4CHTB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex with bound calcium ion
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
215
structure length
215
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords DNA TOPOISOMERASE 3-ALPHA
total genus 55
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4chtB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4chtB02
4CGYB 3NBIA 4CHTB
chains in the Genus database with same CATH superfamily
1Y14B 4HJ5A 4DAPA 3HOWB 2DZLA 5IT9S 1CKNB 2MROB 4MGYE 2B8GA 4IO9A 4BA2I 1DOLA 4U673 1GUWA 3M4YA 5JI2E 4RHRA 4F8MA 1IY0A 3IAYA 2KNAA 1N34L 3AOEA 4G4QA 1BQQT 4A3VB 2VDBB 1G8ZD 3ND8A 5LMUL 2JWSA 2XZFA 2RDFA 4Y7NH 1I94M 4L5SA 1STAA 2O25A 4OHJA 2ZTEA 2F0HA 1MJGM 4A93H 3OWEB 3D8BA 4IFDG 4A75A 2ALYB 1VQ9A 1SG9A 5ELCA 4DV1Q 1IL8A 2EPBA 1FGBD 2HT1A 5E26A 3MEHA 4KHVA 3PXGA 3SASA 1S3OA 3K0YA 4GRIA 1TXYA 2A69C 4JV5L 2L15A 3I04M 2J7NA 1GJSA 1YHQA 4DV7L 2UXDM 3J81E 2M2LA 5ITYA 1K0SA 3VYUA 1HQYE 3DM3A 3RZOH 2ZXPA 2NVXB 2BA0A 2VXWA 4B7HA 1F2ZA 1SN8A 3EA6A 1GJXA 4LFCQ 4JI5M 4C3JH 1ICWA 1L8QA 2EA0A 5JI3E 1TF0B 1OKSA 2VZAA 4KY5A 4C1NI 3J81c 3TPZA 3W68A 5LMUQ 2OT2A 1KXLA 4DNTB 2B39A 4FDBA 1WTQA 3PCOB 2L4NA 1E1OA 1XC8A 3CMEA 2BE5C 2CKZB 5FTJA 3HGBA 5E7NA 4RHSA 5C0XJ 4CKBA 4IUVA 3CGWA 2KEEA 1IBLQ 1EU3A 3AOEC 3MAQA 2ZAMA 1VEJA 3GTLB 1N36M 3SE0A 3PO2H 4PZ7A 1FYCA 4J1MA 2L7IA 2NBFA 3FD9A 3TREA 4DR1L 4C3HH 2F0GA 2F0LA 2F03A 1VF7A 3A98B 3FYDA 1W2BA 4X6AH 4A3GH 3MXUA 3PO2B 5A2QE 3PF4A 3GTQB 1C1KA 4NRWA 4GMQA 3KFUG 4WJWA 4DR3L 3A5ZB 3S14B 4DR6M 1I4PA 4NC6A 2F3VA 2AUKA 3OOCA 1K3XA 3KUPA 3VK7A 4QB4A 2QBYB 2DZNB 2R65A 2F5NA 3G6JB 2GN5A 3DMUA 3UI2A 1ASZA 3BOSA 3J80E 2PZWA 2QEXA 3BDOA 1VDLA 1XPRA 3A8KE 1Y1WH 4I4LA 4KJNA 1T5EA 5J22A 1W6JA 2XZUA 5JVH3 3D8GA 2J4XA 1Y1VG 4WJ4A 5EP4A 5IZ7D 3EIEA 4XQJA 4A3LH 3GO5A 3CF6E 1L1TA 2EQSA 3DZDA 4DR2M 3HKSA 2EKFA 2LVAA 5DAUA 1ILQA 3B6YA 5C4JH 2CHBD 4DV2L 4KY7A 2RHQB 1DGHB 2ZM6L 1B3AA 4XK8F 1ENFA 2NTTA 3CRKC 3D0FA 4IPGA 4KK7A 2E5LL 5JJKA 3S2HB 5BN4A 3MXNA 4M9XA 1X56A 2DNEA 2R6FA 2YTYA 2JY7A 1R2ZA 2EVBA 4KY6A 1EY8A 4Z6YA 3R8FA 4KD3A 1B53A 1Q02A 4KT0F 1YZ6A 5CV4A 2OQ0A 1WCMG 3RUZA 1VQMA 2NN6I 3S1MH 3HOWG 3HOYH 4BBSH 1FJGM 3L29A 2KNZA 2BH2A 2A68C 4YHHL 4LNQA 4RGOS 3SARA 4F1IA 4X62L 3Q24A 3PO3G 2KHHA 1CQFA 3B7ZA 1WGLA 3T1YL 3LNNA 2CP8A 3HJSA 4IBDA 4IUPA 4DV5L 1WJJA 1L0WA 1PYBA 3GQBA 5CORA 5DYIA 1HUMA 1EY9A 4A3DB 2KA7A 4K2KA 3VYRA 1R4GA 3H0GH 2PMZB 1A8VA 4WURA 5C4XG 5KYLA 1A6XA 4NPSA 3GPYA 1VQJA 2JY8A 3J81S 1SXJE 5JEAG 2DJGC 3BG3A 5A2QL 1IBKQ 2GNOA 1OO9B 2F0IA 3CPFA 3H0GG 4AG6A 4RNAA 1V1OA 3GTGB 2JN4A 2JP1A 4JXJA 1UM8A 3LVWA 1N36L 4DA2A 4ZUIA 4EQNA 4L63B 2IL8A 4BY7B 1N33M 5JOBA 1IFYA 3I4YA 2A73B 3LMMA 1Q46A 5JAVA 1FJGL 3JAML 3EQLC 1R2YA 3TQYA 5C44G 3GLIB 4FF1A 2YV5A 3TP6A 3HOYG 4BBSG 4YCVA 1EIJA 2Y20A 3U6LA 5CYUA 1T9HA 5IIFA 1HNXL 3SAVA 3KOWE 4LG2A 4R4OA 1DONA 2Q8TA 3NHHA 1IN8A 2F0VA 1QNUA 1VQ5A 5K36H 1H9KA 1PJSA 3CCEA 1PYSB 1KC8C 1SE2A 1SRUA 4KN4C 4P73A 3CCJA 3BVMA 2WKDA 3TRZA 3SR1A 4KODA 5M5WB 1N36Q 2C98A 4ILWA 1DXMA 1SSOA 1HZCA 2IHFA 2X4AA 1K8GA 2F4IA 3S15H 2F5PA 3S17H 1EQTA 1ESFA 2XTIA 4IN3A 3J80i 2RF4A 2L09A 2TSSA 2YTXA 1CKNA 1RHPA 2F0DA 4OXPA 3A7AB 3I4MG 2NN6H 3OW7A 4JBJA 2DHRA 4HCSA 2XF3A 4JI4Q 3C1EA 1LUZA 4TUWA 4J6HA 3KLWA 2X6GA 1QZMA 3L25A 2F0QA 2K01A 2JA6G 4DV5M 3KJOA 1RDPD 4RKLA 2PO4A 2EJGC 2QDBA 1E9SA 3FUTA 5LMUM 4FCWA 2MGSA 1I50B 4QF4A 1VMPA 4IBGA 3ND9A 5I6YA 2UXDQ 3EIVA 4V190 2K28A 4GNXB 1GM5A 4A3GG 1XNRL 1JCKB 4DU9A 2JEAI 4XQNA 3IRBA 2B2UC 1AP0A 2BOSA 5CC4A 2XSZA 1HR0M 2PZTA 3GV3A 1YNND 5BR8M 1I3QB 3QG1A 5DM73 1MJCA 2J7ZA 4G4OA 1TWAB 4IJFA 1JJCB 2F3WA 1X3EA 1GD7A 2XFTA 1D0LA 1RU3A 4FWHA 1BBWA 1Y8PB 2QP9X 4QOZC 3SK8A 1N32L 1EYDA 2KA6B 2LY7A 5GAGC 1YLAA 3HU1A 2OOBA 4MGHA 4A3FG 4K0KL 1GUSA 1U5KA 1QB5D 4LUZA 1K9MC 1KAWA 1K83H 1QZEA 3KSXA 4DV0L 3CCMA 4JCVE 4FP5D 3LQQA 1XPUA 2G9HD 1KQSA 2PI2E 4XYOA 2R93B 1EFID 1RL2A 2LMCB 4IJEA 5FLXc 1SXTA 2MQHA 2FH0A 3U6DA 3BYYB 5J3BA 4JI7Q 3MZ5A 8CATA 4BY1B 1EE8A 1PZID 2CHVA 2RKOA 4K14A 5C4ZA 2DXIA 2HIXA 2MR9A 3GLFB 2LXKA 3UK6A 1E7ZA 3QOLA 3OTOQ 1GVNA 1H9MA 3S1RB 4N8X1 2I7PA 4A3KH 3LQRA 3KOXE 1LTTD 5I4DA 4OGQC 2IT1A 2JA8H 2E2HB 1V9PA 1WTWA 1EL0A 1Y1VB 3AFQA 1JR3D 2Z1CA 3SVMA 2QSFX 2E2IB 2R92G 1MIUA 4DR2Q 1GUTA 4BY7G 3GPPA 2OWOA 1CM9A 1D1IA 5FLMH 3KJPA 4KN7C 1FJGQ 1PFNA 5AFWA 5KPRA 4CHTB 4K2LA 2OF1A 1BR9A 1F9PA 1VQNA 1E3PA 2HHHQ 4L5RC 2APLA 4DAYB 5IT9c 4FW9A 3J81L 3HOUB 1Q1BA 1WTRA 1CZGA 5A2QS 1PRTF 1KDAA 4DV2Q 1HA6A 2UUCQ 3U4VA 5M5XH 4QUCA 5LHY1 2XSCA 4Y52H 2XH9A 3D4DA 4QJFA 1N33Q 4BA1I 5LMNW 3RE8A 1RIPA 3PUZA 2BJWA 1DO2A 3QWLA 3SK4A 4FF2A 2R7ZH 1PM5A 1W5SA 1MHWC 3KP0E 1WTHA 3Q0AA 4DUZQ 1SYFA 1D0MA 1N75A 3FDTA 4FVMA 2B2TA 2XIWA 5EKKA 2UUAL 3K9OA 3U6EA 3UE0A 2NQ8C 2J5YA 2TMPA 3E9SA 5KPTA 3X3MA 3M3YB 3NTIA 3T1YQ 4NB3A 1ENCA 2B2VC 2EY2A 4W5WA 2QCPX 3JAME 4NXMQ 3GV6A 1SBBB 3HJ8A 2CQOA 1NTGA 4DR6L 1Y69U 3BDLA 1EZ6A 1BF4A 1OXUA 1EYAA 1GO5A 4LF8L 3SYLA 2YYZA 4LF5L 3S15B 4B3SM 1I6HH 2RDHA 3IFDA 2RCFA 2WSCF 3HKPA 3TZUA 5HY6A 4A3EH 4MNOA 4LF9M 1XWIA 4IUQA 4M1UB 4PZ6A 2K47A 1XXHE 1D1KA 1SYDA 3CCRA 1PA6A 4QQBX 1ZKOA 3CTWB 5J39A 1VQBA 3J81i 1NUCA 3UZUA 2A6EC 1B9NA 4PCZA 4OX9Q 3IHPA 4LY6A 3TP7A 2VUMB 4JI3M 4FYDA 2VQFM 1O7ZA 1KHIA 2SNSA 4IPHA 3MVVA 3HHWA 4RAUC 2C5CA 2LSSA 2CV1A 2FFKB 3OPOA 3R9XB 1R7RA 3OSOA 2YTVA 1NHGC 2EYLA 2GA4B 5BR8Q 2MJ5B 1HZ9A 4NXNL 3FHWA 5IWAL 3F1ZA 1XPOA 3HGIA 2CV0A 2K03A 1I4WA 4N8FA 4G3OA 3GTMH 3KW6A 1ENAA 4G4KA 1U9RA 3E6ZX 3MXGA 3T6PA 5IGFA 3NBHB 5IT9L 5M5XB 3MWYW 4JYAL 2M00A 1G291 1X37A 3T1HL 4RWSC 4HJAA 1GKIA 2EUCA 1LTID 2K5VA 3GTMB 1HT1E 1J09A 3JR4A 4A3GB 3Q8XA 3R8BA 3L26A 3MTSA 2Q2IA 1AN8A 2JK8A 2SOBA 3GO8A 2KUMA 1SE3A 2NVTB 1KFVA 2DY8A 2Y0SG 4A93B 1HQMC 2QDLA 3PUYA 4CDCC 4LF7Q 4IBBA 2IJ0A 3FKIB 3P1HA 4NDXA 2VQEL 4IFDI 1SAPA 3VR2A 3UDGA 3OTOL 4BS9A 4BBAA 1OQYA 4R4CA 4H13C 3VA5A 5JVG3 1HNWQ 4DBGB 4YIJA 1XMOL 2L2DA 2E2HH 1TS2A 2PI2A 4CJ1B 2PNRC 1KD1C 2FINB 1FD7D 2LH0A 1L1ZA 2PQAB 3ULLA 2VY3A 4PQXA 4L8JA 2JA9A 5C4JB 1SNDA 2O01F 4C3JB 1VDDA 1IY1A 4OVZA 3HHZA 3D3RA 3FP9A 4MH0E 4C3HB 5C3EB 3U6PA 4OX9L 2NVXH 4K5XA 4DV3L 4GLXA 2JA8G 1C48A 4B7FA 2JNHA 2RCNA 2UXCL 2VF7A 3M7GA 1E2ZA 4JI6Q 1W5TA 4DR3Q 3WOEA 1C8CA 3I72A 1PTOD 1KNAA 2EY1A 4JV5M 1N78A 2XRSD 2VQEQ 4AG5A 4OX9M 4DR7M 2G5GX 2LBCA 4R71A 1HTPA 4KKSA 1HT2E 3H4JA 5C0XI 4DV2M 1JWUD 1K0RA 2Q8RE 2H5XA 1EOVA 3SHLA 4GS3A 4H44C 2OTLA 3K80C 1RJTA 4B3RL 1PRTD 4WORA 5IY0A 4DV6Q 1SE4A 4GKKM 4KO8A 4DK1A 1NAPA 5KNBA 1YI2A 3D8LA 1OTRA 5IYDH 3LWEA 3CQZB 3UDIA 1N9WA 1JR0D 4NKLA 4E6IA 3KOYE 1RTOA 5T1IA 2HHHM 1A15A 4YCUA 2C9OA 2AWOA 4ULLA 5JEAH 4BXXG 3GTQH 3B7NA 2DAMA 4EX5A 2D2CC 1MBYA 3T51B 3H3VI 1NE3A 1VQKA 4MGKE 2CVRA 3T1YM 3I56A 2EZVA 2Q2UA 3OHXC 1YJ9A 2B63B 4OIKA 3SXHA 3T13A 4B9XA 5F2DA 4YHHM 3GLGB 3TBIB 3S1RH 2C99A 3UDFA 2UU9Q 1I4HA 2VIIA 1V1QA 3R2TA 1VCIA 3IG8A 1E22A 3M4PA 5EBCA 5M3FG 2LFNA 2HHHL 4YY3Q 1G91A 3QYEA 1P16A 4B3TL 2A5HA 3HX3A 1XTCD 1BCPF 3PIOA 4BB9A 4G4RA 2K50A 2D7EA 1UUPA 3HOZG 4M8AA 3NTHA 2XGNA 5KEEA 1YHBA 1Q90A 1K73C 2IWHA 4LF6Q 5JJIA 4LGYA 4ANRA 1SJED 1YHAA 1S72A 1PFBA 5FK9C 1AH9A 3S16B 4O2DA 4OU7A 1SXJB 2J0TD 2NN6G 3ULJA 4JYAQ 2IW3A 4DV6M 4OO1G 2MO1A 3T1HQ 2WINB 1S5BD 5KYIA 1NY5A 2L0CA 4DUZL 1Z47A 4UP8A 2R7FA 2JA6B 1PV4A 1SXJA 1NNUC 3PSIA 2F1MA 2O5IC 1B8AA 1HNXM 1L0XB 4CKEA 3GQ5A 1QJOA 4O1NA 4IJHA 4NXNQ 2K7VA 2UXDL 1KTKA 2CE7A 1HTLD 3V2TA 1VQ6A 1Y1VH 5IGDA 4QIWB 1EFUB 3DFZA 3J7ZC 1Y8GA 1HH2P 5ELBA 1SXJC 2LVOC 4FXGC 4EQ5A 1K8MA 2VS1A 3E0EA 2E8GA 2G3QA 5FLXL 2F0PA 4OEMB 3LVVA 2B3GA 5ELEA 4DUYM 1DCZA 4KHPM 5C18A 2JA2A 1EY4A 3PQIA 3AFPA 5FTMA 4DV1L 3NP8A 3GLGA 1JQJC 1TWFB 4KHZA 3S1NB 4LFAL 1QUQA 3C3EA 3HOVH 4A3KG 1YNNC 2UUCL 3FUVA 2E76C 1JR3A 1E1TA 2QF7A 4RG1A 4IQZA 5IP7H 2K32A 4PZ8A 1L1OC 4NOOB 2UUAM 3PO2G 5JJLA 1TH3A 1XNRQ 3WHLA 4DV4L 3E3XA 2R7DA 1CTMA 2ZXRA 3CF2A 1AZPA 1QAOA 5I2YA 2VB2X 1QUSA 1GUNA 1GLNA 3EVQA 2DENA 3HOXH 4LF9Q 4HR7B 2DUDA 4OIJA 2LVNC 2JYOA 2ID0A 1PYWD 1X9NA 1E2VA 2E2DC 4A3IB 3I4NG 5GADC 4G7ZC 5ITUA 1KYIA 2KBNA 1D7QA 1HQRD 1UWVA 2E5LM 1MKHA 2OO9A 3PUXA 3GRVA 1V1PB 4A3MG 2PQEA 3S1QB 4A3CH 3TP5A 2J7OA 4KI0A 3E9IA 1XXHA 2O2LD 4N9PA 1C7YA 1TDHA 1QE6A 1GHKA 2FXQA 4XDXA 1JOOA 4ITQA 5CR3A 1SMYC 3TWMA 1PJQA 1DGHA 4A3CG 3GTOB 1ONLA 1NV8A 1PTOH 4EQPA 2MHVA 1V1PA 2HDLA 2JA7G 1O7LA 1JOKA 1X55A 2CQAA 3CC2A 3S24A 4IJLA 4JI3L 1WCMB 4IFDH 4AIMA 1CHQD 3IG5A 2MNAA 3K5LA 1G2SA 2ATWA 1F9RA 1IXSA 2B2UA 1QVRA 1TH2A 2VQEM 1ZV1A 5DNFA 1B7YB 1HNWL 5ITQA 3HOUG 2WB1E 2QBYA 1J7KA 5E4XA 2FMCA 1WCMH 1B2TA 3AFHA 2C35B 4ZYSA 3G6EA 4ME3A 4AI6A 4F7XA 4LFAM 2VB3X 4CIZA 5E4WC 3B74A 2RGHA 4QMGA 5BN3A 3NXWA 4ZCKA 4G7HC 1NJIC 2OEOA 3WWVA 5FJ8H 4MZ9A 4HSPA 1XMQQ 5C5LA 3I4LA 1BVSA 1B1ZA 1QVGA 4X64Q 3CD6A 4CBVA 4GNXA 1SLJA 1L2DA 2UXBL 2IY5B 1VQGA 4QHSA 3DWPA 2R93H 1STNA 4OW0A 3OWFA 1G41A 2I5HA 4LFBQ 1J9OA 3S17B 4JOIA 3M0EA 4KJOA 1IXRA 1NR2A 3PFIA 2KHIA 1XNQL 5G3LF 1LLRD 5H1SE 1J8IA 4R4QA 3AL0C 3S1MB 2KW0A 3E4RA 4A3BB 2EO2A 2ZT9C 2A5YB 3BYTB 2FNAA 1PH9A 1QOHA 1Y1WB 3VLFB 2RVLA 2CUZA 1Q8IA 1TWAH 1GXDC 2PW5A 4DGZA 2K5HA 4CJ2C 3NWSA 3HRZC 2NZHA 4A3DH 4RGTA 1HA5A 4KV6A 1NHWC 3GLHB 3ERSX 4Q5VA 4LJ5A 2LVPC 5FTLA 3H6MA 1P8LA 1JWMD 3S1NH 2EYPA 3BVGA 1QCBD 3CCSA 3HFZB 1E2WA 2CWBA 2Z4IA 1GKHA 3OYYA 3VR6A 2JY5A 2D5DA 2WP8J 2PCFB 1IHZA 4AYBB 1G2TA 3AB9A 3D31A 3NBXX 3MHBA 4RCOA 2Z6BA 3C3DA 3IKJA 4YWLA 1OFHA 1DM0B 3A46A 4ZKCB 3VFDA 3S2DH 1RODA 4DR6Q 1IQPA 5CV8A 2JEBI 1YBYA 4F87A 1ORYB 3I8ZA 1DGFA 4YY3L 3I7FA 4GOPB 3U60B 2V1UA 3VKHA 1CK1A 1S5CD 3L0OA 1E94E 4C3JG 3VDYA 3GLHA 2F4VM 3MXPA 1HNWM 1F2YA 1YNJC 2KRKA 3ZJYC 2QZ4A 3ICEA 3KF6B 5IP7G 3GTJB 5JJZA 4JYAM 1QZGA 3L7ZC 1HFGA 1PH8A 1VQFA 4JI0M 3GTKH 3M9BA 1KRTA 3THGA 5CGKA 4NL4H 3D6CA 3KK7A 1QUTA 2QENA 1XXHB 2LHGA 3I4NB 3FYCA 4GKKL 2F0FA 4BLCA 1PHJA 2CV2A 3CF5A 3H3VC 2BA1A 3KF8A 1IYUA 4JI5Q 1IN7A 3QO2A 1NMGA 4A3EG 2E74C 1ZXTA 5IGGA 2PQAA 3S14H 1CZWA 2B2VA 3RD4A 3J7AV 4WP2A 2XFSA 3GLFE 1YNXA 4HMJA 3M85A 1DD2A 4RGNA 1TWGH 3URYA 1Q39A 1XMQL 1U4RA 3CPWA 2WACA 2JJQA 3U6MA 1UE5A 5FO9B 2B3TA 3Q8DA 1NNXA 3M4OB 4CDDC 4B3TM 1XWEA 1GL6A 3HKZE 4R4TA 1K8AC 1AE2A 1SNPA 2L6OA 1CA5A 5EJCA 4HEDA 3CAMA 2H4OA 4MM3B 4JG2A 1EIYB 3L2AA 5BR8L 3NQIA 2WIIB 2UXCQ 3MK6A 5EPLA 4K6DA 2E2IH 1D5MC 3C3LA 4D82A 2V6ZM 5EP2A 3CCUA 3TS0A 1KL9A 3L3OC 4C3HG 1X6OA 5CBEE 3U5ZA 1NY6A 5IGEA 4DV3Q 1WTVA 5C3XA 3TWLA 3HS0C 4P2CB 4H7BA 4BBRH 3TEHB 2ERCA 4RH6A 4DFAA 3W0LB 3RN5A 4FO2A 4A3IG 1Z6TA 4JI8L 1HNZM 2CW0D 4MHEA 2VUMG 2XLJA 1E32A 4LFBM 1VQAA 3T16A 4WW0A 1EUJA 3UDXA 4ALPA 1CSPA 5FKAC 3J80c 2NVTH 3J7BA 1I4XA 3SEBA 5HURA 4DV5Q 1R5LA 2K5DA 2VW9A 4RF1A 3IL8A 1ZMVA 1V92A 5EGTA 4FD2A 3PIPA 3LCVB 2ZM6M 3L9AX 4P74A 5CV7A 3S2HH 4XT1B 2DAKA 1BBUA 4HLQA 1S4ZA 1KRSA 1EWCA 3A42A 3D4WA 4GOPA 4K5VA 4HEOA 3P7JA 2UXBQ 2A68D 2RHSB 2M5ZA 3GTKB 4DR7L 2EJSA 3J7AF 2XWBB 3FRIA 3GTJH 1S5DD 4XYQA 2V4DA 1I4GA 1VQ1A 4IUNA 3B89A 1PVOA 1TDZA 4GOPC 2ZM6Q 3OMCA 1STGA 1XNQM 4FXKC 3A5UA 4MB7A 1HXYD 4ZLTF 1IBLL 1SXJD 1UEBA 3RZOB 1XXGA 1K82A 2Z4SA 2ZAOA 1J5EL 1G4AE 3FEWX 1DGSA 4HJ8A 4KMUC 3W67A 2Z6KC 2F3IA 5D3DA 3W2DA 1DGBA 1I50H 4DK3C 2EXDA 3J7AS 4P17A 2L55A 3BZDB 1YIJA 4HSVA 4LCBA 1WFQA 3KS4A 2A6HC 1F4IA 2QKIC 2WSFF 1LT6D 2F5QA 1SNMA 4PMCA 1V8QA 2K33A 3ONAB 3F2UA 3W5OA 3VYTA 4JI6M 1BBXC 4PV1C 3VYSA 3GTLH 2V1CA 2BCOA 4A3FH 1PXUA 2L7HA 3HEJA 