4DV0M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv0M02
1L2DA 2UXCM 1HNWM 1HR0M 2E5LM 4DR6M 4DR4M 3J7AS 3TWMA 4KHPM 4JI1M 2Q2EB 1IBKM 1N33M 4B3SM 5ITTA 1XNQM 1EE8A 5LMUM 4DV5M 1MX0A 1XMOM 3SASA 4JI7M 1Z5AA 4CISA 4PD2A 3SATA 4DR1M 1N36M 4B3RM 4PDGA 4G4QA 3U6MA 4DV7M 3GQ5A 1FJGM 4LF8M 4X65M 1KFVA 4AQYM 4LF6M 2ZM6M 3U6SA 4YY3M 3SARA 4ITQA 3GPUA 5ITRA 3U6CA 4LF5M 5ITQA 4GKKM 3U6DA 1IBLM 2F4VM 1HNXM 3JR5A 3SAVA 4YHHM 2VQEM 1NNJA 3VK7A 1HNZM 4X64M 1PJJA 4B3TM 4K0KM 3JAMS 3J80S 1N32M 3VK8A 1MU5A 3SAWA 1L2BA 3GPYA 4LFAM 3A46A 4B3MM 1Z59A 4JI8M 3W0FA 4PCZA 3GO8A 3TWLA 4JI6M 5BR8M 4G4RA 2EA0A 4DV0M 2OPFA 2ZBKB 3J81S 2F5PA 4DR3M 3DOAA 3TWKA 4NXNM 2HKJA 1PM5A 1IBMM 3GP1A 3U6PA 4OX9M 4NRVA 4JI2M 3U6OA 3A45A 2VQFM 3T1YM 4NRWA 2UUAM 2OQ4A 5ITXA 5A2QS 3SBJA 4NXMM 1Q39A 5FLXS 5IT9S 3GQ3A 4DR5M 1TDHA 4JYAM 4LF7M 4LF9M 4G4OA 3GQ4A 4JI0M 4X66M 4LFCM 2UUCM 1Q3BA 3T1HM 4DUYM 1K3WA 4LFBM 4GKJM 1TDZA 1J5EM 5IWAM 2HHHM 3GPXA 3JR4A 1L1ZA 4G4NA 1XC8A 4DUZM 4DV1M 1K82A 1L1TA 4MB7A 1PJIA 3U6LA 1Z5BA 1XNRM 2F5NA 1Q3CA 4JI5M 2F5SA 4JV5M 2F5OA 1K3XA 3SAUA 4JI4M 1I94M 1L2CA 4DV3M 1R2YA 4DV4M 5ITUA 4DV2M 4DV6M 2F5QA 2UXDM 3U6QA 3OTOM 3C58A 3A42A 5LMNM 4JI3M 1XMQM 4LF4M 2XZUA 2XZFA 3GPPA 2UXBM 2UUBM 5ITYA 2UU9M 4X62M 4DR7M 1N34M 4PDIA 1Z5CA 1R2ZA 4DR2M 5ITXE 3U6EA
chains in the Genus database with same CATH superfamily
5EP4A 3Q8GA 1IN7A 2UXCM 2FS1A 1HR0M 1XHBA 2Y0TA 3A98B 3L2AA 4DR4M 1KSFX 4AI6A 3MMPA 4IBDA 2FE8A 2JY7A 4RKUF 3B7NA 3CF0A 1UFZA 1N33M 1WGNA 2KW0A 2O01F 3CF2A 3HHXA 5ITTA 4GHAA 1IFYA 8CATA 3J27B 1D2NA 2Z7JA 4QNMA 3LVVA 5C1BA 1N36M 1JR3E 4W5WA 2VF8A 2MROB 2CUZA 1QYRA 4ANRA 3R9XB 3GLHA 4WP2A 5KO3A 4II7A 2OOAA 2H1RA 1CUKA 2KXEA 2LXEA 1D0MA 2JZ1A 2P5TA 1MJGM 1IXZA 2ZAMA 3DFZA 3I51A 4MGKE 1WJ7A 4LF6M 2ZM6M 2L6OA 2C5RA 1SG9A 1TTEA 3H4MA 4YY3M 1JB0F 3T15A 1TH3A 5EJCA 4RF0A 4ITQA 2Y20A 4GC9A 1YSYA 3GPUA 1SXJE 3FYDA 1WR1B 3BBZA 1WHCA 4M0DA 2CV0A 2F4VM 1HNXM 3JR5A 3HHZA 1L8QA 3SAVA 3ZCBB 1VDDA 3SHGB 3SFZA 4B3TM 1NJGA 2XFTA 3JAMS 4K0KM 5DYGA 2R0IA 3TQSA 3KOXE 1TR8A 3A46A 2QP9X 3FTFA 4PCZA 3TWLA 4D80A 4G4RA 2G5GX 1GL7A 1RU3A 3ZC7B 3BXWA 2ZBKB 3J81S 3SMPA 5E26A 2KNVA 2CHVA 4L6V6 3DOAA 3AFHA 2M60A 4HL4A 4NXNM 2N35A 1PM5A 1F4IA 4NRVA 2L2DA 4JI2M 3HWSA 2VF7A 2WSEF 2FFJA 3GRUA 2C98A 2FNAA 4P17A 1Q39A 3HX3A 1TDHA 4EIWA 4JYAM 1TF0B 2HL7A 3J2PB 3RGSA 4LF7M 4LF9M 4M0WA 2DWLA 3GQ4A 4G4OA 4A3VB 1FJGM 4IIWA 2CV1A 1R4GA 4OW0A 5DFLA 2Z3XA 2MGWA 3E46A 1Q3BA 2R18A 1VQ1A 2MH8A 1R6BX 3LVWA 3DA1A 1TDZA 1J5EM 1FNNA 3I01M 2DXIA 4IBJA 5E6JA 3V76A 2DZLA 3QWLA 2K6BA 4GEWA 1K82A 1W5SA 3GLGE 2JY5A 3GRVA 3WHLA 3UGJA 2CHGA 1UM8A 1NSFA 3GLIE 2J7OA 1OAOC 2EO2A 3WHKA 4JV5M 2LBCA 1K3XA 3SAUA 2XSZA 1I94M 3FUTA 5IREB 3U61B 1ZMUA 1ZMVA 5JI2E 2R4JA 2ZTDA 2RGOA 5EXSA 2Y21A 1G4AE 2Y0QA 2YNMD 4DV6M 4GHLA 1H6UA 4L15A 1T3TA 3KP1E 5L8RF 2DZNB 2C99A 1YLAA 1WXQA 1DV0A 1IN5A 3A42A 3M7GA 3L25A 2O5RA 4JI3M 5EXTA 2LHCA 1XXHA 3C3EA 4G6ZA 2CRUA 2XZFA 3GPPA 2FOIC 4QHSA 1QANA 2UXBM 1ZAEA 3L29A 4I5SA 2UU9M 3MJ5A 4FWDA 1DO2A 2K0BX 2QENA 3IECA 4PDIA 5BPVA 5ITXE 1QDRA 3C3DA 3NBXX 4LJ7A 4MM3B 1HT1E 1QUTA 1HNWM 2C9OA 3PNVA 1QUSA 4KHPM 4KODA 2XSZD 4CIZA 3QAUA 4LJ5A 1IBKM 4B3SM 2XEPA 1BVSA 1EE8A 5LMUM 4OVZB 4DV5M 1IN4A 1XMOM 3LQQA 2LWXA 1Z5AA 2R65A 4B7FA 4DR1M 5DYIA 3HU1A 5KQDA 1DGHA 5KPZA 1WGLA 4AKGA 2WSFF 4LY6A 2CV2A 1V34A 2WZJA 2ZANA 3U6MA 3KS8A 3FKEA 3FD9A 3GQ5A 1GJSA 4QOZC 3HKPA 4AQYM 1IXSB 4LJ8A 2DWZB 3U60A 4HLQA 2B3TA 2CFOA 2DAIA 2QSFX 5FTKA 3ILKA 1TH2A 3LMMA 1NY5A 5ITRA 3U6CA 3SYLA 2EKKA 5ITQA 3U6DA 3B74A 1IBLM 2CE7A 3EIHA 4Z8XA 1IXRC 1Z6TA 3K9PA 3I4VA 1E32A 1J09A 1G71A 4GITA 1DO0A 1DGFA 3KP0E 4NSRA 2VQEM 1PJJA 1IN8A 1GABA 3L27A 4GH9A 2R4EA 3LCVB 2K47A 5KQ8A 1TH4A 3PNYA 2V1CA 1Y8GA 2VDBB 2DHYA 2LVQD 4DBGB 3GO8A 4JI6M 3CTWB 1G59A 4FCTA 1SXJC 2EA0A 2OPFA 1GKIA 1ZQ9A 5FTJA 2DI0A 3TWKA 2J5YA 3B9PA 4OX9M 3AKZA 4NL4H 