4CHTB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex with bound calcium ion
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
215
structure length
215
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords DNA TOPOISOMERASE 3-ALPHA
total genus 55
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4chtB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4chtB02
3NBIA 4CGYB 4CHTB
chains in the Genus database with same CATH superfamily
1HNWM 4FF2A 4X64L 2FFJA 3ULJA 2R45A 4LJ8A 4JG2A 3T38A 2CWPA 1IXSA 3S1MB 1AW7A 2KCTA 4B3SL 3M9BA 4KHPQ 3KP0E 4R4OA 1LO5D 3GV6A 1OTCA 1NJFA 5EJCA 4LFAM 3VKGA 1SNPA 2L4EA 4O2DA 1S5FD 5ITUA 1K0SA 4LJ9A 1YNND 3OPOA 3GPPA 1IYVA 4D82A 3GLIA 2L9HA 2LTUA 3ULLA 1NJGA 2KEDA 3QB3A 1PXUA 2N3SA 4JVZA 3RLFA 4DR3Q 1X9NA 2L09A 4AKHA 2ZANA 3DMUA 1T6OA 4J8QA 1RCVD 5ITRA 4ULLA 4C3HH 3PIPA 5LMNQ 3VA5A 4IBIA 2B2TC 4RMFA 3VYTA 2QBYB 2Z4IA 1V92A 1X3FA 2BH2A 4BY7G 1QOHA 4UHVA 1XMOL 2LHGA 4QIWB 2B2WC 1Y1WB 3GRVA 2JP1A 1Z7TA 2CCZA 2R3ZA 3S2DB 5EP4A 1J5EL 1HZBA 5KNBA 1E2WA 4PZ8A 3D8LA 1MSHA 1EFWA 4DV7Q 1EY0A 4L6V6 4OO1H 4KT0F 1UAPA 1XMOM 3L3OC 4NL4H 2PQAA 5GAHC 1EYGA 2H1RA 5ELCA 3GTKH 3S1NH 1SYEA 4MZ9A 4DAMA 3THGA 2B2TA 4IJHA 1L2FA 5GQOA 3GQ5A 4JBWA 1EE8A 1S5DD 1JB0F 3PUVA 2NVQB 4A76A 1Y8PB 3K2LA 3K1JA 3SMSA 2ZM6Q 5IGEA 3QG1A 2R7ZH 1Q1BA 4X66Q 4G57A 3DOAA 2HCIA 4YCUA 2JA8B 1PVOA 1STEA 5JPNC 4LK1C 4ALPA 2UU9M 1QG7A 1PYSB 4BS9A 1L1OA 3IRBA 3NXWA 1JE5A 3U6OA 1RKNA 4LF5Q 3HOYG 5C4JH 3A54A 5KPZA 2LVPC 2L15A 1PJSA 1M8AA 3IFDA 2NN6H 5IGGA 1Z5AA 1IN5A 5FLXc 2A1AA 2CEAA 3HOVH 2A5YB 1RIPA 4NSOB 5E4WC 4XXEA 3TP6A 3NWTA 4KHPL 4G7ZC 4IFDI 1EEFD 2QILA 2PI2A 3WHLA 2KHHA 2N49A 2Q2EB 4DV0L 4EVOA 1KIXA 3NQTA 5CGKA 1MJEA 4MGIE 4RGNA 2FS1A 3E46A 1AZPA 4N8X1 3L28A 4DAPA 3CCLA 1XXHE 3K5OA 2BCOA 4GC5A 3RGPA 3M3YH 3A45A 1TWCH 4GC9A 1HZ9A 1R4GA 4IUTA 2RF4A 3NE5B 2EZVA 4EQNA 4DV7L 2DKLA 2GNOA 4HL4A 1BCPD 3L25A 2JEAI 5KQ8A 2RGOA 1N36M 1EUJA 2JY7A 1B53A 1IY1A 4RKUF 3U61B 5IYDH 4HN7A 4HJAA 4KJOA 2A69D 4IN3A 2KHIA 2ID0A 4CKCA 4LF4Q 4WRDA 2K52A 2ZM6L 5GKNA 3K58A 4A3CH 1WGLA 1NNJA 5IP7G 4Z8XA 1L2DA 1R4PB 1F2LA 4XT3B 3K59A 2UU9Q 2ZJPA 1D5MC 3JAME 2L2DA 3BZCA 1W2BA 4FF1A 3M4OH 2VNUD 1PH7A 4NW2A 2CHGA 2CUZA 2MO1A 4XYQA 1MU5A 2YV5A 4RKBA 4JN6A 1BR9A 2F5PA 3T1HL 1PTOB 1BBXC 4PCZA 3H0GB 1VQHA 1X3EA 4C3IB 2E2IB 1LUZA 1VDZA 4RCOA 2XSZD 3FYDA 3M4OB 4PZ7A 3W68A 3RD4A 1HNXM 3DXJC 3J81i 5C0XG 1HNZL 3HP3A 3C3EA 1QNUA 1PH8A 3S2DH 1TY0A 2K01A 4JI4L 2G9HD 4PQXA 3TL4X 4CISA 3GTJB 2K75A 1HNXQ 3HOZB 2MHVA 3NQIA 4RHSA 1N75A 2QQ8A 3I72A 1D0MA 2CHQA 3I01M 3L7ZC 2JA5G 1ZYRC 2VDBB 4DV6L 1C48A 2K5DA 3I91A 4C1NI 2X49A 1X37A 2PPBC 1NCVA 1STBA 1FJGM 4LJAA 2ZXPA 5J1ZA 4IURA 4DV6M 2VUMB 4LJ5A 3FD9A 4M9ZA 3R93A 5JJIA 4TRDA 1J09A 4P16A 1Y1VG 1K82A 3A7AB 4GLXA 2C98A 2Y0QA 4JBJA 2QEXA 1L1OB 2KDLA 1EEID 4K5XA 2APLA 1BNZA 1XWIA 5C3EH 3CF6E 4MNOA 3SK8A 2H1EA 2XRSD 5LMNW 3C1EA 3K8ZA 5C4ZA 1IW7C 2E2HB 3E21A 2L55A 3H3VH 1VQCA 4P75A 1KHIA 2QPAA 4CBVA 2SNSA 1B7YB 4I81A 4IBGA 3CHBD 4L63B 5KNDA 2KRKA 3M7GA 1NY5A 3MEFA 5M5XB 1D0KA 2RHQB 3SAWA 2HQLA 1QE6A 2NUCA 4MTKA 1D1IA 4XYOA 1IBLQ 4FWGA 4X64Q 3FUXA 1VEGA 2BWEA 2UXBQ 2VB2X 3RN2A 2HHHQ 4RF0A 4BBRG 3PNVA 1Z9FA 2AQ2B 4DR3L 2HCCA 2AHMA 4RA8A 2K9DA 1NO1A 5LL6S 4LJ7A 1Q12A 5C5LA 5A2QE 1EY9A 2DENA 1TQOA 3RR5A 4AG5A 1SXJE 4IBJA 3NK9A 1ORYB 1R9TH 1ENFA 1FNVA 1O7ZA 1DOKA 3V2TA 4ME5A 2JSOA 2F52A 4NOOB 2K14A 3PUYA 4BBSH 4DK0A 3NTKA 4C3IG 3GTQH 2CW0C 2F5SA 1HNWL 4GOPA 1Y1WH 2RRUA 2DY8A 2YTVA 2QP9X 1EIFA 3Q22A 3VLFB 4NPSA 2VUMG 4WJ4A 4YHHQ 4MH0E 1WCMG 3L9AX 2OF1A 1NMGA 4WP2A 3D4RA 2UUCQ 2E2IH 4KY5A 1WTRA 1Y14B 5GROA 1HNZM 1VQ1A 3HOYH 3FRPB 2LBCA 2R92H 3UI2A 3E6ZX 2VQFL 4U673 4ZUJA 2EO2A 1Q3LA 2K6BA 3HJQA 2ZBKB 2QNJA 3KLWA 2NZ1D 4A3FH 2K0BX 2OWOA 2DHYA 3S15B 2JK8A 3S1NB 2K1BA 2YU9B 1TDZA 3GTPH 1VQFA 4B3TQ 2N35A 3G6EA 3EN2A 2LVQD 1OAOC 2ZAOA 1OQYA 1GJXA 5FO7B 2UXDQ 1SE8A 4EX5A 1SJHD 1SXJC 4S3SA 4LJZC 4D81A 4MGYE 1Y1VB 4L5QA 1ASYA 1NNXA 3IFTA 1D0LA 1NHGC 3W1BA 2B29A 1QDRA 5DEHA 1GHJA 4GHLA 3FEWX 1OXSC 2XGNA 5CBEE 2K4KA 1DXMA 1G51A 3KDFB 1NUCA 4B3ML 2F0GA 3QOJA 1E32A 1L8QA 1LTMA 2CWBA 3GPYA 1O80A 1N36L 4IBEA 1MN3A 5EAYA 5M3MB 3CC7A 4BY1G 1QUSA 1WR1B 3H09A 1YLAA 1X65A 1WTOA 1DGHA 2MJ5B 3VDUA 2Z4RA 2IHEA 3FMCA 5C0XH 2EYMA 1PFMA 3K0XA 3QWLA 4GN3B 1OFIA 4AKGA 1SYCA 1OXXK 1QUQB 3M4YA 1NSNS 5I2XA 4DKAC 1MHWC 2SEBD 1VCIA 3KF8B 4XQJA 2KRUA 1YJWA 3Q0AA 2B2UC 4R8NA 1BCPC 4P73A 1VQ7A 1IY0A 3R8FA 3OMCA 4OEMB 2CV1A 3TDQA 4LZJA 3DZDA 3ER0A 2V4DA 3IAYA 4DV0M 4FCVA 1E1TA 5JI2E 1IXRA 1X3QA 3VDYA 3R9XB 4KHPM 5M5XH 2JA8G 4CKEA 1PRTC 1J7KA 2VL6A 4R4QA 3OWFA 1DJRD 3FHWA 4KKSA 4NSRA 2UUAL 1SNOA 4HCSA 2VQEQ 1Y1VH 2WACA 1YHQA 4PNYA 4IBBA 4DFAA 1SJED 2OQ0A 4FVMA 2MUYA 3HOXH 1H9SB 2PQAB 3KF6A 1PH6A 5FO9B 2UU9L 1EOTA 1IXRC 2NVQH 3PO3H 3HHYA 4X64M 3ILKA 4IFDH 3BZDB 2VZAA 1ESFA 1NR2A 3AOEC 4DR7Q 2F4IA 4PD2A 4CDDC 3U6SA 1HHVA 3FTEA 1UNSA 3TWKA 1E9SA 5CV4A 1XJVA 3AOGA 2HCBA 3L0OA 5LMNL 2DNAA 2Z6KA 1QILA 2F0DA 3HU2A 3A5UA 1YBYA 3RN5A 1HNXL 2I46A 3Q8GA 3DFZA 1GXDC 1H9KA 2A6EC 1KXLA 3LCVB 3HHZA 4ITQA 1B9MA 2R6GA 3KYHC 1II3A 4ABNA 1A3TA 1B2TA 1JOQA 2KCCA 1PH9A 3U60A 1G2TA 1KQSA 3BZKA 2OTJA 3K6OA 3KVWA 5CV9A 3NENA 3VR4A 4M0WA 4KI0A 2AQ1B 1ZYRD 3FPPA 1VQ6A 1E9RA 4DV4L 1AIPC 3CF0A 4B3RL 3H0GG 2B63H 1IBKQ 1SE2A 4FWHA 1E2ZA 3K7AH 4I8OA 1SLJA 2Y21A 3KOWE 2XZFA 4XQQA 1IN4A 1TWGH 1HFGA 1PMRA 1V1PB 2F1MA 1V1QA 3GLHA 2XVSA 3T4AC 2X8AA 3FUVA 4BBSG 2G5GX 2NVXB 1TWHH 3T6PA 3D4DA 1U4PA 4QJFA 3MEHA 1C1KA 2UUAQ 2Q2IA 3S1QB 3QWNA 2YTYA 4V0BA 1QUTA 1IQPA 3GQ4A 1TWFB 2JA7H 3LQRA 4OW0A 4KD4A 2BH8A 3G48A 2KEBA 2LXEA 1E2VA 2B2YC 3CC4A 1VQ8A 4DV7M 2Z0SA 1WOCA 1DGSA 2F0SA 1BKBA 4R1JA 5KNCA 2CV2A 3MZ5A 3KDFA 1GO3E 4JI1Q 5FTMA 4GN5A 4ZKBB 3KJPA 1TU2B 2R7FA 3L2AA 3ONAB 1I50H 1LM0A 4LZZA 2YTXA 4AYBB 1AZQA 3STBD 3HOUB 3RGSA 1FNUA 1NTGA 2BE5D 3PF4A 1B9NA 1CKNB 1NBWA 2B2YA 4DR4Q 3KP1E 2V1UA 2A6HC 3EIHA 4G6ZA 2L0CA 2EJSA 4UP7A 3C2PA 1WCMH 1DONA 3OWEB 4BY7B 4KO8A 4X65M 1P8LA 5CR3A 5IP9H 1FGUA 5J22A 1YNJD 5ELOA 5EJWA 4BB9A 3J80E 2R4JA 3J7YW 4QHSA 2R7ZB 4CHTB 1F9RA 4P74A 1QZMA 1ENAA 3SK4A 3KJOA 1VQ9A 4R9WA 3VYRA 1N9WA 4N9TA 3T56B 4LJ4A 3TS2A 4DR3M 1ILQA 2JA7B 5LMUL 2RCNA 3HKPA 2I07B 1OIPA 3W67A 5CV8A 3SXHA 1WIVA 2VXWA 5C44B 1TS4A 3HOZH 2MR9A 2WKCA 1EY8A 4NRWA 2Q2TA 1O7IA 2FNAA 4LFAQ 4PDIA 3GTLB 3OOCA 5FK9C 4CKBA 3PXGA 2BJWA 4IBFA 1R7RA 1ASZA 1IN6A 1TY2A 3LCUA 4L4UA 1JC7A 4IPCA 2UXCL 4QNRA 4FWDA 3AU7A 4FO2A 4DNTB 3GLGB 3IG8A 3IG5A 1HA5A 3AYHB 1U4LA 2BA0A 3DM3A 3GTLH 3IL8A 4DN4M 1XNRQ 3MFYA 1N33Q 3NWLA 4KJNA 2CKZB 1IKLA 3NUCA 4C3JH 4UP8A 4FCWA 2KHSA 3T53B 3IECA 2FOIC 2CP8A 1XMQQ 5M5YH 1SFOB 1EQVA 3AJIB 1WHCA 1O7YA 1TH4A 4LFCQ 4AQYM 1GD7A 2NVYB 4DR4L 2V1CC 1HQMC 5C44G 4JC0A 3PO3G 4DF7A 2WSCF 5KPTA 2A8VA 5L37A 4Q7JA 1IXZA 2Y0SG 5AJ3Q 2EJFC 4DR1M 3RFWA 5M3MG 1KAAA 3EJIA 2A5HA 1NSFA 2O01F 1F9QA 4IFDJ 1A15A 1K83H 1MKHA 1EL0A 1I3QB 2SOBA 1D2BA 1XPOA 1HA6A 1KNEA 5C4XB 4A3CG 2LY7A 2NWGA 4NXML 3FKIB 4JI8L 4JK1C 2ICIA 4GKJL 2DXIA 2OOBA 5IYCG 3PO2H 1Q81C 1EQQA 4HR7B 3E4RA 2JA5H 5COYA 2C96A 4M0DA 3ZC7B 1U4RA 3ND8A 2BWBA 1PZID 2D0OA 3OHXC 4G4RA 3TE6A 3GTOH 4A3BH 4LF8L 4QCLA 1A2UA 2I5HA 1W3SA 1G8PA 1NV8A 4LW1A 4A3EG 1D5ZC 1YI2A 2IY5B 5K36H 2HAKA 3GLIE 2EVBA 1XB2B 4GNXA 1YSYA 3EA6A 5FTLA 1A2TA 4K6DA 3NSWA 1KDAA 2AUJD 2E5LQ 2OXPA 4IBCA 1Q8IA 2F0VA 4DV2M 4A3KB 5HURA 2F3IA 1I4WA 1A3VA 1ZMWA 3BBZA 2WAQB 1IXSB 2B2WA 1XNRL 5JJKA 4LF6L 1S5ED 1IKMA 3BVGA 2ZM6M 1DGBA 2JZ0A 2CFMA 2EDGA 1PLFA 3AKZA 4MN3A 1Q7YC 4POGA 3PCOB 3AL0C 1NR4A 2Z8LA 4FW9A 3J7AV 1KSFX 1FYCA 2QBYA 5EPKA 4IBDA 1LTLA 1Y1WG 4GKKQ 4A3JH 2DZOB 2X6GA 1CKMA 3F92A 5M9OA 1X6OA 2KECA 2Q2HA 3PFIA 1KDCA 4L5TA 2F0QA 2AKWB 3Q6SA 4K6LA 4MHEA 1PFBA 3A55A 3Q8DA 4A3KG 1KD1C 5KRUA 4XK8F 3KS4A 4KLNA 3H6MA 3SAVA 4DPGA 5E4XA 2C35B 1G291 4DK6C 4JI0L 4EQPA 1L1OC 2UUCL 4QQBX 2LVAA 1IZ6A 1RJTA 2XTIA 5BN5A 1PTOF 4A3JB 3S15H 3NP8A 1OFHA 2EKKA 3R2IA 4C3HB 4JI3M 5ITYA 2OPFA 1Y8NB 3MHBA 1ILPA 4R71A 3MC0B 1V1PA 2DAEA 1BF4A 1H9MA 4LF7M 3S1RB 4GEWA 2B8GA 2KUMA 1KRTA 5FKAC 1EWHA 2H5XA 4UPAA 4A3DH 4JV5Q 3J7AF 4X62L 1GL6A 3L26A 1VQLA 3TZUA 1B50A 1I94Q 2E2JH 2K47A 4XIGS 3KOZE 2NQ8C 3MWYW 2N78A 5D14A 2EOTA 3QR8A 1ICWA 3WDNA 1I94M 2LH0A 2AHOB 2IL8A 4IOAA 1F2YA 1R9TB 2C9OA 2LXKA 1EWIA 1I4GA 3HGIA 3FTCA 3U60B 5IWAM 1ENCA 1MIUA 1YNJC 5DNYA 1VF5C 2JN4A 3K8AA 4AYBG 4V190 3I4MG 1SDFA 1WJJA 1HT1E 3EQLC 1CM9A 4GOPB 3A98B 5JI3E 3U4ZA 4Y7NB 4DAYB 4QOSA 2JA5B 1QQWA 4HCEA 1N78A 3NBHB 1IYUA 4DV5Q 1P3QQ 4IUQA 3K9PA 4RNAA 2MQHA 3HFZB 3OSOA 3TREA 1EQTA 4JPBW 5JJZA 1IL8A 1JOKA 2OT2A 4JI1M 4O42A 2F0JA 1XMQM 1U4MA 1JB3A 4X65Q 2R0IA 1P16A 4R4IA 1VQOA 3K57A 5EKIA 4DUZM 1IM2A 5I4DA 2E2HH 2KNZA 5E3FA 3PF5A 3RLNA 1Q39A 1QVRA 2FFKB 4WFN3 4MM3B 2JXNA 2JP7A 1B70B 2WSEF 5IOCA 1H9RA 3CCSA 2XLJA 4E6IA 4IJEA 3SAUA 2IPKD 2XH9A 2Q8RE 4DR6M 3TEHB 4LFAL 1BBUA 2CHBD 4N9PA 1TT2A 5FTKA 5NUCA 3Q8XA 3GTPB 1IN7A 4B3SM 4TQUS 1PRTD 2VW9A 2VQEL 4A3GG 4GH9A 2HHHM 2F0WA 1T3TA 2DJGC 1EY7A 4GHAA 1HH2P 2WINB 4RKLA 4XT1B 4CJ1B 4IPGA 1VQ4A 4JV5L 1TF0B 1CA5A 4NMZA 1X56A 4JOIA 3B7NA 4TVAB 1KLUD 1JE4A 1ET6A 1MD2D 3I70A 2F3VA 2J7ZA 3D4WA 2DJFC 5BPVA 2UXBL 1TWAH 1MX0A 1W6KA 3N52A 2PMZB 4HIDA 1EZ6A 1K83B 3EROA 2YNMD 4JI2L 1EY4A 1S40A 1WTXA 3D3RA 4MTNA 4POFA 3FUTA 1F2ZA 4JI7L 4PDGA 2O5RA 4DR7L 1K28A 3P20A 4BBSB 2HWJA 1TS3A 3KOYE 2L7HA 4UN2B 2ICEC 4GZYC 4ZAIA 3K92A 1IYJB 3HRZC 3Q23A 2E5LM 2IX1A 1UEBA 3T1YM 1RTOA 3KDSE 4R4CA 1VMPA 2EYFA 5ELFA 2CH4W 4QOZC 3HGBA 4B7GA 3UE0A 4YHHL 4C3JB 2F4VM 3VYSA 2IX3A 2QENA 4DV1L 1KC8C 2HIVA 3CCMA 1PHJA 3A74A 4FDBA 3X3MA 2EXDA 3HJ8A 4PT5A 4BY7H 5DLQE 1WCMB 4RH6A 4K2KA 1UE7A 1IBKM 1A8VA 2A19A 5A2QL 3M6AA 3FPUB 1TWAB 3UDXA 3FP9A 3PO3B 3HKZB 4A3KH 2QEJC 5CYUA 5EXXA 4IUPA 1SE3A 1CUKA 1RU3A 1JJ2A 4NKLA 2R61A 4OX9M 3L29A 1RTNA 3R3OA 4UAIA 1I6HH 4GRIA 2R93B 2Y0SE 1Q90A 1FJGQ 1LT3D 2QCPX 2PNRC 4CDCC 3HOWG 2K5HA 4K8IA 4F8MA 2L11A 2CWAA 2ZJRA 1CHQD 1SBBB 2H4OA 5C4XG 4AZFA 1B8AA 1SNCA 1PJTA 1AH9A 3BS1A 2F0TA 1J9OA 3LQQA 2ALYB 3SK6A 1TH2A 5IGBA 1DO0A 2RKOA 3HHWA 3LWUA 4B3TL 1L2CA 2LS01 5FTJA 4IJFA 1S4ZA 3NPPA 1CTMA 5IP9G 4YY3M 1N36Q 2O5IC 4LFBQ 3D31A 1V9PA 1OKSA 1QANA 1BO0A 2JA9A 1C9OA 2F0KA 3H3VI 1J6QA 3GV3A 3AFQA 1AFPA 3HZJA 4ID6A 4H02A 2XNAC 1LTGD 2ZAMA 1HUNA 1Q3BA 1KFVA 3LMMA 3K7AB 4DV3M 1T43A 2L4NA 3ND9A 3U6DA 2RSOA 3GTJH 1EU4A 5E26A 3KF8A 3KOXE 4A75A 2K5VA 2XWJB 4Y7NH 3CP0A 2PZWA 3JAML 2NB0A 4QGUA 1B1ZA 1DCZA 5C4HA 3MHVC 2NZOA 3TMEA 3U5ZB 3K5LA 4IUVA 4ZQ3A 1YEZA 1EY5A 2XWBB 4FD2A 5EGTA 2F4VQ 3OTOQ 1BDOA 3QO2A 1Q82C 4A3EB 1TWFH 1CZGA 2F5OA 4GKKM 1SXJA 4FXGC 3J27B 3UGJA 2AMCB 1VDLA 5E6JA 4OU7A 5EP3A 4AI6A 4DUYM 2DAKA 3BG3A 2JJQA 2Q8TA 1BBWA 1TDHA 3K81C 1OO9B 4BY1B 1HQCA 1XXHB 3CC2A 1YIJA 3I2ZA 4DR5M 3J7ZC 2GN5A 1X54A 4FF3A 4DBGB 2B2VC 5LL6X 3F1ZA 1ZKOA 4IPHA 5BR8M 4FYDA 4JI6L 5HGQA 1SROA 1LTTD 2EXZA 2EY2A 1JR3D 1N33L 1OTRA 3AB9A 1JJGA 1LT4D 4ZK9B 3J80L 4R8IA 4OO1I 4GNXB 2VF8A 4LNQA 2ENBA 1QCBD 3KBXA 4DV5L 1OAIA 4LFCL 3UZUA 3U6EA 4RHRA 1QYRA 2UUBM 2PW7A 4XBOA 2RDGA 5EBCA 3E9SA 4QUFA 2FMCA 2CQAA 5JAVA 1RF2D 1SXTA 2XFTA 5IYCH 4JI5Q 1PRTF 4OHJA 2Y20A 3BXWA 1NJIC 4NXMQ 3S14B 4CDFC 3C9PA 3KOJA 3GDEA 4DU9A 2KOLA 3CCRA 4HJ9A 1OIZA 3MMPA 5BR8L 1DGFA 3RZDH 1JT8A 2LVOC 1YE9A 3HG9A 5M3MH 5ISRA 2RGHA 2KENA 2JA6G 1C7YA 1EOVA 3JR4A 3BJUA 2F0PA 4G4NA 5DYIA 5CV6A 