3BXWA 3MMPA 3HZJA 4NW2A 2AQ3B 2JA5G 1XMOQ 2NB0A 1IBLM 1Q3LA 4D81A 3U6QA 1G3IA 1YE9A 2QPAA 5EXPA 5EJWA 3D6WA 1BOSA 4II7A 4UP7A 4ABNA 2C5RA 4LF4Q 4S12A 1GJTA 2XVSA 3CRLC 1PTOB 1BXTA 2DAGA 1Q82C 4GITA 2HQLA 3DWAA 1N34Q 1CSQA 4LJ7A 1CFMA 3SGIA 1WVLA 4AZFA 1CA6A 1X54A 1K3RA 5C3WA 4GEWA 2FJ2A 4BY1H 2M9VA 1TTEA 2AQ2B 2D0OA 3CKIB 2QGQA 2JQOA 1RTNA 3SHGB 3GQ3A 3GLHE 2RDGA 3CCQA 2Q2TA 2VUMH 2VQFL 3A0JA 4NP5A 2DWNA 1FL0A 4GNXC 1Q3BA 1S40A 5D65A 4XTCS 1Y8OB 1R9TB 2KZSA 3GLIA 5IODA 1MSHA 1FVIA 1Q7YC 1IYVA 2NVQH 3U4ZA 3I4MH 2A1AA 5FO8B 2A74C 3X3NA 1GABA 2RGOA 4YCWA 1QVCA 2KRUA 3I91A 2ENBA 1A3UA 1JQYD 4B3SL 3P20A 3CU7A 2RRUA 2EE1A 4R8NA 2A69D 5T1GA 1I94Q 3K0XA 3SMPA 1PH2A 3Q8GA 3K2LA 1STBA 1T5XD 4HIOA 2EYHA 3ZCBB 3W3AA 1LTBD 4DR1M 2LWXA 3JAMi 4JI2M 2R92H 2HAKA 3F2CA 1ILPA 4GN5A 4ZK9B 3U58A 1IBMQ 5C44H 1H6UA 3O13A 3C2PA 2HCIA 1LTMA 3M6AA 1D0KA 2G9DA 2Y0SE 1XYIA 1G51A 5GQOA 4AH6A 4AQYM 3AEVA 2P5TA 5F3WA 3CMAA 4UPAA 1XB2B 1TWGB 1DOKA 1F2LA 2D0PA 4DAVA 3PMFA 4JI3Q 3AMUA 4QNMA 1EU4A 5M9OA 5ELDA 4QY7A 3E5SA 1OFIA 5LL6X 3F2DA 3NTKA 4A3BG 1QILA 2QHOB 3WOFA 5C44B 1IW7D 4LF6L 2Q2EB 2LS01 1AIPC 2EY6A 1OXSC 1LTGD 5KGUA 1SYCA 3Q23A 3MJ5A 1PJIA 3I4NH 2X8AA 2HCBA 1S5FD 3EJIA 1K8OA 4KTAA 2R4EA 4DV4M 5G3LD 4LFCM 2OQ4A 3HKZB 4LGMA 3U60A 3FTFA 5H37D 3I2ZA 5FOBB 4DR5M 3HOXG 2I5MX 3GP7A 4C3IH 3NQTA 1FR3A 2D9UA 3VA7A 1NMFA 4L5QA 2C96A 5IYCH 2QA4A 4IOAA 4LJ8A 1TWFH 3B9PA 1UFZA 2VL6A 5EPKA 2LTUA 2FMMA 2HWJA 3I4OA 1OIZA 3KBGA 3I01M 4PDIA 4BBRG 4X64L 3KDFB 1SE8A 2DY7A 2SEBD 3I4MB 3R2IA 1XNRM 3GTGH 3HU2A 1RCVD 2CHQA 1KLUD 2Z7JA 1H9SA 3TSSA 3GTOH 2MO0A 3GLIE 2KCCA 1KDBA 3IECA 2JP7A 3E46A 4X65L 2F0NA 2KCTA 2WSEF 2D62A 1TY2A 3BZKA 3E21A 3KLSX 4HTHA 1I4QA 4EIWA 5C0XG 1QWYA 3R93A 1WIVA 3PNYA 1N77A 3NUCA 5K36G 1WJ7A 1JMCA 1C0AA 5A35A 2JA6H 5JPNC 5COYA 2MPMA 2G8LA 2OTJA 4L6TB 4LRSA 3TP8A 1YUBA 1W3SA 2K14A 1E0BA 3ULPA 3H09A 2OPFA 4DV4Q 4QNRA 1UNSA 5KRUA 1PZJD 1F9SA 2CW0C 3G7LA 2ZTDA 3SK5A 5IP9G 1TR8A 4X3SA 5DM63 4JI1Q 5FJ8G 3HZXA 5M5YH 4FXDA 5KNCA 7CATA 3V76A 3LCUA 3FMCA 3R3OA 4JW0A 4Q0FA 1D8LA 3H15A 1Z5CA 1SR3A 2KECA 2AKWB 4I7AA 3BS1A 2YNMD 3HHXA 1H9SB 2RA4A 2X69A 2MGWA 5E1FA 5ELFA 3K7AH 4DV0Q 2Z9HA 4JBKA 2EJFC 1BCPC 3KP1E 1NO1A 1I94L 1MI2A 4FCTA 3HOZH 4G6ZA 1GOZA 4DK0A 1A5TA 3CCVA 2XN9C 1RF2D 3A55A 3AQQA 3QAUA 3DUZA 3VK8A 2FFJA 4JI2Q 5D14A 1JOQA 2NUCA 3A8JE 4G57A 2F52A 3ER0A 2JSOA 2N88A 4YY3M 3E9HA 4ZRZA 3STBD 3HOWH 5KQ8A 4WRDA 3SC3A 4JI6L 3ZC7B 4LF7M 2VF8A 4HN7A 5CBAE 2DAIA 1SNQA 4ZQ3A 4AYBG 1EQRA 3RFWA 4RKUF 4LJ6A 2PW7A 5CV6A 4JN6A 4HIDA 4GIPA 3AKZA 3I4VA 4A3JB 4MTKA 5KO3A 2WFWA 4DUYL 2B2TC 1WHCA 5IYDG 1TWHB 3FVQA 4REZA 3ZYYX 4X62M 1JJ2A 4OONA 5EKIA 4DR1Q 1YNJD 1WD0A 3U9OA 3RLNA 1X3PA 2F0TA 1QQWA 3I90A 1SJHD 1NBWA 1S5ED 1ML0D 4O42A 1G6PA 1EQQA 5EP1A 1KAAA 3G71A 2CCZA 1Y1WG 1I6VC 4C56C 4NMZA 2YU9B 2L11A 4F88A 2HUGA 1B4OA 1JB3A 4JI5L 4FF4A 5EBDA 1CI3M 2ZBKB 5EQ0A 3JAMS 1VQLA 3L2PA 2G5DA 2A8VA 3HOXB 1L1OB 1P3QQ 1EY7A 5L8RF 1DO0A 2L12A 3NWTA 1Z5AA 1PJTA 1B50A 1L1OA 4KLNA 5ITXA 4MGIE 4OL7A 4R1JA 2EYMA 4RKBA 2UXBM 3BBZA 1QUQB 3EFXD 1VF5C 4HL4A 4AKGA 2F5SA 3A8IE 4A3FB 3VDPA 1EEID 2I5LX 2DZOB 1IXSB 3FTEA 3WDNA 1Y8NB 4A3JH 3F92A 4TVAB 2LNHC 3FPPA 5C5MA 4FWGA 4R3DA 3U61A 1SNOA 5ITTA 3HOYB 4BBSB 1MJEA 4K8IA 3T53B 3KDSE 4LF5M 1IKLA 1C9OA 4Z8XA 1CKMA 1TS5A 4DR5L 3GLFA 4LF4M 2JA7H 4IURA 3AOGA 1OXXK 4Z9CB 4LFCL 1AE3A 3V05A 1ZMWA 2XEPA 3HWSA 1X3FA 5JEAJ 2JZ0A 3M7NA 2JY6B 1Q86C 2RSNA 3J7A5 1V33A 3RN2A 4JV5Q 4DV7Q 3SDZA 1VS0A 4LUOA 1CKOA 4LMQD 4A3BH 4RCNA 2YR0A 1PH6A 3NBIA 5ELNA 1ZEQX 3AV0A 4K0KQ 4GKJL 2N55A 1BNZA 2KNVA 5C4XB 4DV7M 4FF3A 5M5WH 1D2BA 2ZXOA 3TQSA 1MGSA 2B2YC 2R62A 3UE1A 2R46A 1LM0A 2BDOA 3A54A 2UUBQ 1HR0Q 2CFOA 1ASYA 4DR5Q 2WB1G 3PO3H 1L2FA 2MJ8A 3T56B 4JK1C 1B44D 3SATA 4GC9A 4TQUS 1I4RA 2EY5A 5IWAQ 5C3EG 3CC4A 1ZYRD 3RNUA 4JI2L 3PO3B 1FNWA 1HZAA 4OWWB 4C2MB 4P75A 3ZH9B 4WFN3 1FGUA 5I6WA 3F2BA 2XNAC 1A2UA 4G4NA 4NSRA 5EXTA 2FOIC 3A56A 4JI0Q 4GN3B 1MN3A 3U6OA 1ZYRC 5FO7B 3HG9A 1QVFA 2KDLA 3PUWA 5LMNQ 4F2LA 4LW1A 1PDQA 1IN6A 3T4AC 3Q22A 3OTOM 3WHKA 1N34M 3SK6A 2DN8A 1M8AA 3I73A 2ICEC 5IYBG 2L9HA 2PPBC 4A3KB 4KKUA 1PMRA 4N9TA 2Y0QA 2ZJQA 5M3MH 1G71A 4H02A 2E2JH 5I9PA 2R7ZB 2Z8LA 4DR4M 2PNHA 4DK6C 3K5OA 3DLLA 1TVXA 3BDCA 4XQQA 1GVPA 1Q8KA 1TQOA 3D4RA 3MXNB 1HNZQ 1JORA 1AEXA 1LT4D 2KXEA 4IOCA 2B63G 1EFWA 4B08A 3K57A 1T3TA 1A3TA 1STEA 2A6ED 3KLSA 1BUVT 1AFPA 4LJ9A 1N32Q 3RMHA 2X49A 1PZKD 1IYJB 3JC66 3FKIG 1DV0A 1UE7A 5ITXE 2JA5H 1PRTC 4DR4L 1VQPA 3C1FA 4AYBE 1OAIA 3DM1A 2H1RA 1SMYD 2BDNA 2DWMA 1VG5A 4YWMA 3VR5A 3OIQA 1SYGA 3C9PA 5IE8A 3A74A 4TSSA 4OWXB 2MUYA 1QAQA 4IBIA 2KCNA 4MN3A 3TN2A 3OW2A 4B3ML 2IX3A 3FE3A 2B2WC 1NV9A 1XNQQ 2C9CA 3FUUA 3K7UC 4DPGA 1WGNA 5EPJA 1GL7A 3KS8A 2EIFA 2JZ1A 3I55A 2FS1A 4KLKA 1R6BX 2AHMA 2ZJRA 1U4LA 4XGIA 4KHPL 4JI8Q 4DXGA 4QUFA 1VQIA 1NCVA 3HU3A 2EDGA 3P75A 3J81j 4PMWA 5CV9A 3SAUA 3EN2A 4Y28F 4PMBA 1UAPA 2EYJA 1IM2A 3K5NA 2B8FA 3KVWA 2L1BA 4HAEA 1ZAEA 1PTOF 1PRTB 3T15A 3TWKA 4LJAA 1STYA 2K52A 4JBWA 5M3FB 2K0BX 2WAQG 3HKZG 4P71A 4NXML 2BNKA 2W82A 1VQHA 4DUZM 5M5YB 1F2MA 5EP3A 1D5XC 4K0KM 2NVYH 2WAQE 1HNXQ 3W0FA 4IBKA 1Q12A 1VQOA 2NVQB 4A4IA 4DR2L 1EY6A 2NYZD 2LXJA 3RLOA 4GKJM 1IXZA 3TMEA 3I51A 5C4HA 3MFGA 3VKGA 1UE1A 2KQ3A 3HY5A 1JR3E 4C1NK 3K7AB 2MFIA 4X3KA 4MGZE 2ES2A 4RF0A 4LF6M 1JB7A 3NE5B 1Q3CA 2UXCM 4DAMA 2HCCA 3FUXA 2RKSA 4A3IH 4LFBL 1LYLA 2R18A 1V43A 4JI4L 3MA2B 2F4VL 1EY5A 4DR3M 5EXSA 3UGJA 4DV3M 1SEBD 2P5ZX 1STHA 2KZUA 1VQ7A 3K58A 1VQ8A 3TE6A 1FNVA 1LT3D 4OELB 4AW4A 1LT5D 3SMSA 2R6GA 3I3CA 2ZJPA 3VR3A 3DOAA 4A3EB 1B9MA 4M0WA 4QGUA 4IBEA 2WAQB 5HGTA 1IW7C 3PIO3 2QW7A 4CISA 5GROA 4QOSA 5IOCA 4HMIA 1ZMUA 3G4SA 1KABA 2F0UA 2EYFA 2Z8YM 3NENA 3QIAA 5FLMG 3GRUA 2X6LA 4IBCA 1ET6A 4JC0A 2F0KA 1TH4A 5LL6S 4APVA 3GQ4A 3EIHA 3U6CA 5EQTA 4A76A 5EAYA 3SFZA 2R44A 1PFSA 2EYOA 5IGCA 2DAEA 1F77A 1Q81C 1O7IA 2MH8A 1NNJA 4L15A 4LZJA 1TY0A 3K5MA 4L6V6 4DXFA 1BDOA 4RA8A 4DR7Q 4CGYB 1TS4A 1N8RC 5I2XA 3FKEA 1QZHA 5M3MG 2I07B 1K3WA 3MFYA 4DAYA 1ESRA 3PNVA 4JI1L 1IBMM 4JI7L 4GC5A 2CWPA 1XJVA 4B3TQ 4BY7H 5C3EH 5AJ3Q 3HOUH 3M4QA 3H91A 3HJQA 1EQVA 2NVYB 4UP9A 3QJYA 2WKCA 2UU9L 1N32M 2I0QA 4R9WA 1NJFA 1QAMA 1G8PA 1EIGA 1CT1D 3H0GB 3Q6SA 1JT8A 3J80S 1MX0A 2ZANA 4JI8M 2EJMA 2EOTA 3BZCA 3GRYA 1PTOC 1R4PB 3FTCA 4FNFA 4JI0L 3KBXA 4GLAC 3A45A 2JUJA 3J2PB 2JA7B 4ZUJA 4J15A 5NUCA 4RGMA 2E5LQ 2JE6I 2Q8IB 4KD4A 1SFOB 4R8IA 2N78A 4LF4L 1L0YB 2AUJD 4JOIC 1KSFX 2O5JC 3NK9A 4LF9L 5EXXA 1VEGA 4A3MH 2ASBA 2R0IA 2BJVA 1YEZA 3DWQA 4KHPQ 2AMCB 3MEFA 3PV0A 4L4UA 2RSOA 4JBMA 2Y0SB 1R4QB 3B7QA 4X66M 2V1CC 4GHLA 2CH4A 5TSSA 4A3JG 1HJPA 1SNCA 5GKNA 5KPZA 4NXNM 1FNNA 4QHTA 1J5EM 1XX8A 1SYEA 1HQCA 3M4OH 2E2JB 2NWGA 3C58A 1HZBA 3KSJA 1AW7A 3CW2C 4GKKQ 4C2MH 2A6HD 1VMCA 4DR4Q 1T43A 3CHBD 5I9OA 2PYKA 3L28A 5BPVA 3W1BA 4DUYQ 3DEPA 2KEDA 4PDGA 4GHAA 1SROA 1VQ4A 4ID6A 1J6QA 3U9SA 1X3GA 5JPMC 3MHVC 2N49A 3ITPA 5EKLA 4B3MQ 4CJ6A 1O80A 4AQYQ 1L2CA 1IN5A 1E24A 2AWNA 3QB3A 2CRUA 1TIID 5LMNM 3RLFA 3PF5A 2DNCA 3TDQA 1LV7A 3TZDA 2Z4RA 1YJWA 1PGYA 1LTRD 5C6AA 1M4VA 2UUCM 2QQ8A 3FRHA 1DOMA 4CDEC 5M3MB 1M1KC 3CF0A 5CV5A 2N8NA 5KQDA 1OIPA 1EEFD 1EY0A 4X64M 5DYGA 3OMGA 2GVBA 4AKHA 2KVMA 4LJZC 3FTDA 5ELOA 4ZAIA 2R45A 3ZQJA 1EWHA 4POFA 1BCPB 3H3VH 5FLXS 3PIP3 2LKVA 2KJXA 4CKCA 1RKNA 3KOZE 2CHGA 4FWDA 4GZYC 1IY2A 2L4EA 4GLVB 4PNYA 1CUKA 3UJNA 5BN5A 3A7LA 1EIFA 2RQXA 1I6HB 2UUBM 1X65A 3SAWA 2Z6KA 2BH8A 1BO0A 2F4VQ 3CCLA 1S3SA 3K1JA 1I5FA 1X3QA 2AHOB 1R9TH 1VEKA 2IPKD 5ITRA 2BWBA 5E3FA 1TR5A 4WJ3M 3C46A 4BWGB 1W6KA 3M3YH 2F0SA 1QDTA 2OXPA 1PH1A 2GQFA 1PH4A 1HR0W 3TS2A 1SMXA 1YVCA 1IKMA 1U4MA 1LTLA 1K28A 2KENA 1KNEA 2KHJA 4JVZA 5C4XH 3RGSA 3SYKA 4HJ7A 2WB1B 3PVSA 1YITA 2JXMB 2NZ1D 2QNJA 2XRQD 4IALA 1UEAB 4GKJQ 1V34A 1XMOM 4QCLA 3H94A 2F0JA 2OCEA 4RFBA 3GPXA 1EWIA 5GAHC 3FPUB 1HR0L 1CHPD 3GRRA 1SYBA 3KYHC 2R61A 2XGTA 3K92A 2BE5D 4DNRB 2DVWB 5IREB 3BJUA 4X65M 3OIPA 1AUAA 4DN4M 4X66Q 3SBJA 1K3BC 1MU5A 1YSYA 4GH9A 2DGYA 1OTCA 3K81C 1Z59A 1QNKA 1O78A 2UUAQ 3EBEA 4LF8M 4IPCA 5LMNL 3EROA 2HL7A 3VR4A 4P16A 2B2YA 1JE4A 3E0JA 1MD2D 4Y7NB 2QCUA 5CMDA 2B29A 3J27B 1OXVA 2K6BA 2F5OA 4HIMA 4BBRB 5IP9H 3W1GA 5KIXA 4IIWA 4R7GA 1AZQA 4IFDJ 4OO1H 3HHYA 3STBC 4A3LG 1NVMA 1QANA 3QOJA 1NSNS 4M9ZA 1OXTA 4DV6L 1II3A 4B3RM 4LF8Q 1WXQA 3U61B 4LAAA 4JPBW 1DZ1A 4IBFA 3NPPA 3SHFA 5FSWA 2KOLA 1IXRC 1LTAD 2F0WA 2RBMA 4J8QA 3GP1A 2K5QA 5C0XH 4C3IG 1HRJA 2L5TA 1X32A 2DWZB 2CH4W 3LX0A 3CC7A 2GVAA 2QILA 5M3FH 4GN4B 2UUBL 1TGUA 2ZTCA 4UHVA 1D2NA 2YU9H 5E6JA 4ODGA 1XHBA 4L5TA 1PJJA 4X65Q 2FHTA 2QEJC 5HGQA 3UMMA 1A62A 2K6AA 1K83B 1O7YA 1IZ6A 3RZDH 2N3SA 4V0BA 3S2DB 4EVOA 2BWEA 2JXNA 1VQEA 1NSFA 2NZOA 3K8AA 2N35A 4YWKA 4LFAQ 4HIKA 5IYCG 4A3MB 1RD9D 1TWHH 2HQEA 3N6RA 5FLXE 2L4FA 4L78A 1EOTA 4M9SA 1TT2A 4POGA 1WTOA 1I3QH 3T38A 3J7YW 1WOCA 3BVZA 1LACA 1LABA 4I65A 4B3MM 2I7NA 2K05A 5DLQE 1EIHA 3H4MA 1EYGA 1SDFA 1TU2B 4ZPXA 1WI5A 2A19A 4C3IB 4M0DA 1H95A 2K4KA 4IUTA 3VDUA 1A2TA 1QYRA 2UU9M 1GO3E 4TRDA 2H1EA 1GUOA 1E9RA 1H9RA 2JA8B 2AQ1B 2XSZD 3MC0B 1HUNA 4XBOA 2JA5B 1TWCB 1KDCA 1A0IA 4JI1M 5DNYA 4LF5Q 2D7GA 1JICA 4IZ8A 4KKTA 4LJ4A 1OAOC 4U68A 3PUVA 3HOVG 3JR5A 2CWAA 2HIVA 4X3TA 5IGBA 1TKWB 3AYHB 1PH5A 3GPUA 3NEMA 2M60A 1DYQA 1JE5A 1HFNA 1T6OA 2FE8A 2B2WA 1HHVA 4DNIA 2OQKA 4AQYL 5IT9E 1ICFB 4HJ9A 1JJGA 1MSGA 4PT5A 3LWUA 5L37A 1HCZA 1N33L 4LK1C 1PH7A 2I46A 3GDEA 1H9JA 4MTNA 3NSWA 4QIWE 2DWLA 3S16H 2KHSA 2EXZA 2HDMA 1BCPD 3K59A 2F0OA 1D5ZC 3TL4X 4BY1G 1IL2A 1IBKM 4UY8C 1KLGD 1NJGA 4Q7JA 2YFQA 3PGZA 4S3SA 2O5RA 3BU2A 5GAEC 3LW5F 3DHQA 2Y0TA 3K8ZA 2HD3A 4CJ0B 2KCMA 1WR1B 2VNUD 2D7HA 1FNUA 1J5EQ 4B7GA 1CQVA 2LXEA 4FCVA 3LGJA 1QDRA 2CFMA 3NWLA 4X62Q 3JAMc 2K75A 3HOZB 4LWCA 2Y21A 4K8JA 1PRBA 1U0LA 1Z9FA 2DHYA 1M90C 2YQZA 2SNMA 3U5ZB 4NSOB 2IX0A 3S1QH 3K6OA 4LRTA 1DGGA 4DV0M 1GHJA 1OJLA 1B3QA 3AJIB 4JI7M 4EQOA 1IBML 2Z0SA 1QG7A 1JWSD 1YJNA 2DI0A 2PMZE 5IYBH 1KIXA 2K5WA 1WYDA 2MP1A 1A3VA 4BXXH 1L2BA 3K9PA 4I8OA 1TWCH 2IHEA 3QYBA 1VQDA 5DEHA 3KDFA 4DF7A 4I5SA 1NR4A 1DJRD 4DKAC 1WTXA 3DA1A 4PD2A 3FRPB 2LHCA 2DJFC 4ME5A 1D6EC 3NELA 2K5NA 3U50C 5AJ3L 4RMFA 4I7ZC 4K5WA 5K5PA 2LVQD 4A93G 4QL5A 1F9QA 5KNDA 4LUVA 4O0AA 3GTPH 1Z5BA 1Q1EA 1PFMA 3AU7A 4X66L 1UE6A 2WV6D 1HPCA 4PG3A 3KF6A 4XXEA 3CP0A 2R92B 4DV1M 1VDZA 2O4XA 3DEOA 2DKLA 2VQFQ 3G48A 1HNZL 3FUWA 1XTDA 3KOJA 1JB0F 2OOAA 4OVZB 3KXEC 1BKBA 1EYCA 3V96A 4LF7L 3KFUA 1LV9A 2PZUA 4CDFC 2R3ZA 2IX1A 2Q2HA 2CEAA 1PLFA 3GTPB 2Z4HA 1SFOH 2SDFA 4JI4M 2K1BA 1PH3A 1B70B 2DNAA 3CQZH 4OO1I 4NRVA 2EKKA 2WZJA 4LZZA 3RGPA 3T1HM 2K9DA 3FKIH 3IFTA 3I70A 1WD1A 2HKJA 2E75C 4UDUC 4I81A 1U4PA 3RR5A 1IBKL 4B3SQ 3HOVB 2NTSA 3GD7A 3GLGE 4D80A 4UN2B 1VQCA 4TKOB 1Z6HA 4X3UA 4IPDA 3QWNA 4A3DG 2R4JA 1TS3A 3QR8A 5FTNA 4L16A 4AKIA 1ZQ9A 3DXJC 4MIUA 4P72A 1G6ZA 3CXCA 3ILKA 5DFLA 3KLRA 4XT3B 4H0LC 2Z3XA 4R4IA 3S9WA 3HP3A 4IUUA 2K04A 1XMQM 3U6SA 2ICIA 4EGVA 2F0EA 4G7OC 3RZDB 1ET9A 5D3IB 3J80L 4HCEA 4K6LA 5IWAM 1NY4A 4UAIA 4NXMM 1C4QA 1EZ8A 1IN4A 1G59A 1LO5D 1LTSD 4OWTB 5J1ZA 3N52A 5FTKA 2R7ZG 3L27A 4YHHQ 3NBHA 3F8TA 5ISRA 5C1BA 1A63A 4IBJA 3ERQA 3KF8B 2KEBA 1JC7A 2F0MA 2R93G 1WTPA 4L8RC 1GUGA 4B9WA 1Z7TA 2XWJB 4XIGS 4ZKBB 4B3RQ 2B63H
chains in the Genus database with same CATH topology
