4DV0M

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4dv0M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4dv0M02
4NXNM 3T1HM 3J80S 3A46A 4DUZM 1K82A 4LF9M 4OX9M 4DR6M 2OQ4A 3GQ3A 5IWAM 3SASA 4DR3M 2UXBM 4DV5M 3GPUA 1PJJA 5IT9S 5ITYA 3J7AS 5ITQA 3U6DA 2XZFA 3JR5A 4JI6M 3TWLA 3SBJA 5ITTA 4K0KM 1I94M 1KFVA 4CISA 4B3RM 4DR4M 2OPFA 3SARA 4DV4M 4NXMM 3U6OA 2E5LM 4JI4M 3TWMA 4PDGA 4LFCM 4JI2M 1XMOM 1L2CA 4MB7A 3VK7A 3U6PA 1L2DA 5FLXS 2UUAM 3U6LA 1MX0A 4DR7M 4DV0M 3JAMS 5ITRA 4NRVA 4JI0M 1N32M 2HKJA 2F5PA 4DR2M 5ITXE 3T1YM 1Z59A 3U6SA 1HNWM 1R2ZA 1HR0M 1FJGM 4YHHM 1N34M 4DV2M 1R2YA 4X66M 1Q3CA 4LF6M 3C58A 3U6QA 4ITQA 4LF4M 3SAWA 2Q2EB 1XC8A 1K3XA 3W0FA 4LF7M 1XNRM 3J81S 1PJIA 4JI8M 4LFBM 1Z5AA 2XZUA 1Z5BA 4YY3M 2ZM6M 3U6MA 1IBLM 2F5SA 4PD2A 4B3MM 3GQ5A 1L1ZA 3VK8A 4DV1M 2ZBKB 3SAVA 4PDIA 4DR5M 1IBKM 5A2QS 1Q3BA 4JI7M 3U6CA 3SATA 4DUYM 1MU5A 4GKJM 4KHPM 1Z5CA 3GO8A 5ITXA 4DV6M 4B3TM 1L2BA 3GPPA 1TDZA 2VQFM 2HHHM 2UUCM 4X62M 1PM5A 1HNXM 3A45A 4JI1M 4NRWA 4DV7M 1N36M 2UXDM 3TWKA 4LF5M 1Q39A 3OTOM 2UXCM 3A42A 3JR4A 2F5QA 3SAUA 4X65M 4B3SM 1XNQM 5ITUA 4JI3M 1XMQM 4DV3M 3U6EA 3DOAA 3GPXA 3GQ4A 2VQEM 4G4NA 5LMUM 2UUBM 4LF8M 4JV5M 2F4VM 1EE8A 1L1TA 3GP1A 3GPYA 1NNJA 2F5OA 1J5EM 4G4OA 4DR1M 1N33M 4GKKM 2F5NA 4G4RA 4JI5M 4LFAM 1TDHA 2UU9M 2EA0A 5LMNM 1IBMM 4G4QA 1HNZM 4JYAM 4PCZA 4X64M 1K3WA 5BR8M 4AQYM
chains in the Genus database with same CATH superfamily
1P3QQ 2D7GA 2BJWA 3BBZA 3A46A 4DUZM 1QANA 4I4LA 4LF9M 4OX9M 1W5SA 4D81A 3VKHA 1XXHE 3Q8GA 1QAQA 2UXBM 3FUXA 3W67A 4DV5M 4S12A 1NY5A 1PJJA 2FOIC 2QSFX 5IT9S 1HQCA 1ZAEA 3SHGB 5ITQA 3K8ZA 4B08A 3FTCA 5JI2E 5FTJA 2RGOA 1OAIA 3M0EA 3VDPA 2LVQD 4QHSA 4K0KM 3ZH9B 3FYCA 2M5ZA 3FRIA 3H4MA 4QNMA 2JZ0A 3D8BA 4CISA 2X4AA 3SARA 2DHRA 4MGIE 3RGPA 2E5LM 4D82A 3T15A 2WSFF 3TWMA 3A98B 5KPTA 2L2DA 4JI2M 3SMSA 3U6PA 4ZPXA 1L2DA 2UUAM 1DGGA 1XXHA 1MX0A 2CRUA 2C9CA 3F92A 1RU3A 3HHWA 4NSOB 4DR7M 3HJQA 1IN5A 2XFTA 4RNAA 2KA6B 5ITRA 4IBIA 2HKJA 4AG6A 2O5RA 3PFIA 5ITXE 4CGYB 4DR2M 1GJSA 3U61B 2XEPA 3T1YM 2XSZA 3DFZA 2MJ5B 5C18A 1HR0M 3KXEC 2QNJA 5GKNA 5IZ7D 2CV0A 3EIEA 1D0LA 3AV0A 3C58A 2R65A 1SXJD 2JY8A 2X49A 2RRUA 3K1JA 3W0FA 4LF7M 1GJTA 1R4GA 1PJIA 1V33A 1D0KA 4B7HA 5EXPA 1Z5BA 1SXJB 4REZA 5KPZA 2C99A 2B3TA 1LTMA 1IN8A 1IXSA 2I7NA 1FNNA 1YE9A 2MR9A 4DV1M 3SAVA 1L8QA 1E9RA 2A5YB 4JI7M 2QQ8A 2Z4RA 3SATA 4GKJM 1MU5A 2C5RA 4KHPM 3QYEA 7CATA 2DZOB 2R46A 3GO8A 3KSJA 5ITXA 4KODA 2CHVA 3GLFE 2L4FA 4DV6M 2VQFM 4L78A 4AI6A 4M9SA 2JZ1A 2CEAA 4LZJA 3KS4A 1WGNA 1OJLA 3QAUA 4NL4H 1N36M 4FW9A 2R0IA 2DAGA 4LF5M 1Q39A 2YNMD 2KNZA 2UXCM 1BVSA 3JR4A 3R8FA 3KVWA 1HJPA 1ZV1A 4HLQA 5ITUA 4B3SM 1GABA 1TH3A 3FUVA 2VQEM 2DZNB 5EXSA 4L4UA 1EE8A 2DAEA 3CTWB 3GRUA 3Q8XA 3GPYA 2KNVA 2LHCA 1VEKA 3GRYA 4G3OA 5KQDA 1NJFA 4DR1M 4PT5A 3K92A 1EFUB 4FWGA 3C3DA 2MGWA 4FWDA 3L27A 2C9OA 2JXNA 4MGYE 3I51A 4NOOB 1KSFX 2JY5A 3SYLA 3SYKA 3WHKA 3AOEA 4JI5M 1DGHB 1VEGA 1TDHA 2C96A 2QCUA 1HT1E 3TE6A 4Z6YA 3GLFA 1W5TA 1K3WA 3LMMA 4IBFA 1T43A 5BR8M 1YUBA 1VDLA 1GVNA 3L25A 1PJSA 1QYRA 4GC9A 3M6AA 4L15A 3EIHA 3RGSA 3THGA 3D8LA 5EXTA 2M60A 3UJNA 3CF2A 3SC3A 2D7HA 2LVPC 2QENA 3ZC7B 2GNOA 4G6ZA 4QOSA 2LBCA 3IG8A 2WZJA 1DGBA 4RKUF 3T38A 2APLA 2L09A 2QPAA 3KP1E 5ITYA 4BLCA 3K9PA 1XHBA 5C1BA 3UZUA 8CATA 2DHYA 2KRUA 4CHTB 3I01M 2XZFA 4MGKE 2QBYA 3JR5A 3HJ8A 4JI6M 3VDUA 1SXJC 1PGYA 4BB9A 1NVMA 4GH9A 2Y20A 4W5WA 1I94M 2R6FA 2J5YA 1X37A 4XBOA 2XSZD 3KW6A 4LJAA 5L8RF 4FCWA 3FD9A 2OPFA 5E26A 3MMPA 3MHVC 3LVVA 4WURA 4NXMM 3PNYA 3U6OA 4I8OA 2R18A 3AKZA 4JI4M 1G3IA 2RGHA 4GEWA 3ZQJA 1DV0A 2J7NA 1NO1A 1L2CA 3B89A 5FLXS 2OOBA 1OFHA 3IG5A 3U6LA 3M7GA 3TL4X 2EJSA 1A5TA 2I7PA 4MH0E 4DV0M 2DWNA 3I4YA 4JI0M 1N32M 2CV1A 1NV9A 1NY6A 2JUJA 3U60A 1KYIA 4B7FA 3V76A 3B74A 1LV7A 2EUCA 4P16A 5FTMA 1G4AE 2RKOA 3FRHA 4LCBA 3U6SA 1QAMA 3AFHA 5KQ8A 4QOZC 2JP7A 1GL7A 4HL4A 2XFSA 3K9OA 4LRSA 2WSCF 