4CHTB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex with bound calcium ion
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
215
structure length
215
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords DNA TOPOISOMERASE 3-ALPHA
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4chtB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4chtB02
3NBIA 4CHTB 4CGYB
chains in the Genus database with same CATH superfamily
1R2ZA 1HNXM 1KHIA 5IGGA 3U50C 4GNXB 1XNQQ 3JR4A 1MJCA 1OXSC 3OIPA 3DWQA 3BYYB 2R0IA 3FEWX 3IRBA 1IN7A 1VQ5A 1D7QA 2EYPA 2XRSD 3HG9A 2FS1A 3J81c 1A3VA 5IGCA 3J81i 1N34Q 1Q86C 1PH8A 1HNXL 3BVMA 1OXXK 4DR6M 5T1IA 4KT0F 2CFOA 2MR9A 2P5TA 3AOGA 4XBOA 4PZ6A 3CD6A 3OIQA 4RGMA 4DGZA 3I04M 2B2YA 3MTSA 4L4UA 1MKHA 3C1EA 1IN4A 4K5XA 3TSSA 1VQ1A 1Q3LA 3CAMA 3FMCA 4C3IB 1AZQA 4DR6L 3AEVA 2JY5A 1L2BA 3TP6A 4GNXA 3ULPA 2GQFA 3DMUA 5IYBG 2ERCA 4DXGA 4MN3A 4JI1M 3EIHA 2X69A 1C48A 3T1YQ 3TMEA 3CXCA 4DPGA 2XFTA 1SYEA 2Z9HA 4I4LA 4LGMA 4K8IA 1VQIA 2X4AA 1TWHH 3CCVA 2KHHA 1VQFA 2EKKA 1PTOC 3SATA 1SNQA 1OFHA 5FJ8H 3LVVA 4RG1A 3RGSA 1CQVA 4JI1L 2JJQA 2F4VQ 3M3YB 2F0WA 2JYOA 1PRTB 3I4MH 4DAYB 1HNZQ 5ELCA 1CZGA 2F0FA 4K8JA 1IBLM 1NSNS 1B7YB 3FUTA 5D65A 1TY0A 2I5MX 1JMCA 2D7EA 5C0XG 1D1IA 3TBIB 4UDUC 3HP3A 5I6YA 4UP9A 1NBWA 3S9WA 2KVMA 2EIFA 2D9UA 2V1CA 5BN3A 1CSQA 1IBLL 1SMYD 3HHZA 2SNSA 2OQ0A 2CRUA 1XXHB 5BN5A 3KS8A 2EYMA 1G51A 4MTNA 2RBMA 2P5ZX 4KHPM 1D5MC 5FLMG 1AZPA 4B3RQ 2JE6I 4POGA 3NSWA 1XXGA 1ESFA 4DAYA 3S17H 4ME5A 2NVXB 2CW0C 4KD3A 3QJYA 5A35A 3FYDA 5IY0A 1ML0D 2UU9Q 1VQKA 4KLKA 3TWKA 2ZJPA 4QUCA 2B2WA 4KHPL 3MXPA 4LJ6A 2Q2HA 4A3JB 2F0NA 1Y8GA 1CKOA 5KNDA 3MWYW 3D0FA 1XXHA 2BCOA 5JEAH 1VQ8A 1IN6A 1X9NA 5IYCH 1PJQA 3ZJYC 1CI3M 3FKEA 1F9PA 2JA2A 3FUWA 3KF8B 3PIPA 4GS3A 2KOLA 1K8OA 2LTUA 4BA1I 3AFPA 3D8BA 2MFIA 3G48A 1O7YA 3B7NA 5EXPA 3VR3A 1LACA 1LO5D 1S5CD 3R2IA 2DAGA 3GLHB 5M3MG 3FPUB 5DM73 4IUQA 5IT9c 2PPBC 5C5LA 3TZDA 1D0LA 2MO1A 4DV6M 3FYCA 2NN6I 4K0KQ 1NNUC 1LV9A 4NB3A 2APLA 3DA1A 3K92A 2N88A 1HA5A 2F52A 4RGOS 5EPLA 1DONA 4DR7M 2BH2A 3KF8A 1S5ED 1Q3CA 4DV6L 1DO2A 1QZMA 4C3IH 4W5WA 1SSOA 1J8IA 4FW9A 1JOOA 4JYAM 1A8VA 4YWMA 1QVGA 3MJ5A 3A98B 1V1PB 3CPWA 4DK1A 1T5EA 4DR7L 2N49A 3GLHA 1EU3A 1IKLA 2BNKA 4DK0A 2C5RA 2BWEA 3NTIA 1V33A 3I4OA 4LF6M 1V1QA 2JA6B 1PH5A 1JCKB 2ALYB 4PMCA 1UAPA 2B2YC 3H3VI 4JYAL 5EP2A 4KKUA 4LFAQ 4QL5A 3QOLA 4L16A 3FD9A 2D7HA 1JWSD 5C3EB 4GNXC 3M3YH 4EQPA 4LF6L 2WSCF 2VF7A 1EYAA 3PUXA 4X3SA 4A4IA 2CVRA 5ITYA 1SRUA 4HAEA 5BR8Q 3HY5A 2F0QA 3CMEA 1HNXQ 3S1MB 2KHJA 4FYDA 1Y8PB 1KABA 2OEOA 4GRIA 1PZID 5D3IB 2F3IA 4BBSG 1E2WA 2SNMA 2LHGA 1Q3BA 1U4PA 1Z7TA 1LYLA 1UE1A 1V1PA 3AKZA 2EYJA 4DK6C 2F5SA 3HOWG 2MHVA 1L2CA 5C4JB 4LMQD 3F2CA 2QEJC 3HKZB 1SNMA 2VL6A 4CJ0B 4LF9M 3L9AX 5M5XB 3E6ZX 3N52A 3KYHC 2EKFA 4BA2I 1KXLA 8CATA 3EJIA 4UAIA 1AUAA 3JAML 3SAUA 1MX0A 2IPKD 1GD7A 3PNVA 4XQNA 1Y69U 2A6HD 5JPNC 1NO1A 1KDAA 5JEAJ 1RF2D 2WKDA 4EX5A 2NVXH 1BOSA 1HT1E 4JVZA 5EP3A 4E6IA 4LF9L 4OHJA 2Q2EB 3QOJA 4GZYC 4RKUF 3R8FA 2V1CC 3ND9A 3FUUA 2F5OA 1GUWA 1KRTA 1KFVA 2XWJB 2N55A 2XGNA 4A3KG 1OJLA 1IFYA 4A3JH 1BCPF 1EIHA 4B3SQ 4HJ5A 3VKGA 3RUZA 3AQQA 3LX0A 1PRTC 5KEEA 1AW7A 2XTIA 5A2QL 3GQ5A 3G6EA 3OW7A 3VA7A 1YVCA 2G3QA 2GA4B 4QJFA 4KO8A 2B2WC 4DR3Q 3A8IE 1OFIA 4XQQA 4OIJA 4RKBA 1NY4A 1QANA 3PO2B 4MH0E 3HOXG 2QGQA 1HZAA 3RD4A 1V92A 2DUDA 2QW7A 3GPXA 4DR5Q 4PMWA 3E5SA 2RF4A 2CWAA 1H9RA 1EY7A 4H44C 3T53B 5I6WA 2DNEA 4LWCA 1HFGA 3U9OA 1EZ8A 3KS4A 2IX3A 2ZT9C 4DUYM 4BBRG 2ATWA 1NHGC 1AP0A 5TSSA 1TS4A 2HD3A 3J81E 5J22A 4OX9Q 5E7NA 4K2LA 2PO4A 3VYTA 4B9XA 4KHPQ 4LRSA 1QILA 4PZ7A 2K5HA 1XMQM 1EQQA 1IBKM 2K28A 5FO8B 4DUYL 4NL4H 1NR4A 2O25A 1SAPA 1RHPA 3K5OA 5HURA 1S5BD 4CJ2C 4DUZQ 4EIWA 4A3GG 4IFDH 2B2VA 1E9SA 2E2HB 1D6EC 2F0LA 1PFBA 5KQDA 3I4NG 3L2PA 4A3CG 3RMHA 2A68D 1XMQL 2KHIA 3X3MA 1Y1WB 1IBKL 1MD2D 4KN4C 3UE0A 2JA6H 2FJ2A 1ICFB 3VFDA 1B70B 3T56B 2HL7A 3CTWB 3DFZA 1IY0A 3LCVB 2WSEF 1PTOF 4CBVA 1WTRA 1BF4A 1Z47A 2R93B 1U4MA 1LT3D 2R7ZG 3PXGA 3RLNA 1SYBA 3NQIA 5C3EH 3HHWA 2PMZE 3E21A 2UUBM 1ZYRC 3B6YA 2IHEA 3F1ZA 1Z9FA 3QAUA 1OXVA 3FHWA 1PJIA 3S1MH 2DNCA 1NAPA 3PUVA 1NJIC 5ISRA 1STGA 2YQZA 2EJFC 2ZAMA 3DWPA 1Y1VB 1CFMA 2Q8IB 2UUBL 1QDTA 1QNUA 4IN3A 4DV6Q 1WHCA 5C4JH 1PH3A 1TKWB 4LFCQ 2EO2A 2YU9B 2G9DA 1PA6A 5LL6S 5M5XH 4CHTB 3NTHA 3W3AA 2JA8G 4LGYA 4HL4A 2JA5B 2VY3A 3Q8GA 3FE3A 2LVOC 1FL0A 2CP8A 2FE8A 5DNYA 1N75A 4BY1B 3ZCBB 2XSZD 1RKNA 5G3LF 3QIAA 3PUYA 5FLXc 5C4ZA 3VYRA 2WZJA 1JE5A 1DOLA 1E7ZA 1LTID 4JYAQ 1R4QB 1XPRA 2RDHA 1Z5AA 3MEHA 1U4RA 1NMGA 4P75A 4D81A 3GLGA 3H91A 3OSOA 4PQXA 1E32A 2D0PA 2Y0SB 3OTOQ 1R4PB 4B3TM 1CQFA 2XF3A 4A75A 4JI4Q 2RCNA 1V8QA 2QNJA 4ULLA 1MIUA 1PH7A 3T13A 4U68A 2Z8YM 4GIPA 1AN8A 1BUVT 3GTGB 2AMCB 4B3TL 4A93B 4ZUJA 3MFYA 4HCEA 3W1GA 3PO2H 4FCTA 1MGSA 2L09A 1EQRA 3B9PA 3PIOA 4RH6A 3LWEA 1IY2A 3GLFA 5LMUM 2K05A 5IGDA 1KNEA 1DYQA 3ULJA 4B7GA 1YHBA 4I5SA 1KDBA 1PFMA 3PIP3 1E0BA 2NZOA 4DU9A 5KPZA 1X6OA 1QAOA 4IFDJ 1YUBA 1IL8A 1EE8A 1WYDA 2YTYA 4LF9Q 4L5QA 3K8ZA 3MXGA 1WTQA 5IT9E 5LMUL 2YTVA 3OOCA 2R65A 4JV5M 4LFBQ 3GPUA 4XK8F 1Y1WG 3K59A 1TVXA 5I4DA 1D0MA 3OW2A 2KRKA 4BXXH 1GUGA 3T51B 2R93G 3A8KE 1G91A 2CH4W 2CEAA 2ZM6M 4KJNA 3KJOA 5KYLA 2KNZA 1KDCA 4JV5L 3HOUG 2E2HH 2NQ8C 3FKIB 3K7UC 5I9PA 2BDOA 3D3RA 1VEKA 2OOAA 5EXXA 3IL8A 3ONAB 1QVFA 1Y1WH 3TWLA 1UEBA 4V190 4I65A 1Q8KA 2ZM6L 3SARA 2R93H 1JWUD 4KKTA 3P7JA 4HSPA 2Z6KA 3PNYA 2KEBA 3U6DA 4ABNA 1XXHE 3TP5A 2B2VC 4JBWA 3C2PA 3RZOB 2L7HA 2K50A 4YHHQ 1EOVA 2F0OA 4M9ZA 1GKIA 1VDDA 4DV5M 2QQ8A 1DD2A 1TU2B 1Q12A 4DK3C 1M1KC 4JI2Q 2YFQA 1Y1VH 2X6GA 1L8QA 1CKMA 1ZV1A 3HGIA 3UJNA 3H4JA 2DI0A 3U6CA 4PCZA 2V6ZM 1UE6A 4LUOA 3IG8A 4R4QA 4GHLA 2L4NA 5D3DA 2O4XA 4DUYQ 3FRIA 4LF8Q 2YU9H 2CV0A 4DV5L 4JI6M 4YWLA 1BDOA 2BA0A 4RFBA 2HHHM 3G6JB 5DFLA 2JA5H 4XDXA 3GV3A 3PFIA 4NXNM 1NY6A 1XMQQ 4BY1H 1T3TA 2PYKA 1K3XA 2KDLA 1IBKQ 5FOBB 1H9JA 3QO2A 2J5YA 4GEWA 1C7YA 1P8LA 4RGNA 4JI6L 1VMPA 1VQAA 2HHHL 2D0OA 2JP7A 3LGJA 4NXNL 1MHWC 5E6JA 4MM3B 2C9OA 1EEID 2AQ3B 1PRTF 1ET6A 2QILA 3GLHE 2K0BX 2R44A 2AHOB 2F03A 1GKHA 1LUZA 2QF7A 2RRUA 1S5DD 5EGTA 3KW6A 1KAAA 3HKSA 1Q46A 3C1FA 4AKHA 2UUBQ 1GJXA 1ESRA 5EP1A 3GTGH 2VQFQ 3VK7A 1UEAB 2MO0A 4R4TA 1QB5D 2LXEA 4IJHA 4A93H 4X66M 1BVSA 2V4DA 3CPFA 5DEHA 2KA7A 1QAQA 3SDZA 1VQDA 4F2LA 1N36Q 2EE1A 1L1OB 1AEXA 4UY8C 3F2UA 3H4MA 1JB7A 1W6JA 1JJ2A 3J81S 3MK6A 2HIXA 1X55A 2I7NA 4X66L 2MGSA 3MHVC 1XX8A 2BE5D 4QY7A 3MMPA 1IBMM 3I01M 1RODA 5J39A 1EWHA 5JVG3 3BJUA 4DR4M 2Y0QA 5EJCA 2EJGC 2X8AA 4G4OA 3OYYA 1WD1A 4JI0M 2E5LM 3U6EA 2UUCM 1VS0A 2ENBA 2RDFA 3PUWA 1H9KA 1SMXA 1PJJA 2HDLA 2EJSA 1II3A 1IBML 2FH0A 4FWDA 5IIFA 4JI8M 4DR4L 1HCZA 2VQEM 3GTKB 1EFID 1L1OA 2BOSA 1DGSA 3FKIH 1D5ZC 4L5RC 4JI0L 1PVOA 2E5LL 2UUCL 1YJNA 5KPRA 4WP2A 2K14A 2NVQB 4FF3A 2UXCM 1A5TA 3WOFA 4B3TQ 4WW0A 4F7XA 1WTVA 2K5WA 4R8NA 4JI8L 1GABA 3B89A 1I6HB 2VQEL 4H02A 2JEAI 5J1ZA 3HKZE 2DNAA 1QYRA 1WGLA 4CJ6A 5IP7G 2EVBA 2F0IA 4ZKBB 2UXCL 3K1JA 3RZOH 4L8JA 1G41A 4C1NI 2L1BA 1DV0A 3U9SA 3TZUA 4AQYM 5IODA 3LW5F 2H1RA 1HZBA 2BWBA 4M9SA 3SFZA 4JCVE 1Q90A 3HOYG 2L0CA 2C5CA 2EZVA 3C3DA 2F0HA 3DLLA 4IIWA 2F5PA 2Z6KC 3NBIA 4HIOA 5D14A 2MROB 3GTJB 2UXBM 1I4PA 4AQYL 4GN5A 3GTLB 2NN6H 1ICWA 1EWCA 4RA8A 4IBDA 2KZUA 4XGIA 5FKAC 1CM9A 1CT1D 1GLNA 2CQOA 4MNOA 3IFTA 2UXBL 4AG5A 2OTLA 1G8ZD 5FTJA 4PZ8A 3T16A 1XTCD 4NW2A 3J80c 3OHXC 4QCLA 2LS01 3KDSE 5CV4A 2IL8A 1Q39A 1SNCA 2WV6D 4FF2A 2JXMB 5FLXE 2KENA 4NC6A 4ME3A 5BN4A 5HGTA 3GLIA 1KL9A 4X65M 3A46A 4GN3B 1BQQT 1HNWM 3A0JA 5L37A 4A3DB 1ASZA 1LT5D 1SXTA 3RE8A 4C3JG 2AWOA 1K8MA 3IFDA 3K6OA 1FNWA 4DFAA 4DV2M 5HY6A 1KSFX 3OWEB 4R1JA 2JA7B 4AKIA 3H3VH 1GOZA 4X65L 5DAUA 1JT8A 1SXJB 4OXPA 4JOIC 1HNWL 5ITTA 2EDGA 2H1EA 2EJMA 5DYIA 5LHY1 1S40A 4DV2L 1GXDC 1CZWA 3LNNA 2QKIC 5H1SE 3IECA 1EY0A 2OPFA 3H15A 2QEXA 1Q7YC 1YBYA 5IT9S 3HGBA 5HGQA 1HPCA 4CIZA 4QGUA 1PZKD 3W0FA 1A2TA 5EBCA 4NP5A 3B7ZA 3AFQA 3S1QB 1FR3A 2R92B 1E94E 1KNAA 4PNYA 2MGWA 4N9PA 1G291 3PIO3 5C4HA 2HHHQ 4LF4M 1ZAEA 2NWGA 1Q81C 2N35A 3KXEC 1D2BA 4R7GA 4RMFA 1SXJA 2XZFA 1R4GA 3CCUA 2OCEA 1JB0F 2RGOA 1P3QQ 2HIVA 2GN5A 4LF4L 1KC8C 1HQCA 3GTKH 2Q8RE 1DO0A 3O13A 5IWAQ 4HIKA 2NVQH 4ZCKA 4ZQ3A 4B3MQ 2XFSA 3H3VC 3GLGE 2DWNA 2R46A 4MGYE 3NELA 4KD4A 3VR2A 5FJ8G 1GVPA 1U9RA 4XQJA 4DV7Q 1I6HH 2R6FA 2Z6BA 2RQXA 1LABA 3I4MG 3MXNB 2I46A 1K73C 2L12A 2SOBA 2EQSA 3TP8A 4GC9A 1L1OC 1X65A 3SHFA 2EYHA 1Z5BA 4HN7A 3KUPA 3FDTA 2MNAA 1WVLA 1X54A 1DCZA 1G6PA 2KUMA 3HU1A 4KTAA 4OWWB 4A3IB 2JNHA 4HMJA 3N6RA 4N9TA 1RDPD 2JQOA 4OO1I 1F9QA 3FP9A 5I2YA 1RL2A 2MH8A 2K01A 2ZJRA 3S14B 2LWXA 3GLFE 2ID0A 1OIPA 3K0YA 3GTJH 4RF1A 4JBJA 5EJWA 1IW7D 1IBMQ 4X3UA 1W6KA 1OAOC 3GTLH 3JAMc 2D2CC 5EPKA 4DV4M 4FF1A 2ZTEA 3JAMi 2L2DA 3MXNA 3UDFA 3GQ3A 2PQAB 2UUCQ 2L7IA 1YIJA 3L29A 1I4XA 1R9TB 3I7FA 1E22A 2Q8TA 1K8GA 1TWFB 4PMBA 2XN9C 3M6AA 2WKCA 4JI8Q 5IP9H 2XNAC 3CQZB 2X49A 2VQEQ 4DV4L 4QNRA 3RFWA 3GV6A 4DKAC 1IYVA 2E76C 4ODGA 1IXSB 3BZCA 5JJIA 5JEAG 5JAVA 4A3DH 1NV8A 4UHVA 4OIKA 3J80L 3S2DB 1OQYA 4ZKCB 3T4AC 3UZUA 5T1GA 5IYCG 1SNDA 1OXTA 5ITXA 3OWFA 2QA4A 4HEDA 2R61A 4M8AA 3F2BA 4IBJA 3T38A 4DAMA 1I50B 2JA7H 1A63A 4DR2Q 1H6UA 5AJ3L 5E4WC 5CC4A 1CUKA 3R9XB 4IPCA 4H0LC 4AQYQ 1B1ZA 2F1MA 2WP8J 3ICEA 5EAYA 1VQGA 1ZMUA 2HCBA 4R4OA 4CDDC 2LBCA 2KHSA 3TPZA 3AL0C 2YR0A 3EN2A 4JXJA 2JZ1A 1B44D 5EKIA 2UXBQ 2R92H 3S1QH 4JN6A 2PZWA 3V05A 4CDEC 1HQMC 1GM5A 3D4WA 1O7LA 1H9MA 7CATA 4NXMQ 3HWSA 4C3IG 3BOSA 4LJAA 1NY5A 2QHOB 4EQOA 1N77A 2PZTA 3R2TA 1B4OA 1GUSA 2UXDM 4J15A 4DV0M 4WORA 1IXZA 2RDGA 3DXJC 1QE6A 1KRSA 3U5ZB 1XTDA 1U0LA 4LF5M 1EY6A 3V96A 1HNWQ 5EKLA 5IYDH 2DN8A 2UXDL 1TS5A 4DV0L 3PO3B 2KCNA 4DF7A 1SXJC 3MA2B 2F0DA 2H5XA 1MN3A 3CP0A 4AZFA 2CCZA 1XMOQ 3U4VA 4OVZB 4LF5L 1XPUA 3M4QA 1FVIA 1B53A 4WJ4A 1VQJA 1W5TA 3I4LA 1EIJA 3CKIB 2Z4SA 4A3IH 2QCUA 2R7DA 4LZZA 1WCMB 5ELBA 3A55A 4A76A 2CKZB 2VS1A 4LJ5A 1VQPA 3SYKA 4JPBW 3S14H 3AB9A 1ENFA 1AIPC 1XWIA 3SE0A 3L25A 4EGVA 3P75A 1FJGM 1XB2B 2LY7A 1E1OA 2NB0A 5GAHC 4IBFA 3CMAA 3A7AB 3AFHA 4OVZA 4NMZA 5EKKA 1AH9A 3BDOA 1GVNA 3FTEA 3U6LA 1TT2A 4FXKC 3KVWA 1VG5A 4ANRA 2O01F 5FLXS 3U60B 2K75A 4DXFA 5KNBA 1R9TH 4CKBA 4DR6Q 1TWFH 2I5HA 2F0PA 5C44B 4A3BB 1EYCA 2E74C 1HZCA 2I07B 1FJGL 2UUAM 4DV1M 3CQZH 4MIUA 4X3KA 1YHAA 1M8AA 4A3JG 1F9RA 1QNKA 1MU5A 2EYLA 4UPAA 1UUPA 4QOSA 3MZ5A 1FGBD 3TL4X 2AQ1B 4TQUS 3J7AF 1PDQA 1Z6HA 1BKBA 4ALPA 2UUAL 3S2DH 4DV1L 1Y8OB 3EA6A 4L5TA 1ILPA 4FP5D 4JI1Q 1HHVA 4LUVA 1QAMA 1I50H 1Z6TA 2JK8A 4X62M 1AE3A 1J6QA 4AYBB 3CC2A 5C18A 4ILWA 2IX1A 3U60A 1TXYA 2KCTA 3H0GB 1HRJA 4A3LH 2BH8A 4NDXA 5JPMC 4LJ8A 1TDHA 1TH2A 2RGHA 3M9BA 1ZEQX 4Z9CB 4ZRZA 1QCBD 1QZGA 4X62L 3C58A 4G4RA 3K5LA 1MJEA 1BBXC 1IBLQ 1NJFA 3GRVA 4L15A 1O80A 2F0EA 2QENA 3KDFB 1A3TA 5BPVA 3Q6SA 1SN8A 2WB1B 3S24A 1WIVA 4HIDA 3S2HB 3GO5A 5FTMA 4P72A 4KHVA 4DV4Q 1TIID 5M3FB 1BCPD 2EYOA 1I5FA 3L26A 5FTKA 5KO3A 3L3OC 2N8NA 4BY7B 1G3IA 2DJGC 1PJSA 4LCBA 1SNPA 1PM5A 4IFDG 2VF8A 1KLUD 2ZXPA 3FTCA 3EROA 3BG3A 4ID6A 1Y14B 2ZTCA 3K80C 4C56C 3UMMA 1YJ9A 2JA6G 2RVLA 5AJ3Q 2NUCA 1Q82C 2ASBA 2DAKA 3GLIE 3HX3A 1TWCB 4A3EB 3PO3H 3K81C 3KDFA 3X3NA 4GKKM 2K5VA 3NWLA 1K3WA 2K33A 5C3EG 4D82A 1Q02A 1STAA 1I6VC 5J3BA 2YYZA 4OGQC 5IGFA 4BS9A 1I3QB 2CHGA 3T6PA 2JSOA 2K5QA 1GHJA 2WAQB 2HAKA 3DEOA 5EXTA 5EP4A 1MBYA 4FD2A 1MSGA 2XIWA 3VR6A 4GKKL 1W2BA 