4DAPA 3HOWB 5IT9S 2B8GA 4MGYE 4BA2I 1DOLA 4U673 1GUWA 3M4YA 5JI2E 4RHRA 4F8MA 1IY0A 3IAYA 3AOEA 4G4QA 1BQQT 4A3VB 1G8ZD 3ND8A 2XZFA 2RDFA 1I94M 1STAA 4OHJA 2F0HA 3OWEB 3D8BA 4IFDG 5ELCA 1IL8A 2EPBA 1FGBD 5E26A 3MEHA 4KHVA 3PXGA 3SASA 3K0YA 4GRIA 2A69C 2J7NA 2UXDM 3J81E 2M2LA 5ITYA 3VYUA 1HQYE 2ZXPA 2NVXB 2BA0A 2VXWA 4B7HA 1F2ZA 3EA6A 1GJXA 4JI5M 1ICWA 1L8QA 2EA0A 5JI3E 4C1NI 4KY5A 3TPZA 2OT2A 4DNTB 2B39A 1WTQA 2L4NA 1XC8A 2BE5C 5FTJA 3HGBA 4RHSA 5C0XJ 4CKBA 4IUVA 2KEEA 1EU3A 3AOEC 3MAQA 2ZAMA 3GTLB 1N36M 3SE0A 1FYCA 4J1MA 2L7IA 2NBFA 3FD9A 2F0GA 2F0LA 2F03A 1VF7A 3A98B 3FYDA 3MXUA 3PO2B 5A2QE 3GTQB 1C1KA 4NRWA 4GMQA 3KFUG 4WJWA 3S14B 4DR6M 1I4PA 2F3VA 2AUKA 3OOCA 1K3XA 3KUPA 3VK7A 4QB4A 2QBYB 2DZNB 2R65A 2F5NA 3G6JB 3DMUA 3UI2A 3BOSA 3J80E 2PZWA 3BDOA 3A8KE 4I4LA 4KJNA 1T5EA 5J22A 1W6JA 2XZUA 5JVH3 3D8GA 2J4XA 5EP4A 5IZ7D 3EIEA 4XQJA 3GO5A 3CF6E 1L1TA 3DZDA 4DR2M 5DAUA 1ILQA 2CHBD 4KY7A 1DGHB 1B3AA 1ENFA 3CRKC 2NTTA 4KK7A 3S2HB 5BN4A 3MXNA 4M9XA 2DNEA 4KY6A 1R2ZA 2EVBA 1EY8A 4Z6YA 3R8FA 4KD3A 1B53A 5CV4A 3RUZA 2NN6I 1FJGM 3L29A 2A68C 4RGOS 3SARA 3Q24A 1CQFA 3LNNA 3HJSA 4IBDA 4IUPA 5CORA 3GQBA 5DYIA 1HUMA 1EY9A 4A3DB 2KA7A 4K2KA 3VYRA 2PMZB 4WURA 1A6XA 5KYLA 3GPYA 3J81S 1SXJE 5JEAG 3BG3A 5A2QL 1OO9B 2F0IA 4AG6A 4RNAA 1V1OA 3GTGB 2JP1A 4JXJA 1UM8A 3LVWA 4DA2A 4ZUIA 4EQNA 4L63B 2IL8A 4BY7B 1N33M 5JOBA 3I4YA 2A73B 3LMMA 5JAVA 3JAML 3EQLC 1R2YA 3GLIB 4FF1A 3TP6A 2Y20A 3U6LA 5CYUA 5IIFA 3SAVA 3KOWE 4LG2A 1DONA 2Q8TA 3NHHA 1IN8A 2F0VA 1QNUA 5K36H 1H9KA 1SE2A 4KN4C 3BVMA 2WKDA 3SR1A 4KODA 5M5WB 2C98A 4ILWA 1DXMA 1SSOA 2X4AA 2F4IA 2F5PA 1EQTA 1ESFA 4IN3A 2L09A 2TSSA 2F0DA 1RHPA 3A7AB 2NN6H 3OW7A 2DHRA 4HCSA 2XF3A 3C1EA 4TUWA 4J6HA 2X6GA 1QZMA 3L25A 2F0QA 2K01A 4DV5M 1RDPD 4RKLA 2PO4A 2EJGC 2QDBA 1E9SA 3FUTA 5LMUM 4FCWA 2MGSA 1I50B 4QF4A 1VMPA 4IBGA 3ND9A 5I6YA 4V190 2K28A 1JCKB 4DU9A 2JEAI 4XQNA 2B2UC 1AP0A 2BOSA 5CC4A 2XSZA 1HR0M 2PZTA 3GV3A 1YNND 5BR8M 1I3QB 3QG1A 5DM73 2J7ZA 4G4OA 1TWAB 4IJFA 2F3WA 2XFTA 1Y8PB 4FWHA 3SK8A 2QP9X 4QOZC 1EYDA 2KA6B 2LY7A 3HU1A 4MGHA 1GUSA 1QB5D 3KSXA 4FP5D 3LQQA 2G9HD 4XYOA 2R93B 1EFID 2LMCB 4IJEA 1SXTA 3U6DA 3BYYB 3MZ5A 8CATA 4BY1B 1EE8A 1PZID 2CHVA 2RKOA 4K14A 5C4ZA 2DXIA 3GLFB 3UK6A 3QOLA 3S1RB 1GVNA 1H9MA 2I7PA 3LQRA 3KOXE 1LTTD 5I4DA 4OGQC 2IT1A 2E2HB 1EL0A 1WTWA 1Y1VB 1JR3D 2Z1CA 3SVMA 2E2IB 1GUTA 3GPPA 1CM9A 1D1IA 4KN7C 1PFNA 5AFWA 5KPRA 4CHTB 4K2LA 2OF1A 1BR9A 1F9PA 4FW9A 3J81L 3HOUB 1Q1BA 1WTRA 1CZGA 5A2QS 1PRTF 1KDAA 1HA6A 4QUCA 5LHY1 2XSCA 2XH9A 3D4DA 4BA1I 3RE8A 3PUZA 2BJWA 1DO2A 3QWLA 3SK4A 4FF2A 1PM5A 1W5SA 3KP0E 3Q0AA 1SYFA 1N75A 3FDTA 4FVMA 2B2TA 2XIWA 5EKKA 3U6EA 2NQ8C 2TMPA 3E9SA 5KPTA 3X3MA 3M3YB 3NTIA 1ENCA 2B2VC 2EY2A 4W5WA 2QCPX 3JAME 3GV6A 1SBBB 3HJ8A 1Y69U 3BDLA 1EZ6A 1BF4A 1EYAA 1OXUA 3S15B 3SYLA 2YYZA 4B3SM 2RDHA 3IFDA 3HKPA 3TZUA 4LF9M 1XWIA 4IUQA 4M1UB 2K47A 1D1KA 1SYDA 1ZKOA 3CTWB 5J39A 1NUCA 3UZUA 2A6EC 1B9NA 4PCZA 4LY6A 3TP7A 2VUMB 4JI3M 4FYDA 2VQFM 1O7ZA 2SNSA 3MVVA 3HHWA 4RAUC 2C5CA 2CV1A 2FFKB 3OPOA 3R9XB 1R7RA 3OSOA 1NHGC 2EYLA 2GA4B 3HGIA 2CV0A 2K03A 1I4WA 3KW6A 1ENAA 4G4KA 1U9RA 3E6ZX 3MXGA 5IGFA 5M5XB 5IT9L 3MWYW 2M00A 1G291 1X37A 4RWSC 1GKIA 2EUCA 1LTID 3GTMB 1HT1E 1J09A 3JR4A 4A3GB 3Q8XA 3R8BA 3L26A 3MTSA 1AN8A 2SOBA 2KUMA 3GO8A 1SE3A 2NVTB 1KFVA 2DY8A 4A93B 1HQMC 3PUYA 4IBBA 2IJ0A 3FKIB 3P1HA 4NDXA 4IFDI 1SAPA 3VR2A 4BS9A 4BBAA 4H13C 3VA5A 5JVG3 4YIJA 1TS2A 4CJ1B 2PNRC 2FINB 1FD7D 2LH0A 1L1ZA 4PQXA 4L8JA 5C4JB 1SNDA 4C3JB 1VDDA 1IY1A 4OVZA 3HHZA 3D3RA 4MH0E 4C3HB 5C3EB 3U6PA 4K5XA 1C48A 4B7FA 1E2ZA 3M7GA 1W5TA 1C8CA 3WOEA 3I72A 1PTOD 1KNAA 2EY1A 4JV5M 1N78A 2XRSD 4AG5A 4OX9M 4DR7M 2G5GX 4KKSA 1HTPA 1HT2E 5C0XI 4DV2M 1JWUD 2Q8RE 3SHLA 4H44C 1RJTA 1PRTD 4WORA 1SE4A 4GKKM 4KO8A 4DK1A 1NAPA 5KNBA 3D8LA 3LWEA 3CQZB 4NKLA 1JR0D 4E6IA 3KOYE 1RTOA 5T1IA 2HHHM 1A15A 2C9OA 2AWOA 4ULLA 5JEAH 2D2CC 1MBYA 3T51B 4MGKE 2CVRA 3T1YM 2B63B 2EZVA 3OHXC 4OIKA 3SXHA 3T13A 4B9XA 5F2DA 4YHHM 3GLGB 3TBIB 2C99A 1I4HA 2VIIA 3R2TA 1VCIA 3IG8A 5EBCA 1G6ZA 2LFNA 1G91A 2A5HA 1XTCD 1BCPF 4BB9A 4G4RA 2D7EA 1UUPA 4M8AA 3NTHA 2XGNA 5KEEA 1Q90A 2IWHA 4LGYA 1SJED 1PFBA 5FK9C 3S16B 4OU7A 1SXJB 2J0TD 2NN6G 2IW3A 4DV6M 4OO1G 2WINB 1S5BD 5KYIA 1NY5A 2L0CA 1Z47A 2JA6B 1SXJA 1NNUC 2O5IC 2F1MA 1HNXM 1L0XB 4CKEA 3GQ5A 1QJOA 4O1NA 2K7VA 1KTKA 2CE7A 1HTLD 3V2TA 5IGDA 4QIWB 3DFZA 5ELBA 1SXJC 4FXGC 1K8MA 5FLXL 2F0PA 3LVVA 5ELEA 4DUYM 1DCZA 4KHPM 5C18A 2JA2A 1EY4A 5FTMA 3NP8A 3GLGA 1JQJC 1TWFB 4KHZA 3S1NB 1YNNC 3FUVA 2E76C 1JR3A 2QF7A 4IQZA 2K32A 4NOOB 2UUAM 1TH3A 3WHLA 2ZXRA 1CTMA 1AZPA 3CF2A 1QAOA 5I2YA 2VB2X 3EVQA 1GUNA 1GLNA 4HR7B 4OIJA 2JYOA 2ID0A 1PYWD 1E2VA 2E2DC 4A3IB 4G7ZC 5ITUA 1KYIA 1HQRD 2E5LM 3PUXA 3S1QB 3GRVA 1V1PB 2PQEA 3TP5A 2J7OA 4KI0A 1XXHA 2O2LD 4N9PA 1TDHA 1QE6A 1GHKA 5CR3A 4XDXA 1JOOA 4ITQA 1SMYC 3TWMA 1DGHA 3GTOB 1ONLA 1PTOH 4EQPA 2MHVA 1V1PA 2HDLA 1O7LA 1JOKA 2CQAA 1WCMB 4IFDH 1CHQD 3IG5A 3K5LA 1G2SA 1F9RA 2B2UA 1QVRA 1TH2A 2VQEM 5DNFA 5ITQA 2QBYA 1J7KA 5E4XA 2FMCA 1B2TA 3AFHA 4ZYSA 4F7XA 4AI6A 4LFAM 2VB3X 5E4WC 2RGHA 4QMGA 5BN3A 3NXWA 4G7HC 2OEOA 4HSPA 5C5LA 3I4LA 1B1ZA 4CBVA 1L2DA 4QHSA 3DWPA 1STNA 4OW0A 3OWFA 1G41A 1J9OA 3S17B 3M0EA 4KJOA 1NR2A 3PFIA 5G3LF 1LLRD 1J8IA 3AL0C 3S1MB 2KW0A 3E4RA 4A3BB 2EO2A 2ZT9C 2A5YB 3BYTB 2FNAA 1QOHA 1Y1WB 2RVLA 3VLFB 2CUZA 1Q8IA 1GXDC 2PW5A 4DGZA 4CJ2C 3NWSA 3HRZC 4RGTA 1HA5A 4KV6A 1NHWC 3GLHB 4Q5VA 4LJ5A 5FTLA 3H6MA 1JWMD 2EYPA 3BVGA 1QCBD 1E2WA 2Z4IA 3VR6A 2D5DA 2WP8J 2PCFB 1IHZA 4AYBB 1G2TA 3AB9A 3D31A 3MHBA 4RCOA 3IKJA 1OFHA 1DM0B 3A46A 4ZKCB 3VFDA 1RODA 1IQPA 5CV8A 2JEBI 4F87A 1ORYB 3I8ZA 1DGFA 3U60B 2V1UA 3VKHA 1CK1A 1S5CD 1E94E 4C3JG 3GLHA 2F4VM 3MXPA 1HNWM 1F2YA 1YNJC 2KRKA 2QZ4A 3GTJB 5JJZA 4JYAM 3L7ZC 1HFGA 4JI0M 5CGKA 3THGA 4NL4H 3D6CA 3KK7A 2QENA 1XXHB 3I4NB 3FYCA 2F0FA 4BLCA 2CV2A 3H3VC 2BA1A 3KF8A 1IYUA 1IN7A 3QO2A 2E74C 1ZXTA 5IGGA 1CZWA 2B2VA 3RD4A 3J7AV 2XFSA 3M85A 4HMJA 1DD2A 4RGNA 3URYA 1Q39A 1U4RA 2WACA 3U6MA 5FO9B 3M4OB 4B3TM 1XWEA 1GL6A 1SNPA 2L6OA 1CA5A 5EJCA 4HEDA 2H4OA 4MM3B 3L2AA 3NQIA 2WIIB 3MK6A 5EPLA 4K6DA 1D5MC 3C3LA 4D82A 2V6ZM 5EP2A 3L3OC 4C3HG 1WTVA 5CBEE 3U5ZA 1NY6A 5IGEA 5C3XA 3TWLA 3HS0C 4P2CB 4H7BA 2ERCA 4RH6A 4DFAA 3W0LB 4FO2A 1Z6TA 1HNZM 2CW0D 4MHEA 2XLJA 1E32A 4LFBM 3T16A 4WW0A 5FKAC 3J7BA 1I4XA 3SEBA 5HURA 2K5DA 4RF1A 3IL8A 5EGTA 4FD2A 2ZM6M 3L9AX 5CV7A 4XT1B 4HLQA 1S4ZA 1EWCA 3A42A 3D4WA 4K5VA 3P7JA 2A68D 3GTKB 2M5ZA 3J7AF 2XWBB 1S5DD 4XYQA 2V4DA 1I4GA 4IUNA 1TDZA 3OMCA 1STGA 1XNQM 4FXKC 4MB7A 1HXYD 4ZLTF 1SXJD 3RZOB 1XXGA 1K82A 2Z4SA 2ZAOA 1G4AE 3FEWX 4KMUC 5D3DA 3W2DA 1DGBA 3J7AS 2L55A 3BZDB 4HSVA 4LCBA 3KS4A 2A6HC 2QKIC 1LT6D 2F5QA 1SNMA 4PMCA 1V8QA 2K33A 3ONAB 3F2UA 3VYTA 4JI6M 1BBXC 4PV1C 3VYSA 2V1CA 2BCOA 1PXUA 2L7HA 3HEJA 4NW2A 2AQ3B 2NB0A 1IBLM 1Q3LA 1G3IA 1YE9A 2QPAA 5EXPA 4D81A 3U6QA 5EJWA 3D6WA 1BOSA 4II7A 4ABNA 2C5RA 4S12A 2XVSA 3CRLC 1PTOB 1BXTA 4GITA 3DWAA 4LJ7A 1CFMA 1WVLA 4AZFA 1CA6A 5C3WA 2FJ2A 2M9VA 2AQ2B 3CKIB 1RTNA 3SHGB 3GQ3A 2RDGA 4NP5A 2DWNA 1Q3BA 5D65A 4XTCS 1Y8OB 1R9TB 2KZSA 3GLIA 5IODA 1MSHA 1IYVA 5FO8B 2A74C 3X3NA 2RGOA 2KRUA 3I91A 2ENBA 1A3UA 1JQYD 3P20A 3CU7A 2EE1A 4R8NA 2A69D 5T1GA 3SMPA 3K2LA 1STBA 1T5XD 2EYHA 3ZCBB 3W3AA 1LTBD 4DR1M 2LWXA 4JI2M 1ILPA 4ZK9B 1H6UA 3O13A 3C2PA 2HCIA 3M6AA 2G9DA 1XYIA 4AQYM 2P5TA 5F3WA 1TWGB 1DOKA 1F2LA 4DAVA 3PMFA 3AMUA 4QNMA 1EU4A 5M9OA 5ELDA 5LL6X 3E5SA 1OFIA 3NTKA 1QILA 3WOFA 5C44B 1IW7D 2Q2EB 2LS01 2EY6A 1OXSC 1LTGD 5KGUA 1SYCA 3Q23A 3MJ5A 1PJIA 2X8AA 2HCBA 1S5FD 3EJIA 1K8OA 4KTAA 2R4EA 4DV4M 5G3LD 4LFCM 2OQ4A 3HKZB 4LGMA 3U60A 3FTFA 5H37D 5FOBB 4DR5M 3GP7A 3NQTA 1FR3A 2D9UA 3VA7A 2C96A 4LJ8A 3B9PA 5EPKA 2FMMA 3KBGA 4PDIA 2DY7A 2SEBD 3I4MB 3R2IA 1XNRM 3HU2A 1RCVD 2CHQA 1KLUD 2Z7JA 1H9SA 3TSSA 2KCCA 1KDBA 2F0NA 2D62A 1TY2A 3KLSX 4HTHA 1I4QA 4EIWA 5C0XG 1QWYA 3R93A 3PNYA 1N77A 3NUCA 5K36G 5A35A 5JPNC 5COYA 2MPMA 2G8LA 4L6TB 4LRSA 3TP8A 1YUBA 1E0BA 3H09A 2OPFA 4QNRA 1UNSA 5KRUA 1PZJD 1F9SA 2CW0C 3G7LA 3SK5A 5DM63 4X3SA 3HZXA 4FXDA 5KNCA 7CATA 3FMCA 3R3OA 4Q0FA 1Z5CA 2KECA 3BS1A 2YNMD 3HHXA 1H9SB 2RA4A 2X69A 5E1FA 5ELFA 2EJFC 1BCPC 3KP1E 1MI2A 4FCTA 4G6ZA 1GOZA 4DK0A 2XN9C 1RF2D 3A55A 3QAUA 3DUZA 3VK8A 2FFJA 5D14A 1JOQA 2NUCA 3A8JE 4G57A 2JSOA 2N88A 4YY3M 4ZRZA 5KQ8A 4WRDA 3SC3A 3ZC7B 4LF7M 4HN7A 5CBAE 1SNQA 4ZQ3A 3RFWA 4LJ6A 2PW7A 5CV6A 4JN6A 4GIPA 3AKZA 3I4VA 4A3JB 5KO3A 2B2TC 1TWHB 3FVQA 4REZA 3ZYYX 4X62M 5EKIA 1YNJD 1WD0A 3U9OA 1X3PA 2F0TA 1QQWA 3I90A 1SJHD 1S5ED 1ML0D 4O42A 5EP1A 1KAAA 1I6VC 4C56C 4NMZA 2YU9B 2L11A 4F88A 2HUGA 1B4OA 1JB3A 4FF4A 5EBDA 1CI3M 2ZBKB 5EQ0A 3JAMS 3HOXB 1EY7A 1DO0A 2L12A 3NWTA 1Z5AA 1B50A 4KLNA 5ITXA 4MGIE 4OL7A 2EYMA 4RKBA 2UXBM 3EFXD 1VF5C 4HL4A 4AKGA 2F5SA 3A8IE 4A3FB 3VDPA 1EEID 2DZOB 1IXSB 3FTEA 3WDNA 1Y8NB 2LNHC 3FPPA 5C5MA 4FWGA 4R3DA 3U61A 1SNOA 5ITTA 3HOYB 4BBSB 4K8IA 3T53B 3KDSE 4LF5M 1IKLA 1TS5A 4Z8XA 3GLFA 4LF4M 4IURA 3AOGA 1OXXK 4Z9CB 3V05A 2XEPA 3HWSA 5JEAJ 3M7NA 2RSNA 3SDZA 4LMQD 4RCNA 2YR0A 3NBIA 1ZEQX 3AV0A 2N55A 1BNZA 5C4XB 4DV7M 4FF3A 1D2BA 2ZXOA 3TQSA 1MGSA 2B2YC 2R62A 2R46A 2BDOA 3A54A 2CFOA 2MJ8A 3T56B 4JK1C 1B44D 3SATA 4GC9A 4TQUS 1I4RA 2EY5A 1ZYRD 3PO3B 1FNWA 4C2MB 3ZH9B 4WFN3 5I6WA 2XNAC 1A2UA 4G4NA 4NSRA 5EXTA 2FOIC 3A56A 3U6OA 1ZYRC 5FO7B 3HG9A 3PUWA 1PDQA 1IN6A 3T4AC 3Q22A 3OTOM 3WHKA 1N34M 3SK6A 2DN8A 1M8AA 3I73A 2ICEC 2L9HA 2PPBC 4A3KB 4KKUA 1PMRA 4N9TA 2Y0QA 5I9PA 2R7ZB 2Z8LA 4DR4M 3K5OA 1TVXA 3BDCA 4XQQA 1TQOA 3D4RA 1JORA 1AEXA 1LT4D 2KXEA 4B08A 3K57A 1T3TA 1A3TA 1STEA 2A6ED 3KLSA 1BUVT 1AFPA 4LJ9A 3RMHA 2X49A 1PZKD 5ITXE 1PRTC 3C1FA 3DM1A 2H1RA 1SMYD 2BDNA 2DWMA 3VR5A 3OIQA 1SYGA 4TSSA 2MUYA 1QAQA 4IBIA 2KCNA 4MN3A 3TN2A 2IX3A 2B2WC 2C9CA 3FUUA 5EPJA 1GL7A 3KS8A 1R6BX 2AHMA 1U4LA 4XGIA 4DXGA 4QUFA 1NCVA 3HU3A 2EDGA 3P75A 4PMWA 5CV9A 3SAUA 4PMBA 1UAPA 2EYJA 1IM2A 3K5NA 2B8FA 3KVWA 2L1BA 4HAEA 1ZAEA 1PTOF 1PRTB 3T15A 3TWKA 4LJAA 1STYA 4JBWA 5M3FB 2BNKA 2W82A 5M5YB 4DUZM 1F2MA 5EP3A 1D5XC 4K0KM 3W0FA 4IBKA 1Q12A 2NVQB 1EY6A 2NYZD 4GKJM 1IXZA 3TMEA 3I51A 5C4HA 3MFGA 3VKGA 2KQ3A 4C1NK 3K7AB 4X3KA 4MGZE 4RF0A 4LF6M 3NE5B 1Q3CA 2UXCM 2HCCA 3FUXA 2RKSA 1V43A 2R18A 3MA2B 1EY5A 4DR3M 5EXSA 3UGJA 4DV3M 1SEBD 1STHA 2KZUA 3K58A 3TE6A 1FNVA 1LT3D 4AW4A 1LT5D 3SMSA 2R6GA 3I3CA 4A3EB 3VR3A 3DOAA 1B9MA 4M0WA 4IBEA 2WAQB 5HGTA 1IW7C 3PIO3 4CISA 4QOSA 5IOCA 4HMIA 1KABA 2F0UA 2EYFA 3QIAA 3GRUA 2X6LA 4IBCA 1ET6A 2F0KA 1TH4A 5LL6S 3GQ4A 3EIHA 3U6CA 5EQTA 3SFZA 2EYOA 5IGCA 1F77A 1NNJA 4L15A 4LZJA 1TY0A 3K5MA 4DXFA 1BDOA 4RA8A 4CGYB 1TS4A 5I2XA 3FKEA 2I07B 1K3WA 3MFYA 4DAYA 1ESRA 3PNVA 1IBMM 4GC5A 3H91A 3HJQA 1EQVA 2NVYB 3QJYA 2WKCA 1N32M 4R9WA 1NJFA 1QAMA 1G8PA 1EIGA 1CT1D 3H0GB 3Q6SA 3J80S 1MX0A 2ZANA 4JI8M 2EJMA 2EOTA 3GRYA 1PTOC 1R4PB 3FTCA 4FNFA 3KBXA 3A45A 3J2PB 2JA7B 4ZUJA 5NUCA 4RGMA 2JE6I 2Q8IB 4KD4A 1SFOB 4R8IA 1L0YB 2AUJD 1KSFX 2O5JC 3NK9A 5EXXA 2BJVA 3DWQA 3PV0A 4L4UA 2RSOA 2Y0SB 1R4QB 4X66M 4GHLA 5TSSA 1SNCA 5GKNA 5KPZA 4NXNM 1FNNA 4QHTA 1J5EM 1XX8A 1SYEA 1HQCA 2E2JB 2NWGA 3C58A 3KSJA 1AW7A 2A6HD 1VMCA 3CHBD 5I9OA 2PYKA 3L28A 5BPVA 3DEPA 2KEDA 4PDGA 4GHAA 4ID6A 3U9SA 5JPMC 3MHVC 3ITPA 5EKLA 1O80A 1L2CA 1IN5A 2AWNA 3QB3A 1TIID 5LMNM 3RLFA 2DNCA 3TDQA 1LV7A 3TZDA 2Z4RA 1LTRD 5C6AA 1M4VA 2UUCM 1DOMA 5M3MB 3CF0A 5CV5A 5KQDA 1EEFD 1EY0A 4X64M 5DYGA 3OMGA 4AKHA 2KVMA 4LJZC 3FTDA 