3AOEA 4XBOA 3M6AA 5C18A 1SXJA 3A45A 3GLFB 2VQFM 3T1YM 2DWMA 3U5ZA 2OQ4A 4I81A 2RKOA 3C9PA 4TUWA 1VEJA 5ITXA 5IT9S 3EIEA 4B08A 4DR5M 2D7EA 3QYEA 3LCUA 3VLFB 2DAEA 4JI0M 4X66M 3M0EA 3FUUA 1NV9A 1EIJA 3KSXA 3CF6E 4R71A 4LZZA 1IY2A 1E9SA 1P3QQ 4LFBM 1VEKA 3KFUG 3VFDA 3FTCA 2Z4RA 3KS4A 1GL6A 3CGWA 2HHHM 2XLJA 2L7IA 4G4NA 2MR9A 1YE9A 2JY6B 1L1TA 4MB7A 1YUBA 3RFWA 2KZUA 2ZAOA 2G3QA 4JI5M 4CJ6A 4IBFA 1NY6A 1E9RA 3K8ZA 1GVNA 1QDTA 2CWBA 3E9SA 1NVMA 3U61A 1G3IA 3IHPA 3L28A 1R2YA 4DV4M 2HWJA 2CHQA 1KYIA 2XF3A 1G8PA 2F5QA 2O25A 2UXDM 1AIPC 4CGYB 2C9CA 4MGIE 3F92A 5LMNM 4OVZA 1XMQM 4LF4M 3NWLA 5FSWA 2DHRA 2BJVA 3FYCA 1NV8A 2A5YB 3B89A 4FVMA 1SXJD 4DR2M 4L8RC 3K2LA 4WW0A 3U6EA 1QZMA 1A5TA 4QOSA 2J7NA 1JR3A 2JNHA 2KNAA 1R7RA 2I7PA 3K92A 3W67A 2D7GA 4LCBA 1OQYA 1Q02A 3TWMA 2KEBA 3AOEC 4FD2A 1IY1A 2KZSA 2Q2EB 2KA6B 1W5TA 4MH0E 1VDLA 3UMMA 2R44A 1SXJB 3L26A 3GLFA 1PJQA 1HJPA 4D82A 3SASA 4JI7M 4CISA 4PD2A 3SATA 4M9ZA 1IY0A 4IBKA 5EP2A 2H5XA 2L4FA 5EQTA 3SC3A 2V1UA 4AKIA 5KPRA 4PT5A 4LF8M 4X65M 3GLIB 4QHTA 1KFVA 2R6FA 3U6SA 3I04M 4REZA 2M5ZA 4FWGA 3SARA 2X4AA 4LZJA 1TGUA 3GRRA 1OIZA 1XWIA 3GLHE 4BLCA 3E21A 2DWNA 3FTDA 2W82A 4M9XA 4FCWA 3U60B 2EKFA 1QAMA 5EP1A 1C1KA 4F1IA 4KO8A 4YHHM 4M9SA 5GKNA 4X64M 1ZV1A 3VK7A 1N32M 1MU5A 1L2BA 2XGNA 4LFAM 2KRUA 1G41A 1Z59A 2DVWB 3AJIB 3W0FA 1PJSA 2JA2A 4AG6A 2BWBA 2DAMA 3HZJA 3I4YA 4DV0M 2NQ8C 4AKHA 2ERCA 2QNJA 3KSJA 4FWHA 4DR3M 3GLHB 1V92A 4LJ9A 2HKJA 3HU3A 4B7GA 4GMQA 3ZH9B 3UJNA 3GP1A 2JUJA 3IG8A 3U6PA 2RGHA 3QYBA 5EP3A 4L4UA 1NHGC 2R45A 2RRUA 4LJAA 7CATA 1N78A 3D8LA 4Z6YA 2UUAM 2DAGA 2XFSA 4NXMM 5FLXS 3GQ3A 1HT2E 1T6OA 1D0KA 3B7ZA 2DAKA 1J7KA 2DENA 3KW6A 4LFCM 2LNHC 2UUCM 3E4RA 4IBCA 1VEGA 2BJWA 1K3WA 4DUYM 4GKJM 3SYKA 2XH9A 2DNAA 3PFIA 4LGMA 5IWAM 3GPXA 1D0LA 1X37A 4JN6A 2OO9A 1XC8A 1HQCA 4DUZM 4LJ4A 2MJ5B 1DGHB 3FUXA 2VIIA 3J7BA 1PJIA 3HJQA 4LJ6A 1Z5BA 3U6LA 1N77A 4WURA 1Q3CA 3K1JA 4NSOB 2C96A 3HHWA 3FUWA 2I7NA 4IBEA 2LH0A 2F5OA 4JI4M 3KXEC 3HU2A 1OIPA 2D7HA 3FUVA 1VG5A 3B7QA 1OKSA 3LQRA 4LG2A 2QQ8A 1QVRA 2GQFA 2KNZA 2L4EA 3DZDA 3KOWE 1OFIA 3UZUA 3U6QA 3OTOM 4NC6A 3AL0C 3C58A 5DNYA 4BBAA 2QHOB 4L16A 2GNOA 2LHGA 4P16A 1N75A 1QAQA 3RGPA 4R3DA 2XZUA 1C7YA 2UUBM 3LW5F 2WSCF 3T6PA 4X62M 4Q7JA 4DR7M 1N34M 2CEAA 4KLNA 2V6ZM 4IBIA 4NOOB 4UN2B 1XXHB 3FTEA 4KT0F 3GRYA 1L2DA 1LTMA 3VDPA 4AZFA 3KVWA 2E5LM 4DR6M 1OTRA 2JP7A 3J7AS 1PRBA 3H4JA 2Z8YM 3HJSA 3HHYA 4JI1M 4G3OA 1ZMWA 1WIVA 4FW9A 3RE8A 3SHFA 2Z4SA 1NO1A 1MX0A 2QPAA 1PJTA 2DZOB 5EXXA 1DGBA 4OU7A 4B3RM 4QNRA 4PDGA 1DGGA 4G4QA 3GLGB 4DV7M 4AW4A 1OFHA 1T43A 4GRIA 4BB9A 3U5ZB 5KPTA 4S12A 1E94E 2R62A 4AG5A 2CP8A 2JXNA 3MK6A 3PXGA 1ORYB 1JQJC 4LF5M 4GKKM 4ZPXA 3TPZA 3R8FA 5FTNA 4Y28F 2AHMA 2HCBA 3IG5A 1NNJA 1HNZM 2JZ0A 1V33A 2G8LA 1NJFA 3TL4X 3J80S 2APLA 2LTUA 3SAWA 3VK8A 3HJ8A 3GPYA 3D8BA 1OJLA 4GC5A 4B7HA 2EUCA 4B3MM 4I4LA 4JI8M 3ZQJA 2L09A 2KHHA 2X49A 5BR8M 4MGHA 3THGA 1LV7A 2F5PA 3PVSA 1AUAA 3SMSA 3BOSA 3GLGA 1IBMM 4XK8F 3FRIA 1QAOA 2JWSA 5FTMA 5FTLA 1IM2A 1MN3A 2BNKA 2EJSA 2HAKA 2YFQA 4F2LA 2KRKA 3AOGA 3U6OA 3GLIA 1PGYA 3NBIA 4NRWA 1S3SA 4L78A 1QQWA 2YQZA 3Q8XA 2L7HA 5A2QS 3SBJA 4LGYA 1NNUC 3W0LB 3VKHA 4RNAA 4MGZE 2LVOC 4RF1A 2KDLA 5IZ7D 3HGIA 3AV0A 4IJFA 4MGYE 2LVNC 2ZTCA 5EXPA 1GJTA 3MHVC 3KOZE 3HY5A 2BWEA 4GIPA 1QZEA 3KOYE 3T1HM 1IXSA 2LVPC 4IBGA 1IN6A 1EFUB 2K9DA 3JR4A 3UK6A 4XGIA 3W68A 1L1ZA 4DV1M 5F3WA 2YR0A 2OOBA 3TE6A 2FH0A 1GLNA 2QCUA 1XXHE 1OAIA 1R5LA 3FE3A 4JXJA 4LRTA 2R46A 2F5NA 1XNRM 4CHTB 2DKLA 3FRHA 2F5SA 1NHWC 2LVAA 4LRSA 5JI3E 1GO5A 2QBYB 4D81A 1IQPA 3VDUA 1L2CA 4DV3M 4IBBA 3K9OA 4FCVA 1HQYE 3KDSE 1JR3D 1I4WA 5ITUA 4DV2M 4HEOA 2QBYA 4IJEA 2X8AA 1XB2B 2QZ4A 2JY8A 4R7GA 5H37D 3VKGA 4I8OA 5ITYA 3GLFE 1Z5CA 1R2ZA 3T38A 1XNQM
chains in the Genus database with same CATH topology
