4CHTB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex with bound calcium ion
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
215
structure length
215
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA TOPOISOMERASE 3-ALPHA
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 55
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4chtB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4chtB02
4CHTB 3NBIA 4CGYB
chains in the Genus database with same CATH superfamily
1T3TA 3E6ZX 1NNUC 1OXXK 4PMBA 3KJPA 3G6JB 4C3IB 4JI0M 2PNRC 5CC4A 1ENCA 3VDYA 1JORA 1O80A 4G4OA 3RZOB 1Z7TA 3CU7A 4OIKA 5D65A 3P7JA 2P5TA 4FCTA 3K2LA 1HXYD 5ITUA 4JI8L 1VEJA 1NR2A 1RIPA 4FXDA 1XNRQ 3OPOA 3QWLA 1VQFA 1XMQL 5EPLA 1STNA 2UXBL 4JV5L 2X49A 2E75C 1E2ZA 3RD4A 1I50B 1Q90A 3I4MB 4A3JH 3CAMA 1QDTA 2MO0A 3PO3G 2RDGA 4YCWA 2V1CA 3JR4A 3OSOA 3E0JA 4DGZA 5A2QS 2NBFA 1L2BA 3STBD 3HOYB 2IY5B 3AOEC 4JI7L 4LF4L 4G7HC 5IWAL 3VLFB 3WOEA 1YJWA 2Q8IB 1VS0A 4JI8Q 1YHQA 5AJ3L 4QUCA 1VG5A 4DV5L 1TS3A 1YNJD 4A3GB 2F0JA 2SDFA 1PTOC 2XRQD 3NBHB 4JV5Q 2UXBQ 3M4PA 3A8IE 2LVQD 1WJ7A 2NQ8C 5GKNA 1IYJB 1E9RA 2RA4A 5C4XB 2ZBKB 5I6WA 1LTGD 4GITA 2KA7A 4MHEA 5HGQA 1T43A 4DR1M 1MI2A 4A3MG 2B63H 3H3VH 1PH1A 1VQAA 1R2ZA 3NQIA 1ENAA 3PSIA 2VS1A 3BZDB 1CKNA 3L0OA 1PGYA 1S3SA 2C9OA 4B3TM 1N78A 3TS2A 4JI7Q 4LF4Q 4L5QA 1QVCA 4AI6A 3AL0C 5IWAQ 1YVCA 2JA6B 2E2HB 4GLAC 1F77A 1X37A 4LRTA 5AJ3Q 3W5OA 3S1QB 4LF5M 1D0LA 2UXCL 2JZ1A 2DHYA 2LVOC 2O01F 4FF4A 3MMPA 4DV5Q 1SNCA 4LWCA 1JJCB 2I07B 2WSFF 2H1EA 1H95A 4C3JH 1BCPD 1PZID 1YSYA 1Y1WG 1C9OA 4RA8A 1Z59A 4DN4M 2QCUA 1XWIA 2CWPA 3GTLH 2A73B 2L09A 1PRTB 1BCPB 1R2YA 5CV9A 4NRVA 1NY4A 2Z7JA 4DV4Q 3MEHA 4UAIA 3SK5A 4X66M 4LF6L 2HDMA 2DNAA 1HA5A 4JPBW 1S5DD 3VA5A 2UXCQ 1YNNC 1LV7A 4A3EG 2QHOB 2HCCA 4Q5VA 1XJVA 5JPNC 2F5PA 4L4UA 3KFUG 4M9XA 4TKOB 1HR0L 1FL0A 5GADC 1X56A 1Z5AA 3FDTA 2QF7A 1WHCA 1STHA 1KDCA 2F0TA 2Z4SA 5CORA 2RGOA 1WTOA 2FHTA 4HIDA 3ULLA 3GP1A 4FP5D 5BN4A 5GAEC 2A6HD 3M85A 3U9OA 2O5JC 1DD2A 2VQEL 3D8GA 1LYLA 3EN2A 1LTLA 3HOVH 4S12A 3NQTA 3VDPA 4MTNA 4I65A 1FR3A 3LWUA 1TY2A 4KV6A 4HJ7A 2BOSA 3L28A 1RU3A 2OQ0A 3LW5F 1FGUA 2FMMA 4DFAA 3KLRA 3KLWA 3K5MA 2MJ5B 2J7ZA 4KKTA 4DR7L 1XHBA 2VW9A 1OAOC 1EYDA 3KOZE 1TXYA 1HR0Q 2FFKB 1PRTF 1BCPF 3W0FA 4AYBG 3PF5A 3KOWE 3Q8XA 5GQOA 1DYQA 1MD2D 2F0FA 2YR0A 3DXJC 4MGIE 5BR8L 1LTID 4TVAB 2HHHL 4C2MH 1SJHD 3JAMS 2KZUA 5I2XA 1C7YA 2EYPA 1JR3E 2VB2X 2I46A 2LTUA 4B7HA 2EYLA 1SXJD 3C3EA 2A5YB 3RN2A 4N8X1 2LVAA 1NBWA 1SROA 2Q2EB 1HT1E 1G41A 2WB1E 3CXCA 4GHLA 3R2IA 4DR7Q 4DUZM 2G8LA 1GL6A 3QOLA 4M1UB 1TWAB 4WURA 4KY6A 3D3RA 3HEJA 4BY7H 4CDCC 3CQZH 1PFNA 3HZXA 2KRKA 4BY1H 5ELBA 2WSEF 3FTDA 5GAGC 4IPGA 3LCVB 2V4DA 4IALA 4L6TB 3CRKC 3NTKA 5BR8Q 1I4GA 3PV0A 2B2VA 5L37A 2HHHQ 2JA7H 4DUYL 1F2LA 3AFPA 3GLGE 3J81c 1V1QA 4DNIA 3RZOH 3H4MA 1U4MA 2F0WA 3FP9A 1VCIA 1HNXM 3DWQA 1SR3A 2R0IA 5EGTA 1TWCB 2M2LA 3E0EA 2JA5B 1WGLA 1JB0F 3EIHA 4NB3A 1STAA 4WJ4A 4OELB 1TWGH 1IN8A 3DEOA 2AHMA 5LMNL 2NYZD 3MHBA 3I4MH 1Z6TA 3MFYA 4KHPL 3H4JA 2LVPC 4BA2I 4AKHA 1E24A 3I73A 4DUYQ 1K8AC 1QAOA 2RRUA 2K32A 3A56A 4DK1A 3GTMH 4ZUJA 3HOYH 2ZTCA 4UDUC 3QAUA 3J80L 3FKIH 2R6FA 1NSFA 4YHHL 1YEZA 5ITTA 1WCMB 2QNJA 2F5SA 3URYA 3GQ4A 4DV1M 4LGMA 1N32L 4N9TA 1EIFA 2PW5A 3NENA 1D0MA 3BDOA 2EY6A 3LVVA 3S2DH 1K73C 4A3GH 2QPAA 3FEWX 5LMNQ 2AHOB 3U6EA 1S72A 1UE1A 4QOSA 1QZMA 4F7XA 5C4XH 1R4QB 4C1NI 4KHPQ 4G4KA 4LJ7A 2F0VA 1CQVA 3D8LA 1UE7A 2JXNA 1B7YB 3GLFA 3KW6A 4WW0A 2J4XA 5C0XJ 4YHHQ 2Q2IA 2JA6H 4A3JG 4DV7L 4DR3Q 1KL9A 1N32Q 2VQFM 3DM3A 3S1QH 3PUZA 3AOEA 3KXEC 5EJWA 1CFMA 2CV0A 3ZCBB 2G5DA 4LF8L 3C2PA 1EY6A 2B39A 5JVG3 3HOXG 4GN4B 1IN7A 4DV2M 2DNEA 2BE5D 1LT4D 2F0HA 2RBMA 3M4OB 2RKOA 1LLRD 4DAYB 2A6ED 5ITXE 2ZTDA 5EKKA 1MN3A 5IP9H 4PD2A 2D9UA 4AIMA 4KODA 1P8LA 1HCZA 1TU2B 2H4OA 4BLCA 2R4JA 4FF2A 1D8LA 3VR4A 4JI1L 4RKBA 4DV7Q 2R93H 1V1OA 4BB9A 2WAQB 2XZFA 4JW0A 4X3SA 2B63G 3SHLA 1HQYE 1B70B 5FTLA 2FINB 2JXMB 4EQNA 4B3SL 4KI0A 1I4QA 2JP1A 1JOOA 4LF8Q 3SFZA 4QIWE 2JA8H 3C46A 5KPZA 1JWSD 4GKJM 1SFOH 1XC8A 3GTPB 3G48A 3PUYA 3EFXD 5ELOA 2LHGA 1IN4A 2LKVA 4UP8A 3HWSA 4X62L 4FXGC 3I4YA 3DLLA 4EQ5A 3KP0E 5KQDA 2EY1A 4C3JG 5FLMG 2F0QA 2A68C 1V1PA 2MO1A 4JI5M 1NR4A 4B3MM 2TMPA 4JI1Q 2LNHC 1Q3BA 4B3RM 2R61A 4CDDC 3D6WA 3BG3A 3AYHB 4AKGA 4B3SQ 2K5QA 4NKLA 1BBWA 4NSRA 2AUKA 2BA1A 2HIXA 3S1RB 3KFUA 1DJRD 4PNYA 2YNMD 4L78A 3J2PB 1SYCA 1TS2A 1Y14B 1CA6A 3B7NA 3JAME 1FNVA 3PVSA 1LT5D 4MNOA 4KLKA 4C1NK 2K28A 3RE8A 4FWDA 1IXRC 4RF0A 3T1YL 2EJSA 3TWMA 4U673 1ZV1A 5FTKA 2RKSA 4YY3M 4IUUA 3RNUA 1RJTA 1G2TA 3VDUA 4APVA 1HTLD 3KF8B 5HURA 5EP1A 2Z6KC 2Z0SA 2NVTB 1N34L 2UU9L 1ZMUA 4JBKA 2EKKA 1PZJD 2JEBI 3Q22A 2LS01 4UY8C 3DWPA 2XSZA 5J39A 1SRUA 3Q8DA 3NP8A 3FMCA 4KJOA 5DYGA 1HQRD 2C99A 2B2YC 1S5BD 1VQIA 1PH6A 5DYIA 3CTWB 3T1YQ 1Q86C 2DJGC 1EOTA 4HAEA 4MGHA 4G4NA 2PMZE 4XBOA 3C1FA 3KOXE 2F0GA 5CV8A 2K01A 4GHAA 1YIJA 4BXXH 1SNQA 3OWFA 3BU2A 1N34Q 2UU9Q 3S2HB 1ET9A 2OQ4A 1TWCH 4X65L 1H9JA 4F8MA 1VQHA 2IL8A 4XIGS 2OXPA 1IBLL 1WJJA 2KNVA 1JWMD 4DA2A 2K9DA 1XNRM 1FNWA 2EO2A 2WIIB 4G3OA 3E46A 1XMOL 1MKHA 1TS4A 4A93B 3BZCA 1B9MA 4RHRA 1DGHA 4X64L 3A45A 5FTMA 4KK7A 2E5LM 4CJ0B 4CISA 4BY7G 2RQXA 4BY1G 1Y8GA 4K5VA 1EYGA 1MIUA 2N88A 2VL6A 4X65Q 2ERCA 1L1OC 3GRYA 3EVQA 4UN2B 4M0DA 2JA7G 1MJGM 1IBLQ 4WFN3 1EY5A 3WOFA 4JI8M 3E4RA 3SVMA 1YE9A 5EKLA 4A3VB 4IZ8A 4AG5A 3CPFA 5KYIA 4IOCA 1FNNA 2N8NA 1TR5A 1VDLA 1YITA 2MPMA 4XQQA 3GLIA 1HJPA 5CV7A 2QEXA 1A15A 5IYDH 1SMXA 5C5LA 2AKWB 1PZKD 4X64Q 4RHSA 1EOVA 3NWSA 4A3IH 4BS9A 1L0XB 5LMUQ 2QCPX 2PO4A 2CH4A 1NSNS 5EKIA 3TREA 5ELNA 3W67A 4HCEA 3KSJA 4JI7M 4XT1B 5IWAM 1QUQA 3STBC 3J81L 4R71A 3NWTA 1S40A 2MFIA 2F4VL 4RCNA 3FKIG 4DKAC 1XPRA 2Q2HA 2KNZA 2LVNC 4BBRH 4GKKL 3M4OH 5M5WB 1S5CD 1MBYA 3KOJA 1U9RA 3T56B 2MROB 1KNAA 1YNJC 3OTOL 1J09A 4JYAM 1ZXTA 1HFGA 2VNUD 3QO2A 4FDBA 2LXKA 3RZDB 3NWLA 3TQYA 5C4XG 3GPXA 5D3IB 3FRIA 1DOLA 2KDLA 3D6CA 3FPUB 2DHRA 1SNMA 4Q0FA 1AUAA 4DV4M 3IRBA 2CWBA 3MVVA 1L0WA 2X8AA 2MJ8A 4EGVA 2KXEA 3T16A 1Q8IA 3SXHA 3U5ZB 3U6PA 4A4IA 2I7NA 1E2VA 3V2TA 3GQ3A 2F0IA 2UXCM 2F4VQ 4WORA 2HWJA 5FLXS 1BXTA 2C9CA 2IX0A 3MZ5A 1KTKA 1LM0A 4BBSB 4R4OA 1EY0A 3IHPA 5I6YA 3J7ZC 1ML0D 1W6KA 4QJFA 4GLXA 1V33A 3CMAA 3OTOQ 4JBJA 3HHXA 4GS3A 2UUCM 2CCZA 1BCPC 4CKEA 4IUPA 1TGUA 2G3QA 1HR0W 3GTKB 4CKCA 4DR6M 5M3FB 3SAWA 1HNZM 3HKZG 4FXKC 2DWNA 2I7PA 2C96A 3OIPA 1W2BA 5IP9G 2DI0A 1GUWA 4LF7L 1VF7A 2X6LA 3F1ZA 3P1HA 3VYSA 2MR9A 4M9SA 3GD7A 2A5HA 5A35A 2DAEA 3RLNA 4A3LH 2BJWA 5C3EH 5JJLA 4XTCS 2R93G 2WB1B 2A68D 3KBGA 4LJZC 1ILPA 5IGEA 4OGQC 5JEAJ 4NPSA 4KY5A 2ZJRA 1KQSA 2IWHA 5JPMC 2JY6B 2JA8G 1K8OA 4DXGA 1HUMA 3KS8A 3BOSA 1NTGA 4EQOA 1SXTA 4HSVA 3GPUA 2R65A 2R44A 3DOAA 1A8VA 2IJ0A 4R4QA 4A3KG 2NVTH 1DZ1A 4JI2L 3L2AA 1D0KA 5EP4A 5C1BA 2F5QA 4DV0L 4LF7Q 2PCFB 4HMIA 1XWEA 3CW2C 4DV6L 4FWGA 1S3OA 1YHBA 1G6PA 2A6HC 1OXVA 2XGTA 1GKIA 1SSOA 3GLFE 3AJIB 1HNWM 3QJYA 1XYIA 2B2UC 1JB3A 1ZMWA 1MSHA 3MXPA 1WD1A 3U60A 2A8VA 4R8NA 1VQGA 3T13A 1QUTA 2E2DC 1F2YA 3UK6A 1IXRA 5BR8M 4D81A 3GTGB 1EIYB 1X6OA 3GRRA 4JI2Q 4R4IA 1F2ZA 1AZQA 4Y52H 1EQTA 4DV0Q 4DV6Q 1SE4A 2Z6KA 5JAVA 3PUWA 2F0OA 1WOCA 1IL8A 2XTIA 1AE2A 2E2JH 1IBMM 3FYCA 2YV5A 3SC3A 1SXJC 1CKOA 4WJ3M 2B8FA 1F4IA 1J9OA 3E3XA 1V9PA 5COYA 1F9PA 4PZ7A 4A93H 5JJIA 2SNMA 3RN5A 5LMNW 2B2YA 2FH0A 2VB3X 2HKJA 5D14A 1NAPA 2K5WA 3M4QA 2UXDL 4QY7A 4A3FB 2Z4HA 4Y28F 1XPUA 1JWUD 1EFUB 1DGSA 1I94L 3C9PA 4LJAA 2G9HD 3PFIA 1OJLA 4HN7A 2M60A 3HJQA 4KY7A 3LNNA 1QVGA 1TR8A 5C44B 1Q1BA 1G6ZA 5LMNM 1X3GA 2F0SA 2L9HA 1ET6A 4HIMA 3T1HL 4JI3M 2MHVA 3I4NB 1ORYB 3FUVA 1TWFB 2UXDQ 1NMFA 2CH4W 5AFWA 1CI3M 1VQ9A 2LXEA 2ZJPA 1GABA 5JJZA 1I94Q 4YHHM 1EWCA 4LJ4A 1YNXA 2I0QA 3IECA 2ZXOA 1IYVA 4DR3M 4IPCA 4A3BH 1N32M 1H9SB 3TEHB 4LFCL 2R92B 1L1OA 1Y1VG 1NV9A 3NELA 5C4JB 5C4HA 4IOAA 4GH9A 2DVWB 1IYUA 1WYDA 4QIWB 1Q82C 3UJNA 2R7ZB 3I4LA 2DZNB 3HJSA 4QL5A 2B2WC 4R9WA 1DO0A 2WP8J 4OXPA 3J80i 1X54A 3J7AS 3RZDH 2OTLA 4RH6A 2F52A 1ICWA 1YLAA 1OAIA 1D5XC 2RCNA 4AYBE 5C0XH 2RHSB 4UP7A 4V190 1HZAA 1STEA 1T9HA 3BJUA 3UI2A 5FLXE 2DENA 5IGDA 1EWIA 3H0GB 2JYOA 3MXUA 2O4XA 5KPRA 4DV7M 1GUSA 2CUZA 1BUVT 2JY7A 3SDZA 3HKSA 2UUAL 1GUGA 4A3IG 1KIXA 3GTJB 4NXNL 2NUCA 4LFCQ 1A3VA 4LW1A 3GPPA 2Z1CA 4DR5L 3GTOB 1XMQQ 3IAYA 5KRUA 3HOWB 3EIVA 1XB2B 2I5MX 3NBHA 3OYYA 5EBCA 1ESRA 2L0CA 4OHJA 1PJIA 3GTKH 3I56A 1IBKL 4BBRG 3NSWA 2BE5C 5LL6S 3K0XA 3I01M 2A6EC 3UZUA 3SK4A 3KYHC 3CMEA 2K5NA 1UAPA 3S24A 2JEAI 1YJ9A 1RTOA 1AFPA 3M3YB 2BH2A 3HOZB 2UUAQ 3S1NB 1ESFA 2DAGA 4NXNQ 1GLNA 2Y0SG 2D7EA 1JT8A 2AQ2B 1N9WA 2PQAA 3BYYB 5KNDA 4DR5Q 1AZPA 3GTQH 2FS1A 1II3A 1PRTD 4HIOA 4DAMA 4GNXA 1X65A 4CBVA 2QA4A 1E1TA 1G59A 1UE6A 4IUTA 3U61A 2QDBA 1CKNB 4RG1A 1L1ZA 3GLHA 2D7GA 2AUJD 1IBKQ 1NJGA 2IX3A 3FTEA 2F0UA 3H94A 3BXWA 4YWLA 1MJEA 3I70A 4TSSA 2RSOA 2PMZB 5KYLA 1HFNA 1OKSA 3AU7A 3OOCA 3ZJYC 3GLIE 2XRSD 3KLSA 4QOZC 3TPZA 4XDXA 3BDLA 1SNOA 3QYBA 2L12A 1BBUA 2KNAA 4OX9M 1E22A 4I4LA 2QKIC 2VXWA 2GVAA 1UM8A 2MGWA 1BVSA 3CCVA 3U6CA 1WGNA 2DAIA 3CRLC 1VQNA 2NTTA 2N49A 2OOBA 1ENFA 1IY2A 1SYDA 3FE3A 4K8IA 5C3EG 1IL2A 1TS5A 2QZ4A 2QSFX 4FW9A 5DM63 1IXSA 2XVSA 4A3CH 4LF6Q 5D3DA 3FUWA 2CV1A 4K2KA 3TS0A 2IT1A 1Y8NB 2NVXH 4H02A 3B7QA 4GRIA 4LFAL 3SMPA 3S17B 3HX3A 1PFMA 4G57A 1DM0B 3F2UA 1JMCA 2DJFC 1GJXA 2QQ8A 1DGFA 3C3LA 1H9RA 3FD9A 1UEAB 2L1BA 3J81S 4HMJA 5IT9E 3CF6E 1XNQL 1CZWA 1TDZA 1WTPA 2JE6I 2B2UA 2HL7A 3KDSE 4KKSA 5J1ZA 1EYAA 4X3TA 4OVZA 2JY5A 1FNUA 3PUVA 1SMYD 2I5LX 2K05A 2VQEQ 5C3XA 3OMGA 4GN3B 4ILWA 1TH3A 1WD0A 4LNQA 3UE1A 3SK6A 2Z8LA 2KECA 1NCVA 1J8IA 2XH9A 3LX0A 2B3TA 2EA0A 4DPGA 5H1SE 1EU4A 2K5HA 2XWBB 4HEDA 1IM2A 1HH2P 5TSSA 5C44H 2N3SA 2XFTA 3SHGB 4L8JA 3LCUA 3HGBA 5IP7H 4AQYM 1HZBA 4O2DA 2VY3A 1GD7A 2QGQA 4GEWA 3UE0A 3R9XB 2Q2UA 4A3DH 2VUMB 2EYMA 1SXJA 2NZHA 3F2CA 1X9NA 3I4NH 2XNAC 1N36L 4PCZA 4KN7C 3U6OA 5C4ZA 4C3IH 3HOUB 3FVQA 1KABA 2LHCA 1I4WA 4G6ZA 4X64M 1QG7A 5EBDA 2NTSA 1GM5A 3AB9A 4A93G 5LMUM 1VEKA 4C56C 2M00A 3NUCA 4ZUIA 2EYHA 2PNHA 2R92H 4H44C 3VKGA 4J6HA 4IFDJ 3L27A 1JB7A 4B9WA 1AIPC 5A2QE 1I50H 4K0KM 1JICA 1GO3E 1QB5D 1WFQA 4I7ZC 1OXTA 1QDRA 3UDXA 1PH5A 1K3WA 4TUWA 2CE7A 4DV3L 3VK7A 1H9KA 1N36Q 4JN6A 1WTXA 1C8CA 4ITQA 3H6MA 4PV1C 2A1AA 1VMCA 3PCOB 1M90C 2X4AA 3RGSA 2ZJQA 4ZCKA 3H0GH 4ZYSA 4MGKE 2HT1A 2I5HA 3JAMc 4HJ9A 1JR0D 4RAUC 3SHFA 1UEBA 1PH4A 3A8JE 3K8AA 1VQBA 4M9ZA 2R7FA 2DY7A 3K80C 3GRUA 3V05A 3GTJH 1G291 1QZEA 3U6SA 1SLJA 1K83B 2HD3A 3A8KE 2EJGC 2F0NA 3I8ZA 3GTOH 1W5SA 2F4VM 2O25A 1R4PB 2WKCA 2CHBD 2PZTA 4JI0L 5KIXA 4CJ2C 4DV3Q 1EQVA 4A3BG 4GOPB 3M7GA 2YU9B 1PH3A 5HGTA 4ALPA 3OTOM 2L7HA 2B2WA 2HQEA 1T6OA 4NXMM 3GQBA 1JQYD 1BBXC 1EZ8A 1AW7A 3J81i 2E2HH 3M3YH 4L5SA 1DOMA 5FTJA 3S1NH 4IO9A 3S14B 3PO3B 4ZPXA 2KBNA 2NVQB 5E1FA 2GA4B 2K4KA 2K50A 3CKIB 2EUCA 1PFSA 1PMRA 2F0LA 2J7OA 3FYDA 2CQOA 3QB3A 5E4WC 4JI0Q 4KD3A 1BDOA 3T4AC 3GLFB 4J8QA 3UDIA 3K1JA 1AN8A 3AKZA 2K5VA 3R3OA 3H3VC 1LTMA 4X3KA 3GV6A 4WP2A 1L1TA 1U0LA 1GKHA 3B6YA 1IY0A 3RFWA 3VR3A 4J15A 2IHEA 2CHVA 4Z8XA 1G2SA 3MXNA 1QVRA 4P75A 4IPHA 4ZLTF 1K28A 2G5GX 3HZJA 1EIHA 1R9TB 3SYLA 1LABA 4A3MB 4EX5A 1IZ6A 1CHQD 1PTOB 3MK6A 3TZDA 4IBBA 1KFVA 4LF9M 3GQ5A 1HQCA 3DA1A 2KOLA 5JEAH 1HT2E 4RF1A 1YUBA 1PRBA 2ZANA 1EIJA 1S5FD 1GUOA 3IG5A 2KW0A 4FCWA 3HHWA 2HAKA 1PYBA 5BPVA 3DM1A 4YCVA 1Q02A 3CC4A 2EXDA 3OW7A 4NDXA 1CM9A 