;  2UUA M;  4AKH A;  4BBA A;  1I4W A;  4L78 A;  4NRV A;  4KO8 A;  1NNU C;  4M0W A;  2UUC M;  3VKH A;  3D8B A;  3E4R A;  4LFA M;  4RF1 A;  4Z6Y A;  5ITX E;  2L6O A;  3W0F A;  2R46 A;  2UXD M;  3SHG B;  3A45 A;  3KSX A;  2ZAM A;  3HU3 A;  2BJW A;  2Q2E B;  3K1J A;  3WHL A;  1J09 A;  1GKI A;  3AOE A;  2Y20 A;  3LVV A;  1H6U A;  3GRY A;  3SC3 A;  4QNM A;  3LQR A;  4OVZ A;  2C96 A;  2R4J A;  4IBE A;  3L29 A;  1NY5 A;  3AFH A;  2OPF A;  3W0L B;  4JI7 M;  2E5L M;  1QAO A;  2LH0 A;  3U6L A;  4GKK M;  1KSF X;  2ERC A;  3EIH A;  4GMQ A;  2FFJ A;  5FSW A;  4LCB A;  3KSJ A;  2CV2 A;  4AKI A;  1SXJ C;  4AW4 A;  4S12 A;  3L27 A;  3J7B A;  7CAT A;  4WW0 A;  2KZU A;  4JXJ A;  4NXN M;  4NOO B;  5LMN M;  4X65 M;  4LGM A;  5JI2 E;  3VLF B;  1HT1 E;  2H1R A;  1FNN A;  5EXT A;  5KPT A;  5KPZ A;  3L26 A;  2EA0 A;  3M7G A;  4DR1 M;  3KOX E;  3DOA A;  4JI0 M;  3RGS A;  3U6Q A;  1XMO M;  3CTW B;  4ITQ A;  1IN8 A;  1GL7 A;  2Z3X A;  2F4V M;  4X66 M;  1GL6 A;  5ITQ A;  1XC8 A;  4AQY M;  3GPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...