2PW7A 4JBMA 4QHSA 4M9XA 5C0XI 4WJWA 1WCMH 2EY2A 1QWYA 2RSNA 2PI2A 3PGZA 4AG6A 4UP7A 1OTRA 1ZMWA 2DXIA 4UP8A 3I73A 3L7ZC 1QUQB 3HKZG 1WJ7A 3UDXA 3PF4A 4KK7A 4WFN3 4CKEA 3NE5B 5ITQA 2B63B 3FTDA 3EBEA 1XNRM 2R18A 2NZ1D 1SYFA 2NVTH 1B3QA 4RF0A 4IURA 3Q8DA 4DAVA 3I2ZA 2JWSA 4JK1C 3JAME 1PTOD 3VKHA 4R8IA 2CHBD 2UXDQ 2K6BA 4YCUA 4IBBA 5C44H 4A3BH 1SXJE 5FTLA 1J09A 1XNRL 4DAPA 4DR7Q 4IUTA 2OO9A 4HJ8A 4NPSA 2BJWA 3KLWA 3KOXE 3Q0AA 4II7A 1QUQA 4N8FA 2L11A 1EIYB 1B9NA 3QB3A 2QBYB 2QDLA 2CWPA 4EQNA 1PRBA 4KN7C 5CV9A 4LF6Q 1UFZA 3GTQB 5A2QE 2LHCA 3PO2G 3PVSA 2K4KA 4HSVA 3H0GH 1UE5A 2ZAOA 1TQOA 4IOAA 2KNAA 2JXNA 1I4HA 1FNUA 2CW0D 1A15A 2XRQD 2XWBB 5G3LD 1VDLA 5M9OA 2O2LD 3HOZB 4C3HB 4PDIA 3NENA 4NSRA 1JC7A 1VDZA 1V34A 2FFJA 2NVYB 4K5VA 2JA9A 2EYFA 3CRLC 2QBYA 3S2HH 4LW1A 5CV6A 2EPBA 5KNCA 4FWHA 2L6OA 3J7AS 3CF6E 3D8GA 1SROA 5M3FH 2ZTDA 1WTXA 2Y0TA 3IKJA 3TS0A 4BXXG 3RZDB 1HQRD 4BY7H 1E2ZA 3I70A 4FWGA 2VB2X 1SFOB 4K5WA 5DLQE 2UUAQ 2FFKB 4XT3B 3SASA 3RGPA 1E24A 1JICA 3J7AV 2YNMD 1C0AA 1TWCH 4A3EH 3M4PA 4IZ8A 3ULLA 4Q0FA 1HXYD 1TS2A 4B7FA 3CCMA 2IX0A 1LTLA 1EQVA 4REZA 4K6DA 2NYZD 5ITXE 3UDIA 4AI6A 3EIVA 2NZHA 1I3QH 3QG1A 1N78A 3GRUA 1F2LA 2XSCA 1P16A 3E0JA 1K9MC 1DOKA 2KBNA 3D4RA 3B7QA 1Y1VG 1EFUB 4LJ9A 4X3TA 3K9PA 1X32A 5ITUA 5GQOA 3GRRA 2OOBA 4MGZE 1EWIA 1K28A 1TWAB 3CC4A 2K5NA 3WOEA 1VQOA 1PH2A 1SXJD 3LQQA 3A5ZB 2EXZA 4D80A 3MVVA 4FCVA 2KCMA 3HOVB 2B63H 2JA5G 2F0TA 4L6V6 4XTCS 1XC8A 3WHLA 4BY1G 3EVQA 3VA5A 4RCNA 3SK4A 2G5DA 3CW2C 3ND8A 1OXUA 2HCCA 3CC7A 3UI2A 1LTMA 1VMCA 2HQEA 5EBDA 4DR1M 3FUXA 4LUZA 4DNTB 3K58A 2M9VA 1B50A 3U58A 2VUMB 2LH0A 2B8GA 3D8LA 4GMQA 1WFQA 2Y0SG 4RGTA 4GLVB 4XT1B 4MB7A 2ZBKB 2IY5B 4JG2A 5C4XB 2A19A 4DR1L 3BDCA 2Z1CA 1EL0A 2MJ8A 3I3CA 4GKKQ 3FUVA 3D4DA 3KOWE 1T9HA 1GJTA 3LCUA 4L5SA 1PYSB 4JOIA 3PMFA 4OWTB 4RNAA 2M60A 1JR3A 1XNQM 3I51A 3GTQH 4A93G 1VCIA 2A73B 3SXHA 3PV0A 4CJ1B 2NTSA 1VQ4A 3HEJA 1V9PA 2GVBA 1PFSA 3GTMB 3DWAA 3NXWA 1N34M 3I4VA 1EIGA 2JN4A 2DZNB 4IJFA 1XNQL 2JY7A 1IXRA 4HLQA 5KQ8A 1UE7A 4C3HH 3HJ8A 3S1RB 1C9OA 3HOZH 4OO1H 2NVYH 3RLOA 4GH9A 2Q2UA 1EZ6A 3U6MA 4QOZC 4PV1C 3KJPA 1XNRQ 4V0BA 3VDUA 2LVAA 3SAVA 1PRTD 3RZDH 2R62A 2E2IB 1SFOH 4NRWA 1EYGA 3A74A 3T1YM 4WRDA 1JE4A 3FKIG 4K6LA 4TSSA 3V76A 5FTNA 3KSJA 1EY5A 2M5ZA 2XLJA 1YNXA 2HUGA 3KP1E 3DOAA 2RCFA 4WURA 3E4RA 5CV8A 1WGNA 1LM0A 3KK7A 4F88A 3T1YL 1HNZM 3K5NA 2Q2IA 5M5YB 3EIEA 4F1IA 4A3MB 1YNNC 2A5YB 1DGFA 1QQWA 1R5LA 1Q8IA 3HOVG 1V1OA 3KF6B 3J7ZC 1HNZL 1EOTA 5CYUA 2ES2A 1JWMD 1PJTA 4A3FB 1HA6A 3ZQJA 1CKNB 4G4KA 2C98A 1TWAH 4G4NA 1EY9A 1I4GA 4UN2B 1D0KA 1HR0W 3C46A 2ZXRA 4NKLA 1AE2A 2CUZA 2AUKA 4F87A 1K82A 1WXQA 1LTRD 3TEHB 3SMPA 4B3RM 3HOVH 2FMMA 2NN6G 1FNNA 1X37A 3JAMS 4PG3A 5LMUQ 1MI2A 1YEZA 3HZJA 3SGIA 3GD7A 5K5PA 2KCCA 2J4XA 4CKCA 2OWOA 1FNVA 1RTOA 4I7AA 4MGKE 4XYOA 4IO9A 3IG5A 4B3RL 3W68A 5C3WA 2F0KA 1LV7A 2CH4A 3KF6A 4YWKA 3RN2A 2W82A 1HT2E 3NEMA 2FOIC 2JUJA 4HR7B 2F3VA 4JV5Q 2RKSA 2K9DA 1CKNA 1ZYRD 2L4FA 1IN8A 3FRHA 2VUMH 1EFWA 1QVCA 4C1NK 5LL6X 4MGIE 4LRTA 2QDBA 4IBGA 2XZUA 4P74A 5C4XH 2ZM6Q 5A2QS 2O5JC 3J80i 2HQLA 1TGUA 1DOMA 2EXDA 1NR2A 2A6HC 1LT4D 2L4EA 4O2DA 2WB1E 1NUCA 2JZ0A 2WACA 2D62A 5IE8A 1PGYA 3UK6A 3PSIA 4B9WA 2A6EC 1TWGB 4R4CA 1J5EM 5FSWA 3GTMH 3M4OB 2OTJA 2EOTA 3MFGA 4AKGA 3R8BA 4Q7JA 3I90A 3TWMA 1SEBD 3W2DA 1H9SB 1KQSA 1EYDA 3AOEC 5E3FA 4JI5M 1IHZA 3S1RH 1GO3E 2PI2E 4G57A 1OO9B 4ZAIA 1WR1B 1J5EL 2LNHC 3T15A 2PZUA 4DV5Q 4LZJA 1DGHB 4FXDA 3GP1A 4IBKA 2VNUD 4LY6A 5DYGA 1KAWA 2VZAA 5JJKA 1X56A 4LJZC 1L0WA 5GROA 1RJTA 1F4IA 4JI5L 2JY8A 3BXWA 2R4EA 1I4QA 1O7IA 3L0OA 3NBHB 1CHPD 2E2IH 4JI6Q 3A54A 1IXRC 5CV5A 4M0DA 5K36H 4IJEA 4G7OC 2A5HA 3W1BA 1WTHA 2DENA 4NXNQ 2F0GA 1H9SA 2MP1A 1QDRA 3NP8A 3SMSA 4ZYSA 3FRPB 5EQTA 1UM8A 1MSHA 1UNSA 2LMCB 4HCSA 2I7PA 1TR8A 1W5SA 4HTHA 1SNOA 3G71A 4HJ7A 4LFAM 2K5DA 3E9SA 2B3GA 3QYBA 3TP7A 3SK8A 5M5YH 1D5XC 5F2DA 4A3MH 3CGWA 5BR8M 2DWMA 3Q24A 3AMUA 2K04A 1QG7A 1SE2A 4LFAL 2FMCA 3GQBA 1U5KA 3AYHB 3OMGA 2KA6B 2Z3XA 1CHQD 2DJFC 3NBHA 2QPAA 4IPHA 3GTOB 4A3FH 5BR8L 4LNQA 4X6AH 4WJ3M 2A68C 4OL7A 4HIMA 3V2TA 3OMCA 1I94M 1EY4A 4QF4A 4L78A 3IHPA 3FPPA 4X66Q 1H95A 3Q23A 3BYTB 2R3ZA 3BZKA 5M3MB 4OWXB 5IREB 5CR3A 1GL7A 1HUNA 1I94L 3I55A 1TY2A 3HJQA 2M2LA 2NBFA 4FXGC 3IAYA 1ZKOA 3A42A 2HWJA 1BXTA 4O1NA 4K2KA 4JBKA 4TUWA 3KLSX 1E9RA 3ZYYX 4JI7M 1LTGD 1KYIA 5IP9G 3GTPB 4QIWB 2DGYA 2Y0SE 4DR4Q 4B3SM 1E3PA 1EU4A 5GKNA 4JI0Q 2E5LQ 3DZDA 1B3AA 2RA4A 2RHSB 4JI7L 4A3DG 3P20A 3CCLA 1S4ZA 1D2NA 5IYBH 4P2CB 1A3UA 2B2TC 5ELDA 4IPGA 4DR3M 4B3SL 1O78A 3VDYA 3BS1A 2JA7G 2K03A 3BVZA 2UXCQ 3TQSA 4DNRB 4DR5M 1L0XB 1K3BC 1VQEA 1WTOA 2RSOA 2A69C 1TWGH 1GO5A 4I7ZC 4DR3L 3M4OH 1YZ6A 4QUFA 1ORYB 2PNRC 1Q1EA 1K0SA 3GPYA 1NCVA 2PQAA 2LVQD 2AUJD 2BDNA 2X6LA 3M0EA 1I4RA 4IOCA 4DR5L 4BWGB 5C0XH 2R92G 4OX9M 4BBSB 4GOPB 5LMNW 4XXEA 3HOWB 3RNUA 2R4JA 4ZK9B 2ICEC 3HU3A 1VQNA 1NNJA 4RKLA 3J2PB 5E4XA 4FCWA 2KNVA 1KLGD 1WD0A 1JOQA 1IXSA 4DUZM 3Q8XA 4OX9L 2LFNA 3S16B 4IUVA 1VEJA 2VDBB 3RLFA 2PNHA 5FLMH 5M5WB 2OF1A 2C9CA 4C2MB 4APVA 2Y21A 1LT6D 3MXUA 2DY8A 1E2VA 5I9OA 4H13C 2KQ3A 4DUZL 2A74C 5IYDG 3D6CA 1X3QA 4GOPA 1CK1A 4A3KB 5ITRA 1HUMA 3HU2A 5IGEA 1GUNA 2K6AA 5KPTA 3NUCA 3EFXD 4X65Q 3CHBD 3WDNA 3MEFA 4NOOB 1SLJA 3E3XA 2RHQB 1WJJA 3F2DA 1T43A 4GITA 2V1UA 4X64M 2DAIA 2WSFF 2EY1A 1JR3E 4A3IG 3HHXA 1A2UA 1GUOA 1J5EQ 4KHZA 1QOHA 1N32M 4DV2Q 3GTOH 4POFA 2LXKA 3DEPA 3ERQA 1U4LA 3FVQA 1G8PA 3P1HA 1B2TA 2B3TA 5E1FA 4LFCM 2JP1A 5DM63 1YSYA 1W3SA 3HOXB 4JI5Q 1PH1A 3D31A 1S3SA 4X64L 2FNAA 1XWEA 3BVGA 1X3EA 3MC0B 4AIMA 3R93A 4GC5A 2K32A 5IGBA 5M3MH 3LVWA 1ONLA 1YNND 3J81L 1G2SA 1N32L 1KIXA 5C5MA 2E75C 2MQHA 4RAUC 4LFCL 3U5ZA 1ENAA 3D6WA 4IBIA 4R3DA 1SYCA 1ZQ9A 4P71A 5KIXA 2Q2TA 1PH6A 1SJHD 4BBRB 3LQRA 1Z5CA 2J7ZA 3KBXA 4Z6YA 3GTPH 2XEPA 1CA6A 4LF4Q 1PFNA 4U673 3OTOM 3B74A 1Z59A 3TQYA 2NVTB 1G4AE 2KEEA 4JI4M 3ITPA 3WWVA 2VB3X 4Q5VA 4A3GB 4HJAA 2HDMA 3T1HM 5JI2E 1LLRD 3CF0A 1XHBA 1VQLA 1ASYA 3I4NB 4KMUC 2SEBD 1S5FD 3L28A 2SDFA 1PYWD 3OTOL 5C0XJ 2MUYA 4J8QA 3NWTA 4JI4L 4R4IA 3J80E 1JB3A 3U6QA 2DWLA 3I56A 1PH9A 3Q22A 3SHGB 1LTAD 4A3LG 4MGHA 2R7ZB 3T1HL 3HS0C 4LG2A 1L1TA 2PQEA 2Z4RA 3J27B 4G6ZA 2Z4HA 3TS2A 4L63B 1GJSA 1QZHA 2IWHA 1FGUA 2F5NA 1NNXA 3BBZA 1I94Q 4L6TB 2VXWA 4IBEA 2B29A 5CMDA 2EY5A 4MZ9A 4BBSH 4LFBM 1STEA 3JC66 3PUZA 3HOWH 1NVMA 2O5RA 2E2JB 2OQ4A 4S12A 2F4IA 3NHHA 2AWNA 1EQTA 3KLRA 3SEBA 1ET9A 1WTPA 4JI7Q 5GADC 2FHTA 3S16H 2A6ED 2JA8B 3TRZA 2KXEA 4LFBL 2DZLA 2F3WA 4IBCA 2Y20A 5JI3E 4OEMB 5M5WH 1IY1A 2EA0A 1RU3A 4C2MH 1YHQA 1DXMA 1L1ZA 3VK8A 1VQBA 2K47A 3M7GA 2DAMA 4R9WA 4FNFA 4QQBX 1JR3D 2BE5C 3U6PA 3PO3G 2HCIA 3KFUA 1C4QA 1XJVA 4S3SA 3DHQA 4BBAA 4A3KH 2C99A 5AFWA 4JI3M 5EPJA 4Y52H 2CHQA 1VF7A 4YHHM 1HR0M 3VR4A 1X3GA 3MAQA 4G3OA 4IUNA 2F0VA 1B8AA 1YNJC 2MPMA 2CWBA 1SYGA 1TF0B 2XGTA 3SK5A 2G9HD 4JI2M 3C9PA 1STNA 4KV6A 2AQ2B 4JI3L 4Z8XA 1B9MA 2HT1A 1WCMG 4TRDA 4YHHL 4GOPC 1HR0L 4LF8M 2ICIA 5ELOA 1PMRA 3I4YA 3GDEA 3HOXH 4KY5A 4JI2L 3G7LA 3NBXX 2DKLA 2F0JA 1HZ9A 4M0WA 3M4YA 5IT9L 5E26A 3NWSA 1TH3A 3AJIB 1WOCA 4IUPA 4LF8L 1IN5A 1SG9A 1PV4A 3WHKA 3QWLA 2QCPX 2GNOA 4BBRH 3URYA 1MJGM 5C44G 1JOKA 1STHA 4A3BG 2LVPC 2XH9A 1JJGA 3E9HA 3K8AA 4N8X1 3STBC 1X3FA 3H94A 4H7BA 3DUZA 2LKVA 2A8VA 1JQJC 3DM1A 2B2UA 1NE3A 4FDBA 1DJRD 2F0SA 5GAGC 1G59A 4A3GH 1CSPA 4PD2A 1VQ9A 1QVRA 4DV0Q 3HOUB 2ZANA 1SBBB 3I4NH 4A3CH 3S15B 2YTXA 2VQFM 3CCEA 1D8LA 3KOZE 1BR9A 3HZXA 4AW4A 1LTSD 4LF5Q 1SE3A 3DM3A 4KY6A 1TR5A 4AYBG 1G6ZA 5L8RF 3FTFA 1PYBA 2L15A 3BDLA 2BA1A 3H0GG 3KFUG 2NTTA 1N36M 2R7ZH 4X64Q 4GLAC 1ZXTA 1TS3A 2TSSA 3RN5A 3GLGB 1IZ6A 2VQFL 1N32Q 4NRVA 3CF5A 1KD1C 1QZEA 4R71A 4P16A 1L2FA 3SR1A 3I8ZA 3KOYE 1N36L 1R7RA 2AKWB 3S1NB 2WB1G 1XYIA 1I4WA 1S72A 5FO9B 5M3FG 2CHVA 2E2JH 3HFZB 4LF7M 1IL2A 3PCOB 4TKOB 1HTLD 3BZDB 1A62A 1N9WA 4BY7G 4HJ9A 3MHBA 3GLFB 1F9SA 2IW3A 4JC0A 1GL6A 2A1AA 2A69D 2JA8H 5COYA 3K9OA 2CQAA 1J7KA 1EY8A 3AU7A 1FJGQ 2DWZB 2PCFB 1K83B 2K1BA 2LXJA 4LF7L 5CGKA 5NUCA 3SHLA 4Y7NB 4O0AA 4I8OA 4OU7A 2D5DA 1OAIA 4FVMA 4OW0A 3HJSA 2F0UA 1EEFD 1M90C 4A3EG 3T1HQ 4PDGA 1YLAA 4DNIA 1JJCB 1F2YA 2O5IC 4DV1Q 2IHFA 4YY3M 1V43A 1X3PA 4AH6A 2R6GA 4GKJM 4B7HA 4IALA 2R7FA 4KY7A 1G71A 1VQMA 2J7OA 4DV3M 1BNZA 2F0MA 2WAQG 2Z4IA 3CCRA 2LVNC 2VW9A 1RD9D 3CCSA 1VF5C 2CV1A 4LK1C 1YI2A 1IM2A 2L55A 4CGYB 3E0EA 1YE9A 2EY6A 4OELB 4YY3L 5ELEA 4IQZA 1QUSA 4GKJL 2OT2A 1XPOA 1SJED 3H09A 1K3RA 4QIWE 4RHSA 4DV3L 1LTTD 4X62Q 2FINB 1HFNA 2Z7JA 3H6MA 1SE4A 4IJLA 1QUTA 3U61B 2IT1A 2OXPA 2B63G 2CV2A 3CU7A 1BBUA 3E9IA 3K2LA 4HEOA 3ZH9B 5C1BA 3A45A 1N33M 4I81A 1STYA 4RCOA 1NTGA 4EVOA 1YJWA 2C35B 1C8CA 2WFWA 2J7NA 1BO0A 2L5TA 3W0LB 4GHAA 1D1KA 3LMMA 3SAWA 1NMFA 4O42A 3VDPA 2DHYA 4ZLTF 4J6HA 1N33L 3CRKC 1NSFA 2AHMA 1JQYD 1FYCA 3GQ4A 1SE8A 4ZPXA 2OQKA 3F92A 4M1UB 3BU2A 1IYUA 4CDCC 3CF2A 3U61A 1IW7C 3J80S 1L2DA 2Z0SA 3HOUH 3TE6A 3ER0A 3NK9A 2MJ5B 4KLNA 4JI3Q 2WINB 3S15H 4DN4M 1R6BX 2E2DC 4KODA 4HMIA 1HQYE 1HR0Q 1ILQA 2TMPA 1SMYC 5KRUA 2YV5A 1L0YB 3NQTA 2I0QA 1J9OA 3RR5A 2QSFX 5LMNM 3GO8A 1BCPB 2B2UC 2B39A 2PW5A 3LWUA 2Z8LA 3SVMA 1F2MA 3J7YW 3K7AB 2N78A 3SBJA 3AOEA 2J0TD 1RCVD 4GN4B 4DBGB 1HTPA 4ZUIA 1OTCA 4KI0A 2JY6B 3HOZG 4C3HG 3UGJA 3PQIA 4OO1G 4PT5A 5LMNL 2RKOA 1FD7D 3S1NH 3L27A 1WI5A 4QHTA 3L2AA 4JW0A 1SYDA 3HOYB 5KYIA 3PF5A 1KTKA 1NV9A 1PLFA 2KEDA 2VIIA 2G8LA 4KKSA 4DA2A 2KZSA 1OIZA 1K8AC 5DNFA 5ELNA 3G4SA 3M7NA 1ZMVA 3K57A 2KW0A 5F3WA 3UDGA 1GHKA 1VQ7A 1PHJA 1K83H 5FK9C 5IWAM 2C96A 1N34L 4IFDI 3I72A 1G2TA 5FLXL 4KJOA 4BB9A 4B3MM 3NPPA 4Y7NH 1UWVA 4XIGS 1A6XA 2N3SA 3QYEA 4EQ5A 4DV7M 3THGA 2EUCA 4RWSC 3J81j 5FO7B 4ITQA 3SK6A 1F2ZA 5IWAL 3A5UA 2L9HA 1CA5A 4B3ML 2LSSA 3M85A 2QZ4A 5CBEE 4A3VB 2D7GA 4MTKA 5CBAE 1Y8NB 4DV7L 4C3JB 3KBGA 2F4VM 2KRUA 5KGUA 1O7ZA 1HJPA 3HKPA 1DGBA 1EUJA 3CCQA 1PTOB 2I5LX 4J1MA 3VR5A 1R2YA 2DAEA 4IUUA 1TDZA 3OPOA 2M00A 3GPPA 4GLXA 1AFPA 2B8FA 3ZC7B 2ZJQA 2F4VL 3I91A 1QJOA 1IYJB 1RTNA 3A56A 3KOJA 1YITA 3KLSA 3R3OA 5ELFA 2H4OA 2WIIB 3TDQA 1VQCA 3GP7A 4LF7Q 3U6OA 1YNJD 5CORA 4QNMA 3U6SA 1DM0B 1HH2P 2DVWB 3QWNA 3AV0A 5CV7A 3EQLC 2CE7A 4P17A 1C1KA 3SYLA 4TVAB 5C6AA 2JEBI 3TREA 1BBWA 1NJGA 1OKSA 5IOCA 3W67A 2VUMG 2IJ0A 5JOBA 5H37D 2UU9M 4FO2A 3JR5A 2B2TA 5JJZA 5C4XG 3KSXA 2E8GA 3TN2A 5JJLA 2XSZA 3E46A 4AYBE 4G7ZC 3GRYA 4YY3Q 4DR2M 5GAEC 1PH4A 4G4QA 1E1TA 4GKJQ 4G7HC 1SR3A 3W5OA 4L8RC 4QB4A 1TWHB 4YCVA 2UU9L 3C3EA 3VYSA 4DV3Q 4CDFC 1T6OA 1LTBD 1GUTA 3ILKA 3STBD 4XYQA 2G5GX 3I4MB 3GLIB 3U4ZA 4DR2L 3HRZC 3K7AH 3UE1A 1IQPA 1SDFA 1STBA 5IP7H 3C3LA 3ERSX 4NSOB 4IPDA 4MHEA 2DHRA 1DZ1A 2BJVA 4OONA 1M4VA 4YCWA 1CTMA 3QR8A 4NXMM 3HOYH 1N33Q 4K0KM 1PXUA 3KP0E 4BLCA 1T5XD 1ENCA 1JR0D 4K14A 1Q1BA 3VYUA 1IKMA 3J7BA 2PMZB 1F77A 2KECA 1JORA 1A0IA 3A8JE 4RHRA 2GVAA 3A7LA 4P73A 5K36G 3S17B 1TH4A 2K52A 4NXML 3SC3A 1VEGA 2KJXA 5JVH3 3VLFB 3K0XA 1N8RC 4K0KL 1TTEA 2R45A 5IZ7D 3HHYA 1RIPA 2K7VA 4QMGA 2CFMA 4LAAA 1WTWA 1NHWC 1XMOM 4DR1Q 4FF4A 3NTKA 4A3MG 4LJ4A 2WAQE 1EIFA 1BCPC 1PZJD 2XVSA 4CISA 2FXQA 5EQ0A 5EXSA 5I2XA 2DY7A 2DZOB 1VQ6A 1DGGA 3J7A5 5C3XA 4C3JH 1VQHA 5LMNQ 3F8TA 1S3OA 4B08A 2QP9X 4F8MA 1XMOL 2HKJA 4LJ7A 1K0RA 2ZXOA 4A3FG 3CCJA 1DGHA 4YIJA 2F5QA 4Y28F 1PTOH 3K5MA
chains in the Genus database with same CATH topology