4OX9Q 2Z9HA 1Q46A 2FXQA 4C56C 1LACA 1AE2A 4AYBE 1GVNA 2A69C 3CPFA 2EPBA 1A0IA 5FSWA 2XZUA 1JQJC 1ET9A 1X32A 4DV3Q 1WD1A 5F3WA 4JYAQ 3OW2A 3VA7A 1L1TA 1WTVA 2J7OA 2QHOB 1K3BC 1MJGM 3E9IA 5LHY1 3CMAA 4LF8Q 3ERSX 1ZV1A 2EYOA 4F2LA 1F4IA 3GPXA 4DUZQ 3M4PA 2DAMA 1L0XB 4A3IG 1WVLA 4OWTB 3S16H 3T1HQ 1LTRD 2F03A 2K7VA 2Z6BA 1IBML 4A3LG 5C3EG 1FVIA 3I7FA 3SARA 4HEDA 2NVXH 1DM0B 1AUAA 5CMDA 1IBLM 4OL7A 2K28A 1K8AC 3B7ZA 2KA7A 3NBHA 4BBAA 5D3DA 1SYFA 2E2JB 1EZ8A 4H0LC 4OVZA 5FJ8H 4FCTA 3KFUG 2UXDL 2OQKA 4LGMA 1C8CA 4S12A 1XNQM 2RSNA 4MGHA 1WTHA 2EY6A 3NHHA 2NTTA 3H91A 1GVPA 3SMPA 2E75C 4JXJA 1L0YB 1D6EC 3I56A 3FTDA 3U6PA 4LFBM 3I8ZA 4EGVA 1HQRD 4DV1Q 1JQYD 4OO1G 1VF7A 2X69A 1I4QA 4DV2Q 4GLVB 1N77A 2F3WA 4L15A 4LGYA 1QZEA 3GLIB 1XPUA 1YHBA 2HD3A 2WAQG 2ZXRA 2IJ0A 3CPWA 2CHVA 1S72A 4HJ7A 1ZMUA 1U9RA 1MSGA 3CCEA 4GIPA 3DM1A 2JE6I 2A73B 4QNMA 5CBAE 1NMFA 2JUJA 1CI3M 3E3XA 3HHXA 2WB1E 4ZPXA 2Z1CA 5M5YB 2XF3A 3HS0C 3KLRA 2LWXA 4C3IH 4R4TA 2DAIA 3S17B 4X66L 2KEEA 3AEVA 1PTOH 3NTIA 3M7NA 4OX9L 4O1NA 3B74A 4K8JA 3TP8A 1XNQL 1KABA 2B3TA 2F0LA 4GOPC 2UXDM 2MO0A 3C46A 3PIOA 2R62A 3MXNA 3IKJA 1JR3E 3B89A 4DK3C 1IBLL 4A3IB 3AFPA 4C3HG 1W5SA 2OOAA 4WJWA 4NXNL 4A3JG 4HTHA 5IT9E 1SNMA 3NBIA 1Z6TA 1E1OA 1JR3A 2IT1A 2Z4HA 3W1GA 4JYAM 3F2UA 3FUUA 1LT6D 3SVMA 3H3VC 4CGYB 4KKTA 3T1YL 4APVA 3S14H 3CRLC 2BDOA 1HR0L 5FTNA 3T15A 3NWSA 2O2LD 3PO2B 2L4FA 2EUCA 3G71A 4A93H 2K32A 4YCVA 3CCQA 2XGTA 2Z3XA 2MGWA 1KRSA 3OTOL 1K73C 1R5LA 3RE8A 5AJ3L 5C0XJ 4NXNM 3TWLA 4DK1A 1SSOA 4RGTA 3JAMi 3ZYYX 1SYDA 4K5WA 1UE5A 4A3DG 4A4IA 1U0LA 3K80C 1JR0D 3NTHA 3ICEA 5FLXS 1NHWC 2KZUA 2GVAA 1XXGA 3RUZA 2ES2A 2JA6B 1I6HB 2C9CA 1EFUB 1PH3A 3PIO3 3HKZE 1C0AA 4DAVA 2UUBL 2QF7A 2QGQA 4KN7C 4IZ8A 2VQEM 1STGA 1N8RC 1E0BA 1VDDA 5FO8B 1SAPA 2NN6G 2AUKA 3GP1A 2JY6B 5EXPA 2YU9H 4LF5M 2R46A 2JWSA 4QB4A 5ITQA 1LV7A 1WD0A 2JA8H 2EY1A 3R8BA 2B2UA 2D5DA 1KDBA 3OTOM 3H15A 5IP7H 3WWVA 1PJJA 5E7NA 4KODA 4DR5Q 1SXJD 1HFNA 2WP8J 5EQTA 3EVQA 2I7NA 4LRTA 3GRUA 4DR6Q 1H95A 2AQ3B 2HUGA 4JI1L 1YHAA 1K8OA 4JOIC 4K0KM 2BDNA 4KMUC 2DAGA 3GRYA 1JWUD 3SEBA 4DUYL 3OIQA 4L6TB 1LABA 1D2NA 1EU3A 1ONLA 4Q0FA 1HRJA 1STHA 1DO2A 2J7NA 5KQDA 3SHLA 3FUWA 1XC8A 1BXTA 1E7ZA 3FTFA 2LVNC 2LFNA 4OIJA 2JA6H 4GKKL 2A68C 3U6MA 4A3MB 2CH4A 1CA6A 1CSPA 4F1IA 1R6BX 2MJ8A 2LSSA 4KHVA 3KS8A 3A8IE 4JI5L 3EIVA 2DNEA 2X6LA 5IIFA 2RCFA 1GKIA 1GUTA 4LF9L 4JI5M 4F7XA 3GLGA 3BDCA 4PMBA 4L5SA 3M3YB 5A2QS 1A3UA 3D6CA 4LUVA 3A8JE 1EYCA 4FF4A 1SN8A 3TSSA 1C4QA 3PIP3 3GLFB 3KBGA 1GKHA 4IO9A 3SK5A 1GUSA 3DWQA 1JWSD 5ITTA 3V76A 2JZ1A 1I5FA 2R44A 5DAUA 1Q1EA 4Z6YA 5ITXE 1GUOA 4LF7L 2EKFA 2R6FA 1Y8GA 1UE6A 1VQAA 2BA1A 2KA6B 2YR0A 2WV6D 4I4LA 3AOEA 2LKVA 4QIWE 4CJ2C 1F9PA 3K5MA 1SRUA 2TMPA 1E24A 5IT9L 3BOSA 3PUWA 3ZJYC 3P7JA 1PM5A 1I4HA 2DUDA 1SEBD 1YUBA 1ZQ9A 1Q02A 5C3EB 1NVMA 2D7HA 1IW7D 3GTMH 3HOWB 3PQIA 5KYLA 2VF7A 2DZLA 3CMEA 4R7GA 2EYPA 2I7PA 4W5WA 3VDPA 2GVBA 2K50A 2QKIC 4LUZA 1FD7D 4OIKA 4AH6A 4A93B 3LWEA 4HJ5A 3LX0A 2K6AA 1LLRD 4LF5L 4KK7A 2M2LA 2LHCA 1IBMQ 3GO8A 2HDMA 1K0RA 4QUCA 3A8KE 2NYZD 1M90C 1I4RA 3SBJA 1N34L 1YJNA 2DWZB 2WKDA 1B4OA 1ZXTA 5M3FH 3HX3A 3HOVB 4MGKE 3M0EA 4N8FA 2JNHA 3CQZH 2E2DC 4JI8Q 4IUNA 2JXMB 1QZHA 4FXDA 4G3OA 2GQFA 4IBKA 1UFZA 4IUUA 2EQSA 2CW0D 3RZOB 4LF4M 4DR2L 1IL2A 4DV2L 1V43A 1YZ6A 1SE4A 3I73A 2A68D 1K3WA 4MGZE 4I5SA 3PV0A 1UWVA 2J4XA 1AP0A 1S5BD 3I4YA 4B3RQ 1HR0M 1VQDA 4K0KL 3OYYA 3J2PB 1DYQA 3QIAA 1LT5D 1EIGA 4IALA 5F2DA 3SDZA 3L2PA 2VQFQ 1EQRA 3U9SA 3UE1A 4HAEA 4DR2M 4LF4L 1WTQA 3GTKB 1HT2E 4NXNQ 3CCJA 1CKOA 1HJPA 2WAQE 3PUZA 3DA1A 3AQQA 1M1KC 4BXXG 1XXHA 5JEAJ 3FDTA 5K5PA 3AMUA 1N32L 4C2MH 1QVCA 2DGYA 4GLAC 1PJQA 4CJ0B 3PNYA 3LVVA 4A93G 2OCEA 3UK6A 2F5NA 3KUPA 1K8MA 4JI2Q 2QDLA 2HL7A 3LW5F 2RKSA 1JMCA 4XQNA 3RZOH 2L12A 3FVQA 3J80i 1KNAA 1ZEQX 1DGGA 2O25A 4DV5M 4DR1L 2KHJA 3HOXG 2I5MX 1IHZA 3BYYB 3CQZB 1VS0A 2KJXA 5HY6A 4HEOA 2EIFA 4YY3L 1PYWD 4EIWA 4NDXA 1PFSA 1J5EQ 2DVWB 5IREB 3SHFA 1N34Q 1HZCA 1JORA 3GQ3A 5C3XA 2YQZA 4QHTA 4II7A 3QJYA 1PH2A 1GUWA 4X3SA 2BJVA 4QMGA 1BOSA 3C58A 5IGFA 3SASA 4DA2A 4DXFA 1RL2A 2OO9A 4NC6A 3URYA 3JR5A 4JW0A 2SDFA 2HIXA 4M1UB 1UUPA 4KLKA 1TIID 3U6QA 3QYEA 5C4JB 4JYAL 2HQEA 4U68A 3P75A 1XWEA 5KIXA 4G7HC 4RG1A 4IQZA 1K9MC 3J80S 1XX8A 2RVLA 2EYJA 3SC3A 5ELEA 5JOBA 4IFDG 3S2HB 2LNHC 1QVGA 5IWAL 5FJ8G 2J5YA 2QCUA 1PJIA 4LF9M 3TQYA 4C2MB 3S1RH 5DFLA 2QW7A 2MNAA 1CZWA 2B3GA 5T1IA 2HKJA 1I94L 3I4NG 2XEPA 1EIHA 1R4QB 1QUQA 1IBMM 1TR8A 4BY1H 4HLQA 3TPZA 1OXTA 1PRTB 2OQ4A 5C1BA 4BLCA 1WGNA 4PG3A 3M4QA 2VY3A 5EKKA 3B7QA 4LY6A 4X66M 2ZXOA 3A42A 3HKZG 4PMCA 2DY7A 1TH3A 3FRHA 4GITA 3JAMc 2SNMA 3V96A 1QAQA 3MXNB 4OONA 5EPLA 4BA2I 1T5XD 3SYLA 2R93G 3W5OA 1CT1D 2G9DA 1S3SA 1XYIA 2VS1A 1BCPB 5IODA 3KK7A 3FKIG 4NB3A 4OWWB 3U5ZA 3OW7A 5A35A 3ERQA 3TRZA 3FKEA 2K5WA 3DLLA 2QDBA 1H9JA 5BN4A 4G4QA 2K5QA 5M3FG 1XTDA 4QL5A 2QA4A 1E3PA 4BWGB 1Q86C 1IFYA 3H94A 3I3CA 4F87A 3VR5A 4KV6A 1PZJD 3CCVA 1JB7A 4LFCM 3H0GH 2B63G 4CIZA 5JVG3 2I5LX 3VK8A 3OIPA 1CFMA 4LUOA 5FLMG 1N32M 4KTAA 1D5XC 3CU7A 1IY2A 2RBMA 2JYOA 1N33M 1WTWA 4H44C 2IX0A 4Y52H 2ZTDA 2J0TD 4FP5D 3DHQA 5DNFA 3CCUA 2KQ3A 4RFBA 2JY8A 3I4NB 3I90A 2ASBA 1CHPD 4UDUC 4P17A 2MPMA 3PMFA 2N88A 5I2YA 4M9SA 2F0EA 3E9HA 2PNHA 3DEPA 1YVCA 1AN8A 2E5LL 1QB5D 4OWXB 2XSZA 2K33A 1H9SA 1B3QA 3KF6B 1QJOA 2PCFB 4BXXH 5JEAG 3TQSA 3GLHB 1T5EA 1W6JA 2ERCA 4JI7M 5KGUA 1MI2A 3CRKC 2R4EA 4KHZA 1E22A 4HMIA 1I50B 1KL9A 3IHPA 1K3RA 3BVZA 4ZKCB 2VUMH 4PZ6A 1HXYD 5BR8Q 3VK7A 3TZDA 3NBXX 3CF2A 1PA6A 1ZMVA 5DM63 1JCKB 4QY7A 4ZYSA 3LNNA 2R92G 1HQYE 3NELA 5CV5A 4UP9A 3G4SA 3HOUG 2FH0A 1N34M 5I9OA 1CSQA 3KLSA 8CATA 3UMMA 2F0NA 3NEMA 4DV3L 4A3MH 5KPRA 2O5JC 4A3FG 4WJ3M 3QAUA 4AW4A 1LV9A 4K2LA 5EP2A 1SYBA 4WORA 1GM5A 5M5WH 4M9XA 3GLFE 2FHTA 3F2BA 2G5DA 5C18A 1B44D 3BDOA 2DWMA 1V33A 1DV0A 4C3JG 1VEKA 1G4AE 5G3LF 4J15A 1TWGB 4R3DA 2M5ZA 2MP1A 4A3DB 2JQOA 3GQBA 4O0AA 5J3BA 1R2ZA 1HTLD 1S5CD 2Y0TA 4MB7A 4IOCA 4DR5L 1YITA 1MBYA 1XMQL 5C44H 4A3BG 1QNKA 1RDPD 4A3GH 2K5NA 1OXVA 4A3EH 2P5TA 2RDHA 2C5CA 3R2TA 5CV7A 3KLSX 4Q5VA 4LFBL 1G6PA 2C5RA 3T16A 2NN6I 2UXCM 2WB1B 4X6AH 1EYAA 3C1FA 3ZCBB 2RHSB 2Z7JA 1N32Q 1A62A 1PYBA 4HJ8A 3CKIB 2XSCA 2CFOA 2CE7A 2B2VA 3VR6A 4B3MM 4TKOB 3CGWA 2NBFA 3CF5A 1M4VA 3L27A 3MTSA 1UM8A 4IPDA 2MH8A 1IBKL 1O78A 1GABA 1GJSA 1I4PA 5DM73 1GL7A 1MJCA 5FLXE 1KYIA 2RA4A 4X3UA 3HOZG 5ITXA 4WURA 1O7LA 3VFDA 4LRSA 1STYA 3TP5A 4L8RC 1TR5A 4YWLA 4GKJQ 1KLGD 2C99A 4IJLA 5JVH3 1STAA 2F4VL 1JJCB 1I4XA 2IWHA 1GOZA 1KAWA 1TWCB 1VQJA 4LJ6A 4X62M 1NY4A 1FL0A 4B9WA 2QZ4A 4X65L 3WOEA 1QWYA 3N6RA 2PMZE 3I4NH 2CV0A 2WFWA 3E0EA 4BBRB 4AKIA 3EFXD 4HSPA 4X3TA 3U6CA 2O4XA 2PZTA 4JI3L 4FXKC 3W2DA 3GLHE 1G6ZA 2E8GA 3TP7A 1DOLA 3B9PA 4RWSC 3VKHA 2F0UA 3X3NA 3J81c 1SMYD 1EWCA 3HU3A 2Z6KC 3UDIA 4DNRB 4QF4A 1QVFA 5H37D 4LMQD 4HMJA 3GTGB 5D65A 3W3AA 4B3SQ 3K9OA 4C1NK 1TWHB 3A46A 4RCNA 2Q2UA 3GTOB 4A3BB 3I4MB 2BNKA 3PVSA 5CC4A 1GLNA 3Q24A 3GO5A 4ZUIA 4NXMM 1SG9A 5ELDA 2A6HD 1X3PA 5IYBG 1SYGA 4RGMA 1KTKA 3CXCA 4H13C 4JI7Q 4B3MQ 4G7OC 1MGSA 4LF6Q 2KXEA 2FMMA 2EJGC 3HWSA 5T1GA 4DV6Q 4JI4Q 1D8LA 4ZCKA 4BA1I 1V8QA 4DNIA 1PGYA 2DWLA 3KW6A 3S17H 1VQ5A 4F88A 3J7A5 1LTBD 2XN9C 1HR0Q 1VQNA 4LF6M 3PO2G 1G71A 1HR0W 1XNRM 3DUZA 5I9PA 1XHBA 4DR4M 2M60A 1L2BA 2N8NA 3SGIA 3SATA 3WHKA 4HSVA 5JEAH 5LMUQ 4TSSA 1PH4A 2G8LA 2XRQD 4JCVE 4DR2Q 4HIKA 5CORA 3J7BA 1VQIA 4YWMA 1G41A 2NVYH 3HJSA 1QDTA 4L78A 1TXYA 3DWPA 3MFGA 4P2CB 3D8GA 4CDEC 4GN4B 5BN3A 1PH1A 5GAEC 4ZLTF 4A3FB 1ESRA 2JA7G 3GD7A 1TS5A 5J39A 2EYHA 3UDGA 2E74C 4B7FA 2DN8A 2QSFX 5EXSA 4NP5A 3MXPA 4A3GB 3HOXB 4LF8M 2FJ2A 4WW0A 5IY0A 2ZJQA 3CD6A 1OXUA 5C6AA 4JBMA 2DI0A 5C5MA 1PH5A 4ME3A 3J81S 3T13A 1F9SA 2WIIB 1GUNA 4RAUC 5IGDA 3KSXA 3VYUA 3S2HH 3M85A 1EY6A 3F8TA 2YYZA 1RHPA 2UUBQ 1VQEA 3I4MH 2NZHA 4JV5M 1LTAD 5KO3A 1XTCD 3JC66 1UEAB 4IIWA 4KY7A 2FINB 3HKSA 1FNNA 1HUMA 2PI2E 3TN2A 2R7ZG 5IZ7D 2UXCQ 2HHHL 3A7LA 3F2DA 3PGZA 3S16B 1PTOC 1FJGL 4DGZA 2EA0A 2L1BA 4K14A 5G3LD 5M3FB 1HTPA 4Y28F 4K5VA 4DR6L 4I7AA 1QAMA 5EXTA 2ZTCA 2UUAM 4KKUA 3SFZA 3DWAA 2B39A 2Q8IB 3I4LA 1G59A 3FRIA 2D62A 4YWKA 3J7AS 4HIMA 1Y69U 1SR3A 3DEOA 4B3TM 4AQYL 5JJLA 4YY3Q 4AG6A 4A3MG 3HOVG 1Z59A 4JI4M 1VQPA 2D0PA 5IYDG 2MFIA 5EKLA 3GLFA 4I65A 1GJTA 4RGOS 1L0WA 5GAGC 5FOBB 1K8GA 4DUYQ 3RLOA 2KCMA 1V1OA 1BQQT 3BDLA 1I6VC 2V1CA 4YIJA 2F0OA 1ML0D 2D9UA 1IN8A 1X55A 2DNCA 5JPMC 4LF9Q 4P71A 3CW2C 2F0IA 1DOMA 2HT1A 3GTGH 4L5RC 3P1HA 7CATA 4EQ5A 3S9WA 4I7ZC 1VQMA 5IE8A 5KYIA 3MXGA 4LF7Q 1RODA 3GPUA 5TSSA 3C3DA 3ZQJA 2V6ZM 1Q3CA 1EIYB 2KNAA 3HU1A 1WJ7A 2R65A 3MVVA 1L1ZA 1TGUA 3KXEC 5HGTA 2JY5A 2L6OA 1XNQQ 1K3XA 2MGSA 4KY6A 5LMUM 1NAPA 2ATWA 4ZRZA 1SFOH 1PTOD 2HDLA 2B8FA 3C3LA 2TSSA 1LTID 3G6JB 4PMWA 1SXJB 4MIUA 3U58A 2NVTB 4DV1M 1G91A 2WSFF 2R92B 4YHHM 1QZGA 5IWAQ 1AE3A 2AWNA 4D80A 5H1SE 1QAOA 1FNWA 1NNUC 3I51A 3WOFA 4B3RM 1J8IA 2WB1G 2XFSA 2CQOA 1PV4A 3SR1A 3A56A 3QYBA 1RD9D 5I6YA 1CQFA 1G3IA 3K5NA 2F0HA 3HZXA 5EQ0A 3STBC 1XMOQ 2B63B 4DR7M 3MA2B 4GMQA 3U61A 1LYLA 3MXUA 2BE5C 4AQYQ 4P72A 1BCPF 1TKWB 2UUCM 2KNVA 2CRUA 5EPJA 5C0XI 4XDXA 4JI0M 4L16A 4LCBA 1Z47A 5IYBH 1WFQA 4ANRA 3LGJA 1NE3A 1Z6HA 2F0MA 2EYLA 3O13A 2JEBI 5EP1A 4OGQC 2JA2A 4CJ6A 2N55A 2VB3X 4K0KQ 3BU2A 1CKNA 4OXPA 4A3VB 1SMYC 3ITPA 3PSIA 5K36G 1GO5A 5FLXL 3UJNA 3J81j 2R7DA 5FLMH 3VR2A 3TWMA 1HCZA 1EYDA 3W0FA 2PZUA 3UDFA 1F77A 3U50C 3HOWH 2KBNA 3GTMB 1DGHB 1GHKA 1Q8KA 1A5TA 5M5WB 2L5TA 2YFQA 3PUXA 3I55A 4JI3Q 4KD3A 4JI6M 2RQXA 4B08A 3V05A 4LG2A 1SNDA 3J81L 1TTEA 4YCWA 2Y0SB 3GLGE 2CVRA 5IGCA 3MAQA 2AWOA 2D7GA 5AFWA 4DUZL 3T51B 1AEXA 4BBRH 1GUGA 1EIJA 1HZAA 1DD2A 2IHFA 2PW5A 4DV0Q 1TS2A 3MK6A 1J5EM 2KW0A 1VQGA 2DHRA 4ILWA 2KCNA 1F2MA 1PZKD 2RDFA 2R93H 3VR3A 3U9OA 2E76C 1PRBA 2A6ED 3HY5A 4G4OA 1FGBD 4LAAA 2FE8A 3SYKA 1NY6A 1CQVA 5LMNM 4EQOA 3FKIH 1B3AA 3A5ZB 5C4XH 3EIEA 4TUWA 2ZT9C 1I3QH 2OEOA 1PFNA 1D7QA 3CTWB 1ICFB 4OELB 3HOUH 1H6UA 4JI8M 1DZ1A 3I4OA 2LXJA 4L8JA 3AFHA 4B7HA 3H4MA 5IT9S 1VMCA 4DXGA 1VQKA 3KFUA 3JAMS 4GS3A 4DR1Q 3D8BA 3S24A 3KSJA 2M9VA 2EJMA 3QOLA 3G7LA 5GADC 2PO4A 1T9HA 1E94E 1HNWQ 2LMCB 2A74C 1Z5BA 2W82A 2MROB 2K03A 4KN4C 1STNA 1OJLA 2WZJA 4Z9CB 1CK1A 4DV4Q 2NTSA 4G4KA 1G2SA 3ULPA 1PDQA 1FR3A 2K04A 3TBIB 1JOOA 2GA4B 5DYGA 5ELBA 3U4VA 1V34A 3K7UC 1G8ZD 4UY8C 2X4AA 2OTLA 3SE0A 3A0JA 4REZA 3GP7A 2L7IA 4M8AA 1A63A 1Y8OB 3EBEA 3E0JA 3J80c 4OVZB 3BYTB 1NV9A 2VIIA 1WI5A 5E1FA 3RNUA 4JI6Q 3GRRA 2DWNA 1U5KA 3HOYB 3D0FA 3FYCA 5C3WA 3B6YA 2PQEA 2NVTH 1BVSA 4X3KA 4RF1A 3T1HM 1LTSD 4XGIA 1WXQA 3AV0A 1SNQA 1TVXA 2P5ZX 3LVWA 1S3OA 3D6WA 1HPCA 3BVMA 3F2CA 3J81E 2F0FA 2M00A 1UE1A 4PV1C 3ZH9B 3MJ5A 2G3QA 3T1YQ 1SMXA 4B9XA 3GTQB 4J1MA 1WYDA 1W5TA 3I4VA 3U6LA 1D1KA 4HIOA 1VG5A 2Z4SA 1HNZQ 1YNNC 3TS0A 2EE1A 4DAYA 1BUVT 2PYKA 1JICA 5IT9c 5L8RF 3S1MH 3I04M 3HEJA 2R18A 2K05A 1JWMD 5D3IB 2Z8YM 3K0YA 4JI0Q 2D7EA 1VEJA 1Z5CA 5EBDA 4DV4M 3W0LB 2BOSA 2I0QA 2EY5A 3FE3A 3E5SA 4J6HA 4GNXC 3SHGB 4XTCS 4AIMA 2IW3A 5ELNA 4FNFA 1R2YA 2XIWA 5KEEA 2D2CC 4H7BA 5I6WA 4A3IH 2F5QA 1EFID 4JBKA 2VQFM 3OMGA 2KVMA 4X62Q 4A3LH 3RMHA 1YJ9A 1X3GA 1ZAEA 4JI2M 4ODGA 2DZNB 1A6XA 3H4JA 2UXBM 1XPRA 4GKJM 4NRVA 1VQBA 2ZTEA 3CAMA 4LWCA 1WTPA 2KZSA 3RZDB 3S1QH 1YNXA
chains in the Genus database with same CATH topology