3KSXA 3KOYE 3GLGB 4B7GA 4L16A 4MGZE 3GLIB 4ITQA 2K6BA 3B7QA 5EP3A 3FUUA 4JI8M 2X8AA 2ZM6M 3K2LA 4KO8A 2F5SA 4B3MM 4GHAA 3SFZA 4PDIA 1T6OA 1G71A 1Q3BA 4R71A 3U6CA 4RF0A 1R6BX 1N78A 1VG5A 4XK8F 3ILKA 1GL6A 1QAOA 2DWLA 4P17A 4B3TM 1L2BA 3GPPA 1TDZA 3DA1A 2NQ8C 2HHHM 2KXEA 5EJCA 1SG9A 5KO3A 4NRWA 4JI1M 4DV7M 2G3QA 1ORYB 2QP9X 4OVZB 2VIIA 2DAMA 3HHXA 1NHGC 4LJ5A 2H5XA 3OTOM 3CF6E 4IBJA 4CIZA 4F1IA 2JNHA 2W82A 3HJSA 5KPRA 2F5QA 3CGWA 3SAUA 5DYIA 1G8PA 4GC5A 4JI3M 2EKFA 2CE7A 4DV3M 3U6EA 1QDTA 3GLHB 4G4NA 2Z8YM 1G59A 4IBGA 3I04M 3GLIE 1NNJA 3KOZE 2F5OA 1J5EM 3VKGA 5EP1A 4DBGB 4G4OA 1N33M 2DVWB 1AUAA 2AHMA 1N77A 2Z7JA 3HZJA 2N35A 2UU9M 2EA0A 5LMNM 1IBMM 4IJFA 2JY6B 4JYAM 3AL0C 3AOGA 4FVMA 5EP4A 3IHPA 4M9XA 4NXNM 1JR3E 1QVRA 3T1HM 2KW0A 3J80S 2DWZB 2KZUA 3J27B 1K82A 3U5ZB 4GIPA 4NC6A 1OIPA 3UMMA 5IWAM 3GQ3A 3SASA 1WR1B 3FTDA 2YR0A 3E4RA 4IBEA 1TGUA 1QUTA 2FFJA 1E9SA 4MM3B 3I4VA 1DO2A 4LZZA 3GPUA 2G5GX 4LJ4A 1QZMA 2R62A 1IN6A 5FSWA 3L2AA 4AW4A 1R5LA 3GLIA 1HT2E 2CFOA 3SMPA 1WGLA 3KP0E 1SXJE 3FKEA 2DI0A 1VDDA 2L4EA 3TWLA 3QYBA 3L26A 3NBXX 3SBJA 3BOSA 4D80A 2QBYB 3LCUA 4IJEA 1KFVA 2DWMA 2ZAMA 1ZQ9A 4DR4M 2DAIA 2ZTCA 1QDRA 2ZAOA 3PVSA 4DV4M 1IXZA 1S3SA 1JR3A 5FTKA 2CHGA 2KEBA 3LW5F 2V6ZM 2LNHC 4M9ZA 2Z4SA 3U61A 1XMOM 1TF0B 1OIZA 4IBKA 2EO2A 2K0BX 2DZLA 2QHOB 1TTEA 1IY0A 3FTEA 1WHCA 1GO5A 4KLNA 3UK6A 3W0LB 3MK6A 2R44A 1GLNA 1Z59A 2P5TA 5EQTA 1GKIA 1XXHB 1HNWM 1IM2A 1J7KA 1SXJA 1E32A 1Q02A 1IQPA 3GLHA 4L8RC 4YHHM 3GRVA 1N34M 1IXRC 4DV2M 2Z3XA 2XF3A 1R2YA 1ZMUA 4I5SA 4ANRA 1T3TA 1WJ7A 3U6QA 4GITA 2LHGA 2G8LA 2Q2EB 3SAWA 1XC8A 1K3XA 1XNRM 4UN2B 1QUSA 4LFBM 3HX3A 2K9DA 2XZUA 1OKSA 3CF0A 1TR8A 2OO9A 1V92A 5E6JA 4YY3M 3U6MA 3MJ5A 4AZFA 1AIPC 3GQ5A 1I4WA 1QZEA 2ZBKB 5A2QS 2FNAA 3J7AS 4DUYM 3U5ZA 1Z5CA 2D7EA 4FWHA 3B7ZA 3PNVA 2YFQA 1WXQA 3HHZA 1HQYE 3RE8A 3FTFA 2UUCM 4X62M 2HWJA 2BWEA 4LGMA 5DNYA 3A45A 2JWSA 2VF8A 2LWXA 2UXDM 1YLAA 4IIWA 3TWKA 2R45A 1IN7A 3L28A 3HHYA 4X65M 4KT0F 3KFUG 4Y28F 1XMQM 3DOAA 5BPVA 4LJ9A 1DGHA 3GPXA 3GQ4A 4LY6A 5LMUM 2C98A 2FS1A 4M0WA 4F2LA 1L1TA 3GP1A 1MJGM 3C9PA 2GQFA 2FE8A 1IN4A 1UM8A 1JQJC 4GKKM 2F5NA 2ERCA 4G4RA 5H37D 2HL7A 2HCBA 4Q7JA 3LVWA 1F4IA 2O01F 4LFAM 4A3VB 4BBAA 2DKLA 1MN3A 2YQZA 4G4QA 5FTNA 3NWLA 4X64M 1G41A 4AQYM 3E46A 3FUWA 2O25A 3E21A 4LJ7A 3WHLA 2HAKA 1CUKA 2Y0QA 4DR6M 5F3WA 1NSFA 1VQ1A 2KDLA 2OQ4A 2L7IA 3KS8A 1TH4A 2LH0A 2LVAA 4OU7A 3FUTA 4FD2A 1IY1A 1JR3D 3GLFB 1PRBA 4DR3M 5JI3E 1NV8A 3KDSE 4FCTA 1J09A 3LQRA 3GLGE 2XGNA 2J7OA 5DFLA 5EXXA 4LJ8A 3U6DA 5DYGA 2KRKA 1PJQA 2H1RA 3E9SA 3LCVB 3W68A 4GHLA 3BXWA 4WW0A 5ITTA 3DZDA 4LG2A 2QZ4A 4AKIA 4LJ6A 4B3RM 1D2NA 1NJGA 2BNKA 4LGYA 4EIWA 4PDGA 4QHTA 4LFCM 4CJ6A 3ZCBB 2MROB 4MB7A 3VK7A 1ZMVA 4WP2A 4JN6A 4IBCA 2XH9A 3JAMS 2R4JA 4NRVA 1V34A 3VLFB 3HU2A 3GLGA 1E94E 3UGJA 3HKPA 2F5PA 2DENA 1C1KA 2CV2A 2JY7A 1QQWA 2LTUA 3HGIA 1R7RA 1R2ZA 3FE3A 3GLHE 3GRRA 1FJGM 2KHHA 2BJVA 2DNAA 3L29A 3H4JA 4XGIA 2JA2A 1YSYA 4R7GA 4OW0A 4Z8XA 1Q3CA 3TQSA 2OOAA 2Y21A 4X66M 3U60B 4LF6M 1D0MA 1H6UA 4IBDA 4LF4M 2CWBA 4L6V6 1DO0A 3J81S 3QWLA 5FTLA 1Z5AA 3J2PB 2LVNC 2Y0TA 1N75A 5EP2A 1Z6TA 1IBLM 4PD2A 2MH8A 5IREB 4TUWA 2KZSA 2VF7A 4RF1A 2DAKA 2DXIA 1L1ZA 3VK8A 1IBKM 2FH0A 4DR5M 2XLJA 1OAOC 4AKGA 1IFYA 1OQYA 1XWIA 4MGHA 3R9XB 1NNUC 4OVZA 1NHWC 1EIJA 3B9PA 1PJTA 1TH2A 4JXJA 3TPZA 4M0DA 4NSRA 3AOEC 4AG5A 1Y8GA 3HWSA 2LVOC 4GMQA 3HU1A 1PM5A 1XB2B 1HNXM 3IECA 2LXEA 3NBIA 2ZANA 3PXGA 3SHFA 3A42A 1UFZA 2WSEF 1VEJA 2CUZA 4HEOA 4R3DA 1C7YA 2BWBA 1XNQM 3HY5A 2ZTDA 3J7BA 2L6OA 1ZMWA 4FCVA 2UUBM 4LF8M 3KOWE 4JV5M 2CHQA 2V1UA 4I81A 4LRTA 2F4VM 1WIVA 3C3EA 2L7HA 1JB0F 1OTRA 3RFWA 3T6PA 4AKHA 3KOXE 3B7NA 2KNAA 3VFDA 2V1CA 1IY2A 1OFIA 4GRIA 2CP8A 3LQQA 4II7A 4IBBA 3HU3A 4QNRA 2EKKA 3AJIB 1DGFA 2R4EA 3FYDA 1HNZM 4PCZA 1IXSB 2VDBB 2K47A
chains in the Genus database with same CATH topology