5EP4A 1IN7A 2UXCM 1HR0M 1XHBA 2Y0TA 3A98B 3L2AA 4DR4M 1KSFX 4AI6A 4IBDA 2FE8A 3CF0A 1N33M 2KW0A 3HHXA 4GHAA 3CF2A 5ITTA 8CATA 3J27B 1D2NA 2Z7JA 4QNMA 3LVVA 5C1BA 1N36M 4W5WA 2CUZA 1QYRA 3R9XB 3GLHA 5KO3A 4II7A 2H1RA 2KXEA 2LXEA 2P5TA 3DFZA 3I51A 1FJGM 1IXZA 2ZAMA 4MGKE 4LF6M 2ZM6M 2L6OA 2C5RA 4YY3M 3H4MA 3T15A 1TH3A 5EJCA 4RF0A 4ITQA 2Y20A 4GC9A 1YSYA 3GPUA 1SXJE 3FYDA 2CV0A 2F4VM 4M0DA 1HNXM 3JR5A 3HHZA 1L8QA 3SAVA 3ZCBB 1VDDA 3SHGB 3SFZA 4B3TM 1NJGA 2XFTA 3JAMS 4K0KM 5DYGA 3TQSA 3KOXE 3A46A 2QP9X 3FTFA 4PCZA 3TWLA 4D80A 4G4RA 2G5GX 1GL7A 3ZC7B 2ZBKB 3J81S 3SMPA 5E26A 2CHVA 3DOAA 3AFHA 2M60A 4HL4A 4NXNM 1PM5A 4NRVA 4JI2M 3HWSA 2FFJA 3GRUA 2C98A 2FNAA 1Q39A 4EIWA 1TDHA 4JYAM 2HL7A 3J2PB 3RGSA 4LF7M 4LF9M 4M0WA 2DWLA 3GQ4A 4G4OA 4A3VB 4IIWA 2CV1A 4OW0A 2Z3XA 1Q3BA 2R18A 1R6BX 3LVWA 3DA1A 1TDZA 1J5EM 1FNNA 2DXIA 4IBJA 5E6JA 3QWLA 1K82A 1W5SA 3GRVA 3WHLA 3UGJA 2CHGA 1UM8A 1NSFA 2J7OA 3WHKA 2EO2A 4JV5M 1K3XA 3SAUA 2XSZA 1I94M 3FUTA 5IREB 3U61B 5JI2E 2R4JA 5EXSA 2RGOA 2Y21A 1G4AE 2Y0QA 2YNMD 4DV6M 4GHLA 1H6UA 4L15A 1T3TA 3KP1E 2DZNB 2C99A 1WXQA 1IN5A 3A42A 3M7GA 3L25A 2O5RA 4JI3M 5EXTA 1XXHA 4G6ZA 2XZFA 3GPPA 2FOIC 4QHSA 1QANA 2UXBM 1ZAEA 3L29A 4I5SA 2UU9M 3MJ5A 4FWDA 1DO2A 2QENA 4PDIA 5BPVA 5ITXE 4LJ7A 4MM3B 1HT1E 1HNWM 2C9OA 3PNVA 4KHPM 4KODA 2XSZD 3QAUA 4LJ5A 1IBKM 4B3SM 2XEPA 1EE8A 5LMUM 4OVZB 4DV5M 1IN4A 1XMOM 3LQQA 2LWXA 1Z5AA 2R65A 4B7FA 4DR1M 5DYIA 3HU1A 5KQDA 1DGHA 5KPZA 4AKGA 4LY6A 2CV2A 2ZANA 3U6MA 3KS8A 3FKEA 3FD9A 3GQ5A 4QOZC 3HKPA 4AQYM 1IXSB 4LJ8A 2DWZB 3U60A 4HLQA 2CFOA 5FTKA 3LMMA 3ILKA 1TH2A 1NY5A 5ITRA 3U6CA 3SYLA 5ITQA 3U6DA 1IBLM 2CE7A 3EIHA 4Z8XA 1IXRC 1Z6TA 3I4VA 1E32A 1J09A 4GITA 1DO0A 1DGFA 3KP0E 4NSRA 2VQEM 1PJJA 1IN8A 3L27A 4GH9A 2R4EA 2K47A 5KQ8A 1TH4A 3PNYA 2V1CA 3GO8A 4JI6M 3CTWB 1G59A 4FCTA 1SXJC 2EA0A 2OPFA 1GKIA 1ZQ9A 5FTJA 3TWKA 3B9PA 4OX9M 3AKZA 4NL4H 3AOEA 4XBOA 3M6AA 5C18A 1SXJA 3A45A 3GLFB 2VQFM 3T1YM 2DWMA 3U5ZA 2OQ4A 4I81A 2RKOA 4TUWA 5ITXA 5IT9S 3EIEA 4B08A 4DR5M 2D7EA 3VLFB 4JI0M 4X66M 3M0EA 3FUUA 3KSXA 3CF6E 4LZZA 1IY2A 1E9SA 4LFBM 3KFUG 3VFDA 3FTCA 2Z4RA 3KS4A 1GL6A 2HHHM 2XLJA 2L7IA 4G4NA 1YE9A 1L1TA 4MB7A 1YUBA 3RFWA 2KZUA 2ZAOA 4JI5M 4IBFA 1NY6A 1E9RA 3K8ZA 1GVNA 3E9SA 1NVMA 3U61A 1G3IA 3L28A 1R2YA 4DV4M 2CHQA 1KYIA 2XF3A 1G8PA 2F5QA 2UXDM 4CGYB 2C9CA 4MGIE 5LMNM 4OVZA 1XMQM 4LF4M 3NWLA 5FSWA 2DHRA 2BJVA 3FYCA 2A5YB 4FVMA 1SXJD 4DR2M 4L8RC 3K2LA 4WW0A 3U6EA 1QZMA 4QOSA 2J7NA 1JR3A 1R7RA 2I7PA 3K92A 2D7GA 4LCBA 3TWMA 2KEBA 3AOEC 4FD2A 1IY1A 2KZSA 2Q2EB 2KA6B 1W5TA 4MH0E 3UMMA 3L26A 1SXJB 3GLFA 4D82A 3SASA 4JI7M 4CISA 4PD2A 3SATA 4M9ZA 1IY0A 4IBKA 5EP2A 5EQTA 3SC3A 2V1UA 4AKIA 5KPRA 4PT5A 4LF8M 4X65M 3GLIB 4QHTA 1KFVA 3U6SA 4REZA 2M5ZA 4FWGA 3SARA 2X4AA 4LZJA 1TGUA 3GRRA 1XWIA 4BLCA 2DWNA 3FTDA 2W82A 4M9XA 4FCWA 3U60B 1QAMA 5EP1A 1C1KA 4KO8A 4YHHM 4M9SA 5GKNA 4X64M 3VK7A 1N32M 1MU5A 1L2BA 2XGNA 4LFAM 2KRUA 1G41A 1Z59A 2DVWB 3AJIB 3W0FA 2JA2A 4AG6A 4DV0M 4AKHA 3I4YA 2NQ8C 2ERCA 4FWHA 3KSJA 4DR3M 3GLHB 4LJ9A 2HKJA 3HU3A 4B7GA 4GMQA 3ZH9B 3UJNA 3GP1A 3U6PA 3IG8A 2RGHA 5EP3A 4L4UA 1NHGC 2R45A 4LJAA 1N78A 7CATA 3D8LA 4Z6YA 2UUAM 2XFSA 4NXMM 5FLXS 3GQ3A 1HT2E 1J7KA 3KW6A 4LFCM 2LNHC 2UUCM 3E4RA 4IBCA 2BJWA 1K3WA 4DUYM 4GKJM 3SYKA 2XH9A 3PFIA 4LGMA 5IWAM 3GPXA 1X37A 4JN6A 1XC8A 1HQCA 4DUZM 4LJ4A 1DGHB 3FUXA 2VIIA 3J7BA 1PJIA 3HJQA 4LJ6A 1Z5BA 3U6LA 1N77A 4WURA 1Q3CA 3K1JA 4NSOB 2C96A 3HHWA 3FUWA 2I7NA 4IBEA 2LH0A 2F5OA 4JI4M 3KXEC 3HU2A 2D7HA 3FUVA 3LQRA 4LG2A 3KOWE 3DZDA 1QVRA 1OFIA 3UZUA 3U6QA 3OTOM 3AL0C 3C58A 5DNYA 4BBAA 4L16A 4P16A 1N75A 1QAQA 3RGPA 4R3DA 2XZUA 2UUBM 4X62M 4DR7M 1N34M 2CEAA 4KLNA 2V6ZM 4IBIA 4NOOB 1XXHB 3FTEA 3GRYA 1L2DA 3VDPA 4AZFA 3KVWA 2E5LM 4DR6M 3J7AS 3HHYA 3HJSA 4JI1M 4FW9A 3RE8A 3SHFA 2Z4SA 1MX0A 2QPAA 2DZOB 5EXXA 1DGBA 4OU7A 4B3RM 4QNRA 4PDGA 1DGGA 4G4QA 3GLGB 4DV7M 4AW4A 1OFHA 4GRIA 4BB9A 3U5ZB 5KPTA 4S12A 1E94E 2R62A 4AG5A 3MK6A 3PXGA 1ORYB 