1HNWM 4FF2A 2FFJA 2R45A 4LJ8A 3T38A 3S1MB 1AW7A 3KP0E 1LO5D 3GV6A 1NJFA 5EJCA 4LFAM 3VKGA 1SNPA 1S5FD 5ITUA 4LJ9A 1YNND 3OPOA 3GPPA 1IYVA 4D82A 3GLIA 2L9HA 1NJGA 2KEDA 3QB3A 1PXUA 3RLFA 2L09A 4AKHA 2ZANA 3DMUA 4J8QA 1RCVD 5ITRA 4ULLA 3VA5A 4IBIA 2B2TC 3VYTA 2QBYB 2Z4IA 1QOHA 4QIWB 2B2WC 1Y1WB 3GRVA 2JP1A 1Z7TA 2R3ZA 3S2DB 5EP4A 5KNBA 1E2WA 3D8LA 1MSHA 1EY0A 4OO1H 1UAPA 3L3OC 1XMOM 4NL4H 2H1RA 5ELCA 1SYEA 3THGA 2B2TA 3GQ5A 4JBWA 1EE8A 1S5DD 3PUVA 2NVQB 1Y8PB 3K2LA 3K1JA 3SMSA 5IGEA 3QG1A 1Q1BA 4G57A 3DOAA 2HCIA 2JA8B 1STEA 5JPNC 4LK1C 2UU9M 1QG7A 4BS9A 3NXWA 3U6OA 1RKNA 3A54A 5KPZA 1M8AA 3IFDA 2NN6H 5IGGA 1Z5AA 1IN5A 2CEAA 2A5YB 4NSOB 5E4WC 4XXEA 3TP6A 3NWTA 4G7ZC 4IFDI 1EEFD 2QILA 3WHLA 2Q2EB 4EVOA 3NQTA 5CGKA 4MGIE 4RGNA 1AZPA 3L28A 4DAPA 3K5OA 2BCOA 4GC5A 3RGPA 3A45A 4GC9A 4IUTA 3NE5B 2EZVA 4EQNA 3L25A 4HL4A 1BCPD 2JEAI 5KQ8A 2RGOA 1N36M 1B53A 1IY1A 3U61B 4HN7A 4KJOA 2A69D 4IN3A 2ID0A 4CKCA 4WRDA 5GKNA 3K58A 1NNJA 4Z8XA 1L2DA 1R4PB 1F2LA 4XT3B 3K59A 1D5MC 3JAME 4FF1A 2VNUD 4NW2A 2CHGA 2CUZA 4XYQA 1MU5A 4RKBA 4JN6A 1BR9A 2F5PA 1PTOB 1BBXC 4PCZA 3H0GB 4C3IB 2E2IB 1VDZA 4RCOA 2XSZD 3FYDA 3M4OB 3RD4A 1HNXM 3DXJC 5C0XG 3HP3A 1QNUA 1TY0A 2K01A 2G9HD 4PQXA 3TL4X 4CISA 3GTJB 3HOZB 2MHVA 3NQIA 4RHSA 1N75A 3I72A 2CHQA 3L7ZC 1ZYRC 1C48A 2K5DA 3I91A 4C1NI 2X49A 1X37A 2PPBC 1NCVA 1STBA 1FJGM 4LJAA 2ZXPA 5J1ZA 4IURA 4DV6M 2VUMB 4LJ5A 3FD9A 4M9ZA 3R93A 4TRDA 1J09A 4P16A 1K82A 3A7AB 2C98A 2Y0QA 1EEID 4K5XA 1BNZA 1XWIA 3CF6E 3SK8A 2H1EA 2XRSD 3C1EA 3K8ZA 5C4ZA 1IW7C 2E2HB 2L55A 2QPAA 4CBVA 2SNSA 4I81A 4IBGA 3CHBD 4L63B 5KNDA 2KRKA 3M7GA 1NY5A 5M5XB 3SAWA 1QE6A 2NUCA 1D1IA 4XYOA 4FWGA 3FUXA 2VB2X 4RF0A 3PNVA 2AQ2B 2HCCA 2AHMA 4RA8A 5LL6S 4LJ7A 1Q12A 5C5LA 5A2QE 1EY9A 1TQOA 4AG5A 1SXJE 4IBJA 3NK9A 1ORYB 1ENFA 1FNVA 1O7ZA 1DOKA 3V2TA 4ME5A 2JSOA 4NOOB 3PUYA 4DK0A 3NTKA 4C3IG 2CW0C 2F5SA 2DY8A 2QP9X 3Q22A 3VLFB 4MH0E 3L9AX 2OF1A 3D4RA 4KY5A 1WTRA 1HNZM 3FRPB 3UI2A 3E6ZX 4U673 4ZUJA 2EO2A 1Q3LA 3HJQA 2ZBKB 2NZ1D 3S15B 3S1NB 2K1BA 2YU9B 1TDZA 2ZAOA 1GJXA 5FO7B 1SJHD 1SXJC 4S3SA 4LJZC 4D81A 4MGYE 1Y1VB 3IFTA 1NHGC 5DEHA 1GHJA 4GHLA 3FEWX 1OXSC 2XGNA 5CBEE 1DXMA 1NUCA 2F0GA 3QOJA 1E32A 1L8QA 3GPYA 1O80A 4IBEA 5M3MB 3H09A 1WTOA 1DGHA 3VDUA 2Z4RA 3FMCA 5C0XH 2EYMA 1PFMA 3QWLA 1OFIA 4AKGA 1SYCA 1OXXK 3M4YA 1NSNS 5I2XA 2SEBD 1VCIA 4XQJA 2KRUA 3Q0AA 2B2UC 4R8NA 1BCPC 1IY0A 3R8FA 3OMCA 2CV1A 3TDQA 4LZJA 3DZDA 2V4DA 3IAYA 4DV0M 4FCVA 5JI2E 1X3QA 3R9XB 4KHPM 4CKEA 1PRTC 1J7KA 3OWFA 1DJRD 4KKSA 4NSRA 1SNOA 4HCSA 2WACA 4PNYA 4IBBA 4DFAA 1SJED 4FVMA 2MUYA 1H9SB 5FO9B 1EOTA 1IXRC 3HHYA 4X64M 3ILKA 4IFDH 3BZDB 1ESFA 1NR2A 3AOEC 2F4IA 4PD2A 3U6SA 1HHVA 3FTEA 1UNSA 3TWKA 1E9SA 5CV4A 3AOGA 2HCBA 1QILA 2F0DA 3HU2A 2I46A 3DFZA 1GXDC 1H9KA 2A6EC 3HHZA 4ITQA 1B9MA 2R6GA 4ABNA 1B2TA 1II3A 1JOQA 1A3TA 2KCCA 3U60A 1G2TA 3K6OA 3KVWA 5CV9A 3VR4A 4M0WA 4KI0A 2AQ1B 1ZYRD 3FPPA 1E9RA 3CF0A 1SE2A 4FWHA 1E2ZA 4I8OA 2Y21A 3KOWE 2XZFA 4XQQA 1IN4A 1HFGA 1PMRA 1V1PB 2F1MA 3GLHA 2XVSA 3T4AC 2X8AA 3FUVA 2G5GX 2NVXB 3D4DA 1U4PA 3MEHA 1C1KA 3S1QB 3QWNA 4V0BA 1TWFB 1IQPA 3GQ4A 3LQRA 4OW0A 4KD4A 2KEBA 2LXEA 1E2VA 2B2YC 4DV7M 2F0SA 5KNCA 2CV2A 3MZ5A 5FTMA 4ZKBB 1TU2B 3L2AA 3ONAB 4LZZA 4AYBB 1AZQA 3HOUB 3RGSA 1FNUA 2BE5D 1B9NA 2B2YA 3KP1E 2V1UA 2A6HC 3EIHA 4G6ZA 2L0CA 3C2PA 1DONA 3OWEB 4BY7B 4KO8A 4X65M 5CR3A 5J22A 1YNJD 5EJWA 4BB9A 3J80E 2R4JA 3J7YW 4QHSA 4CHTB 1F9RA 1QZMA 1ENAA 3SK4A 4R9WA 3VYRA 4N9TA 3T56B 4LJ4A 4DR3M 1ILQA 2JA7B 3HKPA 2I07B 5CV8A 3SXHA 2VXWA 5C44B 1TS4A 2WKCA 1EY8A 4NRWA 2FNAA 4PDIA 3GTLB 3OOCA 5FK9C 4CKBA 3PXGA 2BJWA 4IBFA 1R7RA 1IN6A 1TY2A 4L4UA 1JC7A 4QNRA 4FWDA 3AU7A 4FO2A 4DNTB 3GLGB 3IG8A 3IG5A 1HA5A 1U4LA 2BA0A 3IL8A 4DN4M 3MFYA 3NWLA 4KJNA 1IKLA 3NUCA 4FCWA 2KHSA 3T53B 2FOIC 1SFOB 1EQVA 3AJIB 1O7YA 1TH4A 4AQYM 2NVYB 1HQMC 4DF7A 5KPTA 1IXZA 2EJFC 4DR1M 3RFWA 1KAAA 3EJIA 2A5HA 1NSFA 1F9QA 4IFDJ 1A15A 1EL0A 1I3QB 2SOBA 1D2BA 1HA6A 1KNEA 5C4XB 2LY7A 2NWGA 3FKIB 4JK1C 2ICIA 2DXIA 4HR7B 3E4RA 5COYA 2C96A 4M0DA 3ZC7B 1U4RA 3ND8A 3OHXC 1PZID 4G4RA 3TE6A 4QCLA 1A2UA 1G8PA 1D5ZC 5K36H 2EVBA 1YSYA 3EA6A 5FTLA 1A2TA 4K6DA 3NSWA 1KDAA 2AUJD 2OXPA 4IBCA 1Q8IA 2F0VA 4DV2M 4A3KB 5HURA 1I4WA 1A3VA 2WAQB 1IXSB 2B2WA 1S5ED 1IKMA 3BVGA 2ZM6M 1DGBA 2EDGA 1PLFA 3AKZA 4MN3A 3AL0C 1NR4A 2Z8LA 4FW9A 3J7AV 1KSFX 1FYCA 2QBYA 5EPKA 4IBDA 2DZOB 2X6GA 5M9OA 2KECA 3PFIA 1KDCA 2F0QA 3Q6SA 4K6LA 4MHEA 1PFBA 3A55A 5KRUA 3KS4A 4KLNA 3H6MA 3SAVA 5E4XA 1G291 4EQPA 1RJTA 5BN5A 1PTOF 4A3JB 3NP8A 1OFHA 3R2IA 4C3HB 4JI3M 5ITYA 2OPFA 1Y8NB 3MHBA 1ILPA 3MC0B 1V1PA 1BF4A 1H9MA 4LF7M 3S1RB 2B8GA 2KUMA 5FKAC 1EWHA 3J7AF 1GL6A 3L26A 3TZUA 1B50A 2K47A 4XIGS 3KOZE 2NQ8C 3MWYW 5D14A 2EOTA 1ICWA 3WDNA 1I94M 2LH0A 2IL8A 1F2YA 1R9TB 2C9OA 1I4GA 3HGIA 3FTCA 3U60B 5IWAM 1ENCA 1YNJC 4V190 5DNYA 1VF5C 1SDFA 1HT1E 3EQLC 1CM9A 3A98B 5JI3E 4Y7NB 4QOSA 2JA5B 1QQWA 4HCEA 1N78A 1IYUA 4IUQA 4RNAA 5JJZA 3OSOA 1EQTA 1IL8A 1JOKA 2OT2A 4JI1M 4O42A 2F0JA 1XMQM 1U4MA 1JB3A 3K57A 5EKIA 4DUZM 1IM2A 5I4DA 5E3FA 1Q39A 1QVRA 2FFKB 4WFN3 4MM3B 5IOCA 1H9RA 2XLJA 4E6IA 4IJEA 3SAUA 2IPKD 2XH9A 2Q8RE 4DR6M 2CHBD 4N9PA 1TT2A 5FTKA 5NUCA 3Q8XA 3GTPB 1IN7A 4B3SM 4TQUS 1PRTD 4GH9A 2HHHM 2F0WA 1T3TA 1EY7A 4GHAA 2WINB 4CJ1B 4RKLA 4XT1B 1CA5A 4NMZA 1KLUD 1JE4A 1ET6A 1MD2D 3I70A 2F3VA 2J7ZA 3D4WA 5BPVA 1MX0A 1W6KA 3N52A 2PMZB 1EZ6A 1K83B 3EROA 2YNMD 1EY4A 1WTXA 3D3RA 3FUTA 1F2ZA 4PDGA 2O5RA 4BBSB 3P20A 1TS3A 3KOYE 2L7HA 2ICEC 4GZYC 4ZAIA 3K92A 3HRZC 3Q23A 2E5LM 2IX1A 3T1YM 1RTOA 3KDSE 1VMPA 2EYFA 5ELFA 4QOZC 3HGBA 4B7GA 4C3JB 2F4VM 3VYSA 2IX3A 2QENA 3X3MA 3HJ8A 4PT5A 1WCMB 4RH6A 4K2KA 1IBKM 5A2QL 3M6AA 3FPUB 1TWAB 3PO3B 3HKZB 2QEJC 5CYUA 5EXXA 4IUPA 1SE3A 4NKLA 2R61A 4OX9M 3L29A 1RTNA 3R3OA 4UAIA 4GRIA 2R93B 1Q90A 1LT3D 2QCPX 2PNRC 4K8IA 4F8MA 2L11A 1CHQD 1SBBB 2H4OA 4AZFA 1SNCA 3BS1A 2F0TA 1J9OA 3LQQA 3SK6A 1TH2A 5IGBA 1DO0A 2RKOA 3HHWA 3LWUA 1L2CA 2LS01 5FTJA 4IJFA 1S4ZA 3NPPA 1CTMA 4YY3M 2O5IC 3D31A 1QANA 1BO0A 2F0KA 3GV3A 1AFPA 4ID6A 2XNAC 1LTGD 2ZAMA 1HUNA 1Q3BA 1KFVA 3LMMA 3K7AB 4DV3M 2L4NA 3ND9A 3U6DA 2RSOA 1EU4A 5E26A 3KF8A 3KOXE 2XWJB 2PZWA 3JAML 2NB0A 1B1ZA 1DCZA 5C4HA 3MHVC 3TMEA 3U5ZB 3K5LA 4IUVA 4ZQ3A 1EY5A 2XWBB 4FD2A 5EGTA 1BDOA 3QO2A 4A3EB 1CZGA 2F5OA 4GKKM 1SXJA 4FXGC 3J27B 3UGJA 5E6JA 4OU7A 5EP3A 4AI6A 4DUYM 3BG3A 2Q8TA 1TDHA 1OO9B 4BY1B 1HQCA 1XXHB 4DR5M 4FF3A 2B2VC 5LL6X 1ZKOA 5BR8M 4FYDA 1LTTD 2EXZA 2EY2A 1JR3D 3AB9A 1LT4D 4ZK9B 3J80L 4R8IA 4OO1I 2ENBA 1QCBD 3KBXA 3UZUA 3U6EA 4RHRA 1QYRA 2UUBM 2PW7A 4XBOA 2RDGA 5EBCA 3E9SA 4QUFA 2FMCA 2CQAA 5JAVA 1RF2D 1SXTA 2XFTA 1PRTF 4OHJA 2Y20A 3S14B 4DU9A 2KOLA 1DGFA 1YE9A 3HG9A 5ISRA 2RGHA 3JR4A 5CV6A 2F0PA 4G4NA 5DYIA 4C56C 1LACA 1GVNA 2A69C 2EPBA 5FSWA 2XZUA 1JQJC 1ET9A 1X32A 1WD1A 5F3WA 3VA7A 1L1TA 1WTVA 2J7OA 5LHY1 2EYOA 3GPXA 1L0XB 1WVLA 1LTRD 2F03A 2K7VA 3SARA 4HEDA 1DM0B 5CMDA 1IBLM 4OL7A 2K28A 2KA7A 3NBHA 4BBAA 5D3DA 1SYFA 2E2JB 1EZ8A 4H0LC 4OVZA 4FCTA 3KFUG 4LGMA 1C8CA 4S12A 1XNQM 2RSNA 4MGHA 2EY6A 3NHHA 2NTTA 3H91A 3SMPA 2E75C 4JXJA 1L0YB 1D6EC 3FTDA 3U6PA 4LFBM 3I8ZA 4EGVA 1HQRD 4OO1G 1JQYD 1VF7A 2X69A 1I4QA 1N77A 2F3WA 4L15A 4LGYA 3GLIB 2ZXRA 2IJ0A 2CHVA 1U9RA 1MSGA 4GIPA 3DM1A 2JE6I 2A73B 4QNMA 5CBAE 1CI3M 3HHXA 4ZPXA 2Z1CA 5M5YB 2XF3A 3HS0C 3KLRA 2LWXA 3S17B 2KEEA 1PTOH 3NTIA 3M7NA 4O1NA 4K8JA 3TP8A 1KABA 2F0LA 2UXDM 3C46A 2R62A 3MXNA 3IKJA 4A3IB 4C3HG 1W5SA 4WJWA 4HTHA 5IT9E 1SNMA 3NBIA 1Z6TA 1JR3A 2IT1A 2Z4HA 4JYAM 3F2UA 3FUUA 1LT6D 3SVMA 3H3VC 4CGYB 4KKTA 3CRLC 2BDOA 5FTNA 3T15A 3NWSA 2O2LD 3PO2B 2EUCA 2K32A 2Z3XA 3RE8A 5C0XJ 4NXNM 3TWLA 4DK1A 1SSOA 4RGTA 3ZYYX 1SYDA 4K5WA 1JR0D 3NTHA 5FLXS 1NHWC 2KZUA 1I6HB 1XXGA 3RUZA 2JA6B 2C9CA 3PIO3 4DAVA 2QF7A 4KN7C 4IZ8A 2VQEM 1STGA 1E0BA 1VDDA 5FO8B 1SAPA 2NN6G 2AUKA 3GP1A 5EXPA 4LF5M 2R46A 4QB4A 5ITQA 1LV7A 1WD0A 2EY1A 3R8BA 2B2UA 2D5DA 1KDBA 3OTOM 1PJJA 4KODA 1HFNA 1SXJD 2WP8J 5EQTA 3EVQA 2I7NA 4LRTA 3GRUA 2AQ3B 2HUGA 1K8OA 4K0KM 2BDNA 4KMUC 3GRYA 1JWUD 3SEBA 3OIQA 4L6TB 1LABA 1D2NA 1EU3A 1ONLA 4Q0FA 1HRJA 1STHA 1DO2A 2J7NA 5KQDA 3SHLA 3FUWA 1XC8A 1BXTA 2LFNA 3FTFA 4OIJA 2A68C 3U6MA 4A3MB 1CA6A 1R6BX 2MJ8A 4KHVA 3KS8A 3A8IE 2DNEA 2X6LA 5IIFA 1GKIA 1GUTA 4JI5M 4F7XA 3GLGA 3BDCA 4PMBA 3M3YB 5A2QS 1A3UA 3D6CA 3A8JE 1EYCA 4FF4A 3TSSA 1C4QA 3PIP3 3GLFB 3KBGA 3SK5A 1GUSA 3DWQA 1JWSD 5ITTA 5DAUA 1Q1EA 4Z6YA 5ITXE 1GUOA 2BA1A 2WV6D 2KA6B 2YR0A 4I4LA 3AOEA 2LKVA 4CJ2C 3K5MA 1F9PA 2TMPA 5IT9L 3BOSA 3PUWA 3P7JA 1PM5A 1I4HA 1SEBD 1YUBA 1ZQ9A 5C3EB 1NVMA 2D7HA 1IW7D 3HOWB 5KYLA 4R7GA 2EYPA 2I7PA 4W5WA 3VDPA 4A93B 2QKIC 4OIKA 1FD7D 3LWEA 3LX0A 2K6AA 1LLRD 4KK7A 2M2LA 3GO8A 2HDMA 4QUCA 3A8KE 2NYZD 1I4RA 3SBJA 2DWZB 2WKDA 1B4OA 1ZXTA 3HOVB 4MGKE 3M0EA 2E2DC 4IUNA 2JXMB 4FXDA 4IBKA 4IUUA 2CW0D 3RZOB 4LF4M 1V43A 1SE4A 3I73A 2A68D 1K3WA 4MGZE 4I5SA 3PV0A 1AP0A 2J4XA 1S5BD 3I4YA 1HR0M 3J2PB 1DYQA 3QIAA 1LT5D 1EIGA 4IALA 5F2DA 3SDZA 3U9SA 4HAEA 4DR2M 1WTQA 3GTKB 1HT2E 3PUZA 3DA1A 1XXHA 5JEAJ 3FDTA 5K5PA 3AMUA 4CJ0B 3PNYA 3LVVA 3UK6A 2F5NA 3KUPA 1K8MA 2HL7A 2RKSA 4XQNA 2L12A 3FVQA 1KNAA 1ZEQX 1DGGA 4DV5M 1IHZA 3BYYB 3CQZB 2KJXA 1PYWD 4EIWA 4NDXA 2DVWB 5IREB 3SHFA 1JORA 3GQ3A 5C3XA 2YQZA 4QHTA 4II7A 3QJYA 1GUWA 4X3SA 2BJVA 4QMGA 1BOSA 3C58A 5IGFA 3SASA 4DA2A 4DXFA 3URYA 3JR5A 2SDFA 4M1UB 1UUPA 1TIID 3U6QA 5C4JB 2HQEA 4U68A 3P75A 1XWEA 5KIXA 4G7HC 4IQZA 3J80S 1XX8A 2RVLA 2EYJA 3SC3A 5ELEA 5JOBA 4IFDG 3S2HB 2LNHC 2QCUA 1PJIA 4LF9M 4C2MB 1CZWA 5T1IA 2HKJA 2XEPA 1EIHA 1R4QB 1IBMM 4HLQA 3TPZA 1OXTA 1PRTB 2OQ4A 5C1BA 4BLCA 5EKKA 4LY6A 4X66M 2ZXOA 3A42A 4PMCA 2DY7A 1TH3A 4GITA 2SNMA 3V96A 1QAQA 5EPLA 4BA2I 1T5XD 3SYLA 1CT1D 2G9DA 1S3SA 1XYIA 1BCPB 5IODA 3KK7A 3U5ZA 3OW7A 5A35A 3ERQA 3FKEA 2K5WA 2QDBA 1H9JA 5BN4A 4G4QA 2K5QA 4BWGB 3H94A 3I3CA 4F87A 3VR5A 4KV6A 1PZJD 4LFCM 5JVG3 3VK8A 3OIPA 1CFMA 1N32M 4KTAA 1D5XC 3CU7A 2RBMA 1IY2A 2JYOA 1N33M 1WTWA 4H44C 2IX0A 2J0TD 4FP5D 3DHQA 5DNFA 2KQ3A 4RFBA 3I4NB 3I90A 1CHPD 4UDUC 2MPMA 3PMFA 2N88A 5I2YA 4M9SA 2F0EA 3DEPA 1AN8A 1QB5D 2XSZA 2K33A 1H9SA 1QJOA 2PCFB 5JEAG 3TQSA 3GLHB 1T5EA 1W6JA 2ERCA 4JI7M 5KGUA 1MI2A 3CRKC 2R4EA 4KHZA 4HMIA 1I50B 3BVZA 4ZKCB 1HXYD 3VK7A 3TZDA 3CF2A 5DM63 1JCKB 4ZYSA 3LNNA 1HQYE 5CV5A 1N34M 5I9OA 3KLSA 8CATA 3UMMA 2F0NA 2O5JC 5KPRA 3QAUA 4AW4A 1LV9A 4K2LA 5EP2A 1SYBA 4WORA 4M9XA 2FHTA 5C18A 1B44D 3BDOA 2DWMA 4C3JG 1G4AE 5G3LF 1TWGB 4R3DA 2M5ZA 2MP1A 4A3DB 3GQBA 1R2ZA 1HTLD 1S5CD 2Y0TA 4MB7A 2R7ZB 1MBYA 1QNKA 1RDPD 1OXVA 2P5TA 2RDHA 2C5CA 3R2TA 5CV7A 3KLSX 4Q5VA 2C5RA 3T16A 2NN6I 2UXCM 2WB1B 1EYAA 3C1FA 3ZCBB 2Z7JA 3CKIB 2XSCA 2CFOA 2CE7A 2B2VA 3VR6A 4B3MM 4TKOB 2NBFA 1M4VA 3L27A 3MTSA 1UM8A 1O78A 1I4PA 5DM73 1GL7A 5FLXE 1KYIA 2RA4A 4X3UA 5ITXA 4WURA 1O7LA 3VFDA 4LRSA 1STYA 3TP5A 4L8RC 1TR5A 1KLGD 2C99A 5JVH3 1STAA 1I4XA 2IWHA 1GOZA 1TWCB 4LJ6A 4X62M 4B9WA 2QZ4A 3WOEA 1QWYA 3N6RA 2CV0A 4BBRB 4AKIA 3EFXD 4HSPA 4X3TA 3U6CA 2O4XA 2PZTA 4FXKC 3W2DA 1G6ZA 3TP7A 1DOLA 3B9PA 4RWSC 3VKHA 2F0UA 3X3NA 1SMYD 1EWCA 3HU3A 4DNRB 4QF4A 5H37D 4LMQD 4HMJA 3GTGB 5D65A 3W3AA 4C1NK 1TWHB 3A46A 4RCNA 3GTOB 4A3BB 3I4MB 2BNKA 3PVSA 5CC4A 1GLNA 3Q24A 3GO5A 4ZUIA 4NXMM 5ELDA 2A6HD 1X3PA 1SYGA 4RGMA 1KTKA 4G7OC 4H13C 1MGSA 2KXEA 2FMMA 2EJGC 3HWSA 5T1GA 4BA1I 1V8QA 2DWLA 3KW6A 4F88A 1LTBD 2XN9C 4LF6M 1XNRM 3DUZA 5I9PA 1XHBA 4DR4M 2M60A 1L2BA 3SATA 3WHKA 4HSVA 5JEAH 4TSSA 2G8LA 2XRQD 5CORA 3J7BA 