4ZAIA 2R45A 1EWHA 1BCPB 5FLXS 3PIP3 2LKVA 2KJXA 4CKCA 1RKNA 3KOZE 2CHGA 4FWDA 4GZYC 1IY2A 4PNYA 3UJNA 5BN5A 3A7LA 2RQXA 1I6HB 2UUBM 3SAWA 1BO0A 1S3SA 3K1JA 1X3QA 2IPKD 5ITRA 5E3FA 1TR5A 3C46A 4BWGB 1W6KA 2F0SA 2OXPA 1IKMA 1U4MA 1KNEA 3RGSA 3SYKA 2WB1B 3PVSA 2JXMB 2NZ1D 2XRQD 4IALA 1UEAB 1XMOM 4QCLA 3H94A 2F0JA 4RFBA 3GPXA 3FPUB 1CHPD 3GRRA 1SYBA 2R61A 3K92A 2BE5D 4DNRB 2DVWB 5IREB 4X65M 3OIPA 4DN4M 3SBJA 1MU5A 1YSYA 4GH9A 1Z59A 1QNKA 1O78A 4LF8M 3EROA 2HL7A 3VR4A 4P16A 2B2YA 1JE4A 3E0JA 1MD2D 4Y7NB 2QCUA 5CMDA 3J27B 1OXVA 2F5OA 4BBRB 5KIXA 4IIWA 4R7GA 1AZQA 4IFDJ 4OO1H 3HHYA 1NVMA 1QANA 3QOJA 4M9ZA 1NSNS 1OXTA 1II3A 4B3RM 1WXQA 3U61B 4LAAA 1DZ1A 4IBFA 3NPPA 3SHFA 5FSWA 2KOLA 1IXRC 1LTAD 2F0WA 2RBMA 4J8QA 3GP1A 2K5QA 5C0XH 4C3IG 1HRJA 2L5TA 1X32A 2DWZB 3LX0A 2QILA 1TGUA 1D2NA 5E6JA 4ODGA 1XHBA 1PJJA 2FHTA 2QEJC 3UMMA 2K6AA 1K83B 1O7YA 4V0BA 3S2DB 4EVOA 1NSFA 4A3MB 1RD9D 2HQEA 3N6RA 5FLXE 4L78A 1EOTA 4M9SA 1TT2A 1WTOA 3T38A 3J7YW 3BVZA 4I65A 1LACA 1LABA 4B3MM 2I7NA 2K05A 1EIHA 3H4MA 1SDFA 1TU2B 4ZPXA 4C3IB 4M0DA 4IUTA 4TRDA 3VDUA 1A2TA 1QYRA 2UU9M 2H1EA 1GUOA 1E9RA 1H9RA 2JA8B 2AQ1B 2XSZD 3MC0B 1HUNA 4XBOA 2JA5B 1TWCB 1KDCA 4JI1M 5DNYA 2D7GA 1JICA 4IZ8A 4KKTA 4LJ4A 4U68A 3PUVA 3JR5A 4X3TA 5IGBA 1TKWB 3GPUA 2M60A 1DYQA 1HFNA 2FE8A 2B2WA 1HHVA 5IT9E 1MSGA 4PT5A 3LWUA 1HCZA 4LK1C 2I46A 1H9JA 3NSWA 2DWLA 2KHSA 2EXZA 2HDMA 1BCPD 3K59A 2F0OA 1D5ZC 3TL4X 1IBKM 1KLGD 1NJGA 2YFQA 4S3SA 2O5RA 3DHQA 2Y0TA 3K8ZA 4CJ0B 2VNUD 2D7HA 1FNUA 4B7GA 1CQVA 2LXEA 4FCVA 3NWLA 3HOZB 2Y21A 4K8JA 2YQZA 2SNMA 3U5ZB 4NSOB 2IX0A 3K6OA 4LRTA 1DGGA 4DV0M 1GHJA 1OJLA 3AJIB 4JI7M 4EQOA 1QG7A 1JWSD 2K5WA 2MP1A 1A3VA 1L2BA 4I8OA 5DEHA 4DF7A 4I5SA 1NR4A 1DJRD 1WTXA 3DA1A 4PD2A 3FRPB 4ME5A 1D6EC 4I7ZC 4K5WA 5K5PA 1F9QA 5KNDA 1Z5BA 1Q1EA 1PFMA 3AU7A 2WV6D 1HPCA 4XXEA 2R92B 4DV1M 1VDZA 2O4XA 3DEOA 3FUWA 4OVZB 3KXEC 1EYCA 3V96A 1LV9A 2PZUA 2R3ZA 2IX1A 2CEAA 1PLFA 3GTPB 2Z4HA 2SDFA 4JI4M 2K1BA 4OO1I 4NRVA 4LZZA 3RGPA 3T1HM 3IFTA 1WD1A 3I70A 2HKJA 2E75C 4UDUC 4I81A 1U4PA 3HOVB 2NTSA 3GD7A 4X3UA 4D80A 4TKOB 1Z6HA 3QWNA 2R4JA 1TS3A 5FTNA 4L16A 4AKIA 1ZQ9A 3DXJC 4MIUA 3ILKA 3KLRA 4XT3B 4H0LC 2Z3XA 3S9WA 3HP3A 4IUUA 2K04A 1XMQM 3U6SA 2ICIA 4EGVA 2F0EA 4G7OC 3RZDB 1ET9A 5D3IB 3J80L 4HCEA 4K6LA 5IWAM 4UAIA 4NXMM 1C4QA 1EZ8A 1IN4A 1G59A 1LO5D 1LTSD 5J1ZA 3N52A 5FTKA 3L27A 3NBHA 5ISRA 5C1BA 4IBJA 3ERQA 2KEBA 1JC7A 2F0MA 1WTPA 4L8RC 1GUGA 4B9WA 1Z7TA 2XWJB 4XIGS 4ZKBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGY B;  3NBI A;  4CHT B; 
#chains in the Genus database with same CATH topology
 1Y14 B;  4HJ5 A;  4DAP A;  3HOW B;  2DZL A;  5IT9 S;  1CKN B;  2MRO B;  4MGY E;  2B8G A;  4IO9 A;  4BA2 I;  1DOL A;  4U67 3;  1GUW A;  3M4Y A;  5JI2 E;  4RHR A;  4F8M A;  1IY0 A;  3IAY A;  2KNA A;  1N34 L;  3AOE A;  4G4Q A;  1BQQ T;  4A3V B;  2VDB B;  1G8Z D;  3ND8 A;  5LMU L;  2JWS A;  2XZF A;  2RDF A;  4Y7N H;  1I94 M;  4L5S A;  1STA A;  2O25 A;  4OHJ A;  2ZTE A;  2F0H A;  1MJG M;  4A93 H;  3OWE B;  3D8B A;  4IFD G;  4A75 A;  2ALY B;  1VQ9 A;  1SG9 A;  5ELC A;  4DV1 Q;  1IL8 A;  2EPB A;  1FGB D;  2HT1 A;  5E26 A;  3MEH A;  4KHV A;  3PXG A;  3SAS A;  1S3O A;  3K0Y A;  4GRI A;  1TXY A;  2A69 C;  4JV5 L;  2L15 A;  3I04 M;  2J7N A;  1GJS A;  1YHQ A;  4DV7 L;  2UXD M;  3J81 E;  2M2L A;  5ITY A;  1K0S A;  3VYU A;  1HQY E;  3DM3 A;  3RZO H;  2ZXP A;  2NVX B;  2BA0 A;  2VXW A;  4B7H A;  1F2Z A;  1SN8 A;  3EA6 A;  1GJX A;  4LFC Q;  4JI5 M;  4C3J H;  1ICW A;  1L8Q A;  2EA0 A;  5JI3 E;  1TF0 B;  1OKS A;  2VZA A;  4KY5 A;  4C1N I;  3J81 c;  3TPZ A;  3W68 A;  5LMU Q;  2OT2 A;  1KXL A;  4DNT B;  2B39 A;  4FDB A;  1WTQ A;  3PCO B;  2L4N A;  1E1O A;  1XC8 A;  3CME A;  2BE5 C;  2CKZ B;  5FTJ A;  3HGB A;  5E7N A;  4RHS A;  5C0X J;  4CKB A;  4IUV A;  3CGW A;  2KEE A;  1IBL Q;  1EU3 A;  3AOE C;  3MAQ A;  2ZAM A;  1VEJ A;  3GTL B;  1N36 M;  3SE0 A;  3PO2 H;  4PZ7 A;  1FYC A;  4J1M A;  2L7I A;  2NBF A;  3FD9 A;  3TRE A;  4DR1 L;  4C3H H;  2F0G A;  2F0L A;  2F03 A;  1VF7 A;  3A98 B;  3FYD A;  1W2B A;  4X6A H;  4A3G H;  3MXU A;  3PO2 B;  5A2Q E;  3PF4 A;  3GTQ B;  1C1K A;  4NRW A;  4GMQ A;  3KFU G;  4WJW A;  4DR3 L;  3A5Z B;  3S14 B;  4DR6 M;  1I4P A;  4NC6 A;  2F3V A;  2AUK A;  3OOC A;  1K3X A;  3KUP A;  3VK7 A;  4QB4 A;  2QBY B;  2DZN B;  2R65 A;  2F5N A;  3G6J B;  2GN5 A;  3DMU A;  3UI2 A;  1ASZ A;  3BOS A;  3J80 E;  2PZW A;  2QEX A;  3BDO A;  1VDL A;  1XPR A;  3A8K E;  1Y1W H;  4I4L A;  4KJN A;  1T5E A;  5J22 A;  1W6J A;  2XZU A;  5JVH 3;  3D8G A;  2J4X A;  1Y1V G;  4WJ4 A;  5EP4 A;  5IZ7 D;  3EIE A;  4XQJ A;  4A3L H;  3GO5 A;  3CF6 E;  1L1T A;  2EQS A;  3DZD A;  4DR2 M;  3HKS A;  2EKF A;  2LVA A;  5DAU A;  1ILQ A;  3B6Y A;  5C4J H;  2CHB D;  4DV2 L;  4KY7 A;  2RHQ B;  1DGH B;  2ZM6 L;  1B3A A;  4XK8 F;  1ENF A;  2NTT A;  3CRK C;  3D0F A;  4IPG A;  4KK7 A;  2E5L L;  5JJK A;  3S2H B;  5BN4 A;  3MXN A;  4M9X A;  1X56 A;  2DNE A;  2R6F A;  2YTY A;  2JY7 A;  1R2Z A;  2EVB A;  4KY6 A;  1EY8 A;  4Z6Y A;  3R8F A;  4KD3 A;  1B53 A;  1Q02 A;  4KT0 F;  1YZ6 A;  5CV4 A;  2OQ0 A;  1WCM G;  3RUZ A;  1VQM A;  2NN6 I;  3S1M H;  3HOW G;  3HOY H;  4BBS H;  1FJG M;  3L29 A;  2KNZ A;  2BH2 A;  2A68 C;  4YHH L;  4LNQ A;  4RGO S;  3SAR A;  4F1I A;  4X62 L;  3Q24 A;  3PO3 G;  2KHH A;  1CQF A;  3B7Z A;  1WGL A;  3T1Y L;  3LNN A;  2CP8 A;  3HJS A;  4IBD A;  4IUP A;  4DV5 L;  1WJJ A;  1L0W A;  1PYB A;  3GQB A;  5COR A;  5DYI A;  1HUM A;  1EY9 A;  4A3D B;  2KA7 A;  4K2K A;  3VYR A;  1R4G A;  3H0G H;  2PMZ B;  1A8V A;  4WUR A;  5C4X G;  5KYL A;  1A6X A;  4NPS A;  3GPY A;  1VQJ A;  2JY8 A;  3J81 S;  1SXJ E;  5JEA G;  2DJG C;  3BG3 A;  5A2Q L;  1IBK Q;  2GNO A;  1OO9 B;  2F0I A;  3CPF A;  3H0G G;  4AG6 A;  4RNA A;  1V1O A;  3GTG B;  2JN4 A;  2JP1 A;  4JXJ A;  1UM8 A;  3LVW A;  1N36 L;  4DA2 A;  4ZUI A;  4EQN A;  4L63 B;  2IL8 A;  4BY7 B;  1N33 M;  5JOB A;  1IFY A;  3I4Y A;  2A73 B;  3LMM A;  1Q46 A;  5JAV A;  1FJG L;  3JAM L;  3EQL C;  1R2Y A;  3TQY A;  5C44 G;  3GLI B;  4FF1 A;  2YV5 A;  3TP6 A;  3HOY G;  4BBS G;  4YCV A;  1EIJ A;  2Y20 A;  3U6L A;  5CYU A;  1T9H A;  5IIF A;  1HNX L;  3SAV A;  3KOW E;  4LG2 A;  4R4O A;  1DON A;  2Q8T A;  3NHH A;  1IN8 A;  2F0V A;  1QNU A;  1VQ5 A;  5K36 H;  1H9K A;  1PJS A;  3CCE A;  1PYS B;  1KC8 C;  1SE2 A;  1SRU A;  4KN4 C;  4P73 A;  3CCJ A;  3BVM A;  2WKD A;  3TRZ A;  3SR1 A;  4KOD A;  5M5W B;  1N36 Q;  2C98 A;  4ILW A;  1DXM A;  1SSO A;  1HZC A;  2IHF A;  2X4A A;  1K8G A;  2F4I A;  3S15 H;  2F5P A;  3S17 H;  1EQT A;  1ESF A;  2XTI A;  4IN3 A;  3J80 i;  2RF4 A;  2L09 A;  2TSS A;  2YTX A;  1CKN A;  1RHP A;  2F0D A;  4OXP A;  3A7A B;  3I4M G;  2NN6 H;  3OW7 A;  4JBJ A;  2DHR A;  4HCS A;  2XF3 A;  4JI4 Q;  3C1E A;  1LUZ A;  4TUW A;  4J6H A;  3KLW A;  2X6G A;  1QZM A;  3L25 A;  2F0Q A;  2K01 A;  2JA6 G;  4DV5 M;  3KJO A;  1RDP D;  4RKL A;  2PO4 A;  2EJG C;  2QDB A;  1E9S A;  3FUT A;  5LMU M;  4FCW A;  2MGS A;  1I50 B;  4QF4 A;  1VMP A;  4IBG A;  3ND9 A;  5I6Y A;  2UXD Q;  3EIV A;  4V19 0;  2K28 A;  4GNX B;  1GM5 A;  4A3G G;  1XNR L;  1JCK B;  4DU9 A;  2JEA I;  4XQN A;  3IRB A;  2B2U C;  1AP0 A;  2BOS A;  5CC4 A;  2XSZ A;  1HR0 M;  2PZT A;  3GV3 A;  1YNN D;  5BR8 M;  1I3Q B;  3QG1 A;  5DM7 3;  1MJC A;  2J7Z A;  4G4O A;  1TWA B;  4IJF A;  1JJC B;  2F3W A;  1X3E A;  1GD7 A;  2XFT A;  1D0L A;  1RU3 A;  4FWH A;  1BBW A;  1Y8P B;  2QP9 X;  4QOZ C;  3SK8 A;  1N32 L;  1EYD A;  2KA6 B;  2LY7 A;  5GAG C;  1YLA A;  3HU1 A;  2OOB A;  4MGH A;  4A3F G;  4K0K L;  1GUS A;  1U5K A;  1QB5 D;  4LUZ A;  1K9M C;  1KAW A;  1K83 H;  1QZE A;  3KSX A;  4DV0 L;  3CCM A;  4JCV E;  4FP5 D;  3LQQ A;  1XPU A;  2G9H D;  1KQS A;  2PI2 E;  4XYO A;  2R93 B;  1EFI D;  1RL2 A;  2LMC B;  4IJE A;  5FLX c;  1SXT A;  2MQH A;  2FH0 A;  3U6D A;  3BYY B;  5J3B A;  4JI7 Q;  3MZ5 A;  8CAT A;  4BY1 B;  1EE8 A;  1PZI D;  2CHV A;  2RKO A;  4K14 A;  5C4Z A;  2DXI A;  2HIX A;  2MR9 A;  3GLF B;  2LXK A;  3UK6 A;  1E7Z A;  3QOL A;  3OTO Q;  1GVN A;  1H9M A;  3S1R B;  4N8X 1;  2I7P A;  4A3K H;  3LQR A;  3KOX E;  1LTT D;  5I4D A;  4OGQ C;  2IT1 A;  2JA8 H;  2E2H B;  1V9P A;  1WTW A;  1EL0 A;  1Y1V B;  3AFQ A;  1JR3 D;  2Z1C A;  3SVM A;  2QSF X;  2E2I B;  2R92 G;  1MIU A;  4DR2 Q;  1GUT A;  4BY7 G;  3GPP A;  2OWO A;  1CM9 A;  1D1I A;  5FLM H;  3KJP A;  4KN7 C;  1FJG Q;  1PFN A;  5AFW A;  5KPR A;  4CHT B;  4K2L A;  2OF1 A;  1BR9 A;  1F9P A;  1VQN A;  1E3P A;  2HHH Q;  4L5R C;  2APL A;  4DAY B;  5IT9 c;  4FW9 A;  3J81 L;  3HOU B;  1Q1B A;  1WTR A;  1CZG A;  5A2Q S;  1PRT F;  1KDA A;  4DV2 Q;  1HA6 A;  2UUC Q;  3U4V A;  5M5X H;  4QUC A;  5LHY 1;  2XSC A;  4Y52 H;  2XH9 A;  3D4D A;  4QJF A;  1N33 Q;  4BA1 I;  5LMN W;  3RE8 A;  1RIP A;  3PUZ A;  2BJW A;  1DO2 A;  3QWL A;  3SK4 A;  4FF2 A;  2R7Z H;  1PM5 A;  1W5S A;  1MHW C;  3KP0 E;  1WTH A;  3Q0A A;  4DUZ Q;  1SYF A;  1D0M A;  1N75 A;  3FDT A;  4FVM A;  2B2T A;  2XIW A;  5EKK A;  2UUA L;  3K9O A;  3U6E A;  3UE0 A;  2NQ8 C;  2J5Y A;  2TMP A;  3E9S A;  5KPT A;  3X3M A;  3M3Y B;  3NTI A;  3T1Y Q;  4NB3 A;  1ENC A;  2B2V C;  2EY2 A;  4W5W A;  2QCP X;  3JAM E;  4NXM Q;  3GV6 A;  1SBB B;  3HJ8 A;  2CQO A;  1NTG A;  4DR6 L;  1Y69 U;  3BDL A;  1EZ6 A;  1BF4 A;  1OXU A;  1EYA A;  1GO5 A;  4LF8 L;  3SYL A;  2YYZ A;  4LF5 L;  3S15 B;  4B3S M;  1I6H H;  2RDH A;  3IFD A;  2RCF A;  2WSC F;  3HKP A;  3TZU A;  5HY6 A;  4A3E H;  4MNO A;  4LF9 M;  1XWI A;  4IUQ A;  4M1U B;  4PZ6 A;  2K47 A;  1XXH E;  1D1K A;  1SYD A;  3CCR A;  1PA6 A;  4QQB X;  1ZKO A;  3CTW B;  5J39 A;  1VQB A;  3J81 i;  1NUC A;  3UZU A;  2A6E C;  1B9N A;  4PCZ A;  4OX9 Q;  3IHP A;  4LY6 A;  3TP7 A;  2VUM B;  4JI3 M;  4FYD A;  2VQF M;  1O7Z A;  1KHI A;  2SNS A;  4IPH A;  3MVV A;  3HHW A;  4RAU C;  2C5C A;  2LSS A;  2CV1 A;  2FFK B;  3OPO A;  3R9X B;  1R7R A;  3OSO A;  2YTV A;  1NHG C;  2EYL A;  2GA4 B;  5BR8 Q;  2MJ5 B;  1HZ9 A;  4NXN L;  3FHW A;  5IWA L;  3F1Z A;  1XPO A;  3HGI A;  2CV0 A;  2K03 A;  1I4W A;  4N8F A;  4G3O A;  3GTM H;  3KW6 A;  1ENA A;  4G4K A;  1U9R A;  3E6Z X;  3MXG A;  3T6P A;  5IGF A;  3NBH B;  5IT9 L;  5M5X B;  3MWY W;  4JYA L;  2M00 A;  1G29 1;  1X37 A;  3T1H L;  4RWS C;  4HJA A;  1GKI A;  2EUC A;  1LTI D;  2K5V A;  3GTM B;  1HT1 E;  1J09 A;  3JR4 A;  4A3G B;  3Q8X A;  3R8B A;  3L26 A;  3MTS A;  2Q2I A;  1AN8 A;  2JK8 A;  2SOB A;  3GO8 A;  2KUM A;  1SE3 A;  2NVT B;  1KFV A;  2DY8 A;  2Y0S G;  4A93 B;  1HQM C;  2QDL A;  3PUY A;  4CDC C;  4LF7 Q;  4IBB A;  2IJ0 A;  3FKI B;  3P1H A;  4NDX A;  2VQE L;  4IFD I;  1SAP A;  3VR2 A;  3UDG A;  3OTO L;  4BS9 A;  4BBA A;  1OQY A;  4R4C A;  4H13 C;  3VA5 A;  5JVG 3;  1HNW Q;  4DBG B;  4YIJ A;  1XMO L;  2L2D A;  2E2H H;  1TS2 A;  2PI2 A;  4CJ1 B;  2PNR C;  1KD1 C;  2FIN B;  1FD7 D;  2LH0 A;  1L1Z A;  2PQA B;  3ULL A;  2VY3 A;  4PQX A;  4L8J A;  2JA9 A;  5C4J B;  1SND A;  2O01 F;  4C3J B;  1VDD A;  1IY1 A;  4OVZ A;  3HHZ A;  3D3R A;  3FP9 A;  4MH0 E;  4C3H B;  5C3E B;  3U6P A;  4OX9 L;  2NVX H;  4K5X A;  4DV3 L;  4GLX A;  2JA8 G;  1C48 A;  4B7F A;  2JNH A;  2RCN A;  2UXC L;  2VF7 A;  3M7G A;  1E2Z A;  4JI6 Q;  1W5T A;  4DR3 Q;  3WOE A;  1C8C A;  3I72 A;  1PTO D;  1KNA A;  2EY1 A;  4JV5 M;  1N78 A;  