2D7GA 2BJWA 3A46A 4DUZM 1QANA 4I4LA 4LF9M 4OX9M 1W5SA 4D81A 3VKHA 1QAQA 2UXBM 3FUXA 4DV5M 4S12A 1NY5A 1PJJA 2FOIC 5IT9S 1HQCA 1ZAEA 3SHGB 5ITQA 3K8ZA 4B08A 3FTCA 5JI2E 5FTJA 2RGOA 3M0EA 3VDPA 4QHSA 4K0KM 3ZH9B 3FYCA 2M5ZA 4QNMA 3H4MA 3D8BA 4CISA 2X4AA 3SARA 2DHRA 4MGIE 3RGPA 2E5LM 4D82A 3T15A 3TWMA 3A98B 5KPTA 4JI2M 3SMSA 3U6PA 4ZPXA 1L2DA 2UUAM 1DGGA 1XXHA 1MX0A 3HHWA 2C9CA 4NSOB 4DR7M 3HJQA 1IN5A 2XFTA 4RNAA 2KA6B 5ITRA 4IBIA 2HKJA 4AG6A 2O5RA 3PFIA 5ITXE 4CGYB 4DR2M 3U61B 2XEPA 3T1YM 2XSZA 3DFZA 5C18A 1HR0M 3KXEC 5GKNA 5IZ7D 2CV0A 3EIEA 3AV0A 3C58A 2R65A 1SXJD 2X49A 3K1JA 3W0FA 4LF7M 1PJIA 4B7HA 5EXPA 1Z5BA 1SXJB 4REZA 5KPZA 2C99A 4DV1M 1IN8A 1FNNA 2I7NA 1YE9A 3SAVA 1L8QA 1E9RA 2A5YB 4JI7M 2Z4RA 3SATA 4GKJM 1MU5A 2C5RA 4KHPM 7CATA 2DZOB 2R46A 3GO8A 3KSJA 5ITXA 4KODA 2CHVA 4DV6M 2VQFM 4L78A 4AI6A 4M9SA 2CEAA 4LZJA 3KS4A 1OJLA 3QAUA 4NL4H 1N36M 4FW9A 4LF5M 1Q39A 2YNMD 2UXCM 3JR4A 3R8FA 3KVWA 4B3SM 4HLQA 5ITUA 1TH3A 3FUVA 2VQEM 2DZNB 5EXSA 4L4UA 1EE8A 3CTWB 3GRUA 3Q8XA 3GPYA 5KQDA 3GRYA 1NJFA 4DR1M 4PT5A 4FWDA 4FWGA 5DNYA 3L27A 2C9OA 4MGYE 4NOOB 3I51A 3SYLA 1KSFX 3SYKA 3WHKA 4JI5M 3AOEA 1DGHB 1TDHA 2C96A 2QCUA 1HT1E 3TE6A 4Z6YA 3GLFA 1W5TA 1K3WA 3LMMA 4IBFA 5BR8M 1YUBA 1GVNA 3L25A 1QYRA 4GC9A 3M6AA 4L15A 3EIHA 3RGSA 3THGA 3D8LA 5EXTA 2M60A 3UJNA 3CF2A 3SC3A 2D7HA 2QENA 3ZC7B 4G6ZA 4QOSA 3IG8A 1DGBA 3T38A 2L09A 2QPAA 3KP1E 5ITYA 4BLCA 5C1BA 8CATA 1XHBA 5KO3A 3UZUA 3J7AS 2KRUA 2XZFA 4CHTB 4MGKE 3JR5A 3HJ8A 4JI6M 3VDUA 1SXJC 4BB9A 1NVMA 4GH9A 2Y20A 4W5WA 1I94M 4XBOA 1X37A 2XSZD 3KW6A 4LJAA 2OPFA 4FCWA 3FD9A 5E26A 3MHVC 3LVVA 4WURA 4NXMM 3PNYA 3U6OA 4I8OA 2R18A 3AKZA 4JI4M 1G3IA 2RGHA 2J7NA 1L2CA 5FLXS 1OFHA 3IG5A 3U6LA 3M7GA 3TL4X 2I7PA 4MH0E 4DV0M 2DWNA 3I4YA 4JI0M 1N32M 2CV1A 1NY6A 3U60A 1KYIA 4B7FA 1LV7A 2EUCA 4P16A 5FTMA 1G4AE 2RKOA 4LCBA 3U6SA 1QAMA 3AFHA 5KQ8A 4QOZC 1GL7A 4HL4A 2XFSA 4LRSA 3KSXA 3KOYE 3GLGB 4B7GA 4L16A 4MGZE 3GLIB 4ITQA 5EP3A 3FUUA 4JI8M 2X8AA 2ZM6M 3K2LA 4KO8A 2F5SA 4B3MM 4GHAA 3SFZA 4PDIA 1Q3BA 3U6CA 4RF0A 1R6BX 1N78A 3ILKA 1GL6A 1QAOA 2DWLA 4B3TM 1L2BA 3GPPA 1TDZA 3DA1A 2NQ8C 2HHHM 2KXEA 5EJCA 4NRWA 4JI1M 4DV7M 1ORYB 2QP9X 4OVZB 2VIIA 3HHXA 1NHGC 4LJ5A 3OTOM 3CF6E 4IBJA 5KPRA 2W82A 3HJSA 2F5QA 3SAUA 5DYIA 1G8PA 4GC5A 4JI3M 4DV3M 2CE7A 3U6EA 3GLHB 4G4NA 1G59A 4IBGA 1NNJA 3KOZE 2F5OA 1J5EM 3VKGA 5EP1A 4G4OA 1N33M 2DVWB 2AHMA 1N77A 2Z7JA 2UU9M 2EA0A 5LMNM 1IBMM 4IJFA 4JYAM 3AL0C 3AOGA 4FVMA 5EP4A 4M9XA 4NXNM 1QVRA 3T1HM 2KW0A 3J80S 2DWZB 2KZUA 3J27B 1K82A 3U5ZB 4GIPA 3UMMA 5IWAM 3GQ3A 3SASA 3FTDA 2YR0A 3E4RA 4IBEA 1TGUA 2FFJA 4MM3B 1E9SA 3I4VA 1DO2A 4LZZA 3GPUA 2G5GX 4LJ4A 1QZMA 2R62A 1IN6A 5FSWA 3L2AA 4AW4A 3GLIA 1HT2E 2CFOA 3SMPA 3L26A 3KP0E 1SXJE 3FKEA 1VDDA 3TWLA 3SBJA 3BOSA 4D80A 2QBYB 4IJEA 1KFVA 2DWMA 2ZAMA 1ZQ9A 4DR4M 2ZAOA 3PVSA 4DV4M 1IXZA 1S3SA 1JR3A 5FTKA 2CHGA 2KEBA 2V6ZM 2LNHC 4M9ZA 2Z4SA 3U61A 1XMOM 4IBKA 2EO2A 1IY0A 3FTEA 4KLNA 3UK6A 3W0LB 3MK6A 1GLNA 1Z59A 2P5TA 5EQTA 1GKIA 1XXHB 1HNWM 1IM2A 1J7KA 1SXJA 1E32A 1IQPA 3GLHA 4L8RC 4YHHM 3GRVA 1N34M 1IXRC 4DV2M 2Z3XA 2XF3A 1R2YA 4I5SA 1T3TA 3U6QA 4GITA 3SAWA 2G8LA 2Q2EB 1XC8A 1K3XA 1XNRM 4LFBM 2XZUA 3CF0A 4YY3M 3U6MA 5E6JA 3MJ5A 4AZFA 3GQ5A 1I4WA 2ZBKB 5A2QS 2FNAA 4DUYM 3U5ZA 1Z5CA 2D7EA 4FWHA 3PNVA 2YFQA 1WXQA 3HHZA 1HQYE 3RE8A 3FTFA 2UUCM 4X62M 4LGMA 3A45A 2LWXA 2UXDM 4IIWA 3TWKA 2R45A 1IN7A 3L28A 3HHYA 4X65M 3KFUG 1XMQM 3DOAA 5BPVA 4LJ9A 1DGHA 3GPXA 3GQ4A 4LY6A 5LMUM 2C98A 4M0WA 2QBYA 1L1TA 3GP1A 2FE8A 1IN4A 1UM8A 1JQJC 4GKKM 2F5NA 2ERCA 4G4RA 5H37D 2HL7A 2HCBA 3LVWA 4LFAM 4A3VB 4BBAA 2YQZA 4G4QA 5FTNA 3NWLA 4X64M 1G41A 4AQYM 3FUWA 4LJ7A 3WHLA 2Y0QA 4DR6M 5F3WA 1NSFA 2OQ4A 3KS8A 2L7IA 1TH4A 2LH0A 4OU7A 3FUTA 4FD2A 1IY1A 1JR3D 3GLFB 4DR3M 5JI3E 3KDSE 4FCTA 1J09A 3LQRA 2XGNA 2J7OA 5EXXA 4LJ8A 3U6DA 5DYGA 2KRKA 2H1RA 3E9SA 4GHLA 4WW0A 5ITTA 3DZDA 4LG2A 2QZ4A 4AKIA 4LJ6A 4B3RM 1D2NA 1NJGA 