1R2ZA 1HNXM 5IGGA 3JR4A 1OXSC 3OIPA 3DWQA 3BYYB 3FEWX 1IN7A 2EYPA 2XRSD 3HG9A 1A3VA 5IGCA 3BVMA 1OXXK 4DR6M 5T1IA 2CFOA 2P5TA 3AOGA 4XBOA 3OIQA 4RGMA 4DGZA 2B2YA 3MTSA 4L4UA 3C1EA 1IN4A 4K5XA 3TSSA 1Q3LA 4C3IB 1AZQA 3FMCA 1L2BA 3TP6A 3DMUA 2ERCA 4DXGA 4MN3A 4JI1M 3EIHA 2X69A 1C48A 3TMEA 2XFTA 1SYEA 4I4LA 4LGMA 4K8IA 2X4AA 1PTOC 3SATA 1SNQA 1OFHA 3LVVA 3RGSA 1CQVA 3M3YB 2F0WA 2JYOA 1PRTB 5ELCA 1CZGA 2F0FA 4K8JA 1IBLM 1NSNS 3FUTA 5D65A 1TY0A 2D7EA 5C0XG 1D1IA 3TBIB 4UDUC 3HP3A 5I6YA 3S9WA 2KVMA 2D9UA 2V1CA 5BN3A 1SMYD 3HHZA 2SNSA 5BN5A 1XXHB 3KS8A 2EYMA 2RBMA 4KHPM 1D5MC 1AZPA 2JE6I 3NSWA 1XXGA 1ESFA 4DAYA 4ME5A 2NVXB 2CW0C 4KD3A 3QJYA 5A35A 3FYDA 1ML0D 3TWKA 4QUCA 2B2WA 3MXPA 4LJ6A 4A3JB 2F0NA 5KNDA 3MWYW 1XXHA 2BCOA 5JEAH 1IN6A 1CI3M 3FKEA 1F9PA 2JA2A 3FUWA 2KOLA 1K8OA 4BA1I 3D8BA 1O7YA 5EXPA 3VR3A 1LACA 1LO5D 1S5CD 3R2IA 3GLHB 3FPUB 5DM73 4IUQA 2PPBC 5C5LA 3TZDA 4DV6M 3FYCA 2NN6I 1NNUC 1LV9A 3DA1A 3K92A 2N88A 1HA5A 4RGOS 5EPLA 1DONA 4DR7M 3KF8A 1S5ED 1Q3CA 1DO2A 1QZMA 4W5WA 1SSOA 1J8IA 4FW9A 1JOOA 4JYAM 3MJ5A 3A98B 1V1PB 4DK1A 1T5EA 3GLHA 1EU3A 1IKLA 2BNKA 4DK0A 2C5RA 3NTIA 4LF6M 2JA6B 1JCKB 4PMCA 1UAPA 2B2YC 5EP2A 4KKUA 3QOLA 4L16A 3FD9A 2D7HA 1JWSD 5C3EB 4EQPA 1EYAA 3PUXA 4X3SA 2CVRA 5ITYA 4HAEA 2F0QA 3S1MB 4FYDA 1Y8PB 1KABA 2OEOA 4GRIA 1PZID 5D3IB 1E2WA 2SNMA 1Q3BA 1U4PA 1Z7TA 1V1PA 2EYJA 3AKZA 2F5SA 2MHVA 1L2CA 5C4JB 4LMQD 2QEJC 3HKZB 1SNMA 4CJ0B 4LF9M 3L9AX 5M5XB 3E6ZX 3N52A 4BA2I 8CATA 3EJIA 4UAIA 3JAML 3SAUA 1MX0A 2IPKD 4XQNA 3PNVA 1Y69U 2A6HD 5JPNC 5JEAJ 1KDAA 1RF2D 2WKDA 1BOSA 1HT1E 5EP3A 4E6IA 4OHJA 2Q2EB 3QOJA 4GZYC 3R8FA 3ND9A 3FUUA 2F5OA 1GUWA 1KFVA 2XWJB 2N55A 2XGNA 1OJLA 1BCPF 1EIHA 3VKGA 3RUZA 3LX0A 1PRTC 5KEEA 1AW7A 5A2QL 3GQ5A 3OW7A 3VA7A 2GA4B 4KO8A 2B2WC 3A8IE 1OFIA 4XQQA 4OIJA 4RKBA 1QANA 3PO2B 4MH0E 3RD4A 3GPXA 4PMWA 3E5SA 1H9RA 1EY7A 4H44C 3T53B 5I6WA 2DNEA 1HFGA 3U9OA 1EZ8A 3KS4A 2IX3A 2ZT9C 4DUYM 1NHGC 1AP0A 5TSSA 1TS4A 3J81E 5J22A 4K2LA 2PO4A 3VYTA 4B9XA 4LRSA 1QILA 1XMQM 1IBKM 2K28A 5FO8B 4NL4H 1NR4A 1SAPA 1RHPA 3K5OA 5HURA 1S5BD 4CJ2C 4EIWA 4IFDH 2B2VA 1E9SA 2E2HB 2F0LA 1D6EC 1PFBA 5KQDA 3RMHA 2A68D 3X3MA 1Y1WB 1MD2D 4KN4C 2FJ2A 3VFDA 3T56B 4CBVA 1WTRA 2HL7A 3CTWB 3DFZA 1IY0A 1BF4A 1PTOF 2R93B 1Z47A 1U4MA 1LT3D 3PXGA 1SYBA 3NQIA 3HHWA 2UUBM 1ZYRC 3QAUA 1OXVA 1PJIA 2DNCA 1NAPA 3PUVA 5ISRA 1STGA 2YQZA 2EJFC 2ZAMA 3DWPA 1Y1VB 1CFMA 2Q8IB 1QNUA 4IN3A 1TKWB 2EO2A 2YU9B 2G9DA 5LL6S 4CHTB 3NTHA 3W3AA 4LGYA 4HL4A 2JA5B 2FE8A 5DNYA 1N75A 4BY1B 3ZCBB 2XSZD 1RKNA 5G3LF 3QIAA 3PUYA 5C4ZA 3VYRA 1DOLA 1LTID 1R4QB 2RDHA 1Z5AA 3MEHA 1U4RA 4D81A 3GLGA 3H91A 3OSOA 4PQXA 1E32A 2Y0SB 1R4PB 4B3TM 1CQFA 2XF3A 1V8QA 4ULLA 3T13A 4U68A 4GIPA 1AN8A 1BUVT 3GTGB 4A93B 4ZUJA 3MFYA 4HCEA 4FCTA 1MGSA 2L09A 3B9PA 4RH6A 3LWEA 1IY2A 3GLFA 5LMUM 2K05A 5IGDA 1KNEA 1DYQA 4B7GA 4I5SA 1KDBA 1PFMA 3PIP3 1E0BA 4DU9A 5KPZA 4IFDJ 1QAOA 1YUBA 1IL8A 1EE8A 3K8ZA 3MXGA 1WTQA 5IT9E 3OOCA 2R65A 4JV5M 3GPUA 3K59A 1TVXA 5I4DA 2KRKA 1GUGA 3T51B 3A8KE 1G91A 2CEAA 2ZM6M 4KJNA 5KYLA 1KDCA 2NQ8C 3FKIB 5I9PA 2BDOA 3D3RA 5EXXA 3IL8A 3ONAB 3TWLA 4V190 4I65A 3SARA 1JWUD 4KKTA 3P7JA 4HSPA 3PNYA 2KEBA 3U6DA 4ABNA 3TP5A 2B2VC 4JBWA 3C2PA 3RZOB 2L7HA 2F0OA 4M9ZA 1GKIA 1VDDA 4DV5M 1DD2A 1TU2B 1Q12A 2YFQA 2X6GA 1L8QA 3UJNA 3HGIA 3U6CA 4PCZA 2V6ZM 3IG8A 4GHLA 2L4NA 5D3DA 2O4XA 2CV0A 4JI6M 1BDOA 2BA0A 4RFBA 2HHHM 3G6JB 4XDXA 3GV3A 3PFIA 4NXNM 1NY6A 1T3TA 2PYKA 1K3XA 5FOBB 1H9JA 3QO2A 4RGNA 1VMPA 5E6JA 4MM3B 2C9OA 1EEID 2AQ3B 1PRTF 1ET6A 2QILA 2F03A 2QF7A 1S5DD 5EGTA 3KW6A 1KAAA 3C1FA 4AKHA 1GJXA 1ESRA 5EP1A 3VK7A 1UEAB 1QB5D 2LXEA 4X66M 2V4DA 5DEHA 2KA7A 1QAQA 3SDZA 2EE1A 1AEXA 3F2UA 3H4MA 1W6JA 3J81S 3MK6A 2I7NA 2MGSA 3MHVC 1XX8A 2BE5D 5J39A 1IBMM 1RODA 5JVG3 1EWHA 4DR4M 2Y0QA 5EJCA 2EJGC 2X8AA 4G4OA 1WD1A 4JI0M 2E5LM 3U6EA 2UUCM 2ENBA 2RDFA 3PUWA 1H9KA 1PJJA 2HDLA 1II3A 4FWDA 5IIFA 4JI8M 1HCZA 2VQEM 3GTKB 1EFID 2BOSA 1D5ZC 5KPRA 2NVQB 4FF3A 2UXCM 3WOFA 4WW0A 4F7XA 1WTVA 2K5WA 4R8NA 1I6HB 2JEAI 5J1ZA 1QYRA 2EVBA 2F0IA 4ZKBB 3K1JA 4L8JA 1G41A 4C1NI 2L1BA 3U9SA 3TZUA 4AQYM 5IODA 2H1RA 4M9SA 3SFZA 1Q90A 2L0CA 2C5CA 2EZVA 2F0HA 4IIWA 2F5PA 3NBIA 5D14A 3GTJB 2UXBM 1I4PA 3GTLB 2NN6H 1ICWA 1EWCA 4RA8A 4IBDA 2KZUA 4XGIA 5FKAC 1CM9A 1CT1D 1GLNA 3IFTA 4AG5A 1G8ZD 5FTJA 3T16A 1XTCD 4NW2A 3OHXC 4QCLA 2LS01 3KDSE 5CV4A 2IL8A 1Q39A 1SNCA 2WV6D 4FF2A 2JXMB 5FLXE 5BN4A 5HGTA 3GLIA 4X65M 3A46A 1BQQT 1HNWM 4A3DB 1LT5D 1SXTA 3RE8A 4C3JG 2AWOA 1K8MA 3IFDA 3K6OA 1FNWA 4DFAA 4DV2M 1KSFX 3OWEB 2JA7B 4AKIA 1GOZA 5DAUA 1SXJB 5ITTA 2EDGA 2H1EA 2EJMA 5DYIA 5LHY1 1GXDC 1CZWA 3LNNA 2QKIC 1EY0A 2OPFA 3HGBA 5IT9S 1HPCA 1PZKD 3W0FA 1A2TA 5EBCA 4NP5A 2R92B 3S1QB 1FR3A 1E94E 1KNAA 4PNYA 4N9PA 1G291 3PIO3 5C4HA 4LF4M 1ZAEA 2NWGA 3KXEC 1D2BA 4R7GA 1SXJA 2XZFA 2RGOA 1HQCA 2Q8RE 1DO0A 3O13A 4ZQ3A 2XFSA 3H3VC 2DWNA 2R46A 4MGYE 4KD4A 3VR2A 1U9RA 4XQJA 2RQXA 1LABA 2I46A 2L12A 2SOBA 3TP8A 4GC9A 3SHFA 2EYHA 1Z5BA 4HN7A 3KUPA 3FDTA 1WVLA 1DCZA 2KUMA 3HU1A 4KTAA 4A3IB 4HMJA 3N6RA 4N9TA 1RDPD 4OO1I 1F9QA 5I2YA 2K01A 3S14B 2LWXA 2ID0A 3K0YA 4RF1A 5EJWA 1IW7D 4X3UA 1W6KA 2D2CC 5EPKA 4DV4M 4FF1A 3MXNA 3GQ3A 2L7IA 3L29A 1I4XA 1R9TB 2Q8TA 1TWFB 4PMBA 2XN9C 3M6AA 2WKCA 2XNAC 3CQZB 2X49A 4QNRA 3RFWA 3GV6A 1IYVA 2E76C 4ODGA 1IXSB 5JEAG 5JAVA 4OIKA 3J80L 3S2DB 4ZKCB 3T4AC 3UZUA 5T1GA 1SNDA 1OXTA 5ITXA 3OWFA 4HEDA 2R61A 4M8AA 4IBJA 3T38A 1I50B 1H6UA 5E4WC 5CC4A 3R9XB 4H0LC 1B1ZA 2F1MA 2WP8J 2HCBA 2KHSA 3TPZA 3AL0C 2YR0A 4JXJA 1B44D 5EKIA 4JN6A 2PZWA 3V05A 1HQMC 3D4WA 1O7LA 1H9MA 7CATA 3HWSA 4C3IG 3BOSA 4LJAA 1NY5A 4EQOA 1N77A 2PZTA 3R2TA 1B4OA 1GUSA 2UXDM 4DV0M 4WORA 1IXZA 2RDGA 3DXJC 1QE6A 3U5ZB 4LF5M 1EY6A 3V96A 5EKLA 2DN8A 1TS5A 3PO3B 2KCNA 4DF7A 1SXJC 3MA2B 2F0DA 4AZFA 4OVZB 1B53A 1W5TA 3I4LA 3CKIB 2Z4SA 2QCUA 4LZZA 1WCMB 5ELBA 3A55A 4LJ5A 3SYKA 3AB9A 1ENFA 1XWIA 3SE0A 3L25A 4EGVA 3P75A 1FJGM 2LY7A 2NB0A 4IBFA 3A7AB 3AFHA 4OVZA 4NMZA 5EKKA 3BDOA 1GVNA 3FTEA 3U6LA 1TT2A 4FXKC 3KVWA 5FLXS 3U60B 4DXFA 5KNBA 4CKBA 2F0PA 5C44B 4A3BB 1EYCA 2E74C 2I07B 2UUAM 4DV1M 4MIUA 4X3KA 1M8AA 1F9RA 1QNKA 1MU5A 2EYLA 1UUPA 4QOSA 3MZ5A 1FGBD 3TL4X 2AQ1B 4TQUS 3J7AF 1PDQA 1Z6HA 1Y8OB 3EA6A 1ILPA 4FP5D 1HHVA 1QAMA 1Z6TA 4X62M 4AYBB 5C18A 4ILWA 2IX1A 3U60A 3H0GB 1HRJA 4NDXA 5JPMC 4LJ8A 1TDHA 1TH2A 2RGHA 1ZEQX 4Z9CB 4ZRZA 1QCBD 3C58A 4G4RA 3K5LA 1BBXC 1NJFA 3GRVA 4L15A 1O80A 2F0EA 2QENA 3Q6SA 1A3TA 5BPVA 2WB1B 3S2HB 3GO5A 5FTMA 4KHVA 1TIID 5M3FB 1BCPD 2EYOA 3L26A 5FTKA 5KO3A 3L3OC 4BY7B 1G3IA 4LCBA 1SNPA 1PM5A 4IFDG 1KLUD 2ZXPA 3FTCA 3EROA 3BG3A 4ID6A 4C56C 3UMMA 2RVLA 2NUCA 1TWCB 4A3EB 3X3NA 4GKKM 3NWLA 1K3WA 2K33A 4D82A 1STAA 1I6VC 2YYZA 4OGQC 5IGFA 4BS9A 2CHGA 1I3QB 2JSOA 2K5QA 1GHJA 2WAQB 3DEOA 5EXTA 5EP4A 1MBYA 4FD2A 1MSGA 2XIWA 3VR6A 2PW7A 4QHSA 4M9XA 5C0XI 4WJWA 2EY2A 1QWYA 2RSNA 4AG6A 2DXIA 3I73A 3L7ZC 4KK7A 4WFN3 4CKEA 3NE5B 5ITQA 2B63B 3FTDA 1XNRM 2R18A 2NZ1D 1SYFA 4RF0A 4IURA 4DAVA 4JK1C 3JAME 1PTOD 3VKHA 4R8IA 2CHBD 4IBBA 1SXJE 5FTLA 1J09A 4DAPA 4IUTA 2BJWA 3KOXE 3Q0AA 4II7A 2L11A 1B9NA 3QB3A 2QBYB 4EQNA 4KN7C 5CV9A 3GTQB 5A2QE 3PVSA 4HSVA 2ZAOA 1TQOA 1I4HA 1FNUA 2CW0D 1A15A 2XRQD 2XWBB 5G3LD 5M9OA 2O2LD 3HOZB 4C3HB 4PDIA 4NSRA 1JC7A 1VDZA 2NVYB 2FFJA 4K5VA 2EYFA 3CRLC 2QBYA 5CV6A 2EPBA 5KNCA 4FWHA 2L6OA 3J7AS 3CF6E 3D8GA 1WTXA 2Y0TA 3IKJA 3RZDB 1HQRD 1E2ZA 3I70A 4FWGA 2VB2X 1SFOB 4K5WA 2FFKB 4XT3B 3SASA 3RGPA 1JICA 3J7AV 2YNMD 4IZ8A 4Q0FA 1HXYD 1TS2A 4B7FA 2IX0A 1EQVA 4REZA 4K6DA 2NYZD 5ITXE 4AI6A 3QG1A 1N78A 3GRUA 1F2LA 2XSCA 3E0JA 1DOKA 3D4RA 4X3TA 4LJ9A 1X32A 5ITUA 3GRRA 1TWAB 4MGZE 3WOEA 1SXJD 3LQQA 2EXZA 4D80A 3MVVA 4FCVA 3HOVB 2F0TA 4XTCS 1XC8A 3WHLA 3EVQA 3VA5A 4RCNA 3SK4A 3ND8A 1OXUA 2HCCA 3UI2A 1VMCA 2HQEA 5EBDA 4DR1M 3FUXA 4DNTB 3K58A 2M9VA 1B50A 2VUMB 2LH0A 2B8GA 3D8LA 4GMQA 4RGTA 4XT1B 4MB7A 2ZBKB 5C4XB 3BDCA 2Z1CA 1EL0A 2MJ8A 3I3CA 3FUVA 3D4DA 3KOWE 3PMFA 4RNAA 2M60A 1JR3A 1XNQM 3I51A 1VCIA 2A73B 3SXHA 3PV0A 4CJ1B 2NTSA 3HEJA 3GTMB 3DWAA 3NXWA 1N34M 3I4VA 1EIGA 2DZNB 4IJFA 4HLQA 5KQ8A 3S1RB 3HJ8A 4OO1H 4GH9A 1EZ6A 3U6MA 4QOZC 4PV1C 4V0BA 3VDUA 3SAVA 1PRTD 2R62A 2E2IB 4NRWA 3T1YM 4WRDA 1JE4A 4K6LA 4TSSA 5FTNA 3KSJA 1EY5A 2M5ZA 2XLJA 2HUGA 3KP1E 3DOAA 4WURA 3E4RA 5CV8A 3KK7A 4F88A 1HNZM 3K5NA 5M5YB 3EIEA 4A3MB 1YNNC 2A5YB 1DGFA 1QQWA 1Q8IA 1V1OA 1EOTA 5CYUA 1HA6A 1JWMD 4A3FB 4G4KA 2C98A 4G4NA 1EY9A 1I4GA 3C46A 2ZXRA 4NKLA 2CUZA 2AUKA 4F87A 1K82A 1WXQA 1LTRD 3SMPA 4B3RM 2FMMA 2NN6G 1FNNA 1X37A 3JAMS 1MI2A 3GD7A 5K5PA 2KCCA 2J4XA 4CKCA 1FNVA 1RTOA 4MGKE 4XYOA 3IG5A 5C3WA 2F0KA 1LV7A 2W82A 1HT2E 2FOIC 4HR7B 2F3VA 2RKSA 1ZYRD 1IN8A 4C1NK 5LL6X 4MGIE 4LRTA 2QDBA 4IBGA 2XZUA 2O5JC 5A2QS 1TGUA 1DOMA 1NR2A 2A6HC 1LT4D 1NUCA 2WACA 2D62A 3UK6A 4B9WA 2A6EC 1TWGB 1J5EM 5FSWA 3M4OB 2EOTA 3MFGA 4AKGA 3R8BA 3I90A 3W2DA 3TWMA 1SEBD 1H9SB 1EYDA 3AOEC 5E3FA 4JI5M 1IHZA 4G57A 1OO9B 4ZAIA 2LNHC 3T15A 2PZUA 4LZJA 1DGHB 4FXDA 3GP1A 4IBKA 2VNUD 4LY6A 5DYGA 4LJZC 1RJTA 2R4EA 1I4QA 1CHPD 3A54A 1IXRC 5CV5A 4M0DA 5K36H 4IJEA 4G7OC 2A5HA 2F0GA 1H9SA 2MP1A 3NP8A 3SMSA 4ZYSA 3FRPB 5EQTA 1UM8A 1MSHA 1UNSA 2LMCB 4HCSA 2I7PA 1W5SA 4HTHA 1SNOA 4LFAM 2K5DA 3E9SA 3TP7A 3SK8A 1D5XC 5F2DA 5BR8M 2DWMA 3Q24A 3AMUA 2K04A 1QG7A 1SE2A 2FMCA 3GQBA 3OMGA 2KA6B 2Z3XA 1CHQD 3NBHA 2QPAA 3GTOB 2A68C 4OL7A 3V2TA 3OMCA 1I94M 1EY4A 4QF4A 4L78A 3FPPA 3Q23A 3BYTB 2R3ZA 5M3MB 5IREB 5CR3A 1GL7A 1HUNA 3IAYA 1TY2A 3HJQA 2M2LA 2NBFA 4FXGC 1ZKOA 3A42A 1BXTA 4O1NA 4K2KA 4TUWA 3KLSX 1E9RA 3ZYYX 4JI7M 1LTGD 1KYIA 3GTPB 4QIWB 4B3SM 1EU4A 5GKNA 3DZDA 1B3AA 2RA4A 3P20A 1S4ZA 1D2NA 4P2CB 1A3UA 2B2TC 5ELDA 4DR3M 1O78A 3BS1A 2K03A 3BVZA 3TQSA 4DNRB 4DR5M 1L0XB 1WTOA 2RSOA 2A69C 4I7ZC 4QUFA 1ORYB 2PNRC 1Q1EA 3GPYA 1NCVA 2AUJD 2BDNA 2X6LA 3M0EA 1I4RA 4BWGB 5C0XH 4BBSB 4OX9M 4XXEA 3HOWB 2R4JA 4ZK9B 2ICEC 3HU3A 1NNJA 4RKLA 3J2PB 5E4XA 4FCWA 1KLGD 1WD0A 1JOQA 4DUZM 3Q8XA 2LFNA 3S16B 4IUVA 3RLFA 5M5WB 2OF1A 2C9CA 4C2MB 2Y21A 1LT6D 3MXUA 2DY8A 1E2VA 5I9OA 4H13C 2KQ3A 2A74C 3D6CA 1X3QA 1CK1A 4A3KB 5ITRA 1HUMA 3HU2A 5IGEA 1GUNA 2K6AA 5KPTA 3NUCA 3EFXD 3CHBD 3WDNA 4NOOB 4GITA 2V1UA 4X64M 2EY1A 3HHXA 1A2UA 1GUOA 4KHZA 1QOHA 1N32M 3DEPA 3ERQA 1U4LA 3FVQA 1G8PA 3P1HA 1B2TA 5E1FA 4LFCM 2JP1A 5DM63 1YSYA 3HOXB 3D31A 1S3SA 2FNAA 1XWEA 3BVGA 3MC0B 3R93A 4GC5A 2K32A 5IGBA 3J81L 3LVWA 1YNND 1ONLA 1G2SA 5C5MA 2E75C 4RAUC 3U5ZA 1ENAA 3D6WA 4IBIA 4R3DA 1SYCA 1ZQ9A 5KIXA 1SJHD 4BBRB 3LQRA 1Z5CA 2J7ZA 3KBXA 4Z6YA 2XEPA 1CA6A 1PFNA 4U673 3OTOM 1Z59A 2NVTB 1G4AE 2KEEA 4JI4M 3ITPA 2VB3X 4Q5VA 4A3GB 2HDMA 3T1HM 5JI2E 1LLRD 3CF0A 1XHBA 3I4NB 4KMUC 2SEBD 1S5FD 3L28A 2SDFA 1PYWD 5C0XJ 2MUYA 4J8QA 3NWTA 3J80E 1JB3A 3U6QA 2DWLA 3Q22A 3SHGB 1LTAD 4MGHA 2R7ZB 3HS0C 4LG2A 1L1TA 2PQEA 2Z4RA 3J27B 4G6ZA 2Z4HA 4L63B 2IWHA 2F5NA 4L6TB 2VXWA 4IBEA 5CMDA 2EY5A 4LFBM 1STEA 3PUZA 1NVMA 2O5RA 2E2JB 2OQ4A 4S12A 2F4IA 3NHHA 2AWNA 1EQTA 3KLRA 3SEBA 1ET9A 1WTPA 2FHTA 2A6ED 2JA8B 2KXEA 2F3WA 4IBCA 2Y20A 5JI3E 1IY1A 2EA0A 1DXMA 1L1ZA 3VK8A 2K47A 3M7GA 4R9WA 4FNFA 1JR3D 2BE5C 3U6PA 2HCIA 1C4QA 4S3SA 3DHQA 4BBAA 2C99A 5AFWA 4JI3M 5EPJA 2CHQA 1VF7A 4YHHM 1HR0M 3VR4A 3MAQA 4IUNA 2F0VA 1YNJC 2MPMA 1SYGA 3SK5A 2G9HD 4JI2M 4KV6A 1STNA 2AQ2B 4Z8XA 1B9MA 4TRDA 4LF8M 2ICIA 1PMRA 3I4YA 4KY5A 3G7LA 2F0JA 4M0WA 3M4YA 5IT9L 5E26A 3NWSA 1TH3A 3AJIB 4IUPA 1IN5A 3WHKA 3QWLA 2QCPX 3URYA 1JOKA 1STHA 2XH9A 3H94A 4H7BA 3DUZA 2LKVA 1JQJC 3DM1A 