2UUBM 4L15A 1Y1WB 5IZ7D 1H6UA 3G71A 2DAMA 1K3RA 4P17A 3SATA 1YHAA 3PIO3 4DV0M 5CBEE 4CKBA 4LAAA 4MB7A 3LGJA 2CRUA 3K6OA 3B9PA 1HUNA 5EXXA 4F88A 4DR4L 1SNPA 4POFA 3RR5A 1V1PB 1JOKA 3GDEA 3IL8A 3WWVA 2RDHA 2YTYA 4A3EB 3RUZA 4O1NA 2HUGA 4X62Q 4LUOA 4ZK9B 2N55A 1J6QA 4IJEA 1AP0A 1VDDA 4K6DA 4H0LC 4DNTB 2B29A 1QZGA 5FO8B 2EPBA 4TQUS 1O7ZA 1PTOF 4OL7A 1QYRA 2FE8A 1VQLA 1I6HB 4HL4A 3JR5A 4UP9A 2JA2A 4RWSC 4DXFA 3OWEB 1X32A 1MJCA 3NBXX 3TWLA 2K33A 4IBDA 4XXEA 1ZYRD 3CPWA 3BBZA 3S1MB 4W5WA 5KGUA 1Q12A 4DR4Q 1TWAH 3PQIA 5M5YB 1TWHB 3M0EA 5IE8A 3HOVG 3WHLA 1OIPA 1HZ9A 3J7A5 2VUMH 1F2MA 1D1IA 3PNVA 2JSOA 1PJSA 3B89A 2BJVA 5I4DA 4G7ZC 3T51B 2PQEA 5ISRA 4OO1H 3TE6A 5I9PA 1K0SA 2TSSA 5IYCH 1JCKB 1E7ZA 4XQNA 2CHQA 3CP0A 1ASZA 4A76A 1AH9A 1A62A 2UXDM 4KHVA 4AYBB 2K14A 2JA5H 3GLHE 1A0IA 3HKZE 1IN6A 3A42A 4MH0E 5F2DA 1DGGA 3I04M 4DNRB 1TKWB 4R7GA 4QQBX 2NWGA 2CVRA 1KD1C 4M0WA 4F1IA 3IFTA 4RKUF 1K8MA 3PNYA 5G3LF 4FVMA 2KRUA 3MA2B 4MZ9A 3IKJA 4IURA 5C44G 1CA5A 2YTXA 1OTCA 2DWMA 2ASBA 2CQAA 4LJ9A 2DAKA 2L4NA 4S3SA 5IP7G 3U4ZA 5J22A 1BQQT 4DR2L 2HCBA 4A3DG 5EAYA 1WCMH 3SE0A 2OWOA 1LACA 2BDOA 4DUZL 4BWGB 1J5EL 4LCBA 4C3IG 1QCBD 1K83H 3T53B 1SEBD 3KF6A 1G4AE 4LFCM 1KLUD 2K47A 2LXJA 1UUPA 5EPJA 5IOCA 1LT3D 3AV0A 1DGHB 1XMQM 1XMOQ 2UXBM 4JV5M 1VEGA 5I9OA 2F0PA 2CFMA 2KHIA 1HNXL 4GIPA 2K6AA 3U58A 1JOQA 2N78A 4JI6L 1YI2A 5IODA 3NPPA 1GJTA 3I4MG 3W0LB 4DR2Q 1GUTA 4AW4A 1KAWA 3ITPA 4DUZQ 1EY7A 1J5EQ 4LF4M 3IFDA 3KS4A 2NVQH 2V6ZM 3W68A 1PVOA 4PDIA 4KHZA 1VMPA 4FCVA 3GLIB 2UUAM 3HOYG 4NMZA 4II7A 4NXNM 3BVZA 3MWYW 1EY8A 4DR5M 5IYBH 4DV5M 3E9HA 3H0GG 4L5RC 1Z6HA 4IUVA 2AMCB 5M3MB 1XPOA 1U4RA 1NUCA 4FO2A 1PJJA 1EE8A 1GJSA 4PZ6A 2O2LD 1HNXQ 4A3GG 4JI6Q 3V96A 4K14A 3ONAB 3DZDA 1QUQB 1L0YB 2C5CA 4DV1L 3HU3A 3NXWA 5E7NA 2CHGA 1WTHA 3TL4X 1S5ED 4QGUA 4HIKA 3ERQA 1KC8C 2Z3XA 2FOIC 1R9TH 1SXJE 3U6LA 2ES2A 2O5IC 1B9NA 1XXGA 4LZJA 2VIIA 1R6BX 1DCZA 4P74A 1X3QA 3QWNA 1FJGL 3KJOA 2JA6G 2JJQA 3GTPH 1TT2A 4AH6A 3JAML 2EOTA 1A2UA 4CDFC 1GHJA 1XXHA 3A46A 1PRTC 2J0TD 4GN5A 3TZUA 1PYSB 1JR3D 1SAPA 1SN8A 3RLFA 7CATA 2E8GA 4DV1Q 3HOXB 3PO2B 4LUVA 2VQFL 2B3GA 1NVMA 1A6XA 4L8RC 1KHIA 4GMQA 4LF6M 4J1MA 2KJXA 3OMCA 3FUXA 2CFOA 3K9OA 1EYCA 3BS1A 4LUZA 5IIFA 1QAMA 2KHHA 1CHPD 1W6JA 4DV2L 3S1RH 3H3VI 2EE1A 4KKUA 1KYIA 2PI2A 1BO0A 3KSXA 3L7ZC 1FJGQ 1NY5A 2ZAMA 2F5OA 4CJ1B 3D4RA 3I72A 1HPCA 1YJNA 2QBYA 3A54A 5IREB 4YIJA 3F8TA 4O0AA 3PIP3 2B63B 1HR0M 1N33L 4M8AA 1WTVA 3AFHA 3CHBD 3EROA 2H5XA 1SNDA 2KHSA 2C35B 1STBA 4H7BA 2K5DA 2Y0TA 5EXTA 2OQKA 5JEAG 2DZLA 1P16A 3A5ZB 2YQZA 3SAVA 3SR1A 2JUJA 1D5ZC 5CBAE 2BA0A 1A2TA 3K5NA 2VQEM 3G6EA 4DV2Q 5FJ8H 4GKJL 3J80S 3GLGA 4OW0A 1O78A 4PZ8A 1IY1A 1A63A 4C3JB 4ME5A 2XGNA 2L7IA 3DWAA 1Q3CA 2EY2A 1Q7YC 3I2ZA 3GPYA 1V43A 3I55A 4DR7M 4DK0A 3O13A 3PXGA 4CJ6A 5FLXc 2XWJB 1N33Q 4JI5L 2D0PA 4B3ML 3FUUA 2G9DA 4AZFA 3ZYYX 4BA1I 4B3RL 1EEID 3CCQA 1VQPA 1KAAA 1WVLA 5F3WA 4GNXB 3CCRA 4QNMA 2MGSA 3THGA 3L9AX 4F87A 2HHHM 1L2FA 3S2HH 1Z47A 1TQOA 3ND8A 3FHWA 1I6VC 1UE5A 2B2TC 4GKJQ 3ZQJA 5DEHA 4MM3B 3HHZA 5KNCA 3NTIA 1G91A 3MAQA 2F0DA 1SMYC 1ZQ9A 3TQSA 4QHSA 5C18A 4FF1A 3KDFA 2SOBA 1QE6A 4TRDA 1Y8PB 1V92A 1QILA 5E4XA 4YY3L 4IBGA 4BBAA 2Z4IA 2Y0SE 1VQMA 2EVBA 3J7AV 1OXUA 5DLQE 2FJ2A 1N75A 3KLSX 4L5TA 1AE3A 4B3RQ 2J7NA 4B7GA 2E2IB 2DN8A 3NE5B 3NHHA 5JJKA 4DUYM 5FSWA 2VUMG 2D0OA 1SE8A 2FNAA 3Q24A 4OO1G 1Z5BA 2ZXPA 3W2DA 5IYCG 3G4SA 4XT3B 2KVMA 4NSOB 4D82A 4IFDH 4BXXG 2DXIA 2OF1A 3CCLA 2KQ3A 4YY3Q 1DOKA 3WHKA 2C98A 2JA5G 4NOOB 2NN6H 2DKLA 3H15A 2X6GA 2WV6D 4KHPM 4ABNA 4K2LA 4EVOA 1NNXA 3SK8A 1QVFA 3S16B 1TH2A 3M6AA 2L6OA 2CP8A 5IGGA 2J5YA 1PYWD 3DUZA 1V8QA 1LTAD 3AQQA 5H37D 1VQ7A 1GL7A 2LH0A 2R6GA 1V34A 2CW0D 4B7FA 2CV2A 2XSCA 3RMHA 3EBEA 1BKBA 1X3PA 1XNRL 1ONLA 3TMEA 3ICEA 3JC66 5ITRA 5EQ0A 4XYOA 1JE5A 1E94E 2FXQA 2NB0A 3BDCA 3BYTB 4IN3A 4R8IA 1K9MC 4BY7B 1GXDC 3CQZB 4BY1B 1WCMG 5DAUA 5M5WH 4R1JA 5M3MH 3ND9A 3FKEA 4GOPC 4G4QA 3SBJA 3T1HQ 1B53A 3L2PA 2E5LL 2OTJA 1M1KC 2JA7B 4RGOS 1Y69U 3ERSX 2OT2A 1PHJA 5GROA 3HP3A 2DGYA 2IW3A 3VR2A 3Q23A 1PH8A 4ZRZA 2KHJA 1CKMA 1L1OB 1QANA 1M4VA 4X6AH 4HEOA 1FYCA 1SDFA 3N52A 4ID6A 3K9PA 2K1BA 4MN3A 5IT9c 5IYDG 2IHFA 4MTKA 4IUNA 4LJ8A 1TWGB 1X3FA 4WJWA 3A0JA 1I4PA 3ER0A 5DM73 4BBSH 1HQMC 2WFWA 3TBIB 2Z6BA 4QUFA 4LF8M 2R3ZA 4RCOA 3C58A 2Q2TA 3K5OA 2E5LQ 4C3HB 1EZ6A 2ZM6L 3U9SA 3E9SA 2JZ0A 3SYKA 1WTWA 4LRSA 1U4PA 2A19A 3A7LA 1MU5A 3WDNA 5I2YA 3GTMB 3PO2H 3FKIB 3HOXH 1WIVA 5IYBG 4OEMB 4HLQA 4ME3A 5M3FH 1N77A 2Z9HA 3D8BA 2ATWA 3L25A 1LV9A 2ZXRA 1I5FA 1KLGD 3MHVC 5EQTA 4JI1M 4K8JA 1B2TA 3S2DB 4QHTA 2DY8A 4DAVA 1PH9A 3K7UC 4B3SM 4LJ5A 3HHYA 2DNCA 4CDEC 2WAQG 4JYAL 1EY9A 3A74A 4PQXA 1N8RC 5ITQA 4DAPA 2L4EA 4FWHA 1QJOA 1OFHA 2IPKD 4K5WA 1U5KA 2ZM6Q 2Q8TA 1DGBA 4DV4L 3J80E 2JQOA 4X62M 4F2LA 3GO5A 4JBWA 1EEFD 4P72A 1RODA 4U68A 1VQ4A 2PQAB 3CD6A 4PG3A 4B9XA 4IJHA 3GO8A 2F3WA 4H13C 3W1GA 1NHGC 1VQDA 5FLMH 4DU9A 1CZGA 4CHTB 2KEBA 1YBYA 2KEEA 1IW7D 4DBGB 3RGPA 2WZJA 2EYJA 5CMDA 4Z6YA 3U61B 3H09A 1QAQA 3GLHB 1SYBA 2DWZB 3HKZB 4JYAQ 2UUCL 1EQQA 4NL4H 1MSGA 2C5RA 1CTMA 4DR4M 2LFNA 2E76C 2ZTEA 3OW2A 4DR6L 2B8GA 2EYFA 4P73A 3SEBA 1QZHA 1HNZL 2RCFA 1G51A 1GHKA 3KOYE 4POGA 4D80A 4A3LG 3T1YM 3ILKA 1B3AA 1K3XA 3A98B 5KO3A 3GTGH 2MUYA 4G4RA 4KLNA 2R93B 3F2BA 2Y21A 1I3QB 3GV3A 2BNKA 3PIPA 4IBKA 2K03A 5M5XB 5NUCA 1N34M 4LFBQ 2UU9M 4GLVB 5CV4A 1BNZA 2JA8B 1VDZA 3VR6A 2PZUA 1A3UA 1SFOB 2NZ1D 2X69A 3U6DA 4IBJA 2UUCQ 3NEMA 4A3KB 5EXPA 1K82A 3QR8A 2K52A 3TP6A 1D7QA 4DR6Q 1IXSB 5FJ8G 2BWBA 1ZYRC 3VK8A 3F92A 3CCJA 3UDGA 1HNZQ 1EFWA 2K6BA 5K36H 1TTEA 1G8PA 4I5SA 5JVH3 2BWEA 2E2IH 2N35A 2MH8A 1PH7A 2R18A 2RGHA 3BVMA 1C48A 4RGNA 4A3FH 2D7HA 3K81C 1KRSA 4Y7NB 1R7RA 3SGIA 4LFAQ 1HNWL 1XXHE 5BN3A 4X65M 3QG1A 4RGMA 2ALYB 4GC5A 2QEJC 1Y8OB 1TIID 2B2TA 3D4WA 3MTSA 1IBLM 2EXZA 2PYKA 1RF2D 4CGYB 4HJ5A 1PM5A 2BCOA 1CQFA 2RVLA 3U6MA 1TVXA 1AEXA 2EJMA 3MEFA 4OVZB 1XNQQ 4GKKQ 5CV5A 3P75A 1XMOM 2F4IA 3EA6A 1GVPA 1RD9D 5DNFA 3S16H 1TWFH 1WR1B 2PI2E 2KA6B 2K04A 3C3DA 3J27B 3S9WA 1EIGA 5FLXL 4IBCA 2PZWA 2SEBD 4L63B 5CYUA 3LWEA 1IBML 4DR2M 2XLJA 2K7VA 1OXSC 1MGSA 1HNWQ 1ZMVA 1J5EM 2XFSA 4JI4L 3TN2A 4OO1I 1EWHA 1SE3A 1LTSD 3L3OC 1MX0A 5C4JH 2A69D 1T5EA 4O42A 1SXJB 1B44D 3C1EA 1HZCA 2APLA 3R2TA 4ANRA 2R7ZH 3B7ZA 1TDHA 4JG2A 3FRHA 3M7NA 4IFDG 1F9SA 1EU3A 4Z9CB 1QOHA 3D31A 1NNJA 4JI6M 5K5PA 3CCMA 2QENA 3MFGA 1UWVA 3A55A 4YCUA 2NN6G 3Q6SA 2L15A 1T5XD 3E9IA 1IBMQ 3T6PA 1VQKA 1XTDA 8CATA 1LO5D 1X55A 2F0MA 2WACA 1SYEA 4JI4Q 4P16A 4JC0A 4LGYA 1GO5A 3ZH9B 4AKIA 4JI3L 2WINB 3HOWH 1ZEQX 3M4YA 1JC7A 1LTRD 3HS0C 1W3SA 4C3HH 1EQRA 3I90A 3VR5A 4ZKCB 2EIFA 3VA7A 1Y1VB 4GOPA 5JI3E 1W5TA 1NMGA 1QNKA 3LQQA 5IGCA 5M3MG 3DEPA 3UGJA 1CSPA 2F3VA 4DR3L 5E3FA 2L4FA 1NE3A 1STYA 2R46A 1EUJA 1SBBB 2KCCA 2QW7A 5ELFA 2EZVA 3HOZH 5M9OA 5FOBB 1VQEA 3S15B 4UHVA 5C0XG 1EL0A 1FGBD 4IBFA 2DUDA 4JI3Q 3FUTA 2EYOA 1FJGM 1GUNA 2AQ3B 4NW2A 1WXQA 1E32A 4OWTB 3CF0A 4OWWB 4A3IB 1YZ6A 3H91A 4DAYA 2MP1A 4KO8A 4BBSG 1R5LA 2BH8A 3CCUA 1PTOD 4K6LA 4LMQD 3U4VA 1DONA 1D5MC 5EXSA 3Q8GA 1D1KA 1VQ8A 4RNAA 1KSFX 2KCTA 2DZOB 1DV0A 2NZOA 2LSSA 1IKLA 3HKPA 3CF5A 3E5SA 3PO2G 4LF7M 5M3FG 1PFBA 4BBRB 3EJIA 3JAMi 2CKZB 3CC7A 2EDGA 4JVZA 1C1KA 5CGKA 2P5ZX 4GZYC 4DR1L 4JXJA 1WI5A 4P71A 1CK1A 5ELCA 4IPDA 2ZAOA 3GRVA 4KJNA 2M5ZA 3HGIA 5EP3A 5IT9L 2F03A 1NV8A 1HRJA 3KVWA 3MXNB 1F9RA 3PGZA 4B3TL 1N33M 1VQJA 5LHY1 2Y0SB 2GVBA 5FK9C 3K5LA 1X3EA 2WB1G 4R4TA 4KD4A 1QNUA 3K0YA 2KZSA 4OIJA 4IIWA 2CWAA 4LF5L 4OU7A 1I3QH 2L11A 4CIZA 1E3PA 2OCEA 5M5XH 1PJQA 1Z9FA 5E6JA 2Q8RE 4JI2M 3S17H 3EIEA 4QNRA 3J81E 2AWOA 2YTVA 4P2CB 2RHQB 4DV6M 2EY5A 1Q39A 3VKHA 1QUSA 2ICEC 1D2BA 1TH4A 5E26A 2NVYB 4HR7B 4DR1Q 4A3KH 3OHXC 5BN5A 1KNEA 2D2CC 1A3TA 3R93A 1SG9A 2GN5A 3N6RA 5G3LD 2R4EA 1ASYA 1ILQA 4B3TQ 4X66L 1YNND 1PJTA 2QILA 5C3WA 3B74A 4LF5Q 1J7KA 4N9PA 4REZA 5DNYA 4Y7NH 3KF8A 5GAHC 4OX9L 1ICFB 2VZAA 4FD2A 4Q7JA 4GC9A 4R3DA 3A7AB 4N8FA 1O7YA 5C3EB 1WTRA 1K8GA 1IXZA 2E74C 3K59A 4A3CG 5IY0A 2XEPA 4E6IA 2R45A 1EY4A 1I4HA 5A2QL 5EJCA 2H1RA 3QIAA 1PXUA 3HU2A 1E0BA 4L6V6 2XSZD 1FD7D 4KT0F 3U6QA 5IGBA 4X66Q 4RMFA 2F0KA 2KUMA 3HOUH 1LUZA 1JQJC 1E9SA 4OX9Q 4JOIC 5T1IA 3TP5A 2LY7A 5K36G 3FTCA 1K0RA 2D62A 3HY5A 1E2WA 4EIWA 4HTHA 1I94M 1R4GA 2DWLA 5J3BA 2F3IA 4KN4C 5KNBA 5EPKA 4A3FG 4NC6A 4MGZE 1GVNA 2FFJA 1WTQA 1VQ6A 5KPTA 5FKAC 1VQ5A 3T1HM 2Z4RA 4FYDA 4NRWA 2HIVA 3MXGA 4JCVE 4QB4A 3UMMA 4FF3A 1TY0A 4NP5A 1HA6A 1NHWC 3W3AA 3DMUA 3PMFA 1H9MA 4LFBL 4V0BA 1QWYA 1I4XA 3I4NG 3ULPA 4RFBA 2IX1A 3I4VA 2Z8YM 5IGFA 2E2JB 1LT6D 4AQYL 2OPFA 1I4RA 1S4ZA 2CW0C 2L55A 5LL6X 4MIUA 5ITYA 2MNAA 2BDNA 2WSCF 1XX8A 3D0FA 2LBCA 1EFID 3Q0AA 4I8OA 3X3MA 4ULLA 2YU9H 1RKNA 3TWKA 4PDGA 2R92G 2Y20A 3K58A 1NY6A 1Y1VH 4UPAA 4IFDI 5LMUL 1IHZA 3BVGA 2R7ZG 1SJED 3A5UA 3AOGA 3UDFA 2GNOA 4K5XA 3GP7A 4I7AA 2ZT9C 2YYZA 3KF6B 3K7AB 4HSPA 2NN6I 4X3UA 4IBEA 3ZC7B 3CC2A 1L2DA 1IQPA 2OO9A 2XZUA 1Q1EA 2OEOA 1ZAEA 3S14H 4PMCA 3PO3H 1IN5A 3S15H 4AQYQ 1G71A 1VQ1A 3DFZA 3BZKA 4JBMA 4K0KL 1RTNA 1KXLA 3ULJA 5L8RF 3D4DA 1Q81C 5ELDA 2V1CC 3EQLC 1PV4A 4AG6A 3X3NA 3GTQB 3SMSA 4LZZA 2R7DA 2ZM6M 3DHQA 3IG8A 1QQWA 3HOWG 1IBKM 3W1BA 2PPBC 3M9BA 2V1UA 1OIZA 2K75A 4C3HG 4FNFA 4XGIA 1BOSA 1M8AA 3I51A 4A3BB 2K0BX 5DFLA 5EP2A 4A3MH 2JNHA 2VDBB 4K0KQ 3VFDA 4JK1C 1DXMA 4A75A 1PTOH 4ZQ3A 4OWXB 3U5ZA 1L8QA 3VYRA 2EQSA 4YWKA 5C0XI 3LVWA 3U50C 1B50A 3TSSA 3K92A 3HOZG 4A3JB 1MHWC 1IKMA 3SAUA 3TP8A 4NXML 1OFIA 2JN4A 1HHVA 3SASA 3KBXA 5CR3A 3OIQA 4KTAA 1DO2A 1K3BC 1PLFA 3CF2A 2EJFC 2VF8A 1CUKA 4XYQA 4QMGA 3SARA 1Y1WH 3CCSA 3QOJA 2GQFA 2KCNA 5JOBA 3PUXA 1VF5C 2KEDA 4GNXC 2OOAA 3RLOA 1UNSA 4HJ8A 3LQRA 1VQCA 5FO7B 3T15A 4LFBM 5FTNA 1GOZA 2NVYH 1JR3A 4LG2A 3P20A 4ODGA 4LJ6A 4HCSA 2ENBA 2HQLA 2FMCA 1XXHB 4YWMA 4DF7A 4I81A 2WKDA 3F2DA 3HJ8A 2QP9X 3KUPA 1IW7C 3I4OA 3J7YW 4A3EH 4NXMQ 1PH2A 3CGWA 2SNSA 3MC0B 1NJFA 1P3QQ 4RGTA 1NO1A 2HDLA 2QDLA 5C5MA 3HU1A 2VQFQ 1B8AA 2JWSA 1PDQA 3I7FA 1JE4A 4XQJA 1I6HH 1OO9B 2PW7A 5KEEA 3NBIA 4LF9L 1UFZA 2A74C 2QBYB 4LFAM 1RL2A 3S1MH 1BR9A 3L26A 2D5DA 3TDQA 1OTRA 2VF7A 4XK8F 2JY8A 1VQOA 5M5YH 1TWHH 2F0EA 1ZKOA 1A5TA 3GTLB 1CT1D 3TRZA 2Y0QA 4IJFA 4GKKM 5CV6A 3PIOA 1XNQM 2UUBL 1STGA 4L16A 2XN9C 3FRPB 3CCEA 4KMUC 3AFQA 3GLGB 1C4QA 3NK9A 1C0AA 1SYGA 1RDPD 3VYUA 3J81j 4ZAIA 3TP7A 4LF9Q 4MGYE 2CEAA 4IQZA 3FPPA 3R8FA 3HG9A 1FVIA 1F9QA 2F1MA 2MQHA 1Z5CA 3L29A 3U60B 1Q46A 1B4OA 1PA6A 3QYEA 3V76A 4QF4A 4PT5A 1LTTD 3VYTA 4EQPA 2JA9A 5JI2E 1Q3LA 1CSQA 1OQYA 4JI5Q 2UUBQ 5C6AA 1Q8KA 4B3MQ 2JK8A 5KQ8A 1D6EC 2R62A 2LMCB 2WAQE 3NTHA 1G3IA 2HCIA 4G7OC 3E21A 2ID0A 4OONA 4LK1C 2AQ1B 1N36M 3KP1E 2RDFA 1O7IA 2JP7A 1SYFA 1XTCD 4IUQA 3HOVB 2NVXB 1D2NA 1RHPA 3R8BA 1JJ2A 1KDAA 2EKFA 4HJAA 2XIWA 3PF4A 3I91A 1KDBA 3KDFB 3G7LA 3LMMA 3KK7A 2RF4A 3HOUG 4RKLA 3J7AF 1U4LA 2KENA 4JOIA 3AMUA 2KCMA 1HTPA 1IFYA 3J7BA 4JI4M 2W82A 4IBIA 3J80c 4WRDA 1BF4A 2B2VC 2ICIA 4IJLA 1JJGA 3I3CA 4B08A 1G8ZD 3T38A 4DK3C 3HRZC 1O7LA 3MJ5A 1B3QA 2A69C 2L5TA 2O5RA 4R4CA 4DV3M 5IT9S 5ELEA 4C2MB 2YFQA 4LY6A 4DK6C 3K57A 3HFZB 4ZKBB 1TF0B 2XF3A 5ITXA 3K8ZA 2RSNA 1NJIC 1E1OA 3K7AH 2L2DA 5HY6A 1SE2A 4QCLA 4PMWA 2AWNA 1RCVD 2M9VA 1L2CA 3FTFA 1LTBD 2LWXA 5FO9B 1H9SA 1B1ZA 5T1GA 3AEVA 1KRTA 4A3DB 2F5NA
chains in the Genus database with same CATH topology