1JQJC 4LF5M 4GKKM 4ZPXA 3TPZA 3R8FA 5FTNA 2AHMA 2HCBA 3IG5A 1NNJA 1HNZM 2G8LA 1NJFA 3TL4X 3J80S 3VK8A 3SAWA 3HJ8A 3GPYA 3D8BA 1OJLA 4GC5A 4B7HA 2EUCA 4B3MM 4I4LA 4JI8M 2L09A 2X49A 5BR8M 4MGHA 3THGA 1LV7A 2F5PA 3PVSA 3SMSA 3GLGA 3BOSA 1IBMM 5FTLA 1QAOA 5FTMA 1IM2A 2BNKA 3U6OA 2YFQA 2KRKA 3AOGA 3GLIA 3NBIA 4NRWA 1S3SA 4L78A 1QQWA 2YQZA 3Q8XA 2L7HA 5A2QS 3SBJA 4LGYA 1NNUC 3W0LB 3VKHA 4RNAA 4MGZE 4RF1A 5IZ7D 3HGIA 3AV0A 4IJFA 4MGYE 5EXPA 3MHVC 3KOZE 4GIPA 3T1HM 3KOYE 4IBGA 1IN6A 3JR4A 3UK6A 4XGIA 1L1ZA 4DV1M 5F3WA 2YR0A 3TE6A 1GLNA 2QCUA 4JXJA 4LRTA 1XNRM 2F5NA 2R46A 4CHTB 2F5SA 1NHWC 4LRSA 5JI3E 2QBYB 4D81A 1IQPA 3VDUA 1L2CA 4DV3M 4IBBA 4FCVA 1HQYE 3KDSE 1JR3D 1I4WA 5ITUA 4DV2M 2QBYA 4IJEA 2X8AA 2QZ4A 4R7GA 5H37D 3VKGA 4I8OA 5ITYA 1Z5CA 1R2ZA 3T38A 1XNQM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2D A;  2UXC M;  1HNW M;  1HR0 M;  2E5L M;  4DR6 M;  4DR4 M;  3J7A S;  3TWM A;  4KHP M;  4JI1 M;  2Q2E B;  1IBK M;  1N33 M;  4B3S M;  5ITT A;  1XNQ M;  1EE8 A;  5LMU M;  4DV5 M;  1MX0 A;  1XMO M;  3SAS A;  4JI7 M;  1Z5A A;  4CIS A;  4PD2 A;  3SAT A;  4DR1 M;  1N36 M;  4B3R M;  4PDG A;  4G4Q A;  3U6M A;  4DV7 M;  3GQ5 A;  1FJG M;  4LF8 M;  4X65 M;  1KFV A;  4AQY M;  4LF6 M;  2ZM6 M;  3U6S A;  4YY3 M;  3SAR A;  4ITQ A;  3GPU A;  5ITR A;  3U6C A;  4LF5 M;  5ITQ A;  4GKK M;  3U6D A;  1IBL M;  2F4V M;  1HNX M;  3JR5 A;  3SAV A;  4YHH M;  2VQE M;  1NNJ A;  3VK7 A;  1HNZ M;  4X64 M;  1PJJ A;  4B3T M;  4K0K M;  3JAM S;  3J80 S;  1N32 M;  3VK8 A;  1MU5 A;  3SAW A;  1L2B A;  3GPY A;  4LFA M;  3A46 A;  4B3M M;  1Z59 A;  4JI8 M;  3W0F A;  4PCZ A;  3GO8 A;  3TWL A;  4JI6 M;  5BR8 M;  4G4R A;  2EA0 A;  4DV0 M;  2OPF A;  2ZBK B;  3J81 S;  2F5P A;  4DR3 M;  3DOA A;  3TWK A;  4NXN M;  2HKJ A;  1PM5 A;  1IBM M;  3GP1 A;  3U6P A;  4OX9 M;  4NRV A;  4JI2 M;  3U6O A;  3A45 A;  2VQF M;  3T1Y M;  4NRW A;  2UUA M;  2OQ4 A;  5ITX A;  5A2Q S;  3SBJ A;  4NXM M;  1Q39 A;  5FLX S;  5IT9 S;  3GQ3 A;  4DR5 M;  1TDH A;  4JYA M;  4LF7 M;  4LF9 M;  4G4O A;  3GQ4 A;  4JI0 M;  4X66 M;  4LFC M;  2UUC M;  1Q3B A;  3T1H M;  4DUY M;  1K3W A;  4LFB M;  4GKJ M;  1TDZ A;  1J5E M;  5IWA M;  2HHH M;  3GPX A;  3JR4 A;  1L1Z A;  4G4N A;  1XC8 A;  4DUZ M;  4DV1 M;  1K82 A;  1L1T A;  4MB7 A;  1PJI A;  3U6L A;  1Z5B A;  1XNR M;  2F5N A;  1Q3C A;  4JI5 M;  2F5S A;  4JV5 M;  2F5O A;  1K3X A;  3SAU A;  4JI4 M;  1I94 M;  1L2C A;  4DV3 M;  1R2Y A;  4DV4 M;  5ITU A;  4DV2 M;  4DV6 M;  2F5Q A;  2UXD M;  3U6Q A;  3OTO M;  3C58 A;  3A42 A;  5LMN M;  4JI3 M;  1XMQ M;  4LF4 M;  2XZU A;  2XZF A;  3GPP A;  2UXB M;  2UUB M;  5ITY A;  2UU9 M;  4X62 M;  4DR7 M;  1N34 M;  4PDI A;  1Z5C A;  1R2Z A;  4DR2 M;  5ITX E;  3U6E A; 
#chains in the Genus database with same CATH topology
 5EP4 A;  3Q8G A;  1IN7 A;  2UXC M;  2FS1 A;  1HR0 M;  1XHB A;  2Y0T A;  3A98 B;  3L2A A;  4DR4 M;  1KSF X;  4AI6 A;  3MMP A;  4IBD A;  2FE8 A;  2JY7 A;  4RKU F;  3B7N A;  3CF0 A;  1UFZ A;  1N33 M;  1WGN A;  2KW0 A;  2O01 F;  3CF2 A;  3HHX A;  5ITT A;  4GHA A;  1IFY A;  8CAT A;  3J27 B;  1D2N A;  2Z7J A;  4QNM A;  3LVV A;  5C1B A;  1N36 M;  1JR3 E;  4W5W A;  2VF8 A;  2MRO B;  2CUZ A;  1QYR A;  4ANR A;  3R9X B;  3GLH A;  4WP2 A;  5KO3 A;  4II7 A;  2OOA A;  2H1R A;  1CUK A;  2KXE A;  2LXE A;  1D0M A;  2JZ1 A;  2P5T A;  1MJG M;  1IXZ A;  2ZAM A;  3DFZ A;  3I51 A;  4MGK E;  1WJ7 A;  4LF6 M;  2ZM6 M;  2L6O A;  2C5R A;  1SG9 A;  1TTE A;  3H4M A;  4YY3 M;  1JB0 F;  3T15 A;  1TH3 A;  5EJC A;  4RF0 A;  4ITQ A;  2Y20 A;  4GC9 A;  1YSY A;  3GPU A;  1SXJ E;  3FYD A;  1WR1 B;  3BBZ A;  1WHC A;  4M0D A;  2CV0 A;  2F4V M;  1HNX M;  3JR5 A;  3HHZ A;  1L8Q A;  3SAV A;  3ZCB B;  1VDD A;  3SHG B;  3SFZ A;  4B3T M;  1NJG A;  2XFT A;  3JAM S;  4K0K M;  5DYG A;  2R0I A;  3TQS A;  3KOX E;  1TR8 A;  3A46 A;  2QP9 X;  3FTF A;  4PCZ A;  3TWL A;  4D80 A;  