2XRS D;  2VQE Q;  4AG5 A;  4OX9 M;  4DR7 M;  2G5G X;  2LBC A;  4R71 A;  1HTP A;  4KKS A;  1HT2 E;  3H4J A;  5C0X I;  4DV2 M;  1JWU D;  1K0R A;  2Q8R E;  2H5X A;  1EOV A;  3SHL A;  4GS3 A;  4H44 C;  2OTL A;  3K80 C;  1RJT A;  4B3R L;  1PRT D;  4WOR A;  5IY0 A;  4DV6 Q;  1SE4 A;  4GKK M;  4KO8 A;  4DK1 A;  1NAP A;  5KNB A;  1YI2 A;  3D8L A;  1OTR A;  5IYD H;  3LWE A;  3CQZ B;  3UDI A;  1N9W A;  1JR0 D;  4NKL A;  4E6I A;  3KOY E;  1RTO A;  5T1I A;  2HHH M;  1A15 A;  4YCU A;  2C9O A;  2AWO A;  4ULL A;  5JEA H;  4BXX G;  3GTQ H;  3B7N A;  2DAM A;  4EX5 A;  2D2C C;  1MBY A;  3T51 B;  3H3V I;  1NE3 A;  1VQK A;  4MGK E;  2CVR A;  3T1Y M;  3I56 A;  2EZV A;  2Q2U A;  3OHX C;  1YJ9 A;  2B63 B;  4OIK A;  3SXH A;  3T13 A;  4B9X A;  5F2D A;  4YHH M;  3GLG B;  3TBI B;  3S1R H;  2C99 A;  3UDF A;  2UU9 Q;  1I4H A;  2VII A;  1V1Q A;  3R2T A;  1VCI A;  3IG8 A;  1E22 A;  3M4P A;  5EBC A;  5M3F G;  2LFN A;  2HHH L;  4YY3 Q;  1G91 A;  3QYE A;  1P16 A;  4B3T L;  2A5H A;  3HX3 A;  1XTC D;  1BCP F;  3PIO A;  4BB9 A;  4G4R A;  2K50 A;  2D7E A;  1UUP A;  3HOZ G;  4M8A A;  3NTH A;  2XGN A;  5KEE A;  1YHB A;  1Q90 A;  1K73 C;  2IWH A;  4LF6 Q;  5JJI A;  4LGY A;  4ANR A;  1SJE D;  1YHA A;  1S72 A;  1PFB A;  5FK9 C;  1AH9 A;  3S16 B;  4O2D A;  4OU7 A;  1SXJ B;  2J0T D;  2NN6 G;  3ULJ A;  4JYA Q;  2IW3 A;  4DV6 M;  4OO1 G;  2MO1 A;  3T1H Q;  2WIN B;  1S5B D;  5KYI A;  1NY5 A;  2L0C A;  4DUZ L;  1Z47 A;  4UP8 A;  2R7F A;  2JA6 B;  1PV4 A;  1SXJ A;  1NNU C;  3PSI A;  2F1M A;  2O5I C;  1B8A A;  1HNX M;  1L0X B;  4CKE A;  3GQ5 A;  1QJO A;  4O1N A;  4IJH A;  4NXN Q;  2K7V A;  2UXD L;  1KTK A;  2CE7 A;  1HTL D;  3V2T A;  1VQ6 A;  1Y1V H;  5IGD A;  4QIW B;  1EFU B;  3DFZ A;  3J7Z C;  1Y8G A;  1HH2 P;  5ELB A;  1SXJ C;  2LVO C;  4FXG C;  4EQ5 A;  1K8M A;  2VS1 A;  3E0E A;  2E8G A;  2G3Q A;  5FLX L;  2F0P A;  4OEM B;  3LVV A;  2B3G A;  5ELE A;  4DUY M;  1DCZ A;  4KHP M;  5C18 A;  2JA2 A;  1EY4 A;  3PQI A;  3AFP A;  5FTM A;  4DV1 L;  3NP8 A;  3GLG A;  1JQJ C;  1TWF B;  4KHZ A;  3S1N B;  4LFA L;  1QUQ A;  3C3E A;  3HOV H;  4A3K G;  1YNN C;  2UUC L;  3FUV A;  2E76 C;  1JR3 A;  1E1T A;  2QF7 A;  4RG1 A;  4IQZ A;  5IP7 H;  2K32 A;  4PZ8 A;  1L1O C;  4NOO B;  2UUA M;  3PO2 G;  5JJL A;  1TH3 A;  1XNR Q;  3WHL A;  4DV4 L;  3E3X A;  2R7D A;  1CTM A;  2ZXR A;  3CF2 A;  1AZP A;  1QAO A;  5I2Y A;  2VB2 X;  1QUS A;  1GUN A;  1GLN A;  3EVQ A;  2DEN A;  3HOX H;  4LF9 Q;  4HR7 B;  2DUD A;  4OIJ A;  2LVN C;  2JYO A;  2ID0 A;  1PYW D;  1X9N A;  1E2V A;  2E2D C;  4A3I B;  3I4N G;  5GAD C;  4G7Z C;  5ITU A;  1KYI A;  2KBN A;  1D7Q A;  1HQR D;  1UWV A;  2E5L M;  1MKH A;  2OO9 A;  3PUX A;  3GRV A;  1V1P B;  4A3M G;  2PQE A;  3S1Q B;  4A3C H;  3TP5 A;  2J7O A;  4KI0 A;  3E9I A;  1XXH A;  2O2L D;  4N9P A;  1C7Y A;  1TDH A;  1QE6 A;  1GHK A;  2FXQ A;  4XDX A;  1JOO A;  4ITQ A;  5CR3 A;  1SMY C;  3TWM A;  1PJQ A;  1DGH A;  4A3C G;  3GTO B;  1ONL A;  1NV8 A;  1PTO H;  4EQP A;  2MHV A;  1V1P A;  2HDL A;  2JA7 G;  1O7L A;  1JOK A;  1X55 A;  2CQA A;  3CC2 A;  3S24 A;  4IJL A;  4JI3 L;  1WCM B;  4IFD H;  4AIM A;  1CHQ D;  3IG5 A;  2MNA A;  3K5L A;  1G2S A;  2ATW A;  1F9R A;  1IXS A;  2B2U A;  1QVR A;  1TH2 A;  2VQE M;  1ZV1 A;  5DNF A;  1B7Y B;  1HNW L;  5ITQ A;  3HOU G;  2WB1 E;  2QBY A;  1J7K A;  5E4X A;  2FMC A;  1WCM H;  1B2T A;  3AFH A;  2C35 B;  4ZYS A;  3G6E A;  4ME3 A;  4AI6 A;  4F7X A;  4LFA M;  2VB3 X;  4CIZ A;  5E4W C;  3B74 A;  2RGH A;  4QMG A;  5BN3 A;  3NXW A;  4ZCK A;  4G7H C;  1NJI C;  2OEO A;  3WWV A;  5FJ8 H;  4MZ9 A;  4HSP A;  1XMQ Q;  5C5L A;  3I4L A;  1BVS A;  1B1Z A;  1QVG A;  4X64 Q;  3CD6 A;  4CBV A;  4GNX A;  1SLJ A;  1L2D A;  2UXB L;  2IY5 B;  1VQG A;  4QHS A;  3DWP A;  2R93 H;  1STN A;  4OW0 A;  3OWF A;  1G41 A;  2I5H A;  4LFB Q;  1J9O A;  3S17 B;  4JOI A;  3M0E A;  4KJO A;  1IXR A;  1NR2 A;  3PFI A;  2KHI A;  1XNQ L;  5G3L F;  1LLR D;  5H1S E;  1J8I A;  4R4Q A;  3AL0 C;  3S1M B;  2KW0 A;  3E4R A;  4A3B B;  2EO2 A;  2ZT9 C;  2A5Y B;  3BYT B;  2FNA A;  1PH9 A;  1QOH A;  1Y1W B;  3VLF B;  2RVL A;  2CUZ A;  1Q8I A;  1TWA H;  1GXD C;  2PW5 A;  4DGZ A;  2K5H A;  4CJ2 C;  3NWS A;  3HRZ C;  2NZH A;  4A3D H;  4RGT A;  1HA5 A;  4KV6 A;  1NHW C;  3GLH B;  3ERS X;  4Q5V A;  4LJ5 A;  2LVP C;  5FTL A;  3H6M A;  1P8L A;  1JWM D;  3S1N H;  2EYP A;  3BVG A;  1QCB D;  3CCS A;  3HFZ B;  1E2W A;  2CWB A;  2Z4I A;  1GKH A;  3OYY A;  3VR6 A;  2JY5 A;  2D5D A;  2WP8 J;  2PCF B;  1IHZ A;  4AYB B;  1G2T A;  3AB9 A;  3D31 A;  3NBX X;  3MHB A;  4RCO A;  2Z6B A;  3C3D A;  3IKJ A;  4YWL A;  1OFH A;  1DM0 B;  3A46 A;  4ZKC B;  3VFD A;  3S2D H;  1ROD A;  4DR6 Q;  1IQP A;  5CV8 A;  2JEB I;  1YBY A;  4F87 A;  1ORY B;  3I8Z A;  1DGF A;  4YY3 L;  3I7F A;  4GOP B;  3U60 B;  2V1U A;  3VKH A;  1CK1 A;  1S5C D;  3L0O A;  1E94 E;  4C3J G;  3VDY A;  3GLH A;  2F4V M;  3MXP A;  1HNW M;  1F2Y A;  1YNJ C;  2KRK A;  3ZJY C;  2QZ4 A;  3ICE A;  3KF6 B;  5IP7 G;  3GTJ B;  5JJZ A;  4JYA M;  1QZG A;  3L7Z C;  1HFG A;  1PH8 A;  1VQF A;  4JI0 M;  3GTK H;  3M9B A;  1KRT A;  3THG A;  5CGK A;  4NL4 H;  3D6C A;  3KK7 A;  1QUT A;  2QEN A;  1XXH B;  2LHG A;  3I4N B;  3FYC A;  4GKK L;  2F0F A;  4BLC A;  1PHJ A;  2CV2 A;  3CF5 A;  3H3V C;  2BA1 A;  3KF8 A;  1IYU A;  4JI5 Q;  1IN7 A;  3QO2 A;  1NMG A;  4A3E G;  2E74 C;  1ZXT A;  5IGG A;  2PQA A;  3S14 H;  1CZW A;  2B2V A;  3RD4 A;  3J7A V;  4WP2 A;  2XFS A;  3GLF E;  1YNX A;  4HMJ A;  3M85 A;  1DD2 A;  4RGN A;  1TWG H;  3URY A;  1Q39 A;  1XMQ L;  1U4R A;  3CPW A;  2WAC A;  2JJQ A;  3U6M A;  1UE5 A;  5FO9 B;  2B3T A;  3Q8D A;  1NNX A;  3M4O B;  4CDD C;  4B3T M;  1XWE A;  1GL6 A;  3HKZ E;  4R4T A;  1K8A C;  1AE2 A;  1SNP A;  2L6O A;  1CA5 A;  5EJC A;  4HED A;  3CAM A;  2H4O A;  4MM3 B;  4JG2 A;  1EIY B;  3L2A A;  5BR8 L;  3NQI A;  2WII B;  2UXC Q;  3MK6 A;  5EPL A;  4K6D A;  2E2I H;  1D5M C;  3C3L A;  4D82 A;  2V6Z M;  5EP2 A;  3CCU A;  3TS0 A;  1KL9 A;  3L3O C;  4C3H G;  1X6O A;  5CBE E;  3U5Z A;  1NY6 A;  5IGE A;  4DV3 Q;  1WTV A;  5C3X A;  3TWL A;  3HS0 C;  4P2C B;  4H7B A;  4BBR H;  3TEH B;  2ERC A;  4RH6 A;  4DFA A;  3W0L B;  3RN5 A;  4FO2 A;  4A3I G;  1Z6T A;  4JI8 L;  1HNZ M;  2CW0 D;  4MHE A;  2VUM G;  2XLJ A;  1E32 A;  4LFB M;  1VQA A;  3T16 A;  4WW0 A;  1EUJ A;  3UDX A;  4ALP A;  1CSP A;  5FKA C;  3J80 c;  2NVT H;  3J7B A;  1I4X A;  3SEB A;  5HUR A;  4DV5 Q;  1R5L A;  2K5D A;  2VW9 A;  4RF1 A;  3IL8 A;  1ZMV A;  1V92 A;  5EGT A;  4FD2 A;  3PIP A;  3LCV B;  2ZM6 M;  3L9A X;  4P74 A;  5CV7 A;  3S2H H;  4XT1 B;  2DAK A;  1BBU A;  4HLQ A;  1S4Z A;  1KRS A;  1EWC A;  3A42 A;  3D4W A;  4GOP A;  4K5V A;  4HEO A;  3P7J A;  2UXB Q;  2A68 D;  2RHS B;  2M5Z A;  3GTK B;  4DR7 L;  2EJS A;  3J7A F;  2XWB B;  3FRI A;  3GTJ H;  1S5D D;  4XYQ A;  2V4D A;  1I4G A;  1VQ1 A;  4IUN A;  3B89 A;  1PVO A;  1TDZ A;  4GOP C;  2ZM6 Q;  3OMC A;  1STG A;  1XNQ M;  4FXK C;  3A5U A;  4MB7 A;  1HXY D;  4ZLT F;  1IBL L;  1SXJ D;  1UEB A;  3RZO B;  1XXG A;  1K82 A;  2Z4S A;  2ZAO A;  1J5E L;  1G4A E;  3FEW X;  1DGS A;  4HJ8 A;  4KMU C;  3W67 A;  2Z6K C;  2F3I A;  5D3D A;  3W2D A;  1DGB A;  1I50 H;  4DK3 C;  2EXD A;  3J7A S;  4P17 A;  2L55 A;  3BZD B;  1YIJ A;  4HSV A;  4LCB A;  1WFQ A;  3KS4 A;  2A6H C;  1F4I A;  2QKI C;  2WSF F;  1LT6 D;  2F5Q A;  1SNM A;  4PMC A;  1V8Q A;  2K33 A;  3ONA B;  3F2U A;  3W5O A;  3VYT A;  4JI6 M;  1BBX C;  4PV1 C;  3VYS A;  3GTL H;  2V1C A;  2BCO A;  4A3F H;  1PXU A;  2L7H A;  3HEJ A;  3BXW A;  3MMP A;  3HZJ A;  4NW2 A;  2AQ3 B;  2JA5 G;  1XMO Q;  2NB0 A;  1IBL M;  1Q3L A;  4D81 A;  3U6Q A;  1G3I A;  1YE9 A;  2QPA A;  5EXP A;  5EJW A;  3D6W A;  1BOS A;  4II7 A;  4UP7 A;  4ABN A;  2C5R A;  4LF4 Q;  4S12 A;  1GJT A;  2XVS A;  3CRL C;  1PTO B;  1BXT A;  2DAG A;  1Q82 C;  4GIT A;  2HQL A;  3DWA A;  1N34 Q;  1CSQ A;  4LJ7 A;  1CFM A;  3SGI A;  1WVL A;  4AZF A;  1CA6 A;  1X54 A;  1K3R A;  5C3W A;  4GEW A;  2FJ2 A;  4BY1 H;  2M9V A;  1TTE A;  2AQ2 B;  2D0O A;  3CKI B;  2QGQ A;  2JQO A;  1RTN A;  3SHG B;  3GQ3 A;  3GLH E;  2RDG A;  3CCQ A;  2Q2T A;  2VUM H;  2VQF L;  3A0J A;  4NP5 A;  2DWN A;  1FL0 A;  4GNX C;  1Q3B A;  1S40 A;  5D65 A;  4XTC S;  1Y8O B;  1R9T B;  2KZS A;  3GLI A;  5IOD A;  1MSH A;  1FVI A;  1Q7Y C;  1IYV A;  2NVQ H;  3U4Z A;  3I4M H;  2A1A A;  5FO8 B;  2A74 C;  3X3N A;  1GAB A;  2RGO A;  4YCW A;  1QVC A;  2KRU A;  3I91 A;  2ENB A;  1A3U A;  1JQY D;  4B3S L;  3P20 A;  3CU7 A;  2RRU A;  2EE1 A;  4R8N A;  2A69 D;  5T1G A;  1I94 Q;  3K0X A;  3SMP A;  1PH2 A;  3Q8G A;  3K2L A;  1STB A;  1T5X D;  4HIO A;  2EYH A;  3ZCB B;  3W3A A;  1LTB D;  4DR1 M;  2LWX A;  3JAM i;  4JI2 M;  2R92 H;  2HAK A;  3F2C A;  1ILP A;  4GN5 A;  4ZK9 B;  3U58 A;  1IBM Q;  5C44 H;  1H6U A;  3O13 A;  3C2P A;  2HCI A;  1LTM A;  3M6A A;  1D0K A;  2G9D A;  2Y0S E;  1XYI A;  1G51 A;  5GQO A;  4AH6 A;  4AQY M;  3AEV A;  2P5T A;  5F3W A;  3CMA A;  4UPA A;  1XB2 B;  1TWG B;  1DOK A;  1F2L A;  2D0P A;  4DAV A;  3PMF A;  4JI3 Q;  3AMU A;  4QNM A;  1EU4 A;  5M9O A;  5ELD A;  4QY7 A;  3E5S A;  1OFI A;  5LL6 X;  3F2D A;  3NTK A;  4A3B G;  1QIL A;  2QHO B;  3WOF A;  5C44 B;  1IW7 D;  4LF6 L;  2Q2E B;  2LS0 1;  1AIP C;  2EY6 A;  1OXS C;  1LTG D;  5KGU A;  1SYC A;  3Q23 A;  3MJ5 A;  1PJI A;  3I4N H;  2X8A A;  2HCB A;  1S5F D;  3EJI A;  1K8O A;  4KTA A;  2R4E A;  4DV4 M;  5G3L D;  4LFC M;  2OQ4 A;  3HKZ B;  4LGM A;  3U60 A;  3FTF A;  5H37 D;  3I2Z A;  5FOB B;  4DR5 M;  3HOX G;  2I5M X;  3GP7 A;  4C3I H;  3NQT A;  1FR3 A;  2D9U A;  3VA7 A;  1NMF A;  4L5Q A;  2C96 A;  5IYC H;  2QA4 A;  4IOA A;  4LJ8 A;  1TWF H;  3B9P A;  1UFZ A;  2VL6 A;  5EPK A;  2LTU A;  2FMM A;  2HWJ A;  3I4O A;  1OIZ A;  3KBG A;  3I01 M;  4PDI A;  4BBR G;  4X64 L;  3KDF B;  1SE8 A;  2DY7 A;  2SEB D;  3I4M B;  3R2I A;  1XNR M;  3GTG H;  3HU2 A;  1RCV D;  2CHQ A;  1KLU D;  2Z7J A;  1H9S A;  3TSS A;  3GTO H;  2MO0 A;  3GLI E;  2KCC A;  1KDB A;  3IEC A;  2JP7 A;  3E46 A;  4X65 L;  2F0N A;  2KCT A;  2WSE F;  2D62 A;  1TY2 A;  3BZK A;  3E21 A;  3KLS X;  4HTH A;  1I4Q A;  4EIW A;  5C0X G;  1QWY A;  3R93 A;  1WIV A;  3PNY A;  1N77 A;  3NUC A;  5K36 G;  1WJ7 A;  1JMC A;  1C0A A;  5A35 A;  2JA6 H;  5JPN C;  5COY A;  2MPM A;  2G8L A;  2OTJ A;  4L6T B;  4LRS A;  3TP8 A;  1YUB A;  1W3S A;  2K14 A;  1E0B A;  3ULP A;  3H09 A;  2OPF A;  4DV4 Q;  4QNR A;  1UNS A;  5KRU A;  1PZJ D;  1F9S A;  2CW0 C;  3G7L A;  2ZTD A;  3SK5 A;  5IP9 G;  1TR8 A;  4X3S A;  5DM6 3;  4JI1 Q;  5FJ8 G;  3HZX A;  5M5Y H;  4FXD A;  5KNC A;  7CAT A;  3V76 A;  3LCU A;  3FMC A;  3R3O A;  4JW0 A;  4Q0F A;  1D8L A;  3H15 A;  1Z5C A;  1SR3 A;  2KEC A;  2AKW B;  4I7A A;  3BS1 A;  2YNM D;  3HHX A;  1H9S B;  2RA4 A;  2X69 A;  2MGW A;  5E1F A;  5ELF A;  3K7A H;  4DV0 Q;  2Z9H A;  4JBK A;  2EJF C;  1BCP C;  3KP1 E;  1NO1 A;  1I94 L;  1MI2 A;  4FCT A;  3HOZ H;  4G6Z A;  1GOZ A;  4DK0 A;  1A5T A;  3CCV A;  2XN9 C;  1RF2 D;  3A55 A;  3AQQ A;  3QAU A;  3DUZ A;  3VK8 A;  2FFJ A;  4JI2 Q;  5D14 A;  1JOQ A;  2NUC A;  3A8J E;  4G57 A;  2F52 A;  3ER0 A;  2JSO A;  2N88 A;  4YY3 M;  3E9H A;  4ZRZ A;  3STB D;  3HOW H;  5KQ8 A;  4WRD A;  3SC3 A;  4JI6 L;  3ZC7 B;  4LF7 M;  2VF8 A;  4HN7 A;  5CBA E;  2DAI A;  1SNQ A;  