2BNKA 4LGYA 4EIWA 4PDGA 4QHTA 4LFCM 3ZCBB 4MB7A 3VK7A 4JN6A 4IBCA 2XH9A 3JAMS 2R4JA 4NRVA 3VLFB 3HU2A 3GLGA 1E94E 3UGJA 3HKPA 2F5PA 1C1KA 2CV2A 1QQWA 3HGIA 1R7RA 1R2ZA 3GRRA 1FJGM 2BJVA 4XGIA 3L29A 2JA2A 1YSYA 4R7GA 4OW0A 4Z8XA 1Q3CA 3TQSA 4X66M 2Y21A 3U60B 4LF6M 1H6UA 4LF4M 4IBDA 1DO0A 3J81S 3QWLA 5FTLA 1Z5AA 3J2PB 2Y0TA 1N75A 5EP2A 1Z6TA 1IBLM 4PD2A 5IREB 4TUWA 2KZSA 4RF1A 2DXIA 1L1ZA 3VK8A 1IBKM 4DR5M 2XLJA 4AKGA 1XWIA 4MGHA 3R9XB 1NNUC 4OVZA 1NHWC 3B9PA 1TH2A 3TPZA 4JXJA 4M0DA 4NSRA 3AOEC 4AG5A 3HWSA 4GMQA 3HU1A 1PM5A 1HNXM 2LXEA 3NBIA 2ZANA 3PXGA 3SHFA 3A42A 1XNQM 4R3DA 2CUZA 3J7BA 2L6OA 4FCVA 2UUBM 4LF8M 3KOWE 4JV5M 2CHQA 2V1UA 4I81A 4LRTA 2F4VM 4AKHA 2L7HA 3RFWA 3KOXE 3VFDA 2V1CA 1IY2A 1OFIA 4GRIA 3LQQA 4II7A 4IBBA 3HU3A 4QNRA 3AJIB 1DGFA 2R4EA 3FYDA 1HNZM 4PCZA 1IXSB 3K92A 2K47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN M;  3T1H M;  3J80 S;  3A46 A;  4DUZ M;  1K82 A;  4LF9 M;  4OX9 M;  4DR6 M;  2OQ4 A;  3GQ3 A;  5IWA M;  3SAS A;  4DR3 M;  2UXB M;  4DV5 M;  3GPU A;  1PJJ A;  5IT9 S;  5ITY A;  3J7A S;  5ITQ A;  3U6D A;  2XZF A;  3JR5 A;  4JI6 M;  3TWL A;  3SBJ A;  5ITT A;  4K0K M;  1I94 M;  1KFV A;  4CIS A;  4B3R M;  4DR4 M;  2OPF A;  3SAR A;  4DV4 M;  4NXM M;  3U6O A;  2E5L M;  4JI4 M;  3TWM A;  4PDG A;  4LFC M;  4JI2 M;  1XMO M;  1L2C A;  4MB7 A;  3VK7 A;  3U6P A;  1L2D A;  5FLX S;  2UUA M;  3U6L A;  1MX0 A;  4DR7 M;  4DV0 M;  3JAM S;  5ITR A;  4NRV A;  4JI0 M;  1N32 M;  2HKJ A;  2F5P A;  4DR2 M;  5ITX E;  3T1Y M;  1Z59 A;  3U6S A;  1HNW M;  1R2Z A;  1HR0 M;  1FJG M;  4YHH M;  1N34 M;  4DV2 M;  1R2Y A;  4X66 M;  1Q3C A;  4LF6 M;  3C58 A;  3U6Q A;  4ITQ A;  4LF4 M;  3SAW A;  2Q2E B;  1XC8 A;  1K3X A;  3W0F A;  4LF7 M;  1XNR M;  3J81 S;  1PJI A;  4JI8 M;  4LFB M;  1Z5A A;  2XZU A;  1Z5B A;  4YY3 M;  2ZM6 M;  3U6M A;  1IBL M;  2F5S A;  4PD2 A;  4B3M M;  3GQ5 A;  1L1Z A;  3VK8 A;  4DV1 M;  2ZBK B;  3SAV A;  4PDI A;  4DR5 M;  1IBK M;  5A2Q S;  1Q3B A;  4JI7 M;  3U6C A;  3SAT A;  4DUY M;  1MU5 A;  4GKJ M;  4KHP M;  1Z5C A;  3GO8 A;  5ITX A;  4DV6 M;  4B3T M;  1L2B A;  3GPP A;  1TDZ A;  2VQF M;  2HHH M;  2UUC M;  4X62 M;  1PM5 A;  1HNX M;  3A45 A;  4JI1 M;  4NRW A;  4DV7 M;  1N36 M;  2UXD M;  3TWK A;  4LF5 M;  1Q39 A;  3OTO M;  2UXC M;  3A42 A;  3JR4 A;  2F5Q A;  3SAU A;  4X65 M;  4B3S M;  1XNQ M;  5ITU A;  4JI3 M;  1XMQ M;  4DV3 M;  3U6E A;  3DOA A;  3GPX A;  3GQ4 A;  2VQE M;  4G4N A;  5LMU M;  2UUB M;  4LF8 M;  4JV5 M;  2F4V M;  1EE8 A;  1L1T A;  3GP1 A;  3GPY A;  1NNJ A;  2F5O A;  1J5E M;  4G4O A;  4DR1 M;  1N33 M;  4GKK M;  2F5N A;  4G4R A;  4JI5 M;  4LFA M;  1TDH A;  2UU9 M;  2EA0 A;  5LMN M;  1IBM M;  4G4Q A;  1HNZ M;  4JYA M;  4PCZ A;  4X64 M;  1K3W A;  5BR8 M;  4AQY M; 
#chains in the Genus database with same CATH topology
 1P3Q Q;  2D7G A;  2BJW A;  3BBZ A;  3A46 A;  4DUZ M;  1QAN A;  4I4L A;  4LF9 M;  4OX9 M;  1W5S A;  4D81 A;  3VKH A;  1XXH E;  3Q8G A;  1QAQ A;  2UXB M;  3FUX A;  3W67 A;  4DV5 M;  4S12 A;  1NY5 A;  1PJJ A;  2FOI C;  2QSF X;  5IT9 S;  1HQC A;  1ZAE A;  3SHG B;  5ITQ A;  3K8Z A;  4B08 A;  3FTC A;  5JI2 E;  5FTJ A;  2RGO A;  1OAI A;  3M0E A;  3VDP A;  2LVQ D;  4QHS A;  4K0K M;  3ZH9 B;  3FYC A;  2M5Z A;  3FRI A;  3H4M A;  4QNM A;  2JZ0 A;  3D8B A;  4CIS A;  2X4A A;  3SAR A;  2DHR A;  4MGI E;  3RGP A;  2E5L M;  4D82 A;  3T15 A;  2WSF F;  3TWM A;  3A98 B;  5KPT A;  2L2D A;  4JI2 M;  3SMS A;  3U6P A;  4ZPX A;  1L2D A;  2UUA M;  1DGG A;  1XXH A;  1MX0 A;  2CRU A;  2C9C A;  3F92 A;  1RU3 A;  3HHW A;  4NSO B;  4DR7 M;  3HJQ A;  1IN5 A;  2XFT A;  4RNA A;  2KA6 B;  5ITR A;  4IBI A;  2HKJ A;  4AG6 A;  2O5R A;  3PFI A;  5ITX E;  4CGY B;  4DR2 M;  1GJS A;  3U61 B;  2XEP A;  3T1Y M;  2XSZ A;  3DFZ A;  2MJ5 B;  5C18 A;  1HR0 M;  3KXE C;  2QNJ A;  5GKN A;  5IZ7 D;  2CV0 A;  3EIE A;  1D0L A;  3AV0 A;  3C58 A;  2R65 