1G41A 3HJSA 4L78A 3DWPA 3MFGA 4P2CB 3D8GA 5BN3A 4ZLTF 4A3FB 1ESRA 3GD7A 1TS5A 5J39A 2EYHA 4A3GB 2E74C 4B7FA 2DN8A 5EXSA 4NP5A 3MXPA 3HOXB 4LF8M 2FJ2A 4WW0A 1OXUA 5C6AA 5C5MA 3J81S 3T13A 1F9SA 2WIIB 1GUNA 4RAUC 5IGDA 3KSXA 3VYUA 3M85A 1EY6A 2YYZA 1RHPA 4JV5M 1LTAD 5KO3A 1XTCD 1UEAB 4IIWA 4KY7A 2FINB 1FNNA 1HUMA 3TN2A 5IZ7D 3A7LA 3S16B 1PTOC 4DGZA 2EA0A 2L1BA 4K14A 5G3LD 5M3FB 1HTPA 4K5VA 1QAMA 5EXTA 2UUAM 4KKUA 3SFZA 3DWAA 2B39A 2Q8IB 3I4LA 1G59A 2D62A 3J7AS 1Y69U 3DEOA 4B3TM 4AG6A 1Z59A 4JI4M 5EKLA 3GLFA 4I65A 4RGOS 5FOBB 1V1OA 1BQQT 3BDLA 2V1CA 1I6VC 4YIJA 2F0OA 1ML0D 2D9UA 1IN8A 2DNCA 5JPMC 2F0IA 1DOMA 3P1HA 7CATA 3S9WA 4I7ZC 5KYIA 3MXGA 1RODA 3GPUA 5TSSA 2V6ZM 1Q3CA 3HU1A 2R65A 3MVVA 1L1ZA 1TGUA 3KXEC 5HGTA 2L6OA 1K3XA 2MGSA 4KY6A 5LMUM 1NAPA 4ZRZA 1PTOD 2HDLA 2B8FA 3C3LA 2TSSA 1LTID 3G6JB 4PMWA 1SXJB 4MIUA 2NVTB 4DV1M 1G91A 2R92B 4YHHM 2AWNA 4D80A 1QAOA 1FNWA 1NNUC 3I51A 3WOFA 4B3RM 1J8IA 2XFSA 3SR1A 3A56A 1RD9D 5I6YA 1CQFA 1G3IA 3K5NA 2F0HA 3HZXA 5EQ0A 2B63B 4DR7M 3MA2B 4GMQA 3U61A 3MXUA 2BE5C 1BCPF 1TKWB 2UUCM 5EPJA 5C0XI 4XDXA 4JI0M 4L16A 4LCBA 1Z47A 1Z6HA 2F0MA 2EYLA 3O13A 2JEBI 5EP1A 4OGQC 2JA2A 2N55A 2VB3X 4A3VB 1SMYC 3ITPA 5K36G 5FLXL 3UJNA 3VR2A 3TWMA 1HCZA 1EYDA 3W0FA 2PZUA 1F77A 3GTMB 1DGHB 1GHKA 5M5WB 2L5TA 2YFQA 3PUXA 4KD3A 4JI6M 2RQXA 4B08A 3V05A 4LG2A 1SNDA 3J81L 2Y0SB 2CVRA 5IGCA 3MAQA 2AWOA 2D7GA 5AFWA 3T51B 1AEXA 1GUGA 1DD2A 2PW5A 1TS2A 3MK6A 1J5EM 2KW0A 2DHRA 4ILWA 2KCNA 1F2MA 1PZKD 2RDFA 3VR3A 3U9OA 2E76C 2A6ED 4G4OA 1FGBD 4LAAA 2FE8A 3SYKA 1NY6A 1CQVA 5LMNM 4EQOA 1B3AA 3EIEA 4TUWA 2ZT9C 2OEOA 1PFNA 3CTWB 1H6UA 4JI8M 1DZ1A 4L8JA 3AFHA 4B7HA 3H4MA 5IT9S 1VMCA 4DXGA 3JAMS 3D8BA 3KSJA 2M9VA 2EJMA 3QOLA 3G7LA 2PO4A 1E94E 2LMCB 2A74C 1Z5BA 2W82A 2K03A 4KN4C 1STNA 1OJLA 4Z9CB 1CK1A 2NTSA 4G4KA 1G2SA 1PDQA 1FR3A 2K04A 3TBIB 1JOOA 2GA4B 5DYGA 5ELBA 1G8ZD 2X4AA 3SE0A 4REZA 3GP7A 2L7IA 4M8AA 1Y8OB 3E0JA 4OVZB 3BYTB 2VIIA 5E1FA 3GRRA 2DWNA 3HOYB 3FYCA 5C3WA 2PQEA 4X3KA 4RF1A 3T1HM 1LTSD 4XGIA 1WXQA 3AV0A 1SNQA 1TVXA 3LVWA 3D6WA 1HPCA 3BVMA 3J81E 2F0FA 2M00A 4PV1C 3ZH9B 3MJ5A 4B9XA 3GTQB 4J1MA 1W5TA 3I4VA 3U6LA 1D1KA 2Z4SA 1YNNC 2EE1A 4DAYA 1BUVT 2PYKA 1JICA 3HEJA 2R18A 2K05A 1JWMD 5D3IB 3K0YA 2D7EA 1Z5CA 5EBDA 4DV4M 3W0LB 2BOSA 2EY5A 3E5SA 4J6HA 3SHGB 4XTCS 2IW3A 4FNFA 1R2YA 2XIWA 5KEEA 2D2CC 4H7BA 5I6WA 2F5QA 1EFID 2VQFM 3OMGA 2KVMA 3RMHA 1ZAEA 4JI2M 4ODGA 2DZNB 1A6XA 2UXBM 4GKJM 4NRVA 1WTPA 2KZSA 3RZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBI A;  4CGY B;  4CHT B; 
#chains in the Genus database with same CATH topology
 1HNW M;  4FF2 A;  4X64 L;  2FFJ A;  3ULJ A;  2R45 A;  4LJ8 A;  4JG2 A;  3T38 A;  2CWP A;  1IXS A;  3S1M B;  1AW7 A;  2KCT A;  4B3S L;  3M9B A;  4KHP Q;  3KP0 E;  4R4O A;  1LO5 D;  3GV6 A;  1OTC A;  1NJF A;  5EJC A;  4LFA M;  3VKG A;  1SNP A;  2L4E A;  4O2D A;  1S5F D;  5ITU A;  1K0S A;  4LJ9 A;  1YNN D;  3OPO A;  3GPP A;  1IYV A;  4D82 A;  3GLI A;  2L9H A;  2LTU A;  3ULL A;  1NJG A;  2KED A;  3QB3 A;  1PXU A;  2N3S A;  4JVZ A;  3RLF A;  4DR3 Q;  1X9N A;  2L09 A;  4AKH A;  2ZAN A;  3DMU A;  1T6O A;  4J8Q A;  1RCV D;  5ITR A;  4ULL A;  4C3H H;  3PIP A;  5LMN Q;  3VA5 A;  4IBI A;  2B2T C;  4RMF A;  3VYT A;  2QBY B;  2Z4I A;  1V92 A;  1X3F A;  2BH2 A;  4BY7 G;  1QOH A;  4UHV A;  1XMO L;  2LHG A;  4QIW B;  2B2W C;  1Y1W B;  3GRV A;  2JP1 A;  1Z7T A;  2CCZ A;  2R3Z A;  3S2D B;  5EP4 A;  1J5E L;  1HZB A;  5KNB A;  1E2W A;  4PZ8 A;  3D8L A;  1MSH A;  1EFW A;  4DV7 Q;  1EY0 A;  4L6V 6;  4OO1 H;  4KT0 F;  1UAP A;  1XMO M;  3L3O C;  4NL4 H;  2PQA A;  5GAH C;  1EYG A;  2H1R A;  5ELC A;  3GTK H;  3S1N H;  1SYE A;  4MZ9 A;  4DAM A;  3THG A;  2B2T A;  4IJH A;  1L2F A;  5GQO A;  3GQ5 A;  4JBW A;  1EE8 A;  1S5D D;  1JB0 F;  3PUV A;  2NVQ B;  4A76 A;  1Y8P B;  3K2L A;  3K1J A;  3SMS A;  2ZM6 Q;  5IGE A;  3QG1 A;  2R7Z H;  1Q1B A;  4X66 Q;  4G57 A;  3DOA A;  2HCI A;  4YCU A;  2JA8 B;  1PVO A;  1STE A;  5JPN C;  4LK1 C;  4ALP A;  2UU9 M;  1QG7 A;  1PYS B;  4BS9 A;  1L1O A;  3IRB A;  3NXW A;  1JE5 A;  3U6O A;  1RKN A;  4LF5 Q;  3HOY G;  5C4J H;  3A54 A;  5KPZ A;  2LVP C;  2L15 A;  1PJS A;  1M8A A;  3IFD A;  2NN6 H;  5IGG A;  1Z5A A;  1IN5 A;  5FLX c;  2A1A A;  2CEA A;  3HOV H;  2A5Y B;  1RIP A;  4NSO B;  5E4W C;  4XXE A;  3TP6 A;  3NWT A;  4KHP L;  4G7Z C;  4IFD I;  1EEF D;  2QIL A;  2PI2 A;  3WHL A;  2KHH A;  2N49 A;  2Q2E B;  4DV0 L;  4EVO A;  1KIX A;  3NQT A;  5CGK A;  1MJE A;  4MGI E;  4RGN A;  2FS1 A;  3E46 A;  1AZP A;  4N8X 1;  3L28 A;  4DAP A;  3CCL A;  1XXH E;  3K5O A;  2BCO A;  4GC5 A;  3RGP A;  3M3Y H;  3A45 A;  1TWC H;  4GC9 A;  1HZ9 A;  1R4G A;  4IUT A;  2RF4 A;  3NE5 B;  2EZV A;  4EQN A;  4DV7 L;  2DKL A;  2GNO A;  4HL4 A;  1BCP D;  3L25 A;  2JEA I;  5KQ8 A;  2RGO A;  1N36 M;  1EUJ A;  2JY7 A;  1B53 A;  1IY1 A;  4RKU F;  3U61 B;  5IYD H;  4HN7 A;  4HJA A;  4KJO A;  2A69 D;  4IN3 A;  2KHI A;  2ID0 A;  4CKC A;  4LF4 Q;  4WRD A;  2K52 A;  2ZM6 L;  5GKN A;  3K58 A;  4A3C H;  1WGL A;  1NNJ A;  5IP7 G;  4Z8X A;  1L2D A;  1R4P B;  1F2L A;  4XT3 B;  3K59 A;  2UU9 Q;  2ZJP A;  1D5M C;  3JAM E;  2L2D A;  3BZC A;  1W2B A;  4FF1 A;  3M4O H;  2VNU D;  1PH7 A;  4NW2 A;  2CHG A;  2CUZ A;  2MO1 A;  4XYQ A;  1MU5 A;  2YV5 A;  4RKB A;  4JN6 A;  1BR9 A;  2F5P A;  3T1H L;  1PTO B;  1BBX C;  4PCZ A;  3H0G B;  1VQH A;  1X3E A;  4C3I B;  2E2I B;  1LUZ A;  1VDZ A;  4RCO A;  2XSZ D;  3FYD A;  3M4O B;  4PZ7 A;  3W68 A;  3RD4 A;  1HNX M;  3DXJ C;  3J81 i;  5C0X G;  1HNZ L;  3HP3 A;  3C3E A;  1QNU A;  1PH8 A;  3S2D H;  1TY0 A;  2K01 A;  4JI4 L;  2G9H D;  4PQX A;  3TL4 X;  4CIS A;  3GTJ B;  2K75 A;  1HNX Q;  3HOZ B;  2MHV A;  3NQI A;  4RHS A;  1N75 A;  2QQ8 A;  3I72 A;  1D0M A;  2CHQ A;  3I01 M;  3L7Z C;  2JA5 G;  1ZYR C;  2VDB B;  4DV6 L;  1C48 A;  2K5D A;  3I91 A;  4C1N I;  2X49 A;  1X37 A;  2PPB C;  1NCV A;  1STB A;  1FJG M;  4LJA A;  2ZXP A;  5J1Z A;  4IUR A;  4DV6 M;  2VUM B;  4LJ5 A;  3FD9 A;  4M9Z A;  3R93 A;  5JJI A;  4TRD A;  1J09 A;  4P16 A;  1Y1V G;  1K82 A;  3A7A B;  4GLX A;  2C98 A;  2Y0Q A;  4JBJ A;  2QEX A;  1L1O B;  2KDL A;  1EEI D;  4K5X A;  2APL A;  1BNZ A;  1XWI A;  5C3E H;  3CF6 E;  4MNO A;  3SK8 A;  2H1E A;  2XRS D;  5LMN W;  3C1E A;  3K8Z A;  5C4Z A;  1IW7 C;  2E2H B;  3E21 A;  2L55 A;  3H3V H;  1VQC A;  4P75 A;  1KHI A;  2QPA A;  4CBV A;  2SNS A;  1B7Y B;  4I81 A;  4IBG A;  3CHB D;  4L63 B;  5KND A;  2KRK A;  3M7G A;  1NY5 A;  3MEF A;  5M5X B;  1D0K A;  2RHQ B;  3SAW A;  2HQL A;  1QE6 A;  2NUC A;  4MTK A;  1D1I A;  4XYO A;  1IBL Q;  4FWG A;  4X64 Q;  3FUX A;  1VEG A;  2BWE A;  2UXB Q;  2VB2 X;  3RN2 A;  2HHH Q;  4RF0 A;  4BBR G;  3PNV A;  1Z9F A;  2AQ2 B;  4DR3 L;  2HCC A;  2AHM A;  4RA8 A;  2K9D A;  1NO1 A;  5LL6 S;  4LJ7 A;  1Q12 A;  5C5L A;  5A2Q E;  1EY9 A;  2DEN A;  1TQO A;  3RR5 A;  4AG5 A;  1SXJ E;  4IBJ A;  3NK9 A;  1ORY B;  1R9T H;  1ENF A;  1FNV A;  1O7Z A;  1DOK A;  3V2T A;  4ME5 A;  2JSO A;  2F52 A;  4NOO B;  2K14 A;  3PUY A;  4BBS H;  4DK0 A;  3NTK A;  4C3I G;  3GTQ H;  2CW0 C;  2F5S A;  1HNW L;  4GOP A;  1Y1W H;  2RRU A;  2DY8 A;  2YTV A;  2QP9 X;  1EIF A;  3Q22 A;  3VLF B;  4NPS A;  2VUM G;  4WJ4 A;  4YHH Q;  4MH0 E;  1WCM G;  3L9A X;  2OF1 A;  1NMG A;  4WP2 A;  3D4R A;  2UUC Q;  2E2I H;  4KY5 A;  1WTR A;  1Y14 B;  5GRO A;  1HNZ M;  1VQ1 A;  3HOY H;  3FRP B;  2LBC A;  2R92 H;  3UI2 A;  3E6Z X;  2VQF L;  4U67 3;  4ZUJ A;  2EO2 A;  1Q3L A;  2K6B A;  3HJQ A;  2ZBK B;  2QNJ A;  3KLW A;  2NZ1 D;  4A3F H;  2K0B X;  2OWO A;  2DHY A;  3S15 B;  2JK8 A;  3S1N B;  2K1B A;  2YU9 B;  1TDZ A;  3GTP H;  1VQF A;  4B3T Q;  2N35 A;  3G6E A;  3EN2 A;  2LVQ D;  1OAO C;  2ZAO A;  1OQY A;  1GJX A;  5FO7 B;  2UXD Q;  1SE8 A;  4EX5 A;  1SJH D;  1SXJ C;  4S3S A;  4LJZ C;  4D81 A;  4MGY E;  1Y1V B;  4L5Q A;  1ASY A;  1NNX A;  3IFT A;  1D0L A;  1NHG C;  3W1B A;  2B29 A;  1QDR A;  5DEH A;  1GHJ A;  4GHL A;  3FEW X;  1OXS C;  2XGN A;  5CBE E;  2K4K A;  1DXM A;  1G51 A;  3KDF B;  1NUC A;  4B3M L;  2F0G A;  3QOJ A;  1E32 A;  1L8Q A;  1LTM A;  2CWB A;  3GPY A;  1O80 A;  1N36 L;  4IBE A;  1MN3 A;  5EAY A;  5M3M B;  3CC7 A;  4BY1 G;  1QUS A;  1WR1 B;  3H09 A;  1YLA A;  1X65 A;  1WTO A;  1DGH A;  2MJ5 B;  3VDU A;  2Z4R A;  2IHE A;  3FMC A;  5C0X H;  2EYM A;  1PFM A;  3K0X A;  3QWL A;  4GN3 B;  1OFI A;  4AKG A;  1SYC A;  1OXX K;  1QUQ B;  3M4Y A;  1NSN S;  5I2X A;  4DKA C;  1MHW C;  2SEB D;  1VCI A;  3KF8 B;  4XQJ A;  2KRU A;  1YJW A;  3Q0A A;  2B2U C;  4R8N A;  1BCP C;  4P73 A;  1VQ7 A;  1IY0 A;  3R8F A;  3OMC A;  4OEM B;  2CV1 A;  3TDQ A;  4LZJ A;  3DZD A;  3ER0 A;  2V4D A;  3IAY A;  4DV0 M;  4FCV A;  1E1T A;  5JI2 E;  1IXR A;  1X3Q A;  3VDY A;  3R9X B;  4KHP M;  5M5X H;  2JA8 G;  4CKE A;  1PRT C;  1J7K A;  2VL6 A;  4R4Q A;  3OWF A;  1DJR D;  3FHW A;  4KKS A;  4NSR A;  2UUA L;  1SNO A;  4HCS A;  2VQE Q;  1Y1V H;  2WAC A;  1YHQ A;  4PNY A;  4IBB A;  4DFA A;  1SJE D;  2OQ0 A;  4FVM A;  2MUY A;  3HOX H;  1H9S B;  2PQA B;  3KF6 A;  1PH6 A;  5FO9 B;  2UU9 L;  1EOT A;  1IXR C;  2NVQ H;  3PO3 H;  3HHY A;  4X64 M;  3ILK A;  4IFD H;  3BZD B;  2VZA A;  1ESF A;  1NR2 A;  3AOE C;  4DR7 Q;  2F4I A;  4PD2 A;  4CDD C;  3U6S A;  1HHV A;  3FTE A;  1UNS A;  3TWK A;  1E9S A;  5CV4 A;  1XJV A;  3AOG A;  2HCB A;  3L0O A;  5LMN L;  2DNA A;  2Z6K A;  1QIL A;  2F0D A;  3HU2 A;  3A5U A;  1YBY A;  3RN5 A;  1HNX L;  2I46 A;  3Q8G A;  3DFZ A;  1GXD C;  1H9K A;  2A6E C;  1KXL A;  3LCV B;  3HHZ A;  4ITQ A;  1B9M A;  2R6G A;  3KYH C;  1II3 A;  4ABN A;  1A3T A;  1B2T A;  1JOQ A;  2KCC A;  1PH9 A;  3U60 A;  1G2T A;  1KQS A;  3BZK A;  2OTJ A;  3K6O A;  3KVW A;  5CV9 A;  3NEN A;  3VR4 A;  4M0W A;  4KI0 A;  2AQ1 B;  1ZYR D;  3FPP A;  1VQ6 A;  1E9R A;  4DV4 L;  1AIP C;  3CF0 A;  4B3R L;  3H0G G;  2B63 H;  1IBK Q;  1SE2 A;  4FWH A;  1E2Z A;  3K7A H;  4I8O A;  1SLJ A;  2Y21 A;  3KOW E;  2XZF A;  4XQQ A;  1IN4 A;  1TWG H;  1HFG A;  1PMR A;  1V1P B;  2F1M A;  1V1Q A;  3GLH A;  2XVS A;  3T4A C;  2X8A A;  3FUV A;  4BBS G;  2G5G X;  2NVX B;  1TWH H;  3T6P A;  3D4D A;  1U4P A;  4QJF A;  3MEH A;  1C1K A;  2UUA Q;  2Q2I A;  3S1Q B;  3QWN A;  2YTY A;  4V0B A;  1QUT A;  1IQP A;  3GQ4 A;  1TWF B;  2JA7 H;  3LQR A;  4OW0 A;  4KD4 A;  2BH8 A;  3G48 A;  2KEB A;  2LXE A;  1E2V A;  2B2Y C;  3CC4 A;  1VQ8 A;  4DV7 M;  2Z0S A;  1WOC A;  1DGS A;  2F0S A;  1BKB A;  4R1J A;  5KNC A;  2CV2 A;  3MZ5 A;  3KDF A;  1GO3 E;  4JI1 Q;  5FTM A;  4GN5 A;  4ZKB B;  3KJP A;  1TU2 B;  2R7F A;  3L2A A;  3ONA B;  1I50 H;  1LM0 A;  4LZZ A;  2YTX A;  4AYB B;  1AZQ A;  3STB D;  3HOU B;  3RGS A;  1FNU A;  1NTG A;  2BE5 D;  3PF4 A;  1B9N A;  1CKN B;  1NBW A;  2B2Y A;  4DR4 Q;  3KP1 E;  2V1U A;  2A6H C;  3EIH A;  4G6Z A;  2L0C A;  2EJS A;  4UP7 A;  3C2P A;  1WCM H;  1DON A;  3OWE B;  4BY7 B;  4KO8 A;  4X65 M;  1P8L A;  5CR3 A;  5IP9 H;  1FGU A;  5J22 A;  1YNJ D;  5ELO A;  5EJW A;  4BB9 A;  3J80 E;  2R4J A;  3J7Y W;  4QHS A;  2R7Z B;  4CHT B;  1F9R A;  4P74 A;  1QZM A;  1ENA A;  3SK4 A;  3KJO A;  1VQ9 A;  4R9W A;  3VYR A;  1N9W A;  4N9T A;  3T56 B;  4LJ4 A;  3TS2 A;  4DR3 M;  1ILQ A;  2JA7 B;  5LMU L;  2RCN A;  3HKP A;  2I07 B;  1OIP A;  3W67 A;  5CV8 A;  3SXH A;  1WIV A;  2VXW A;  5C44 B;  1TS4 A;  