1T3TA 3E6ZX 1NNUC 1OXXK 4PMBA 3G6JB 4C3IB 4JI0M 2PNRC 5CC4A 1ENCA 1JORA 1O80A 4G4OA 3RZOB 1Z7TA 3CU7A 4OIKA 5D65A 3P7JA 2P5TA 4FCTA 3K2LA 1HXYD 5ITUA 1NR2A 4FXDA 3OPOA 3QWLA 5EPLA 1STNA 2X49A 2E75C 1E2ZA 3RD4A 1I50B 1Q90A 3I4MB 2RDGA 2V1CA 3JR4A 3OSOA 3E0JA 4DGZA 5A2QS 2NBFA 1L2BA 3HOYB 3AOEC 4G7HC 3VLFB 3WOEA 2Q8IB 4QUCA 1TS3A 1YNJD 4A3GB 2F0JA 2SDFA 1PTOC 2XRQD 3A8IE 2NQ8C 5GKNA 2RA4A 1E9RA 5C4XB 2ZBKB 5I6WA 1LTGD 4GITA 2KA7A 4MHEA 4DR1M 1MI2A 1R2ZA 3NQIA 1ENAA 3BZDB 1S3SA 2C9OA 4B3TM 1N78A 4AI6A 3AL0C 2JA6B 2E2HB 1F77A 1X37A 4LRTA 3S1QB 4LF5M 4FF4A 1SNCA 2I07B 2H1EA 1BCPD 1PZID 1YSYA 4RA8A 1Z59A 4DN4M 2QCUA 1XWIA 2A73B 2L09A 1PRTB 1BCPB 1R2YA 5CV9A 4NRVA 2Z7JA 3MEHA 4UAIA 3SK5A 4X66M 2HDMA 1HA5A 1S5DD 3VA5A 1YNNC 1LV7A 2HCCA 4Q5VA 5JPNC 2F5PA 4L4UA 3KFUG 4M9XA 4TKOB 1Z5AA 3FDTA 2QF7A 1STHA 1KDCA 2F0TA 2Z4SA 5CORA 2RGOA 1WTOA 2FHTA 3GP1A 4FP5D 5BN4A 3M85A 2A6HD 3U9OA 2O5JC 1DD2A 3D8GA 4S12A 3NQTA 3VDPA 4I65A 1FR3A 3LWUA 1TY2A 4KV6A 2BOSA 3L28A 2FMMA 4DFAA 3KLRA 3K5MA 2J7ZA 4KKTA 1XHBA 1EYDA 3KOZE 2FFKB 1PRTF 1BCPF 3W0FA 3KOWE 3Q8XA 1DYQA 1MD2D 2F0FA 2YR0A 3DXJC 4MGIE 1LTID 1SJHD 3JAMS 2KZUA 5I2XA 2EYPA 2VB2X 2I46A 4B7HA 2EYLA 1SXJD 2A5YB 2Q2EB 1HT1E 1G41A 4GHLA 3R2IA 4DUZM 2G8LA 1GL6A 3QOLA 4M1UB 1TWAB 4WURA 4KY6A 3D3RA 3HEJA 1PFNA 3HZXA 2KRKA 5ELBA 3FTDA 2V4DA 4IALA 4L6TB 3CRKC 3NTKA 1I4GA 3PV0A 2B2VA 1F2LA 3H4MA 1U4MA 2F0WA 1VCIA 1HNXM 3DWQA 5EGTA 1TWCB 2M2LA 2JA5B 3EIHA 1STAA 1IN8A 3DEOA 2AHMA 2NYZD 3MHBA 1Z6TA 3MFYA 4BA2I 4AKHA 3I73A 1QAOA 2K32A 3A56A 4DK1A 4ZUJA 4UDUC 3QAUA 3J80L 1NSFA 5ITTA 1WCMB 2F5SA 3URYA 3GQ4A 4DV1M 4LGMA 4N9TA 2PW5A 3BDOA 2EY6A 3LVVA 2QPAA 3FEWX 3U6EA 4QOSA 1QZMA 4F7XA 1R4QB 4C1NI 4G4KA 4LJ7A 2F0VA 1CQVA 3D8LA 3GLFA 3KW6A 4WW0A 2J4XA 5C0XJ 2VQFM 3PUZA 3AOEA 3KXEC 5EJWA 1CFMA 2CV0A 3ZCBB 3C2PA 1EY6A 2B39A 5JVG3 1IN7A 4DV2M 2DNEA 2BE5D 1LT4D 2F0HA 2RBMA 3M4OB 2RKOA 1LLRD 2A6ED 5ITXE 5EKKA 4PD2A 2D9UA 4KODA 1HCZA 1TU2B 2H4OA 4BLCA 2R4JA 4FF2A 3VR4A 4RKBA 1V1OA 4BB9A 2WAQB 2XZFA 4X3SA 3SHLA 1HQYE 2FINB 5FTLA 2JXMB 4EQNA 4KI0A 1I4QA 2JP1A 1JOOA 3SFZA 3C46A 5KPZA 1JWSD 4GKJM 1XC8A 3GTPB 3PUYA 3EFXD 1IN4A 2LKVA 3HWSA 4FXGC 3I4YA 3KP0E 5KQDA 2EY1A 4C3JG 2F0QA 2A68C 1V1PA 4JI5M 1NR4A 4B3MM 2TMPA 2LNHC 1Q3BA 4B3RM 2R61A 3D6WA 3BG3A 4AKGA 2K5QA 4NKLA 4NSRA 2AUKA 2BA1A 3S1RB 1DJRD 4PNYA 2YNMD 4L78A 3J2PB 1SYCA 1TS2A 1CA6A 3JAME 1FNVA 3PVSA 1LT5D 4C1NK 2K28A 3RE8A 4FWDA 1IXRC 4RF0A 3TWMA 4U673 5FTKA 2RKSA 4YY3M 4IUUA 1RJTA 1G2TA 3VDUA 1HTLD 5HURA 5EP1A 2NVTB 1PZJD 2JEBI 3Q22A 2LS01 3DWPA 2XSZA 5J39A 3NP8A 3FMCA 4KJOA 5DYGA 1HQRD 2C99A 2B2YC 1S5BD 5DYIA 3CTWB 1EOTA 4HAEA 4MGHA 4G4NA 4XBOA 3C1FA 3KOXE 2F0GA 5CV8A 2K01A 4GHAA 1SNQA 3OWFA 3S2HB 1ET9A 2OQ4A 1H9JA 4F8MA 2IL8A 4XIGS 2OXPA 1JWMD 4DA2A 1XNRM 1FNWA 2EO2A 2WIIB 1TS4A 4A93B 1B9MA 4RHRA 1DGHA 3A45A 5FTMA 4KK7A 2E5LM 4CJ0B 4CISA 2RQXA 4K5VA 2N88A 2ERCA 3GRYA 3EVQA 4M0DA 4WFN3 1EY5A 3WOFA 4JI8M 3E4RA 3SVMA 1YE9A 5EKLA 4A3VB 4IZ8A 4AG5A 5KYIA 1FNNA 1TR5A 2MPMA 4XQQA 3GLIA 5CV7A 1A15A 5C5LA 1PZKD 4RHSA 3NWSA 4BS9A 1L0XB 2QCPX 2PO4A 5EKIA 1NSNS 4HCEA 3KSJA 4JI7M 4XT1B 5IWAM 3J81L 3NWTA 4RCNA 5M5WB 1S5CD 1MBYA 1U9RA 3T56B 1KNAA 1YNJC 1J09A 4JYAM 1ZXTA 1HFGA 2VNUD 3QO2A 3RZDB 3NWLA 3GPXA 5D3IB 1DOLA 3FPUB 3D6CA 2DHRA 1SNMA 4Q0FA 4DV4M 3MVVA 2X8AA 2MJ8A 4EGVA 2KXEA 3T16A 1Q8IA 3SXHA 3U5ZB 3U6PA 2I7NA 1E2VA 3V2TA 3GQ3A 2F0IA 2UXCM 4WORA 5FLXS 1BXTA 2C9CA 2IX0A 3MZ5A 1KTKA 4BBSB 1EY0A 5I6YA 1ML0D 1W6KA 3HHXA 2UUCM 1BCPC 4CKEA 4IUPA 1TGUA 3GTKB 4CKCA 4DR6M 5M3FB 3SAWA 1HNZM 4FXKC 2DWNA 2I7PA 2C96A 3OIPA 1GUWA 1VF7A 2X6LA 3P1HA 3VYSA 4M9SA 3GD7A 2A5HA 5A35A 2BJWA 4XTCS 2WB1B 2A68D 3KBGA 4LJZC 1ILPA 5IGEA 4OGQC 5JEAJ 4KY5A 2IWHA 5JPMC 1K8OA 4DXGA 1HUMA 3KS8A 3BOSA 4EQOA 1SXTA 4HSVA 3GPUA 2R65A 3DOAA 2IJ0A 1DZ1A 3L2AA 5C1BA 5EP4A 2F5QA 2PCFB 4HMIA 1XWEA 4FWGA 2A6HC 1OXVA 1GKIA 1SSOA 1HNWM 3AJIB 1XYIA 3QJYA 2B2UC 1JB3A 1MSHA 3MXPA 1WD1A 3U60A 4R8NA 3T13A 2E2DC 1F2YA 3UK6A 5BR8M 4D81A 3GTGB 3GRRA 1AZQA 1F2ZA 1EQTA 1SE4A 5JAVA 3PUWA 2F0OA 1IL8A 1IBMM 3FYCA 3SC3A 1SXJC 2B8FA 1J9OA 5COYA 1F9PA 2SNMA 2B2YA 2VB3X 2HKJA 5D14A 1NAPA 2K5WA 4A3FB 2Z4HA 1JWUD 4LJAA 2G9HD 3PFIA 1OJLA 4HN7A 2M60A 3HJQA 4KY7A 3LNNA 5C44B 1Q1BA 1G6ZA 5LMNM 2F0SA 2L9HA 1ET6A 4JI3M 2MHVA 3I4NB 1ORYB 3FUVA 1TWFB 5AFWA 1CI3M 2LXEA 5JJZA 4YHHM 1EWCA 4LJ4A 2ZXOA 1IYVA 4DR3M 1N32M 1H9SB 2R92B 5C4JB 5C4HA 4GH9A 2DVWB 1IYUA 4QIWB 2R7ZB 3UJNA 3I4LA 2DZNB 3HJSA 2B2WC 4R9WA 1DO0A 2WP8J 3J7AS 4RH6A 1ICWA 1D5XC 5C0XH 4V190 1STEA 5FLXE 3UI2A 5IGDA 3H0GB 2JYOA 3MXUA 2O4XA 5KPRA 4DV7M 1GUSA 2CUZA 1BUVT 3SDZA 1GUGA 3GTJB 2NUCA 1A3VA 3GPPA 2Z1CA 3GTOB 3IAYA 5KRUA 3HOWB 3NBHA 5EBCA 1ESRA 2L0CA 4OHJA 1PJIA 3NSWA 2BE5C 5LL6S 2A6EC 3UZUA 3SK4A 2JEAI 1UAPA 1RTOA 1AFPA 3M3YB 3HOZB 3S1NB 1ESFA 1GLNA 2D7EA 2AQ2B 3BYYB 5KNDA 1AZPA 1II3A 1PRTD 4CBVA 1G59A 4IUTA 3U61A 2QDBA 1L1ZA 3GLHA 2D7GA 2AUJD 1NJGA 2IX3A 3FTEA 2F0UA 3H94A 3I70A 4TSSA 2RSOA 2PMZB 5KYLA 1HFNA 3AU7A 3OOCA 2XRSD 3KLSA 4QOZC 3TPZA 4XDXA 3BDLA 1SNOA 2L12A 4OX9M 4I4LA 2QKIC 2VXWA 1UM8A 3U6CA 3CRLC 2NTTA 1ENFA 1IY2A 1SYDA 4K8IA 1TS5A 2QZ4A 5DM63 4FW9A 2XVSA 5D3DA 3FUWA 2CV1A 4K2KA 2IT1A 1Y8NB 4GRIA 3SMPA 3S17B 1PFMA 4G57A 1DM0B 3F2UA 1GJXA 1DGFA 3C3LA 1H9RA 3FD9A 1UEAB 2L1BA 3J81S 4HMJA 5IT9E 3CF6E 1CZWA 1TDZA 1WTPA 2JE6I 2B2UA 2HL7A 3KDSE 4KKSA 5J1ZA 1EYAA 4X3TA 4OVZA 1FNUA 3PUVA 1SMYD 2K05A 1WD0A 5C3XA 3OMGA 4ILWA 1TH3A 3SK6A 2Z8LA 2KECA 1NCVA 1J8IA 2XH9A 3LX0A 2EA0A 1EU4A 2XWBB 4HEDA 1IM2A 5TSSA 2XFTA 3SHGB 4L8JA 3HGBA 4AQYM 2VUMB 3R9XB 2EYMA 1SXJA 2XNAC 4PCZA 4KN7C 3U6OA 5C4ZA 3HOUB 3FVQA 1KABA 1I4WA 4G6ZA 4X64M 1QG7A 5EBDA 2NTSA 3AB9A 5LMUM 4C56C 2M00A 3NUCA 4ZUIA 2EYHA 4H44C 3VKGA 4J6HA 4IFDJ 3L27A 4B9WA 5A2QE 4K0KM 1JICA 1QB5D 4I7ZC 1OXTA 1K3WA 4TUWA 2CE7A 3VK7A 1H9KA 4JN6A 1WTXA 1C8CA 4ITQA 3H6MA 4PV1C 1VMCA 2X4AA 3RGSA 4ZYSA 4MGKE 1JR0D 4RAUC 3SHFA 3A8JE 4M9ZA 2DY7A 3GRUA 3V05A 1G291 3U6SA 1K83B 3A8KE 3I8ZA 2EJGC 2F0NA 1W5SA 2F4VM 1R4PB 2WKCA 2CHBD 2PZTA 5KIXA 4CJ2C 1EQVA 3M7GA 2YU9B 5HGTA 3OTOM 2L7HA 2B2WA 2HQEA 4NXMM 3GQBA 1JQYD 1BBXC 1EZ8A 1AW7A 1DOMA 5FTJA 3S14B 3PO3B 4ZPXA 2NVQB 5E1FA 2GA4B 3CKIB 2EUCA 1PMRA 2F0LA 2J7OA 3FYDA 3QB3A 5E4WC 4KD3A 1BDOA 3T4AC 3GLFB 4J8QA 3K1JA 1AN8A 3AKZA 3R3OA 3H3VC 4X3KA 3GV6A 1L1TA 1IY0A 3RFWA 3VR3A 2CHVA 4Z8XA 1G2SA 3MXNA 1QVRA 4ZLTF 2G5GX 1EIHA 1R9TB 3SYLA 1LABA 4A3MB 1CHQD 1PTOB 3MK6A 3TZDA 4IBBA 1KFVA 4LF9M 3GQ5A 1HQCA 3DA1A 2KOLA 5JEAH 1HT2E 4RF1A 1YUBA 2ZANA 1S5FD 1GUOA 3IG5A 2KW0A 4FCWA 3HHWA 5BPVA 3DM1A 3OW7A 4NDXA 1CM9A 2UUBM 4L15A 1Y1WB 5IZ7D 1H6UA 3SATA 3PIO3 4DV0M 5CBEE 4CKBA 4LAAA 4MB7A 3K6OA 3B9PA 1HUNA 5EXXA 4F88A 1SNPA 1V1PB 1JOKA 3IL8A 2RDHA 4A3EB 3RUZA 4O1NA 2HUGA 4ZK9B 2N55A 1AP0A 4IJEA 1VDDA 4K6DA 4H0LC 4DNTB 5FO8B 2EPBA 4TQUS 1O7ZA 1PTOF 4OL7A 1QYRA 2FE8A 1I6HB 4HL4A 3JR5A 2JA2A 4RWSC 4DXFA 3OWEB 1X32A 3TWLA 2K33A 4IBDA 4XXEA 1ZYRD 3S1MB 4W5WA 5KGUA 1Q12A 5M5YB 1TWHB 3M0EA 3WHLA 1F2MA 1D1IA 3PNVA 2JSOA 2BJVA 5I4DA 4G7ZC 3T51B 2PQEA 5ISRA 4OO1H 3TE6A 5I9PA 2TSSA 1JCKB 4XQNA 2CHQA 2UXDM 4KHVA 4AYBB 1IN6A 3A42A 4MH0E 5F2DA 1DGGA 4DNRB 1TKWB 4R7GA 2NWGA 2CVRA 4M0WA 3IFTA 1K8MA 3PNYA 5G3LF 4FVMA 2KRUA 3MA2B 3IKJA 4IURA 1CA5A 2DWMA 2CQAA 4LJ9A 2L4NA 4S3SA 5J22A 1BQQT 2HCBA 3SE0A 1LACA 2BDOA 4BWGB 4LCBA 4C3IG 1QCBD 3T53B 1SEBD 1G4AE 4LFCM 1KLUD 2K47A 1UUPA 5EPJA 5IOCA 1LT3D 3AV0A 1DGHB 1XMQM 2UXBM 4JV5M 5I9OA 2F0PA 4GIPA 2K6AA 1JOQA 5IODA 3NPPA 3W0LB 1GUTA 4AW4A 3ITPA 1EY7A 4LF4M 3IFDA 3KS4A 2V6ZM 4PDIA 4KHZA 1VMPA 4FCVA 3GLIB 2UUAM 4NMZA 4II7A 4NXNM 3BVZA 3MWYW 1EY8A 4DR5M 4DV5M 1Z6HA 4IUVA 5M3MB 1U4RA 1NUCA 4FO2A 1PJJA 1EE8A 2O2LD 3V96A 4K14A 3ONAB 3DZDA 1L0YB 2C5CA 3HU3A 3NXWA 2CHGA 3TL4X 1S5ED 3ERQA 2Z3XA 2FOIC 1SXJE 3U6LA 2O5IC 1B9NA 1XXGA 4LZJA 2VIIA 1R6BX 1DCZA 1X3QA 3QWNA 1TT2A 3JAML 2EOTA 1A2UA 1GHJA 1XXHA 3A46A 1PRTC 2J0TD 3TZUA 1SAPA 1JR3D 3RLFA 3PO2B 7CATA 3HOXB 1NVMA 1A6XA 4L8RC 4GMQA 4LF6M 4J1MA 2KJXA 3OMCA 3FUXA 2CFOA 1EYCA 3BS1A 5IIFA 1QAMA 1CHPD 1W6JA 2EE1A 4KKUA 1KYIA 1BO0A 3KSXA 3L7ZC 1NY5A 2ZAMA 2F5OA 4CJ1B 3D4RA 3I72A 1HPCA 2QBYA 3A54A 5IREB 4YIJA 3PIP3 2B63B 1HR0M 4M8AA 1WTVA 3AFHA 3CHBD 3EROA 1SNDA 2KHSA 1STBA 4H7BA 2K5DA 2Y0TA 5EXTA 5JEAG 3SR1A 2YQZA 3SAVA 5CBAE 1D5ZC 3K5NA 2BA0A 1A2TA 2VQEM 3J80S 3GLGA 4OW0A 1O78A 1IY1A 4C3JB 4ME5A 2XGNA 2L7IA 3DWAA 1Q3CA 2EY2A 3GPYA 1V43A 4DR7M 4DK0A 3O13A 3PXGA 2XWJB 3FUUA 2G9DA 4AZFA 3ZYYX 4BA1I 1EEID 1WVLA 1KAAA 5F3WA 4QNMA 2MGSA 3THGA 3L9AX 4F87A 2HHHM 1Z47A 1TQOA 3ND8A 1I6VC 2B2TC 5DEHA 4MM3B 3HHZA 5KNCA 3NTIA 1G91A 3MAQA 2F0DA 1SMYC 1ZQ9A 3TQSA 4QHSA 5C18A 4FF1A 2SOBA 1QE6A 4TRDA 1Y8PB 5E4XA 1QILA 4IBGA 4BBAA 2Z4IA 3J7AV 2EVBA 1OXUA 2FJ2A 1N75A 3KLSX 2J7NA 4B7GA 2E2IB 2DN8A 3NE5B 3NHHA 4DUYM 5FSWA 2FNAA 3Q24A 4OO1G 1Z5BA 2ZXPA 3W2DA 4XT3B 2KVMA 4NSOB 4D82A 4IFDH 2DXIA 2OF1A 2KQ3A 1DOKA 3WHKA 2C98A 4NOOB 2NN6H 2X6GA 2WV6D 4KHPM 4ABNA 4K2LA 4EVOA 3SK8A 3S16B 1TH2A 3M6AA 2L6OA 5IGGA 1PYWD 3DUZA 1V8QA 1LTAD 5H37D 1GL7A 2LH0A 2R6GA 2CW0D 4B7FA 2CV2A 2XSCA 3RMHA 1X3PA 1ONLA 3TMEA 5ITRA 5EQ0A 4XYOA 2NB0A 1E94E 3BYTB 4IN3A 3BDCA 4R8IA 4BY7B 1GXDC 3CQZB 4BY1B 5DAUA 3ND9A 3FKEA 4G4QA 3SBJA 1B53A 2JA7B 4RGOS 1Y69U 2OT2A 3HP3A 2IW3A 3VR2A 3Q23A 4ZRZA 1QANA 1M4VA 1FYCA 1SDFA 3N52A 4ID6A 2K1BA 4MN3A 4IUNA 4LJ8A 1TWGB 4WJWA 1I4PA 5DM73 1HQMC 3TBIB 4QUFA 4LF8M 2R3ZA 4RCOA 3C58A 3K5OA 4C3HB 1EZ6A 3U9SA 3E9SA 3SYKA 1WTWA 4LRSA 1U4PA 3A7LA 3WDNA 1MU5A 5I2YA 3GTMB 3FKIB 4HLQA 1N77A 3D8BA 3L25A 1LV9A 2ZXRA 1KLGD 3MHVC 5EQTA 4JI1M 4K8JA 1B2TA 3S2DB 4QHTA 2DY8A 4DAVA 4B3SM 4LJ5A 3HHYA 2DNCA 1EY9A 4PQXA 5ITQA 4DAPA 4FWHA 1QJOA 1OFHA 2IPKD 4K5WA 2Q8TA 1DGBA 3J80E 4X62M 4JBWA 3GO5A 1EEFD 1RODA 4U68A 4B9XA 3GO8A 2F3WA 4H13C 1NHGC 4DU9A 4CHTB 1CZGA 2KEBA 2KEEA 1IW7D 3RGPA 2EYJA 5CMDA 4Z6YA 3U61B 3H09A 1QAQA 3GLHB 1SYBA 2DWZB 3HKZB 4NL4H 1MSGA 2C5RA 1CTMA 4DR4M 2LFNA 2E76C 2B8GA 2EYFA 3SEBA 1GHKA 3KOYE 4D80A 3T1YM 3ILKA 1B3AA 1K3XA 3A98B 5KO3A 2MUYA 4G4RA 4KLNA 2R93B 2Y21A 1I3QB 3GV3A 2BNKA 4IBKA 2K03A 5M5XB 5NUCA 1N34M 2UU9M 5CV4A 1BNZA 2JA8B 1VDZA 3VR6A 2PZUA 1A3UA 1SFOB 2NZ1D 2X69A 3U6DA 4IBJA 4A3KB 5EXPA 1K82A 3TP6A 1IXSB 1ZYRC 3VK8A 5K36H 1G8PA 4I5SA 5JVH3 2R18A 2RGHA 3BVMA 1C48A 4RGNA 2D7HA 4Y7NB 1R7RA 5BN3A 4X65M 3QG1A 4RGMA 4GC5A 2QEJC 1Y8OB 1TIID 2B2TA 3D4WA 3MTSA 1IBLM 2EXZA 2PYKA 1RF2D 4CGYB 1PM5A 2BCOA 1CQFA 2RVLA 3U6MA 1TVXA 1AEXA 2EJMA 4OVZB 5CV5A 3P75A 1XMOM 2F4IA 3EA6A 1RD9D 5DNFA 2KA6B 2K04A 3J27B 3S9WA 1EIGA 5FLXL 4IBCA 2PZWA 2SEBD 4L63B 5CYUA 3LWEA 4DR2M 2XLJA 2K7VA 1OXSC 1MGSA 1J5EM 2XFSA 4OO1I 3TN2A 1EWHA 1SE3A 1LTSD 3L3OC 1MX0A 2A69D 1T5EA 4O42A 1SXJB 1B44D 3C1EA 3R2TA 1TDHA 3M7NA 4IFDG 1F9SA 1EU3A 4Z9CB 1QOHA 3D31A 1NNJA 4JI6M 5K5PA 2QENA 3MFGA 3A55A 2NN6G 3Q6SA 1T5XD 8CATA 1LO5D 2WACA 2F0MA 1SYEA 4P16A 4LGYA 3ZH9B 4AKIA 2WINB 1ZEQX 3M4YA 1JC7A 1LTRD 3HS0C 3I90A 3VR5A 4ZKCB 3VA7A 1Y1VB 5JI3E 1W5TA 1QNKA 3LQQA 5IGCA 3DEPA 3UGJA 2F3VA 5E3FA 1STYA 2R46A 1SBBB 2KCCA 5ELFA 2EZVA 5M9OA 5FOBB 3S15B 5C0XG 1EL0A 1FGBD 4IBFA 3FUTA 2EYOA 1FJGM 1GUNA 2AQ3B 4NW2A 1WXQA 1E32A 3CF0A 4A3IB 3H91A 4DAYA 2MP1A 4KO8A 1PTOD 4K6LA 4LMQD 1DONA 1D5MC 5EXSA 1D1KA 4RNAA 1KSFX 2DZOB 1IKLA 3HKPA 3E5SA 4LF7M 1PFBA 4BBRB 3EJIA 2EDGA 1C1KA 5CGKA 4GZYC 4JXJA 1CK1A 5ELCA 2ZAOA 3GRVA 4KJNA 2M5ZA 3HGIA 5EP3A 5IT9L 2F03A 1HRJA 3KVWA 1F9RA 