A;  1SXJ D;  2JY8 A;  2X49 A;  2RRU A;  3K1J A;  3W0F A;  4LF7 M;  1GJT A;  1R4G A;  1PJI A;  1V33 A;  1D0K A;  4B7H A;  5EXP A;  1Z5B A;  1SXJ B;  4REZ A;  5KPZ A;  2C99 A;  2B3T A;  1LTM A;  1IN8 A;  1IXS A;  2I7N A;  1FNN A;  1YE9 A;  2MR9 A;  4DV1 M;  3SAV A;  1L8Q A;  1E9R A;  2A5Y B;  4JI7 M;  2QQ8 A;  2Z4R A;  3SAT A;  4GKJ M;  1MU5 A;  2C5R A;  4KHP M;  3QYE A;  7CAT A;  2DZO B;  2R46 A;  3GO8 A;  3KSJ A;  5ITX A;  4KOD A;  2CHV A;  3GLF E;  2L4F A;  4DV6 M;  2VQF M;  4L78 A;  4AI6 A;  4M9S A;  2JZ1 A;  2CEA A;  4LZJ A;  3KS4 A;  1WGN A;  1OJL A;  3QAU A;  4NL4 H;  1N36 M;  4FW9 A;  2R0I A;  2DAG A;  4LF5 M;  1Q39 A;  2YNM D;  2KNZ A;  2UXC M;  1BVS A;  3JR4 A;  3R8F A;  3KVW A;  1HJP A;  1ZV1 A;  4HLQ A;  5ITU A;  4B3S M;  1GAB A;  1TH3 A;  3FUV A;  2VQE M;  2DZN B;  5EXS A;  4L4U A;  1EE8 A;  2DAE A;  3CTW B;  3GRU A;  3Q8X A;  3GPY A;  2KNV A;  2LHC A;  1VEK A;  3GRY A;  4G3O A;  5KQD A;  1NJF A;  4DR1 M;  4PT5 A;  3K92 A;  1EFU B;  4FWG A;  3C3D A;  2MGW A;  4FWD A;  3L27 A;  2C9O A;  2JXN A;  4MGY E;  3I51 A;  4NOO B;  1KSF X;  2JY5 A;  3SYL A;  3SYK A;  3WHK A;  3AOE A;  4JI5 M;  1DGH B;  1VEG A;  1TDH A;  2C96 A;  2QCU A;  1HT1 E;  3TE6 A;  4Z6Y A;  3GLF A;  1W5T A;  1K3W A;  3LMM A;  4IBF A;  1T43 A;  5BR8 M;  1YUB A;  1VDL A;  1GVN A;  3L25 A;  1PJS A;  1QYR A;  4GC9 A;  3M6A A;  4L15 A;  3EIH A;  3RGS A;  3THG A;  3D8L A;  5EXT A;  2M60 A;  3UJN A;  3CF2 A;  3SC3 A;  2D7H A;  2LVP C;  2QEN A;  3ZC7 B;  2GNO A;  4G6Z A;  4QOS A;  2LBC A;  3IG8 A;  2WZJ A;  1DGB A;  4RKU F;  3T38 A;  2APL A;  2L09 A;  2QPA A;  3KP1 E;  5ITY A;  4BLC A;  3K9P A;  1XHB A;  5C1B A;  3UZU A;  8CAT A;  2DHY A;  2KRU A;  4CHT B;  3I01 M;  2XZF A;  4MGK E;  2QBY A;  3JR5 A;  3HJ8 A;  4JI6 M;  3VDU A;  1SXJ C;  1PGY A;  4BB9 A;  1NVM A;  4GH9 A;  2Y20 A;  4W5W A;  1I94 M;  2R6F A;  2J5Y A;  1X37 A;  4XBO A;  2XSZ D;  3KW6 A;  4LJA A;  5L8R F;  4FCW A;  3FD9 A;  2OPF A;  5E26 A;  3MMP A;  3MHV C;  3LVV A;  4WUR A;  4NXM M;  3PNY A;  3U6O A;  4I8O A;  2R18 A;  3AKZ A;  4JI4 M;  1G3I A;  2RGH A;  4GEW A;  3ZQJ A;  1DV0 A;  2J7N A;  1NO1 A;  1L2C A;  3B89 A;  5FLX S;  2OOB A;  1OFH A;  3IG5 A;  3U6L A;  3M7G A;  3TL4 X;  2EJS A;  1A5T A;  2I7P A;  4MH0 E;  4DV0 M;  2DWN A;  3I4Y A;  4JI0 M;  1N32 M;  2CV1 A;  1NV9 A;  1NY6 A;  2JUJ A;  3U60 A;  1KYI A;  4B7F A;  3V76 A;  3B74 A;  1LV7 A;  2EUC A;  4P16 A;  5FTM A;  1G4A E;  2RKO A;  3FRH A;  4LCB A;  3U6S A;  1QAM A;  3AFH A;  5KQ8 A;  4QOZ C;  2JP7 A;  1GL7 A;  4HL4 A;  2XFS A;  3K9O A;  4LRS A;  2WSC F;  3KSX A;  3KOY E;  3GLG B;  4B7G A;  4L16 A;  4MGZ E;  3GLI B;  4ITQ A;  2K6B A;  3B7Q A;  5EP3 A;  3FUU A;  4JI8 M;  2X8A A;  2ZM6 M;  3K2L A;  4KO8 A;  2F5S A;  4B3M M;  4GHA A;  3SFZ A;  4PDI A;  1T6O A;  1G71 A;  1Q3B A;  4R71 A;  3U6C A;  4RF0 A;  1R6B X;  1N78 A;  1VG5 A;  4XK8 F;  3ILK A;  1GL6 A;  1QAO A;  2DWL A;  4P17 A;  4B3T M;  1L2B A;  3GPP A;  1TDZ A;  3DA1 A;  2NQ8 C;  2HHH M;  2KXE A;  5EJC A;  1SG9 A;  5KO3 A;  4NRW A;  4JI1 M;  4DV7 M;  2G3Q A;  1ORY B;  2QP9 X;  4OVZ B;  2VII A;  2DAM A;  3HHX A;  1NHG C;  4LJ5 A;  2H5X A;  3OTO M;  3CF6 E;  4IBJ A;  4CIZ A;  4F1I A;  2JNH A;  2W82 A;  3HJS A;  5KPR A;  2F5Q A;  3CGW A;  3SAU A;  5DYI A;  1G8P A;  4GC5 A;  4JI3 M;  2EKF A;  2CE7 A;  4DV3 M;  3U6E A;  1QDT A;  3GLH B;  4G4N A;  2Z8Y M;  1G59 A;  4IBG A;  3I04 M;  3GLI E;  1NNJ A;  3KOZ E;  2F5O A;  1J5E M;  3VKG A;  5EP1 A;  4DBG B;  4G4O A;  1N33 M;  2DVW B;  1AUA A;  2AHM A;  1N77 A;  2Z7J A;  3HZJ A;  2N35 A;  2UU9 M;  2EA0 A;  5LMN M;  1IBM M;  4IJF A;  2JY6 B;  4JYA M;  3AL0 C;  3AOG A;  4FVM A;  5EP4 A;  3IHP A;  4M9X A;  4NXN M;  1JR3 E;  1QVR A;  3T1H M;  2KW0 A;  3J80 S;  2DWZ B;  2KZU A;  3J27 B;  1K82 A;  3U5Z B;  4GIP A;  4NC6 A;  1OIP A;  3UMM A;  5IWA M;  3GQ3 A;  3SAS A;  1WR1 B;  3FTD A;  2YR0 A;  3E4R A;  4IBE A;  1TGU A;  1QUT A;  2FFJ A;  1E9S A;  4MM3 B;  3I4V A;  1DO2 A;  4LZZ A;  3GPU A;  2G5G X;  4LJ4 A;  1QZM A;  2R62 A;  1IN6 A;  5FSW A;  3L2A A;  4AW4 A;  1R5L A;  3GLI A;  1HT2 E;  2CFO A;  3SMP A;  1WGL A;  3KP0 E;  1SXJ E;  3FKE A;  2DI0 A;  1VDD A;  2L4E A;  3TWL A;  3QYB A;  3L26 A;  3NBX X;  3SBJ A;  3BOS A;  4D80 A;  2QBY B;  3LCU A;  4IJE A;  1KFV A;  2DWM A;  2ZAM A;  1ZQ9 A;  4DR4 M;  2DAI A;  2ZTC A;  1QDR A;  2ZAO A;  3PVS A;  4DV4 M;  1IXZ A;  1S3S A;  1JR3 A;  5FTK A;  2CHG A;  2KEB A;  3LW5 F;  2V6Z M;  2LNH C;  4M9Z A;  2Z4S A;  3U61 A;  1XMO M;  1TF0 B;  1OIZ A;  4IBK A;  2EO2 A;  2K0B X;  2DZL A;  2QHO B;  1TTE A;  1IY0 A;  3FTE A;  1WHC A;  1GO5 A;  4KLN A;  3UK6 A;  3W0L B;  3MK6 A;  2R44 A;  1GLN A;  1Z59 A;  2P5T A;  5EQT A;  1GKI A;  1XXH B;  1HNW M;  1IM2 A;  1J7K A;  1SXJ A;  1E32 A;  1Q02 A;  1IQP A;  3GLH A;  4L8R C;  4YHH M;  3GRV A;  1N34 M;  1IXR C;  4DV2 M;  2Z3X A;  2XF3 A;  1R2Y A;  1ZMU A;  4I5S A;  4ANR A;  1T3T A;  1WJ7 A;  3U6Q A;  4GIT A;  2LHG A;  2G8L A;  2Q2E B;  3SAW A;  1XC8 A;  1K3X A;  1XNR M;  4UN2 B;  1QUS A;  4LFB M;  3HX3 A;  2K9D A;  2XZU A;  1OKS A;  3CF0 A;  1TR8 A;  2OO9 A;  1V92 A;  5E6J A;  4YY3 M;  3U6M A;  3MJ5 A;  4AZF A;  1AIP C;  3GQ5 A;  1I4W A;  1QZE A;  2ZBK B;  5A2Q S;  2FNA A;  3J7A S;  4DUY M;  3U5Z A;  1Z5C A;  2D7E A;  4FWH A;  3B7Z A;  3PNV A;  2YFQ A;  1WXQ A;  3HHZ A;  1HQY E;  3RE8 A;  3FTF A;  2UUC M;  4X62 M;  2HWJ A;  2BWE A;  4LGM A;  5DNY A;  3A45 A;  2JWS A;  2VF8 A;  2LWX A;  2UXD M;  1YLA A;  4IIW A;  3TWK A;  2R45 A;  1IN7 A;  3L28 A;  3HHY A;  4X65 M;  4KT0 F;  3KFU G;  4Y28 F;  1XMQ M;  3DOA A;  5BPV A;  4LJ9 A;  1DGH A;  3GPX A;  3GQ4 A;  4LY6 A;  5LMU M;  2C98 A;  2FS1 A;  4M0W A;  4F2L A;  1L1T A;  3GP1 A;  1MJG M;  3C9P A;  2GQF A;  2FE8 A;  1IN4 A;  1UM8 A;  1JQJ C;  4GKK M;  2F5N A;  2ERC A;  4G4R A;  5H37 D;  2HL7 A;  2HCB A;  4Q7J A;  3LVW A;  1F4I A;  2O01 F;  4LFA M;  4A3V B;  4BBA A;  2DKL A;  1MN3 A;  2YQZ A;  4G4Q A;  5FTN A;  3NWL A;  4X64 M;  1G41 A;  4AQY M;  3E46 A;  3FUW A;  2O25 A;  3E21 A;  4LJ7 A;  3WHL A;  2HAK A;  1CUK A;  2Y0Q A;  4DR6 M;  5F3W A;  1NSF A;  1VQ1 A;  2KDL A;  2OQ4 A;  2L7I A;  3KS8 A;  1TH4 A;  2LH0 A;  2LVA A;  4OU7 A;  3FUT A;  4FD2 A;  1IY1 A;  1JR3 D;  3GLF B;  1PRB A;  4DR3 M;  5JI3 E;  1NV8 A;  3KDS E;  4FCT A;  1J09 A;  3LQR A;  3GLG E;  2XGN A;  2J7O A;  5DFL A;  5EXX A;  4LJ8 A;  3U6D A;  5DYG A;  2KRK A;  1PJQ A;  2H1R A;  3E9S A;  3LCV B;  3W68 A;  4GHL A;  3BXW A;  4WW0 A;  5ITT A;  3DZD A;  4LG2 A;  2QZ4 A;  4AKI A;  4LJ6 A;  4B3R M;  1D2N A;  1NJG A;  2BNK A;  4LGY A;  4EIW A;  4PDG A;  4QHT A;  4LFC M;  4CJ6 A;  3ZCB B;  2MRO B;  4MB7 A;  3VK7 A;  1ZMV A;  4WP2 A;  4JN6 A;  4IBC A;  2XH9 A;  3JAM S;  2R4J A;  4NRV A;  1V34 A;  3VLF B;  3HU2 A;  3GLG A;  1E94 E;  3UGJ A;  3HKP A;  2F5P A;  2DEN A;  1C1K A;  2CV2 A;  2JY7 A;  1QQW A;  2LTU A;  3HGI A;  1R7R A;  1R2Z A;  3FE3 A;  3GLH E;  3GRR A;  1FJG M;  2KHH A;  2BJV A;  2DNA A;  3L29 A;  3H4J A;  4XGI A;  2JA2 A;  1YSY A;  4R7G A;  4OW0 A;  4Z8X A;  1Q3C A;  3TQS A;  2OOA A;  2Y21 A;  4X66 M;  3U60 B;  4LF6 M;  1D0M A;  1H6U A;  4IBD A;  4LF4 M;  2CWB A;  4L6V 6;  1DO0 A;  3J81 S;  3QWL A;  5FTL A;  1Z5A A;  3J2P B;  2LVN C;  2Y0T A;  1N75 A;  5EP2 A;  1Z6T A;  1IBL M;  4PD2 A;  2MH8 A;  5IRE B;  4TUW A;  2KZS A;  2VF7 A;  4RF1 A;  2DAK A;  2DXI A;  1L1Z A;  3VK8 A;  1IBK M;  2FH0 A;  4DR5 M;  2XLJ A;  1OAO C;  4AKG A;  1IFY A;  1OQY A;  1XWI A;  4MGH A;  3R9X B;  1NNU C;  4OVZ A;  1NHW C;  1EIJ A;  3B9P A;  1PJT A;  1TH2 A;  4JXJ A;  3TPZ A;  4M0D A;  4NSR A;  3AOE C;  4AG5 A;  1Y8G A;  3HWS A;  2LVO C;  4GMQ A;  3HU1 A;  1PM5 A;  1XB2 B;  1HNX M;  3IEC A;  2LXE A;  3NBI A;  2ZAN A;  3PXG A;  3SHF A;  3A42 A;  1UFZ A;  2WSE F;  1VEJ A;  2CUZ A;  4HEO A;  4R3D A;  1C7Y A;  2BWB A;  1XNQ M;  3HY5 A;  2ZTD A;  3J7B A;  2L6O A;  1ZMW A;  4FCV A;  2UUB M;  4LF8 M;  3KOW E;  4JV5 M;  2CHQ A;  2V1U A;  4I81 A;  4LRT A;  2F4V M;  1WIV A;  3C3E A;  2L7H A;  1JB0 F;  1OTR A;  3RFW A;  3T6P A;  4AKH A;  3KOX E;  3B7N A;  2KNA A;  3VFD A;  2V1C A;  1IY2 A;  1OFI A;  4GRI A;  2CP8 A;  3LQQ A;  4II7 A;  4IBB A;  3HU3 A;  4QNR A;  2EKK A;  3AJI B;  1DGF A;  2R4E A;  3FYD A;  1HNZ M;  4PCZ A;  1IXS B;  2VDB B;  2K47 A; 