3HOZ H;  2MR9 A;  2WKC A;  1EY8 A;  4NRW A;  2Q2T A;  1O7I A;  2FNA A;  4LFA Q;  4PDI A;  3GTL B;  3OOC A;  5FK9 C;  4CKB A;  3PXG A;  2BJW A;  4IBF A;  1R7R A;  1ASZ A;  1IN6 A;  1TY2 A;  3LCU A;  4L4U A;  1JC7 A;  4IPC A;  2UXC L;  4QNR A;  4FWD A;  3AU7 A;  4FO2 A;  4DNT B;  3GLG B;  3IG8 A;  3IG5 A;  1HA5 A;  3AYH B;  1U4L A;  2BA0 A;  3DM3 A;  3GTL H;  3IL8 A;  4DN4 M;  1XNR Q;  3MFY A;  1N33 Q;  3NWL A;  4KJN A;  2CKZ B;  1IKL A;  3NUC A;  4C3J H;  4UP8 A;  4FCW A;  2KHS A;  3T53 B;  3IEC A;  2FOI C;  2CP8 A;  1XMQ Q;  5M5Y H;  1SFO B;  1EQV A;  3AJI B;  1WHC A;  1O7Y A;  1TH4 A;  4LFC Q;  4AQY M;  1GD7 A;  2NVY B;  4DR4 L;  2V1C C;  1HQM C;  5C44 G;  4JC0 A;  3PO3 G;  4DF7 A;  2WSC F;  5KPT A;  2A8V A;  5L37 A;  4Q7J A;  1IXZ A;  2Y0S G;  5AJ3 Q;  2EJF C;  4DR1 M;  3RFW A;  5M3M G;  1KAA A;  3EJI A;  2A5H A;  1NSF A;  2O01 F;  1F9Q A;  4IFD J;  1A15 A;  1K83 H;  1MKH A;  1EL0 A;  1I3Q B;  2SOB A;  1D2B A;  1XPO A;  1HA6 A;  1KNE A;  5C4X B;  4A3C G;  2LY7 A;  2NWG A;  4NXM L;  3FKI B;  4JI8 L;  4JK1 C;  2ICI A;  4GKJ L;  2DXI A;  2OOB A;  5IYC G;  3PO2 H;  1Q81 C;  1EQQ A;  4HR7 B;  3E4R A;  2JA5 H;  5COY A;  2C96 A;  4M0D A;  3ZC7 B;  1U4R A;  3ND8 A;  2BWB A;  1PZI D;  2D0O A;  3OHX C;  4G4R A;  3TE6 A;  3GTO H;  4A3B H;  4LF8 L;  4QCL A;  1A2U A;  2I5H A;  1W3S A;  1G8P A;  1NV8 A;  4LW1 A;  4A3E G;  1D5Z C;  1YI2 A;  2IY5 B;  5K36 H;  2HAK A;  3GLI E;  2EVB A;  1XB2 B;  4GNX A;  1YSY A;  3EA6 A;  5FTL A;  1A2T A;  4K6D A;  3NSW A;  1KDA A;  2AUJ D;  2E5L Q;  2OXP A;  4IBC A;  1Q8I A;  2F0V A;  4DV2 M;  4A3K B;  5HUR A;  2F3I A;  1I4W A;  1A3V A;  1ZMW A;  3BBZ A;  2WAQ B;  1IXS B;  2B2W A;  1XNR L;  5JJK A;  4LF6 L;  1S5E D;  1IKM A;  3BVG A;  2ZM6 M;  1DGB A;  2JZ0 A;  2CFM A;  2EDG A;  1PLF A;  3AKZ A;  4MN3 A;  1Q7Y C;  4POG A;  3PCO B;  3AL0 C;  1NR4 A;  2Z8L A;  4FW9 A;  3J7A V;  1KSF X;  1FYC A;  2QBY A;  5EPK A;  4IBD A;  1LTL A;  1Y1W G;  4GKK Q;  4A3J H;  2DZO B;  2X6G A;  1CKM A;  3F92 A;  5M9O A;  1X6O A;  2KEC A;  2Q2H A;  3PFI A;  1KDC A;  4L5T A;  2F0Q A;  2AKW B;  3Q6S A;  4K6L A;  4MHE A;  1PFB A;  3A55 A;  3Q8D A;  4A3K G;  1KD1 C;  5KRU A;  4XK8 F;  3KS4 A;  4KLN A;  3H6M A;  3SAV A;  4DPG A;  5E4X A;  2C35 B;  1G29 1;  4DK6 C;  4JI0 L;  4EQP A;  1L1O C;  2UUC L;  4QQB X;  2LVA A;  1IZ6 A;  1RJT A;  2XTI A;  5BN5 A;  1PTO F;  4A3J B;  3S15 H;  3NP8 A;  1OFH A;  2EKK A;  3R2I A;  4C3H B;  4JI3 M;  5ITY A;  2OPF A;  1Y8N B;  3MHB A;  1ILP A;  4R71 A;  3MC0 B;  1V1P A;  2DAE A;  1BF4 A;  1H9M A;  4LF7 M;  3S1R B;  4GEW A;  2B8G A;  2KUM A;  1KRT A;  5FKA C;  1EWH A;  2H5X A;  4UPA A;  4A3D H;  4JV5 Q;  3J7A F;  4X62 L;  1GL6 A;  3L26 A;  1VQL A;  3TZU A;  1B50 A;  1I94 Q;  2E2J H;  2K47 A;  4XIG S;  3KOZ E;  2NQ8 C;  3MWY W;  2N78 A;  5D14 A;  2EOT A;  3QR8 A;  1ICW A;  3WDN A;  1I94 M;  2LH0 A;  2AHO B;  2IL8 A;  4IOA A;  1F2Y A;  1R9T B;  2C9O A;  2LXK A;  1EWI A;  1I4G A;  3HGI A;  3FTC A;  3U60 B;  5IWA M;  1ENC A;  1MIU A;  1YNJ C;  5DNY A;  1VF5 C;  2JN4 A;  3K8A A;  4AYB G;  4V19 0;  3I4M G;  1SDF A;  1WJJ A;  1HT1 E;  3EQL C;  1CM9 A;  4GOP B;  3A98 B;  5JI3 E;  3U4Z A;  4Y7N B;  4DAY B;  4QOS A;  2JA5 B;  1QQW A;  4HCE A;  1N78 A;  3NBH B;  1IYU A;  4DV5 Q;  1P3Q Q;  4IUQ A;  3K9P A;  4RNA A;  2MQH A;  3HFZ B;  3OSO A;  3TRE A;  1EQT A;  4JPB W;  5JJZ A;  1IL8 A;  1JOK A;  2OT2 A;  4JI1 M;  4O42 A;  2F0J A;  1XMQ M;  1U4M A;  1JB3 A;  4X65 Q;  2R0I A;  1P16 A;  4R4I A;  1VQO A;  3K57 A;  5EKI A;  4DUZ M;  1IM2 A;  5I4D A;  2E2H H;  2KNZ A;  5E3F A;  3PF5 A;  3RLN A;  1Q39 A;  1QVR A;  2FFK B;  4WFN 3;  4MM3 B;  2JXN A;  2JP7 A;  1B70 B;  2WSE F;  5IOC A;  1H9R A;  3CCS A;  2XLJ A;  4E6I A;  4IJE A;  3SAU A;  2IPK D;  2XH9 A;  2Q8R E;  4DR6 M;  3TEH B;  4LFA L;  1BBU A;  2CHB D;  4N9P A;  1TT2 A;  5FTK A;  5NUC A;  3Q8X A;  3GTP B;  1IN7 A;  4B3S M;  4TQU S;  1PRT D;  2VW9 A;  2VQE L;  4A3G G;  4GH9 A;  2HHH M;  2F0W A;  1T3T A;  2DJG C;  1EY7 A;  4GHA A;  1HH2 P;  2WIN B;  4RKL A;  4XT1 B;  4CJ1 B;  4IPG A;  1VQ4 A;  4JV5 L;  1TF0 B;  1CA5 A;  4NMZ A;  1X56 A;  4JOI A;  3B7N A;  4TVA B;  1KLU D;  1JE4 A;  1ET6 A;  1MD2 D;  3I70 A;  2F3V A;  2J7Z A;  3D4W A;  2DJF C;  5BPV A;  2UXB L;  1TWA H;  1MX0 A;  1W6K A;  3N52 A;  2PMZ B;  4HID A;  1EZ6 A;  1K83 B;  3ERO A;  2YNM D;  4JI2 L;  1EY4 A;  1S40 A;  1WTX A;  3D3R A;  4MTN A;  4POF A;  3FUT A;  1F2Z A;  4JI7 L;  4PDG A;  2O5R A;  4DR7 L;  1K28 A;  3P20 A;  4BBS B;  2HWJ A;  1TS3 A;  3KOY E;  2L7H A;  4UN2 B;  2ICE C;  4GZY C;  4ZAI A;  3K92 A;  1IYJ B;  3HRZ C;  3Q23 A;  2E5L M;  2IX1 A;  1UEB A;  3T1Y M;  1RTO A;  3KDS E;  4R4C A;  1VMP A;  2EYF A;  5ELF A;  2CH4 W;  4QOZ C;  3HGB A;  4B7G A;  3UE0 A;  4YHH L;  4C3J B;  2F4V M;  3VYS A;  2IX3 A;  2QEN A;  4DV1 L;  1KC8 C;  2HIV A;  3CCM A;  1PHJ A;  3A74 A;  4FDB A;  3X3M A;  2EXD A;  3HJ8 A;  4PT5 A;  4BY7 H;  5DLQ E;  1WCM B;  4RH6 A;  4K2K A;  1UE7 A;  1IBK M;  1A8V A;  2A19 A;  5A2Q L;  3M6A A;  3FPU B;  1TWA B;  3UDX A;  3FP9 A;  3PO3 B;  3HKZ B;  4A3K H;  2QEJ C;  5CYU A;  5EXX A;  4IUP A;  1SE3 A;  1CUK A;  1RU3 A;  1JJ2 A;  4NKL A;  2R61 A;  4OX9 M;  3L29 A;  1RTN A;  3R3O A;  4UAI A;  1I6H H;  4GRI A;  2R93 B;  2Y0S E;  1Q90 A;  1FJG Q;  1LT3 D;  2QCP X;  2PNR C;  4CDC C;  3HOW G;  2K5H A;  4K8I A;  4F8M A;  2L11 A;  2CWA A;  2ZJR A;  1CHQ D;  1SBB B;  2H4O A;  5C4X G;  4AZF A;  1B8A A;  1SNC A;  1PJT A;  1AH9 A;  3BS1 A;  2F0T A;  1J9O A;  3LQQ A;  2ALY B;  3SK6 A;  1TH2 A;  5IGB A;  1DO0 A;  2RKO A;  3HHW A;  3LWU A;  4B3T L;  1L2C A;  2LS0 1;  5FTJ A;  4IJF A;  1S4Z A;  3NPP A;  1CTM A;  5IP9 G;  4YY3 M;  1N36 Q;  2O5I C;  4LFB Q;  3D31 A;  1V9P A;  1OKS A;  1QAN A;  1BO0 A;  2JA9 A;  1C9O A;  2F0K A;  3H3V I;  1J6Q A;  3GV3 A;  3AFQ A;  1AFP A;  3HZJ A;  4ID6 A;  4H02 A;  2XNA C;  1LTG D;  2ZAM A;  1HUN A;  1Q3B A;  1KFV A;  3LMM A;  3K7A B;  4DV3 M;  1T43 A;  2L4N A;  3ND9 A;  3U6D A;  2RSO A;  3GTJ H;  1EU4 A;  5E26 A;  3KF8 A;  3KOX E;  4A75 A;  2K5V A;  2XWJ B;  4Y7N H;  3CP0 A;  2PZW A;  3JAM L;  2NB0 A;  4QGU A;  1B1Z A;  1DCZ A;  5C4H A;  3MHV C;  2NZO A;  3TME A;  3U5Z B;  3K5L A;  4IUV A;  4ZQ3 A;  1YEZ A;  1EY5 A;  2XWB B;  4FD2 A;  5EGT A;  2F4V Q;  3OTO Q;  1BDO A;  3QO2 A;  1Q82 C;  4A3E B;  1TWF H;  1CZG A;  2F5O A;  4GKK M;  1SXJ A;  4FXG C;  3J27 B;  3UGJ A;  2AMC B;  1VDL A;  5E6J A;  4OU7 A;  5EP3 A;  4AI6 A;  4DUY M;  2DAK A;  3BG3 A;  2JJQ A;  2Q8T A;  1BBW A;  1TDH A;  3K81 C;  1OO9 B;  4BY1 B;  1HQC A;  1XXH B;  3CC2 A;  1YIJ A;  3I2Z A;  4DR5 M;  3J7Z C;  2GN5 A;  1X54 A;  4FF3 A;  4DBG B;  2B2V C;  5LL6 X;  3F1Z A;  1ZKO A;  4IPH A;  5BR8 M;  4FYD A;  4JI6 L;  5HGQ A;  1SRO A;  1LTT D;  2EXZ A;  2EY2 A;  1JR3 D;  1N33 L;  1OTR A;  3AB9 A;  1JJG A;  1LT4 D;  4ZK9 B;  3J80 L;  4R8I A;  4OO1 I;  4GNX B;  2VF8 A;  4LNQ A;  2ENB A;  1QCB D;  3KBX A;  4DV5 L;  1OAI A;  4LFC L;  3UZU A;  3U6E A;  4RHR A;  1QYR A;  2UUB M;  2PW7 A;  4XBO A;  2RDG A;  5EBC A;  3E9S A;  4QUF A;  2FMC A;  2CQA A;  5JAV A;  1RF2 D;  1SXT A;  2XFT A;  5IYC H;  4JI5 Q;  1PRT F;  4OHJ A;  2Y20 A;  3BXW A;  1NJI C;  4NXM Q;  3S14 B;  4CDF C;  3C9P A;  3KOJ A;  3GDE A;  4DU9 A;  2KOL A;  3CCR A;  4HJ9 A;  1OIZ A;  3MMP A;  5BR8 L;  1DGF A;  3RZD H;  1JT8 A;  2LVO C;  1YE9 A;  3HG9 A;  5M3M H;  5ISR A;  2RGH A;  2KEN A;  2JA6 G;  1C7Y A;  1EOV A;  3JR4 A;  3BJU A;  2F0P A;  4G4N A;  5DYI A;  5CV6 A;  4OX9 Q;  2Z9H A;  1Q46 A;  2FXQ A;  4C56 C;  1LAC A;  1AE2 A;  4AYB E;  1GVN A;  2A69 C;  3CPF A;  2EPB A;  1A0I A;  5FSW A;  2XZU A;  1JQJ C;  1ET9 A;  1X32 A;  4DV3 Q;  1WD1 A;  5F3W A;  4JYA Q;  3OW2 A;  3VA7 A;  1L1T A;  1WTV A;  2J7O A;  2QHO B;  1K3B C;  1MJG M;  3E9I A;  5LHY 1;  3CMA A;  4LF8 Q;  3ERS X;  1ZV1 A;  2EYO A;  4F2L A;  1F4I A;  3GPX A;  4DUZ Q;  3M4P A;  2DAM A;  1L0X B;  4A3I G;  1WVL A;  4OWT B;  3S16 H;  3T1H Q;  1LTR D;  2F03 A;  2K7V A;  2Z6B A;  1IBM L;  4A3L G;  5C3E G;  1FVI A;  3I7F A;  3SAR A;  4HED A;  2NVX H;  1DM0 B;  1AUA A;  5CMD A;  1IBL M;  4OL7 A;  2K28 A;  1K8A C;  3B7Z A;  2KA7 A;  3NBH A;  4BBA A;  5D3D A;  1SYF A;  2E2J B;  1EZ8 A;  4H0L C;  4OVZ A;  5FJ8 H;  4FCT A;  3KFU G;  2UXD L;  2OQK A;  4LGM A;  1C8C A;  4S12 A;  1XNQ M;  2RSN A;  4MGH A;  1WTH A;  2EY6 A;  3NHH A;  2NTT A;  3H91 A;  1GVP A;  3SMP A;  2E75 C;  4JXJ A;  1L0Y B;  1D6E C;  3I56 A;  3FTD A;  3U6P A;  4LFB M;  3I8Z A;  4EGV A;  1HQR D;  4DV1 Q;  1JQY D;  4OO1 G;  1VF7 A;  2X69 A;  1I4Q A;  4DV2 Q;  4GLV B;  1N77 A;  2F3W A;  4L15 A;  4LGY A;  1QZE A;  3GLI B;  1XPU A;  1YHB A;  2HD3 A;  2WAQ G;  2ZXR A;  2IJ0 A;  3CPW A;  2CHV A;  1S72 A;  4HJ7 A;  1ZMU A;  1U9R A;  1MSG A;  3CCE A;  4GIP A;  3DM1 A;  2JE6 I;  2A73 B;  4QNM A;  5CBA E;  1NMF A;  2JUJ A;  1CI3 M;  3E3X A;  3HHX A;  2WB1 E;  4ZPX A;  2Z1C A;  5M5Y B;  2XF3 A;  3HS0 C;  3KLR A;  2LWX A;  4C3I H;  4R4T A;  2DAI A;  3S17 B;  4X66 L;  2KEE A;  3AEV A;  1PTO H;  3NTI A;  3M7N A;  4OX9 L;  4O1N A;  3B74 A;  4K8J A;  3TP8 A;  1XNQ L;  1KAB A;  2B3T A;  2F0L A;  4GOP C;  2UXD M;  2MO0 A;  3C46 A;  3PIO A;  2R62 A;  3MXN A;  3IKJ A;  1JR3 E;  3B89 A;  4DK3 C;  1IBL L;  4A3I B;  3AFP A;  4C3H G;  1W5S A;  2OOA A;  4WJW A;  4NXN L;  4A3J G;  4HTH A;  5IT9 E;  1SNM A;  3NBI A;  1Z6T A;  1E1O A;  1JR3 A;  2IT1 A;  2Z4H A;  3W1G A;  4JYA M;  3F2U A;  3FUU A;  1LT6 D;  3SVM A;  3H3V C;  4CGY B;  4KKT A;  3T1Y L;  4APV A;  3S14 H;  3CRL C;  2BDO A;  1HR0 L;  5FTN A;  3T15 A;  3NWS A;  2O2L D;  3PO2 B;  2L4F A;  2EUC A;  3G71 A;  4A93 H;  2K32 A;  4YCV A;  3CCQ A;  2XGT A;  2Z3X A;  2MGW A;  1KRS A;  3OTO L;  1K73 C;  1R5L A;  3RE8 A;  5AJ3 L;  5C0X J;  4NXN M;  3TWL A;  4DK1 A;  1SSO A;  4RGT A;  3JAM i;  3ZYY X;  1SYD A;  4K5W A;  1UE5 A;  4A3D G;  4A4I A;  1U0L A;  3K80 C;  1JR0 D;  3NTH A;  3ICE A;  5FLX S;  1NHW C;  2KZU A;  2GVA A;  1XXG A;  3RUZ A;  2ES2 A;  2JA6 B;  1I6H B;  2C9C A;  1EFU B;  1PH3 A;  3PIO 3;  3HKZ E;  1C0A A;  4DAV A;  2UUB L;  2QF7 A;  2QGQ A;  4KN7 C;  4IZ8 A;  2VQE M;  1STG A;  1N8R C;  1E0B A;  1VDD A;  5FO8 B;  1SAP A;  2NN6 G;  2AUK A;  3GP1 A;  2JY6 B;  5EXP A;  2YU9 H;  4LF5 M;  2R46 A;  2JWS A;  4QB4 A;  5ITQ A;  1LV7 A;  1WD0 A;  2JA8 H;  2EY1 A;  3R8B A;  2B2U A;  2D5D A;  1KDB A;  3OTO M;  3H15 A;  5IP7 H;  3WWV A;  1PJJ A;  5E7N A;  4KOD A;  4DR5 Q;  1SXJ D;  1HFN A;  2WP8 J;  5EQT A;  3EVQ A;  2I7N A;  4LRT A;  3GRU A;  4DR6 Q;  1H95 A;  2AQ3 B;  2HUG A;  4JI1 L;  1YHA A;  1K8O A;  4JOI C;  4K0K M;  2BDN A;  4KMU C;  2DAG A;  3GRY A;  1JWU D;  3SEB A;  4DUY L;  3OIQ A;  4L6T B;  1LAB A;  1D2N A;  1EU3 A;  1ONL A;  4Q0F A;  1HRJ A;  1STH A;  1DO2 A;  2J7N A;  5KQD A;  3SHL A;  3FUW A;  1XC8 A;  1BXT A;  1E7Z A;  3FTF A;  2LVN C;  2LFN A;  4OIJ A;  2JA6 H;  4GKK L;  2A68 C;  3U6M A;  4A3M B;  2CH4 A;  1CA6 A;  1CSP A;  4F1I A;  1R6B X;  2MJ8 A;  2LSS A;  4KHV A;  3KS8 A;  3A8I E;  4JI5 L;  3EIV A;  2DNE A;  2X6L A;  5IIF A;  2RCF A;  1GKI A;  1GUT A;  4LF9 L;  4JI5 M;  4F7X A;  3GLG A;  3BDC A;  4PMB A;  4L5S A;  3M3Y B;  5A2Q S;  1A3U A;  3D6C A;  4LUV A;  3A8J E;  1EYC A;  4FF4 A;  1SN8 A;  3TSS A;  