1N33M 5LHY1 2Y0SB 5FK9C 3K5LA 4KD4A 1QNUA 3K0YA 2KZSA 4OIJA 4IIWA 4OU7A 2L11A 2Q8RE 5E6JA 4JI2M 3EIEA 4QNRA 3J81E 2AWOA 4P2CB 4DV6M 2EY5A 1Q39A 3VKHA 2ICEC 1D2BA 1TH4A 5E26A 2NVYB 4HR7B 3OHXC 5BN5A 1KNEA 2D2CC 1A3TA 3R93A 3N6RA 5G3LD 2R4EA 1ILQA 1YNND 2QILA 5C3WA 1J7KA 4N9PA 4REZA 5DNYA 3KF8A 4FD2A 4GC9A 4R3DA 3A7AB 1WTRA 1O7YA 5C3EB 1IXZA 2E74C 3K59A 2XEPA 4E6IA 2R45A 1EY4A 1I4HA 5A2QL 5EJCA 2H1RA 3QIAA 1PXUA 3HU2A 1E0BA 2XSZD 1FD7D 3U6QA 5IGBA 2F0KA 2KUMA 1JQJC 1E9SA 5T1IA 3TP5A 2LY7A 5K36G 3FTCA 2D62A 1E2WA 4EIWA 4HTHA 1I94M 2DWLA 4KN4C 5KNBA 5EPKA 4MGZE 1GVNA 2FFJA 1WTQA 5KPTA 5FKAC 3T1HM 2Z4RA 4FYDA 4NRWA 3MXGA 4FF3A 4QB4A 3UMMA 1TY0A 4NP5A 1HA6A 1NHWC 3W3AA 3DMUA 3PMFA 1H9MA 4V0BA 1QWYA 1I4XA 4RFBA 2IX1A 3I4VA 5IGFA 2E2JB 1LT6D 2OPFA 1I4RA 1S4ZA 2CW0C 2L55A 5LL6X 4MIUA 5ITYA 2BDNA 1XX8A 1EFID 3Q0AA 4I8OA 3X3MA 4ULLA 1RKNA 3TWKA 4PDGA 2Y20A 3K58A 1NY6A 4IFDI 1IHZA 3BVGA 1SJED 3AOGA 4K5XA 3GP7A 2ZT9C 2YYZA 3K7AB 4HSPA 2NN6I 4X3UA 4IBEA 3ZC7B 1Q1EA 1IQPA 1L2DA 2XZUA 2OEOA 1ZAEA 4PMCA 1IN5A 3DFZA 1RTNA 3D4DA 5ELDA 3EQLC 4AG6A 3X3NA 3GTQB 3SMSA 4LZZA 2ZM6M 3DHQA 3IG8A 1QQWA 1IBKM 2PPBC 2V1UA 4C3HG 4FNFA 4XGIA 1BOSA 1M8AA 3I51A 4A3BB 5EP2A 3VFDA 4JK1C 1DXMA 1PTOH 4ZQ3A 3U5ZA 1L8QA 3VYRA 5C0XI 3LVWA 1B50A 3TSSA 3K92A 4A3JB 1IKMA 3SAUA 3TP8A 1OFIA 1HHVA 3SASA 3KBXA 5CR3A 3OIQA 4KTAA 1DO2A 1PLFA 3CF2A 2EJFC 4XYQA 4QMGA 3SARA 3QOJA 2KCNA 5JOBA 3PUXA 1VF5C 2KEDA 1UNSA 3LQRA 5FO7B 3T15A 4LFBM 5FTNA 1GOZA 3P20A 1JR3A 4LG2A 4ODGA 4LJ6A 4HCSA 2ENBA 4DF7A 2FMCA 1XXHB 4I81A 2WKDA 3HJ8A 2QP9X 3KUPA 1IW7C 3J7YW 3MC0B 2SNSA 1NJFA 4RGTA 2HDLA 5C5MA 3HU1A 1PDQA 1JE4A 4XQJA 1OO9B 2PW7A 5KEEA 3NBIA 2A74C 2QBYB 4LFAM 1BR9A 3L26A 2D5DA 3TDQA 2F0EA 1ZKOA 3GTLB 1CT1D 2Y0QA 4IJFA 4GKKM 5CV6A 1XNQM 1STGA 4L16A 2XN9C 3FRPB 4KMUC 3GLGB 1C4QA 3NK9A 1SYGA 1RDPD 3VYUA 4ZAIA 3TP7A 4MGYE 2CEAA 4IQZA 3FPPA 3R8FA 3HG9A 1F9QA 2F1MA 1Z5CA 3L29A 3U60B 1B4OA 4QF4A 4PT5A 1LTTD 3VYTA 4EQPA 5JI2E 1Q3LA 5C6AA 5KQ8A 1D6EC 2R62A 2LMCB 3NTHA 1G3IA 2HCIA 4G7OC 2ID0A 4LK1C 2AQ1B 1N36M 3KP1E 2RDFA 1XTCD 1SYFA 4IUQA 3HOVB 2NVXB 1D2NA 1RHPA 3R8BA 1KDAA 2XIWA 3I91A 1KDBA 3G7LA 3LMMA 3KK7A 4RKLA 3J7AF 1U4LA 3AMUA 1HTPA 3J7BA 4JI4M 2W82A 4IBIA 4WRDA 1BF4A 2B2VC 2ICIA 3I3CA 4B08A 1G8ZD 3T38A 3HRZC 1O7LA 3MJ5A 2A69C 2L5TA 2O5RA 4DV3M 5IT9S 5ELEA 4C2MB 2YFQA 4LY6A 3K57A 4ZKBB 2XF3A 5ITXA 3K8ZA 2RSNA 1SE2A 4QCLA 4PMWA 2AWNA 1RCVD 2M9VA 1L2CA 3FTFA 1LTBD 2LWXA 5FO9B 1H9SA 1B1ZA 5T1GA 4A3DB 2F5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHT B;  3NBI A;  4CGY B; 
#chains in the Genus database with same CATH topology
 1T3T A;  3E6Z X;  1NNU C;  1OXX K;  4PMB A;  3KJP A;  3G6J B;  4C3I B;  4JI0 M;  2PNR C;  5CC4 A;  1ENC A;  3VDY A;  1JOR A;  1O80 A;  4G4O A;  3RZO B;  1Z7T A;  3CU7 A;  4OIK A;  5D65 A;  3P7J A;  2P5T A;  4FCT A;  3K2L A;  1HXY D;  5ITU A;  4JI8 L;  1VEJ A;  1NR2 A;  1RIP A;  4FXD A;  1XNR Q;  3OPO A;  3QWL A;  1VQF A;  1XMQ L;  5EPL A;  1STN A;  2UXB L;  4JV5 L;  2X49 A;  2E75 C;  1E2Z A;  3RD4 A;  1I50 B;  1Q90 A;  3I4M B;  4A3J H;  3CAM A;  1QDT A;  2MO0 A;  3PO3 G;  2RDG A;  4YCW A;  2V1C A;  3JR4 A;  3OSO A;  3E0J A;  4DGZ A;  5A2Q S;  2NBF A;  1L2B A;  3STB D;  3HOY B;  2IY5 B;  3AOE C;  4JI7 L;  4LF4 L;  4G7H C;  5IWA L;  3VLF B;  3WOE A;  1YJW A;  2Q8I B;  1VS0 A;  4JI8 Q;  1YHQ A;  5AJ3 L;  4QUC A;  1VG5 A;  4DV5 L;  1TS3 A;  1YNJ D;  4A3G B;  2F0J A;  2SDF A;  1PTO C;  2XRQ D;  3NBH B;  4JV5 Q;  2UXB Q;  3M4P A;  3A8I E;  2LVQ D;  1WJ7 A;  2NQ8 C;  5GKN A;  1IYJ B;  1E9R A;  2RA4 A;  5C4X B;  2ZBK B;  5I6W A;  1LTG D;  4GIT A;  2KA7 A;  4MHE A;  5HGQ A;  1T43 A;  4DR1 M;  1MI2 A;  4A3M G;  2B63 H;  3H3V H;  1PH1 A;  1VQA A;  1R2Z A;  3NQI A;  1ENA A;  3PSI A;  2VS1 A;  3BZD B;  1CKN A;  3L0O A;  1PGY A;  1S3S A;  2C9O A;  4B3T M;  1N78 A;  3TS2 A;  4JI7 Q;  4LF4 Q;  4L5Q A;  1QVC A;  4AI6 A;  3AL0 C;  5IWA Q;  1YVC A;  2JA6 B;  2E2H B;  4GLA C;  1F77 A;  1X37 A;  4LRT A;  5AJ3 Q;  3W5O A;  3S1Q B;  4LF5 M;  1D0L A;  2UXC L;  2JZ1 A;  2DHY A;  2LVO C;  2O01 F;  4FF4 A;  3MMP A;  4DV5 Q;  1SNC A;  4LWC A;  1JJC B;  2I07 B;  2WSF F;  2H1E A;  1H95 A;  4C3J H;  1BCP D;  1PZI D;  1YSY A;  1Y1W G;  1C9O A;  4RA8 A;  1Z59 A;  4DN4 M;  2QCU A;  1XWI A;  2CWP A;  3GTL H;  2A73 B;  2L09 A;  1PRT B;  1BCP B;  1R2Y A;  5CV9 A;  4NRV A;  1NY4 A;  2Z7J A;  4DV4 Q;  3MEH A;  4UAI A;  3SK5 A;  4X66 M;  4LF6 L;  2HDM A;  2DNA A;  1HA5 A;  4JPB W;  1S5D D;  3VA5 A;  2UXC Q;  1YNN C;  1LV7 A;  4A3E G;  2QHO B;  2HCC A;  4Q5V A;  1XJV A;  5JPN C;  2F5P A;  4L4U A;  3KFU G;  4M9X A;  4TKO B;  1HR0 L;  1FL0 A;  5GAD C;  1X56 A;  1Z5A A;  3FDT A;  2QF7 A;  1WHC A;  1STH A;  1KDC A;  2F0T A;  2Z4S A;  5COR A;  2RGO A;  1WTO A;  2FHT A;  4HID A;  3ULL A;  3GP1 A;  4FP5 D;  5BN4 A;  5GAE C;  2A6H D;  3M85 A;  3U9O A;  2O5J C;  1DD2 A;  2VQE L;  3D8G A;  1LYL A;  3EN2 A;  1LTL A;  3HOV H;  4S12 A;  3NQT A;  3VDP A;  4MTN A;  4I65 A;  1FR3 A;  3LWU A;  1TY2 A;  4KV6 A;  4HJ7 A;  2BOS A;  3L28 A;  1RU3 A;  2OQ0 A;  3LW5 F;  1FGU A;  2FMM A;  4DFA A;  3KLR A;  3KLW A;  3K5M A;  2MJ5 B;  2J7Z A;  4KKT A;  4DR7 L;  1XHB A;  2VW9 A;  1OAO C;  1EYD A;  3KOZ E;  1TXY A;  1HR0 Q;  2FFK B;  1PRT F;  1BCP F;  3W0F A;  4AYB G;  3PF5 A;  3KOW E;  3Q8X A;  5GQO A;  1DYQ A;  1MD2 D;  2F0F A;  2YR0 A;  3DXJ C;  4MGI E;  5BR8 L;  1LTI D;  4TVA B;  2HHH L;  4C2M H;  1SJH D;  3JAM S;  2KZU A;  5I2X A;  1C7Y A;  2EYP A;  1JR3 E;  2VB2 X;  2I46 A;  2LTU A;  4B7H A;  2EYL A;  1SXJ D;  3C3E A;  2A5Y B;  3RN2 A;  4N8X 1;  2LVA A;  1NBW A;  1SRO A;  2Q2E B;  1HT1 E;  1G41 A;  2WB1 E;  3CXC A;  4GHL A;  3R2I A;  4DR7 Q;  4DUZ M;  2G8L A;  1GL6 A;  3QOL A;  4M1U B;  1TWA B;  4WUR A;  4KY6 A;  3D3R A;  3HEJ A;  4BY7 H;  4CDC C;  3CQZ H;  1PFN A;  3HZX A;  2KRK A;  4BY1 H;  5ELB A;  2WSE F;  3FTD A;  5GAG C;  4IPG A;  3LCV B;  2V4D A;  4IAL A;  4L6T B;  3CRK C;  3NTK A;  5BR8 Q;  1I4G A;  3PV0 A;  2B2V A;  5L37 A;  2HHH Q;  2JA7 H;  4DUY L;  1F2L A;  3AFP A;  3GLG E;  3J81 c;  1V1Q A;  4DNI A;  3RZO H;  3H4M A;  1U4M A;  2F0W A;  3FP9 A;  1VCI A;  1HNX M;  3DWQ A;  1SR3 A;  2R0I A;  5EGT A;  1TWC B;  2M2L A;  3E0E A;  2JA5 B;  1WGL A;  1JB0 F;  3EIH A;  4NB3 A;  1STA A;  4WJ4 A;  4OEL B;  1TWG H;  1IN8 A;  3DEO A;  2AHM A;  5LMN L;  2NYZ D;  3MHB A;  3I4M H;  1Z6T A;  3MFY A;  4KHP L;  3H4J A;  2LVP C;  4BA2 I;  4AKH A;  1E24 A;  3I73 A;  4DUY Q;  1K8A C;  1QAO A;  2RRU A;  2K32 A;  3A56 A;  4DK1 A;  3GTM H;  4ZUJ A;  3HOY H;  2ZTC A;  4UDU C;  3QAU A;  3J80 L;  3FKI H;  2R6F A;  1NSF A;  4YHH L;  1YEZ A;  5ITT A;  1WCM B;  2QNJ A;  2F5S A;  3URY A;  3GQ4 A;  4DV1 M;  4LGM A;  1N32 L;  4N9T A;  1EIF A;  2PW5 A;  3NEN A;  1D0M A;  3BDO A;  2EY6 A;  3LVV A;  3S2D H;  1K73 C;  4A3G H;  2QPA A;  3FEW X;  5LMN Q;  2AHO B;  3U6E A;  1S72 A;  1UE1 A;  4QOS A;  1QZM A;  4F7X A;  5C4X H;  1R4Q B;  4C1N I;  4KHP Q;  4G4K A;  4LJ7 A;  2F0V A;  1CQV A;  3D8L A;  1UE7 A;  2JXN A;  1B7Y B;  3GLF A;  3KW6 A;  4WW0 A;  2J4X A;  5C0X J;  4YHH Q;  2Q2I A;  2JA6 H;  4A3J G;  4DV7 L;  4DR3 Q;  1KL9 A;  1N32 Q;  2VQF M;  3DM3 A;  3S1Q H;  3PUZ A;  3AOE A;  3KXE C;  5EJW A;  1CFM A;  2CV0 A;  3ZCB B;  2G5D A;  4LF8 L;  3C2P A;  1EY6 A;  2B39 A;  5JVG 3;  3HOX G;  4GN4 B;  1IN7 A;  4DV2 M;  2DNE A;  2BE5 D;  1LT4 D;  2F0H A;  2RBM A;  3M4O B;  2RKO A;  1LLR D;  4DAY B;  2A6E D;  5ITX E;  2ZTD A;  5EKK A;  1MN3 A;  5IP9 H;  4PD2 A;  2D9U A;  4AIM A;  4KOD A;  1P8L A;  1HCZ A;  1TU2 B;  2H4O A;  4BLC A;  2R4J A;  4FF2 A;  1D8L A;  3VR4 A;  4JI1 L;  4RKB A;  4DV7 Q;  2R93 H;  1V1O A;  4BB9 A;  2WAQ B;  2XZF A;  4JW0 A;  4X3S A;  2B63 G;  3SHL A;  1HQY E;  1B70 B;  5FTL A;  2FIN B;  2JXM B;  4EQN A;  4B3S L;  4KI0 A;  1I4Q A;  2JP1 A;  1JOO A;  4LF8 Q;  3SFZ A;  4QIW E;  2JA8 H;  3C46 A;  5KPZ A;  1JWS D;  4GKJ M;  1SFO H;  1XC8 A;  3GTP B;  3G48 A;  3PUY A;  3EFX D;  5ELO A;  2LHG A;  1IN4 A;  2LKV A;  4UP8 A;  3HWS A;  4X62 L;  4FXG C;  3I4Y A;  3DLL A;  4EQ5 A;  3KP0 E;  5KQD A;  2EY1 A;  4C3J G;  5FLM G;  2F0Q A;  2A68 C;  1V1P A;  2MO1 A;  4JI5 M;  1NR4 A;  4B3M M;  2TMP A;  4JI1 Q;  2LNH C;  1Q3B A;  4B3R M;  2R61 A;  4CDD C;  3D6W A;  3BG3 A;  3AYH B;  4AKG A;  4B3S Q;  2K5Q A;  4NKL A;  1BBW A;  4NSR A;  2AUK A;  2BA1 A;  2HIX A;  3S1R B;  3KFU A;  1DJR D;  4PNY A;  2YNM D;  4L78 A;  3J2P B;  1SYC A;  1TS2 A;  1Y14 B;  1CA6 A;  3B7N A;  3JAM E;  1FNV A;  3PVS A;  1LT5 D;  4MNO A;  4KLK A;  4C1N K;  2K28 A;  3RE8 A;  4FWD A;  1IXR C;  4RF0 A;  3T1Y L;  2EJS A;  3TWM A;  4U67 3;  1ZV1 A;  5FTK A;  2RKS A;  4YY3 M;  4IUU A;  3RNU A;  1RJT A;  1G2T A;  3VDU A;  4APV A;  1HTL D;  3KF8 B;  5HUR A;  5EP1 A;  2Z6K C;  2Z0S A;  2NVT B;  1N34 L;  2UU9 L;  1ZMU A;  4JBK A;  2EKK A;  1PZJ D;  2JEB I;  3Q22 A;  2LS0 1;  4UY8 C;  3DWP A;  2XSZ A;  5J39 A;  1SRU A;  3Q8D A;  3NP8 A;  3FMC A;  4KJO A;  5DYG A;  1HQR D;  2C99 A;  2B2Y C;  1S5B D;  1VQI A;  1PH6 A;  5DYI A;  3CTW B;  3T1Y Q;  1Q86 C;  2DJG C;  1EOT A;  4HAE A;  4MGH A;  4G4N A;  2PMZ E;  4XBO A;  3C1F A;  3KOX E;  2F0G A;  5CV8 A;  2K01 A;  4GHA A;  1YIJ A;  4BXX H;  1SNQ A;  3OWF A;  3BU2 A;  1N34 Q;  2UU9 Q;  3S2H B;  1ET9 A;  2OQ4 A;  1TWC H;  4X65 L;  1H9J A;  4F8M A;  1VQH A;  2IL8 A;  4XIG S;  2OXP A;  1IBL L;  1WJJ A;  2KNV A;  1JWM D;  4DA2 A;  2K9D A;  1XNR M;  1FNW A;  2EO2 A;  2WII B;  4G3O A;  3E46 A;  1XMO L;  1MKH A;  1TS4 A;  4A93 B;  3BZC A;  1B9M A;  4RHR A;  1DGH A;  4X64 L;  3A45 A;  5FTM A;  4KK7 A;  2E5L M;  4CJ0 B;  4CIS A;  4BY7 G;  2RQX A;  4BY1 G;  1Y8G A;  4K5V A;  1EYG A;  1MIU A;  2N88 A;  2VL6 A;  4X65 Q;  2ERC A;  1L1O C;  3GRY A;  3EVQ A;  4UN2 B;  4M0D A;  2JA7 G;  1MJG M;  1IBL Q;  4WFN 3;  1EY5 A;  3WOF A;  4JI8 M;  3E4R A;  3SVM A;  1YE9 A;  5EKL A;  4A3V B;  4IZ8 A;  4AG5 A;  3CPF A;  5KYI A;  4IOC A;  1FNN A;  2N8N A;  1TR5 A;  1VDL A;  1YIT A;  2MPM A;  4XQQ A;  3GLI A;  1HJP A;  5CV7 A;  2QEX A;  1A15 A;  5IYD H;  1SMX A;  5C5L A;  2AKW B;  1PZK D;  4X64 Q;  4RHS A;  1EOV A;  3NWS A;  4A3I H;  4BS9 A;  1L0X B;  5LMU Q;  2QCP X;  2PO4 A;  2CH4 A;  1NSN S;  5EKI A;  3TRE A;  5ELN A;  3W67 A;  4HCE A;  3KSJ A;  4JI7 M;  4XT1 B;  5IWA M;  1QUQ A;  3STB C;  3J81 L;  4R71 A;  3NWT A;  1S40 A;  2MFI A;  2F4V L;  4RCN A;  3FKI G;  4DKA C;  1XPR A;  2Q2H A;  2KNZ A;  2LVN C;  4BBR H;  4GKK L;  3M4O H;  5M5W B;  1S5C D;  1MBY A;  3KOJ A;  1U9R A;  3T56 B;  2MRO B;  1KNA A;  1YNJ C;  3OTO L;  1J09 A;  4JYA M;  1ZXT A;  1HFG A;  2VNU D;  3QO2 A;  4FDB A;  2LXK A;  3RZD B;  3NWL A;  3TQY A;  5C4X G;  3GPX A;  5D3I B;  3FRI A;  1DOL A;  2KDL A;  3D6C A;  3FPU B;  2DHR A;  1SNM A;  4Q0F A;  1AUA A;  4DV4 M;  3IRB A;  2CWB A;  3MVV A;  1L0W A;  2X8A A;  2MJ8 A;  4EGV A;  2KXE A;  3T16 A;  1Q8I A;  3SXH A;  3U5Z B;  3U6P A;  4A4I A;  2I7N A;  1E2V A;  3V2T A;  3GQ3 A;  2F0I A;  2UXC M;  2F4V Q;  4WOR A;  2HWJ A;  5FLX S;  1BXT A;  2C9C A;  2IX0 A;  3MZ5 A;  1KTK A;  1LM0 A;  4BBS B;  4R4O A;  1EY0 A;  3IHP A;  5I6Y A;  3J7Z C;  1ML0 D;  1W6K A;  4QJF A;  4GLX A;  1V33 A;  3CMA A;  3OTO Q;  4JBJ A;  3HHX A;  4GS3 A;  2UUC M;  2CCZ A;  1BCP C;  4CKE A;  4IUP A;  