#chains in the Genus database with same CATH homology
 2D7G A;  2BJW A;  3A46 A;  4DUZ M;  1QAN A;  4I4L A;  4LF9 M;  4OX9 M;  1W5S A;  4D81 A;  3VKH A;  1QAQ A;  2UXB M;  3FUX A;  4DV5 M;  4S12 A;  1NY5 A;  1PJJ A;  2FOI C;  5IT9 S;  1HQC A;  1ZAE A;  3SHG B;  5ITQ A;  3K8Z A;  4B08 A;  3FTC A;  5JI2 E;  5FTJ A;  2RGO A;  3M0E A;  3VDP A;  4QHS A;  4K0K M;  3ZH9 B;  3FYC A;  2M5Z A;  4QNM A;  3H4M A;  3D8B A;  4CIS A;  2X4A A;  3SAR A;  2DHR A;  4MGI E;  3RGP A;  2E5L M;  4D82 A;  3T15 A;  3TWM A;  3A98 B;  5KPT A;  4JI2 M;  3SMS A;  3U6P A;  4ZPX A;  1L2D A;  2UUA M;  1DGG A;  1XXH A;  1MX0 A;  3HHW A;  2C9C A;  4NSO B;  4DR7 M;  3HJQ A;  1IN5 A;  2XFT A;  4RNA A;  2KA6 B;  5ITR A;  4IBI A;  2HKJ A;  4AG6 A;  2O5R A;  3PFI A;  5ITX E;  4CGY B;  4DR2 M;  3U61 B;  2XEP A;  3T1Y M;  2XSZ A;  3DFZ A;  5C18 A;  1HR0 M;  3KXE C;  5GKN A;  5IZ7 D;  2CV0 A;  3EIE A;  3AV0 A;  3C58 A;  2R65 A;  1SXJ D;  2X49 A;  3K1J A;  3W0F A;  4LF7 M;  1PJI A;  4B7H A;  5EXP A;  1Z5B A;  1SXJ B;  4REZ A;  5KPZ A;  2C99 A;  4DV1 M;  1IN8 A;  1FNN A;  2I7N A;  1YE9 A;  3SAV A;  1L8Q A;  1E9R A;  2A5Y B;  4JI7 M;  2Z4R A;  3SAT A;  4GKJ M;  1MU5 A;  2C5R A;  4KHP M;  7CAT A;  2DZO B;  2R46 A;  3GO8 A;  3KSJ A;  5ITX A;  4KOD A;  2CHV A;  4DV6 M;  2VQF M;  4L78 A;  4AI6 A;  4M9S A;  2CEA A;  4LZJ A;  3KS4 A;  1OJL A;  3QAU A;  4NL4 H;  1N36 M;  4FW9 A;  4LF5 M;  1Q39 A;  2YNM D;  2UXC M;  3JR4 A;  3R8F A;  3KVW A;  4B3S M;  4HLQ A;  5ITU A;  1TH3 A;  3FUV A;  2VQE M;  2DZN B;  5EXS A;  4L4U A;  1EE8 A;  3CTW B;  3GRU A;  3Q8X A;  3GPY A;  5KQD A;  3GRY A;  1NJF A;  4DR1 M;  4PT5 A;  4FWD A;  4FWG A;  5DNY A;  3L27 A;  2C9O A;  4MGY E;  4NOO B;  3I51 A;  3SYL A;  1KSF X;  3SYK A;  3WHK A;  4JI5 M;  3AOE A;  1DGH B;  1TDH A;  2C96 A;  2QCU A;  1HT1 E;  3TE6 A;  4Z6Y A;  3GLF A;  1W5T A;  1K3W A;  3LMM A;  4IBF A;  5BR8 M;  1YUB A;  1GVN A;  3L25 A;  1QYR A;  4GC9 A;  3M6A A;  4L15 A;  3EIH A;  3RGS A;  3THG A;  3D8L A;  5EXT A;  2M60 A;  3UJN A;  3CF2 A;  3SC3 A;  2D7H A;  2QEN A;  3ZC7 B;  4G6Z A;  4QOS A;  3IG8 A;  1DGB A;  3T38 A;  2L09 A;  2QPA A;  3KP1 E;  5ITY A;  4BLC A;  5C1B A;  8CAT A;  1XHB A;  5KO3 A;  3UZU A;  3J7A S;  2KRU A;  2XZF A;  4CHT B;  4MGK E;  3JR5 A;  3HJ8 A;  4JI6 M;  3VDU A;  1SXJ C;  4BB9 A;  1NVM A;  4GH9 A;  2Y20 A;  4W5W A;  1I94 M;  4XBO A;  1X37 A;  2XSZ D;  3KW6 A;  4LJA A;  2OPF A;  4FCW A;  3FD9 A;  5E26 A;  3MHV C;  3LVV A;  4WUR A;  4NXM M;  3PNY A;  3U6O A;  4I8O A;  2R18 A;  3AKZ A;  4JI4 M;  1G3I A;  2RGH A;  2J7N A;  1L2C A;  5FLX S;  1OFH A;  3IG5 A;  3U6L A;  3M7G A;  3TL4 X;  2I7P A;  4MH0 E;  4DV0 M;  2DWN A;  3I4Y A;  4JI0 M;  1N32 M;  2CV1 A;  1NY6 A;  3U60 A;  1KYI A;  4B7F A;  1LV7 A;  2EUC A;  4P16 A;  5FTM A;  1G4A E;  2RKO A;  4LCB A;  3U6S A;  1QAM A;  3AFH A;  5KQ8 A;  4QOZ C;  1GL7 A;  4HL4 A;  2XFS A;  4LRS A;  3KSX A;  3KOY E;  3GLG B;  4B7G A;  4L16 A;  4MGZ E;  3GLI B;  4ITQ A;  5EP3 A;  3FUU A;  4JI8 M;  2X8A A;  2ZM6 M;  3K2L A;  4KO8 A;  2F5S A;  4B3M M;  4GHA A;  3SFZ A;  4PDI A;  1Q3B A;  3U6C A;  4RF0 A;  1R6B X;  1N78 A;  3ILK A;  1GL6 A;  1QAO A;  2DWL A;  4B3T M;  1L2B A;  3GPP A;  1TDZ A;  3DA1 A;  2NQ8 C;  2HHH M;  2KXE A;  5EJC A;  4NRW A;  4JI1 M;  4DV7 M;  1ORY B;  2QP9 X;  4OVZ B;  2VII A;  3HHX