4G4R A;  2G5G X;  1GL7 A;  1RU3 A;  3ZC7 B;  3BXW A;  2ZBK B;  3J81 S;  3SMP A;  5E26 A;  2KNV A;  2CHV A;  4L6V 6;  3DOA A;  3AFH A;  2M60 A;  4HL4 A;  4NXN M;  2N35 A;  1PM5 A;  1F4I A;  4NRV A;  2L2D A;  4JI2 M;  3HWS A;  2VF7 A;  2WSE F;  2FFJ A;  3GRU A;  2C98 A;  2FNA A;  4P17 A;  1Q39 A;  3HX3 A;  1TDH A;  4EIW A;  4JYA M;  1TF0 B;  2HL7 A;  3J2P B;  3RGS A;  4LF7 M;  4LF9 M;  4M0W A;  2DWL A;  3GQ4 A;  4G4O A;  4A3V B;  1FJG M;  4IIW A;  2CV1 A;  1R4G A;  4OW0 A;  5DFL A;  2Z3X A;  2MGW A;  3E46 A;  1Q3B A;  2R18 A;  1VQ1 A;  2MH8 A;  1R6B X;  3LVW A;  3DA1 A;  1TDZ A;  1J5E M;  1FNN A;  3I01 M;  2DXI A;  4IBJ A;  5E6J A;  3V76 A;  2DZL A;  3QWL A;  2K6B A;  4GEW A;  1K82 A;  1W5S A;  3GLG E;  2JY5 A;  3GRV A;  3WHL A;  3UGJ A;  2CHG A;  1UM8 A;  1NSF A;  3GLI E;  2J7O A;  1OAO C;  2EO2 A;  3WHK A;  4JV5 M;  2LBC A;  1K3X A;  3SAU A;  2XSZ A;  1I94 M;  3FUT A;  5IRE B;  3U61 B;  1ZMU A;  1ZMV A;  5JI2 E;  2R4J A;  2ZTD A;  2RGO A;  5EXS A;  2Y21 A;  1G4A E;  2Y0Q A;  2YNM D;  4DV6 M;  4GHL A;  1H6U A;  4L15 A;  1T3T A;  3KP1 E;  5L8R F;  2DZN B;  2C99 A;  1YLA A;  1WXQ A;  1DV0 A;  1IN5 A;  3A42 A;  3M7G A;  3L25 A;  2O5R A;  4JI3 M;  5EXT A;  2LHC A;  1XXH A;  3C3E A;  4G6Z A;  2CRU A;  2XZF A;  3GPP A;  2FOI C;  4QHS A;  1QAN A;  2UXB M;  1ZAE A;  3L29 A;  4I5S A;  2UU9 M;  3MJ5 A;  4FWD A;  1DO2 A;  2K0B X;  2QEN A;  3IEC A;  4PDI A;  5BPV A;  5ITX E;  1QDR A;  3C3D A;  3NBX X;  4LJ7 A;  4MM3 B;  1HT1 E;  1QUT A;  1HNW M;  2C9O A;  3PNV A;  1QUS A;  4KHP M;  4KOD A;  2XSZ D;  4CIZ A;  3QAU A;  4LJ5 A;  1IBK M;  4B3S M;  2XEP A;  1BVS A;  1EE8 A;  5LMU M;  4OVZ B;  4DV5 M;  1IN4 A;  1XMO M;  3LQQ A;  2LWX A;  1Z5A A;  2R65 A;  4B7F A;  4DR1 M;  5DYI A;  3HU1 A;  5KQD A;  1DGH A;  5KPZ A;  1WGL A;  4AKG A;  2WSF F;  4LY6 A;  2CV2 A;  1V34 A;  2WZJ A;  2ZAN A;  3U6M A;  3KS8 A;  3FKE A;  3FD9 A;  3GQ5 A;  1GJS A;  4QOZ C;  3HKP A;  4AQY M;  1IXS B;  4LJ8 A;  2DWZ B;  3U60 A;  4HLQ A;  2B3T A;  2CFO A;  2DAI A;  2QSF X;  5FTK A;  3ILK A;  1TH2 A;  3LMM A;  1NY5 A;  5ITR A;  3U6C A;  3SYL A;  2EKK A;  5ITQ A;  3U6D A;  3B74 A;  1IBL M;  2CE7 A;  3EIH A;  4Z8X A;  1IXR C;  1Z6T A;  3K9P A;  3I4V A;  1E32 A;  1J09 A;  1G71 A;  4GIT A;  1DO0 A;  1DGF A;  3KP0 E;  4NSR A;  2VQE M;  1PJJ A;  1IN8 A;  1GAB A;  3L27 A;  4GH9 A;  2R4E A;  3LCV B;  2K47 A;  5KQ8 A;  1TH4 A;  3PNY A;  2V1C A;  1Y8G A;  2VDB B;  2DHY A;  2LVQ D;  4DBG B;  3GO8 A;  4JI6 M;  3CTW B;  1G59 A;  4FCT A;  1SXJ C;  2EA0 A;  2OPF A;  1GKI A;  1ZQ9 A;  5FTJ A;  2DI0 A;  3TWK A;  2J5Y A;  3B9P A;  4OX9 M;  3AKZ A;  4NL4 H;  3AOE A;  4XBO A;  3M6A A;  5C18 A;  1SXJ A;  3A45 A;  3GLF B;  2VQF M;  3T1Y M;  2DWM A;  3U5Z A;  2OQ4 A;  4I81 A;  2RKO A;  3C9P A;  4TUW A;  1VEJ A;  5ITX A;  5IT9 S;  3EIE A;  4B08 A;  4DR5 M;  2D7E A;  3QYE A;  3LCU A;  3VLF B;  2DAE A;  4JI0 M;  4X66 M;  3M0E A;  3FUU A;  1NV9 A;  1EIJ A;  3KSX A;  3CF6 E;  4R71 A;  4LZZ A;  1IY2 A;  1E9S A;  1P3Q Q;  4LFB M;  1VEK A;  3KFU G;  3VFD A;  3FTC A;  2Z4R A;  3KS4 A;  1GL6 A;  3CGW A;  2HHH M;  2XLJ A;  2L7I A;  4G4N A;  2MR9 A;  1YE9 A;  2JY6 B;  1L1T A;  4MB7 A;  1YUB A;  3RFW A;  2KZU A;  2ZAO A;  2G3Q A;  4JI5 M;  4CJ6 A;  4IBF A;  1NY6 A;  1E9R A;  3K8Z A;  1GVN A;  1QDT A;  2CWB A;  3E9S A;  1NVM A;  3U61 A;  1G3I A;  3IHP A;  3L28 A;  1R2Y A;  4DV4 M;  2HWJ A;  2CHQ A;  1KYI A;  2XF3 A;  1G8P A;  2F5Q A;  2O25 A;  2UXD M;  1AIP C;  4CGY B;  2C9C A;  4MGI E;  3F92 A;  5LMN M;  4OVZ A;  1XMQ M;  4LF4 M;  3NWL A;  5FSW A;  2DHR A;  2BJV A;  3FYC A;  1NV8 A;  2A5Y B;  3B89 A;  4FVM A;  1SXJ D;  4DR2 M;  4L8R C;  3K2L A;  4WW0 A;  3U6E A;  1QZM A;  1A5T A;  4QOS A;  2J7N A;  1JR3 A;  2JNH A;  2KNA A;  1R7R A;  2I7P A;  3K92 A;  3W67 A;  2D7G A;  4LCB A;  1OQY A;  1Q02 A;  3TWM A;  2KEB A;  