1C4Q A;  3PIP 3;  3GLF B;  3KBG A;  1GKH A;  4IO9 A;  3SK5 A;  1GUS A;  3DWQ A;  1JWS D;  5ITT A;  3V76 A;  2JZ1 A;  1I5F A;  2R44 A;  5DAU A;  1Q1E A;  4Z6Y A;  5ITX E;  1GUO A;  4LF7 L;  2EKF A;  2R6F A;  1Y8G A;  1UE6 A;  1VQA A;  2BA1 A;  2KA6 B;  2YR0 A;  2WV6 D;  4I4L A;  3AOE A;  2LKV A;  4QIW E;  4CJ2 C;  1F9P A;  3K5M A;  1SRU A;  2TMP A;  1E24 A;  5IT9 L;  3BOS A;  3PUW A;  3ZJY C;  3P7J A;  1PM5 A;  1I4H A;  2DUD A;  1SEB D;  1YUB A;  1ZQ9 A;  1Q02 A;  5C3E B;  1NVM A;  2D7H A;  1IW7 D;  3GTM H;  3HOW B;  3PQI A;  5KYL A;  2VF7 A;  2DZL A;  3CME A;  4R7G A;  2EYP A;  2I7P A;  4W5W A;  3VDP A;  2GVB A;  2K50 A;  2QKI C;  4LUZ A;  1FD7 D;  4OIK A;  4AH6 A;  4A93 B;  3LWE A;  4HJ5 A;  3LX0 A;  2K6A A;  1LLR D;  4LF5 L;  4KK7 A;  2M2L A;  2LHC A;  1IBM Q;  3GO8 A;  2HDM A;  1K0R A;  4QUC A;  3A8K E;  2NYZ D;  1M90 C;  1I4R A;  3SBJ A;  1N34 L;  1YJN A;  2DWZ B;  2WKD A;  1B4O A;  1ZXT A;  5M3F H;  3HX3 A;  3HOV B;  4MGK E;  3M0E A;  4N8F A;  2JNH A;  3CQZ H;  2E2D C;  4JI8 Q;  4IUN A;  2JXM B;  1QZH A;  4FXD A;  4G3O A;  2GQF A;  4IBK A;  1UFZ A;  4IUU A;  2EQS A;  2CW0 D;  3RZO B;  4LF4 M;  4DR2 L;  1IL2 A;  4DV2 L;  1V43 A;  1YZ6 A;  1SE4 A;  3I73 A;  2A68 D;  1K3W A;  4MGZ E;  4I5S A;  3PV0 A;  1UWV A;  2J4X A;  1AP0 A;  1S5B D;  3I4Y A;  4B3R Q;  1HR0 M;  1VQD A;  4K0K L;  3OYY A;  3J2P B;  1DYQ A;  3QIA A;  1LT5 D;  1EIG A;  4IAL A;  5F2D A;  3SDZ A;  3L2P A;  2VQF Q;  1EQR A;  3U9S A;  3UE1 A;  4HAE A;  4DR2 M;  4LF4 L;  1WTQ A;  3GTK B;  1HT2 E;  4NXN Q;  3CCJ A;  1CKO A;  1HJP A;  2WAQ E;  3PUZ A;  3DA1 A;  3AQQ A;  1M1K C;  4BXX G;  1XXH A;  5JEA J;  3FDT A;  5K5P A;  3AMU A;  1N32 L;  4C2M H;  1QVC A;  2DGY A;  4GLA C;  1PJQ A;  4CJ0 B;  3PNY A;  3LVV A;  4A93 G;  2OCE A;  3UK6 A;  2F5N A;  3KUP A;  1K8M A;  4JI2 Q;  2QDL A;  2HL7 A;  3LW5 F;  2RKS A;  1JMC A;  4XQN A;  3RZO H;  2L12 A;  3FVQ A;  3J80 i;  1KNA A;  1ZEQ X;  1DGG A;  2O25 A;  4DV5 M;  4DR1 L;  2KHJ A;  3HOX G;  2I5M X;  1IHZ A;  3BYY B;  3CQZ B;  1VS0 A;  2KJX A;  5HY6 A;  4HEO A;  2EIF A;  4YY3 L;  1PYW D;  4EIW A;  4NDX A;  1PFS A;  1J5E Q;  2DVW B;  5IRE B;  3SHF A;  1N34 Q;  1HZC A;  1JOR A;  3GQ3 A;  5C3X A;  2YQZ A;  4QHT A;  4II7 A;  3QJY A;  1PH2 A;  1GUW A;  4X3S A;  2BJV A;  4QMG A;  1BOS A;  3C58 A;  5IGF A;  3SAS A;  4DA2 A;  4DXF A;  1RL2 A;  2OO9 A;  4NC6 A;  3URY A;  3JR5 A;  4JW0 A;  2SDF A;  2HIX A;  4M1U B;  1UUP A;  4KLK A;  1TII D;  3U6Q A;  3QYE A;  5C4J B;  4JYA L;  2HQE A;  4U68 A;  3P75 A;  1XWE A;  5KIX A;  4G7H C;  4RG1 A;  4IQZ A;  1K9M C;  3J80 S;  1XX8 A;  2RVL A;  2EYJ A;  3SC3 A;  5ELE A;  5JOB A;  4IFD G;  3S2H B;  2LNH C;  1QVG A;  5IWA L;  5FJ8 G;  2J5Y A;  2QCU A;  1PJI A;  4LF9 M;  3TQY A;  4C2M B;  3S1R H;  5DFL A;  2QW7 A;  2MNA A;  1CZW A;  2B3G A;  5T1I A;  2HKJ A;  1I94 L;  3I4N G;  2XEP A;  1EIH A;  1R4Q B;  1QUQ A;  1IBM M;  1TR8 A;  4BY1 H;  4HLQ A;  3TPZ A;  1OXT A;  1PRT B;  2OQ4 A;  5C1B A;  4BLC A;  1WGN A;  4PG3 A;  3M4Q A;  2VY3 A;  5EKK A;  3B7Q A;  4LY6 A;  4X66 M;  2ZXO A;  3A42 A;  3HKZ G;  4PMC A;  2DY7 A;  1TH3 A;  3FRH A;  4GIT A;  3JAM c;  2SNM A;  3V96 A;  1QAQ A;  3MXN B;  4OON A;  5EPL A;  4BA2 I;  1T5X D;  3SYL A;  2R93 G;  3W5O A;  1CT1 D;  2G9D A;  1S3S A;  1XYI A;  2VS1 A;  1BCP B;  5IOD A;  3KK7 A;  3FKI G;  4NB3 A;  4OWW B;  3U5Z A;  3OW7 A;  5A35 A;  3ERQ A;  3TRZ A;  3FKE A;  2K5W A;  3DLL A;  2QDB A;  1H9J A;  5BN4 A;  4G4Q A;  2K5Q A;  5M3F G;  1XTD A;  4QL5 A;  2QA4 A;  1E3P A;  4BWG B;  1Q86 C;  1IFY A;  3H94 A;  3I3C A;  4F87 A;  3VR5 A;  4KV6 A;  1PZJ D;  3CCV A;  1JB7 A;  4LFC M;  3H0G H;  2B63 G;  4CIZ A;  5JVG 3;  2I5L X;  3VK8 A;  3OIP A;  1CFM A;  4LUO A;  5FLM G;  1N32 M;  4KTA A;  1D5X C;  3CU7 A;  1IY2 A;  2RBM A;  2JYO A;  1N33 M;  1WTW A;  4H44 C;  2IX0 A;  4Y52 H;  2ZTD A;  2J0T D;  4FP5 D;  3DHQ A;  5DNF A;  3CCU A;  2KQ3 A;  4RFB A;  2JY8 A;  3I4N B;  3I90 A;  2ASB A;  1CHP D;  4UDU C;  4P17 A;  2MPM A;  3PMF A;  2N88 A;  5I2Y A;  4M9S A;  2F0E A;  3E9H A;  2PNH A;  3DEP A;  1YVC A;  1AN8 A;  2E5L L;  1QB5 D;  4OWX B;  2XSZ A;  2K33 A;  1H9S A;  1B3Q A;  3KF6 B;  1QJO A;  2PCF B;  4BXX H;  5JEA G;  3TQS A;  3GLH B;  1T5E A;  1W6J A;  2ERC A;  4JI7 M;  5KGU A;  1MI2 A;  3CRK C;  2R4E A;  4KHZ A;  1E22 A;  4HMI A;  1I50 B;  1KL9 A;  3IHP A;  1K3R A;  3BVZ A;  4ZKC B;  2VUM H;  4PZ6 A;  1HXY D;  5BR8 Q;  3VK7 A;  3TZD A;  3NBX X;  3CF2 A;  1PA6 A;  1ZMV A;  5DM6 3;  1JCK B;  4QY7 A;  4ZYS A;  3LNN A;  2R92 G;  1HQY E;  3NEL A;  5CV5 A;  4UP9 A;  3G4S A;  3HOU G;  2FH0 A;  1N34 M;  5I9O A;  1CSQ A;  3KLS A;  8CAT A;  3UMM A;  2F0N A;  3NEM A;  4DV3 L;  4A3M H;  5KPR A;  2O5J C;  4A3F G;  4WJ3 M;  3QAU A;  4AW4 A;  1LV9 A;  4K2L A;  5EP2 A;  1SYB A;  4WOR A;  1GM5 A;  5M5W H;  4M9X A;  3GLF E;  2FHT A;  3F2B A;  2G5D A;  5C18 A;  1B44 D;  3BDO A;  2DWM A;  1V33 A;  1DV0 A;  4C3J G;  1VEK A;  1G4A E;  5G3L F;  4J15 A;  1TWG B;  4R3D A;  2M5Z A;  2MP1 A;  4A3D B;  2JQO A;  3GQB A;  4O0A A;  5J3B A;  1R2Z A;  1HTL D;  1S5C D;  2Y0T A;  4MB7 A;  4IOC A;  4DR5 L;  1YIT A;  1MBY A;  1XMQ L;  5C44 H;  4A3B G;  1QNK A;  1RDP D;  4A3G H;  2K5N A;  1OXV A;  4A3E H;  2P5T A;  2RDH A;  2C5C A;  3R2T A;  5CV7 A;  3KLS X;  4Q5V A;  4LFB L;  1G6P A;  2C5R A;  3T16 A;  2NN6 I;  2UXC M;  2WB1 B;  4X6A H;  1EYA A;  3C1F A;  3ZCB B;  2RHS B;  2Z7J A;  1N32 Q;  1A62 A;  1PYB A;  4HJ8 A;  3CKI B;  2XSC A;  2CFO A;  2CE7 A;  2B2V A;  3VR6 A;  4B3M M;  4TKO B;  3CGW A;  2NBF A;  3CF5 A;  1M4V A;  3L27 A;  3MTS A;  1UM8 A;  4IPD A;  2MH8 A;  1IBK L;  1O78 A;  1GAB A;  1GJS A;  1I4P A;  5DM7 3;  1GL7 A;  1MJC A;  5FLX E;  1KYI A;  2RA4 A;  4X3U A;  3HOZ G;  5ITX A;  4WUR A;  1O7L A;  3VFD A;  4LRS A;  1STY A;  3TP5 A;  4L8R C;  1TR5 A;  4YWL A;  4GKJ Q;  1KLG D;  2C99 A;  4IJL A;  5JVH 3;  1STA A;  2F4V L;  1JJC B;  1I4X A;  2IWH A;  1GOZ A;  1KAW A;  1TWC B;  1VQJ A;  4LJ6 A;  4X62 M;  1NY4 A;  1FL0 A;  4B9W A;  2QZ4 A;  4X65 L;  3WOE A;  1QWY A;  3N6R A;  2PMZ E;  3I4N H;  2CV0 A;  2WFW A;  3E0E A;  4BBR B;  4AKI A;  3EFX D;  4HSP A;  4X3T A;  3U6C A;  2O4X A;  2PZT A;  4JI3 L;  4FXK C;  3W2D A;  3GLH E;  1G6Z A;  2E8G A;  3TP7 A;  1DOL A;  3B9P A;  4RWS C;  3VKH A;  2F0U A;  3X3N A;  3J81 c;  1SMY D;  1EWC A;  3HU3 A;  2Z6K C;  3UDI A;  4DNR B;  4QF4 A;  1QVF A;  5H37 D;  4LMQ D;  4HMJ A;  3GTG B;  5D65 A;  3W3A A;  4B3S Q;  3K9O A;  4C1N K;  1TWH B;  3A46 A;  4RCN A;  2Q2U A;  3GTO B;  4A3B B;  3I4M B;  2BNK A;  3PVS A;  5CC4 A;  1GLN A;  3Q24 A;  3GO5 A;  4ZUI A;  4NXM M;  1SG9 A;  5ELD A;  2A6H D;  1X3P A;  5IYB G;  1SYG A;  4RGM A;  1KTK A;  3CXC A;  4H13 C;  4JI7 Q;  4B3M Q;  4G7O C;  1MGS A;  4LF6 Q;  2KXE A;  2FMM A;  2EJG C;  3HWS A;  5T1G A;  4DV6 Q;  4JI4 Q;  1D8L A;  4ZCK A;  4BA1 I;  1V8Q A;  4DNI A;  1PGY A;  2DWL A;  3KW6 A;  3S17 H;  1VQ5 A;  4F88 A;  3J7A 5;  1LTB D;  2XN9 C;  1HR0 Q;  1VQN A;  4LF6 M;  3PO2 G;  1G71 A;  1HR0 W;  1XNR M;  3DUZ A;  5I9P A;  1XHB A;  4DR4 M;  2M60 A;  1L2B A;  2N8N A;  3SGI A;  3SAT A;  3WHK A;  4HSV A;  5JEA H;  5LMU Q;  4TSS A;  1PH4 A;  2G8L A;  2XRQ D;  4JCV E;  4DR2 Q;  4HIK A;  5COR A;  3J7B A;  1VQI A;  4YWM A;  1G41 A;  2NVY H;  3HJS A;  1QDT A;  4L78 A;  1TXY A;  3DWP A;  3MFG A;  4P2C B;  3D8G A;  4CDE C;  4GN4 B;  5BN3 A;  1PH1 A;  5GAE C;  4ZLT F;  4A3F B;  1ESR A;  2JA7 G;  3GD7 A;  1TS5 A;  5J39 A;  2EYH A;  3UDG A;  2E74 C;  4B7F A;  2DN8 A;  2QSF X;  5EXS A;  4NP5 A;  3MXP A;  4A3G B;  3HOX B;  4LF8 M;  2FJ2 A;  4WW0 A;  5IY0 A;  2ZJQ A;  3CD6 A;  1OXU A;  5C6A A;  4JBM A;  2DI0 A;  5C5M A;  1PH5 A;  4ME3 A;  3J81 S;  3T13 A;  1F9S A;  2WII B;  1GUN A;  4RAU C;  5IGD A;  3KSX A;  3VYU A;  3S2H H;  3M85 A;  1EY6 A;  3F8T A;  2YYZ A;  1RHP A;  2UUB Q;  1VQE A;  3I4M H;  2NZH A;  4JV5 M;  1LTA D;  5KO3 A;  1XTC D;  3JC6 6;  1UEA B;  4IIW A;  4KY7 A;  2FIN B;  3HKS A;  1FNN A;  1HUM A;  2PI2 E;  3TN2 A;  2R7Z G;  5IZ7 D;  2UXC Q;  2HHH L;  3A7L A;  3F2D A;  3PGZ A;  3S16 B;  1PTO C;  1FJG L;  4DGZ A;  2EA0 A;  2L1B A;  4K14 A;  5G3L D;  5M3F B;  1HTP A;  4Y28 F;  4K5V A;  4DR6 L;  4I7A A;  1QAM A;  5EXT A;  2ZTC A;  2UUA M;  4KKU A;  3SFZ A;  3DWA A;  2B39 A;  2Q8I B;  3I4L A;  1G59 A;  3FRI A;  2D62 A;  4YWK A;  3J7A S;  4HIM A;  1Y69 U;  1SR3 A;  3DEO A;  4B3T M;  4AQY L;  5JJL A;  4YY3 Q;  4AG6 A;  4A3M G;  3HOV G;  1Z59 A;  4JI4 M;  1VQP A;  2D0P A;  5IYD G;  2MFI A;  5EKL A;  3GLF A;  4I65 A;  1GJT A;  4RGO S;  1L0W A;  5GAG C;  5FOB B;  1K8G A;  4DUY Q;  3RLO A;  2KCM A;  1V1O A;  1BQQ T;  3BDL A;  1I6V C;  2V1C A;  4YIJ A;  2F0O A;  1ML0 D;  2D9U A;  1IN8 A;  1X55 A;  2DNC A;  5JPM C;  4LF9 Q;  4P71 A;  3CW2 C;  2F0I A;  1DOM A;  2HT1 A;  3GTG H;  4L5R C;  3P1H A;  7CAT A;  4EQ5 A;  3S9W A;  4I7Z C;  1VQM A;  5IE8 A;  5KYI A;  3MXG A;  4LF7 Q;  1ROD A;  3GPU A;  5TSS A;  3C3D A;  3ZQJ A;  2V6Z M;  1Q3C A;  1EIY B;  2KNA A;  3HU1 A;  1WJ7 A;  2R65 A;  3MVV A;  1L1Z A;  1TGU A;  3KXE C;  5HGT A;  2JY5 A;  2L6O A;  1XNQ Q;  1K3X A;  2MGS A;  4KY6 A;  5LMU M;  1NAP A;  2ATW A;  4ZRZ A;  1SFO H;  1PTO D;  2HDL A;  2B8F A;  3C3L A;  2TSS A;  1LTI D;  3G6J B;  4PMW A;  1SXJ B;  4MIU A;  3U58 A;  2NVT B;  4DV1 M;  1G91 A;  2WSF F;  2R92 B;  4YHH M;  1QZG A;  5IWA Q;  1AE3 A;  2AWN A;  4D80 A;  5H1S E;  1QAO A;  1FNW A;  1NNU C;  3I51 A;  3WOF A;  4B3R M;  1J8I A;  2WB1 G;  2XFS A;  2CQO A;  1PV4 A;  3SR1 A;  3A56 A;  3QYB A;  1RD9 D;  5I6Y A;  1CQF A;  1G3I A;  3K5N A;  2F0H A;  3HZX A;  5EQ0 A;  3STB C;  1XMO Q;  2B63 B;  4DR7 M;  3MA2 B;  4GMQ A;  3U61 A;  1LYL A;  3MXU A;  2BE5 C;  4AQY Q;  4P72 A;  1BCP F;  1TKW B;  2UUC M;  2KNV A;  2CRU A;  5EPJ A;  5C0X I;  4XDX A;  4JI0 M;  4L16 A;  4LCB A;  1Z47 A;  5IYB H;  1WFQ A;  4ANR A;  3LGJ A;  1NE3 A;  1Z6H A;  2F0M A;  2EYL A;  3O13 A;  2JEB I;  5EP1 A;  4OGQ C;  2JA2 A;  4CJ6 A;  2N55 A;  2VB3 X;  4K0K Q;  3BU2 A;  1CKN A;  4OXP A;  4A3V B;  1SMY C;  3ITP A;  3PSI A;  5K36 G;  1GO5 A;  5FLX L;  3UJN A;  3J81 j;  2R7D A;  5FLM H;  3VR2 A;  3TWM A;  1HCZ A;  1EYD A;  3W0F A;  2PZU A;  3UDF A;  1F77 A;  3U50 C;  3HOW H;  2KBN A;  3GTM B;  1DGH B;  1GHK A;  1Q8K A;  1A5T A;  5M5W B;  2L5T A;  2YFQ A;  3PUX A;  3I55 A;  4JI3 Q;  4KD3 A;  4JI6 M;  2RQX A;  4B08 A;  3V05 A;  4LG2 A;  1SND A;  3J81 L;  1TTE A;  4YCW A;  2Y0S B;  3GLG E;  2CVR A;  5IGC A;  3MAQ A;  2AWO A;  2D7G A;  5AFW A;  4DUZ L;  3T51 B;  1AEX A;  4BBR H;  1GUG A;  1EIJ A;  1HZA A;  1DD2 A;  2IHF A;  2PW5 A;  4DV0 Q;  1TS2 A;  3MK6 A;  1J5E M;  2KW0 A;  1VQG A;  2DHR A;  4ILW A;  2KCN A;  1F2M A;  1PZK D;  2RDF A;  2R93 H;  3VR3 A;  3U9O A;  2E76 C;  1PRB A;  2A6E D;  3HY5 A;  4G4O A;  1FGB D;  4LAA A;  2FE8 A;  3SYK A;  1NY6 A;  1CQV A;  5LMN M;  4EQO A;  3FKI H;  1B3A A;  3A5Z B;  5C4X H;  3EIE A;  4TUW A;  2ZT9 C;  1I3Q H;  2OEO A;  1PFN A;  1D7Q A;  3CTW B;  1ICF B;  4OEL B;  3HOU H;  1H6U A;  4JI8 M;  1DZ1 A;  3I4O A;  2LXJ A;  4L8J A;  3AFH A;  4B7H A;  3H4M A;  5IT9 S;  1VMC A;  4DXG A;  1VQK A;  3KFU A;  3JAM S;  4GS3 A;  4DR1 Q;  3D8B A;  3S24 A;  3KSJ A;  2M9V A;  2EJM A;  3QOL A;  3G7L A;  5GAD C;  2PO4 A;  1T9H A;  1E94 E;  1HNW Q;  2LMC B;  2A74 C;  1Z5B A;  2W82 A;  2MRO B;  2K03 A;  4KN4 C;  1STN A;  1OJL A;  2WZJ A;  4Z9C B;  1CK1 A;  4DV4 Q;  2NTS A;  4G4K A;  1G2S A;  3ULP A;  1PDQ A;  1FR3 A;  2K04 A;  3TBI B;  1JOO A;  2GA4 B;  5DYG A;  5ELB A;  3U4V A;  1V34 A;  3K7U C;  1G8Z D;  4UY8 C;  2X4A A;  2OTL A;  3SE0 A;  3A0J A;  4REZ A;  3GP7 A;  2L7I A;  4M8A A;  1A63 A;  1Y8O B;  3EBE A;  3E0J A;  3J80 c;  4OVZ B;  3BYT B;  1NV9 A;  2VII A;  1WI5 A;  5E1F A;  3RNU A;  4JI6 Q;  3GRR A;  2DWN A;  1U5K A;  3HOY B;  3D0F A;  3FYC A;  5C3W A;  3B6Y A;  2PQE A;  2NVT H;  1BVS A;  4X3K A;  4RF1 A;  3T1H M;  1LTS D;  4XGI A;  1WXQ A;  3AV0 A;  1SNQ A;  1TVX A;  2P5Z X;  3LVW A;  1S3O A;  3D6W A;  1HPC A;  3BVM A;  3F2C A;  3J81 E;  2F0F A;  2M00 A;  1UE1 A;  4PV1 C;  3ZH9 B;  3MJ5 A;  2G3Q A;  3T1Y Q;  1SMX A;  4B9X A;  3GTQ B;  4J1M A;  1WYD A;  1W5T A;  3I4V A;  3U6L A;  1D1K A;  4HIO A;  1VG5 A;  2Z4S A;  1HNZ Q;  1YNN C;  3TS0 A;  2EE1 A;  4DAY A;  1BUV T;  2PYK A;  1JIC A;  5IT9 c;  5L8R F;  3S1M H;  3I04 M;  3HEJ A;  2R18 A;  2K05 A;  1JWM D;  5D3I B;  2Z8Y M;  3K0Y A;  4JI0 Q;  2D7E A;  1VEJ A;  1Z5C A;  5EBD A;  4DV4 M;  3W0L B;  2BOS A;  2I0Q A;  2EY5 A;  3FE3 A;  3E5S A;  4J6H A;  4GNX C;  3SHG B;  4XTC S;  4AIM A;  2IW3 A;  5ELN A;  4FNF A;  1R2Y A;  2XIW A;  5KEE A;  2D2C C;  4H7B A;  5I6W A;  4A3I H;  2F5Q A;  1EFI D;  4JBK A;  2VQF M;  3OMG A;  2KVM A;  4X62 Q;  4A3L H;  3RMH A;  1YJ9 A;  1X3G A;  1ZAE A;  4JI2 M;  4ODG A;  2DZN B;  1A6X A;  3H4J A;  2UXB M;  1XPR A;  4GKJ M;  4NRV A;  1VQB A;  2ZTE A;  3CAM A;  4LWC A;  1WTP A;  2KZS A;  3RZD B;  3S1Q H;  1YNX A; 