2B2UA 1DJRD 2F0SA 1G59A 4PD2A 3HOUB 1QVRA 2ZANA 1SBBB 3S15B 2VQFM 3KOZE 1BR9A 3HZXA 4AW4A 1LTSD 1SE3A 4KY6A 1G6ZA 1TR5A 3FTFA 3BDLA 2BA1A 3KFUG 2NTTA 1N36M 1ZXTA 1TS3A 2TSSA 3GLGB 4NRVA 4P16A 3SR1A 3I8ZA 3KOYE 1R7RA 3S1NB 1XYIA 1I4WA 5FO9B 2CHVA 4LF7M 4TKOB 1HTLD 3BZDB 3MHBA 3GLFB 1F9SA 2IW3A 1GL6A 2A69D 5COYA 2CQAA 1J7KA 1EY8A 3AU7A 2DWZB 2PCFB 1K83B 2K1BA 5CGKA 5NUCA 3SHLA 4Y7NB 2D5DA 4I8OA 4OU7A 4FVMA 4OW0A 3HJSA 2F0UA 1EEFD 4PDGA 1F2YA 2O5IC 4YY3M 1V43A 1X3PA 2R6GA 4GKJM 4B7HA 4IALA 4KY7A 2J7OA 4DV3M 1BNZA 2F0MA 2Z4IA 1RD9D 1VF5C 2CV1A 4LK1C 1IM2A 2L55A 4CGYB 1YE9A 2EY6A 5ELEA 4IQZA 2OT2A 1SJED 3H09A 4RHSA 1LTTD 1HFNA 2FINB 2Z7JA 3H6MA 1SE4A 3U61B 2IT1A 2OXPA 2CV2A 3CU7A 3K2LA 3ZH9B 5C1BA 3A45A 1N33M 4I81A 1STYA 4RCOA 4EVOA 1C8CA 2J7NA 1BO0A 2L5TA 3W0LB 4GHAA 1D1KA 3LMMA 3SAWA 4O42A 3VDPA 4ZLTF 4J6HA 3CRKC 1NSFA 2AHMA 1JQYD 1FYCA 3GQ4A 4ZPXA 4M1UB 1IYUA 3CF2A 3U61A 1IW7C 3J80S 1L2DA 3TE6A 3NK9A 4KLNA 2WINB 4DN4M 1R6BX 2E2DC 4KODA 4HMIA 1HQYE 1ILQA 2TMPA 1SMYC 5KRUA 1L0YB 3NQTA 1J9OA 1BCPB 5LMNM 2B2UC 3GO8A 2B39A 2PW5A 3LWUA 2Z8LA 3SVMA 1F2MA 3J7YW 3K7AB 3SBJA 3AOEA 2J0TD 1RCVD 4ZUIA 1HTPA 4KI0A 4C3HG 3UGJA 4OO1G 4PT5A 2RKOA 1FD7D 3L27A 4QHTA 3L2AA 1SYDA 3HOYB 5KYIA 1KTKA 1PLFA 2KEDA 2VIIA 2G8LA 4KKSA 4DA2A 2KZSA 5DNFA 3M7NA 3K57A 2KW0A 5F3WA 1GHKA 5FK9C 5IWAM 2C96A 4IFDI 3I72A 1G2TA 5FLXL 4KJOA 4BB9A 4B3MM 3NPPA 1A6XA 4XIGS 4DV7M 3THGA 2EUCA 4RWSC 5FO7B 4ITQA 3SK6A 1F2ZA 2L9HA 1CA5A 3M85A 2QZ4A 5CBEE 4A3VB 2D7GA 5CBAE 1Y8NB 4C3JB 3KBGA 2F4VM 2KRUA 5KGUA 1O7ZA 3HKPA 1DGBA 1PTOB 4J1MA 3VR5A 1R2YA 4IUUA 1TDZA 3OPOA 2M00A 3GPPA 1AFPA 2B8FA 3ZC7B 3I91A 1QJOA 1RTNA 3A56A 3KLSA 3R3OA 5ELFA 2H4OA 2WIIB 3TDQA 3GP7A 3U6OA 1YNJD 5CORA 4QNMA 3U6SA 1DM0B 2DVWB 3QWNA 3AV0A 5CV7A 3EQLC 2CE7A 1C1KA 3SYLA 5C6AA 2JEBI 1NJGA 5IOCA 2IJ0A 5JOBA 5H37D 2UU9M 4FO2A 3JR5A 2B2TA 5JJZA 3KSXA 3TN2A 2XSZA 4G7ZC 3GRYA 4DR2M 4G4QA 4G7HC 4L8RC 4QB4A 1TWHB 3VYSA 1LTBD 1GUTA 3ILKA 3I4MB 4XYQA 2G5GX 3GLIB 3HRZC 1IQPA 1SDFA 1STBA 3C3LA 4NSOB 4MHEA 2DHRA 1DZ1A 2BJVA 1M4VA 1CTMA 4NXMM 4K0KM 1PXUA 3KP0E 4BLCA 1T5XD 1ENCA 1JR0D 4K14A 1Q1BA 3VYUA 1IKMA 3J7BA 2PMZB 1F77A 2KECA 1JORA 3A8JE 4RHRA 3A7LA 5K36G 3S17B 1TH4A 3SC3A 2KJXA 5JVH3 3VLFB 2R45A 5IZ7D 3HHYA 2K7VA 4QMGA 4LAAA 1WTWA 1NHWC 1XMOM 4FF4A 3NTKA 4LJ4A 1BCPC 1PZJD 2XVSA 4CISA 5EQ0A 5EXSA 5I2XA 2DY7A 2DZOB 1DGGA 5C3XA 4B08A 2QP9X 4F8MA 2HKJA 4LJ7A 2ZXOA 1DGHA 4YIJA 2F5QA 1PTOH 3K5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBI A;  4CHT B;  4CGY B; 
#chains in the Genus database with same CATH topology
 1R2Z A;  1HNX M;  1KHI A;  5IGG A;  3U50 C;  4GNX B;  1XNQ Q;  3JR4 A;  1MJC A;  1OXS C;  3OIP A;  3DWQ A;  3BYY B;  2R0I A;  3FEW X;  3IRB A;  1IN7 A;  1VQ5 A;  1D7Q A;  2EYP A;  2XRS D;  3HG9 A;  2FS1 A;  3J81 c;  1A3V A;  5IGC A;  3J81 i;  1N34 Q;  1Q86 C;  1PH8 A;  1HNX L;  3BVM A;  1OXX K;  4DR6 M;  5T1I A;  4KT0 F;  2CFO A;  2MR9 A;  2P5T A;  3AOG A;  4XBO A;  4PZ6 A;  3CD6 A;  3OIQ A;  4RGM A;  4DGZ A;  3I04 M;  2B2Y A;  3MTS A;  4L4U A;  1MKH A;  3C1E A;  1IN4 A;  4K5X A;  3TSS A;  1VQ1 A;  1Q3L A;  3CAM A;  3FMC A;  4C3I B;  1AZQ A;  4DR6 L;  3AEV A;  2JY5 A;  1L2B A;  3TP6 A;  4GNX A;  3ULP A;  2GQF A;  3DMU A;  5IYB G;  2ERC A;  4DXG A;  4MN3 A;  4JI1 M;  3EIH A;  2X69 A;  1C48 A;  3T1Y Q;  3TME A;  3CXC A;  4DPG A;  2XFT A;  1SYE A;  2Z9H A;  4I4L A;  4LGM A;  4K8I A;  1VQI A;  2X4A A;  1TWH H;  3CCV A;  2KHH A;  1VQF A;  2EKK A;  1PTO C;  3SAT A;  1SNQ A;  1OFH A;  5FJ8 H;  3LVV A;  4RG1 A;  3RGS A;  1CQV A;  4JI1 L;  2JJQ A;  2F4V Q;  3M3Y B;  2F0W A;  2JYO A;  1PRT B;  3I4M H;  4DAY B;  1HNZ Q;  5ELC A;  1CZG A;  2F0F A;  4K8J A;  1IBL M;  1NSN S;  1B7Y B;  3FUT A;  5D65 A;  1TY0 A;  2I5M X;  1JMC A;  2D7E A;  5C0X G;  1D1I A;  3TBI B;  4UDU C;  3HP3 A;  5I6Y A;  4UP9 A;  1NBW A;  3S9W A;  2KVM A;  2EIF A;  2D9U A;  2V1C A;  5BN3 A;  1CSQ A;  1IBL L;  1SMY D;  3HHZ A;  2SNS A;  2OQ0 A;  2CRU A;  1XXH B;  5BN5 A;  3KS8 A;  2EYM A;  1G51 A;  4MTN A;  2RBM A;  2P5Z X;  4KHP M;  1D5M C;  5FLM G;  1AZP A;  4B3R Q;  2JE6 I;  4POG A;  3NSW A;  1XXG A;  1ESF A;  4DAY A;  3S17 H;  4ME5 A;  2NVX B;  2CW0 C;  4KD3 A;  3QJY A;  5A35 A;  3FYD A;  5IY0 A;  1ML0 D;  2UU9 Q;  1VQK A;  4KLK A;  3TWK A;  2ZJP A;  4QUC A;  2B2W A;  4KHP L;  3MXP A;  4LJ6 A;  2Q2H A;  4A3J B;  2F0N A;  1Y8G A;  1CKO A;  5KND A;  3MWY W;  3D0F A;  1XXH A;  2BCO A;  5JEA H;  1VQ8 A;  1IN6 A;  1X9N A;  5IYC H;  1PJQ A;  3ZJY C;  1CI3 M;  3FKE A;  1F9P A;  2JA2 A;  3FUW A;  3KF8 B;  3PIP A;  4GS3 A;  2KOL A;  1K8O A;  2LTU A;  4BA1 I;  3AFP A;  3D8B A;  2MFI A;  3G48 A;  1O7Y A;  3B7N A;  5EXP A;  3VR3 A;  1LAC A;  1LO5 D;  1S5C D;  3R2I A;  2DAG A;  3GLH B;  5M3M G;  3FPU B;  5DM7 3;  4IUQ A;  5IT9 c;  2PPB C;  5C5L A;  3TZD A;  1D0L A;  2MO1 A;  4DV6 M;  3FYC A;  2NN6 I;  4K0K Q;  1NNU C;  1LV9 A;  4NB3 A;  2APL A;  3DA1 A;  3K92 A;  2N88 A;  1HA5 A;  2F52 A;  4RGO S;  5EPL A;  1DON A;  4DR7 M;  2BH2 A;  3KF8 A;  1S5E D;  1Q3C A;  4DV6 L;  1DO2 A;  1QZM A;  4C3I H;  4W5W A;  1SSO A;  1J8I A;  4FW9 A;  1JOO A;  4JYA M;  1A8V A;  4YWM A;  1QVG A;  3MJ5 A;  3A98 B;  1V1P B;  3CPW A;  4DK1 A;  1T5E A;  4DR7 L;  2N49 A;  3GLH A;  1EU3 A;  1IKL A;  2BNK A;  4DK0 A;  2C5R A;  2BWE A;  3NTI A;  1V33 A;  3I4O A;  4LF6 M;  1V1Q A;  2JA6 B;  1PH5 A;  1JCK B;  2ALY B;  4PMC A;  1UAP A;  2B2Y C;  3H3V I;  4JYA L;  5EP2 A;  4KKU A;  4LFA Q;  4QL5 A;  3QOL A;  4L16 A;  3FD9 A;  2D7H A;  1JWS D;  5C3E B;  4GNX C;  3M3Y H;  4EQP A;  4LF6 L;  2WSC F;  2VF7 A;  1EYA A;  3PUX A;  4X3S A;  4A4I A;  2CVR A;  5ITY A;  1SRU A;  4HAE A;  5BR8 Q;  3HY5 A;  2F0Q A;  3CME A;  1HNX Q;  3S1M B;  2KHJ A;  4FYD A;  1Y8P B;  1KAB A;  2OEO A;  4GRI A;  1PZI D;  5D3I B;  2F3I A;  4BBS G;  1E2W A;  2SNM A;  2LHG A;  1Q3B A;  1U4P A;  1Z7T A;  1LYL A;  1UE1 A;  1V1P A;  3AKZ A;  2EYJ A;  4DK6 C;  2F5S A;  3HOW G;  2MHV A;  1L2C A;  5C4J B;  4LMQ D;  3F2C A;  2QEJ C;  3HKZ B;  1SNM A;  2VL6 A;  4CJ0 B;  4LF9 M;  3L9A X;  5M5X B;  3E6Z X;  3N52 A;  3KYH C;  2EKF A;  4BA2 I;  1KXL A;  8CAT A;  3EJI A;  4UAI A;  1AUA A;  3JAM L;  3SAU A;  1MX0 A;  2IPK D;  1GD7 A;  3PNV A;  4XQN A;  1Y69 U;  2A6H D;  5JPN C;  1NO1 A;  1KDA A;  5JEA J;  1RF2 D;  2WKD A;  4EX5 A;  2NVX H;  1BOS A;  1HT1 E;  4JVZ A;  5EP3 A;  4E6I A;  4LF9 L;  4OHJ A;  2Q2E B;  3QOJ A;  4GZY C;  4RKU F;  3R8F A;  2V1C C;  3ND9 A;  3FUU A;  2F5O A;  1GUW A;  1KRT A;  1KFV A;  2XWJ B;  2N55 A;  2XGN A;  4A3K G;  1OJL A;  1IFY A;  4A3J H;  1BCP F;  1EIH A;  4B3S Q;  4HJ5 A;  3VKG A;  3RUZ A;  3AQQ A;  3LX0 A;  1PRT C;  5KEE A;  1AW7 A;  2XTI A;  5A2Q L;  3GQ5 A;  3G6E A;  3OW7 A;  3VA7 A;  1YVC A;  2G3Q A;  2GA4 B;  4QJF A;  4KO8 A;  2B2W C;  4DR3 Q;  3A8I E;  1OFI A;  4XQQ A;  4OIJ A;  4RKB A;  1NY4 A;  1QAN A;  3PO2 B;  4MH0 E;  3HOX G;  2QGQ A;  1HZA A;  3RD4 A;  1V92 A;  2DUD A;  2QW7 A;  3GPX A;  4DR5 Q;  4PMW A;  3E5S A;  2RF4 A;  2CWA A;  1H9R A;  1EY7 A;  4H44 C;  3T53 B;  5I6W A;  2DNE A;  4LWC A;  1HFG A;  3U9O A;  1EZ8 A;  3KS4 A;  2IX3 A;  2ZT9 C;  4DUY M;  4BBR G;  2ATW A;  1NHG C;  1AP0 A;  5TSS A;  1TS4 A;  2HD3 A;  3J81 E;  5J22 A;  4OX9 Q;  5E7N A;  4K2L A;  2PO4 A;  3VYT A;  4B9X A;  4KHP Q;  4LRS A;  1QIL A;  4PZ7 A;  2K5H A;  1XMQ M;  1EQQ A;  1IBK M;  2K28 A;  5FO8 B;  4DUY L;  4NL4 H;  1NR4 A;  2O25 A;  1SAP A;  1RHP A;  3K5O A;  5HUR A;  1S5B D;  4CJ2 C;  4DUZ Q;  4EIW A;  4A3G G;  4IFD H;  2B2V A;  1E9S A;  2E2H B;  1D6E C;  2F0L A;  1PFB A;  5KQD A;  3I4N G;  3L2P A;  4A3C G;  3RMH A;  2A68 D;  1XMQ L;  2KHI A;  3X3M A;  1Y1W B;  1IBK L;  1MD2 D;  4KN4 C;  3UE0 A;  2JA6 H;  2FJ2 A;  1ICF B;  3VFD A;  1B70 B;  3T56 B;  2HL7 A;  3CTW B;  3DFZ A;  1IY0 A;  3LCV B;  2WSE F;  1PTO F;  4CBV A;  1WTR A;  1BF4 A;  1Z47 A;  2R93 B;  1U4M A;  1LT3 D;  2R7Z G;  3PXG A;  3RLN A;  1SYB A;  3NQI A;  5C3E H;  3HHW A;  2PMZ E;  3E21 A;  2UUB M;  1ZYR C;  3B6Y A;  2IHE A;  3F1Z A;  1Z9F A;  3QAU A;  1OXV A;  3FHW A;  1PJI A;  3S1M H;  2DNC A;  1NAP A;  3PUV A;  1NJI C;  5ISR A;  1STG A;  2YQZ A;  2EJF C;  2ZAM A;  3DWP A;  1Y1V B;  1CFM A;  2Q8I B;  2UUB L;  1QDT A;  1QNU A;  4IN3 A;  4DV6 Q;  1WHC A;  5C4J H;  1PH3 A;  1TKW B;  4LFC Q;  2EO2 A;  2YU9 B;  2G9D A;  1PA6 A;  5LL6 S;  5M5X H;  4CHT B;  3NTH A;  3W3A A;  2JA8 G;  4LGY A;  4HL4 A;  2JA5 B;  2VY3 A;  3Q8G A;  3FE3 A;  2LVO C;  1FL0 A;  2CP8 A;  2FE8 A;  5DNY A;  1N75 A;  4BY1 B;  3ZCB B;  2XSZ D;  1RKN A;  5G3L F;  3QIA A;  3PUY A;  5FLX c;  5C4Z A;  3VYR A;  2WZJ A;  1JE5 A;  1DOL A;  1E7Z A;  1LTI D;  4JYA Q;  1R4Q B;  1XPR A;  2RDH A;  1Z5A A;  3MEH A;  1U4R A;  1NMG A;  4P75 A;  4D81 A;  3GLG A;  3H91 A;  3OSO A;  4PQX A;  1E32 A;  2D0P A;  2Y0S B;  3OTO Q;  1R4P B;  4B3T M;  1CQF A;  2XF3 A;  4A75 A;  4JI4 Q;  2RCN A;  1V8Q A;  2QNJ A;  4ULL A;  1MIU A;  1PH7 A;  3T13 A;  4U68 A;  2Z8Y M;  4GIP A;  1AN8 A;  1BUV T;  3GTG B;  2AMC B;  4B3T L;  4A93 B;  4ZUJ A;  3MFY A;  4HCE A;  3W1G A;  3PO2 H;  4FCT A;  1MGS A;  2L09 A;  1EQR A;  3B9P A;  3PIO A;  4RH6 A;  3LWE A;  1IY2 A;  3GLF A;  5LMU M;  2K05 A;  5IGD A;  1KNE A;  1DYQ A;  3ULJ A;  4B7G A;  1YHB A;  4I5S A;  1KDB A;  1PFM A;  3PIP 3;  1E0B A;  2NZO A;  4DU9 A;  5KPZ A;  1X6O A;  1QAO A;  4IFD J;  1YUB A;  1IL8 A;  1EE8 A;  1WYD A;  2YTY A;  4LF9 Q;  4L5Q A;  3K8Z A;  3MXG A;  1WTQ A;  5IT9 E;  5LMU L;  2YTV A;  3OOC A;  2R65 A;  4JV5 M;  4LFB Q;  3GPU A;  4XK8 F;  1Y1W G;  3K59 A;  1TVX A;  5I4D A;  1D0M A;  3OW2 A;  2KRK A;  4BXX H;  1GUG A;  3T51 B;  2R93 G;  3A8K E;  1G91 A;  2CH4 W;  2CEA A;  2ZM6 M;  4KJN A;  3KJO A;  5KYL A;  2KNZ A;  1KDC A;  4JV5 L;  3HOU G;  2E2H H;  2NQ8 C;  3FKI B;  3K7U C;  5I9P A;  2BDO A;  3D3R A;  1VEK A;  2OOA A;  5EXX A;  3IL8 A;  3ONA B;  1QVF A;  1Y1W H;  3TWL A;  1UEB A;  4V19 0;  4I65 A;  1Q8K A;  2ZM6 L;  3SAR A;  2R93 H;  1JWU D;  4KKT A;  3P7J A;  4HSP A;  2Z6K A;  3PNY A;  2KEB A;  3U6D A;  4ABN A;  1XXH E;  3TP5 A;  2B2V C;  4JBW A;  3C2P A;  3RZO B;  2L7H A;  2K50 A;  4YHH Q;  1EOV A;  2F0O A;  4M9Z A;  1GKI A;  1VDD A;  4DV5 M;  2QQ8 A;  1DD2 A;  1TU2 B;  1Q12 A;  4DK3 C;  1M1K C;  4JI2 Q;  2YFQ A;  1Y1V H;  2X6G A;  1L8Q A;  1CKM A;  1ZV1 A;  3HGI A;  3UJN A;  3H4J A;  2DI0 A;  3U6C A;  4PCZ A;  2V6Z M;  1UE6 A;  4LUO A;  3IG8 A;  4R4Q A;  4GHL A;  2L4N A;  5D3D A;  2O4X A;  4DUY Q;  3FRI A;  4LF8 Q;  2YU9 H;  2CV0 A;  4DV5 L;  4JI6 M;  4YWL A;  1BDO A;  2BA0 A;  4RFB A;  2HHH M;  3G6J B;  5DFL A;  2JA5 H;  4XDX A;  3GV3 A;  3PFI A;  4NXN M;  1NY6 A;  1XMQ Q;  4BY1 H;  1T3T A;  2PYK A;  1K3X A;  2KDL A;  1IBK Q;  5FOB B;  1H9J A;  3QO2 A;  2J5Y A;  4GEW A;  1C7Y A;  1P8L A;  4RGN A;  4JI6 L;  1VMP A;  1VQA A;  2HHH L;  2D0O A;  2JP7 A;  3LGJ A;  4NXN L;  1MHW C;  5E6J A;  4MM3 B;  2C9O A;  1EEI D;  2AQ3 B;  1PRT F;  1ET6 A;  2QIL A;  3GLH E;  2K0B X;  2R44 A;  2AHO B;  2F03 A;  1GKH A;  1LUZ A;  2QF7 A;  2RRU A;  1S5D D;  5EGT A;  3KW6 A;  1KAA A;  3HKS A;  1Q46 A;  3C1F A;  4AKH A;  2UUB Q;  1GJX A;  1ESR A;  5EP1 A;  3GTG H;  2VQF Q;  3VK7 A;  1UEA B;  2MO0 A;  4R4T A;  1QB5 D;  2LXE A;  4IJH A;  4A93 H;  4X66 M;  1BVS A;  