3AOE C;  4FD2 A;  1IY1 A;  2KZS A;  2Q2E B;  2KA6 B;  1W5T A;  4MH0 E;  1VDL A;  3UMM A;  2R44 A;  1SXJ B;  3L26 A;  3GLF A;  1PJQ A;  1HJP A;  4D82 A;  3SAS A;  4JI7 M;  4CIS A;  4PD2 A;  3SAT A;  4M9Z A;  1IY0 A;  4IBK A;  5EP2 A;  2H5X A;  2L4F A;  5EQT A;  3SC3 A;  2V1U A;  4AKI A;  5KPR A;  4PT5 A;  4LF8 M;  4X65 M;  3GLI B;  4QHT A;  1KFV A;  2R6F A;  3U6S A;  3I04 M;  4REZ A;  2M5Z A;  4FWG A;  3SAR A;  2X4A A;  4LZJ A;  1TGU A;  3GRR A;  1OIZ A;  1XWI A;  3GLH E;  4BLC A;  3E21 A;  2DWN A;  3FTD A;  2W82 A;  4M9X A;  4FCW A;  3U60 B;  2EKF A;  1QAM A;  5EP1 A;  1C1K A;  4F1I A;  4KO8 A;  4YHH M;  4M9S A;  5GKN A;  4X64 M;  1ZV1 A;  3VK7 A;  1N32 M;  1MU5 A;  1L2B A;  2XGN A;  4LFA M;  2KRU A;  1G41 A;  1Z59 A;  2DVW B;  3AJI B;  3W0F A;  1PJS A;  2JA2 A;  4AG6 A;  2BWB A;  2DAM A;  3HZJ A;  3I4Y A;  4DV0 M;  2NQ8 C;  4AKH A;  2ERC A;  2QNJ A;  3KSJ A;  4FWH A;  4DR3 M;  3GLH B;  1V92 A;  4LJ9 A;  2HKJ A;  3HU3 A;  4B7G A;  4GMQ A;  3ZH9 B;  3UJN A;  3GP1 A;  2JUJ A;  3IG8 A;  3U6P A;  2RGH A;  3QYB A;  5EP3 A;  4L4U A;  1NHG C;  2R45 A;  2RRU A;  4LJA A;  7CAT A;  1N78 A;  3D8L A;  4Z6Y A;  2UUA M;  2DAG A;  2XFS A;  4NXM M;  5FLX S;  3GQ3 A;  1HT2 E;  1T6O A;  1D0K A;  3B7Z A;  2DAK A;  1J7K A;  2DEN A;  3KW6 A;  4LFC M;  2LNH C;  2UUC M;  3E4R A;  4IBC A;  1VEG A;  2BJW A;  1K3W A;  4DUY M;  4GKJ M;  3SYK A;  2XH9 A;  2DNA A;  3PFI A;  4LGM A;  5IWA M;  3GPX A;  1D0L A;  1X37 A;  4JN6 A;  2OO9 A;  1XC8 A;  1HQC A;  4DUZ M;  4LJ4 A;  2MJ5 B;  1DGH B;  3FUX A;  2VII A;  3J7B A;  1PJI A;  3HJQ A;  4LJ6 A;  1Z5B A;  3U6L A;  1N77 A;  4WUR A;  1Q3C A;  3K1J A;  4NSO B;  2C96 A;  3HHW A;  3FUW A;  2I7N A;  4IBE A;  2LH0 A;  2F5O A;  4JI4 M;  3KXE C;  3HU2 A;  1OIP A;  2D7H A;  3FUV A;  1VG5 A;  3B7Q A;  1OKS A;  3LQR A;  4LG2 A;  2QQ8 A;  1QVR A;  2GQF A;  2KNZ A;  2L4E A;  3DZD A;  3KOW E;  1OFI A;  3UZU A;  3U6Q A;  3OTO M;  4NC6 A;  3AL0 C;  3C58 A;  5DNY A;  4BBA A;  2QHO B;  4L16 A;  2GNO A;  2LHG A;  4P16 A;  1N75 A;  1QAQ A;  3RGP A;  4R3D A;  2XZU A;  1C7Y A;  2UUB M;  3LW5 F;  2WSC F;  3T6P A;  4X62 M;  4Q7J A;  4DR7 M;  1N34 M;  2CEA A;  4KLN A;  2V6Z M;  4IBI A;  4NOO B;  4UN2 B;  1XXH B;  3FTE A;  4KT0 F;  3GRY A;  1L2D A;  1LTM A;  3VDP A;  4AZF A;  3KVW A;  2E5L M;  4DR6 M;  1OTR A;  2JP7 A;  3J7A S;  1PRB A;  3H4J A;  2Z8Y M;  3HJS A;  3HHY A;  4JI1 M;  4G3O A;  1ZMW A;  1WIV A;  4FW9 A;  3RE8 A;  3SHF A;  2Z4S A;  1NO1 A;  1MX0 A;  2QPA A;  1PJT A;  2DZO B;  5EXX A;  1DGB A;  4OU7 A;  4B3R M;  4QNR A;  4PDG A;  1DGG A;  4G4Q A;  3GLG B;  4DV7 M;  4AW4 A;  1OFH A;  1T43 A;  4GRI A;  4BB9 A;  3U5Z B;  5KPT A;  4S12 A;  1E94 E;  2R62 A;  4AG5 A;  2CP8 A;  2JXN A;  3MK6 A;  3PXG A;  1ORY B;  1JQJ C;  4LF5 M;  4GKK M;  4ZPX A;  3TPZ A;  3R8F A;  5FTN A;  4Y28 F;  2AHM A;  2HCB A;  3IG5 A;  1NNJ A;  1HNZ M;  2JZ0 A;  1V33 A;  2G8L A;  1NJF A;  3TL4 X;  3J80 S;  2APL A;  2LTU A;  3SAW A;  3VK8 A;  3HJ8 A;  3GPY A;  3D8B A;  1OJL A;  4GC5 A;  4B7H A;  2EUC A;  4B3M M;  4I4L A;  4JI8 M;  3ZQJ A;  2L09 A;  2KHH A;  2X49 A;  5BR8 M;  4MGH A;  3THG A;  1LV7 A;  2F5P A;  3PVS A;  1AUA A;  3SMS A;  3BOS A;  3GLG A;  1IBM M;  4XK8 F;  3FRI A;  1QAO A;  2JWS A;  5FTM A;  5FTL A;  1IM2 A;  1MN3 A;  2BNK A;  2EJS A;  2HAK A;  2YFQ A;  4F2L A;  2KRK A;  3AOG A;  3U6O A;  3GLI A;  1PGY A;  3NBI A;  4NRW A;  1S3S A;  4L78 A;  1QQW A;  2YQZ A;  3Q8X A;  2L7H A;  5A2Q S;  3SBJ A;  4LGY A;  1NNU C;  3W0L B;  3VKH A;  4RNA A;  4MGZ E;  2LVO C;  4RF1 A;  2KDL A;  5IZ7 D;  3HGI A;  3AV0 A;  4IJF A;  4MGY E;  2LVN C;  2ZTC A;  5EXP A;  1GJT A;  3MHV C;  3KOZ E;  3HY5 A;  2BWE A;  4GIP A;  1QZE A;  3KOY E;  3T1H M;  1IXS A;  2LVP C;  4IBG A;  1IN6 A;  1EFU B;  2K9D A;  3JR4 A;  3UK6 A;  4XGI A;  3W68 A;  1L1Z A;  4DV1 M;  5F3W A;  2YR0 A;  2OOB A;  3TE6 A;  2FH0 A;  1GLN A;  2QCU A;  1XXH E;  1OAI A;  1R5L A;  3FE3 A;  4JXJ A;  4LRT A;  2R46 A;  2F5N A;  1XNR M;  4CHT B;  2DKL A;  3FRH A;  2F5S A;  1NHW C;  2LVA A;  4LRS A;  5JI3 E;  1GO5 A;  2QBY B;  4D81 A;  1IQP A;  3VDU A;  1L2C A;  4DV3 M;  4IBB A;  3K9O A;  4FCV A;  1HQY E;  3KDS E;  1JR3 D;  1I4W A;  5ITU A;  4DV2 M;  4HEO A;  2QBY A;  4IJE A;  2X8A A;  1XB2 B;  2QZ4 A;  2JY8 A;  4R7G A;  5H37 D;  3VKG A;  4I8O A;  5ITY A;  3GLF E;  1Z5C A;  1R2Z A;  3T38 A;  1XNQ M; 