#chains in the Genus database with same CATH homology
 1HNW M;  4FF2 A;  2FFJ A;  2R45 A;  4LJ8 A;  3T38 A;  3S1M B;  1AW7 A;  3KP0 E;  1LO5 D;  3GV6 A;  1NJF A;  5EJC A;  4LFA M;  3VKG A;  1SNP A;  1S5F D;  5ITU A;  4LJ9 A;  1YNN D;  3OPO A;  3GPP A;  1IYV A;  4D82 A;  3GLI A;  2L9H A;  1NJG A;  2KED A;  3QB3 A;  1PXU A;  3RLF A;  2L09 A;  4AKH A;  2ZAN A;  3DMU A;  4J8Q A;  1RCV D;  5ITR A;  4ULL A;  3VA5 A;  4IBI A;  2B2T C;  3VYT A;  2QBY B;  2Z4I A;  1QOH A;  4QIW B;  2B2W C;  1Y1W B;  3GRV A;  2JP1 A;  1Z7T A;  2R3Z A;  3S2D B;  5EP4 A;  5KNB A;  1E2W A;  3D8L A;  1MSH A;  1EY0 A;  4OO1 H;  1UAP A;  3L3O C;  1XMO M;  4NL4 H;  2H1R A;  5ELC A;  1SYE A;  3THG A;  2B2T A;  3GQ5 A;  4JBW A;  1EE8 A;  1S5D D;  3PUV A;  2NVQ B;  1Y8P B;  3K2L A;  3K1J A;  3SMS A;  5IGE A;  3QG1 A;  1Q1B A;  4G57 A;  3DOA A;  2HCI A;  2JA8 B;  1STE A;  5JPN C;  4LK1 C;  2UU9 M;  1QG7 A;  4BS9 A;  3NXW A;  3U6O A;  1RKN A;  3A54 A;  5KPZ A;  1M8A A;  3IFD A;  2NN6 H;  5IGG A;  1Z5A A;  1IN5 A;  2CEA A;  2A5Y B;  4NSO B;  5E4W C;  4XXE A;  3TP6 A;  3NWT A;  4G7Z C;  4IFD I;  1EEF D;  2QIL A;  3WHL A;  2Q2E B;  4EVO A;  3NQT A;  5CGK A;  4MGI E;  4RGN A;  1AZP A;  3L28 A;  4DAP A;  3K5O A;  2BCO A;  4GC5 A;  3RGP A;  3A45 A;  4GC9 A;  4IUT A;  3NE5 B;  2EZV A;  4EQN A;  3L25 A;  4HL4 A;  1BCP D;  2JEA I;  5KQ8 A;  2RGO A;  1N36 M;  1B53 A;  1IY1 A;  3U61 B;  4HN7 A;  4KJO A;  2A69 D;  4IN3 A;  2ID0 A;  4CKC A;  4WRD A;  5GKN A;  3K58 A;  1NNJ A;  4Z8X A;  1L2D A;  1R4P B;  1F2L A;  4XT3 B;  3K59 A;  1D5M C;  3JAM E;  4FF1 A;  2VNU D;  4NW2 A;  2CHG A;  2CUZ A;  4XYQ A;  1MU5 A;  4RKB A;  4JN6 A;  1BR9 A;  2F5P A;  1PTO B;  1BBX C;  4PCZ A;  3H0G B;  4C3I B;  2E2I B;  1VDZ A;  4RCO A;  2XSZ D;  3FYD A;  3M4O B;  3RD4 A;  1HNX M;  3DXJ C;  5C0X G;  3HP3 A;  1QNU A;  1TY0 A;  2K01 A;  2G9H D;  4PQX A;  3TL4 X;  4CIS A;  3GTJ B;  3HOZ B;  2MHV A;  3NQI A;  4RHS A;  1N75 A;  3I72 A;  2CHQ A;  3L7Z C;  1ZYR C;  1C48 A;  2K5D A;  3I91 A;  4C1N I;  2X49 A;  1X37 A;  2PPB C;  1NCV A;  1STB A;  1FJG M;  4LJA A;  2ZXP A;  5J1Z A;  4IUR A;  4DV6 M;  2VUM B;  4LJ5 A;  3FD9 A;  4M9Z A;  3R93 A;  4TRD A;  1J09 A;  4P16 A;  1K82 A;  3A7A B;  2C98 A;  2Y0Q A;  1EEI D;  4K5X A;  1BNZ A;  1XWI A;  3CF6 E;  3SK8 A;  2H1E A;  2XRS D;  3C1E A;  3K8Z A;  5C4Z A;  1IW7 C;  2E2H B;  2L55 A;  2QPA A;  4CBV A;  2SNS A;  4I81 A;  4IBG A;  3CHB D;  4L63 B;  5KND A;  2KRK A;  3M7G A;  1NY5 A;  5M5X B;  3SAW A;  1QE6 A;  2NUC A;  1D1I A;  4XYO A;  4FWG A;  3FUX A;  2VB2 X;  4RF0 A;  3PNV A;  2AQ2 B;  2HCC A;  2AHM A;  4RA8 A;  5LL6 S;  4LJ7 A;  1Q12 A;  5C5L A;  5A2Q E;  1EY9 A;  1TQO A;  4AG5 A;  1SXJ E;  4IBJ A;  3NK9 A;  1ORY B;  1ENF A;  1FNV A;  1O7Z A;  1DOK A;  3V2T A;  4ME5 A;  2JSO A;  4NOO B;  3PUY A;  4DK0 A;  3NTK A;  4C3I G;  2CW0 C;  2F5S A;  2DY8 A;  2QP9 X;  3Q22 A;  3VLF B;  4MH0 E;  3L9A X;  2OF1 A;  3D4R A;  4KY5 A;  1WTR A;  1HNZ M;  3FRP B;  3UI2 A;  3E6Z X;  4U67 3;  4ZUJ A;  2EO2 A;  1Q3L A;  3HJQ A;  2ZBK B;  2NZ1 D;  3S15 B;  3S1N B;  2K1B A;  2YU9 B;  1TDZ A;  2ZAO A;  1GJX A;  5FO7 B;  1SJH D;  1SXJ C;  4S3S A;  4LJZ C;  4D81 A;  4MGY E;  1Y1V B;  3IFT A;  1NHG C;  5DEH A;  1GHJ A;  4GHL A;  3FEW X;  1OXS C;  2XGN A;  5CBE E;  1DXM A;  1NUC A;  2F0G A;  3QOJ A;  1E32 A;  1L8Q A;  3GPY A;  1O80 A;  4IBE A;  5M3M B;  3H09 A;  1WTO A;  1DGH A;  3VDU A;  2Z4R A;  3FMC A;  5C0X H;  2EYM A;  1PFM A;  3QWL A;  1OFI A;  4AKG A;  1SYC A;  1OXX K;  3M4Y A;  1NSN S;  5I2X A;  2SEB D;  1VCI A;  4XQJ A;  2KRU A;  3Q0A A;  2B2U C;  4R8N A;  1BCP C;  1IY0 A;  3R8F A;  3OMC A;  2CV1 A;  3TDQ A;  4LZJ A;  3DZD A;  2V4D A;  3IAY A;  4DV0 M;  4FCV A;  5JI2 E;  1X3Q A;  3R9X B;  4KHP M;  4CKE A;  1PRT C;  1J7K A;  3OWF A;  1DJR D;  4KKS A;  4NSR A;  1SNO A;  4HCS A;  2WAC A;  4PNY A;  4IBB A;  4DFA A;  1SJE D;  4FVM A;  2MUY A;  1H9S B;  5FO9 B;  1EOT A;  1IXR C;  3HHY A;  4X64 M;  3ILK A;  4IFD H;  3BZD B;  1ESF A;  1NR2 A;  3AOE C;  2F4I A;  4PD2 A;  3U6S A;  1HHV A;  3FTE A;  1UNS A;  3TWK A;  1E9S A;  5CV4 A;  3AOG A;  2HCB A;  1QIL A;  2F0D A;  3HU2 A;  2I46 A;  3DFZ A;  1GXD C;  1H9K A;  2A6E C;  3HHZ A;  4ITQ A;  1B9M A;  2R6G A;  4ABN A;  1B2T A;  1II3 A;  1JOQ A;  1A3T A;  2KCC A;  3U60 A;  1G2T A;  3K6O A;  3KVW A;  5CV9 A;  3VR4 A;  4M0W A;  4KI0 A;  2AQ1 B;  1ZYR D;  3FPP A;  1E9R A;  3CF0 A;  1SE2 A;  4FWH A;  1E2Z A;  4I8O A;  2Y21 A;  3KOW E;  2XZF A;  4XQQ A;  1IN4 A;  1HFG A;  1PMR A;  1V1P B;  2F1M A;  3GLH A;  2XVS A;  3T4A C;  2X8A A;  3FUV A;  2G5G X;  2NVX B;  3D4D A;  1U4P A;  3MEH A;  1C1K A;  3S1Q B;  3QWN A;  4V0B A;  1TWF B;  1IQP A;  3GQ4 A;  3LQR A;  4OW0 A;  4KD4 A;  2KEB A;  2LXE A;  1E2V A;  2B2Y C;  4DV7 M;  2F0S A;  5KNC A;  2CV2 A;  3MZ5 A;  5FTM A;  4ZKB B;  1TU2 B;  3L2A A;  3ONA B;  4LZZ A;  4AYB B;  1AZQ A;  3HOU B;  3RGS A;  1FNU A;  2BE5 D;  1B9N A;  2B2Y A;  3KP1 E;  2V1U A;  2A6H C;  3EIH A;  4G6Z A;  2L0C A;  3C2P A;  1DON A;  3OWE B;  4BY7 B;  4KO8 A;  4X65 M;  5CR3 A;  5J22 A;  1YNJ D;  5EJW A;  4BB9 A;  3J80 E;  2R4J A;  3J7Y W;  4QHS A;  4CHT B;  1F9R A;  1QZM A;  1ENA A;  3SK4 A;  4R9W A;  3VYR A;  4N9T A;  3T56 B;  4LJ4 A;  4DR3 M;  1ILQ A;  2JA7 B;  3HKP A;  2I07 B;  5CV8 A;  3SXH A;  2VXW A;  5C44 B;  1TS4 A;  2WKC A;  1EY8 A;  4NRW A;  2FNA A;  4PDI A;  3GTL B;  3OOC A;  5FK9 C;  4CKB A;  3PXG A;  2BJW A;  4IBF A;  1R7R A;  1IN6 A;  1TY2 A;  4L4U A;  1JC7 A;  4QNR A;  4FWD A;  3AU7 A;  4FO2 A;  4DNT B;  3GLG B;  3IG8 A;  3IG5 A;  1HA5 A;  1U4L A;  2BA0 A;  3IL8 A;  4DN4 M;  3MFY A;  3NWL A;  4KJN A;  1IKL A;  3NUC A;  4FCW A;  2KHS A;  3T53 B;  2FOI C;  1SFO B;  1EQV A;  3AJI B;  1O7Y A;  1TH4 A;  4AQY M;  2NVY B;  1HQM C;  4DF7 A;  5KPT A;  1IXZ A;  2EJF C;  4DR1 M;  3RFW A;  1KAA A;  3EJI A;  2A5H A;  1NSF A;  1F9Q A;  4IFD J;  1A15 A;  1EL0 A;  1I3Q B;  2SOB A;  1D2B A;  1HA6 A;  1KNE A;  5C4X B;  2LY7 A;  2NWG A;  3FKI B;  4JK1 C;  2ICI A;  2DXI A;  4HR7 B;  3E4R A;  5COY A;  2C96 A;  4M0D A;  3ZC7 B;  1U4R A;  3ND8 A;  3OHX C;  1PZI D;  4G4R A;  3TE6 A;  4QCL A;  1A2U A;  1G8P A;  1D5Z C;  5K36 H;  2EVB A;  1YSY A;  3EA6 A;  5FTL A;  1A2T A;  4K6D A;  3NSW A;  1KDA A;  2AUJ D;  2OXP A;  4IBC A;  1Q8I A;  2F0V A;  4DV2 M;  4A3K B;  5HUR A;  1I4W A;  1A3V A;  2WAQ B;  1IXS B;  2B2W A;  1S5E D;  1IKM A;  3BVG A;  2ZM6 M;  1DGB A;  2EDG A;  1PLF A;  3AKZ A;  4MN3 A;  3AL0 C;  1NR4 A;  2Z8L A;  4FW9 A;  3J7A V;  1KSF X;  1FYC A;  2QBY A;  5EPK A;  4IBD A;  2DZO B;  2X6G A;  5M9O A;  2KEC A;  3PFI A;  1KDC A;  2F0Q A;  3Q6S A;  4K6L A;  4MHE A;  1PFB A;  3A55 A;  5KRU A;  3KS4 A;  4KLN A;  3H6M A;  3SAV A;  5E4X A;  1G29 1;  4EQP A;  1RJT A;  5BN5 A;  1PTO F;  4A3J B;  3NP8 A;  1OFH A;  3R2I A;  4C3H B;  4JI3 M;  5ITY A;  2OPF A;  1Y8N B;  3MHB A;  1ILP A;  3MC0 B;  1V1P A;  1BF4 A;  1H9M A;  4LF7 M;  3S1R B;  2B8G A;  2KUM A;  5FKA C;  1EWH A;  3J7A F;  1GL6 A;  3L26 A;  3TZU A;  1B50 A;  2K47 A;  4XIG S;  3KOZ E;  2NQ8 C;  3MWY W;  5D14 A;  2EOT A;  1ICW A;  3WDN A;  1I94 M;  2LH0 A;  2IL8 A;  1F2Y A;  1R9T B;  2C9O A;  1I4G A;  3HGI A;  3FTC A;  3U60 B;  5IWA M;  1ENC A;  1YNJ C;  4V19 0;  5DNY A;  1VF5 C;  1SDF A;  1HT1 E;  3EQL C;  1CM9 A;  3A98 B;  5JI3 E;  4Y7N B;  4QOS A;  2JA5 B;  1QQW A;  4HCE A;  1N78 A;  1IYU A;  4IUQ A;  4RNA A;  5JJZ A;  3OSO A;  1EQT A;  1IL8 A;  1JOK A;  2OT2 A;  4JI1 M;  4O42 A;  2F0J A;  1XMQ M;  1U4M A;  1JB3 A;  3K57 A;  5EKI A;  4DUZ M;  1IM2 A;  5I4D A;  5E3F A;  1Q39 A;  1QVR A;  2FFK B;  4WFN 3;  4MM3 B;  5IOC A;  1H9R A;  2XLJ A;  4E6I A;  4IJE A;  3SAU A;  2IPK D;  2XH9 A;  2Q8R E;  4DR6 M;  2CHB D;  4N9P A;  1TT2 A;  5FTK A;  5NUC A;  3Q8X A;  3GTP B;  1IN7 A;  4B3S M;  4TQU S;  1PRT D;  4GH9 A;  2HHH M;  2F0W A;  1T3T A;  1EY7 A;  4GHA A;  2WIN B;  4CJ1 B;  4RKL A;  4XT1 B;  1CA5 A;  4NMZ A;  1KLU D;  1JE4 A;  1ET6 A;  1MD2 D;  3I70 A;  2F3V A;  2J7Z A;  3D4W A;  5BPV A;  1MX0 A;  1W6K A;  3N52 A;  2PMZ B;  1EZ6 A;  1K83 B;  3ERO A;  2YNM D;  1EY4 A;  1WTX A;  3D3R A;  3FUT A;  1F2Z A;  4PDG A;  2O5R A;  4BBS B;  3P20 A;  1TS3 A;  3KOY E;  2L7H A;  2ICE C;  4GZY C;  4ZAI A;  3K92 A;  3HRZ C;  3Q23 A;  2E5L M;  2IX1 A;  3T1Y M;  1RTO A;  3KDS E;  1VMP A;  2EYF A;  5ELF A;  4QOZ C;  3HGB A;  4B7G A;  4C3J B;  2F4V M;  3VYS A;  2IX3 A;  2QEN A;  3X3M A;  3HJ8 A;  4PT5 A;  1WCM B;  4RH6 A;  4K2K A;  1IBK M;  5A2Q L;  3M6A A;  3FPU B;  1TWA B;  3PO3 B;  3HKZ B;  2QEJ C;  5CYU A;  5EXX A;  4IUP A;  1SE3 A;  4NKL A;  2R61 A;  4OX9 M;  3L29 A;  1RTN A;  3R3O A;  4UAI A;  4GRI A;  2R93 B;  1Q90 A;  1LT3 D;  2QCP X;  2PNR C;  4K8I A;  4F8M A;  2L11 A;  1CHQ D;  1SBB B;  2H4O A;  4AZF A;  1SNC A;  3BS1 A;  2F0T A;  1J9O A;  3LQQ A;  3SK6 A;  1TH2 A;  5IGB A;  1DO0 A;  2RKO A;  3HHW A;  3LWU A;  1L2C A;  2LS0 1;  5FTJ A;  4IJF A;  1S4Z A;  3NPP A;  1CTM A;  4YY3 M;  2O5I C;  3D31 A;  1QAN A;  1BO0 A;  2F0K A;  3GV3 A;  1AFP A;  4ID6 A;  2XNA C;  1LTG D;  2ZAM A;  1HUN A;  1Q3B A;  1KFV A;  3LMM A;  3K7A B;  4DV3 M;  2L4N A;  3ND9 A;  3U6D A;  2RSO A;  1EU4 A;  5E26 A;  3KF8 A;  3KOX E;  2XWJ B;  2PZW A;  3JAM L;  2NB0 A;  1B1Z A;  1DCZ A;  5C4H A;  3MHV C;  3TME A;  3U5Z B;  3K5L A;  4IUV A;  4ZQ3 A;  1EY5 A;  2XWB B;  4FD2 A;  5EGT A;  1BDO A;  3QO2 A;  4A3E B;  1CZG A;  2F5O A;  4GKK M;  1SXJ A;  4FXG C;  3J27 B;  3UGJ A;  5E6J A;  4OU7 A;  5EP3 A;  4AI6 A;  4DUY M;  3BG3 A;  2Q8T A;  1TDH A;  1OO9 B;  4BY1 B;  