2V4D A;  3CPF A;  5DEH A;  2KA7 A;  1QAQ A;  3SDZ A;  1VQD A;  4F2L A;  1N36 Q;  2EE1 A;  1L1O B;  1AEX A;  4UY8 C;  3F2U A;  3H4M A;  1JB7 A;  1W6J A;  1JJ2 A;  3J81 S;  3MK6 A;  2HIX A;  1X55 A;  2I7N A;  4X66 L;  2MGS A;  3MHV C;  1XX8 A;  2BE5 D;  4QY7 A;  3MMP A;  1IBM M;  3I01 M;  1ROD A;  5J39 A;  1EWH A;  5JVG 3;  3BJU A;  4DR4 M;  2Y0Q A;  5EJC A;  2EJG C;  2X8A A;  4G4O A;  3OYY A;  1WD1 A;  4JI0 M;  2E5L M;  3U6E A;  2UUC M;  1VS0 A;  2ENB A;  2RDF A;  3PUW A;  1H9K A;  1SMX A;  1PJJ A;  2HDL A;  2EJS A;  1II3 A;  1IBM L;  2FH0 A;  4FWD A;  5IIF A;  4JI8 M;  4DR4 L;  1HCZ A;  2VQE M;  3GTK B;  1EFI D;  1L1O A;  2BOS A;  1DGS A;  3FKI H;  1D5Z C;  4L5R C;  4JI0 L;  1PVO A;  2E5L L;  2UUC L;  1YJN A;  5KPR A;  4WP2 A;  2K14 A;  2NVQ B;  4FF3 A;  2UXC M;  1A5T A;  3WOF A;  4B3T Q;  4WW0 A;  4F7X A;  1WTV A;  2K5W A;  4R8N A;  4JI8 L;  1GAB A;  3B89 A;  1I6H B;  2VQE L;  4H02 A;  2JEA I;  5J1Z A;  3HKZ E;  2DNA A;  1QYR A;  1WGL A;  4CJ6 A;  5IP7 G;  2EVB A;  2F0I A;  4ZKB B;  2UXC L;  3K1J A;  3RZO H;  4L8J A;  1G41 A;  4C1N I;  2L1B A;  1DV0 A;  3U9S A;  3TZU A;  4AQY M;  5IOD A;  3LW5 F;  2H1R A;  1HZB A;  2BWB A;  4M9S A;  3SFZ A;  4JCV E;  1Q90 A;  3HOY G;  2L0C A;  2C5C A;  2EZV A;  3C3D A;  2F0H A;  3DLL A;  4IIW A;  2F5P A;  2Z6K C;  3NBI A;  4HIO A;  5D14 A;  2MRO B;  3GTJ B;  2UXB M;  1I4P A;  4AQY L;  4GN5 A;  3GTL B;  2NN6 H;  1ICW A;  1EWC A;  4RA8 A;  4IBD A;  2KZU A;  4XGI A;  5FKA C;  1CM9 A;  1CT1 D;  1GLN A;  2CQO A;  4MNO A;  3IFT A;  2UXB L;  4AG5 A;  2OTL A;  1G8Z D;  5FTJ A;  4PZ8 A;  3T16 A;  1XTC D;  4NW2 A;  3J80 c;  3OHX C;  4QCL A;  2LS0 1;  3KDS E;  5CV4 A;  2IL8 A;  1Q39 A;  1SNC A;  2WV6 D;  4FF2 A;  2JXM B;  5FLX E;  2KEN A;  4NC6 A;  4ME3 A;  5BN4 A;  5HGT A;  3GLI A;  1KL9 A;  4X65 M;  3A46 A;  4GN3 B;  1BQQ T;  1HNW M;  3A0J A;  5L37 A;  4A3D B;  1ASZ A;  1LT5 D;  1SXT A;  3RE8 A;  4C3J G;  2AWO A;  1K8M A;  3IFD A;  3K6O A;  1FNW A;  4DFA A;  4DV2 M;  5HY6 A;  1KSF X;  3OWE B;  4R1J A;  2JA7 B;  4AKI A;  3H3V H;  1GOZ A;  4X65 L;  5DAU A;  1JT8 A;  1SXJ B;  4OXP A;  4JOI C;  1HNW L;  5ITT A;  2EDG A;  2H1E A;  2EJM A;  5DYI A;  5LHY 1;  1S40 A;  4DV2 L;  1GXD C;  1CZW A;  3LNN A;  2QKI C;  5H1S E;  3IEC A;  1EY0 A;  2OPF A;  3H15 A;  2QEX A;  1Q7Y C;  1YBY A;  5IT9 S;  3HGB A;  5HGQ A;  1HPC A;  4CIZ A;  4QGU A;  1PZK D;  3W0F A;  1A2T A;  5EBC A;  4NP5 A;  3B7Z A;  3AFQ A;  3S1Q B;  1FR3 A;  2R92 B;  1E94 E;  1KNA A;  4PNY A;  2MGW A;  4N9P A;  1G29 1;  3PIO 3;  5C4H A;  2HHH Q;  4LF4 M;  1ZAE A;  2NWG A;  1Q81 C;  2N35 A;  3KXE C;  1D2B A;  4R7G A;  4RMF A;  1SXJ A;  2XZF A;  1R4G A;  3CCU A;  2OCE A;  1JB0 F;  2RGO A;  1P3Q Q;  2HIV A;  2GN5 A;  4LF4 L;  1KC8 C;  1HQC A;  3GTK H;  2Q8R E;  1DO0 A;  3O13 A;  5IWA Q;  4HIK A;  2NVQ H;  4ZCK A;  4ZQ3 A;  4B3M Q;  2XFS A;  3H3V C;  3GLG E;  2DWN A;  2R46 A;  4MGY E;  3NEL A;  4KD4 A;  3VR2 A;  5FJ8 G;  1GVP A;  1U9R A;  4XQJ A;  4DV7 Q;  1I6H H;  2R6F A;  2Z6B A;  2RQX A;  1LAB A;  3I4M G;  3MXN B;  2I46 A;  1K73 C;  2L12 A;  2SOB A;  2EQS A;  3TP8 A;  4GC9 A;  1L1O C;  1X65 A;  3SHF A;  2EYH A;  1Z5B A;  4HN7 A;  3KUP A;  3FDT A;  2MNA A;  1WVL A;  1X54 A;  1DCZ A;  1G6P A;  2KUM A;  3HU1 A;  4KTA A;  4OWW B;  4A3I B;  2JNH A;  4HMJ A;  3N6R A;  4N9T A;  1RDP D;  2JQO A;  4OO1 I;  1F9Q A;  3FP9 A;  5I2Y A;  1RL2 A;  2MH8 A;  2K01 A;  2ZJR A;  3S14 B;  2LWX A;  3GLF E;  2ID0 A;  1OIP A;  3K0Y A;  3GTJ H;  4RF1 A;  4JBJ A;  5EJW A;  1IW7 D;  1IBM Q;  4X3U A;  1W6K A;  1OAO C;  3GTL H;  3JAM c;  2D2C C;  5EPK A;  4DV4 M;  4FF1 A;  2ZTE A;  3JAM i;  2L2D A;  3MXN A;  3UDF A;  3GQ3 A;  2PQA B;  2UUC Q;  2L7I A;  1YIJ A;  3L29 A;  1I4X A;  1R9T B;  3I7F A;  1E22 A;  2Q8T A;  1K8G A;  1TWF B;  4PMB A;  2XN9 C;  3M6A A;  2WKC A;  4JI8 Q;  5IP9 H;  2XNA C;  3CQZ B;  2X49 A;  2VQE Q;  4DV4 L;  4QNR A;  3RFW A;  3GV6 A;  4DKA C;  1IYV A;  2E76 C;  4ODG A;  1IXS B;  3BZC A;  5JJI A;  5JEA G;  5JAV A;  4A3D H;  1NV8 A;  4UHV A;  4OIK A;  3J80 L;  3S2D B;  1OQY A;  4ZKC B;  3T4A C;  3UZU A;  5T1G A;  5IYC G;  1SND A;  1OXT A;  5ITX A;  3OWF A;  2QA4 A;  4HED A;  2R61 A;  4M8A A;  3F2B A;  4IBJ A;  3T38 A;  4DAM A;  1I50 B;  2JA7 H;  1A63 A;  4DR2 Q;  1H6U A;  5AJ3 L;  5E4W C;  5CC4 A;  1CUK A;  3R9X B;  4IPC A;  4H0L C;  4AQY Q;  1B1Z A;  2F1M A;  2WP8 J;  3ICE A;  5EAY A;  1VQG A;  1ZMU A;  2HCB A;  4R4O A;  4CDD C;  2LBC A;  2KHS A;  3TPZ A;  3AL0 C;  2YR0 A;  3EN2 A;  4JXJ A;  2JZ1 A;  1B44 D;  5EKI A;  2UXB Q;  2R92 H;  3S1Q H;  4JN6 A;  2PZW A;  3V05 A;  4CDE C;  1HQM C;  1GM5 A;  3D4W A;  1O7L A;  1H9M A;  7CAT A;  4NXM Q;  3HWS A;  4C3I G;  3BOS A;  4LJA A;  1NY5 A;  2QHO B;  4EQO A;  1N77 A;  2PZT A;  3R2T A;  1B4O A;  1GUS A;  2UXD M;  4J15 A;  4DV0 M;  4WOR A;  1IXZ A;  2RDG A;  3DXJ C;  1QE6 A;  1KRS A;  3U5Z B;  1XTD A;  1U0L A;  4LF5 M;  1EY6 A;  3V96 A;  1HNW Q;  5EKL A;  5IYD H;  2DN8 A;  2UXD L;  1TS5 A;  4DV0 L;  3PO3 B;  2KCN A;  4DF7 A;  1SXJ C;  3MA2 B;  2F0D A;  2H5X A;  1MN3 A;  3CP0 A;  4AZF A;  2CCZ A;  1XMO Q;  3U4V A;  4OVZ B;  4LF5 L;  1XPU A;  3M4Q A;  1FVI A;  1B53 A;  4WJ4 A;  1VQJ A;  1W5T A;  3I4L A;  1EIJ A;  3CKI B;  2Z4S A;  4A3I H;  2QCU A;  2R7D A;  4LZZ A;  1WCM B;  5ELB A;  3A55 A;  4A76 A;  2CKZ B;  2VS1 A;  4LJ5 A;  1VQP A;  3SYK A;  4JPB W;  3S14 H;  3AB9 A;  1ENF A;  1AIP C;  1XWI A;  3SE0 A;  3L25 A;  4EGV A;  3P75 A;  1FJG M;  1XB2 B;  2LY7 A;  1E1O A;  2NB0 A;  5GAH C;  4IBF A;  3CMA A;  3A7A B;  3AFH A;  4OVZ A;  4NMZ A;  5EKK A;  1AH9 A;  3BDO A;  1GVN A;  3FTE A;  3U6L A;  1TT2 A;  4FXK C;  3KVW A;  1VG5 A;  4ANR A;  2O01 F;  5FLX S;  3U60 B;  2K75 A;  4DXF A;  5KNB A;  1R9T H;  4CKB A;  4DR6 Q;  1TWF H;  2I5H A;  2F0P A;  5C44 B;  4A3B B;  1EYC A;  2E74 C;  1HZC A;  2I07 B;  1FJG L;  2UUA M;  4DV1 M;  3CQZ H;  4MIU A;  4X3K A;  1YHA A;  1M8A A;  4A3J G;  1F9R A;  1QNK A;  1MU5 A;  2EYL A;  4UPA A;  1UUP A;  4QOS A;  3MZ5 A;  1FGB D;  3TL4 X;  2AQ1 B;  4TQU S;  3J7A F;  1PDQ A;  1Z6H A;  1BKB A;  4ALP A;  2UUA L;  3S2D H;  4DV1 L;  1Y8O B;  3EA6 A;  4L5T A;  1ILP A;  4FP5 D;  4JI1 Q;  1HHV A;  4LUV A;  1QAM A;  1I50 H;  1Z6T A;  2JK8 A;  4X62 M;  1AE3 A;  1J6Q A;  4AYB B;  3CC2 A;  5C18 A;  4ILW A;  2IX1 A;  3U60 A;  1TXY A;  2KCT A;  3H0G B;  1HRJ A;  4A3L H;  2BH8 A;  4NDX A;  5JPM C;  4LJ8 A;  1TDH A;  1TH2 A;  2RGH A;  3M9B A;  1ZEQ X;  4Z9C B;  4ZRZ A;  1QCB D;  1QZG A;  4X62 L;  3C58 A;  4G4R A;  3K5L A;  1MJE A;  1BBX C;  1IBL Q;  1NJF A;  3GRV A;  4L15 A;  1O80 A;  2F0E A;  2QEN A;  3KDF B;  1A3T A;  5BPV A;  3Q6S A;  1SN8 A;  2WB1 B;  3S24 A;  1WIV A;  4HID A;  3S2H B;  3GO5 A;  5FTM A;  4P72 A;  4KHV A;  4DV4 Q;  1TII D;  5M3F B;  1BCP D;  2EYO A;  1I5F A;  3L26 A;  5FTK A;  5KO3 A;  3L3O C;  2N8N A;  4BY7 B;  1G3I A;  2DJG C;  1PJS A;  4LCB A;  1SNP A;  1PM5 A;  4IFD G;  2VF8 A;  1KLU D;  2ZXP A;  3FTC A;  3ERO A;  3BG3 A;  4ID6 A;  1Y14 B;  2ZTC A;  3K80 C;  4C56 C;  3UMM A;  1YJ9 A;  2JA6 G;  2RVL A;  5AJ3 Q;  2NUC A;  1Q82 C;  2ASB A;  2DAK A;  3GLI E;  3HX3 A;  1TWC B;  4A3E B;  3PO3 H;  3K81 C;  3KDF A;  3X3N A;  4GKK M;  2K5V A;  3NWL A;  1K3W A;  2K33 A;  5C3E G;  4D82 A;  1Q02 A;  1STA A;  1I6V C;  5J3B A;  2YYZ A;  4OGQ C;  5IGF A;  4BS9 A;  1I3Q B;  2CHG A;  3T6P A;  2JSO A;  2K5Q A;  1GHJ A;  2WAQ B;  2HAK A;  3DEO A;  5EXT A;  5EP4 A;  1MBY A;  4FD2 A;  1MSG A;  2XIW A;  3VR6 A;  4GKK L;  1W2B A;  2PW7 A;  4JBM A;  4QHS A;  4M9X A;  5C0X I;  4WJW A;  1WCM H;  2EY2 A;  1QWY A;  2RSN A;  2PI2 A;  3PGZ A;  4AG6 A;  4UP7 A;  1OTR A;  1ZMW A;  2DXI A;  4UP8 A;  3I73 A;  3L7Z C;  1QUQ B;  3HKZ G;  1WJ7 A;  3UDX A;  3PF4 A;  4KK7 A;  4WFN 3;  4CKE A;  3NE5 B;  5ITQ A;  2B63 B;  3FTD A;  3EBE A;  1XNR M;  2R18 A;  2NZ1 D;  1SYF A;  2NVT H;  1B3Q A;  4RF0 A;  4IUR A;  3Q8D A;  4DAV A;  3I2Z A;  2JWS A;  4JK1 C;  3JAM E;  1PTO D;  3VKH A;  4R8I A;  2CHB D;  2UXD Q;  2K6B A;  4YCU A;  4IBB A;  5C44 H;  4A3B H;  1SXJ E;  5FTL A;  1J09 A;  1XNR L;  4DAP A;  4DR7 Q;  4IUT A;  2OO9 A;  4HJ8 A;  4NPS A;  2BJW A;  3KLW A;  3KOX E;  3Q0A A;  4II7 A;  1QUQ A;  4N8F A;  2L11 A;  1EIY B;  1B9N A;  3QB3 A;  2QBY B;  2QDL A;  2CWP A;  4EQN A;  1PRB A;  4KN7 C;  5CV9 A;  4LF6 Q;  1UFZ A;  3GTQ B;  5A2Q E;  2LHC A;  3PO2 G;  3PVS A;  2K4K A;  4HSV A;  3H0G H;  1UE5 A;  2ZAO A;  1TQO A;  4IOA A;  2KNA A;  2JXN A;  1I4H A;  1FNU A;  2CW0 D;  1A15 A;  2XRQ D;  2XWB B;  5G3L D;  1VDL A;  5M9O A;  2O2L D;  3HOZ B;  4C3H B;  4PDI A;  3NEN A;  4NSR A;  1JC7 A;  1VDZ A;  1V34 A;  2FFJ A;  2NVY B;  4K5V A;  2JA9 A;  2EYF A;  3CRL C;  2QBY A;  3S2H H;  4LW1 A;  5CV6 A;  2EPB A;  5KNC A;  4FWH A;  2L6O A;  3J7A S;  3CF6 E;  3D8G A;  1SRO A;  5M3F H;  2ZTD A;  1WTX A;  2Y0T A;  3IKJ A;  3TS0 A;  4BXX G;  3RZD B;  1HQR D;  4BY7 H;  1E2Z A;  3I70 A;  4FWG A;  2VB2 X;  1SFO B;  4K5W A;  5DLQ E;  2UUA Q;  2FFK B;  4XT3 B;  3SAS A;  3RGP A;  1E24 A;  1JIC A;  3J7A V;  2YNM D;  1C0A A;  1TWC H;  4A3E H;  3M4P A;  4IZ8 A;  3ULL A;  4Q0F A;  1HXY D;  1TS2 A;  4B7F A;  3CCM A;  2IX0 A;  1LTL A;  1EQV A;  4REZ A;  4K6D A;  2NYZ D;  5ITX E;  3UDI A;  4AI6 A;  3EIV A;  2NZH A;  1I3Q H;  3QG1 A;  1N78 A;  3GRU A;  1F2L A;  2XSC A;  1P16 A;  3E0J A;  1K9M C;  1DOK A;  2KBN A;  3D4R A;  3B7Q A;  1Y1V G;  1EFU B;  4LJ9 A;  4X3T A;  3K9P A;  1X32 A;  5ITU A;  5GQO A;  3GRR A;  2OOB A;  4MGZ E;  1EWI A;  1K28 A;  1TWA B;  3CC4 A;  2K5N A;  3WOE A;  1VQO A;  1PH2 A;  1SXJ D;  3LQQ A;  3A5Z B;  2EXZ A;  4D80 A;  3MVV A;  4FCV A;  2KCM A;  3HOV B;  2B63 H;  2JA5 G;  2F0T A;  4L6V 6;  4XTC S;  1XC8 A;  3WHL A;  4BY1 G;  3EVQ A;  3VA5 A;  4RCN A;  3SK4 A;  2G5D A;  3CW2 C;  3ND8 A;  1OXU A;  2HCC A;  3CC7 A;  3UI2 A;  1LTM A;  1VMC A;  2HQE A;  5EBD A;  4DR1 M;  3FUX A;  4LUZ A;  4DNT B;  3K58 A;  2M9V A;  1B50 A;  3U58 A;  2VUM B;  2LH0 A;  2B8G A;  3D8L A;  4GMQ A;  1WFQ A;  2Y0S G;  4RGT A;  4GLV B;  4XT1 B;  4MB7 A;  2ZBK B;  2IY5 B;  4JG2 A;  5C4X B;  2A19 A;  4DR1 L;  3BDC A;  2Z1C A;  1EL0 A;  2MJ8 A;  3I3C A;  4GKK Q;  3FUV A;  3D4D A;  3KOW E;  1T9H A;  1GJT A;  3LCU A;  4L5S A;  1PYS B;  4JOI A;  3PMF A;  4OWT B;  4RNA A;  2M60 A;  1JR3 A;  1XNQ M;  3I51 A;  3GTQ H;  4A93 G;  1VCI A;  2A73 B;  3SXH A;  3PV0 A;  4CJ1 B;  2NTS A;  1VQ4 A;  3HEJ A;  1V9P A;  2GVB A;  1PFS A;  3GTM B;  3DWA A;  3NXW A;  1N34 M;  3I4V A;  1EIG A;  2JN4 A;  2DZN B;  4IJF A;  1XNQ L;  2JY7 A;  1IXR A;  4HLQ A;  5KQ8 A;  1UE7 A;  4C3H H;  3HJ8 A;  3S1R B;  1C9O A;  3HOZ H;  4OO1 H;  2NVY H;  3RLO A;  4GH9 A;  2Q2U A;  1EZ6 A;  3U6M A;  4QOZ C;  4PV1 C;  3KJP A;  1XNR Q;  4V0B A;  3VDU A;  2LVA A;  3SAV A;  1PRT D;  3RZD H;  2R62 A;  2E2I B;  1SFO H;  4NRW A;  1EYG A;  3A74 A;  3T1Y M;  4WRD A;  1JE4 A;  3FKI G;  4K6L A;  4TSS A;  3V76 A;  5FTN A;  3KSJ A;  1EY5 A;  2M5Z A;  2XLJ A;  1YNX A;  2HUG A;  3KP1 E;  3DOA A;  2RCF A;  4WUR A;  3E4R A;  5CV8 A;  1WGN A;  1LM0 A;  3KK7 A;  4F88 A;  3T1Y L;  1HNZ M;  3K5N A;  2Q2I A;  5M5Y B;  3EIE A;  4F1I A;  4A3M B;  1YNN C;  2A5Y B;  1DGF A;  1QQW A;  1R5L A;  1Q8I A;  3HOV G;  1V1O A;  3KF6 B;  3J7Z C;  1HNZ L;  1EOT A;  5CYU A;  2ES2 A;  1JWM D;  1PJT A;  4A3F B;  1HA6 A;  3ZQJ A;  1CKN B;  4G4K A;  2C98 A;  1TWA H;  4G4N A;  1EY9 A;  1I4G A;  4UN2 B;  1D0K A;  1HR0 W;  3C46 A;  2ZXR A;  4NKL A;  1AE2 A;  2CUZ A;  2AUK A;  4F87 A;  1K82 A;  1WXQ A;  1LTR D;  3TEH B;  3SMP A;  4B3R M;  3HOV H;  2FMM A;  2NN6 G;  1FNN A;  1X37 A;  3JAM S;  4PG3 A;  5LMU Q;  1MI2 A;  1YEZ A;  3HZJ A;  3SGI A;  3GD7 A;  5K5P A;  2KCC A;  2J4X A;  4CKC A;  2OWO A;  1FNV A;  1RTO A;  4I7A A;  4MGK E;  4XYO A;  4IO9 A;  3IG5 A;  4B3R L;  3W68 A;  5C3W A;  2F0K A;  1LV7 A;  2CH4 A;  3KF6 A;  4YWK A;  3RN2 A;  2W82 A;  1HT2 E;  3NEM A;  2FOI C;  2JUJ A;  4HR7 B;  2F3V A;  4JV5 Q;  2RKS A;  2K9D A;  1CKN A;  1ZYR D;  2L4F A;  1IN8 A;  3FRH A;  2VUM H;  1EFW A;  1QVC A;  4C1N K;  5LL6 X;  4MGI E;  4LRT A;  2QDB A;  4IBG A;  2XZU A;  4P74 A;  5C4X H;  2ZM6 Q;  5A2Q S;  2O5J C;  3J80 i;  2HQL A;  1TGU A;  1DOM A;  2EXD A;  1NR2 A;  2A6H C;  1LT4 D;  2L4E A;  4O2D A;  2WB1 E;  1NUC A;  2JZ0 A;  2WAC A;  2D62 A;  5IE8 A;  1PGY A;  3UK6 A;  3PSI A;  4B9W A;  2A6E C;  1TWG B;  4R4C A;  1J5E M;  5FSW A;  3GTM H;  3M4O B;  2OTJ A;  2EOT A;  3MFG A;  4AKG A;  3R8B A;  4Q7J A;  3I90 A;  3TWM A;  1SEB D;  3W2D A;  1H9S B;  1KQS A;  1EYD A;  3AOE C;  5E3F A;  4JI5 M;  1IHZ A;  3S1R H;  1GO3 E;  2PI2 E;  4G57 A;  1OO9 B;  4ZAI A;  1WR1 B;  1J5E L;  2LNH C;  3T15 A;  2PZU A;  4DV5 Q;  4LZJ A;  1DGH B;  4FXD A;  3GP1 A;  4IBK A;  2VNU D;  4LY6 A;  5DYG A;  1KAW A;  2VZA A;  5JJK A;  1X56 A;  4LJZ C;  1L0W A;  5GRO A;  1RJT A;  1F4I A;  4JI5 L;  2JY8 A;  3BXW A;  2R4E A;  1I4Q A;  1O7I A;  3L0O A;  3NBH B;  1CHP D;  2E2I H;  4JI6 Q;  3A54 A;  1IXR C;  5CV5 A;  4M0D A;  5K36 H;  4IJE A;  4G7O C;  2A5H A;  3W1B A;  1WTH A;  2DEN A;  4NXN Q;  2F0G A;  1H9S A;  2MP1 A;  1QDR A;  3NP8 A;  3SMS A;  4ZYS A;  3FRP B;  5EQT A;  1UM8 A;  1MSH A;  1UNS A;  2LMC B;  4HCS A;  2I7P A;  1TR8 A;  1W5S A;  4HTH A;  1SNO A;  3G71 A;  4HJ7 A;  4LFA M;  2K5D A;  3E9S A;  2B3G A;  3QYB A;  3TP7 A;  3SK8 A;  5M5Y H;  1D5X C;  5F2D A;  4A3M H;  3CGW A;  5BR8 M;  2DWM A;  3Q24 A;  3AMU A;  2K04 A;  1QG7 A;  1SE2 A;  4LFA L;  2FMC A;  3GQB A;  1U5K A;  3AYH B;  3OMG A;  2KA6 B;  2Z3X A;  1CHQ D;  2DJF C;  3NBH A;  2QPA A;  4IPH A;  3GTO B;  4A3F H;  5BR8 L;  4LNQ A;  4X6A H;  4WJ3 M;  2A68 C;  4OL7 A;  4HIM A;  3V2T A;  3OMC A;  1I94 M;  1EY4 A;  4QF4 A;  4L78 A;  3IHP A;  3FPP A;  4X66 Q;  1H95 A;  3Q23 A;  3BYT B;  2R3Z A;  3BZK A;  5M3M B;  4OWX B;  5IRE B;  5CR3 A;  1GL7 A;  1HUN A;  1I94 L;  3I55 A;  1TY2 A;  3HJQ A;  2M2L A;  2NBF A;  4FXG C;  3IAY A;  1ZKO A;  3A42 A;  2HWJ A;  1BXT A;  4O1N A;  4K2K A;  4JBK A;  4TUW A;  3KLS X;  1E9R A;  3ZYY X;  4JI7 M;  1LTG D;  1KYI A;  5IP9 G;  3GTP B;  4QIW B;  2DGY A;  2Y0S E;  4DR4 Q;  4B3S M;  1E3P A;  1EU4 A;  5GKN A;  4JI0 Q;  2E5L Q;  3DZD A;  1B3A A;  2RA4 A;  2RHS B;  4JI7 L;  4A3D G;  3P20 A;  3CCL A;  1S4Z A;  1D2N A;  5IYB H;  4P2C B;  1A3U A;  2B2T C;  5ELD A;  4IPG A;  4DR3 M;  4B3S L;  1O78 A;  3VDY A;  3BS1 A;  2JA7 G;  2K03 A;  3BVZ A;  2UXC Q;  3TQS A;  4DNR B;  4DR5 M;  1L0X B;  1K3B C;  1VQE A;  1WTO A;  2RSO A;  2A69 C;  1TWG H;  1GO5 A;  4I7Z C;  4DR3 L;  3M4O H;  1YZ6 A;  4QUF A;  1ORY B;  2PNR C;  1Q1E A;  1K0S A;  3GPY A;  1NCV A;  2PQA A;  2LVQ D;  2AUJ D;  2BDN A;  2X6L A;  3M0E A;  1I4R A;  4IOC A;  4DR5 L;  4BWG B;  5C0X H;  2R92 G;  4OX9 M;  4BBS B;  4GOP B;  5LMN W;  4XXE A;  3HOW B;  3RNU A;  2R4J A;  4ZK9 B;  2ICE C;  3HU3 A;  1VQN A;  1NNJ A;  4RKL A;  3J2P B;  5E4X A;  4FCW A;  2KNV A;  1KLG D;  1WD0 A;  1JOQ A;  1IXS A;  4DUZ M;  3Q8X A;  4OX9 L;  2LFN A;  3S16 B;  4IUV A;  1VEJ A;  2VDB B;  3RLF A;  2PNH A;  5FLM H;  5M5W B;  2OF1 A;  2C9C A;  4C2M B;  4APV A;  2Y21 A;  1LT6 D;  3MXU A;  2DY8 A;  1E2V A;  5I9O A;  4H13 C;  2KQ3 A;  4DUZ L;  2A74 C;  5IYD G;  3D6C A;  1X3Q A;  4GOP A;  1CK1 A;  4A3K B;  5ITR A;  1HUM A;  3HU2 A;  5IGE A;  1GUN A;  2K6A A;  5KPT A;  3NUC A;  3EFX D;  4X65 Q;  3CHB D;  3WDN A;  3MEF A;  4NOO B;  1SLJ A;  3E3X A;  2RHQ B;  1WJJ A;  3F2D A;  1T43 A;  4GIT A;  2V1U A;  4X64 M;  2DAI A;  2WSF F;  2EY1 A;  1JR3 E;  4A3I G;  3HHX A;  1A2U A;  1GUO A;  1J5E Q;  4KHZ A;  1QOH A;  1N32 M;  4DV2 Q;  3GTO H;  4POF A;  2LXK A;  3DEP A;  3ERQ A;  1U4L A;  3FVQ A;  1G8P A;  3P1H A;  1B2T A;  2B3T A;  5E1F A;  4LFC M;  2JP1 A;  5DM6 3;  1YSY A;  1W3S A;  3HOX B;  4JI5 Q;  1PH1 A;  3D31 A;  1S3S A;  4X64 L;  2FNA A;  1XWE A;  3BVG A;  1X3E A;  3MC0 B;  4AIM A;  3R93 A;  4GC5 A;  2K32 A;  5IGB A;  5M3M H;  3LVW A;  1ONL A;  1YNN D;  3J81 L;  1G2S A;  1N32 L;  1KIX A;  5C5M A;  2E75 C;  2MQH A;  4RAU C;  4LFC L;  3U5Z A;  1ENA A;  3D6W A;  4IBI A;  4R3D A;  1SYC A;  1ZQ9 A;  4P71 A;  5KIX A;  2Q2T A;  1PH6 A;  1SJH D;  4BBR B;  3LQR A;  1Z5C A;  2J7Z A;  3KBX A;  4Z6Y A;  3GTP H;  2XEP A;  1CA6 A;  4LF4 Q;  1PFN A;  4U67 3;  3OTO M;  3B74 A;  1Z59 A;  3TQY A;  2NVT B;  1G4A E;  2KEE A;  4JI4 M;  3ITP A;  3WWV A;  2VB3 X;  4Q5V A;  4A3G B;  4HJA A;  2HDM A;  3T1H M;  5JI2 E;  1LLR D;  3CF0 A;  1XHB A;  1VQL A;  1ASY A;  3I4N B;  4KMU C;  2SEB D;  1S5F D;  3L28 A;  2SDF A;  1PYW D;  3OTO L;  5C0X J;  2MUY A;  4J8Q A;  3NWT A;  4JI4 L;  4R4I A;  3J80 E;  1JB3 A;  3U6Q A;  2DWL A;  3I56 A;  1PH9 A;  3Q22 A;  3SHG B;  1LTA D;  4A3L G;  4MGH A;  2R7Z B;  3T1H L;  3HS0 C;  4LG2 A;  1L1T A;  2PQE A;  2Z4R A;  3J27 B;  4G6Z A;  2Z4H A;  3TS2 A;  4L63 B;  1GJS A;  1QZH A;  2IWH A;  1FGU A;  2F5N A;  1NNX A;  3BBZ A;  1I94 Q;  4L6T B;  2VXW A;  4IBE A;  2B29 A;  5CMD A;  2EY5 A;  4MZ9 A;  4BBS H;  4LFB M;  1STE A;  3JC6 6;  3PUZ A;  3HOW H;  1NVM A;  2O5R A;  2E2J B;  2OQ4 A;  4S12 A;  2F4I A;  3NHH A;  2AWN A;  1EQT A;  3KLR A;  3SEB A;  1ET9 A;  1WTP A;  4JI7 Q;  5GAD C;  2FHT A;  3S16 H;  2A6E D;  2JA8 B;  3TRZ A;  2KXE A;  4LFB L;  2DZL A;  2F3W A;  4IBC A;  2Y20 A;  5JI3 E;  4OEM B;  5M5W H;  1IY1 A;  2EA0 A;  1RU3 A;  4C2M H;  1YHQ A;  1DXM A;  1L1Z A;  3VK8 A;  1VQB A;  2K47 A;  3M7G A;  2DAM A;  4R9W A;  4FNF A;  4QQB X;  1JR3 D;  2BE5 C;  3U6P A;  3PO3 G;  2HCI A;  3KFU A;  1C4Q A;  1XJV A;  4S3S A;  3DHQ A;  4BBA A;  4A3K H;  2C99 A;  5AFW A;  4JI3 M;  5EPJ A;  4Y52 H;  2CHQ A;  1VF7 A;  4YHH M;  1HR0 M;  3VR4 A;  1X3G A;  3MAQ A;  4G3O A;  4IUN A;  2F0V A;  1B8A A;  1YNJ C;  2MPM A;  2CWB A;  1SYG A;  1TF0 B;  2XGT A;  3SK5 A;  2G9H D;  4JI2 M;  3C9P A;  1STN A;  4KV6 A;  2AQ2 B;  4JI3 L;  4Z8X A;  1B9M A;  2HT1 A;  1WCM G;  4TRD A;  4YHH L;  4GOP C;  1HR0 L;  4LF8 M;  2ICI A;  5ELO A;  1PMR A;  3I4Y A;  3GDE A;  3HOX H;  4KY5 A;  4JI2 L;  3G7L A;  3NBX X;  2DKL A;  2F0J A;  1HZ9 A;  4M0W A;  3M4Y A;  5IT9 L;  5E26 A;  3NWS A;  1TH3 A;  3AJI B;  1WOC A;  4IUP A;  4LF8 L;  1IN5 A;  1SG9 A;  1PV4 A;  3WHK A;  3QWL A;  2QCP X;  2GNO A;  4BBR H;  3URY A;  1MJG M;  5C44 G;  1JOK A;  1STH A;  4A3B G;  2LVP C;  2XH9 A;  1JJG A;  3E9H A;  3K8A A;  4N8X 1;  3STB C;  1X3F A;  3H94 A;  4H7B A;  3DUZ A;  2LKV A;  2A8V A;  1JQJ C;  3DM1 A;  2B2U A;  1NE3 A;  4FDB A;  1DJR D;  2F0S A;  5GAG C;  1G59 A;  4A3G H;  1CSP A;  4PD2 A;  1VQ9 A;  1QVR A;  4DV0 Q;  3HOU B;  2ZAN A;  1SBB B;  3I4N H;  4A3C H;  3S15 B;  2YTX A;  2VQF M;  3CCE A;  1D8L A;  3KOZ E;  1BR9 A;  3HZX A;  4AW4 A;  1LTS D;  4LF5 Q;  1SE3 A;  3DM3 A;  4KY6 A;  1TR5 A;  4AYB G;  1G6Z A;  5L8R F;  3FTF A;  1PYB A;  2L15 A;  3BDL A;  2BA1 A;  3H0G G;  3KFU G;  2NTT A;  1N36 M;  2R7Z H;  4X64 Q;  4GLA C;  1ZXT A;  1TS3 A;  2TSS A;  3RN5 A;  3GLG B;  1IZ6 A;  2VQF L;  1N32 Q;  4NRV A;  3CF5 A;  1KD1 C;  1QZE A;  4R71 A;  4P16 A;  1L2F A;  3SR1 A;  3I8Z A;  3KOY E;  1N36 L;  1R7R A;  2AKW B;  3S1N B;  2WB1 G;  1XYI A;  1I4W A;  1S72 A;  5FO9 B;  5M3F G;  2CHV A;  2E2J H;  3HFZ B;  4LF7 M;  1IL2 A;  3PCO B;  4TKO B;  1HTL D;  3BZD B;  1A62 A;  1N9W A;  4BY7 G;  4HJ9 A;  3MHB A;  3GLF B;  1F9S A;  2IW3 A;  4JC0 A;  1GL6 A;  2A1A A;  2A69 D;  2JA8 H;  5COY A;  3K9O A;  2CQA A;  1J7K A;  1EY8 A;  3AU7 A;  1FJG Q;  2DWZ B;  2PCF B;  1K83 B;  2K1B A;  2LXJ A;  4LF7 L;  5CGK A;  5NUC A;  3SHL A;  4Y7N B;  4O0A A;  4I8O A;  4OU7 A;  2D5D A;  1OAI A;  4FVM A;  4OW0 A;  3HJS A;  2F0U A;  1EEF D;  1M90 C;  4A3E G;  3T1H Q;  4PDG A;  1YLA A;  4DNI A;  1JJC B;  1F2Y A;  2O5I C;  4DV1 Q;  2IHF A;  4YY3 M;  1V43 A;  1X3P A;  4AH6 A;  2R6G A;  4GKJ M;  4B7H A;  4IAL A;  2R7F A;  4KY7 A;  1G71 A;  1VQM A;  2J7O A;  4DV3 M;  1BNZ A;  2F0M A;  2WAQ G;  2Z4I A;  3CCR A;  2LVN C;  2VW9 A;  1RD9 D;  3CCS A;  1VF5 C;  2CV1 A;  4LK1 C;  1YI2 A;  1IM2 A;  2L55 A;  4CGY B;  3E0E A;  1YE9 A;  2EY6 A;  4OEL B;  4YY3 L;  5ELE A;  4IQZ A;  1QUS A;  4GKJ L;  2OT2 A;  1XPO A;  1SJE D;  3H09 A;  1K3R A;  4QIW E;  4RHS A;  4DV3 L;  1LTT D;  4X62 Q;  2FIN B;  1HFN A;  2Z7J A;  3H6M A;  1SE4 A;  4IJL A;  1QUT A;  3U61 B;  2IT1 A;  2OXP A;  2B63 G;  2CV2 A;  3CU7 A;  1BBU A;  3E9I A;  3K2L A;  4HEO A;  3ZH9 B;  5C1B A;  3A45 A;  1N33 M;  4I81 A;  1STY A;  4RCO A;  1NTG A;  4EVO A;  1YJW A;  2C35 B;  1C8C A;  2WFW A;  2J7N A;  1BO0 A;  2L5T A;  3W0L B;  4GHA A;  1D1K A;  3LMM A;  3SAW A;  1NMF A;  4O42 A;  3VDP A;  2DHY A;  4ZLT F;  4J6H A;  1N33 L;  3CRK C;  1NSF A;  2AHM A;  1JQY D;  1FYC A;  3GQ4 A;  1SE8 A;  4ZPX A;  2OQK A;  3F92 A;  4M1U B;  3BU2 A;  1IYU A;  4CDC C;  3CF2 A;  3U61 A;  1IW7 C;  3J80 S;  1L2D A;  2Z0S A;  3HOU H;  3TE6 A;  3ER0 A;  3NK9 A;  2MJ5 B;  4KLN A;  4JI3 Q;  2WIN B;  3S15 H;  4DN4 M;  1R6B X;  2E2D C;  4KOD A;  4HMI A;  1HQY E;  1HR0 Q;  1ILQ A;  2TMP A;  1SMY C;  5KRU A;  2YV5 A;  1L0Y B;  3NQT A;  2I0Q A;  1J9O A;  3RR5 A;  2QSF X;  5LMN M;  3GO8 A;  1BCP B;  2B2U C;  2B39 A;  2PW5 A;  3LWU A;  2Z8L A;  3SVM A;  1F2M A;  3J7Y W;  3K7A B;  2N78 A;  3SBJ A;  3AOE A;  2J0T D;  1RCV D;  4GN4 B;  4DBG B;  1HTP A;  4ZUI A;  1OTC A;  4KI0 A;  2JY6 B;  3HOZ G;  4C3H G;  3UGJ A;  3PQI A;  4OO1 G;  4PT5 A;  5LMN L;  2RKO A;  1FD7 D;  3S1N H;  3L27 A;  1WI5 A;  4QHT A;  3L2A A;  4JW0 A;  1SYD A;  3HOY B;  5KYI A;  3PF5 A;  1KTK A;  1NV9 A;  1PLF A;  2KED A;  2VII A;  2G8L A;  4KKS A;  4DA2 A;  2KZS A;  1OIZ A;  1K8A C;  5DNF A;  5ELN A;  3G4S A;  3M7N A;  1ZMV A;  3K57 A;  2KW0 A;  5F3W A;  3UDG A;  1GHK A;  1VQ7 A;  1PHJ A;  1K83 H;  5FK9 C;  5IWA M;  2C96 A;  1N34 L;  4IFD I;  3I72 A;  1G2T A;  5FLX L;  4KJO A;  4BB9 A;  4B3M M;  3NPP A;  4Y7N H;  1UWV A;  4XIG S;  1A6X A;  2N3S A;  3QYE A;  4EQ5 A;  4DV7 M;  3THG A;  2EUC A;  4RWS C;  3J81 j;  5FO7 B;  4ITQ A;  3SK6 A;  1F2Z A;  5IWA L;  3A5U A;  2L9H A;  1CA5 A;  4B3M L;  2LSS A;  3M85 A;  2QZ4 A;  5CBE E;  4A3V B;  2D7G A;  4MTK A;  5CBA E;  1Y8N B;  4DV7 L;  4C3J B;  3KBG A;  2F4V M;  2KRU A;  5KGU A;  1O7Z A;  1HJP A;  3HKP A;  1DGB A;  1EUJ A;  3CCQ A;  1PTO B;  2I5L X;  4J1M A;  3VR5 A;  1R2Y A;  2DAE A;  4IUU A;  1TDZ A;  3OPO A;  2M00 A;  3GPP A;  4GLX A;  1AFP A;  2B8F A;  3ZC7 B;  2ZJQ A;  2F4V L;  3I91 A;  1QJO A;  1IYJ B;  1RTN A;  3A56 A;  3KOJ A;  1YIT A;  3KLS A;  3R3O A;  5ELF A;  2H4O A;  2WII B;  3TDQ A;  1VQC A;  3GP7 A;  4LF7 Q;  3U6O A;  1YNJ D;  5COR A;  4QNM A;  3U6S A;  1DM0 B;  1HH2 P;  2DVW B;  3QWN A;  3AV0 A;  5CV7 A;  3EQL C;  2CE7 A;  4P17 A;  1C1K A;  3SYL A;  4TVA B;  5C6A A;  2JEB I;  3TRE A;  1BBW A;  1NJG A;  1OKS A;  5IOC A;  3W67 A;  2VUM G;  2IJ0 A;  5JOB A;  5H37 D;  2UU9 M;  4FO2 A;  3JR5 A;  2B2T A;  5JJZ A;  5C4X G;  3KSX A;  2E8G A;  3TN2 A;  5JJL A;  2XSZ A;  3E46 A;  4AYB E;  4G7Z C;  3GRY A;  4YY3 Q;  4DR2 M;  5GAE C;  1PH4 A;  4G4Q A;  1E1T A;  4GKJ Q;  4G7H C;  1SR3 A;  3W5O A;  4L8R C;  4QB4 A;  1TWH B;  4YCV A;  2UU9 L;  3C3E A;  3VYS A;  4DV3 Q;  4CDF C;  1T6O A;  1LTB D;  1GUT A;  3ILK A;  3STB D;  4XYQ A;  2G5G X;  3I4M B;  3GLI B;  3U4Z A;  4DR2 L;  3HRZ C;  3K7A H;  3UE1 A;  1IQP A;  1SDF A;  1STB A;  5IP7 H;  3C3L A;  3ERS X;  4NSO B;  4IPD A;  4MHE A;  2DHR A;  1DZ1 A;  2BJV A;  4OON A;  1M4V A;  4YCW A;  1CTM A;  3QR8 A;  4NXM M;  3HOY H;  1N33 Q;  4K0K M;  1PXU A;  3KP0 E;  4BLC A;  1T5X D;  1ENC A;  1JR0 D;  4K14 A;  1Q1B A;  3VYU A;  1IKM A;  3J7B A;  2PMZ B;  1F77 A;  2KEC A;  1JOR A;  1A0I A;  3A8J E;  4RHR A;  2GVA A;  3A7L A;  4P73 A;  5K36 G;  3S17 B;  1TH4 A;  2K52 A;  4NXM L;  3SC3 A;  1VEG A;  2KJX A;  5JVH 3;  3VLF B;  3K0X A;  1N8R C;  4K0K L;  1TTE A;  2R45 A;  5IZ7 D;  3HHY A;  1RIP A;  2K7V A;  4QMG A;  2CFM A;  4LAA A;  1WTW A;  1NHW C;  1XMO M;  4DR1 Q;  4FF4 A;  3NTK A;  4A3M G;  4LJ4 A;  2WAQ E;  1EIF A;  1BCP C;  1PZJ D;  2XVS A;  4CIS A;  2FXQ A;  5EQ0 A;  5EXS A;  5I2X A;  2DY7 A;  2DZO B;  1VQ6 A;  1DGG A;  3J7A 5;  5C3X A;  4C3J H;  1VQH A;  5LMN Q;  3F8T A;  1S3O A;  4B08 A;  2QP9 X;  4F8M A;  1XMO L;  2HKJ A;  4LJ7 A;  1K0R A;  2ZXO A;  4A3F G;  3CCJ A;  1DGH A;  4YIJ A;  2F5Q A;  4Y28 F;  1PTO H;  3K5M A; 