#chains in the Genus database with same CATH homology
 5EP4 A;  1IN7 A;  2UXC M;  1HR0 M;  1XHB A;  2Y0T A;  3A98 B;  3L2A A;  4DR4 M;  1KSF X;  4AI6 A;  4IBD A;  2FE8 A;  3CF0 A;  1N33 M;  2KW0 A;  3HHX A;  4GHA A;  3CF2 A;  5ITT A;  8CAT A;  3J27 B;  1D2N A;  2Z7J A;  4QNM A;  3LVV A;  5C1B A;  1N36 M;  4W5W A;  2CUZ A;  1QYR A;  3R9X B;  3GLH A;  5KO3 A;  4II7 A;  2H1R A;  2KXE A;  2LXE A;  2P5T A;  3DFZ A;  3I51 A;  1FJG M;  1IXZ A;  2ZAM A;  4MGK E;  4LF6 M;  2ZM6 M;  2L6O A;  2C5R A;  4YY3 M;  3H4M A;  3T15 A;  1TH3 A;  5EJC A;  4RF0 A;  4ITQ A;  2Y20 A;  4GC9 A;  1YSY A;  3GPU A;  1SXJ E;  3FYD A;  2CV0 A;  2F4V M;  4M0D A;  1HNX M;  3JR5 A;  3HHZ A;  1L8Q A;  3SAV A;  3ZCB B;  1VDD A;  3SHG B;  3SFZ A;  4B3T M;  1NJG A;  2XFT A;  3JAM S;  4K0K M;  5DYG A;  3TQS A;  3KOX E;  3A46 A;  2QP9 X;  3FTF A;  4PCZ A;  3TWL A;  4D80 A;  4G4R A;  2G5G X;  1GL7 A;  3ZC7 B;  2ZBK B;  3J81 S;  3SMP A;  5E26 A;  2CHV A;  3DOA A;  3AFH A;  2M60 A;  4HL4 A;  4NXN M;  1PM5 A;  4NRV A;  4JI2 M;  3HWS A;  2FFJ A;  3GRU A;  2C98 A;  2FNA A;  1Q39 A;  4EIW A;  1TDH A;  4JYA M;  2HL7 A;  3J2P B;  3RGS A;  4LF7 M;  4LF9 M;  4M0W A;  2DWL A;  3GQ4 A;  4G4O A;  4A3V B;  4IIW A;  2CV1 A;  4OW0 A;  2Z3X A;  1Q3B A;  2R18 A;  1R6B X;  3LVW A;  3DA1 A;  1TDZ A;  1J5E M;  1FNN A;  2DXI A;  4IBJ A;  5E6J A;  3QWL A;  1K82 A;  1W5S A;  3GRV A;  3WHL A;  3UGJ A;  2CHG A;  1UM8 A;  1NSF A;  2J7O A;  3WHK A;  2EO2 A;  4JV5 M;  1K3X A;  3SAU A;  2XSZ A;  1I94 M;  3FUT A;  5IRE B;  3U61 B;  5JI2 E;  2R4J A;  5EXS A;  2RGO A;  2Y21 A;  1G4A E;  2Y0Q A;  2YNM D;  4DV6 M;  4GHL A;  1H6U A;  4L15 A;  1T3T A;  3KP1 E;  2DZN B;  2C99 A;  1WXQ A;  1IN5 A;  3A42 A;  3M7G A;  3L25 A;  2O5R A;  4JI3 M;  5EXT A;  1XXH A;  4G6Z A;  2XZF A;  3GPP A;  2FOI C;  4QHS A;  1QAN A;  2UXB M;  1ZAE A;  3L29 A;  4I5S A;  2UU9 M;  3MJ5 A;  4FWD A;  1DO2 A;  2QEN A;  4PDI A;  5BPV A;  5ITX E;  4LJ7 A;  4MM3 B;  1HT1 E;  1HNW M;  2C9O A;  3PNV A;  4KHP M;  4KOD A;  2XSZ D;  3QAU A;  4LJ5 A;  1IBK M;  4B3S M;  2XEP A;  1EE8 A;  5LMU M;  4OVZ B;  4DV5 M;  1IN4 A;  1XMO M;  3LQQ A;  2LWX A;  1Z5A A;  2R65 A;  4B7F A;  4DR1 M;  5DYI A;  3HU1 A;  5KQD A;  1DGH A;  5KPZ A;  4AKG A;  4LY6 A;  2CV2 A;  2ZAN A;  3U6M A;  3KS8 A;  3FKE A;  3FD9 A;  3GQ5 A;  4QOZ C;  3HKP A;  4AQY M;  1IXS B;  4LJ8 A;  2DWZ B;  3U60 A;  4HLQ A;  2CFO A;  5FTK A;  3LMM A;  3ILK A;  1TH2 A;  1NY5 A;  5ITR A;  3U6C A;  3SYL A;  5ITQ A;  3U6D A;  1IBL M;  2CE7 A;  3EIH A;  4Z8X A;  1IXR C;  1Z6T A;  3I4V A;  1E32 A;  1J09 A;  4GIT A;  1DO0 A;  1DGF A;  3KP0 E;  4NSR A;  2VQE M;  1PJJ A;  1IN8 A;  3L27 A;  4GH9 A;  2R4E A;  2K47 A;  5KQ8 A;  1TH4 A;  3PNY A;  2V1C A;  3GO8 A;  4JI6 M;  3CTW B;  1G59 A;  4FCT A;  1SXJ C;  2EA0 A;  2OPF A;  1GKI A;  1ZQ9 A;  5FTJ A;  3TWK A;  3B9P A;  4OX9 M;  3AKZ A;  4NL4 H;  3AOE A;  4XBO A;  3M6A A;  5C18 A;  1SXJ A;  3A45 A;  3GLF B;  2VQF M;  3T1Y M;  2DWM A;  3U5Z A;  2OQ4 A;  4I81 A;  2RKO A;  4TUW A;  5ITX A;  5IT9 S;  3EIE A;  4B08 A;  4DR5 M;  2D7E A;  3VLF B;  4JI0 M;  4X66 M;  3M0E A;  3FUU A;  3KSX A;  3CF6 E;  4LZZ A;  1IY2 A;  1E9S A;  4LFB M;  3KFU G;  3VFD A;  3FTC A;  2Z4R A;  3KS4 A;  1GL6 A;  2HHH M;  2XLJ A;  2L7I A;  4G4N A;  1YE9 A;  1L1T A;  4MB7 A;  1YUB A;  3RFW A;  2KZU A;  2ZAO