1TGU A;  2G3Q A;  1HR0 W;  3GTK B;  4CKC A;  4DR6 M;  5M3F B;  3SAW A;  1HNZ M;  3HKZ G;  4FXK C;  2DWN A;  2I7P A;  2C96 A;  3OIP A;  1W2B A;  5IP9 G;  2DI0 A;  1GUW A;  4LF7 L;  1VF7 A;  2X6L A;  3F1Z A;  3P1H A;  3VYS A;  2MR9 A;  4M9S A;  3GD7 A;  2A5H A;  5A35 A;  2DAE A;  3RLN A;  4A3L H;  2BJW A;  5C3E H;  5JJL A;  4XTC S;  2R93 G;  2WB1 B;  2A68 D;  3KBG A;  4LJZ C;  1ILP A;  5IGE A;  4OGQ C;  5JEA J;  4NPS A;  4KY5 A;  2ZJR A;  1KQS A;  2IWH A;  5JPM C;  2JY6 B;  2JA8 G;  1K8O A;  4DXG A;  1HUM A;  3KS8 A;  3BOS A;  1NTG A;  4EQO A;  1SXT A;  4HSV A;  3GPU A;  2R65 A;  2R44 A;  3DOA A;  1A8V A;  2IJ0 A;  4R4Q A;  4A3K G;  2NVT H;  1DZ1 A;  4JI2 L;  3L2A A;  1D0K A;  5EP4 A;  5C1B A;  2F5Q A;  4DV0 L;  4LF7 Q;  2PCF B;  4HMI A;  1XWE A;  3CW2 C;  4DV6 L;  4FWG A;  1S3O A;  1YHB A;  1G6P A;  2A6H C;  1OXV A;  2XGT A;  1GKI A;  1SSO A;  3GLF E;  3AJI B;  1HNW M;  3QJY A;  1XYI A;  2B2U C;  1JB3 A;  1ZMW A;  1MSH A;  3MXP A;  1WD1 A;  3U60 A;  2A8V A;  4R8N A;  1VQG A;  3T13 A;  1QUT A;  2E2D C;  1F2Y A;  3UK6 A;  1IXR A;  5BR8 M;  4D81 A;  3GTG B;  1EIY B;  1X6O A;  3GRR A;  4JI2 Q;  4R4I A;  1F2Z A;  1AZQ A;  4Y52 H;  1EQT A;  4DV0 Q;  4DV6 Q;  1SE4 A;  2Z6K A;  5JAV A;  3PUW A;  2F0O A;  1WOC A;  1IL8 A;  2XTI A;  1AE2 A;  2E2J H;  1IBM M;  3FYC A;  2YV5 A;  3SC3 A;  1SXJ C;  1CKO A;  4WJ3 M;  2B8F A;  1F4I A;  1J9O A;  3E3X A;  1V9P A;  5COY A;  1F9P A;  4PZ7 A;  4A93 H;  5JJI A;  2SNM A;  3RN5 A;  5LMN W;  2B2Y A;  2FH0 A;  2VB3 X;  2HKJ A;  5D14 A;  1NAP A;  2K5W A;  3M4Q A;  2UXD L;  4QY7 A;  4A3F B;  2Z4H A;  4Y28 F;  1XPU A;  1JWU D;  1EFU B;  1DGS A;  1I94 L;  3C9P A;  4LJA A;  2G9H D;  3PFI A;  1OJL A;  4HN7 A;  2M60 A;  3HJQ A;  4KY7 A;  3LNN A;  1QVG A;  1TR8 A;  5C44 B;  1Q1B A;  1G6Z A;  5LMN M;  1X3G A;  2F0S A;  2L9H A;  1ET6 A;  4HIM A;  3T1H L;  4JI3 M;  2MHV A;  3I4N B;  1ORY B;  3FUV A;  1TWF B;  2UXD Q;  1NMF A;  2CH4 W;  5AFW A;  1CI3 M;  1VQ9 A;  2LXE A;  2ZJP A;  1GAB A;  5JJZ A;  1I94 Q;  4YHH M;  1EWC A;  4LJ4 A;  1YNX A;  2I0Q A;  3IEC A;  2ZXO A;  1IYV A;  4DR3 M;  4IPC A;  4A3B H;  1N32 M;  1H9S B;  3TEH B;  4LFC L;  2R92 B;  1L1O A;  1Y1V G;  1NV9 A;  3NEL A;  5C4J B;  5C4H A;  4IOA A;  4GH9 A;  2DVW B;  1IYU A;  1WYD A;  4QIW B;  1Q82 C;  3UJN A;  2R7Z B;  3I4L A;  2DZN B;  3HJS A;  4QL5 A;  2B2W C;  4R9W A;  1DO0 A;  2WP8 J;  4OXP A;  3J80 i;  1X54 A;  3J7A S;  3RZD H;  2OTL A;  4RH6 A;  2F52 A;  1ICW A;  1YLA A;  1OAI A;  1D5X C;  2RCN A;  4AYB E;  5C0X H;  2RHS B;  4UP7 A;  4V19 0;  1HZA A;  1STE A;  1T9H A;  3BJU A;  3UI2 A;  5FLX E;  2DEN A;  5IGD A;  1EWI A;  3H0G B;  2JYO A;  3MXU A;  2O4X A;  5KPR A;  4DV7 M;  1GUS A;  2CUZ A;  1BUV T;  2JY7 A;  3SDZ A;  3HKS A;  2UUA L;  1GUG A;  4A3I G;  1KIX A;  3GTJ B;  4NXN L;  2NUC A;  4LFC Q;  1A3V A;  4LW1 A;  3GPP A;  2Z1C A;  4DR5 L;  3GTO B;  1XMQ Q;  3IAY A;  5KRU A;  3HOW B;  3EIV A;  1XB2 B;  2I5M X;  3NBH A;  3OYY A;  5EBC A;  1ESR A;  2L0C A;  4OHJ A;  1PJI A;  3GTK H;  3I56 A;  1IBK L;  4BBR G;  3NSW A;  2BE5 C;  5LL6 S;  3K0X A;  3I01 M;  2A6E C;  3UZU A;  3SK4 A;  3KYH C;  3CME A;  2K5N A;  1UAP A;  3S24 A;  2JEA I;  1YJ9 A;  1RTO A;  1AFP A;  3M3Y B;  2BH2 A;  3HOZ B;  2UUA Q;  3S1N B;  1ESF A;  2DAG A;  4NXN Q;  1GLN A;  2Y0S G;  2D7E A;  1JT8 A;  2AQ2 B;  1N9W A;  2PQA A;  3BYY B;  5KND A;  4DR5 Q;  1AZP A;  3GTQ H;  2FS1 A;  1II3 A;  1PRT D;  4HIO A;  4DAM A;  4GNX A;  1X65 A;  4CBV A;  2QA4 A;  1E1T A;  1G59 A;  1UE6 A;  4IUT A;  3U61 A;  2QDB A;  1CKN B;  4RG1 A;  1L1Z A;  3GLH A;  2D7G A;  2AUJ D;  1IBK Q;  1NJG A;  2IX3 A;  3FTE A;  2F0U A;  3H94 A;  3BXW A;  4YWL A;  1MJE A;  3I70 A;  4TSS A;  2RSO A;  2PMZ B;  5KYL A;  1HFN A;  1OKS A;  3AU7 A;  3OOC A;  3ZJY C;  3GLI E;  2XRS D;  3KLS A;  4QOZ C;  3TPZ A;  4XDX A;  3BDL A;  1SNO A;  3QYB A;  2L12 A;  1BBU A;  2KNA A;  4OX9 M;  1E22 A;  4I4L A;  2QKI C;  2VXW A;  2GVA A;  1UM8 A;  2MGW A;  1BVS A;  3CCV A;  3U6C A;  1WGN A;  2DAI A;  3CRL C;  1VQN A;  2NTT A;  2N49 A;  2OOB A;  1ENF A;  1IY2 A;  1SYD A;  3FE3 A;  4K8I A;  5C3E G;  1IL2 A;  1TS5 A;  2QZ4 A;  2QSF X;  4FW9 A;  5DM6 3;  1IXS A;  2XVS A;  4A3C H;  4LF6 Q;  5D3D A;  3FUW A;  2CV1 A;  4K2K A;  3TS0 A;  2IT1 A;  1Y8N B;  2NVX H;  4H02 A;  3B7Q A;  4GRI A;  4LFA L;  3SMP A;  3S17 B;  3HX3 A;  1PFM A;  4G57 A;  1DM0 B;  3F2U A;  1JMC A;  2DJF C;  1GJX A;  2QQ8 A;  1DGF A;  3C3L A;  1H9R A;  3FD9 A;  1UEA B;  2L1B A;  3J81 S;  4HMJ A;  5IT9 E;  3CF6 E;  1XNQ L;  1CZW A;  1TDZ A;  1WTP A;  2JE6 I;  2B2U A;  2HL7 A;  3KDS E;  4KKS A;  5J1Z A;  1EYA A;  4X3T A;  4OVZ A;  2JY5 A;  1FNU A;  3PUV A;  1SMY D;  2I5L X;  2K05 A;  2VQE Q;  5C3X A;  3OMG A;  4GN3 B;  4ILW A;  1TH3 A;  1WD0 A;  4LNQ A;  3UE1 A;  3SK6 A;  2Z8L A;  2KEC A;  1NCV A;  1J8I A;  2XH9 A;  3LX0 A;  2B3T A;  2EA0 A;  4DPG A;  5H1S E;  1EU4 A;  2K5H A;  2XWB B;  4HED A;  1IM2 A;  1HH2 P;  5TSS A;  5C44 H;  2N3S A;  2XFT A;  3SHG B;  4L8J A;  3LCU A;  3HGB A;  5IP7 H;  4AQY M;  1HZB A;  4O2D A;  2VY3 A;  1GD7 A;  2QGQ A;  4GEW A;  3UE0 A;  3R9X B;  2Q2U A;  4A3D H;  2VUM B;  2EYM A;  1SXJ A;  2NZH A;  3F2C A;  1X9N A;  3I4N H;  2XNA C;  1N36 L;  4PCZ A;  4KN7 C;  3U6O A;  5C4Z A;  4C3I H;  3HOU B;  3FVQ A;  1KAB A;  2LHC A;  1I4W A;  4G6Z A;  4X64 M;  1QG7 A;  5EBD A;  2NTS A;  1GM5 A;  3AB9 A;  4A93 G;  5LMU M;  1VEK A;  4C56 C;  2M00 A;  3NUC A;  4ZUI A;  2EYH A;  2PNH A;  2R92 H;  4H44 C;  3VKG A;  4J6H A;  4IFD J;  3L27 A;  1JB7 A;  4B9W A;  1AIP C;  5A2Q E;  1I50 H;  4K0K M;  1JIC A;  1GO3 E;  1QB5 D;  1WFQ A;  4I7Z C;  1OXT A;  1QDR A;  3UDX A;  1PH5 A;  1K3W A;  4TUW A;  2CE7 A;  4DV3 L;  3VK7 A;  1H9K A;  1N36 Q;  4JN6 A;  1WTX A;  1C8C A;  4ITQ A;  3H6M A;  4PV1 C;  2A1A A;  1VMC A;  3PCO B;  1M90 C;  2X4A A;  3RGS A;  2ZJQ A;  4ZCK A;  3H0G H;  4ZYS A;  4MGK E;  2HT1 A;  2I5H A;  3JAM c;  4HJ9 A;  1JR0 D;  4RAU C;  3SHF A;  1UEB A;  1PH4 A;  3A8J E;  3K8A A;  1VQB A;  4M9Z A;  2R7F A;  2DY7 A;  3K80 C;  3GRU A;  3V05 A;  3GTJ H;  1G29 1;  1QZE A;  3U6S A;  1SLJ A;  1K83 B;  2HD3 A;  3A8K E;  2EJG C;  2F0N A;  3I8Z A;  3GTO H;  1W5S A;  2F4V M;  2O25 A;  1R4P B;  2WKC A;  2CHB D;  2PZT A;  4JI0 L;  5KIX A;  4CJ2 C;  4DV3 Q;  1EQV A;  4A3B G;  4GOP B;  3M7G A;  2YU9 B;  1PH3 A;  5HGT A;  4ALP A;  3OTO M;  2L7H A;  2B2W A;  2HQE A;  1T6O A;  4NXM M;  3GQB A;  1JQY D;  1BBX C;  1EZ8 A;  1AW7 A;  3J81 i;  2E2H H;  3M3Y H;  4L5S A;  1DOM A;  5FTJ A;  3S1N H;  4IO9 A;  3S14 B;  3PO3 B;  4ZPX A;  2KBN A;  2NVQ B;  5E1F A;  2GA4 B;  2K4K A;  2K50 A;  3CKI B;  2EUC A;  1PFS A;  1PMR A;  2F0L A;  2J7O A;  3FYD A;  2CQO A;  3QB3 A;  5E4W C;  4JI0 Q;  4KD3 A;  1BDO A;  3T4A C;  3GLF B;  4J8Q A;  3UDI A;  3K1J A;  1AN8 A;  3AKZ A;  2K5V A;  3R3O A;  3H3V C;  1LTM A;  4X3K A;  3GV6 A;  4WP2 A;  1L1T A;  1U0L A;  1GKH A;  3B6Y A;  1IY0 A;  3RFW A;  3VR3 A;  4J15 A;  2IHE A;  2CHV A;  4Z8X A;  1G2S A;  3MXN A;  1QVR A;  4P75 A;  4IPH A;  4ZLT F;  1K28 A;  2G5G X;  3HZJ A;  1EIH A;  1R9T B;  3SYL A;  1LAB A;  4A3M B;  4EX5 A;  1IZ6 A;  1CHQ D;  1PTO B;  3MK6 A;  3TZD A;  4IBB A;  1KFV A;  4LF9 M;  3GQ5 A;  1HQC A;  3DA1 A;  2KOL A;  5JEA H;  1HT2 E;  4RF1 A;  1YUB A;  1PRB A;  2ZAN A;  1EIJ A;  1S5F D;  1GUO A;  3IG5 A;  2KW0 A;  4FCW A;  3HHW A;  2HAK A;  1PYB A;  5BPV A;  3DM1 A;  4YCV A;  1Q02 A;  3CC4 A;  2EXD A;  3OW7 A;  4NDX A;  1CM9 A;  2UUB M;  4L15 A;  1Y1W B;  5IZ7 D;  1H6U A;  3G71 A;  2DAM A;  1K3R A;  4P17 A;  3SAT A;  1YHA A;  3PIO 3;  4DV0 M;  5CBE E;  4CKB A;  4LAA A;  4MB7 A;  3LGJ A;  2CRU A;  3K6O A;  3B9P A;  1HUN A;  5EXX A;  4F88 A;  4DR4 L;  1SNP A;  4POF A;  3RR5 A;  1V1P B;  1JOK A;  3GDE A;  3IL8 A;  3WWV A;  2RDH A;  2YTY A;  4A3E B;  3RUZ A;  4O1N A;  2HUG A;  4X62 Q;  4LUO A;  4ZK9 B;  2N55 A;  1J6Q A;  4IJE A;  1AP0 A;  1VDD A;  4K6D A;  4H0L C;  4DNT B;  2B29 A;  1QZG A;  5FO8 B;  2EPB A;  4TQU S;  1O7Z A;  1PTO F;  4OL7 A;  1QYR A;  2FE8 A;  1VQL A;  1I6H B;  4HL4 A;  3JR5 A;  4UP9 A;  2JA2 A;  4RWS C;  4DXF A;  3OWE B;  1X32 A;  1MJC A;  3NBX X;  3TWL A;  2K33 A;  4IBD A;  4XXE A;  1ZYR D;  3CPW A;  3BBZ A;  3S1M B;  4W5W A;  5KGU A;  1Q12 A;  4DR4 Q;  1TWA H;  3PQI A;  5M5Y B;  1TWH B;  3M0E A;  5IE8 A;  3HOV G;  3WHL A;  1OIP A;  1HZ9 A;  3J7A 5;  2VUM H;  1F2M A;  1D1I A;  3PNV A;  2JSO A;  1PJS A;  3B89 A;  2BJV A;  5I4D A;  4G7Z C;  3T51 B;  2PQE A;  5ISR A;  4OO1 H;  3TE6 A;  5I9P A;  1K0S A;  2TSS A;  5IYC H;  1JCK B;  1E7Z A;  4XQN A;  2CHQ A;  3CP0 A;  1ASZ A;  4A76 A;  1AH9 A;  1A62 A;  2UXD M;  4KHV A;  4AYB B;  2K14 A;  2JA5 H;  3GLH E;  1A0I A;  3HKZ E;  1IN6 A;  3A42 A;  4MH0 E;  5F2D A;  1DGG A;  3I04 M;  4DNR B;  1TKW B;  4R7G A;  4QQB X;  2NWG A;  2CVR A;  1KD1 C;  4M0W A;  4F1I A;  3IFT A;  4RKU F;  1K8M A;  3PNY A;  5G3L F;  4FVM A;  2KRU A;  3MA2 B;  4MZ9 A;  3IKJ A;  4IUR A;  5C44 G;  1CA5 A;  2YTX A;  1OTC A;  2DWM A;  2ASB A;  2CQA A;  4LJ9 A;  2DAK A;  2L4N A;  4S3S A;  5IP7 G;  3U4Z A;  5J22 A;  1BQQ T;  4DR2 L;  2HCB A;  4A3D G;  5EAY A;  1WCM H;  3SE0 A;  2OWO A;  1LAC A;  2BDO A;  4DUZ L;  4BWG B;  1J5E L;  4LCB A;  4C3I G;  1QCB D;  1K83 H;  3T53 B;  1SEB D;  3KF6 A;  1G4A E;  4LFC M;  1KLU D;  2K47 A;  2LXJ A;  1UUP A;  5EPJ A;  5IOC A;  1LT3 D;  3AV0 A;  1DGH B;  1XMQ M;  1XMO Q;  2UXB M;  4JV5 M;  1VEG A;  5I9O A;  2F0P A;  2CFM A;  2KHI A;  1HNX L;  4GIP A;  2K6A A;  3U58 A;  1JOQ A;  2N78 A;  4JI6 L;  1YI2 A;  5IOD A;  3NPP A;  1GJT A;  3I4M G;  3W0L B;  4DR2 Q;  1GUT A;  4AW4 A;  1KAW A;  3ITP A;  4DUZ Q;  1EY7 A;  1J5E Q;  4LF4 M;  3IFD A;  3KS4 A;  2NVQ H;  2V6Z M;  3W68 A;  1PVO A;  4PDI A;  4KHZ A;  1VMP A;  4FCV A;  3GLI B;  2UUA M;  3HOY G;  4NMZ A;  4II7 A;  4NXN M;  3BVZ A;  3MWY W;  1EY8 A;  4DR5 M;  5IYB H;  4DV5 M;  3E9H A;  3H0G G;  4L5R C;  1Z6H A;  4IUV A;  2AMC B;  5M3M B;  1XPO A;  1U4R A;  1NUC A;  4FO2 A;  1PJJ A;  1EE8 A;  1GJS A;  4PZ6 A;  2O2L D;  1HNX Q;  4A3G G;  4JI6 Q;  3V96 A;  4K14 A;  3ONA B;  3DZD A;  1QUQ B;  1L0Y B;  2C5C A;  4DV1 L;  3HU3 A;  3NXW A;  5E7N A;  2CHG A;  1WTH A;  3TL4 X;  1S5E D;  4QGU A;  4HIK A;  3ERQ A;  1KC8 C;  2Z3X A;  2FOI C;  1R9T H;  1SXJ E;  3U6L A;  2ES2 A;  2O5I C;  1B9N A;  1XXG A;  4LZJ A;  2VII A;  1R6B X;  1DCZ A;  4P74 A;  1X3Q A;  3QWN A;  1FJG L;  3KJO A;  2JA6 G;  2JJQ A;  3GTP H;  1TT2 A;  4AH6 A;  3JAM L;  2EOT A;  1A2U A;  4CDF C;  1GHJ A;  1XXH A;  3A46 A;  1PRT C;  2J0T D;  4GN5 A;  3TZU A;  1PYS B;  1JR3 D;  1SAP A;  1SN8 A;  3RLF A;  7CAT A;  2E8G A;  4DV1 Q;  3HOX B;  3PO2 B;  4LUV A;  2VQF L;  2B3G A;  1NVM A;  1A6X A;  4L8R C;  1KHI A;  4GMQ A;  4LF6 M;  4J1M A;  2KJX A;  3OMC A;  3FUX A;  2CFO A;  3K9O A;  1EYC A;  3BS1 A;  4LUZ A;  5IIF A;  1QAM A;  2KHH A;  1CHP D;  1W6J A;  4DV2 L;  3S1R H;  3H3V I;  2EE1 A;  4KKU A;  1KYI A;  2PI2 A;  1BO0 A;  3KSX A;  3L7Z C;  1FJG Q;  1NY5 A;  2ZAM A;  2F5O A;  4CJ1 B;  3D4R A;  3I72 A;  1HPC A;  1YJN A;  2QBY A;  3A54 A;  5IRE B;  4YIJ A;  3F8T A;  4O0A A;  3PIP 3;  2B63 B;  1HR0 M;  1N33 L;  4M8A A;  1WTV A;  3AFH A;  3CHB D;  3ERO A;  2H5X A;  1SND A;  2KHS A;  2C35 B;  1STB A;  4H7B