A;  1NHG C;  4LJ5 A;  3OTO M;  3CF6 E;  4IBJ A;  5KPR A;  2W82 A;  3HJS A;  2F5Q A;  3SAU A;  5DYI A;  1G8P A;  4GC5 A;  4JI3 M;  4DV3 M;  2CE7 A;  3U6E A;  3GLH B;  4G4N A;  1G59 A;  4IBG A;  1NNJ A;  3KOZ E;  2F5O A;  1J5E M;  3VKG A;  5EP1 A;  4G4O A;  1N33 M;  2DVW B;  2AHM A;  1N77 A;  2Z7J A;  2UU9 M;  2EA0 A;  5LMN M;  1IBM M;  4IJF A;  4JYA M;  3AL0 C;  3AOG A;  4FVM A;  5EP4 A;  4M9X A;  4NXN M;  1QVR A;  3T1H M;  2KW0 A;  3J80 S;  2DWZ B;  2KZU A;  3J27 B;  1K82 A;  3U5Z B;  4GIP A;  3UMM A;  5IWA M;  3GQ3 A;  3SAS A;  3FTD A;  2YR0 A;  3E4R A;  4IBE A;  1TGU A;  2FFJ A;  4MM3 B;  1E9S A;  3I4V A;  1DO2 A;  4LZZ A;  3GPU A;  2G5G X;  4LJ4 A;  1QZM A;  2R62 A;  1IN6 A;  5FSW A;  3L2A A;  4AW4 A;  3GLI A;  1HT2 E;  2CFO A;  3SMP A;  3L26 A;  3KP0 E;  1SXJ E;  3FKE A;  1VDD A;  3TWL A;  3SBJ A;  3BOS A;  4D80 A;  2QBY B;  4IJE A;  1KFV A;  2DWM A;  2ZAM A;  1ZQ9 A;  4DR4 M;  2ZAO A;  3PVS A;  4DV4 M;  1IXZ A;  1S3S A;  1JR3 A;  5FTK A;  2CHG A;  2KEB A;  2V6Z M;  2LNH C;  4M9Z A;  2Z4S A;  3U61 A;  1XMO M;  4IBK A;  2EO2 A;  1IY0 A;  3FTE A;  4KLN A;  3UK6 A;  3W0L B;  3MK6 A;  1GLN A;  1Z59 A;  2P5T A;  5EQT A;  1GKI A;  1XXH B;  1HNW M;  1IM2 A;  1J7K A;  1SXJ A;  1E32 A;  1IQP A;  3GLH A;  4L8R C;  4YHH M;  3GRV A;  1N34 M;  1IXR C;  4DV2 M;  2Z3X A;  2XF3 A;  1R2Y A;  4I5S A;  1T3T A;  3U6Q A;  4GIT A;  3SAW A;  2G8L A;  2Q2E B;  1XC8 A;  1K3X A;  1XNR M;  4LFB M;  2XZU A;  3CF0 A;  4YY3 M;  3U6M A;  5E6J A;  3MJ5 A;  4AZF A;  3GQ5 A;  1I4W A;  2ZBK B;  5A2Q S;  2FNA A;  4DUY M;  3U5Z A;  1Z5C A;  2D7E A;  4FWH A;  3PNV A;  2YFQ A;  1WXQ A;  3HHZ A;  1HQY E;  3RE8 A;  3FTF A;  2UUC M;  4X62 M;  4LGM A;  3A45 A;  2LWX A;  2UXD M;  4IIW A;  3TWK A;  2R45 A;  1IN7 A;  3L28 A;  3HHY A;  4X65 M;  3KFU G;  1XMQ M;  3DOA A;  5BPV A;  4LJ9 A;  1DGH A;  3GPX A;  3GQ4 A;  4LY6 A;  5LMU M;  2C98 A;  4M0W A;  2QBY A;  1L1T A;  3GP1 A;  2FE8 A;  1IN4 A;  1UM8 A;  1JQJ C;  4GKK M;  2F5N A;  2ERC A;  4G4R A;  5H37 D;  2HL7 A;  2HCB A;  3LVW A;  4LFA M;  4A3V B;  4BBA A;  2YQZ A;  4G4Q A;  5FTN A;  3NWL A;  4X64 M;  1G41 A;  4AQY M;  3FUW A;  4LJ7 A;  3WHL A;  2Y0Q A;  4DR6 M;  5F3W A;  1NSF A;  2OQ4 A;  3KS8 A;  2L7I A;  1TH4 A;  2LH0 A;  4OU7 A;  3FUT A;  4FD2 A;  1IY1 A;  1JR3 D;  3GLF B;  4DR3 M;  5JI3 E;  3KDS E;  4FCT A;  1J09 A;  3LQR A;  2XGN A;  2J7O A;  5EXX A;  4LJ8 A;  3U6D A;  5DYG A;  2KRK A;  2H1R A;  3E9S A;  4GHL A;  4WW0 A;  5ITT A;  3DZD A;  4LG2 A;  2QZ4 A;  4AKI A;  4LJ6 A;  4B3R M;  1D2N A;  1NJG A;  2BNK A;  4LGY A;  4EIW A;  4PDG A;  4QHT A;  4LFC M;  3ZCB B;  4MB7 A;  3VK7 A;  4JN6 A;  4IBC A;  2XH9 A;  3JAM S;  2R4J A;  4NRV A;  3VLF B;  3HU2 A;  3GLG A;  1E94 E;  3UGJ A;  3HKP A;  2F5P A;  1C1K A;  2CV2 A;  1QQW A;  3HGI A;  1R7R A;  1R2Z A;  3GRR A;  1FJG M;  2BJV A;  4XGI A;  3L29 A;  2JA2 A;  1YSY A;  4R7G A;  4OW0 A;  4Z8X A;  1Q3C A;  3TQS A;  4X66 M;  2Y21 A;  3U60 B;  4LF6 M;  1H6U A;  4LF4 M;  4IBD A;  1DO0 A;  3J81 S;  3QWL A;  5FTL A;  1Z5A A;  3J2P B;  2Y0T A;  1N75 A;  5EP2 A;  1Z6T A;  1IBL M;  4PD2 A;  5IRE B;  4TUW A;  2KZS A;  4RF1 A;  2DXI A;  1L1Z A;  3VK8 A;  1IBK M;  4DR5 M;  2XLJ A;  4AKG A;  1XWI A;  4MGH A;  3R9X B;  1NNU C;  4OVZ A;  1NHW C;  3B9P A;  1TH2 A;  3TPZ A;  4JXJ A;  4M0D A;  4NSR A;  3AOE C;  4AG5 A;  3HWS A;  4GMQ A;  3HU1 A;  1PM5 A;  1HNX M;  2LXE A;  3NBI A;  2ZAN A;  3PXG A;  3SHF A;  3A42 A;  1XNQ M;  4R3D A;  2CUZ A;  3J7B A;  2L6O A;  4FCV A;  2UUB M;  4LF8 M;  3KOW E;  4JV5 M;  2CHQ A;  2V1U A;  4I81 A;  4LRT A;  2F4V M;  4AKH A;  2L7H A;  3RFW A;  3KOX E;  3VFD A;  2V1C A;  1IY2 A;  1OFI A;  4GRI A;  3LQQ A;  4II7 A;  4IBB A;  3HU3 A;  4QNR A;  3AJI B;  1DGF A;  2R4E A;  3FYD A;  1HNZ M;  4PCZ A;  1IXS B;  3K92 A;  2K47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...