A;  4JI5 M;  4IBF A;  1NY6 A;  1E9R A;  3K8Z A;  1GVN A;  3E9S A;  1NVM A;  3U61 A;  1G3I A;  3L28 A;  1R2Y A;  4DV4 M;  2CHQ A;  1KYI A;  2XF3 A;  1G8P A;  2F5Q A;  2UXD M;  4CGY B;  2C9C A;  4MGI E;  5LMN M;  4OVZ A;  1XMQ M;  4LF4 M;  3NWL A;  5FSW A;  2DHR A;  2BJV A;  3FYC A;  2A5Y B;  4FVM A;  1SXJ D;  4DR2 M;  4L8R C;  3K2L A;  4WW0 A;  3U6E A;  1QZM A;  4QOS A;  2J7N A;  1JR3 A;  1R7R A;  2I7P A;  3K92 A;  2D7G A;  4LCB A;  3TWM A;  2KEB A;  3AOE C;  4FD2 A;  1IY1 A;  2KZS A;  2Q2E B;  2KA6 B;  1W5T A;  4MH0 E;  3UMM A;  3L26 A;  1SXJ B;  3GLF A;  4D82 A;  3SAS A;  4JI7 M;  4CIS A;  4PD2 A;  3SAT A;  4M9Z A;  1IY0 A;  4IBK A;  5EP2 A;  5EQT A;  3SC3 A;  2V1U A;  4AKI A;  5KPR A;  4PT5 A;  4LF8 M;  4X65 M;  3GLI B;  4QHT A;  1KFV A;  3U6S A;  4REZ A;  2M5Z A;  4FWG A;  3SAR A;  2X4A A;  4LZJ A;  1TGU A;  3GRR A;  1XWI A;  4BLC A;  2DWN A;  3FTD A;  2W82 A;  4M9X A;  4FCW A;  3U60 B;  1QAM A;  5EP1 A;  1C1K A;  4KO8 A;  4YHH M;  4M9S A;  5GKN A;  4X64 M;  3VK7 A;  1N32 M;  1MU5 A;  1L2B A;  2XGN A;  4LFA M;  2KRU A;  1G41 A;  1Z59 A;  2DVW B;  3AJI B;  3W0F A;  2JA2 A;  4AG6 A;  4DV0 M;  4AKH A;  3I4Y A;  2NQ8 C;  2ERC A;  4FWH A;  3KSJ A;  4DR3 M;  3GLH B;  4LJ9 A;  2HKJ A;  3HU3 A;  4B7G A;  4GMQ A;  3ZH9 B;  3UJN A;  3GP1 A;  3U6P A;  3IG8 A;  2RGH A;  5EP3 A;  4L4U A;  1NHG C;  2R45 A;  4LJA A;  1N78 A;  7CAT A;  3D8L A;  4Z6Y A;  2UUA M;  2XFS A;  4NXM M;  5FLX S;  3GQ3 A;  1HT2 E;  1J7K A;  3KW6 A;  4LFC M;  2LNH C;  2UUC M;  3E4R A;  4IBC A;  2BJW A;  1K3W A;  4DUY M;  4GKJ M;  3SYK A;  2XH9 A;  3PFI A;  4LGM A;  5IWA M;  3GPX A;  1X37 A;  4JN6 A;  1XC8 A;  1HQC A;  4DUZ M;  4LJ4 A;  1DGH B;  3FUX A;  2VII A;  3J7B A;  1PJI A;  3HJQ A;  4LJ6 A;  1Z5B A;  3U6L A;  1N77 A;  4WUR A;  1Q3C A;  3K1J A;  4NSO B;  2C96 A;  3HHW A;  3FUW A;  2I7N A;  4IBE A;  2LH0 A;  2F5O A;  4JI4 M;  3KXE C;  3HU2 A;  2D7H A;  3FUV A;  3LQR A;  4LG2 A;  3KOW E;  3DZD A;  1QVR A;  1OFI A;  3UZU A;  3U6Q A;  3OTO M;  3AL0 C;  3C58 A;  5DNY A;  4BBA A;  4L16 A;  4P16 A;  1N75 A;  1QAQ A;  3RGP A;  4R3D A;  2XZU A;  2UUB M;  4X62 M;  4DR7 M;  1N34 M;  2CEA A;  4KLN A;  2V6Z M;  4IBI A;  4NOO B;  1XXH B;  3FTE A;  3GRY A;  1L2D A;  3VDP A;  4AZF A;  3KVW A;  2E5L M;  4DR6 M;  3J7A S;  3HHY A;  3HJS A;  4JI1 M;  4FW9 A;  3RE8 A;  3SHF A;  2Z4S A;  1MX0 A;  2QPA A;  2DZO B;  5EXX A;  1DGB A;  4OU7 A;  4B3R M;  4QNR A;  4PDG A;  1DGG A;  4G4Q A;  3GLG B;  4DV7 M;  4AW4 A;  1OFH A;  4GRI A;  4BB9 A;  3U5Z B;  5KPT A;  4S12 A;  1E94 E;  2R62 A;  4AG5 A;  3MK6 A;  3PXG A;  1ORY B;  1JQJ C;  4LF5 M;  4GKK M;  4ZPX A;  3TPZ A;  3R8F A;  5FTN A;  2AHM A;  2HCB A;  3IG5 A;  1NNJ A;  1HNZ M;  2G8L A;  1NJF A;  3TL4 X;  3J80 S;  3VK8 A;  3SAW A;  3HJ8 A;  3GPY A;  3D8B A;  1OJL A;  4GC5 A;  4B7H A;  2EUC A;  4B3M M;  4I4L A;  4JI8 M;  2L09 A;  2X49 A;  5BR8 M;  4MGH A;  3THG A;  1LV7 A;  2F5P A;  3PVS A;  3SMS A;  3GLG A;  3BOS A;  1IBM M;  5FTL A;  1QAO A;  5FTM A;  1IM2 A;  2BNK A;  3U6O A;  2YFQ A;  2KRK A;  3AOG A;  3GLI A;  3NBI A;  4NRW A;  1S3S A;  4L78 A;  1QQW A;  2YQZ A;  3Q8X A;  2L7H A;  5A2Q S;  3SBJ A;  4LGY A;  1NNU C;  3W0L B;  3VKH A;  4RNA A;  4MGZ E;  4RF1 A;  5IZ7 D;  3HGI A;  3AV0 A;  4IJF A;  4MGY E;  5EXP A;  3MHV C;  3KOZ E;  4GIP A;  3T1H M;  3KOY E;  4IBG A;  1IN6 A;  3JR4 A;  3UK6 A;  4XGI A;  1L1Z A;  4DV1 M;  5F3W A;  2YR0 A;  3TE6 A;  1GLN A;  2QCU A;  4JXJ A;  4LRT A;  1XNR M;  2F5N A;  2R46 A;  4CHT B;  2F5S A;  1NHW C;  4LRS A;  5JI3 E;  2QBY B;  4D81 A;  1IQP A;  3VDU A;  1L2C A;  4DV3 M;  4IBB A;  4FCV A;  1HQY E;  3KDS E;  1JR3 D;  1I4W A;  5ITU A;  4DV2 M;  2QBY A;  4IJE A;  2X8A A;  2QZ4 A;  4R7G A;  5H37 D;  3VKG A;  4I8O A;  5ITY A;  1Z5C A;  1R2Z A;  3T38 A;  1XNQ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...