A;  2K5D A;  2Y0T A;  5EXT A;  2OQK A;  5JEA G;  2DZL A;  1P16 A;  3A5Z B;  2YQZ A;  3SAV A;  3SR1 A;  2JUJ A;  1D5Z C;  5CBA E;  2BA0 A;  1A2T A;  3K5N A;  2VQE M;  3G6E A;  4DV2 Q;  5FJ8 H;  4GKJ L;  3J80 S;  3GLG A;  4OW0 A;  1O78 A;  4PZ8 A;  1IY1 A;  1A63 A;  4C3J B;  4ME5 A;  2XGN A;  2L7I A;  3DWA A;  1Q3C A;  2EY2 A;  1Q7Y C;  3I2Z A;  3GPY A;  1V43 A;  3I55 A;  4DR7 M;  4DK0 A;  3O13 A;  3PXG A;  4CJ6 A;  5FLX c;  2XWJ B;  1N33 Q;  4JI5 L;  2D0P A;  4B3M L;  3FUU A;  2G9D A;  4AZF A;  3ZYY X;  4BA1 I;  4B3R L;  1EEI D;  3CCQ A;  1VQP A;  1KAA A;  1WVL A;  5F3W A;  4GNX B;  3CCR A;  4QNM A;  2MGS A;  3THG A;  3L9A X;  4F87 A;  2HHH M;  1L2F A;  3S2H H;  1Z47 A;  1TQO A;  3ND8 A;  3FHW A;  1I6V C;  1UE5 A;  2B2T C;  4GKJ Q;  3ZQJ A;  5DEH A;  4MM3 B;  3HHZ A;  5KNC A;  3NTI A;  1G91 A;  3MAQ A;  2F0D A;  1SMY C;  1ZQ9 A;  3TQS A;  4QHS A;  5C18 A;  4FF1 A;  3KDF A;  2SOB A;  1QE6 A;  4TRD A;  1Y8P B;  1V92 A;  1QIL A;  5E4X A;  4YY3 L;  4IBG A;  4BBA A;  2Z4I A;  2Y0S E;  1VQM A;  2EVB A;  3J7A V;  1OXU A;  5DLQ E;  2FJ2 A;  1N75 A;  3KLS X;  4L5T A;  1AE3 A;  4B3R Q;  2J7N A;  4B7G A;  2E2I B;  2DN8 A;  3NE5 B;  3NHH A;  5JJK A;  4DUY M;  5FSW A;  2VUM G;  2D0O A;  1SE8 A;  2FNA A;  3Q24 A;  4OO1 G;  1Z5B A;  2ZXP A;  3W2D A;  5IYC G;  3G4S A;  4XT3 B;  2KVM A;  4NSO B;  4D82 A;  4IFD H;  4BXX G;  2DXI A;  2OF1 A;  3CCL A;  2KQ3 A;  4YY3 Q;  1DOK A;  3WHK A;  2C98 A;  2JA5 G;  4NOO B;  2NN6 H;  2DKL A;  3H15 A;  2X6G A;  2WV6 D;  4KHP M;  4ABN A;  4K2L A;  4EVO A;  1NNX A;  3SK8 A;  1QVF A;  3S16 B;  1TH2 A;  3M6A A;  2L6O A;  2CP8 A;  5IGG A;  2J5Y A;  1PYW D;  3DUZ A;  1V8Q A;  1LTA D;  3AQQ A;  5H37 D;  1VQ7 A;  1GL7 A;  2LH0 A;  2R6G A;  1V34 A;  2CW0 D;  4B7F A;  2CV2 A;  2XSC A;  3RMH A;  3EBE A;  1BKB A;  1X3P A;  1XNR L;  1ONL A;  3TME A;  3ICE A;  3JC6 6;  5ITR A;  5EQ0 A;  4XYO A;  1JE5 A;  1E94 E;  2FXQ A;  2NB0 A;  3BDC A;  3BYT B;  4IN3 A;  4R8I A;  1K9M C;  4BY7 B;  1GXD C;  3CQZ B;  4BY1 B;  1WCM G;  5DAU A;  5M5W H;  4R1J A;  5M3M H;  3ND9 A;  3FKE A;  4GOP C;  4G4Q A;  3SBJ A;  3T1H Q;  1B53 A;  3L2P A;  2E5L L;  2OTJ A;  1M1K C;  2JA7 B;  4RGO S;  1Y69 U;  3ERS X;  2OT2 A;  1PHJ A;  5GRO A;  3HP3 A;  2DGY A;  2IW3 A;  3VR2 A;  3Q23 A;  1PH8 A;  4ZRZ A;  2KHJ A;  1CKM A;  1L1O B;  1QAN A;  1M4V A;  4X6A H;  4HEO A;  1FYC A;  1SDF A;  3N52 A;  4ID6 A;  3K9P A;  2K1B A;  4MN3 A;  5IT9 c;  5IYD G;  2IHF A;  4MTK A;  4IUN A;  4LJ8 A;  1TWG B;  1X3F A;  4WJW A;  3A0J A;  1I4P A;  3ER0 A;  5DM7 3;  4BBS H;  1HQM C;  2WFW A;  3TBI B;  2Z6B A;  4QUF A;  4LF8 M;  2R3Z A;  4RCO A;  3C58 A;  2Q2T A;  3K5O A;  2E5L Q;  4C3H B;  1EZ6 A;  2ZM6 L;  3U9S A;  3E9S A;  2JZ0 A;  3SYK A;  1WTW A;  4LRS A;  1U4P A;  2A19 A;  3A7L A;  1MU5 A;  3WDN A;  5I2Y A;  3GTM B;  3PO2 H;  3FKI B;  3HOX H;  1WIV A;  5IYB G;  4OEM B;  4HLQ A;  4ME3 A;  5M3F H;  1N77 A;  2Z9H A;  3D8B A;  2ATW A;  3L25 A;  1LV9 A;  2ZXR A;  1I5F A;  1KLG D;  3MHV C;  5EQT A;  4JI1 M;  4K8J A;  1B2T A;  3S2D B;  4QHT A;  2DY8 A;  4DAV A;  1PH9 A;  3K7U C;  4B3S M;  4LJ5 A;  3HHY A;  2DNC A;  4CDE C;  2WAQ G;  4JYA L;  1EY9 A;  3A74 A;  4PQX A;  1N8R C;  5ITQ A;  4DAP A;  2L4E A;  4FWH A;  1QJO A;  1OFH A;  2IPK D;  4K5W A;  1U5K A;  2ZM6 Q;  2Q8T A;  1DGB A;  4DV4 L;  3J80 E;  2JQO A;  4X62 M;  4F2L A;  3GO5 A;  4JBW A;  1EEF D;  4P72 A;  1ROD A;  4U68 A;  1VQ4 A;  2PQA B;  3CD6 A;  4PG3 A;  4B9X A;  4IJH A;  3GO8 A;  2F3W A;  4H13 C;  3W1G A;  1NHG C;  1VQD A;  5FLM H;  4DU9 A;  1CZG A;  4CHT B;  2KEB A;  1YBY A;  2KEE A;  1IW7 D;  4DBG B;  3RGP A;  2WZJ A;  2EYJ A;  5CMD A;  4Z6Y A;  3U61 B;  3H09 A;  1QAQ A;  3GLH B;  1SYB A;  2DWZ B;  3HKZ B;  4JYA Q;  2UUC L;  1EQQ A;  4NL4 H;  1MSG A;  2C5R A;  1CTM A;  4DR4 M;  2LFN A;  2E76 C;  2ZTE A;  3OW2 A;  4DR6 L;  2B8G A;  2EYF A;  4P73 A;  3SEB A;  1QZH A;  1HNZ L;  2RCF A;  1G51 A;  1GHK A;  3KOY E;  4POG A;  4D80 A;  4A3L G;  3T1Y M;  3ILK A;  1B3A A;  1K3X A;  3A98 B;  5KO3 A;  3GTG H;  2MUY A;  4G4R A;  4KLN A;  2R93 B;  3F2B A;  2Y21 A;  1I3Q B;  3GV3 A;  2BNK A;  3PIP A;  4IBK A;  2K03 A;  5M5X B;  5NUC A;  1N34 M;  4LFB Q;  2UU9 M;  4GLV B;  5CV4 A;  1BNZ A;  2JA8 B;  1VDZ A;  3VR6 A;  2PZU A;  1A3U A;  1SFO B;  2NZ1 D;  2X69 A;  3U6D A;  4IBJ A;  2UUC Q;  3NEM A;  4A3K B;  5EXP A;  1K82 A;  3QR8 A;  2K52 A;  3TP6 A;  1D7Q A;  4DR6 Q;  1IXS B;  5FJ8 G;  2BWB A;  1ZYR C;  3VK8 A;  3F92 A;  3CCJ A;  3UDG A;  1HNZ Q;  1EFW A;  2K6B A;  5K36 H;  1TTE A;  1G8P A;  4I5S A;  5JVH 3;  2BWE A;  2E2I H;  2N35 A;  2MH8 A;  1PH7 A;  2R18 A;  2RGH A;  3BVM A;  1C48 A;  4RGN A;  4A3F H;  2D7H A;  3K81 C;  1KRS A;  4Y7N B;  1R7R A;  3SGI A;  4LFA Q;  1HNW L;  1XXH E;  5BN3 A;  4X65 M;  3QG1 A;  4RGM A;  2ALY B;  4GC5 A;  2QEJ C;  1Y8O B;  1TII D;  2B2T A;  3D4W A;  3MTS A;  1IBL M;  2EXZ A;  2PYK A;  1RF2 D;  4CGY B;  4HJ5 A;  1PM5 A;  2BCO A;  1CQF A;  2RVL A;  3U6M A;  1TVX A;  1AEX A;  2EJM A;  3MEF A;  4OVZ B;  1XNQ Q;  4GKK Q;  5CV5 A;  3P75 A;  1XMO M;  2F4I A;  3EA6 A;  1GVP A;  1RD9 D;  5DNF A;  3S16 H;  1TWF H;  1WR1 B;  2PI2 E;  2KA6 B;  2K04 A;  3C3D A;  3J27 B;  3S9W A;  1EIG A;  5FLX L;  4IBC A;  2PZW A;  2SEB D;  4L63 B;  5CYU A;  3LWE A;  1IBM L;  4DR2 M;  2XLJ A;  2K7V A;  1OXS C;  1MGS A;  1HNW Q;  1ZMV A;  1J5E M;  2XFS A;  4JI4 L;  3TN2 A;  4OO1 I;  1EWH A;  1SE3 A;  1LTS D;  3L3O C;  1MX0 A;  5C4J H;  2A69 D;  1T5E A;  4O42 A;  1SXJ B;  1B44 D;  3C1E A;  1HZC A;  2APL A;  3R2T A;  4ANR A;  2R7Z H;  3B7Z A;  1TDH A;  4JG2 A;  3FRH A;  3M7N A;  4IFD G;  1F9S A;  1EU3 A;  4Z9C B;  1QOH A;  3D31 A;  1NNJ A;  4JI6 M;  5K5P A;  3CCM A;  2QEN A;  3MFG A;  1UWV A;  3A55 A;  4YCU A;  2NN6 G;  3Q6S A;  2L15 A;  1T5X D;  3E9I A;  1IBM Q;  3T6P A;  1VQK A;  1XTD A;  8CAT A;  1LO5 D;  1X55 A;  2F0M A;  2WAC A;  1SYE A;  4JI4 Q;  4P16 A;  4JC0 A;  4LGY A;  1GO5 A;  3ZH9 B;  4AKI A;  4JI3 L;  2WIN B;  3HOW H;  1ZEQ X;  3M4Y A;  1JC7 A;  1LTR D;  3HS0 C;  1W3S A;  4C3H H;  1EQR A;  3I90 A;  3VR5 A;  4ZKC B;  2EIF A;  3VA7 A;  1Y1V B;  4GOP A;  5JI3 E;  1W5T A;  1NMG A;  1QNK A;  3LQQ A;  5IGC A;  5M3M G;  3DEP A;  3UGJ A;  1CSP A;  2F3V A;  4DR3 L;  5E3F A;  2L4F A;  1NE3 A;  1STY A;  2R46 A;  1EUJ A;  1SBB B;  2KCC A;  2QW7 A;  5ELF A;  2EZV A;  3HOZ H;  5M9O A;  5FOB B;  1VQE A;  3S15 B;  4UHV A;  5C0X G;  1EL0 A;  1FGB D;  4IBF A;  2DUD A;  4JI3 Q;  3FUT A;  2EYO A;  1FJG M;  1GUN A;  2AQ3 B;  4NW2 A;  1WXQ A;  1E32 A;  4OWT B;  3CF0 A;  4OWW B;  4A3I B;  1YZ6 A;  3H91 A;  4DAY A;  2MP1 A;  4KO8 A;  4BBS G;  1R5L A;  2BH8 A;  3CCU A;  1PTO D;  4K6L A;  4LMQ D;  3U4V A;  1DON A;  1D5M C;  5EXS A;  3Q8G A;  1D1K A;  1VQ8 A;  4RNA A;  1KSF X;  2KCT A;  2DZO B;  1DV0 A;  2NZO A;  2LSS A;  1IKL A;  3HKP A;  3CF5 A;  3E5S A;  3PO2 G;  4LF7 M;  5M3F G;  1PFB A;  4BBR B;  3EJI A;  3JAM i;  2CKZ B;  3CC7 A;  2EDG A;  4JVZ A;  1C1K A;  5CGK A;  2P5Z X;  4GZY C;  4DR1 L;  4JXJ A;  1WI5 A;  4P71 A;  1CK1 A;  5ELC A;  4IPD A;  2ZAO A;  3GRV A;  4KJN A;  2M5Z A;  3HGI A;  5EP3 A;  5IT9 L;  2F03 A;  1NV8 A;  1HRJ A;  3KVW A;  3MXN B;  1F9R A;  3PGZ A;  4B3T L;  1N33 M;  1VQJ A;  5LHY 1;  2Y0S B;  2GVB A;  5FK9 C;  3K5L A;  1X3E A;  2WB1 G;  4R4T A;  4KD4 A;  1QNU A;  3K0Y A;  2KZS A;  4OIJ A;  4IIW A;  2CWA A;  4LF5 L;  4OU7 A;  1I3Q H;  2L11 A;  4CIZ A;  1E3P A;  2OCE A;  5M5X H;  1PJQ A;  1Z9F A;  5E6J A;  2Q8R E;  4JI2 M;  3S17 H;  3EIE A;  4QNR A;  3J81 E;  2AWO A;  2YTV A;  4P2C B;  2RHQ B;  4DV6 M;  2EY5 A;  1Q39 A;  3VKH A;  1QUS A;  2ICE C;  1D2B A;  1TH4 A;  5E26 A;  2NVY B;  4HR7 B;  4DR1 Q;  4A3K H;  3OHX C;  5BN5 A;  1KNE A;  2D2C C;  1A3T A;  3R93 A;  1SG9 A;  2GN5 A;  3N6R A;  5G3L D;  2R4E A;  1ASY A;  1ILQ A;  4B3T Q;  4X66 L;  1YNN D;  1PJT A;  2QIL A;  5C3W A;  3B74 A;  4LF5 Q;  1J7K A;  4N9P A;  4REZ A;  5DNY A;  4Y7N H;  3KF8 A;  5GAH C;  4OX9 L;  1ICF B;  2VZA A;  4FD2 A;  4Q7J A;  4GC9 A;  4R3D A;  3A7A B;  4N8F A;  1O7Y A;  5C3E B;  1WTR A;  1K8G A;  1IXZ A;  2E74 C;  3K59 A;  4A3C G;  5IY0 A;  2XEP A;  4E6I A;  2R45 A;  1EY4 A;  1I4H A;  5A2Q L;  5EJC A;  2H1R A;  3QIA A;  1PXU A;  3HU2 A;  1E0B A;  4L6V 6;  2XSZ D;  1FD7 D;  4KT0 F;  3U6Q A;  5IGB A;  4X66 Q;  4RMF A;  2F0K A;  2KUM A;  3HOU H;  1LUZ A;  1JQJ C;  1E9S A;  4OX9 Q;  4JOI C;  5T1I A;  3TP5 A;  2LY7 A;  5K36 G;  3FTC A;  1K0R A;  2D62 A;  3HY5 A;  1E2W A;  4EIW A;  4HTH A;  1I94 M;  1R4G A;  2DWL A;  5J3B A;  2F3I A;  4KN4 C;  5KNB A;  5EPK A;  4A3F G;  4NC6 A;  4MGZ E;  1GVN A;  2FFJ A;  1WTQ A;  1VQ6 A;  5KPT A;  5FKA C;  1VQ5 A;  3T1H M;  2Z4R A;  4FYD A;  4NRW A;  2HIV A;  3MXG A;  4JCV E;  4QB4 A;  3UMM A;  4FF3 A;  1TY0 A;  4NP5 A;  1HA6 A;  1NHW C;  3W3A A;  3DMU A;  3PMF A;  1H9M A;  4LFB L;  4V0B A;  1QWY A;  1I4X A;  3I4N G;  3ULP A;  4RFB A;  2IX1 A;  3I4V A;  2Z8Y M;  5IGF A;  2E2J B;  1LT6 D;  4AQY L;  2OPF A;  1I4R A;  1S4Z A;  2CW0 C;  2L55 A;  5LL6 X;  4MIU A;  5ITY A;  2MNA A;  2BDN A;  2WSC F;  1XX8 A;  3D0F A;  2LBC A;  1EFI D;  3Q0A A;  4I8O A;  3X3M A;  4ULL A;  2YU9 H;  1RKN A;  3TWK A;  4PDG A;  2R92 G;  2Y20 A;  3K58 A;  1NY6 A;  1Y1V H;  4UPA A;  4IFD I;  5LMU L;  1IHZ A;  3BVG A;  2R7Z G;  1SJE D;  3A5U A;  3AOG A;  3UDF A;  2GNO A;  4K5X A;  3GP7 A;  4I7A A;  2ZT9 C;  2YYZ A;  3KF6 B;  3K7A B;  4HSP A;  2NN6 I;  4X3U A;  4IBE A;  3ZC7 B;  3CC2 A;  1L2D A;  1IQP A;  2OO9 A;  2XZU A;  1Q1E A;  2OEO A;  1ZAE A;  3S14 H;  4PMC A;  3PO3 H;  1IN5 A;  3S15 H;  4AQY Q;  1G71 A;  1VQ1 A;  3DFZ A;  3BZK A;  4JBM A;  4K0K L;  1RTN A;  1KXL A;  3ULJ A;  5L8R F;  3D4D A;  1Q81 C;  5ELD A;  2V1C C;  3EQL C;  1PV4 A;  4AG6 A;  3X3N A;  3GTQ B;  3SMS A;  4LZZ A;  2R7D A;  2ZM6 M;  3DHQ A;  3IG8 A;  1QQW A;  3HOW G;  1IBK M;  3W1B A;  2PPB C;  3M9B A;  2V1U A;  1OIZ A;  2K75 A;  4C3H G;  4FNF A;  4XGI A;  1BOS A;  1M8A A;  3I51 A;  4A3B B;  2K0B X;  5DFL A;  5EP2 A;  4A3M H;  2JNH A;  2VDB B;  4K0K Q;  3VFD A;  4JK1 C;  1DXM A;  4A75 A;  1PTO H;  4ZQ3 A;  4OWX B;  3U5Z A;  1L8Q A;  3VYR A;  2EQS A;  4YWK A;  5C0X I;  3LVW A;  3U50 C;  1B50 A;  3TSS A;  3K92 A;  3HOZ G;  4A3J B;  1MHW C;  1IKM A;  3SAU A;  3TP8 A;  4NXM L;  1OFI A;  2JN4 A;  1HHV A;  3SAS A;  3KBX A;  5CR3 A;  3OIQ A;  4KTA A;  1DO2 A;  1K3B C;  1PLF A;  3CF2 A;  2EJF C;  2VF8 A;  1CUK A;  4XYQ A;  4QMG A;  3SAR A;  1Y1W H;  3CCS A;  3QOJ A;  2GQF A;  2KCN A;  5JOB A;  3PUX A;  1VF5 C;  2KED A;  4GNX C;  2OOA A;  3RLO A;  1UNS A;  4HJ8 A;  3LQR A;  1VQC A;  5FO7 B;  3T15 A;  4LFB M;  5FTN A;  1GOZ A;  2NVY H;  1JR3 A;  4LG2 A;  3P20 A;  4ODG A;  4LJ6 A;  4HCS A;  2ENB A;  2HQL A;  2FMC A;  1XXH B;  4YWM A;  4DF7 A;  4I81 A;  2WKD A;  3F2D A;  3HJ8 A;  2QP9 X;  3KUP A;  1IW7 C;  3I4O A;  3J7Y W;  4A3E H;  4NXM Q;  1PH2 A;  3CGW A;  2SNS A;  3MC0 B;  1NJF A;  1P3Q Q;  4RGT A;  1NO1 A;  2HDL A;  2QDL A;  5C5M A;  3HU1 A;  2VQF Q;  1B8A A;  2JWS A;  1PDQ A;  3I7F A;  1JE4 A;  4XQJ A;  1I6H H;  1OO9 B;  2PW7 A;  5KEE A;  3NBI A;  4LF9 L;  1UFZ A;  2A74 C;  2QBY B;  4LFA M;  1RL2 A;  3S1M H;  1BR9 A;  3L26 A;  2D5D A;  3TDQ A;  1OTR A;  2VF7 A;  4XK8 F;  2JY8 A;  1VQO