4ZQ3 A;  4AYB G;  1EQR A;  3RFW A;  4RKU F;  4LJ6 A;  2PW7 A;  5CV6 A;  4JN6 A;  4HID A;  4GIP A;  3AKZ A;  3I4V A;  4A3J B;  4MTK A;  5KO3 A;  2WFW A;  4DUY L;  2B2T C;  1WHC A;  5IYD G;  1TWH B;  3FVQ A;  4REZ A;  3ZYY X;  4X62 M;  1JJ2 A;  4OON A;  5EKI A;  4DR1 Q;  1YNJ D;  1WD0 A;  3U9O A;  3RLN A;  1X3P A;  2F0T A;  1QQW A;  3I90 A;  1SJH D;  1NBW A;  1S5E D;  1ML0 D;  4O42 A;  1G6P A;  1EQQ A;  5EP1 A;  1KAA A;  3G71 A;  2CCZ A;  1Y1W G;  1I6V C;  4C56 C;  4NMZ A;  2YU9 B;  2L11 A;  4F88 A;  2HUG A;  1B4O A;  1JB3 A;  4JI5 L;  4FF4 A;  5EBD A;  1CI3 M;  2ZBK B;  5EQ0 A;  3JAM S;  1VQL A;  3L2P A;  2G5D A;  2A8V A;  3HOX B;  1L1O B;  1P3Q Q;  1EY7 A;  5L8R F;  1DO0 A;  2L12 A;  3NWT A;  1Z5A A;  1PJT A;  1B50 A;  1L1O A;  4KLN A;  5ITX A;  4MGI E;  4OL7 A;  4R1J A;  2EYM A;  4RKB A;  2UXB M;  3BBZ A;  1QUQ B;  3EFX D;  1VF5 C;  4HL4 A;  4AKG A;  2F5S A;  3A8I E;  4A3F B;  3VDP A;  1EEI D;  2I5L X;  2DZO B;  1IXS B;  3FTE A;  3WDN A;  1Y8N B;  4A3J H;  3F92 A;  4TVA B;  2LNH C;  3FPP A;  5C5M A;  4FWG A;  4R3D A;  3U61 A;  1SNO A;  5ITT A;  3HOY B;  4BBS B;  1MJE A;  4K8I A;  3T53 B;  3KDS E;  4LF5 M;  1IKL A;  1C9O A;  4Z8X A;  1CKM A;  1TS5 A;  4DR5 L;  3GLF A;  4LF4 M;  2JA7 H;  4IUR A;  3AOG A;  1OXX K;  4Z9C B;  4LFC L;  1AE3 A;  3V05 A;  1ZMW A;  2XEP A;  3HWS A;  1X3F A;  5JEA J;  2JZ0 A;  3M7N A;  2JY6 B;  1Q86 C;  2RSN A;  3J7A 5;  1V33 A;  3RN2 A;  4JV5 Q;  4DV7 Q;  3SDZ A;  1VS0 A;  4LUO A;  1CKO A;  4LMQ D;  4A3B H;  4RCN A;  2YR0 A;  1PH6 A;  3NBI A;  5ELN A;  1ZEQ X;  3AV0 A;  4K0K Q;  4GKJ L;  2N55 A;  1BNZ A;  2KNV A;  5C4X B;  4DV7 M;  4FF3 A;  5M5W H;  1D2B A;  2ZXO A;  3TQS A;  1MGS A;  2B2Y C;  2R62 A;  3UE1 A;  2R46 A;  1LM0 A;  2BDO A;  3A54 A;  2UUB Q;  1HR0 Q;  2CFO A;  1ASY A;  4DR5 Q;  2WB1 G;  3PO3 H;  1L2F A;  2MJ8 A;  3T56 B;  4JK1 C;  1B44 D;  3SAT A;  4GC9 A;  4TQU S;  1I4R A;  2EY5 A;  5IWA Q;  5C3E G;  3CC4 A;  1ZYR D;  3RNU A;  4JI2 L;  3PO3 B;  1FNW A;  1HZA A;  4OWW B;  4C2M B;  4P75 A;  3ZH9 B;  4WFN 3;  1FGU A;  5I6W A;  3F2B A;  2XNA C;  1A2U A;  4G4N A;  4NSR A;  5EXT A;  2FOI C;  3A56 A;  4JI0 Q;  4GN3 B;  1MN3 A;  3U6O A;  1ZYR C;  5FO7 B;  3HG9 A;  1QVF A;  2KDL A;  3PUW A;  5LMN Q;  4F2L A;  4LW1 A;  1PDQ A;  1IN6 A;  3T4A C;  3Q22 A;  3OTO M;  3WHK A;  1N34 M;  3SK6 A;  2DN8 A;  1M8A A;  3I73 A;  2ICE C;  5IYB G;  2L9H A;  2PPB C;  4A3K B;  4KKU A;  1PMR A;  4N9T A;  2Y0Q A;  2ZJQ A;  5M3M H;  1G71 A;  4H02 A;  2E2J H;  5I9P A;  2R7Z B;  2Z8L A;  4DR4 M;  2PNH A;  4DK6 C;  3K5O A;  3DLL A;  1TVX A;  3BDC A;  4XQQ A;  1GVP A;  1Q8K A;  1TQO A;  3D4R A;  3MXN B;  1HNZ Q;  1JOR A;  1AEX A;  1LT4 D;  2KXE A;  4IOC A;  2B63 G;  1EFW A;  4B08 A;  3K57 A;  1T3T A;  1A3T A;  1STE A;  2A6E D;  3KLS A;  1BUV T;  1AFP A;  4LJ9 A;  1N32 Q;  3RMH A;  2X49 A;  1PZK D;  1IYJ B;  3JC6 6;  3FKI G;  1DV0 A;  1UE7 A;  5ITX E;  2JA5 H;  1PRT C;  4DR4 L;  1VQP A;  3C1F A;  4AYB E;  1OAI A;  3DM1 A;  2H1R A;  1SMY D;  2BDN A;  2DWM A;  1VG5 A;  4YWM A;  3VR5 A;  3OIQ A;  1SYG A;  3C9P A;  5IE8 A;  3A74 A;  4TSS A;  4OWX B;  2MUY A;  1QAQ A;  4IBI A;  2KCN A;  4MN3 A;  3TN2 A;  3OW2 A;  4B3M L;  2IX3 A;  3FE3 A;  2B2W C;  1NV9 A;  1XNQ Q;  2C9C A;  3FUU A;  3K7U C;  4DPG A;  1WGN A;  5EPJ A;  1GL7 A;  3KS8 A;  2EIF A;  2JZ1 A;  3I55 A;  2FS1 A;  4KLK A;  1R6B X;  2AHM A;  2ZJR A;  1U4L A;  4XGI A;  4KHP L;  4JI8 Q;  4DXG A;  4QUF A;  1VQI A;  1NCV A;  3HU3 A;  2EDG A;  3P75 A;  3J81 j;  4PMW A;  5CV9 A;  3SAU A;  3EN2 A;  4Y28 F;  4PMB A;  1UAP A;  2EYJ A;  1IM2 A;  3K5N A;  2B8F A;  3KVW A;  2L1B A;  4HAE A;  1ZAE A;  1PTO F;  1PRT B;  3T15 A;  3TWK A;  4LJA A;  1STY A;  2K52 A;  4JBW A;  5M3F B;  2K0B X;  2WAQ G;  3HKZ G;  4P71 A;  4NXM L;  2BNK A;  2W82 A;  1VQH A;  4DUZ M;  5M5Y B;  1F2M A;  5EP3 A;  1D5X C;  4K0K M;  2NVY H;  2WAQ E;  1HNX Q;  3W0F A;  4IBK A;  1Q12 A;  1VQO A;  2NVQ B;  4A4I A;  4DR2 L;  1EY6 A;  2NYZ D;  2LXJ A;  3RLO A;  4GKJ M;  1IXZ A;  3TME A;  3I51 A;  5C4H A;  3MFG A;  3VKG A;  1UE1 A;  2KQ3 A;  3HY5 A;  1JR3 E;  4C1N K;  3K7A B;  2MFI A;  4X3K A;  4MGZ E;  2ES2 A;  4RF0 A;  4LF6 M;  1JB7 A;  3NE5 B;  1Q3C A;  2UXC M;  4DAM A;  2HCC A;  3FUX A;  2RKS A;  4A3I H;  4LFB L;  1LYL A;  2R18 A;  1V43 A;  4JI4 L;  3MA2 B;  2F4V L;  1EY5 A;  4DR3 M;  5EXS A;  3UGJ A;  4DV3 M;  1SEB D;  2P5Z X;  1STH A;  2KZU A;  1VQ7 A;  3K58 A;  1VQ8 A;  3TE6 A;  1FNV A;  1LT3 D;  4OEL B;  4AW4 A;  1LT5 D;  3SMS A;  2R6G A;  3I3C A;  2ZJP A;  3VR3 A;  3DOA A;  4A3E B;  1B9M A;  4M0W A;  4QGU A;  4IBE A;  2WAQ B;  5HGT A;  1IW7 C;  3PIO 3;  2QW7 A;  4CIS A;  5GRO A;  4QOS A;  5IOC A;  4HMI A;  1ZMU A;  3G4S A;  1KAB A;  2F0U A;  2EYF A;  2Z8Y M;  3NEN A;  3QIA A;  5FLM G;  3GRU A;  2X6L A;  4IBC A;  1ET6 A;  4JC0 A;  2F0K A;  1TH4 A;  5LL6 S;  4APV A;  3GQ4 A;  3EIH A;  3U6C A;  5EQT A;  4A76 A;  5EAY A;  3SFZ A;  2R44 A;  1PFS A;  2EYO A;  5IGC A;  2DAE A;  1F77 A;  1Q81 C;  1O7I A;  2MH8 A;  1NNJ A;  4L15 A;  4LZJ A;  1TY0 A;  3K5M A;  4L6V 6;  4DXF A;  1BDO A;  4RA8 A;  4DR7 Q;  4CGY B;  1TS4 A;  1N8R C;  5I2X A;  3FKE A;  1QZH A;  5M3M G;  2I07 B;  1K3W A;  3MFY A;  4DAY A;  1ESR A;  3PNV A;  4JI1 L;  1IBM M;  4JI7 L;  4GC5 A;  2CWP A;  1XJV A;  4B3T Q;  4BY7 H;  5C3E H;  5AJ3 Q;  3HOU H;  3M4Q A;  3H91 A;  3HJQ A;  1EQV A;  2NVY B;  4UP9 A;  3QJY A;  2WKC A;  2UU9 L;  1N32 M;  2I0Q A;  4R9W A;  1NJF A;  1QAM A;  1G8P A;  1EIG A;  1CT1 D;  3H0G B;  3Q6S A;  1JT8 A;  3J80 S;  1MX0 A;  2ZAN A;  4JI8 M;  2EJM A;  2EOT A;  3BZC A;  3GRY A;  1PTO C;  1R4P B;  3FTC A;  4FNF A;  4JI0 L;  3KBX A;  4GLA C;  3A45 A;  2JUJ A;  3J2P B;  2JA7 B;  4ZUJ A;  4J15 A;  5NUC A;  4RGM A;  2E5L Q;  2JE6 I;  2Q8I B;  4KD4 A;  1SFO B;  4R8I A;  2N78 A;  4LF4 L;  1L0Y B;  2AUJ D;  4JOI C;  1KSF X;  2O5J C;  3NK9 A;  4LF9 L;  5EXX A;  1VEG A;  4A3M H;  2ASB A;  2R0I A;  2BJV A;  1YEZ A;  3DWQ A;  4KHP Q;  2AMC B;  3MEF A;  3PV0 A;  4L4U A;  2RSO A;  4JBM A;  2Y0S B;  1R4Q B;  3B7Q A;  4X66 M;  2V1C C;  4GHL A;  2CH4 A;  5TSS A;  4A3J G;  1HJP A;  1SNC A;  5GKN A;  5KPZ A;  4NXN M;  1FNN A;  4QHT A;  1J5E M;  1XX8 A;  1SYE A;  1HQC A;  3M4O H;  2E2J B;  2NWG A;  3C58 A;  1HZB A;  3KSJ A;  1AW7 A;  3CW2 C;  4GKK Q;  4C2M H;  2A6H D;  1VMC A;  4DR4 Q;  1T43 A;  3CHB D;  5I9O A;  2PYK A;  3L28 A;  5BPV A;  3W1B A;  4DUY Q;  3DEP A;  2KED A;  4PDG A;  4GHA A;  1SRO A;  1VQ4 A;  4ID6 A;  1J6Q A;  3U9S A;  1X3G A;  5JPM C;  3MHV C;  2N49 A;  3ITP A;  5EKL A;  4B3M Q;  4CJ6 A;  1O80 A;  4AQY Q;  1L2C A;  1IN5 A;  1E24 A;  2AWN A;  3QB3 A;  2CRU A;  1TII D;  5LMN M;  3RLF A;  3PF5 A;  2DNC A;  3TDQ A;  1LV7 A;  3TZD A;  2Z4R A;  1YJW A;  1PGY A;  1LTR D;  5C6A A;  1M4V A;  2UUC M;  2QQ8 A;  3FRH A;  1DOM A;  4CDE C;  5M3M B;  1M1K C;  3CF0 A;  5CV5 A;  2N8N A;  5KQD A;  1OIP A;  1EEF D;  1EY0 A;  4X64 M;  5DYG A;  3OMG A;  2GVB A;  4AKH A;  2KVM A;  4LJZ C;  3FTD A;  5ELO A;  4ZAI A;  2R45 A;  3ZQJ A;  1EWH A;  4POF A;  1BCP B;  3H3V H;  5FLX S;  3PIP 3;  2LKV A;  2KJX A;  4CKC A;  1RKN A;  3KOZ E;  2CHG A;  4FWD A;  4GZY C;  1IY2 A;  2L4E A;  4GLV B;  4PNY A;  1CUK A;  3UJN A;  5BN5 A;  3A7L A;  1EIF A;  2RQX A;  1I6H B;  2UUB M;  1X65 A;  3SAW A;  2Z6K A;  2BH8 A;  1BO0 A;  2F4V Q;  3CCL A;  1S3S A;  3K1J A;  1I5F A;  1X3Q A;  2AHO B;  1R9T H;  1VEK A;  2IPK D;  5ITR A;  2BWB A;  5E3F A;  1TR5 A;  4WJ3 M;  3C46 A;  4BWG B;  1W6K A;  3M3Y H;  2F0S A;  1QDT A;  2OXP A;  1PH1 A;  2GQF A;  1PH4 A;  1HR0 W;  3TS2 A;  1SMX A;  1YVC A;  1IKM A;  1U4M A;  1LTL A;  1K28 A;  2KEN A;  1KNE A;  2KHJ A;  4JVZ A;  5C4X H;  3RGS A;  3SYK A;  4HJ7 A;  2WB1 B;  3PVS A;  1YIT A;  2JXM B;  2NZ1 D;  2QNJ A;  2XRQ D;  4IAL A;  1UEA B;  4GKJ Q;  1V34 A;  1XMO M;  4QCL A;  3H94 A;  2F0J A;  2OCE A;  4RFB A;  3GPX A;  1EWI A;  5GAH C;  3FPU B;  1HR0 L;  1CHP D;  3GRR A;  1SYB A;  3KYH C;  2R61 A;  2XGT A;  3K92 A;  2BE5 D;  4DNR B;  2DVW B;  5IRE B;  3BJU A;  4X65 M;  3OIP A;  1AUA A;  4DN4 M;  4X66 Q;  3SBJ A;  1K3B C;  1MU5 A;  1YSY A;  4GH9 A;  2DGY A;  1OTC A;  3K81 C;  1Z59 A;  1QNK A;  1O78 A;  2UUA Q;  3EBE A;  4LF8 M;  4IPC A;  5LMN L;  3ERO A;  2HL7 A;  3VR4 A;  4P16 A;  2B2Y A;  1JE4 A;  3E0J A;  1MD2 D;  4Y7N B;  2QCU A;  5CMD A;  2B29 A;  3J27 B;  1OXV A;  2K6B A;  2F5O A;  4HIM A;  4BBR B;  5IP9 H;  3W1G A;  5KIX A;  4IIW A;  4R7G A;  1AZQ A;  4IFD J;  4OO1 H;  3HHY A;  3STB C;  4A3L G;  1NVM A;  1QAN A;  3QOJ A;  1NSN S;  4M9Z A;  1OXT A;  4DV6 L;  1II3 A;  4B3R M;  4LF8 Q;  1WXQ A;  3U61 B;  4LAA A;  4JPB W;  1DZ1 A;  4IBF A;  3NPP A;  3SHF A;  5FSW A;  2KOL A;  1IXR C;  1LTA D;  2F0W A;  2RBM A;  4J8Q A;  3GP1 A;  2K5Q A;  5C0X H;  4C3I G;  1HRJ A;  2L5T A;  1X32 A;  2DWZ B;  2CH4 W;  3LX0 A;  3CC7 A;  2GVA A;  2QIL A;  5M3F H;  4GN4 B;  2UUB L;  1TGU A;  2ZTC A;  4UHV A;  1D2N A;  2YU9 H;  5E6J A;  4ODG A;  1XHB A;  4L5T A;  1PJJ A;  4X65 Q;  2FHT A;  2QEJ C;  5HGQ A;  3UMM A;  1A62 A;  2K6A A;  1K83 B;  1O7Y A;  1IZ6 A;  3RZD H;  2N3S A;  4V0B A;  3S2D B;  4EVO A;  2BWE A;  2JXN A;  1VQE A;  1NSF A;  2NZO A;  3K8A A;  2N35 A;  4YWK A;  4LFA Q;  4HIK A;  5IYC G;  4A3M B;  1RD9 D;  1TWH H;  2HQE A;  3N6R A;  5FLX E;  2L4F A;  4L78 A;  1EOT A;  4M9S A;  1TT2 A;  4POG A;  1WTO A;  1I3Q H;  3T38 A;  3J7Y W;  1WOC A;  3BVZ A;  1LAC A;  1LAB A;  4I65 A;  4B3M M;  2I7N A;  2K05 A;  5DLQ E;  1EIH A;  3H4M A;  1EYG A;  1SDF A;  1TU2 B;  4ZPX A;  1WI5 A;  2A19 A;  4C3I B;  4M0D A;  1H95 A;  2K4K A;  4IUT A;  3VDU A;  1A2T A;  1QYR A;  2UU9 M;  1GO3 E;  4TRD A;  2H1E A;  1GUO A;  1E9R A;  1H9R A;  2JA8 B;  2AQ1 B;  2XSZ D;  3MC0 B;  1HUN A;  4XBO A;  2JA5 B;  1TWC B;  1KDC A;  1A0I A;  4JI1 M;  5DNY A;  4LF5 Q;  2D7G A;  1JIC A;  4IZ8 A;  4KKT A;  4LJ4 A;  1OAO C;  4U68 A;  3PUV A;  3HOV G;  3JR5 A;  2CWA A;  2HIV A;  4X3T A;  5IGB A;  1TKW B;  3AYH B;  1PH5 A;  3GPU A;  3NEM A;  2M60 A;  1DYQ A;  1JE5 A;  1HFN A;  1T6O A;  2FE8 A;  2B2W A;  1HHV A;  4DNI A;  2OQK A;  4AQY L;  5IT9 E;  1ICF B;  4HJ9 A;  1JJG A;  1MSG A;  4PT5 A;  3LWU A;  5L37 A;  1HCZ A;  1N33 L;  4LK1 C;  1PH7 A;  2I46 A;  3GDE A;  1H9J A;  4MTN A;  3NSW A;  4QIW E;  2DWL A;  3S16 H;  2KHS A;  2EXZ A;  2HDM A;  1BCP D;  3K59 A;  2F0O A;  1D5Z C;  3TL4 X;  4BY1 G;  1IL2 A;  1IBK M;  4UY8 C;  1KLG D;  1NJG A;  4Q7J A;  2YFQ A;  3PGZ A;  4S3S A;  2O5R A;  3BU2 A;  5GAE C;  3LW5 F;  3DHQ A;  2Y0T A;  3K8Z A;  2HD3 A;  4CJ0 B;  2KCM A;  1WR1 B;  2VNU D;  2D7H A;  1FNU A;  1J5E Q;  4B7G A;  1CQV A;  2LXE A;  4FCV A;  3LGJ A;  1QDR A;  2CFM A;  3NWL A;  4X62 Q;  3JAM c;  2K75 A;  3HOZ B;  4LWC A;  2Y21 A;  4K8J A;  1PRB A;  1U0L A;  1Z9F A;  2DHY A;  1M90 C;  2YQZ A;  2SNM A;  3U5Z B;  4NSO B;  2IX0 A;  3S1Q H;  3K6O A;  4LRT A;  1DGG A;  4DV0 M;  1GHJ A;  1OJL A;  1B3Q A;  3AJI B;  4JI7 M;  4EQO A;  1IBM L;  2Z0S A;  1QG7 A;  1JWS D;  1YJN A;  2DI0 A;  2PMZ E;  5IYB H;  1KIX A;  2K5W A;  1WYD A;  2MP1 A;  1A3V A;  4BXX H;  1L2B A;  3K9P A;  4I8O A;  1TWC H;  2IHE A;  3QYB A;  1VQD A;  5DEH A;  3KDF A;  4DF7 A;  4I5S A;  1NR4 A;  1DJR D;  4DKA C;  1WTX A;  3DA1 A;  4PD2 A;  3FRP B;  2LHC A;  2DJF C;  4ME5 A;  1D6E C;  3NEL A;  2K5N A;  3U50 C;  5AJ3 L;  4RMF A;  4I7Z C;  4K5W A;  5K5P A;  2LVQ D;  4A93 G;  4QL5 A;  1F9Q A;  5KND A;  4LUV A;  4O0A A;  3GTP H;  1Z5B A;  1Q1E A;  1PFM A;  3AU7 A;  4X66 L;  1UE6 A;  2WV6 D;  1HPC A;  4PG3 A;  3KF6 A;  4XXE A;  3CP0 A;  2R92 B;  4DV1 M;  1VDZ A;  2O4X A;  3DEO A;  2DKL A;  2VQF Q;  3G48 A;  1HNZ L;  3FUW A;  1XTD A;  3KOJ A;  1JB0 F;  2OOA A;  4OVZ B;  3KXE C;  1BKB A;  1EYC A;  3V96 A;  4LF7 L;  3KFU A;  1LV9 A;  2PZU A;  4CDF C;  2R3Z A;  2IX1 A;  2Q2H A;  2CEA A;  1PLF A;  3GTP B;  2Z4H A;  1SFO H;  2SDF A;  4JI4 M;  2K1B A;  1PH3 A;  1B70 B;  2DNA A;  3CQZ H;  4OO1 I;  4NRV A;  2EKK A;  2WZJ A;  4LZZ A;  3RGP A;  3T1H M;  2K9D A;  3FKI H;  3IFT A;  3I70 A;  1WD1 A;  2HKJ A;  2E75 C;  4UDU C;  4I81 A;  1U4P A;  3RR5 A;  1IBK L;  4B3S Q;  3HOV B;  2NTS A;  3GD7 A;  3GLG E;  4D80 A;  4UN2 B;  1VQC A;  4TKO B;  1Z6H A;  4X3U A;  4IPD A;  3QWN A;  4A3D G;  2R4J A;  1TS3 A;  3QR8 A;  5FTN A;  4L16 A;  4AKI A;  1ZQ9 A;  3DXJ C;  4MIU A;  4P72 A;  1G6Z A;  3CXC A;  3ILK A;  5DFL A;  3KLR A;  4XT3 B;  4H0L C;  2Z3X A;  4R4I A;  3S9W A;  3HP3 A;  4IUU A;  2K04 A;  1XMQ M;  3U6S A;  2ICI A;  4EGV A;  2F0E A;  4G7O C;  3RZD B;  1ET9 A;  5D3I B;  3J80 L;  4HCE A;  4K6L A;  5IWA M;  1NY4 A;  4UAI A;  4NXM M;  1C4Q A;  1EZ8 A;  1IN4 A;  1G59 A;  1LO5 D;  1LTS D;  4OWT B;  5J1Z A;  3N52 A;  5FTK A;  2R7Z G;  3L27 A;  4YHH Q;  3NBH A;  3F8T A;  5ISR A;  5C1B A;  1A63 A;  4IBJ A;  3ERQ A;  3KF8 B;  2KEB A;  1JC7 A;  2F0M A;  2R93 G;  1WTP A;  4L8R C;  1GUG A;  4B9W A;  1Z7T A;  2XWJ B;  4XIG S;  4ZKB B;  4B3R Q;  2B63 H; 