#chains in the Genus database with same CATH homology
 1R2Z A;  1HNX M;  5IGG A;  3JR4 A;  1OXS C;  3OIP A;  3DWQ A;  3BYY B;  3FEW X;  1IN7 A;  2EYP A;  2XRS D;  3HG9 A;  1A3V A;  5IGC A;  3BVM A;  1OXX K;  4DR6 M;  5T1I A;  2CFO A;  2P5T A;  3AOG A;  4XBO A;  3OIQ A;  4RGM A;  4DGZ A;  2B2Y A;  3MTS A;  4L4U A;  3C1E A;  1IN4 A;  4K5X A;  3TSS A;  1Q3L A;  4C3I B;  1AZQ A;  3FMC A;  1L2B A;  3TP6 A;  3DMU A;  2ERC A;  4DXG A;  4MN3 A;  4JI1 M;  3EIH A;  2X69 A;  1C48 A;  3TME A;  2XFT A;  1SYE A;  4I4L A;  4LGM A;  4K8I A;  2X4A A;  1PTO C;  3SAT A;  1SNQ A;  1OFH A;  3LVV A;  3RGS A;  1CQV A;  3M3Y B;  2F0W A;  2JYO A;  1PRT B;  5ELC A;  1CZG A;  2F0F A;  4K8J A;  1IBL M;  1NSN S;  3FUT A;  5D65 A;  1TY0 A;  2D7E A;  5C0X G;  1D1I A;  3TBI B;  4UDU C;  3HP3 A;  5I6Y A;  3S9W A;  2KVM A;  2D9U A;  2V1C A;  5BN3 A;  1SMY D;  3HHZ A;  2SNS A;  5BN5 A;  1XXH B;  3KS8 A;  2EYM A;  2RBM A;  4KHP M;  1D5M C;  1AZP A;  2JE6 I;  3NSW A;  1XXG A;  1ESF A;  4DAY A;  4ME5 A;  2NVX B;  2CW0 C;  4KD3 A;  3QJY A;  5A35 A;  3FYD A;  1ML0 D;  3TWK A;  4QUC A;  2B2W A;  3MXP A;  4LJ6 A;  4A3J B;  2F0N A;  5KND A;  3MWY W;  1XXH A;  2BCO A;  5JEA H;  1IN6 A;  1CI3 M;  3FKE A;  1F9P A;  2JA2 A;  3FUW A;  2KOL A;  1K8O A;  4BA1 I;  3D8B A;  1O7Y A;  5EXP A;  3VR3 A;  1LAC A;  1LO5 D;  1S5C D;  3R2I A;  3GLH B;  3FPU B;  5DM7 3;  4IUQ A;  2PPB C;  5C5L A;  3TZD A;  4DV6 M;  3FYC A;  2NN6 I;  1NNU C;  1LV9 A;  3DA1 A;  3K92 A;  2N88 A;  1HA5 A;  4RGO S;  5EPL A;  1DON A;  4DR7 M;  3KF8 A;  1S5E D;  1Q3C A;  1DO2 A;  1QZM A;  4W5W A;  1SSO A;  1J8I A;  4FW9 A;  1JOO A;  4JYA M;  3MJ5 A;  3A98 B;  1V1P B;  4DK1 A;  1T5E A;  3GLH A;  1EU3 A;  1IKL A;  2BNK A;  4DK0 A;  2C5R A;  3NTI A;  4LF6 M;  2JA6 B;  1JCK B;  4PMC A;  1UAP A;  2B2Y C;  5EP2 A;  4KKU A;  3QOL A;  4L16 A;  3FD9 A;  2D7H A;  1JWS D;  5C3E B;  4EQP A;  1EYA A;  3PUX A;  4X3S A;  2CVR A;  5ITY A;  4HAE A;  2F0Q A;  3S1M B;  4FYD A;  1Y8P B;  1KAB A;  2OEO A;  4GRI A;  1PZI D;  5D3I B;  1E2W A;  2SNM A;  1Q3B A;  1U4P A;  1Z7T A;  1V1P A;  2EYJ A;  3AKZ A;  2F5S A;  2MHV A;  1L2C A;  5C4J B;  4LMQ D;  2QEJ C;  3HKZ B;  1SNM A;  4CJ0 B;  4LF9 M;  3L9A X;  5M5X B;  3E6Z X;  3N52 A;  4BA2 I;  8CAT A;  3EJI A;  4UAI A;  3JAM L;  3SAU A;  1MX0 A;  2IPK D;  4XQN A;  3PNV A;  1Y69 U;  2A6H D;  5JPN C;  5JEA J;  1KDA A;  1RF2 D;  2WKD A;  1BOS A;  1HT1 E;  5EP3 A;  4E6I A;  4OHJ A;  2Q2E B;  3QOJ A;  4GZY C;  3R8F A;  3ND9 A;  3FUU A;  2F5O A;  1GUW A;  1KFV A;  2XWJ B;  2N55 A;  2XGN A;  1OJL A;  1BCP F;  1EIH A;  3VKG A;  3RUZ A;  3LX0 A;  1PRT C;  5KEE A;  1AW7 A;  5A2Q L;  3GQ5 A;  3OW7 A;  3VA7 A;  2GA4 B;  4KO8 A;  2B2W C;  3A8I E;  1OFI A;  4XQQ A;  4OIJ A;  4RKB A;  1QAN A;  3PO2 B;  4MH0 E;  3RD4 A;  3GPX A;  4PMW A;  3E5S A;  1H9R A;  1EY7 A;  4H44 C;  3T53 B;  5I6W A;  2DNE A;  1HFG A;  3U9O A;  1EZ8 A;  3KS4 A;  2IX3 A;  2ZT9 C;  4DUY M;  1NHG C;  1AP0 A;  5TSS A;  1TS4 A;  3J81 E;  5J22 A;  4K2L A;  2PO4 A;  3VYT A;  4B9X A;  4LRS A;  1QIL A;  1XMQ M;  1IBK M;  2K28 A;  5FO8 B;  4NL4 H;  1NR4 A;  1SAP A;  1RHP A;  3K5O A;  5HUR A;  1S5B D;  4CJ2 C;  4EIW A;  4IFD H;  2B2V A;  1E9S A;  2E2H B;  2F0L A;  1D6E C;  1PFB A;  5KQD A;  3RMH A;  2A68 D;  3X3M A;  1Y1W B;  1MD2 D;  4KN4 C;  2FJ2 A;  3VFD A;  3T56 B;  4CBV A;  1WTR A;  2HL7 A;  3CTW B;  3DFZ A;  1IY0 A;  1BF4 A;  1PTO F;  2R93 B;  1Z47 A;  1U4M A;  1LT3 D;  3PXG A;  1SYB A;  3NQI A;  3HHW A;  2UUB M;  1ZYR C;  3QAU A;  1OXV A;  1PJI A;  2DNC A;  1NAP A;  3PUV A;  5ISR A;  1STG A;  2YQZ A;  2EJF C;  2ZAM A;  3DWP A;  1Y1V B;  1CFM A;  2Q8I B;  1QNU A;  4IN3 A;  1TKW B;  2EO2 A;  2YU9 B;  2G9D A;  5LL6 S;  4CHT B;  3NTH A;  3W3A A;  4LGY A;  4HL4 A;  2JA5 B;  2FE8 A;  5DNY A;  1N75 A;  4BY1 B;  3ZCB B;  2XSZ D;  1RKN A;  5G3L F;  3QIA A;  3PUY A;  5C4Z A;  3VYR A;  1DOL A;  1LTI D;  1R4Q B;  2RDH A;  1Z5A A;  3MEH A;  1U4R A;  4D81 A;  3GLG A;  3H91 A;  3OSO A;  4PQX A;  1E32 A;  2Y0S B;  1R4P B;  4B3T M;  1CQF A;  2XF3 A;  1V8Q A;  4ULL A;  3T13 A;  4U68 A;  4GIP A;  1AN8 A;  1BUV T;  3GTG B;  4A93 B;  4ZUJ A;  3MFY A;  4HCE A;  4FCT A;  1MGS A;  2L09 A;  3B9P A;  4RH6 A;  3LWE A;  1IY2 A;  3GLF A;  5LMU M;  2K05 A;  5IGD A;  1KNE A;  1DYQ A;  4B7G A;  4I5S A;  1KDB A;  1PFM A;  3PIP 3;  1E0B A;  4DU9 A;  5KPZ A;  4IFD J;  1QAO A;  1YUB A;  1IL8 A;  1EE8 A;  3K8Z A;  3MXG A;  1WTQ A;  5IT9 E;  3OOC A;  2R65 A;  4JV5 M;  3GPU A;  3K59 A;  1TVX A;  5I4D A;  2KRK A;  1GUG A;  3T51 B;  3A8K E;  1G91 A;  2CEA A;  2ZM6 M;  4KJN A;  5KYL A;  1KDC A;  2NQ8 C;  3FKI B;  5I9P A;  2BDO A;  3D3R A;  5EXX A;  3IL8 A;  3ONA B;  3TWL A;  4V19 0;  4I65 A;  3SAR A;  1JWU D;  4KKT A;  3P7J A;  4HSP A;  3PNY A;  2KEB A;  3U6D A;  4ABN A;  3TP5 A;  2B2V C;  4JBW A;  3C2P A;  3RZO B;  2L7H A;  2F0O A;  4M9Z A;  1GKI A;  1VDD A;  4DV5 M;  1DD2 A;  1TU2 B;  1Q12 A;  2YFQ A;  2X6G A;  1L8Q A;  3UJN A;  3HGI A;  3U6C A;  4PCZ A;  2V6Z M;  3IG8 A;  4GHL A;  2L4N A;  5D3D A;  2O4X A;  2CV0 A;  4JI6 M;  1BDO A;  2BA0 A;  4RFB A;  2HHH M;  3G6J B;  4XDX A;  3GV3 A;  3PFI A;  4NXN M;  1NY6 A;  1T3T A;  2PYK A;  1K3X A;  5FOB B;  1H9J A;  3QO2 A;  4RGN A;  1VMP A;  5E6J A;  4MM3 B;  2C9O A;  1EEI D;  2AQ3 B;  1PRT F;  1ET6 A;  2QIL A;  2F03 A;  2QF7 A;  1S5D D;  5EGT A;  3KW6 A;  1KAA A;  3C1F A;  4AKH A;  1GJX A;  1ESR A;  5EP1 A;  3VK7 A;  1UEA B;  1QB5 D;  2LXE A;  4X66 M;  2V4D A;  5DEH A;  2KA7 A;  1QAQ A;  3SDZ A;  2EE1 A;  1AEX A;  3F2U A;  3H4M A;  1W6J A;  3J81 S;  3MK6 A;  2I7N A;  2MGS A;  3MHV C;  1XX8 A;  2BE5 D;  5J39 A;  1IBM M;  1ROD A;  5JVG 3;  1EWH A;  4DR4 M;  2Y0Q A;  5EJC A;  2EJG C;  2X8A A;  4G4O A;  1WD1 A;  4JI0 M;  2E5L M;  3U6E A;  2UUC M;  2ENB A;  2RDF A;  3PUW A;  1H9K A;  1PJJ A;  2HDL A;  1II3 A;  4FWD A;  5IIF A;  4JI8 M;  1HCZ A;  2VQE M;  3GTK B;  1EFI D;  2BOS A;  1D5Z C;  5KPR A;  2NVQ B;  4FF3 A;  2UXC M;  3WOF A;  4WW0 A;  4F7X A;  1WTV A;  2K5W A;  4R8N A;  1I6H B;  2JEA I;  5J1Z A;  1QYR A;  2EVB A;  2F0I A;  4ZKB B;  3K1J A;  4L8J A;  1G41 A;  4C1N I;  2L1B A;  3U9S A;  3TZU A;  4AQY M;  5IOD A;  2H1R A;  4M9S A;  3SFZ A;  1Q90 A;  2L0C A;  2C5C A;  2EZV A;  2F0H A;  4IIW A;  2F5P A;  3NBI A;  5D14 A;  3GTJ B;  2UXB M;  1I4P A;  3GTL B;  2NN6 H;  1ICW A;  1EWC A;  4RA8 A;  4IBD A;  2KZU A;  4XGI A;  5FKA C;  1CM9 A;  1CT1 D;  1GLN A;  3IFT A;  4AG5 A;  1G8Z D;  5FTJ A;  3T16 A;  1XTC D;  4NW2 A;  3OHX C;  4QCL A;  2LS0 1;  3KDS E;  5CV4 A;  2IL8 A;  1Q39 A;  1SNC A;  2WV6 D;  4FF2 A;  2JXM B;  5FLX E;  5BN4 A;  5HGT A;  3GLI A;  4X65 M;  3A46 A;  1BQQ T;  1HNW M;  4A3D B;  1LT5 D;  1SXT A;  3RE8 A;  4C3J G;  2AWO A;  1K8M A;  3IFD A;  3K6O A;  1FNW A;  4DFA A;  4DV2 M;  1KSF X;  3OWE B;  2JA7 B;  4AKI A;  1GOZ A;  5DAU A;  1SXJ B;  5ITT A;  2EDG A;  2H1E A;  2EJM A;  5DYI A;  5LHY 1;  1GXD C;  1CZW A;  3LNN A;  2QKI C;  1EY0 A;  2OPF A;  3HGB A;  5IT9 S;  1HPC A;  1PZK D;  3W0F A;  1A2T A;  5EBC A;  4NP5 A;  2R92 B;  3S1Q B;  1FR3 A;  1E94 E;  1KNA A;  4PNY A;  4N9P A;  1G29 1;  3PIO 3;  5C4H A;  4LF4 M;  1ZAE A;  2NWG A;  3KXE C;  1D2B A;  4R7G A;  1SXJ A;  2XZF A;  2RGO A;  1HQC A;  2Q8R E;  1DO0 A;  3O13 A;  4ZQ3 A;  2XFS A;  3H3V C;  2DWN A;  2R46 A;  4MGY E;  4KD4 A;  3VR2 A;  1U9R A;  4XQJ A;  2RQX A;  1LAB A;  2I46 A;  2L12 A;  2SOB A;  3TP8 A;  4GC9 A;  3SHF A;  2EYH A;  1Z5B A;  4HN7 A;  3KUP A;  3FDT A;  1WVL A;  1DCZ A;  2KUM A;  3HU1 A;  4KTA A;  4A3I B;  4HMJ A;  3N6R A;  4N9T A;  1RDP D;  4OO1 I;  1F9Q A;  5I2Y A;  2K01 A;  3S14 B;  2LWX A;  2ID0 A;  3K0Y A;  4RF1 A;  5EJW A;  1IW7 D;  4X3U A;  1W6K A;  2D2C C;  5EPK A;  4DV4 M;  4FF1 A;  3MXN A;  3GQ3 A;  2L7I A;  3L29 A;  1I4X A;  1R9T B;  2Q8T A;  1TWF B;  4PMB A;  2XN9 C;  3M6A A;  2WKC A;  2XNA C;  3CQZ B;  2X49 A;  4QNR A;  3RFW A;  3GV6 A;  1IYV A;  2E76 C;  4ODG A;  1IXS B;  5JEA G;  5JAV A;  4OIK A;  3J80 L;  3S2D B;  4ZKC B;  3T4A C;  3UZU A;  5T1G A;  1SND A;  1OXT A;  5ITX A;  3OWF A;  4HED A;  2R61 A;  4M8A A;  4IBJ A;  3T38 A;  1I50 B;  1H6U A;  5E4W C;  5CC4 A;  3R9X B;  4H0L C;  1B1Z A;  2F1M A;  2WP8 J;  2HCB A;  2KHS A;  3TPZ A;  3AL0 C;  2YR0 A;  4JXJ A;  1B44 D;  5EKI A;  4JN6 A;  2PZW A;  3V05 A;  1HQM C;  3D4W A;  1O7L A;  1H9M A;  7CAT A;  3HWS A;  4C3I G;  3BOS A;  4LJA A;  1NY5 A;  4EQO A;  1N77 A;  2PZT A;  3R2T A;  1B4O A;  1GUS A;  2UXD M;  4DV0 M;  4WOR A;  1IXZ A;  2RDG A;  3DXJ C;  1QE6 A;  3U5Z B;  4LF5 M;  1EY6 A;  3V96 A;  5EKL A;  2DN8 A;  1TS5 A;  3PO3 B;  2KCN A;  4DF7 A;  1SXJ C;  3MA2 B;  2F0D A;  4AZF A;  4OVZ B;  1B53 A;  1W5T A;  3I4L A;  3CKI B;  2Z4S A;  2QCU A;  4LZZ A;  1WCM B;  5ELB A;  3A55 A;  4LJ5 A;  3SYK A;  3AB9 A;  1ENF A;  1XWI A;  3SE0 A;  3L25 A;  4EGV A;  3P75 A;  1FJG M;  2LY7 A;  2NB0 A;  4IBF A;  3A7A B;  3AFH A;  4OVZ A;  4NMZ A;  5EKK A;  3BDO A;  1GVN A;  3FTE A;  3U6L A;  1TT2 A;  4FXK C;  3KVW A;  5FLX S;  3U60 B;  4DXF A;  5KNB A;  4CKB A;  2F0P A;  5C44 B;  4A3B B;  1EYC A;  2E74 C;  2I07 B;  2UUA M;  4DV1 M;  4MIU A;  4X3K A;  1M8A A;  1F9R A;  1QNK A;  1MU5 A;  2EYL A;  1UUP A;  4QOS A;  3MZ5 A;  1FGB D;  3TL4 X;  2AQ1 B;  4TQU S;  3J7A F;  1PDQ A;  1Z6H A;  1Y8O B;  3EA6 A;  1ILP A;  4FP5 D;  1HHV A;  1QAM A;  1Z6T A;  4X62 M;  4AYB B;  5C18 A;  4ILW A;  2IX1 A;  3U60 A;  3H0G B;  1HRJ A;  4NDX A;  5JPM C;  4LJ8 A;  1TDH A;  1TH2 A;  2RGH A;  1ZEQ X;  4Z9C B;  4ZRZ A;  1QCB D;  3C58 A;  4G4R A;  3K5L A;  