A;  5M5Y H;  1TWH H;  2F0E A;  1ZKO A;  1A5T A;  3GTL B;  1CT1 D;  3TRZ A;  2Y0Q A;  4IJF A;  4GKK M;  5CV6 A;  3PIO A;  1XNQ M;  2UUB L;  1STG A;  4L16 A;  2XN9 C;  3FRP B;  3CCE A;  4KMU C;  3AFQ A;  3GLG B;  1C4Q A;  3NK9 A;  1C0A A;  1SYG A;  1RDP D;  3VYU A;  3J81 j;  4ZAI A;  3TP7 A;  4LF9 Q;  4MGY E;  2CEA A;  4IQZ A;  3FPP A;  3R8F A;  3HG9 A;  1FVI A;  1F9Q A;  2F1M A;  2MQH A;  1Z5C A;  3L29 A;  3U60 B;  1Q46 A;  1B4O A;  1PA6 A;  3QYE A;  3V76 A;  4QF4 A;  4PT5 A;  1LTT D;  3VYT A;  4EQP A;  2JA9 A;  5JI2 E;  1Q3L A;  1CSQ A;  1OQY A;  4JI5 Q;  2UUB Q;  5C6A A;  1Q8K A;  4B3M Q;  2JK8 A;  5KQ8 A;  1D6E C;  2R62 A;  2LMC B;  2WAQ E;  3NTH A;  1G3I A;  2HCI A;  4G7O C;  3E21 A;  2ID0 A;  4OON A;  4LK1 C;  2AQ1 B;  1N36 M;  3KP1 E;  2RDF A;  1O7I A;  2JP7 A;  1SYF A;  1XTC D;  4IUQ A;  3HOV B;  2NVX B;  1D2N A;  1RHP A;  3R8B A;  1JJ2 A;  1KDA A;  2EKF A;  4HJA A;  2XIW A;  3PF4 A;  3I91 A;  1KDB A;  3KDF B;  3G7L A;  3LMM A;  3KK7 A;  2RF4 A;  3HOU G;  4RKL A;  3J7A F;  1U4L A;  2KEN A;  4JOI A;  3AMU A;  2KCM A;  1HTP A;  1IFY A;  3J7B A;  4JI4 M;  2W82 A;  4IBI A;  3J80 c;  4WRD A;  1BF4 A;  2B2V C;  2ICI A;  4IJL A;  1JJG A;  3I3C A;  4B08 A;  1G8Z D;  3T38 A;  4DK3 C;  3HRZ C;  1O7L A;  3MJ5 A;  1B3Q A;  2A69 C;  2L5T A;  2O5R A;  4R4C A;  4DV3 M;  5IT9 S;  5ELE A;  4C2M B;  2YFQ A;  4LY6 A;  4DK6 C;  3K57 A;  3HFZ B;  4ZKB B;  1TF0 B;  2XF3 A;  5ITX A;  3K8Z A;  2RSN A;  1NJI C;  1E1O A;  3K7A H;  2L2D A;  5HY6 A;  1SE2 A;  4QCL A;  4PMW A;  2AWN A;  1RCV D;  2M9V A;  1L2C A;  3FTF A;  1LTB D;  2LWX A;  5FO9 B;  1H9S A;  1B1Z A;  5T1G A;  3AEV A;  1KRT A;  4A3D B;  2F5N A; 
#chains in the Genus database with same CATH homology
 1T3T A;  3E6Z X;  1NNU C;  1OXX K;  4PMB A;  3G6J B;  4C3I B;  4JI0 M;  2PNR C;  5CC4 A;  1ENC A;  1JOR A;  1O80 A;  4G4O A;  3RZO B;  1Z7T A;  3CU7 A;  4OIK A;  5D65 A;  3P7J A;  2P5T A;  4FCT A;  3K2L A;  1HXY D;  5ITU A;  1NR2 A;  4FXD A;  3OPO A;  3QWL A;  5EPL A;  1STN A;  2X49 A;  2E75 C;  1E2Z A;  3RD4 A;  1I50 B;  1Q90 A;  3I4M B;  2RDG A;  2V1C A;  3JR4 A;  3OSO A;  3E0J A;  4DGZ A;  5A2Q S;  2NBF A;  1L2B A;  3HOY B;  3AOE C;  4G7H C;  3VLF B;  3WOE A;  2Q8I B;  4QUC A;  1TS3 A;  1YNJ D;  4A3G B;  2F0J A;  2SDF A;  1PTO C;  2XRQ D;  3A8I E;  2NQ8 C;  5GKN A;  2RA4 A;  1E9R A;  5C4X B;  2ZBK B;  5I6W A;  1LTG D;  4GIT A;  2KA7 A;  4MHE A;  4DR1 M;  1MI2 A;  1R2Z A;  3NQI A;  1ENA A;  3BZD B;  1S3S A;  2C9O A;  4B3T M;  1N78 A;  4AI6 A;  3AL0 C;  2JA6 B;  2E2H B;  1F77 A;  1X37 A;  4LRT A;  3S1Q B;  4LF5 M;  4FF4 A;  1SNC A;  2I07 B;  2H1E A;  1BCP D;  1PZI D;  1YSY A;  4RA8 A;  1Z59 A;  4DN4 M;  2QCU A;  1XWI A;  2A73 B;  2L09 A;  1PRT B;  1BCP B;  1R2Y A;  5CV9 A;  4NRV A;  2Z7J A;  3MEH A;  4UAI A;  3SK5 A;  4X66 M;  2HDM A;  1HA5 A;  1S5D D;  3VA5 A;  1YNN C;  1LV7 A;  2HCC A;  4Q5V A;  5JPN C;  2F5P A;  4L4U A;  3KFU G;  4M9X A;  4TKO B;  1Z5A A;  3FDT A;  2QF7 A;  1STH A;  1KDC A;  2F0T A;  2Z4S A;  5COR A;  2RGO A;  1WTO A;  2FHT A;  3GP1 A;  4FP5 D;  5BN4 A;  3M85 A;  2A6H D;  3U9O A;  2O5J C;  1DD2 A;  3D8G A;  4S12 A;  3NQT A;  3VDP A;  4I65 A;  1FR3 A;  3LWU A;  1TY2 A;  4KV6 A;  2BOS A;  3L28 A;  2FMM A;  4DFA A;  3KLR A;  3K5M A;  2J7Z A;  4KKT A;  1XHB A;  1EYD A;  3KOZ E;  2FFK B;  1PRT F;  1BCP F;  3W0F A;  3KOW E;  3Q8X A;  1DYQ A;  1MD2 D;  2F0F A;  2YR0 A;  3DXJ C;  4MGI E;  1LTI D;  1SJH D;  3JAM S;  2KZU A;  5I2X A;  2EYP A;  2VB2 X;  2I46 A;  4B7H A;  2EYL A;  1SXJ D;  2A5Y B;  2Q2E B;  1HT1 E;  1G41 A;  4GHL A;  3R2I A;  4DUZ M;  2G8L A;  1GL6 A;  3QOL A;  4M1U B;  1TWA B;  4WUR A;  4KY6 A;  3D3R A;  3HEJ A;  1PFN A;  3HZX A;  2KRK A;  5ELB A;  3FTD A;  2V4D A;  4IAL A;  4L6T B;  3CRK C;  3NTK A;  1I4G A;  3PV0 A;  2B2V A;  1F2L A;  3H4M A;  1U4M A;  2F0W A;  1VCI A;  1HNX M;  3DWQ A;  5EGT A;  1TWC B;  2M2L A;  2JA5 B;  3EIH A;  1STA A;  1IN8 A;  3DEO A;  2AHM A;  2NYZ D;  3MHB A;  1Z6T A;  3MFY A;  4BA2 I;  4AKH A;  3I73 A;  1QAO A;  2K32 A;  3A56 A;  4DK1 A;  4ZUJ A;  4UDU C;  3QAU A;  3J80 L;  1NSF A;  5ITT A;  1WCM B;  2F5S A;  3URY A;  3GQ4 A;  4DV1 M;  4LGM A;  4N9T A;  2PW5 A;  3BDO A;  2EY6 A;  3LVV A;  2QPA A;  3FEW X;  3U6E A;  4QOS A;  1QZM A;  4F7X A;  1R4Q B;  4C1N I;  4G4K A;  4LJ7 A;  2F0V A;  1CQV A;  3D8L A;  3GLF A;  3KW6 A;  4WW0 A;  2J4X A;  5C0X J;  2VQF M;  3PUZ A;  3AOE A;  3KXE C;  5EJW A;  1CFM A;  2CV0 A;  3ZCB B;  3C2P A;  1EY6 A;  2B39 A;  5JVG 3;  1IN7 A;  4DV2 M;  2DNE A;  2BE5 D;  1LT4 D;  2F0H A;  2RBM A;  3M4O B;  2RKO A;  1LLR D;  2A6E D;  5ITX E;  5EKK A;  4PD2 A;  2D9U A;  4KOD A;  1HCZ A;  1TU2 B;  2H4O A;  4BLC A;  2R4J A;  4FF2 A;  3VR4 A;  4RKB A;  1V1O A;  4BB9 A;  2WAQ B;  2XZF A;  4X3S A;  3SHL A;  1HQY E;  2FIN B;  5FTL A;  2JXM B;  4EQN A;  4KI0 A;  1I4Q A;  2JP1 A;  1JOO A;  3SFZ A;  3C46 A;  5KPZ A;  1JWS D;  4GKJ M;  1XC8 A;  3GTP B;  3PUY A;  3EFX D;  1IN4 A;  2LKV A;  3HWS A;  4FXG C;  3I4Y A;  3KP0 E;  5KQD A;  2EY1 A;  4C3J G;  2F0Q A;  2A68 C;  1V1P A;  4JI5 M;  1NR4 A;  4B3M M;  2TMP A;  2LNH C;  1Q3B A;  4B3R M;  2R61 A;  3D6W A;  3BG3 A;  4AKG A;  2K5Q A;  4NKL A;  4NSR A;  2AUK A;  2BA1 A;  3S1R B;  1DJR D;  4PNY A;  2YNM D;  4L78 A;  3J2P B;  1SYC A;  1TS2 A;  1CA6 A;  3JAM E;  1FNV A;  3PVS A;  1LT5 D;  4C1N K;  2K28 A;  3RE8 A;  4FWD A;  1IXR C;  4RF0 A;  3TWM A;  4U67 3;  5FTK A;  2RKS A;  4YY3 M;  4IUU A;  1RJT A;  1G2T A;  3VDU A;  1HTL D;  5HUR A;  5EP1 A;  2NVT B;  1PZJ D;  2JEB I;  3Q22 A;  2LS0 1;  3DWP A;  2XSZ A;  5J39 A;  3NP8 A;  3FMC A;  4KJO A;  5DYG A;  1HQR D;  2C99 A;  2B2Y C;  1S5B D;  5DYI A;  3CTW B;  1EOT A;  4HAE A;  4MGH A;  4G4N A;  4XBO A;  3C1F A;  3KOX E;  2F0G A;  5CV8 A;  2K01 A;  4GHA A;  1SNQ A;  3OWF A;  3S2H B;  1ET9 A;  2OQ4 A;  1H9J A;  4F8M A;  2IL8 A;  4XIG S;  2OXP A;  1JWM D;  4DA2 A;  1XNR M;  1FNW A;  2EO2 A;  2WII B;  1TS4 A;  4A93 B;  1B9M A;  4RHR A;  1DGH A;  3A45 A;  5FTM A;  4KK7 A;  2E5L M;  4CJ0 B;  4CIS A;  2RQX A;  4K5V A;  2N88 A;  2ERC A;  3GRY A;  3EVQ A;  4M0D A;  4WFN 3;  1EY5 A;  3WOF A;  4JI8 M;  3E4R A;  3SVM A;  1YE9 A;  5EKL A;  4A3V B;  4IZ8 A;  4AG5 A;  5KYI A;  1FNN A;  1TR5 A;  2MPM A;  4XQQ A;  3GLI A;  5CV7 A;  1A15 A;  5C5L A;  1PZK D;  4RHS A;  3NWS A;  4BS9 A;  1L0X B;  2QCP X;  2PO4 A;  5EKI A;  1NSN S;  4HCE A;  3KSJ A;  4JI7 M;  4XT1 B;  5IWA M;  3J81 L;  3NWT A;  4RCN A;  5M5W B;  1S5C D;  1MBY A;  1U9R A;  3T56 B;  1KNA A;  1YNJ C;  1J09 A;  4JYA M;  1ZXT A;  1HFG A;  2VNU D;  3QO2 A;  3RZD B;  3NWL A;  3GPX A;  5D3I B;  1DOL A;  3FPU B;  3D6C A;  2DHR A;  1SNM A;  4Q0F A;  4DV4 M;  3MVV A;  2X8A A;  2MJ8 A;  4EGV A;  2KXE A;  3T16 A;  1Q8I A;  3SXH A;  3U5Z B;  3U6P A;  2I7N A;  1E2V A;  3V2T A;  3GQ3 A;  2F0I A;  2UXC M;  4WOR A;  5FLX S;  1BXT A;  2C9C A;  2IX0 A;  3MZ5 A;  1KTK A;  4BBS B;  1EY0 A;  5I6Y A;  1ML0 D;  1W6K A;  3HHX A;  2UUC M;  1BCP C;  4CKE A;  4IUP A;  1TGU A;  3GTK B;  4CKC A;  4DR6 M;  5M3F B;  3SAW A;  1HNZ M;  4FXK C;  2DWN A;  2I7P A;  2C96 A;  3OIP A;  1GUW A;  1VF7 A;  2X6L A;  3P1H A;  3VYS A;  4M9S A;  3GD7 A;  2A5H A;  5A35 A;  2BJW A;  4XTC S;  2WB1 B;  2A68 D;  3KBG A;  4LJZ C;  1ILP A;  5IGE A;  4OGQ C;  5JEA J;  4KY5 A;  2IWH A;  5JPM C;  1K8O A;  4DXG A;  1HUM A;  3KS8 A;  3BOS A;  4EQO A;  1SXT A;  4HSV A;  3GPU A;  2R65 A;  3DOA A;  2IJ0 A;  1DZ1 A;  3L2A A;  5C1B A;  5EP4 A;  2F5Q A;  2PCF B;  4HMI A;  1XWE A;  4FWG A;  2A6H C;  1OXV A;  1GKI A;  1SSO A;  1HNW M;  3AJI B;  1XYI A;  3QJY A;  2B2U C;  1JB3 A;  1MSH A;  3MXP A;  1WD1 A;  3U60 A;  4R8N A;  3T13 A;  2E2D C;  1F2Y A;  3UK6 A;  5BR8 M;  4D81 A;  3GTG B;  3GRR A;  1AZQ A;  1F2Z A;  1EQT A;  1SE4 A;  5JAV A;  3PUW A;  2F0O A;  1IL8 A;  1IBM M;  3FYC A;  3SC3 A;  1SXJ C;  2B8F A;  1J9O A;  5COY A;  1F9P A;  2SNM A;  2B2Y A;  2VB3 X;  2HKJ A;  5D14 A;  1NAP A;  2K5W A;  4A3F B;  2Z4H A;  1JWU D;  4LJA A;  2G9H D;  3PFI A;  1OJL A;  4HN7 A;  2M60 A;  3HJQ A;  4KY7 A;  3LNN A;  5C44 B;  1Q1B A;  1G6Z A;  5LMN M;  2F0S A;  2L9H A;  1ET6 A;  4JI3 M;  2MHV A;  3I4N B;  1ORY B;  3FUV A;  1TWF B;  5AFW A;  1CI3 M;  2LXE A;  5JJZ A;  4YHH M;  1EWC A;  4LJ4 A;  2ZXO A;  1IYV A;  4DR3 M;  1N32 M;  1H9S B;  2R92 B;  5C4J B;  5C4H A;  4GH9 A;  2DVW B;  1IYU A;  4QIW B;  2R7Z B;  3UJN A;  3I4L A;  2DZN B;  3HJS A;  2B2W C;  4R9W A;  1DO0 A;  2WP8 J;  3J7A S;  4RH6 A;  1ICW A;  1D5X C;  5C0X H;  4V19 0;  1STE A;  5FLX E;  3UI2 A;  5IGD A;  3H0G B;  2JYO A;  3MXU A;  2O4X A;  5KPR A;  4DV7 M;  1GUS A;  2CUZ A;  1BUV T;  3SDZ A;  1GUG A;  3GTJ B;  2NUC A;  1A3V A;  3GPP A;  2Z1C A;  3GTO B;  3IAY A;  5KRU A;  3HOW B;  3NBH A;  5EBC A;  1ESR A;  2L0C A;  4OHJ A;  1PJI A;  3NSW A;  2BE5 C;  5LL6 S;  2A6E C;  3UZU A;  3SK4 A;  2JEA I;  1UAP A;  1RTO A;  1AFP A;  3M3Y B;  3HOZ B;  3S1N B;  1ESF A;  1GLN A;  2D7E A;  2AQ2 B;  3BYY B;  5KND A;  1AZP A;  1II3 A;  1PRT D;  4CBV A;  1G59 A;  4IUT A;  3U61 A;  2QDB A;  1L1Z A;  3GLH A;  2D7G A;  2AUJ D;  1NJG A;  2IX3 A;  3FTE A;  2F0U A;  3H94 A;  3I70 A;  4TSS A;  2RSO A;  2PMZ B;  5KYL A;  1HFN A;  3AU7 A;  3OOC A;  2XRS D;  3KLS A;  4QOZ C;  3TPZ A;  4XDX A;  3BDL A;  1SNO A;  2L12 A;  4OX9 M;  4I4L A;  2QKI C;  2VXW A;  1UM8 A;  3U6C A;  3CRL C;  2NTT A;  1ENF A;  1IY2 A;  1SYD A;  4K8I A;  1TS5 A;  2QZ4 A;  5DM6 3;  4FW9 A;  2XVS A;  5D3D A;  3FUW A;  2CV1 A;  4K2K A;  2IT1 A;  1Y8N B;  4GRI A;  3SMP A;  3S17 B;  1PFM A;  4G57 A;  1DM0 B;  3F2U A;  1GJX A;  1DGF A;  3C3L A;  1H9R A;  3FD9 A;  1UEA B;  2L1B A;  3J81 S;  4HMJ A;  5IT9 E;  3CF6 E;  1CZW A;  1TDZ A;  1WTP A;  2JE6 I;  2B2U A;  2HL7 A;  3KDS E;  4KKS A;  5J1Z A;  1EYA A;  4X3T A;  4OVZ A;  1FNU A;  3PUV A;  1SMY D;  2K05 A;  1WD0 A;  5C3X A;  3OMG A;  4ILW A;  1TH3 A;  3SK6 A;  2Z8L A;  2KEC A;  1NCV A;  1J8I A;  2XH9 A;  3LX0 A;  2EA0 A;  1EU4 A;  2XWB B;  4HED A;  1IM2 A;  5TSS A;  2XFT A;  3SHG B;  4L8J A;  3HGB A;  4AQY M;  2VUM B;  3R9X B;  2EYM A;  1SXJ A;  2XNA C;  4PCZ A;  4KN7 C;  3U6O A;  5C4Z A;  3HOU B;  3FVQ A;  1KAB A;  1I4W A;  4G6Z A;  4X64 M;  1QG7 A;  5EBD A;  2NTS A;  3AB9 A;  5LMU M;  4C56 C;  2M00 A;  3NUC A;  4ZUI A;  2EYH A;  4H44 C;  3VKG A;  4J6H A;  4IFD J;  3L27 A;  4B9W A;  5A2Q E;  4K0K M;  1JIC A;  1QB5 D;  4I7Z C;  1OXT A;  1K3W A;  4TUW A;  2CE7 A;  3VK7 A;  1H9K A;  4JN6 A;  1WTX A;  1C8C A;  4ITQ A;  3H6M A;  4PV1 C;  1VMC A;  2X4A A;  3RGS A;  4ZYS A;  4MGK E;  1JR0 D;  4RAU C;  3SHF A;  3A8J E;  4M9Z A;  2DY7 A;  3GRU A;  3V05 A;  1G29 1;  3U6S A;  1K83 B;  3A8K E;  3I8Z A;  2EJG C;  2F0N A;  1W5S A;  2F4V M;  1R4P B;  2WKC A;  2CHB D;  2PZT A;  5KIX A;  4CJ2 C;  1EQV A;  3M7G A;  2YU9 B;  5HGT A;  3OTO M;  2L7H A;  2B2W A;  2HQE A;  4NXM M;  3GQB A;  1JQY D;  1BBX C;  1EZ8 A;  1AW7 A;  1DOM A;  5FTJ A;  3S14 B;  3PO3 B;  4ZPX A;  2NVQ B;  5E1F A;  2GA4 B;  3CKI B;  2EUC A;  1PMR A;  2F0L A;  2J7O A;  3FYD A;  3QB3 A;  5E4W C;  4KD3 A;  1BDO A;  3T4A C;  3GLF B;  4J8Q A;  3K1J A;  1AN8 A;  3AKZ A;  3R3O A;  3H3V C;  4X3K A;  3GV6 A;  1L1T A;  1IY0 A;  3RFW A;  3VR3 A;  2CHV A;  4Z8X A;  1G2S A;  3MXN A;  1QVR