#chains in the Genus database with same CATH homology
 4DAP A;  3HOW B;  5IT9 S;  2B8G A;  4MGY E;  4BA2 I;  1DOL A;  4U67 3;  1GUW A;  3M4Y A;  5JI2 E;  4RHR A;  4F8M A;  1IY0 A;  3IAY A;  3AOE A;  4G4Q A;  1BQQ T;  4A3V B;  1G8Z D;  3ND8 A;  2XZF A;  2RDF A;  1I94 M;  1STA A;  4OHJ A;  2F0H A;  3OWE B;  3D8B A;  4IFD G;  5ELC A;  1IL8 A;  2EPB A;  1FGB D;  5E26 A;  3MEH A;  4KHV A;  3PXG A;  3SAS A;  3K0Y A;  4GRI A;  2A69 C;  2J7N A;  2UXD M;  3J81 E;  2M2L A;  5ITY A;  3VYU A;  1HQY E;  2ZXP A;  2NVX B;  2BA0 A;  2VXW A;  4B7H A;  1F2Z A;  3EA6 A;  1GJX A;  4JI5 M;  1ICW A;  1L8Q A;  2EA0 A;  5JI3 E;  4C1N I;  4KY5 A;  3TPZ A;  2OT2 A;  4DNT B;  2B39 A;  1WTQ A;  2L4N A;  1XC8 A;  2BE5 C;  5FTJ A;  3HGB A;  4RHS A;  5C0X J;  4CKB A;  4IUV A;  2KEE A;  1EU3 A;  3AOE C;  3MAQ A;  2ZAM A;  3GTL B;  1N36 M;  3SE0 A;  1FYC A;  4J1M A;  2L7I A;  2NBF A;  3FD9 A;  2F0G A;  2F0L A;  2F03 A;  1VF7 A;  3A98 B;  3FYD A;  3MXU A;  3PO2 B;  5A2Q E;  3GTQ B;  1C1K A;  4NRW A;  4GMQ A;  3KFU G;  4WJW A;  3S14 B;  4DR6 M;  1I4P A;  2F3V A;  2AUK A;  3OOC A;  1K3X A;  3KUP A;  3VK7 A;  4QB4 A;  2QBY B;  2DZN B;  2R65 A;  2F5N A;  3G6J B;  3DMU A;  3UI2 A;  3BOS A;  3J80 E;  2PZW A;  3BDO A;  3A8K E;  4I4L A;  4KJN A;  1T5E A;  5J22 A;  1W6J A;  2XZU A;  5JVH 3;  3D8G A;  2J4X A;  5EP4 A;  5IZ7 D;  3EIE A;  4XQJ A;  3GO5 A;  3CF6 E;  1L1T A;  3DZD A;  4DR2 M;  5DAU A;  1ILQ A;  2CHB D;  4KY7 A;  1DGH B;  1B3A A;  1ENF A;  3CRK C;  2NTT A;  4KK7 A;  3S2H B;  5BN4 A;  3MXN A;  4M9X A;  2DNE A;  4KY6 A;  1R2Z A;  2EVB A;  1EY8 A;  4Z6Y A;  3R8F A;  4KD3 A;  1B53 A;  5CV4 A;  3RUZ A;  2NN6 I;  1FJG M;  3L29 A;  2A68 C;  4RGO S;  3SAR A;  3Q24 A;  1CQF A;  3LNN A;  3HJS A;  4IBD A;  4IUP A;  5COR A;  3GQB A;  5DYI A;  1HUM A;  1EY9 A;  4A3D B;  2KA7 A;  4K2K A;  3VYR A;  2PMZ B;  4WUR A;  1A6X A;  5KYL A;  3GPY A;  3J81 S;  1SXJ E;  5JEA G;  3BG3 A;  5A2Q L;  1OO9 B;  2F0I A;  4AG6 A;  4RNA A;  1V1O A;  3GTG B;  2JP1 A;  4JXJ A;  1UM8 A;  3LVW A;  4DA2 A;  4ZUI A;  4EQN A;  4L63 B;  2IL8 A;  4BY7 B;  1N33 M;  5JOB A;  3I4Y A;  2A73 B;  3LMM A;  5JAV A;  3JAM L;  3EQL C;  1R2Y A;  3GLI B;  4FF1 A;  3TP6 A;  2Y20 A;  3U6L A;  5CYU A;  5IIF A;  3SAV A;  3KOW E;  4LG2 A;  1DON A;  2Q8T A;  3NHH A;  1IN8 A;  2F0V A;  1QNU A;  5K36 H;  1H9K A;  1SE2 A;  4KN4 C;  3BVM A;  2WKD A;  3SR1 A;  4KOD A;  5M5W B;  2C98 A;  4ILW A;  1DXM A;  1SSO A;  2X4A A;  2F4I A;  2F5P A;  1EQT A;  1ESF A;  4IN3 A;  2L09 A;  2TSS A;  2F0D A;  1RHP A;  3A7A B;  2NN6 H;  3OW7 A;  2DHR A;  4HCS A;  2XF3 A;  3C1E A;  4TUW A;  4J6H A;  2X6G A;  1QZM A;  3L25 A;  2F0Q A;  2K01 A;  4DV5 M;  1RDP D;  4RKL A;  2PO4 A;  2EJG C;  2QDB A;  1E9S A;  3FUT A;  5LMU M;  4FCW A;  2MGS A;  1I50 B;  4QF4 A;  1VMP A;  4IBG A;  3ND9 A;  5I6Y A;  4V19 0;  2K28 A;  1JCK B;  4DU9 A;  2JEA I;  4XQN A;  2B2U C;  1AP0 A;  2BOS A;  5CC4 A;  2XSZ A;  1HR0 M;  2PZT A;  3GV3 A;  1YNN D;  5BR8 M;  1I3Q B;  3QG1 A;  5DM7 3;  2J7Z A;  4G4O A;  1TWA B;  4IJF A;  2F3W A;  2XFT A;  1Y8P B;  4FWH A;  3SK8 A;  2QP9 X;  4QOZ C;  1EYD A;  2KA6 B;  2LY7 A;  3HU1 A;  4MGH A;  1GUS A;  1QB5 D;  3KSX A;  4FP5 D;  3LQQ A;  2G9H D;  4XYO A;  2R93 B;  1EFI D;  2LMC B;  4IJE A;  1SXT A;  3U6D A;  3BYY B;  3MZ5 A;  8CAT A;  4BY1 B;  1EE8 A;  1PZI D;  2CHV A;  2RKO A;  4K14 A;  5C4Z A;  2DXI A;  3GLF B;  3UK6 A;  3QOL A;  3S1R B;  1GVN A;  1H9M A;  2I7P A;  3LQR A;  3KOX E;  1LTT D;  5I4D A;  4OGQ C;  2IT1 A;  2E2H B;  1EL0 A;  1WTW A;  1Y1V B;  1JR3 D;  2Z1C A;  3SVM A;  2E2I B;  1GUT A;  3GPP A;  1CM9 A;  1D1I A;  4KN7 C;  1PFN A;  5AFW A;  5KPR A;  4CHT B;  4K2L A;  2OF1 A;  1BR9 A;  1F9P A;  4FW9 A;  3J81 L;  3HOU B;  1Q1B A;  1WTR A;  1CZG A;  5A2Q S;  1PRT F;  1KDA A;  1HA6 A;  4QUC A;  5LHY 1;  2XSC A;  2XH9 A;  3D4D A;  4BA1 I;  3RE8 A;  3PUZ A;  2BJW A;  1DO2 A;  3QWL A;  3SK4 A;  4FF2 A;  1PM5 A;  1W5S A;  3KP0 E;  3Q0A A;  1SYF A;  1N75 A;  3FDT A;  4FVM A;  2B2T A;  2XIW A;  5EKK A;  3U6E A;  2NQ8 C;  2TMP A;  3E9S A;  5KPT A;  3X3M A;  3M3Y B;  3NTI A;  1ENC A;  2B2V C;  2EY2 A;  4W5W A;  2QCP X;  3JAM E;  3GV6 A;  1SBB B;  3HJ8 A;  1Y69 U;  3BDL A;  1EZ6 A;  1BF4 A;  1EYA A;  1OXU A;  3S15 B;  3SYL A;  2YYZ A;  4B3S M;  2RDH A;  3IFD A;  3HKP A;  3TZU A;  4LF9 M;  1XWI A;  4IUQ A;  4M1U B;  2K47 A;  1D1K A;  1SYD A;  1ZKO A;  3CTW B;  5J39 A;  1NUC A;  3UZU A;  2A6E C;  1B9N A;  4PCZ A;  4LY6 A;  3TP7 A;  2VUM B;  4JI3 M;  4FYD A;  2VQF M;  1O7Z A;  2SNS A;  3MVV A;  3HHW A;  4RAU C;  2C5C A;  2CV1 A;  2FFK B;  3OPO A;  3R9X B;  1R7R A;  3OSO A;  1NHG C;  2EYL A;  2GA4 B;  3HGI A;  2CV0 A;  2K03 A;  1I4W A;  3KW6 A;  1ENA A;  4G4K A;  1U9R A;  3E6Z X;  3MXG A;  5IGF A;  5M5X B;  5IT9 L;  3MWY W;  2M00 A;  1G29 1;  1X37 A;  4RWS C;  1GKI A;  2EUC A;  1LTI D;  3GTM B;  1HT1 E;  1J09 A;  3JR4 A;  4A3G B;  3Q8X A;  3R8B A;  3L26 A;  3MTS A;  1AN8 A;  2SOB A;  2KUM A;  3GO8 A;  1SE3 A;  2NVT B;  1KFV A;  2DY8 A;  4A93 B;  1HQM C;  3PUY A;  4IBB A;  2IJ0 A;  3FKI B;  3P1H A;  4NDX A;  4IFD I;  1SAP A;  3VR2 A;  4BS9 A;  4BBA A;  4H13 C;  3VA5 A;  5JVG 3;  4YIJ A;  1TS2 A;  4CJ1 B;  2PNR C;  2FIN B;  1FD7 D;  2LH0 A;  1L1Z A;  4PQX A;  4L8J A;  5C4J B;  1SND A;  4C3J B;  1VDD A;  1IY1 A;  4OVZ A;  3HHZ A;  3D3R A;  4MH0 E;  4C3H B;  5C3E B;  3U6P A;  4K5X A;  1C48 A;  4B7F A;  1E2Z A;  3M7G A;  1W5T A;  1C8C A;  3WOE A;  3I72 A;  1PTO D;  1KNA A;  2EY1 A;  4JV5 M;  1N78 A;  2XRS D;  4AG5 A;  4OX9 M;  4DR7 M;  2G5G X;  4KKS A;  1HTP A;  1HT2 E;  5C0X I;  4DV2 M;  1JWU D;  2Q8R E;  3SHL A;  4H44 C;  1RJT A;  1PRT D;  4WOR A;  1SE4 A;  4GKK M;  4KO8 A;  4DK1 A;  1NAP A;  5KNB A;  3D8L A;  3LWE A;  3CQZ B;  4NKL A;  1JR0 D;  4E6I A;  3KOY E;  1RTO A;  5T1I A;  2HHH M;  1A15 A;  2C9O A;  2AWO A;  4ULL A;  5JEA H;  2D2C C;  1MBY A;  3T51 B;  4MGK E;  2CVR A;  3T1Y M;  2B63 B;  2EZV A;  3OHX C;  4OIK A;  3SXH A;  3T13 A;  4B9X A;  5F2D A;  4YHH M;  3GLG B;  3TBI B;  2C99 A;  1I4H A;  2VII A;  3R2T A;  1VCI A;  3IG8 A;  5EBC A;  1G6Z A;  2LFN A;  1G91 A;  2A5H A;  1XTC D;  1BCP F;  4BB9 A;  4G4R A;  2D7E A;  1UUP A;  4M8A A;  3NTH A;  2XGN A;  5KEE A;  1Q90 A;  2IWH A;  4LGY A;  1SJE D;  1PFB A;  5FK9 C;  3S16 B;  4OU7 A;  1SXJ B;  2J0T D;  2NN6 G;  2IW3 A;  4DV6 M;  4OO1 G;  2WIN B;  1S5B D;  5KYI A;  1NY5 A;  2L0C A;  1Z47 A;  2JA6 B;  1SXJ A;  1NNU C;  2O5I C;  2F1M A;  1HNX M;  1L0X B;  4CKE A;  3GQ5 A;  1QJO A;  4O1N A;  2K7V A;  1KTK A;  2CE7 A;  1HTL D;  3V2T A;  5IGD A;  4QIW B;  3DFZ A;  5ELB A;  1SXJ C;  4FXG C;  1K8M A;  5FLX L;  2F0P A;  3LVV A;  5ELE A;  4DUY M;  1DCZ A;  4KHP M;  5C18 A;  2JA2 A;  1EY4 A;  5FTM A;  3NP8 A;  3GLG A;  1JQJ C;  1TWF B;  4KHZ A;  3S1N B;  1YNN C;  3FUV A;  2E76 C;  1JR3 A;  2QF7 A;  4IQZ A;  2K32 A;  4NOO B;  2UUA M;  1TH3 A;  3WHL A;  2ZXR A;  1CTM A;  1AZP A;  3CF2 A;  1QAO A;  5I2Y A;  2VB2 X;  3EVQ A;  1GUN A;  1GLN A;  4HR7 B;  4OIJ A;  2JYO A;  2ID0 A;  1PYW D;  1E2V A;  2E2D C;  4A3I B;  4G7Z C;  5ITU A;  1KYI A;  1HQR D;  2E5L M;  3PUX A;  3S1Q B;  3GRV A;  1V1P B;  2PQE A;  3TP5 A;  2J7O A;  4KI0 A;  1XXH A;  2O2L D;  4N9P A;  1TDH A;  1QE6 A;  1GHK A;  5CR3 A;  4XDX A;  1JOO A;  4ITQ A;  1SMY C;  3TWM A;  1DGH A;  3GTO B;  1ONL A;  1PTO H;  4EQP A;  2MHV A;  1V1P A;  2HDL A;  1O7L A;  1JOK A;  2CQA A;  1WCM B;  4IFD H;  1CHQ D;  3IG5 A;  3K5L A;  1G2S A;  1F9R A;  2B2U A;  1QVR A;  1TH2 A;  2VQE M;  5DNF A;  5ITQ A;  2QBY A;  1J7K A;  5E4X A;  2FMC A;  1B2T A;  3AFH A;  4ZYS A;  4F7X A;  4AI6 A;  4LFA M;  2VB3 X;  5E4W C;  2RGH A;  4QMG A;  5BN3 A;  3NXW A;  4G7H C;  2OEO A;  4HSP A;  5C5L A;  3I4L A;  1B1Z A;  4CBV A;  1L2D A;  4QHS A;  3DWP A;  1STN A;  4OW0 A;  3OWF A;  1G41 A;  1J9O A;  3S17 B;  3M0E A;  4KJO A;  1NR2 A;  3PFI A;  5G3L F;  1LLR D;  1J8I A;  3AL0 C;  3S1M B;  2KW0 A;  3E4R A;  4A3B B;  2EO2 A;  2ZT9 C;  2A5Y B;  3BYT B;  2FNA A;  1QOH A;  1Y1W B;  2RVL A;  3VLF B;  2CUZ A;  1Q8I A;  1GXD C;  2PW5 A;  4DGZ A;  4CJ2 C;  3NWS A;  3HRZ C;  4RGT A;  1HA5 A;  4KV6 A;  1NHW C;  3GLH B;  4Q5V A;  4LJ5 A;  5FTL A;  3H6M A;  1JWM D;  2EYP A;  3BVG A;  1QCB D;  1E2W A;  2Z4I A;  3VR6 A;  2D5D A;  2WP8 J;  2PCF B;  1IHZ A;  4AYB B;  1G2T A;  3AB9 A;  3D31 A;  3MHB A;  4RCO A;  3IKJ A;  1OFH A;  1DM0 B;  3A46 A;  4ZKC B;  3VFD A;  1ROD A;  1IQP A;  5CV8 A;  2JEB I;  4F87 A;  1ORY B;  3I8Z A;  1DGF A;  3U60 B;  2V1U A;  3VKH A;  1CK1 A;  1S5C D;  1E94 E;  4C3J G;  3GLH A;  2F4V M;  3MXP A;  1HNW M;  1F2Y A;  1YNJ C;  2KRK A;  2QZ4 A;  3GTJ B;  5JJZ A;  4JYA M;  3L7Z C;  1HFG A;  4JI0 M;  5CGK A;  3THG A;  4NL4 H;  3D6C A;  3KK7 A;  2QEN A;  1XXH B;  3I4N B;  3FYC A;  2F0F A;  4BLC A;  2CV2 A;  3H3V C;  2BA1 A;  3KF8 A;  1IYU A;  1IN7 A;  3QO2 A;  2E74 C;  1ZXT A;  5IGG A;  1CZW A;  2B2V A;  3RD4 A;  3J7A V;  2XFS A;  3M85 A;  4HMJ A;  1DD2 A;  4RGN A;  3URY A;  1Q39 A;  1U4R A;  2WAC A;  3U6M A;  5FO9 B;  3M4O B;  4B3T M;  1XWE A;  1GL6 A;  1SNP A;  2L6O A;  1CA5 A;  5EJC A;  4HED A;  2H4O A;  4MM3 B;  3L2A A;  3NQI A;  2WII B;  3MK6 A;  5EPL A;  4K6D A;  1D5M C;  3C3L A;  4D82 A;  2V6Z M;  5EP2 A;  3L3O C;  4C3H G;  1WTV A;  5CBE E;  3U5Z A;  1NY6 A;  5IGE A;  5C3X A;  3TWL A;  3HS0 C;  4P2C B;  4H7B A;  2ERC A;  4RH6 A;  4DFA A;  3W0L B;  4FO2 A;  1Z6T A;  1HNZ M;  2CW0 D;  4MHE A;  2XLJ A;  1E32 A;  4LFB M;  3T16 A;  4WW0 A;  5FKA C;  3J7B A;  1I4X A;  3SEB A;  5HUR A;  2K5D A;  4RF1 A;  