1HQC A;  1XXH B;  4DR5 M;  4FF3 A;  2B2V C;  5LL6 X;  1ZKO A;  5BR8 M;  4FYD A;  1LTT D;  2EXZ A;  2EY2 A;  1JR3 D;  3AB9 A;  1LT4 D;  4ZK9 B;  3J80 L;  4R8I A;  4OO1 I;  2ENB A;  1QCB D;  3KBX A;  3UZU A;  3U6E A;  4RHR A;  1QYR A;  2UUB M;  2PW7 A;  4XBO A;  2RDG A;  5EBC A;  3E9S A;  4QUF A;  2FMC A;  2CQA A;  5JAV A;  1RF2 D;  1SXT A;  2XFT A;  1PRT F;  4OHJ A;  2Y20 A;  3S14 B;  4DU9 A;  2KOL A;  1DGF A;  1YE9 A;  3HG9 A;  5ISR A;  2RGH A;  3JR4 A;  5CV6 A;  2F0P A;  4G4N A;  5DYI A;  4C56 C;  1LAC A;  1GVN A;  2A69 C;  2EPB A;  5FSW A;  2XZU A;  1JQJ C;  1ET9 A;  1X32 A;  1WD1 A;  5F3W A;  3VA7 A;  1L1T A;  1WTV A;  2J7O A;  5LHY 1;  2EYO A;  3GPX A;  1L0X B;  1WVL A;  1LTR D;  2F03 A;  2K7V A;  3SAR A;  4HED A;  1DM0 B;  5CMD A;  1IBL M;  4OL7 A;  2K28 A;  2KA7 A;  3NBH A;  4BBA A;  5D3D A;  1SYF A;  2E2J B;  1EZ8 A;  4H0L C;  4OVZ A;  4FCT A;  3KFU G;  4LGM A;  1C8C A;  4S12 A;  1XNQ M;  2RSN A;  4MGH A;  2EY6 A;  3NHH A;  2NTT A;  3H91 A;  3SMP A;  2E75 C;  4JXJ A;  1L0Y B;  1D6E C;  3FTD A;  3U6P A;  4LFB M;  3I8Z A;  4EGV A;  1HQR D;  4OO1 G;  1JQY D;  1VF7 A;  2X69 A;  1I4Q A;  1N77 A;  2F3W A;  4L15 A;  4LGY A;  3GLI B;  2ZXR A;  2IJ0 A;  2CHV A;  1U9R A;  1MSG A;  4GIP A;  3DM1 A;  2JE6 I;  2A73 B;  4QNM A;  5CBA E;  1CI3 M;  3HHX A;  4ZPX A;  2Z1C A;  5M5Y B;  2XF3 A;  3HS0 C;  3KLR A;  2LWX A;  3S17 B;  2KEE A;  1PTO H;  3NTI A;  3M7N A;  4O1N A;  4K8J A;  3TP8 A;  1KAB A;  2F0L A;  2UXD M;  3C46 A;  2R62 A;  3MXN A;  3IKJ A;  4A3I B;  4C3H G;  1W5S A;  4WJW A;  4HTH A;  5IT9 E;  1SNM A;  3NBI A;  1Z6T A;  1JR3 A;  2IT1 A;  2Z4H A;  4JYA M;  3F2U A;  3FUU A;  1LT6 D;  3SVM A;  3H3V C;  4CGY B;  4KKT A;  3CRL C;  2BDO A;  5FTN A;  3T15 A;  3NWS A;  2O2L D;  3PO2 B;  2EUC A;  2K32 A;  2Z3X A;  3RE8 A;  5C0X J;  4NXN M;  3TWL A;  4DK1 A;  1SSO A;  4RGT A;  3ZYY X;  1SYD A;  4K5W A;  1JR0 D;  3NTH A;  5FLX S;  1NHW C;  2KZU A;  1I6H B;  1XXG A;  3RUZ A;  2JA6 B;  2C9C A;  3PIO 3;  4DAV A;  2QF7 A;  4KN7 C;  4IZ8 A;  2VQE M;  1STG A;  1E0B A;  1VDD A;  5FO8 B;  1SAP A;  2NN6 G;  2AUK A;  3GP1 A;  5EXP A;  4LF5 M;  2R46 A;  4QB4 A;  5ITQ A;  1LV7 A;  1WD0 A;  2EY1 A;  3R8B A;  2B2U A;  2D5D A;  1KDB A;  3OTO M;  1PJJ A;  4KOD A;  1HFN A;  1SXJ D;  2WP8 J;  5EQT A;  3EVQ A;  2I7N A;  4LRT A;  3GRU A;  2AQ3 B;  2HUG A;  1K8O A;  4K0K M;  2BDN A;  4KMU C;  3GRY A;  1JWU D;  3SEB A;  3OIQ A;  4L6T B;  1LAB A;  1D2N A;  1EU3 A;  1ONL A;  4Q0F A;  1HRJ A;  1STH A;  1DO2 A;  2J7N A;  5KQD A;  3SHL A;  3FUW A;  1XC8 A;  1BXT A;  2LFN A;  3FTF A;  4OIJ A;  2A68 C;  3U6M A;  4A3M B;  1CA6 A;  1R6B X;  2MJ8 A;  4KHV A;  3KS8 A;  3A8I E;  2DNE A;  2X6L A;  5IIF A;  1GKI A;  1GUT A;  4JI5 M;  4F7X A;  3GLG A;  3BDC A;  4PMB A;  3M3Y B;  5A2Q S;  1A3U A;  3D6C A;  3A8J E;  1EYC A;  4FF4 A;  3TSS A;  1C4Q A;  3PIP 3;  3GLF B;  3KBG A;  3SK5 A;  1GUS A;  3DWQ A;  1JWS D;  5ITT A;  5DAU A;  1Q1E A;  4Z6Y A;  5ITX E;  1GUO A;  2BA1 A;  2WV6 D;  2KA6 B;  2YR0 A;  4I4L A;  3AOE A;  2LKV A;  4CJ2 C;  3K5M A;  1F9P A;  2TMP A;  5IT9 L;  3BOS A;  3PUW A;  3P7J A;  1PM5 A;  1I4H A;  1SEB D;  1YUB A;  1ZQ9 A;  5C3E B;  1NVM A;  2D7H A;  1IW7 D;  3HOW B;  5KYL A;  4R7G A;  2EYP A;  2I7P A;  4W5W A;  3VDP A;  4A93 B;  2QKI C;  4OIK A;  1FD7 D;  3LWE A;  3LX0 A;  2K6A A;  1LLR D;  4KK7 A;  2M2L A;  3GO8 A;  2HDM A;  4QUC A;  3A8K E;  2NYZ D;  1I4R A;  3SBJ A;  2DWZ B;  2WKD A;  1B4O A;  1ZXT A;  3HOV B;  4MGK E;  3M0E A;  2E2D C;  4IUN A;  2JXM B;  4FXD A;  4IBK A;  4IUU A;  2CW0 D;  3RZO B;  4LF4 M;  1V43 A;  1SE4 A;  3I73 A;  2A68 D;  1K3W A;  4MGZ E;  4I5S A;  3PV0 A;  1AP0 A;  2J4X A;  1S5B D;  3I4Y A;  1HR0 M;  3J2P B;  1DYQ A;  3QIA A;  1LT5 D;  1EIG A;  4IAL A;  5F2D A;  3SDZ A;  3U9S A;  4HAE A;  4DR2 M;  1WTQ A;  3GTK B;  1HT2 E;  3PUZ A;  3DA1 A;  1XXH A;  5JEA J;  3FDT A;  5K5P A;  3AMU A;  4CJ0 B;  3PNY A;  3LVV A;  3UK6 A;  2F5N A;  3KUP A;  1K8M A;  2HL7 A;  2RKS A;  4XQN A;  2L12 A;  3FVQ A;  1KNA A;  1ZEQ X;  1DGG A;  4DV5 M;  1IHZ A;  3BYY B;  3CQZ B;  2KJX A;  1PYW D;  4EIW A;  4NDX A;  2DVW B;  5IRE B;  3SHF A;  1JOR A;  3GQ3 A;  5C3X A;  2YQZ A;  4QHT A;  4II7 A;  3QJY A;  1GUW A;  4X3S A;  2BJV A;  4QMG A;  1BOS A;  3C58 A;  5IGF A;  3SAS A;  4DA2 A;  4DXF A;  3URY A;  3JR5 A;  2SDF A;  4M1U B;  1UUP A;  1TII D;  3U6Q A;  5C4J B;  2HQE A;  4U68 A;  3P75 A;  1XWE A;  5KIX A;  4G7H C;  4IQZ A;  3J80 S;  1XX8 A;  2RVL A;  2EYJ A;  3SC3 A;  5ELE A;  5JOB A;  4IFD G;  3S2H B;  2LNH C;  2QCU A;  1PJI A;  4LF9 M;  4C2M B;  1CZW A;  5T1I A;  2HKJ A;  2XEP A;  1EIH A;  1R4Q B;  1IBM M;  4HLQ A;  3TPZ A;  1OXT A;  1PRT B;  2OQ4 A;  5C1B A;  4BLC A;  5EKK A;  4LY6 A;  4X66 M;  2ZXO A;  3A42 A;  4PMC A;  2DY7 A;  1TH3 A;  4GIT A;  2SNM A;  3V96 A;  1QAQ A;  5EPL A;  4BA2 I;  1T5X D;  3SYL A;  1CT1 D;  2G9D A;  1S3S A;  1XYI A;  1BCP B;  5IOD A;  3KK7 A;  3U5Z A;  3OW7 A;  5A35 A;  3ERQ A;  3FKE A;  2K5W A;  2QDB A;  1H9J A;  5BN4 A;  4G4Q A;  2K5Q A;  4BWG B;  3H94 A;  3I3C A;  4F87 A;  3VR5 A;  4KV6 A;  1PZJ D;  4LFC M;  5JVG 3;  3VK8 A;  3OIP A;  1CFM A;  1N32 M;  4KTA A;  1D5X C;  3CU7 A;  2RBM A;  1IY2 A;  2JYO A;  1N33 M;  1WTW A;  4H44 C;  2IX0 A;  2J0T D;  4FP5 D;  3DHQ A;  5DNF A;  2KQ3 A;  4RFB A;  3I4N B;  3I90 A;  1CHP D;  4UDU C;  2MPM A;  3PMF A;  2N88 A;  5I2Y A;  4M9S A;  2F0E A;  3DEP A;  1AN8 A;  1QB5 D;  2XSZ A;  2K33 A;  1H9S A;  1QJO A;  2PCF B;  5JEA G;  3TQS A;  3GLH B;  1T5E A;  1W6J A;  2ERC A;  4JI7 M;  5KGU A;  1MI2 A;  3CRK C;  2R4E A;  4KHZ A;  4HMI A;  1I50 B;  3BVZ A;  4ZKC B;  1HXY D;  3VK7 A;  3TZD A;  3CF2 A;  5DM6 3;  1JCK B;  4ZYS A;  3LNN A;  1HQY E;  5CV5 A;  1N34 M;  5I9O A;  3KLS A;  8CAT A;  3UMM A;  2F0N A;  2O5J C;  5KPR A;  3QAU A;  4AW4 A;  1LV9 A;  4K2L A;  5EP2 A;  1SYB A;  4WOR A;  4M9X A;  2FHT A;  5C18 A;  1B44 D;  3BDO A;  2DWM A;  4C3J G;  1G4A E;  5G3L F;  1TWG B;  4R3D A;  2M5Z A;  2MP1 A;  4A3D B;  3GQB A;  1R2Z A;  1HTL D;  1S5C D;  2Y0T A;  4MB7 A;  2R7Z B;  1MBY A;  1QNK A;  1RDP D;  1OXV A;  2P5T A;  2RDH A;  2C5C A;  3R2T A;  5CV7 A;  3KLS X;  4Q5V A;  2C5R A;  3T16 A;  2NN6 I;  2UXC M;  2WB1 B;  1EYA A;  3C1F A;  3ZCB B;  2Z7J A;  3CKI B;  2XSC A;  2CFO A;  2CE7 A;  2B2V A;  3VR6 A;  4B3M M;  4TKO B;  2NBF A;  1M4V A;  3L27 A;  3MTS A;  1UM8 A;  1O78 A;  1I4P A;  5DM7 3;  1GL7 A;  5FLX E;  1KYI A;  2RA4 A;  4X3U A;  5ITX A;  4WUR A;  1O7L A;  3VFD A;  4LRS A;  1STY A;  3TP5 A;  4L8R C;  1TR5 A;  1KLG D;  2C99 A;  5JVH 3;  1STA A;  1I4X A;  2IWH A;  1GOZ A;  1TWC B;  4LJ6 A;  4X62 M;  4B9W A;  2QZ4 A;  3WOE A;  1QWY A;  3N6R A;  2CV0 A;  4BBR B;  4AKI A;  3EFX D;  4HSP A;  4X3T A;  3U6C A;  2O4X A;  2PZT A;  4FXK C;  3W2D A;  1G6Z A;  3TP7 A;  1DOL A;  3B9P A;  4RWS C;  3VKH A;  2F0U A;  3X3N A;  1SMY D;  1EWC A;  3HU3 A;  4DNR B;  4QF4 A;  5H37 D;  4LMQ D;  4HMJ A;  3GTG B;  5D65 A;  3W3A A;  4C1N K;  1TWH B;  3A46 A;  4RCN A;  3GTO B;  4A3B B;  3I4M B;  2BNK A;  3PVS A;  5CC4 A;  1GLN A;  3Q24 A;  3GO5 A;  4ZUI A;  4NXM M;  5ELD A;  2A6H D;  1X3P A;  1SYG A;  4RGM A;  1KTK A;  4G7O C;  4H13 C;  1MGS A;  2KXE A;  2FMM A;  2EJG C;  3HWS A;  5T1G A;  4BA1 I;  1V8Q A;  2DWL A;  3KW6 A;  4F88 A;  1LTB D;  2XN9 C;  4LF6 M;  1XNR M;  3DUZ A;  5I9P A;  1XHB A;  4DR4 M;  2M60 A;  1L2B A;  3SAT A;  3WHK A;  4HSV A;  5JEA H;  4TSS A;  2G8L A;  2XRQ D;  5COR A;  3J7B A;  1G41 A;  3HJS A;  4L78 A;  3DWP A;  3MFG A;  4P2C B;  3D8G A;  5BN3 A;  4ZLT F;  4A3F B;  1ESR A;  3GD7 A;  1TS5 A;  5J39 A;  2EYH A;  4A3G B;  2E74 C;  4B7F A;  2DN8 A;  5EXS A;  4NP5 A;  3MXP A;  3HOX B;  4LF8 M;  2FJ2 A;  4WW0 A;  1OXU A;  5C6A A;  5C5M A;  3J81 S;  3T13 A;  1F9S A;  2WII B;  1GUN A;  4RAU C;  5IGD A;  3KSX A;  3VYU A;  3M85 A;  1EY6 A;  2YYZ A;  1RHP A;  4JV5 M;  1LTA D;  5KO3 A;  1XTC D;  1UEA B;  4IIW A;  4KY7 A;  2FIN B;  1FNN A;  1HUM A;  3TN2 A;  5IZ7 D;  3A7L A;  3S16 B;  1PTO C;  4DGZ A;  2EA0 A;  2L1B A;  4K14 A;  5G3L D;  5M3F B;  1HTP A;  4K5V A;  1QAM A;  5EXT A;  2UUA M;  4KKU A;  3SFZ A;  3DWA A;  2B39 A;  2Q8I B;  3I4L A;  1G59 A;  2D62 A;  3J7A S;  1Y69 U;  3DEO A;  4B3T M;  4AG6 A;  1Z59 A;  4JI4 M;  5EKL A;  3GLF A;  4I65 A;  4RGO S;  5FOB B;  1V1O A;  1BQQ T;  3BDL A;  2V1C A;  1I6V C;  4YIJ A;  2F0O A;  1ML0 D;  2D9U A;  1IN8 A;  2DNC A;  5JPM C;  2F0I A;  1DOM A;  3P1H A;  7CAT A;  3S9W A;  4I7Z C;  5KYI A;  3MXG A;  1ROD A;  3GPU A;  5TSS A;  2V6Z M;  1Q3C A;  3HU1 A;  2R65 A;  3MVV A;  1L1Z A;  1TGU A;  3KXE C;  5HGT A;  2L6O A;  1K3X A;  2MGS A;  4KY6 A;  5LMU M;  1NAP A;  4ZRZ A;  1PTO D;  2HDL A;  2B8F A;  3C3L A;  2TSS A;  1LTI D;  3G6J B;  4PMW A;  1SXJ B;  4MIU A;  2NVT B;  4DV1 M;  1G91 A;  2R92 B;  4YHH M;  2AWN A;  4D80 A;  1QAO A;  1FNW A;  1NNU C;  3I51 A;  3WOF A;  4B3R M;  1J8I A;  2XFS A;  3SR1 A;  3A56 A;  1RD9 D;  5I6Y A;  1CQF A;  1G3I A;  3K5N A;  2F0H A;  3HZX A;  5EQ0 A;  2B63 B;  4DR7 M;  3MA2 B;  4GMQ A;  3U61 A;  3MXU A;  2BE5 C;  1BCP F;  1TKW B;  2UUC M;  5EPJ A;  5C0X I;  4XDX A;  4JI0 M;  4L16 A;  4LCB A;  1Z47 A;  1Z6H A;  2F0M A;  2EYL A;  3O13 A;  2JEB I;  5EP1 A;  4OGQ C;  2JA2 A;  2N55 A;  2VB3 X;  4A3V B;  1SMY C;  3ITP A;  5K36 G;  5FLX L;  3UJN A;  3VR2 A;  3TWM A;  1HCZ A;  1EYD A;  3W0F A;  2PZU A;  1F77 A;  3GTM B;  1DGH B;  1GHK A;  5M5W B;  2L5T A;  2YFQ A;  3PUX A;  4KD3 A;  4JI6 M;  2RQX A;  4B08 A;  3V05 A;  4LG2 A;  1SND A;  3J81 L;  2Y0S B;  2CVR A;  5IGC A;  3MAQ A;  2AWO A;  2D7G A;  5AFW A;  3T51 B;  1AEX A;  1GUG A;  1DD2 A;  2PW5 A;  1TS2 A;  3MK6 A;  1J5E M;  2KW0 A;  2DHR A;  4ILW A;  2KCN A;  1F2M A;  1PZK D;  2RDF A;  3VR3 A;  3U9O A;  2E76 C;  2A6E D;  4G4O A;  1FGB D;  4LAA A;  2FE8 A;  3SYK A;  1NY6 A;  1CQV A;  5LMN M;  4EQO A;  1B3A A;  3EIE A;  4TUW A;  2ZT9 C;  2OEO A;  1PFN A;  3CTW B;  1H6U A;  4JI8 M;  1DZ1 A;  4L8J A;  3AFH A;  4B7H A;  3H4M A;  5IT9 S;  1VMC A;  4DXG A;  3JAM S;  3D8B A;  3KSJ A;  2M9V A;  2EJM A;  3QOL A;  3G7L A;  2PO4 A;  1E94 E;  2LMC B;  2A74 C;  1Z5B A;  2W82 A;  2K03 A;  4KN4 C;  1STN A;  1OJL A;  4Z9C B;  1CK1 A;  2NTS A;  4G4K A;  1G2S A;  1PDQ A;  1FR3 A;  2K04 A;  3TBI B;  1JOO A;  2GA4 B;  5DYG A;  5ELB A;  1G8Z D;  2X4A A;  3SE0 A;  4REZ A;  3GP7 A;  2L7I A;  4M8A A;  1Y8O B;  3E0J A;  4OVZ B;  3BYT B;  2VII A;  5E1F A;  3GRR A;  2DWN A;  3HOY B;  3FYC A;  5C3W A;  2PQE A;  4X3K A;  4RF1 A;  3T1H M;  1LTS D;  4XGI A;  1WXQ A;  3AV0 A;  1SNQ A;  1TVX A;  3LVW A;  3D6W A;  1HPC A;  3BVM A;  3J81 E;  2F0F A;  2M00 A;  4PV1 C;  3ZH9 B;  3MJ5 A;  4B9X A;  3GTQ B;  4J1M A;  1W5T A;  3I4V A;  3U6L A;  1D1K A;  2Z4S A;  1YNN C;  2EE1 A;  4DAY A;  1BUV T;  2PYK A;  1JIC A;  3HEJ A;  2R18 A;  2K05 A;  1JWM D;  5D3I B;  3K0Y A;  2D7E A;  1Z5C A;  5EBD A;  4DV4 M;  3W0L B;  2BOS A;  2EY5 A;  3E5S A;  4J6H A;  3SHG B;  4XTC S;  2IW3 A;  4FNF A;  1R2Y A;  2XIW A;  5KEE A;  2D2C C;  4H7B A;  5I6W A;  2F5Q A;  1EFI D;  2VQF M;  3OMG A;  2KVM A;  3RMH A;  1ZAE A;  4JI2 M;  4ODG A;  2DZN B;  1A6X A;  2UXB M;  4GKJ M;  4NRV A;  1WTP A;  2KZS A;  3RZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...