1BBX C;  1NJF A;  3GRV A;  4L15 A;  1O80 A;  2F0E A;  2QEN A;  3Q6S A;  1A3T A;  5BPV A;  2WB1 B;  3S2H B;  3GO5 A;  5FTM A;  4KHV A;  1TII D;  5M3F B;  1BCP D;  2EYO A;  3L26 A;  5FTK A;  5KO3 A;  3L3O C;  4BY7 B;  1G3I A;  4LCB A;  1SNP A;  1PM5 A;  4IFD G;  1KLU D;  2ZXP A;  3FTC A;  3ERO A;  3BG3 A;  4ID6 A;  4C56 C;  3UMM A;  2RVL A;  2NUC A;  1TWC B;  4A3E B;  3X3N A;  4GKK M;  3NWL A;  1K3W A;  2K33 A;  4D82 A;  1STA A;  1I6V C;  2YYZ A;  4OGQ C;  5IGF A;  4BS9 A;  2CHG A;  1I3Q B;  2JSO A;  2K5Q A;  1GHJ A;  2WAQ B;  3DEO A;  5EXT A;  5EP4 A;  1MBY A;  4FD2 A;  1MSG A;  2XIW A;  3VR6 A;  2PW7 A;  4QHS A;  4M9X A;  5C0X I;  4WJW A;  2EY2 A;  1QWY A;  2RSN A;  4AG6 A;  2DXI A;  3I73 A;  3L7Z C;  4KK7 A;  4WFN 3;  4CKE A;  3NE5 B;  5ITQ A;  2B63 B;  3FTD A;  1XNR M;  2R18 A;  2NZ1 D;  1SYF A;  4RF0 A;  4IUR A;  4DAV A;  4JK1 C;  3JAM E;  1PTO D;  3VKH A;  4R8I A;  2CHB D;  4IBB A;  1SXJ E;  5FTL A;  1J09 A;  4DAP A;  4IUT A;  2BJW A;  3KOX E;  3Q0A A;  4II7 A;  2L11 A;  1B9N A;  3QB3 A;  2QBY B;  4EQN A;  4KN7 C;  5CV9 A;  3GTQ B;  5A2Q E;  3PVS A;  4HSV A;  2ZAO A;  1TQO A;  1I4H A;  1FNU A;  2CW0 D;  1A15 A;  2XRQ D;  2XWB B;  5G3L D;  5M9O A;  2O2L D;  3HOZ B;  4C3H B;  4PDI A;  4NSR A;  1JC7 A;  1VDZ A;  2NVY B;  2FFJ A;  4K5V A;  2EYF A;  3CRL C;  2QBY A;  5CV6 A;  2EPB A;  5KNC A;  4FWH A;  2L6O A;  3J7A S;  3CF6 E;  3D8G A;  1WTX A;  2Y0T A;  3IKJ A;  3RZD B;  1HQR D;  1E2Z A;  3I70 A;  4FWG A;  2VB2 X;  1SFO B;  4K5W A;  2FFK B;  4XT3 B;  3SAS A;  3RGP A;  1JIC A;  3J7A V;  2YNM D;  4IZ8 A;  4Q0F A;  1HXY D;  1TS2 A;  4B7F A;  2IX0 A;  1EQV A;  4REZ A;  4K6D A;  2NYZ D;  5ITX E;  4AI6 A;  3QG1 A;  1N78 A;  3GRU A;  1F2L A;  2XSC A;  3E0J A;  1DOK A;  3D4R A;  4X3T A;  4LJ9 A;  1X32 A;  5ITU A;  3GRR A;  1TWA B;  4MGZ E;  3WOE A;  1SXJ D;  3LQQ A;  2EXZ A;  4D80 A;  3MVV A;  4FCV A;  3HOV B;  2F0T A;  4XTC S;  1XC8 A;  3WHL A;  3EVQ A;  3VA5 A;  4RCN A;  3SK4 A;  3ND8 A;  1OXU A;  2HCC A;  3UI2 A;  1VMC A;  2HQE A;  5EBD A;  4DR1 M;  3FUX A;  4DNT B;  3K58 A;  2M9V A;  1B50 A;  2VUM B;  2LH0 A;  2B8G A;  3D8L A;  4GMQ A;  4RGT A;  4XT1 B;  4MB7 A;  2ZBK B;  5C4X B;  3BDC A;  2Z1C A;  1EL0 A;  2MJ8 A;  3I3C A;  3FUV A;  3D4D A;  3KOW E;  3PMF A;  4RNA A;  2M60 A;  1JR3 A;  1XNQ M;  3I51 A;  1VCI A;  2A73 B;  3SXH A;  3PV0 A;  4CJ1 B;  2NTS A;  3HEJ A;  3GTM B;  3DWA A;  3NXW A;  1N34 M;  3I4V A;  1EIG A;  2DZN B;  4IJF A;  4HLQ A;  5KQ8 A;  3S1R B;  3HJ8 A;  4OO1 H;  4GH9 A;  1EZ6 A;  3U6M A;  4QOZ C;  4PV1 C;  4V0B A;  3VDU A;  3SAV A;  1PRT D;  2R62 A;  2E2I B;  4NRW A;  3T1Y M;  4WRD A;  1JE4 A;  4K6L A;  4TSS A;  5FTN A;  3KSJ A;  1EY5 A;  2M5Z A;  2XLJ A;  2HUG A;  3KP1 E;  3DOA A;  4WUR A;  3E4R A;  5CV8 A;  3KK7 A;  4F88 A;  1HNZ M;  3K5N A;  5M5Y B;  3EIE A;  4A3M B;  1YNN C;  2A5Y B;  1DGF A;  1QQW A;  1Q8I A;  1V1O A;  1EOT A;  5CYU A;  1HA6 A;  1JWM D;  4A3F B;  4G4K A;  2C98 A;  4G4N A;  1EY9 A;  1I4G A;  3C46 A;  2ZXR A;  4NKL A;  2CUZ A;  2AUK A;  4F87 A;  1K82 A;  1WXQ A;  1LTR D;  3SMP A;  4B3R M;  2FMM A;  2NN6 G;  1FNN A;  1X37 A;  3JAM S;  1MI2 A;  3GD7 A;  5K5P A;  2KCC A;  2J4X A;  4CKC A;  1FNV A;  1RTO A;  4MGK E;  4XYO A;  3IG5 A;  5C3W A;  2F0K A;  1LV7 A;  2W82 A;  1HT2 E;  2FOI C;  4HR7 B;  2F3V A;  2RKS A;  1ZYR D;  1IN8 A;  4C1N K;  5LL6 X;  4MGI E;  4LRT A;  2QDB A;  4IBG A;  2XZU A;  2O5J C;  5A2Q S;  1TGU A;  1DOM A;  1NR2 A;  2A6H C;  1LT4 D;  1NUC A;  2WAC A;  2D62 A;  3UK6 A;  4B9W A;  2A6E C;  1TWG B;  1J5E M;  5FSW A;  3M4O B;  2EOT A;  3MFG A;  4AKG A;  3R8B A;  3I90 A;  3W2D A;  3TWM A;  1SEB D;  1H9S B;  1EYD A;  3AOE C;  5E3F A;  4JI5 M;  1IHZ A;  4G57 A;  1OO9 B;  4ZAI A;  2LNH C;  3T15 A;  2PZU A;  4LZJ A;  1DGH B;  4FXD A;  3GP1 A;  4IBK A;  2VNU D;  4LY6 A;  5DYG A;  4LJZ C;  1RJT A;  2R4E A;  1I4Q A;  1CHP D;  3A54 A;  1IXR C;  5CV5 A;  4M0D A;  5K36 H;  4IJE A;  4G7O C;  2A5H A;  2F0G A;  1H9S A;  2MP1 A;  3NP8 A;  3SMS A;  4ZYS A;  3FRP B;  5EQT A;  1UM8 A;  1MSH A;  1UNS A;  2LMC B;  4HCS A;  2I7P A;  1W5S A;  4HTH A;  1SNO A;  4LFA M;  2K5D A;  3E9S A;  3TP7 A;  3SK8 A;  1D5X C;  5F2D A;  5BR8 M;  2DWM A;  3Q24 A;  3AMU A;  2K04 A;  1QG7 A;  1SE2 A;  2FMC A;  3GQB A;  3OMG A;  2KA6 B;  2Z3X A;  1CHQ D;  3NBH A;  2QPA A;  3GTO B;  2A68 C;  4OL7 A;  3V2T A;  3OMC A;  1I94 M;  1EY4 A;  4QF4 A;  4L78 A;  3FPP A;  3Q23 A;  3BYT B;  2R3Z A;  5M3M B;  5IRE B;  5CR3 A;  1GL7 A;  1HUN A;  3IAY A;  1TY2 A;  3HJQ A;  2M2L A;  2NBF A;  4FXG C;  1ZKO A;  3A42 A;  1BXT A;  4O1N A;  4K2K A;  4TUW A;  3KLS X;  1E9R A;  3ZYY X;  4JI7 M;  1LTG D;  1KYI A;  3GTP B;  4QIW B;  4B3S M;  1EU4 A;  5GKN A;  3DZD A;  1B3A A;  2RA4 A;  3P20 A;  1S4Z A;  1D2N A;  4P2C B;  1A3U A;  2B2T C;  5ELD A;  4DR3 M;  1O78 A;  3BS1 A;  2K03 A;  3BVZ A;  3TQS A;  4DNR B;  4DR5 M;  1L0X B;  1WTO A;  2RSO A;  2A69 C;  4I7Z C;  4QUF A;  1ORY B;  2PNR C;  1Q1E A;  3GPY A;  1NCV A;  2AUJ D;  2BDN A;  2X6L A;  3M0E A;  1I4R A;  4BWG B;  5C0X H;  4BBS B;  4OX9 M;  4XXE A;  3HOW B;  2R4J A;  4ZK9 B;  2ICE C;  3HU3 A;  1NNJ A;  4RKL A;  3J2P B;  5E4X A;  4FCW A;  1KLG D;  1WD0 A;  1JOQ A;  4DUZ M;  3Q8X A;  2LFN A;  3S16 B;  4IUV A;  3RLF A;  5M5W B;  2OF1 A;  2C9C A;  4C2M B;  2Y21 A;  1LT6 D;  3MXU A;  2DY8 A;  1E2V A;  5I9O A;  4H13 C;  2KQ3 A;  2A74 C;  3D6C A;  1X3Q A;  1CK1 A;  4A3K B;  5ITR A;  1HUM A;  3HU2 A;  5IGE A;  1GUN A;  2K6A A;  5KPT A;  3NUC A;  3EFX D;  3CHB D;  3WDN A;  4NOO B;  4GIT A;  2V1U A;  4X64 M;  2EY1 A;  3HHX A;  1A2U A;  1GUO A;  4KHZ A;  1QOH A;  1N32 M;  3DEP A;  3ERQ A;  1U4L A;  3FVQ A;  1G8P A;  3P1H A;  1B2T A;  5E1F A;  4LFC M;  2JP1 A;  5DM6 3;  1YSY A;  3HOX B;  3D31 A;  1S3S A;  2FNA A;  1XWE A;  3BVG A;  3MC0 B;  3R93 A;  4GC5 A;  2K32 A;  5IGB A;  3J81 L;  3LVW A;  1YNN D;  1ONL A;  1G2S A;  5C5M A;  2E75 C;  4RAU C;  3U5Z A;  1ENA A;  3D6W A;  4IBI A;  4R3D A;  1SYC A;  1ZQ9 A;  5KIX A;  1SJH D;  4BBR B;  3LQR A;  1Z5C A;  2J7Z A;  3KBX A;  4Z6Y A;  2XEP A;  1CA6 A;  1PFN A;  4U67 3;  3OTO M;  1Z59 A;  2NVT B;  1G4A E;  2KEE A;  4JI4 M;  3ITP A;  2VB3 X;  4Q5V A;  4A3G B;  2HDM A;  3T1H M;  5JI2 E;  1LLR D;  3CF0 A;  1XHB A;  3I4N B;  4KMU C;  2SEB D;  1S5F D;  3L28 A;  2SDF A;  1PYW D;  5C0X J;  2MUY A;  4J8Q A;  3NWT A;  3J80 E;  1JB3 A;  3U6Q A;  2DWL A;  3Q22 A;  3SHG B;  1LTA D;  4MGH A;  2R7Z B;  3HS0 C;  4LG2 A;  1L1T A;  2PQE A;  2Z4R A;  3J27 B;  4G6Z A;  2Z4H A;  4L63 B;  2IWH A;  2F5N A;  4L6T B;  2VXW A;  4IBE A;  5CMD A;  2EY5 A;  4LFB M;  1STE A;  3PUZ A;  1NVM A;  2O5R A;  2E2J B;  2OQ4 A;  4S12 A;  2F4I A;  3NHH A;  2AWN A;  1EQT A;  3KLR A;  3SEB A;  1ET9 A;  1WTP A;  2FHT A;  2A6E D;  2JA8 B;  2KXE A;  2F3W A;  4IBC A;  2Y20 A;  5JI3 E;  1IY1 A;  2EA0 A;  1DXM A;  1L1Z A;  3VK8 A;  2K47 A;  3M7G A;  4R9W A;  4FNF A;  1JR3 D;  2BE5 C;  3U6P A;  2HCI A;  1C4Q A;  4S3S A;  3DHQ A;  4BBA A;  2C99 A;  5AFW A;  4JI3 M;  5EPJ A;  2CHQ A;  1VF7 A;  4YHH M;  1HR0 M;  3VR4 A;  3MAQ A;  4IUN A;  2F0V A;  1YNJ C;  2MPM A;  1SYG A;  3SK5 A;  2G9H D;  4JI2 M;  4KV6 A;  1STN A;  2AQ2 B;  4Z8X A;  1B9M A;  4TRD A;  4LF8 M;  2ICI A;  1PMR A;  3I4Y A;  4KY5 A;  3G7L A;  2F0J A;  4M0W A;  3M4Y A;  5IT9 L;  5E26 A;  3NWS A;  1TH3 A;  3AJI B;  4IUP A;  1IN5 A;  3WHK A;  3QWL A;  2QCP X;  3URY A;  1JOK A;  1STH A;  2XH9 A;  3H94 A;  4H7B A;  3DUZ A;  2LKV A;  1JQJ C;  3DM1 A;  2B2U A;  1DJR D;  2F0S A;  1G59 A;  4PD2 A;  3HOU B;  1QVR A;  2ZAN A;  1SBB B;  3S15 B;  2VQF M;  3KOZ E;  1BR9 A;  3HZX A;  4AW4 A;  1LTS D;  1SE3 A;  4KY6 A;  1G6Z A;  1TR5 A;  3FTF A;  3BDL A;  2BA1 A;  3KFU G;  2NTT A;  1N36 M;  1ZXT A;  1TS3 A;  2TSS A;  3GLG B;  4NRV A;  4P16 A;  3SR1 A;  3I8Z A;  3KOY E;  1R7R A;  3S1N B;  1XYI A;  1I4W A;  5FO9 B;  2CHV A;  4LF7 M;  4TKO B;  1HTL D;  3BZD B;  3MHB A;  3GLF B;  1F9S A;  2IW3 A;  1GL6 A;  2A69 D;  5COY A;  2CQA A;  1J7K A;  1EY8 A;  3AU7 A;  2DWZ B;  2PCF B;  1K83 B;  2K1B A;  5CGK A;  5NUC A;  3SHL A;  4Y7N B;  2D5D A;  4I8O A;  4OU7 A;  4FVM A;  4OW0 A;  3HJS A;  2F0U A;  1EEF D;  4PDG A;  1F2Y A;  2O5I C;  4YY3 M;  1V43 A;  1X3P A;  2R6G A;  4GKJ M;  4B7H A;  4IAL A;  4KY7 A;  2J7O A;  4DV3 M;  1BNZ A;  2F0M A;  2Z4I A;  1RD9 D;  1VF5 C;  2CV1 A;  4LK1 C;  1IM2 A;  2L55 A;  4CGY B;  1YE9 A;  2EY6 A;  5ELE A;  4IQZ A;  2OT2 A;  1SJE D;  3H09 A;  4RHS A;  1LTT D;  1HFN A;  2FIN B;  2Z7J A;  3H6M A;  1SE4 A;  3U61 B;  2IT1 A;  2OXP A;  2CV2 A;  3CU7 A;  3K2L A;  3ZH9 B;  5C1B A;  3A45 A;  1N33 M;  4I81 A;  1STY A;  4RCO A;  4EVO A;  1C8C A;  2J7N A;  1BO0 A;  2L5T A;  3W0L B;  4GHA A;  1D1K A;  3LMM A;  3SAW A;  4O42 A;  3VDP A;  4ZLT F;  4J6H A;  3CRK C;  1NSF A;  2AHM A;  1JQY D;  1FYC A;  3GQ4 A;  4ZPX A;  4M1U B;  1IYU A;  3CF2 A;  3U61 A;  1IW7 C;  3J80 S;  1L2D A;  3TE6 A;  3NK9 A;  4KLN A;  2WIN B;  4DN4 M;  1R6B X;  2E2D C;  4KOD A;  4HMI A;  1HQY E;  1ILQ A;  2TMP A;  1SMY C;  5KRU A;  1L0Y B;  3NQT A;  1J9O A;  1BCP B;  5LMN M;  2B2U C;  3GO8 A;  2B39 A;  2PW5 A;  3LWU A;  2Z8L A;  3SVM A;  1F2M A;  3J7Y W;  3K7A B;  3SBJ A;  3AOE A;  2J0T D;  1RCV D;  4ZUI A;  1HTP A;  4KI0 A;  4C3H G;  3UGJ A;  4OO1 G;  4PT5 A;  2RKO A;  1FD7 D;  3L27 A;  4QHT A;  3L2A A;  1SYD A;  3HOY B;  5KYI A;  1KTK A;  1PLF A;  2KED A;  2VII A;  2G8L A;  4KKS A;  4DA2 A;  2KZS A;  5DNF A;  3M7N A;  3K57 A;  2KW0 A;  5F3W A;  1GHK A;  5FK9 C;  5IWA M;  2C96 A;  4IFD I;  3I72 A;  1G2T A;  5FLX L;  4KJO A;  4BB9 A;  4B3M M;  3NPP A;  1A6X A;  4XIG S;  4DV7 M;  3THG A;  2EUC A;  4RWS C;  5FO7 B;  4ITQ A;  3SK6 A;  1F2Z A;  2L9H A;  1CA5 A;  3M85 A;  2QZ4 A;  5CBE E;  4A3V B;  2D7G A;  5CBA E;  1Y8N B;  4C3J B;  3KBG A;  2F4V M;  2KRU A;  5KGU A;  1O7Z A;  3HKP A;  1DGB A;  1PTO B;  4J1M A;  3VR5 A;  1R2Y A;  4IUU A;  1TDZ A;  3OPO A;  2M00 A;  3GPP A;  1AFP A;  2B8F A;  3ZC7 B;  3I91 A;  1QJO A;  1RTN A;  3A56 A;  3KLS A;  3R3O A;  5ELF A;  2H4O A;  2WII B;  3TDQ A;  3GP7 A;  3U6O A;  1YNJ D;  5COR A;  4QNM A;  3U6S A;  1DM0 B;  2DVW B;  3QWN A;  3AV0 A;  5CV7 A;  3EQL C;  2CE7 A;  1C1K A;  3SYL A;  5C6A A;  2JEB I;  1NJG A;  5IOC A;  2IJ0 A;  5JOB A;  5H37 D;  2UU9 M;  4FO2 A;  3JR5 A;  2B2T A;  5JJZ A;  3KSX A;  3TN2 A;  2XSZ A;  4G7Z C;  3GRY A;  4DR2 M;  4G4Q A;  4G7H C;  4L8R C;  4QB4 A;  1TWH B;  3VYS A;  1LTB D;  1GUT A;  3ILK A;  3I4M B;  4XYQ A;  2G5G X;  3GLI B;  3HRZ C;  1IQP A;  1SDF A;  1STB A;  3C3L A;  4NSO B;  4MHE A;  2DHR A;  1DZ1 A;  2BJV A;  1M4V A;  1CTM A;  4NXM M;  4K0K M;  1PXU A;  3KP0 E;  4BLC A;  1T5X D;  1ENC A;  1JR0 D;  4K14 A;  1Q1B A;  3VYU A;  1IKM A;  3J7B A;  2PMZ B;  1F77 A;  2KEC A;  1JOR A;  3A8J E;  4RHR A;  3A7L A;  5K36 G;  3S17 B;  1TH4 A;  3SC3 A;  2KJX A;  5JVH 3;  3VLF B;  2R45 A;  5IZ7 D;  3HHY A;  2K7V A;  4QMG A;  4LAA A;  1WTW A;  1NHW C;  1XMO M;  4FF4 A;  3NTK A;  4LJ4 A;  1BCP C;  1PZJ D;  2XVS A;  4CIS A;  5EQ0 A;  5EXS A;  5I2X A;  2DY7 A;  2DZO B;  1DGG A;  5C3X A;  4B08 A;  2QP9 X;  4F8M A;  2HKJ A;  4LJ7 A;  2ZXO A;  1DGH A;  4YIJ A;  2F5Q A;  1PTO H;  3K5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...