3IL8 A;  5EGT A;  4FD2 A;  2ZM6 M;  3L9A X;  5CV7 A;  4XT1 B;  4HLQ A;  1S4Z A;  1EWC A;  3A42 A;  3D4W A;  4K5V A;  3P7J A;  2A68 D;  3GTK B;  2M5Z A;  3J7A F;  2XWB B;  1S5D D;  4XYQ A;  2V4D A;  1I4G A;  4IUN A;  1TDZ A;  3OMC A;  1STG A;  1XNQ M;  4FXK C;  4MB7 A;  1HXY D;  4ZLT F;  1SXJ D;  3RZO B;  1XXG A;  1K82 A;  2Z4S A;  2ZAO A;  1G4A E;  3FEW X;  4KMU C;  5D3D A;  3W2D A;  1DGB A;  3J7A S;  2L55 A;  3BZD B;  4HSV A;  4LCB A;  3KS4 A;  2A6H C;  2QKI C;  1LT6 D;  2F5Q A;  1SNM A;  4PMC A;  1V8Q A;  2K33 A;  3ONA B;  3F2U A;  3VYT A;  4JI6 M;  1BBX C;  4PV1 C;  3VYS A;  2V1C A;  2BCO A;  1PXU A;  2L7H A;  3HEJ A;  4NW2 A;  2AQ3 B;  2NB0 A;  1IBL M;  1Q3L A;  1G3I A;  1YE9 A;  2QPA A;  5EXP A;  4D81 A;  3U6Q A;  5EJW A;  3D6W A;  1BOS A;  4II7 A;  4ABN A;  2C5R A;  4S12 A;  2XVS A;  3CRL C;  1PTO B;  1BXT A;  4GIT A;  3DWA A;  4LJ7 A;  1CFM A;  1WVL A;  4AZF A;  1CA6 A;  5C3W A;  2FJ2 A;  2M9V A;  2AQ2 B;  3CKI B;  1RTN A;  3SHG B;  3GQ3 A;  2RDG A;  4NP5 A;  2DWN A;  1Q3B A;  5D65 A;  4XTC S;  1Y8O B;  1R9T B;  2KZS A;  3GLI A;  5IOD A;  1MSH A;  1IYV A;  5FO8 B;  2A74 C;  3X3N A;  2RGO A;  2KRU A;  3I91 A;  2ENB A;  1A3U A;  1JQY D;  3P20 A;  3CU7 A;  2EE1 A;  4R8N A;  2A69 D;  5T1G A;  3SMP A;  3K2L A;  1STB A;  1T5X D;  2EYH A;  3ZCB B;  3W3A A;  1LTB D;  4DR1 M;  2LWX A;  4JI2 M;  1ILP A;  4ZK9 B;  1H6U A;  3O13 A;  3C2P A;  2HCI A;  3M6A A;  2G9D A;  1XYI A;  4AQY M;  2P5T A;  5F3W A;  1TWG B;  1DOK A;  1F2L A;  4DAV A;  3PMF A;  3AMU A;  4QNM A;  1EU4 A;  5M9O A;  5ELD A;  5LL6 X;  3E5S A;  1OFI A;  3NTK A;  1QIL A;  3WOF A;  5C44 B;  1IW7 D;  2Q2E B;  2LS0 1;  2EY6 A;  1OXS C;  1LTG D;  5KGU A;  1SYC A;  3Q23 A;  3MJ5 A;  1PJI A;  2X8A A;  2HCB A;  1S5F D;  3EJI A;  1K8O A;  4KTA A;  2R4E A;  4DV4 M;  5G3L D;  4LFC M;  2OQ4 A;  3HKZ B;  4LGM A;  3U60 A;  3FTF A;  5H37 D;  5FOB B;  4DR5 M;  3GP7 A;  3NQT A;  1FR3 A;  2D9U A;  3VA7 A;  2C96 A;  4LJ8 A;  3B9P A;  5EPK A;  2FMM A;  3KBG A;  4PDI A;  2DY7 A;  2SEB D;  3I4M B;  3R2I A;  1XNR M;  3HU2 A;  1RCV D;  2CHQ A;  1KLU D;  2Z7J A;  1H9S A;  3TSS A;  2KCC A;  1KDB A;  2F0N A;  2D62 A;  1TY2 A;  3KLS X;  4HTH A;  1I4Q A;  4EIW A;  5C0X G;  1QWY A;  3R93 A;  3PNY A;  1N77 A;  3NUC A;  5K36 G;  5A35 A;  5JPN C;  5COY A;  2MPM A;  2G8L A;  4L6T B;  4LRS A;  3TP8 A;  1YUB A;  1E0B A;  3H09 A;  2OPF A;  4QNR A;  1UNS A;  5KRU A;  1PZJ D;  1F9S A;  2CW0 C;  3G7L A;  3SK5 A;  5DM6 3;  4X3S A;  3HZX A;  4FXD A;  5KNC A;  7CAT A;  3FMC A;  3R3O A;  4Q0F A;  1Z5C A;  2KEC A;  3BS1 A;  2YNM D;  3HHX A;  1H9S B;  2RA4 A;  2X69 A;  5E1F A;  5ELF A;  2EJF C;  1BCP C;  3KP1 E;  1MI2 A;  4FCT A;  4G6Z A;  1GOZ A;  4DK0 A;  2XN9 C;  1RF2 D;  3A55 A;  3QAU A;  3DUZ A;  3VK8 A;  2FFJ A;  5D14 A;  1JOQ A;  2NUC A;  3A8J E;  4G57 A;  2JSO A;  2N88 A;  4YY3 M;  4ZRZ A;  5KQ8 A;  4WRD A;  3SC3 A;  3ZC7 B;  4LF7 M;  4HN7 A;  5CBA E;  1SNQ A;  4ZQ3 A;  3RFW A;  4LJ6 A;  2PW7 A;  5CV6 A;  4JN6 A;  4GIP A;  3AKZ A;  3I4V A;  4A3J B;  5KO3 A;  2B2T C;  1TWH B;  3FVQ A;  4REZ A;  3ZYY X;  4X62 M;  5EKI A;  1YNJ D;  1WD0 A;  3U9O A;  1X3P A;  2F0T A;  1QQW A;  3I90 A;  1SJH D;  1S5E D;  1ML0 D;  4O42 A;  5EP1 A;  1KAA A;  1I6V C;  4C56 C;  4NMZ A;  2YU9 B;  2L11 A;  4F88 A;  2HUG A;  1B4O A;  1JB3 A;  4FF4 A;  5EBD A;  1CI3 M;  2ZBK B;  5EQ0 A;  3JAM S;  3HOX B;  1EY7 A;  1DO0 A;  2L12 A;  3NWT A;  1Z5A A;  1B50 A;  4KLN A;  5ITX A;  4MGI E;  4OL7 A;  2EYM A;  4RKB A;  2UXB M;  3EFX D;  1VF5 C;  4HL4 A;  4AKG A;  2F5S A;  3A8I E;  4A3F B;  3VDP A;  1EEI D;  2DZO B;  1IXS B;  3FTE A;  3WDN A;  1Y8N B;  2LNH C;  3FPP A;  5C5M A;  4FWG A;  4R3D A;  3U61 A;  1SNO A;  5ITT A;  3HOY B;  4BBS B;  4K8I A;  3T53 B;  3KDS E;  4LF5 M;  1IKL A;  1TS5 A;  4Z8X A;  3GLF A;  4LF4 M;  4IUR A;  3AOG A;  1OXX K;  4Z9C B;  3V05 A;  2XEP A;  3HWS A;  5JEA J;  3M7N A;  2RSN A;  3SDZ A;  4LMQ D;  4RCN A;  2YR0 A;  3NBI A;  1ZEQ X;  3AV0 A;  2N55 A;  1BNZ A;  5C4X B;  4DV7 M;  4FF3 A;  1D2B A;  2ZXO A;  3TQS A;  1MGS A;  2B2Y C;  2R62 A;  2R46 A;  2BDO A;  3A54 A;  2CFO A;  2MJ8 A;  3T56 B;  4JK1 C;  1B44 D;  3SAT A;  4GC9 A;  4TQU S;  1I4R A;  2EY5 A;  1ZYR D;  3PO3 B;  1FNW A;  4C2M B;  3ZH9 B;  4WFN 3;  5I6W A;  2XNA C;  1A2U A;  4G4N A;  4NSR A;  5EXT A;  2FOI C;  3A56 A;  3U6O A;  1ZYR C;  5FO7 B;  3HG9 A;  3PUW A;  1PDQ A;  1IN6 A;  3T4A C;  3Q22 A;  3OTO M;  3WHK A;  1N34 M;  3SK6 A;  2DN8 A;  1M8A A;  3I73 A;  2ICE C;  2L9H A;  2PPB C;  4A3K B;  4KKU A;  1PMR A;  4N9T A;  2Y0Q A;  5I9P A;  2R7Z B;  2Z8L A;  4DR4 M;  3K5O A;  1TVX A;  3BDC A;  4XQQ A;  1TQO A;  3D4R A;  1JOR A;  1AEX A;  1LT4 D;  2KXE A;  4B08 A;  3K57 A;  1T3T A;  1A3T A;  1STE A;  2A6E D;  3KLS A;  1BUV T;  1AFP A;  4LJ9 A;  3RMH A;  2X49 A;  1PZK D;  5ITX E;  1PRT C;  3C1F A;  3DM1 A;  2H1R A;  1SMY D;  2BDN A;  2DWM A;  3VR5 A;  3OIQ A;  1SYG A;  4TSS A;  2MUY A;  1QAQ A;  4IBI A;  2KCN A;  4MN3 A;  3TN2 A;  2IX3 A;  2B2W C;  2C9C A;  3FUU A;  5EPJ A;  1GL7 A;  3KS8 A;  1R6B X;  2AHM A;  1U4L A;  4XGI A;  4DXG A;  4QUF A;  1NCV A;  3HU3 A;  2EDG A;  3P75 A;  4PMW A;  5CV9 A;  3SAU A;  4PMB A;  1UAP A;  2EYJ A;  1IM2 A;  3K5N A;  2B8F A;  3KVW A;  2L1B A;  4HAE A;  1ZAE A;  1PTO F;  1PRT B;  3T15 A;  3TWK A;  4LJA A;  1STY A;  4JBW A;  5M3F B;  2BNK A;  2W82 A;  5M5Y B;  4DUZ M;  1F2M A;  5EP3 A;  1D5X C;  4K0K M;  3W0F A;  4IBK A;  1Q12 A;  2NVQ B;  1EY6 A;  2NYZ D;  4GKJ M;  1IXZ A;  3TME A;  3I51 A;  5C4H A;  3MFG A;  3VKG A;  2KQ3 A;  4C1N K;  3K7A B;  4X3K A;  4MGZ E;  4RF0 A;  4LF6 M;  3NE5 B;  1Q3C A;  2UXC M;  2HCC A;  3FUX A;  2RKS A;  1V43 A;  2R18 A;  3MA2 B;  1EY5 A;  4DR3 M;  5EXS A;  3UGJ A;  4DV3 M;  1SEB D;  1STH A;  2KZU A;  3K58 A;  3TE6 A;  1FNV A;  1LT3 D;  4AW4 A;  1LT5 D;  3SMS A;  2R6G A;  3I3C A;  4A3E B;  3VR3 A;  3DOA A;  1B9M A;  4M0W A;  4IBE A;  2WAQ B;  5HGT A;  1IW7 C;  3PIO 3;  4CIS A;  4QOS A;  5IOC A;  4HMI A;  1KAB A;  2F0U A;  2EYF A;  3QIA A;  3GRU A;  2X6L A;  4IBC A;  1ET6 A;  2F0K A;  1TH4 A;  5LL6 S;  3GQ4 A;  3EIH A;  3U6C A;  5EQT A;  3SFZ A;  2EYO A;  5IGC A;  1F77 A;  1NNJ A;  4L15 A;  4LZJ A;  1TY0 A;  3K5M A;  4DXF A;  1BDO A;  4RA8 A;  4CGY B;  1TS4 A;  5I2X A;  3FKE A;  2I07 B;  1K3W A;  3MFY A;  4DAY A;  1ESR A;  3PNV A;  1IBM M;  4GC5 A;  3H91 A;  3HJQ A;  1EQV A;  2NVY B;  3QJY A;  2WKC A;  1N32 M;  4R9W A;  1NJF A;  1QAM A;  1G8P A;  1EIG A;  1CT1 D;  3H0G B;  3Q6S A;  3J80 S;  1MX0 A;  2ZAN A;  4JI8 M;  2EJM A;  2EOT A;  3GRY A;  1PTO C;  1R4P B;  3FTC A;  4FNF A;  3KBX A;  3A45 A;  3J2P B;  2JA7 B;  4ZUJ A;  5NUC A;  4RGM A;  2JE6 I;  2Q8I B;  4KD4 A;  1SFO B;  4R8I A;  1L0Y B;  2AUJ D;  1KSF X;  2O5J C;  3NK9 A;  5EXX A;  2BJV A;  3DWQ A;  3PV0 A;  4L4U A;  2RSO A;  2Y0S B;  1R4Q B;  4X66 M;  4GHL A;  5TSS A;  1SNC A;  5GKN A;  5KPZ A;  4NXN M;  1FNN A;  4QHT A;  1J5E M;  1XX8 A;  1SYE A;  1HQC A;  2E2J B;  2NWG A;  3C58 A;  3KSJ A;  1AW7 A;  2A6H D;  1VMC A;  3CHB D;  5I9O A;  2PYK A;  3L28 A;  5BPV A;  3DEP A;  2KED A;  4PDG A;  4GHA A;  4ID6 A;  3U9S A;  5JPM C;  3MHV C;  3ITP A;  5EKL A;  1O80 A;  1L2C A;  1IN5 A;  2AWN A;  3QB3 A;  1TII D;  5LMN M;  3RLF A;  2DNC A;  3TDQ A;  1LV7 A;  3TZD A;  2Z4R A;  1LTR D;  5C6A A;  1M4V A;  2UUC M;  1DOM A;  5M3M B;  3CF0 A;  5CV5 A;  5KQD A;  1EEF D;  1EY0 A;  4X64 M;  5DYG A;  3OMG A;  4AKH A;  2KVM A;  4LJZ C;  3FTD A;  4ZAI A;  2R45 A;  1EWH A;  1BCP B;  5FLX S;  3PIP 3;  2LKV A;  2KJX A;  4CKC A;  1RKN A;  3KOZ E;  2CHG A;  4FWD A;  4GZY C;  1IY2 A;  4PNY A;  3UJN A;  5BN5 A;  3A7L A;  2RQX A;  1I6H B;  2UUB M;  3SAW A;  1BO0 A;  1S3S A;  3K1J A;  1X3Q A;  2IPK D;  5ITR A;  5E3F A;  1TR5 A;  3C46 A;  4BWG B;  1W6K A;  2F0S A;  2OXP A;  1IKM A;  1U4M A;  1KNE A;  3RGS A;  3SYK A;  2WB1 B;  3PVS A;  2JXM B;  2NZ1 D;  2XRQ D;  4IAL A;  1UEA B;  1XMO M;  4QCL A;  3H94 A;  2F0J A;  4RFB A;  3GPX A;  3FPU B;  1CHP D;  3GRR A;  1SYB A;  2R61 A;  3K92 A;  2BE5 D;  4DNR B;  2DVW B;  5IRE B;  4X65 M;  3OIP A;  4DN4 M;  3SBJ A;  1MU5 A;  1YSY A;  4GH9 A;  1Z59 A;  1QNK A;  1O78 A;  4LF8 M;  3ERO A;  2HL7 A;  3VR4 A;  4P16 A;  2B2Y A;  1JE4 A;  3E0J A;  1MD2 D;  4Y7N B;  2QCU A;  5CMD A;  3J27 B;  1OXV A;  2F5O A;  4BBR B;  5KIX A;  4IIW A;  4R7G A;  1AZQ A;  4IFD J;  4OO1 H;  3HHY A;  1NVM A;  1QAN A;  3QOJ A;  4M9Z A;  1NSN S;  1OXT A;  1II3 A;  4B3R M;  1WXQ A;  3U61 B;  4LAA A;  1DZ1 A;  4IBF A;  3NPP A;  3SHF A;  5FSW A;  2KOL A;  1IXR C;  1LTA D;  2F0W A;  2RBM A;  4J8Q A;  3GP1 A;  2K5Q A;  5C0X H;  4C3I G;  1HRJ A;  2L5T A;  1X32 A;  2DWZ B;  3LX0 A;  2QIL A;  1TGU A;  1D2N A;  5E6J A;  4ODG A;  1XHB A;  1PJJ A;  2FHT A;  2QEJ C;  3UMM A;  2K6A A;  1K83 B;  1O7Y A;  4V0B A;  3S2D B;  4EVO A;  1NSF A;  4A3M B;  1RD9 D;  2HQE A;  3N6R A;  5FLX E;  4L78 A;  1EOT A;  4M9S A;  1TT2 A;  1WTO A;  3T38 A;  3J7Y W;  3BVZ A;  4I65 A;  1LAC A;  1LAB A;  4B3M M;  2I7N A;  2K05 A;  1EIH A;  3H4M A;  1SDF A;  1TU2 B;  4ZPX A;  4C3I B;  4M0D A;  4IUT A;  4TRD A;  3VDU A;  1A2T A;  1QYR A;  2UU9 M;  2H1E A;  1GUO A;  1E9R A;  1H9R A;  2JA8 B;  2AQ1 B;  2XSZ D;  3MC0 B;  1HUN A;  4XBO A;  2JA5 B;  1TWC B;  1KDC A;  4JI1 M;  5DNY A;  2D7G A;  1JIC A;  4IZ8 A;  4KKT A;  4LJ4 A;  4U68 A;  3PUV A;  3JR5 A;  4X3T A;  5IGB A;  1TKW B;  3GPU A;  2M60 A;  1DYQ A;  1HFN A;  2FE8 A;  2B2W A;  1HHV A;  5IT9 E;  1MSG A;  4PT5 A;  3LWU A;  1HCZ A;  4LK1 C;  2I46 A;  1H9J A;  3NSW A;  2DWL A;  2KHS A;  2EXZ A;  2HDM A;  1BCP D;  3K59 A;  2F0O A;  1D5Z C;  3TL4 X;  1IBK M;  1KLG D;  1NJG A;  2YFQ A;  4S3S A;  2O5R A;  3DHQ A;  2Y0T A;  3K8Z A;  4CJ0 B;  2VNU D;  2D7H A;  1FNU A;  4B7G A;  1CQV A;  2LXE A;  4FCV A;  3NWL A;  3HOZ B;  2Y21 A;  4K8J A;  2YQZ A;  2SNM A;  3U5Z B;  4NSO B;  2IX0 A;  3K6O A;  4LRT A;  1DGG A;  4DV0 M;  1GHJ A;  1OJL A;  3AJI B;  4JI7 M;  4EQO A;  1QG7 A;  1JWS D;  2K5W A;  2MP1 A;  1A3V A;  1L2B A;  4I8O A;  5DEH A;  4DF7 A;  4I5S A;  1NR4 A;  1DJR D;  1WTX A;  3DA1 A;  4PD2 A;  3FRP B;  4ME5 A;  1D6E C;  4I7Z C;  4K5W A;  5K5P A;  1F9Q A;  5KND A;  1Z5B A;  1Q1E A;  1PFM A;  3AU7 A;  2WV6 D;  1HPC A;  4XXE A;  2R92 B;  4DV1 M;  1VDZ A;  2O4X A;  3DEO A;  3FUW A;  4OVZ B;  3KXE C;  1EYC A;  3V96 A;  1LV9 A;  2PZU A;  2R3Z A;  2IX1 A;  2CEA A;  1PLF A;  3GTP B;  2Z4H A;  2SDF A;  4JI4 M;  2K1B A;  4OO1 I;  4NRV A;  4LZZ A;  3RGP A;  3T1H M;  3IFT A;  1WD1 A;  3I70 A;  2HKJ A;  2E75 C;  4UDU C;  4I81 A;  1U4P A;  3HOV B;  2NTS A;  3GD7 A;  4X3U A;  4D80 A;  4TKO B;  1Z6H A;  3QWN A;  2R4J A;  1TS3 A;  5FTN A;  4L16 A;  4AKI A;  1ZQ9 A;  3DXJ C;  4MIU A;  3ILK A;  3KLR A;  4XT3 B;  4H0L C;  2Z3X A;  3S9W A;  3HP3 A;  4IUU A;  2K04 A;  1XMQ M;  3U6S A;  2ICI A;  4EGV A;  2F0E A;  4G7O C;  3RZD B;  1ET9 A;  5D3I B;  3J80 L;  4HCE A;  4K6L A;  5IWA M;  4UAI A;  4NXM M;  1C4Q A;  1EZ8 A;  1IN4 A;  1G59 A;  1LO5 D;  1LTS D;  5J1Z A;  3N52 A;  5FTK A;  3L27 A;  3NBH A;  5ISR A;  5C1B A;  4IBJ A;  3ERQ A;  2KEB A;  1JC7 A;  2F0M A;  1WTP A;  4L8R C;  1GUG A;  4B9W A;  1Z7T A;  2XWJ B;  4XIG S;  4ZKB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...