A;  4ZLT F;  2G5G X;  1EIH A;  1R9T B;  3SYL A;  1LAB A;  4A3M B;  1CHQ D;  1PTO B;  3MK6 A;  3TZD A;  4IBB A;  1KFV A;  4LF9 M;  3GQ5 A;  1HQC A;  3DA1 A;  2KOL A;  5JEA H;  1HT2 E;  4RF1 A;  1YUB A;  2ZAN A;  1S5F D;  1GUO A;  3IG5 A;  2KW0 A;  4FCW A;  3HHW A;  5BPV A;  3DM1 A;  3OW7 A;  4NDX A;  1CM9 A;  2UUB M;  4L15 A;  1Y1W B;  5IZ7 D;  1H6U A;  3SAT A;  3PIO 3;  4DV0 M;  5CBE E;  4CKB A;  4LAA A;  4MB7 A;  3K6O A;  3B9P A;  1HUN A;  5EXX A;  4F88 A;  1SNP A;  1V1P B;  1JOK A;  3IL8 A;  2RDH A;  4A3E B;  3RUZ A;  4O1N A;  2HUG A;  4ZK9 B;  2N55 A;  1AP0 A;  4IJE A;  1VDD A;  4K6D A;  4H0L C;  4DNT B;  5FO8 B;  2EPB A;  4TQU S;  1O7Z A;  1PTO F;  4OL7 A;  1QYR A;  2FE8 A;  1I6H B;  4HL4 A;  3JR5 A;  2JA2 A;  4RWS C;  4DXF A;  3OWE B;  1X32 A;  3TWL A;  2K33 A;  4IBD A;  4XXE A;  1ZYR D;  3S1M B;  4W5W A;  5KGU A;  1Q12 A;  5M5Y B;  1TWH B;  3M0E A;  3WHL A;  1F2M A;  1D1I A;  3PNV A;  2JSO A;  2BJV A;  5I4D A;  4G7Z C;  3T51 B;  2PQE A;  5ISR A;  4OO1 H;  3TE6 A;  5I9P A;  2TSS A;  1JCK B;  4XQN A;  2CHQ A;  2UXD M;  4KHV A;  4AYB B;  1IN6 A;  3A42 A;  4MH0 E;  5F2D A;  1DGG A;  4DNR B;  1TKW B;  4R7G A;  2NWG A;  2CVR A;  4M0W A;  3IFT A;  1K8M A;  3PNY A;  5G3L F;  4FVM A;  2KRU A;  3MA2 B;  3IKJ A;  4IUR A;  1CA5 A;  2DWM A;  2CQA A;  4LJ9 A;  2L4N A;  4S3S A;  5J22 A;  1BQQ T;  2HCB A;  3SE0 A;  1LAC A;  2BDO A;  4BWG B;  4LCB A;  4C3I G;  1QCB D;  3T53 B;  1SEB D;  1G4A E;  4LFC M;  1KLU D;  2K47 A;  1UUP A;  5EPJ A;  5IOC A;  1LT3 D;  3AV0 A;  1DGH B;  1XMQ M;  2UXB M;  4JV5 M;  5I9O A;  2F0P A;  4GIP A;  2K6A A;  1JOQ A;  5IOD A;  3NPP A;  3W0L B;  1GUT A;  4AW4 A;  3ITP A;  1EY7 A;  4LF4 M;  3IFD A;  3KS4 A;  2V6Z M;  4PDI A;  4KHZ A;  1VMP A;  4FCV A;  3GLI B;  2UUA M;  4NMZ A;  4II7 A;  4NXN M;  3BVZ A;  3MWY W;  1EY8 A;  4DR5 M;  4DV5 M;  1Z6H A;  4IUV A;  5M3M B;  1U4R A;  1NUC A;  4FO2 A;  1PJJ A;  1EE8 A;  2O2L D;  3V96 A;  4K14 A;  3ONA B;  3DZD A;  1L0Y B;  2C5C A;  3HU3 A;  3NXW A;  2CHG A;  3TL4 X;  1S5E D;  3ERQ A;  2Z3X A;  2FOI C;  1SXJ E;  3U6L A;  2O5I C;  1B9N A;  1XXG A;  4LZJ A;  2VII A;  1R6B X;  1DCZ A;  1X3Q A;  3QWN A;  1TT2 A;  3JAM L;  2EOT A;  1A2U A;  1GHJ A;  1XXH A;  3A46 A;  1PRT C;  2J0T D;  3TZU A;  1SAP A;  1JR3 D;  3RLF A;  3PO2 B;  7CAT A;  3HOX B;  1NVM A;  1A6X A;  4L8R C;  4GMQ A;  4LF6 M;  4J1M A;  2KJX A;  3OMC A;  3FUX A;  2CFO A;  1EYC A;  3BS1 A;  5IIF A;  1QAM A;  1CHP D;  1W6J A;  2EE1 A;  4KKU A;  1KYI A;  1BO0 A;  3KSX A;  3L7Z C;  1NY5 A;  2ZAM A;  2F5O A;  4CJ1 B;  3D4R A;  3I72 A;  1HPC A;  2QBY A;  3A54 A;  5IRE B;  4YIJ A;  3PIP 3;  2B63 B;  1HR0 M;  4M8A A;  1WTV A;  3AFH A;  3CHB D;  3ERO A;  1SND A;  2KHS A;  1STB A;  4H7B A;  2K5D A;  2Y0T A;  5EXT A;  5JEA G;  3SR1 A;  2YQZ A;  3SAV A;  5CBA E;  1D5Z C;  3K5N A;  2BA0 A;  1A2T A;  2VQE M;  3J80 S;  3GLG A;  4OW0 A;  1O78 A;  1IY1 A;  4C3J B;  4ME5 A;  2XGN A;  2L7I A;  3DWA A;  1Q3C A;  2EY2 A;  3GPY A;  1V43 A;  4DR7 M;  4DK0 A;  3O13 A;  3PXG A;  2XWJ B;  3FUU A;  2G9D A;  4AZF A;  3ZYY X;  4BA1 I;  1EEI D;  1WVL A;  1KAA A;  5F3W A;  4QNM A;  2MGS A;  3THG A;  3L9A X;  4F87 A;  2HHH M;  1Z47 A;  1TQO A;  3ND8 A;  1I6V C;  2B2T C;  5DEH A;  4MM3 B;  3HHZ A;  5KNC A;  3NTI A;  1G91 A;  3MAQ A;  2F0D A;  1SMY C;  1ZQ9 A;  3TQS A;  4QHS A;  5C18 A;  4FF1 A;  2SOB A;  1QE6 A;  4TRD A;  1Y8P B;  5E4X A;  1QIL A;  4IBG A;  4BBA A;  2Z4I A;  3J7A V;  2EVB A;  1OXU A;  2FJ2 A;  1N75 A;  3KLS X;  2J7N A;  4B7G A;  2E2I B;  2DN8 A;  3NE5 B;  3NHH A;  4DUY M;  5FSW A;  2FNA A;  3Q24 A;  4OO1 G;  1Z5B A;  2ZXP A;  3W2D A;  4XT3 B;  2KVM A;  4NSO B;  4D82 A;  4IFD H;  2DXI A;  2OF1 A;  2KQ3 A;  1DOK A;  3WHK A;  2C98 A;  4NOO B;  2NN6 H;  2X6G A;  2WV6 D;  4KHP M;  4ABN A;  4K2L A;  4EVO A;  3SK8 A;  3S16 B;  1TH2 A;  3M6A A;  2L6O A;  5IGG A;  1PYW D;  3DUZ A;  1V8Q A;  1LTA D;  5H37 D;  1GL7 A;  2LH0 A;  2R6G A;  2CW0 D;  4B7F A;  2CV2 A;  2XSC A;  3RMH A;  1X3P A;  1ONL A;  3TME A;  5ITR A;  5EQ0 A;  4XYO A;  2NB0 A;  1E94 E;  3BYT B;  4IN3 A;  3BDC A;  4R8I A;  4BY7 B;  1GXD C;  3CQZ B;  4BY1 B;  5DAU A;  3ND9 A;  3FKE A;  4G4Q A;  3SBJ A;  1B53 A;  2JA7 B;  4RGO S;  1Y69 U;  2OT2 A;  3HP3 A;  2IW3 A;  3VR2 A;  3Q23 A;  4ZRZ A;  1QAN A;  1M4V A;  1FYC A;  1SDF A;  3N52 A;  4ID6 A;  2K1B A;  4MN3 A;  4IUN A;  4LJ8 A;  1TWG B;  4WJW A;  1I4P A;  5DM7 3;  1HQM C;  3TBI B;  4QUF A;  4LF8 M;  2R3Z A;  4RCO A;  3C58 A;  3K5O A;  4C3H B;  1EZ6 A;  3U9S A;  3E9S A;  3SYK A;  1WTW A;  4LRS A;  1U4P A;  3A7L A;  3WDN A;  1MU5 A;  5I2Y A;  3GTM B;  3FKI B;  4HLQ A;  1N77 A;  3D8B A;  3L25 A;  1LV9 A;  2ZXR A;  1KLG D;  3MHV C;  5EQT A;  4JI1 M;  4K8J A;  1B2T A;  3S2D B;  4QHT A;  2DY8 A;  4DAV A;  4B3S M;  4LJ5 A;  3HHY A;  2DNC A;  1EY9 A;  4PQX A;  5ITQ A;  4DAP A;  4FWH A;  1QJO A;  1OFH A;  2IPK D;  4K5W A;  2Q8T A;  1DGB A;  3J80 E;  4X62 M;  4JBW A;  3GO5 A;  1EEF D;  1ROD A;  4U68 A;  4B9X A;  3GO8 A;  2F3W A;  4H13 C;  1NHG C;  4DU9 A;  4CHT B;  1CZG A;  2KEB A;  2KEE A;  1IW7 D;  3RGP A;  2EYJ A;  5CMD A;  4Z6Y A;  3U61 B;  3H09 A;  1QAQ A;  3GLH B;  1SYB A;  2DWZ B;  3HKZ B;  4NL4 H;  1MSG A;  2C5R A;  1CTM A;  4DR4 M;  2LFN A;  2E76 C;  2B8G A;  2EYF A;  3SEB A;  1GHK A;  3KOY E;  4D80 A;  3T1Y M;  3ILK A;  1B3A A;  1K3X A;  3A98 B;  5KO3 A;  2MUY A;  4G4R A;  4KLN A;  2R93 B;  2Y21 A;  1I3Q B;  3GV3 A;  2BNK A;  4IBK A;  2K03 A;  5M5X B;  5NUC A;  1N34 M;  2UU9 M;  5CV4 A;  1BNZ A;  2JA8 B;  1VDZ A;  3VR6 A;  2PZU A;  1A3U A;  1SFO B;  2NZ1 D;  2X69 A;  3U6D A;  4IBJ A;  4A3K B;  5EXP A;  1K82 A;  3TP6 A;  1IXS B;  1ZYR C;  3VK8 A;  5K36 H;  1G8P A;  4I5S A;  5JVH 3;  2R18 A;  2RGH A;  3BVM A;  1C48 A;  4RGN A;  2D7H A;  4Y7N B;  1R7R A;  5BN3 A;  4X65 M;  3QG1 A;  4RGM A;  4GC5 A;  2QEJ C;  1Y8O B;  1TII D;  2B2T A;  3D4W A;  3MTS A;  1IBL M;  2EXZ A;  2PYK A;  1RF2 D;  4CGY B;  1PM5 A;  2BCO A;  1CQF A;  2RVL A;  3U6M A;  1TVX A;  1AEX A;  2EJM A;  4OVZ B;  5CV5 A;  3P75 A;  1XMO M;  2F4I A;  3EA6 A;  1RD9 D;  5DNF A;  2KA6 B;  2K04 A;  3J27 B;  3S9W A;  1EIG A;  5FLX L;  4IBC A;  2PZW A;  2SEB D;  4L63 B;  5CYU A;  3LWE A;  4DR2 M;  2XLJ A;  2K7V A;  1OXS C;  1MGS A;  1J5E M;  2XFS A;  4OO1 I;  3TN2 A;  1EWH A;  1SE3 A;  1LTS D;  3L3O C;  1MX0 A;  2A69 D;  1T5E A;  4O42 A;  1SXJ B;  1B44 D;  3C1E A;  3R2T A;  1TDH A;  3M7N A;  4IFD G;  1F9S A;  1EU3 A;  4Z9C B;  1QOH A;  3D31 A;  1NNJ A;  4JI6 M;  5K5P A;  2QEN A;  3MFG A;  3A55 A;  2NN6 G;  3Q6S A;  1T5X D;  8CAT A;  1LO5 D;  2WAC A;  2F0M A;  1SYE A;  4P16 A;  4LGY A;  3ZH9 B;  4AKI A;  2WIN B;  1ZEQ X;  3M4Y A;  1JC7 A;  1LTR D;  3HS0 C;  3I90 A;  3VR5 A;  4ZKC B;  3VA7 A;  1Y1V B;  5JI3 E;  1W5T A;  1QNK A;  3LQQ A;  5IGC A;  3DEP A;  3UGJ A;  2F3V A;  5E3F A;  1STY A;  2R46 A;  1SBB B;  2KCC A;  5ELF A;  2EZV A;  5M9O A;  5FOB B;  3S15 B;  5C0X G;  1EL0 A;  1FGB D;  4IBF A;  3FUT A;  2EYO A;  1FJG M;  1GUN A;  2AQ3 B;  4NW2 A;  1WXQ A;  1E32 A;  3CF0 A;  4A3I B;  3H91 A;  4DAY A;  2MP1 A;  4KO8 A;  1PTO D;  4K6L A;  4LMQ D;  1DON A;  1D5M C;  5EXS A;  1D1K A;  4RNA A;  1KSF X;  2DZO B;  1IKL A;  3HKP A;  3E5S A;  4LF7 M;  1PFB A;  4BBR B;  3EJI A;  2EDG A;  1C1K A;  5CGK A;  4GZY C;  4JXJ A;  1CK1 A;  5ELC A;  2ZAO A;  3GRV A;  4KJN A;  2M5Z A;  3HGI A;  5EP3 A;  5IT9 L;  2F03 A;  1HRJ A;  3KVW A;  1F9R A;  1N33 M;  5LHY 1;  2Y0S B;  5FK9 C;  3K5L A;  4KD4 A;  1QNU A;  3K0Y A;  2KZS A;  4OIJ A;  4IIW A;  4OU7 A;  2L11 A;  2Q8R E;  5E6J A;  4JI2 M;  3EIE A;  4QNR A;  3J81 E;  2AWO A;  4P2C B;  4DV6 M;  2EY5 A;  1Q39 A;  3VKH A;  2ICE C;  1D2B A;  1TH4 A;  5E26 A;  2NVY B;  4HR7 B;  3OHX C;  5BN5 A;  1KNE A;  2D2C C;  1A3T A;  3R93 A;  3N6R A;  5G3L D;  2R4E A;  1ILQ A;  1YNN D;  2QIL A;  5C3W A;  1J7K A;  4N9P A;  4REZ A;  5DNY A;  3KF8 A;  4FD2 A;  4GC9 A;  4R3D A;  3A7A B;  1WTR A;  1O7Y A;  5C3E B;  1IXZ A;  2E74 C;  3K59 A;  2XEP A;  4E6I A;  2R45 A;  1EY4 A;  1I4H A;  5A2Q L;  5EJC A;  2H1R A;  3QIA A;  1PXU A;  3HU2 A;  1E0B A;  2XSZ D;  1FD7 D;  3U6Q A;  5IGB A;  2F0K A;  2KUM A;  1JQJ C;  1E9S A;  5T1I A;  3TP5 A;  2LY7 A;  5K36 G;  3FTC A;  2D62 A;  1E2W A;  4EIW A;  4HTH A;  1I94 M;  2DWL A;  4KN4 C;  5KNB A;  5EPK A;  4MGZ E;  1GVN A;  2FFJ A;  1WTQ A;  5KPT A;  5FKA C;  3T1H M;  2Z4R A;  4FYD A;  4NRW A;  3MXG A;  4FF3 A;  4QB4 A;  3UMM A;  1TY0 A;  4NP5 A;  1HA6 A;  1NHW C;  3W3A A;  3DMU A;  3PMF A;  1H9M A;  4V0B A;  1QWY A;  1I4X A;  4RFB A;  2IX1 A;  3I4V A;  5IGF A;  2E2J B;  1LT6 D;  2OPF A;  1I4R A;  1S4Z A;  2CW0 C;  2L55 A;  5LL6 X;  4MIU A;  5ITY A;  2BDN A;  1XX8 A;  1EFI D;  3Q0A A;  4I8O A;  3X3M A;  4ULL A;  1RKN A;  3TWK A;  4PDG A;  2Y20 A;  3K58 A;  1NY6 A;  4IFD I;  1IHZ A;  3BVG A;  1SJE D;  3AOG A;  4K5X A;  3GP7 A;  2ZT9 C;  2YYZ A;  3K7A B;  4HSP A;  2NN6 I;  4X3U A;  4IBE A;  3ZC7 B;  1Q1E A;  1IQP A;  1L2D A;  2XZU A;  2OEO A;  1ZAE A;  4PMC A;  1IN5 A;  3DFZ A;  1RTN A;  3D4D A;  5ELD A;  3EQL C;  4AG6 A;  3X3N A;  3GTQ B;  3SMS A;  4LZZ A;  2ZM6 M;  3DHQ A;  3IG8 A;  1QQW A;  1IBK M;  2PPB C;  2V1U A;  4C3H G;  4FNF A;  4XGI A;  1BOS A;  1M8A A;  3I51 A;  4A3B B;  5EP2 A;  3VFD A;  4JK1 C;  1DXM A;  1PTO H;  4ZQ3 A;  3U5Z A;  1L8Q A;  3VYR A;  5C0X I;  3LVW A;  1B50 A;  3TSS A;  3K92 A;  4A3J B;  1IKM A;  3SAU A;  3TP8 A;  1OFI A;  1HHV A;  3SAS A;  3KBX A;  5CR3 A;  3OIQ A;  4KTA A;  1DO2 A;  1PLF A;  3CF2 A;  2EJF C;  4XYQ A;  4QMG A;  3SAR A;  3QOJ A;  2KCN A;  5JOB A;  3PUX A;  1VF5 C;  2KED A;  1UNS A;  3LQR A;  5FO7 B;  3T15 A;  4LFB M;  5FTN A;  1GOZ A;  3P20 A;  1JR3 A;  4LG2 A;  4ODG A;  4LJ6 A;  4HCS A;  2ENB A;  4DF7 A;  2FMC A;  1XXH B;  4I81 A;  2WKD A;  3HJ8 A;  2QP9 X;  3KUP A;  1IW7 C;  3J7Y W;  3MC0 B;  2SNS A;  1NJF A;  4RGT A;  2HDL A;  5C5M A;  3HU1 A;  1PDQ A;  1JE4 A;  4XQJ A;  1OO9 B;  2PW7 A;  5KEE A;  3NBI A;  2A74 C;  2QBY B;  4LFA M;  1BR9 A;  3L26 A;  2D5D A;  3TDQ A;  2F0E A;  1ZKO A;  3GTL B;  1CT1 D;  2Y0Q A;  4IJF A;  4GKK M;  5CV6 A;  1XNQ M;  1STG A;  4L16 A;  2XN9 C;  3FRP B;  4KMU C;  3GLG B;  1C4Q A;  3NK9 A;  1SYG A;  1RDP D;  3VYU A;  4ZAI A;  3TP7 A;  4MGY E;  2CEA A;  4IQZ A;  3FPP A;  3R8F A;  3HG9 A;  1F9Q A;  2F1M A;  1Z5C A;  3L29 A;  3U60 B;  1B4O A;  4QF4 A;  4PT5 A;  1LTT D;  3VYT A;  4EQP A;  5JI2 E;  1Q3L A;  5C6A A;  5KQ8 A;  1D6E C;  2R62 A;  2LMC B;  3NTH A;  1G3I A;  2HCI A;  4G7O C;  2ID0 A;  4LK1 C;  2AQ1 B;  1N36 M;  3KP1 E;  2RDF A;  1XTC D;  1SYF A;  4IUQ A;  3HOV B;  2NVX B;  1D2N A;  1RHP A;  3R8B A;  1KDA A;  2XIW A;  3I91 A;  1KDB A;  3G7L A;  3LMM A;  3KK7 A;  4RKL A;  3J7A F;  1U4L A;  3AMU A;  1HTP A;  3J7B A;  4JI4 M;  2W82 A;  4IBI A;  4WRD A;  1BF4 A;  2B2V C;  2ICI A;  3I3C A;  4B08 A;  1G8Z D;  3T38 A;  3HRZ C;  1O7L A;  3MJ5 A;  2A69 C;  2L5T A;  2O5R A;  4DV3 M;  5IT9 S;  5ELE A;  4C2M B;  2YFQ A;  4LY6 A;  3K57 A;  4ZKB B;  2XF3 A;  5ITX A;  3K8Z A;  2RSN A;  1SE2 A;  4QCL A;  4PMW A;  2AWN A;  1RCV D;  2M9V A;  1L2C A;  3FTF A;  1LTB D;  2LWX A;  5FO9 B;  1H9S A;  1B1Z A;  5T1G A;  4A3D B;  2F5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...