4CHTB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex with bound calcium ion
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
215
structure length
215
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA TOPOISOMERASE 3-ALPHA
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 55
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4chtB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4chtB02
3NBIA 4CHTB 4CGYB
chains in the Genus database with same CATH superfamily
5EXTA 2JY5A 3BVGA 2X6LA 3DWAA 5EAYA 4KHVA 4DUZM 2WINB 2M00A 1DO2A 1XHBA 2OXPA 3GRRA 2CH4A 1FNWA 1WD1A 4IBFA 1T9HA 1HA5A 1ML0D 1FL0A 2E2DC 2F0OA 3TPZA 1II3A 3A5ZB 5JAVA 3J27B 3A98B 1LM0A 2O01F 1LT3D 3CCEA 4B3TL 3T1YM 1IBMQ 2PZUA 2LVPC 5IP9H 2FOIC 3S1NH 2JP1A 5I2XA 3S17B 3UI2A 1PH9A 1KQSA 4A3CG 4FXGC 2K9DA 1G291 1D5XC 1WTQA 3KFUG 1OXTA 1OXXK 5CV6A 3J7AF 1IN7A 1XMQQ 3OWFA 2RHSB 5JEAG 2KRKA 3E9SA 3VYSA 1PH7A 2NZOA 3K2LA 1GUSA 1N32L 1UWVA 4PT5A 2Y0SG 3NE5B 4IPDA 1TKWB 1QVCA 3S15H 2PI2A 3PIO3 3I7FA 4V0BA 3G71A 1GVNA 1XJVA 2JZ1A 2E2JB 3W68A 5GQOA 3KF6B 4HEOA 2MJ5B 4LF8M 2XGTA 4IUQA 1VS0A 2UXBM 3W1GA 3NTKA 5JEAH 2C9OA 1LYLA 1PRTB 4NDXA 4X64M 5CV5A 3ONAB 1IY1A 2WKCA 2HCIA 3RD4A 4II7A 5ITQA 1WJJA 2DWNA 1QUSA 2DAGA 4K0KM 4OWTB 3HWSA 3UJNA 1KLUD 1AE2A 3NENA 1T6OA 1VEJA 3W2DA 3C1EA 2F5SA 3SAUA 1BBWA 1WJ7A 1F9QA 1CKNA 2VQEM 4DV2L 4PV1C 1N34L 4X65M 2C5RA 1KNEA 4PD2A 3BVZA 4Z9CB 4GKKM 2AUKA 2AWNA 3HOWH 2L1BA 4A3GB 3S1MB 1EOVA 3IAYA 1PFBA 1SXJC 1K8MA 1JJ2A 5D3DA 1GKHA 2Q8IB 1EYCA 1Q02A 1UAPA 3WOEA 4QHTA 1SJHD 1NE3A 4CDCC 1YNJD 2CHVA 3KOZE 4DR3L 4X62Q 1XNQL 4LGMA 4FF3A 2JEBI 2L12A 1EFID 4RH6A 1E94E 4BA1I 3SR1A 1U9RA 4DAMA 2F5NA 1QZGA 2DWMA 1JJCB 1WTVA 5IWAM 4A76A 2F0MA 1F4IA 1VF5C 5ITXA 4QQBX 1SFOB 3PNYA 4QOSA 2KRUA 2KENA 4QIWE 3E9IA 4K8JA 4FNFA 1CHQD 4JYAL 1U4PA 4RKBA 4OIJA 1TWFH 1SNQA 3MEHA 4IPHA 1UEAB 1UEBA 2FMMA 3J80E 5IGFA 2G5GX 3GTMB 4ZKBB 4AYBE 3U4VA 1QVRA 4JI4M 3A54A 5K5PA 4MGYE 3U6OA 2IHFA 4PNYA 3GLGE 4MB7A 1CM9A 3NBIA 1K8AC 1GJXA 1D0MA 2L0CA 3E0EA 4B3MQ 1Q82C 4JI3Q 1W5TA 4HJ7A 3HKSA 2DKLA 4LFCQ 1D0KA 4C3HH 1JQYD 2RKOA 4JK1C 4GLAC 1JR0D 2N3SA 3WDNA 1VEKA 3ZCBB 5CC4A 2B2WC 1JICA 2UUBM 1TXYA 5FTLA 4GKJQ 4GITA 3FRHA 3I04M 2B63B 1WOCA 3HZXA 4YCWA 3NXWA 5J3BA 2DNAA 4AG5A 4X66L 3FP9A 2HWJA 5BR8M 2OF1A 1QQWA 1H9SB 3CCVA 5GAGC 2KHJA 3RGPA 2IHEA 3GDEA 3S2HB 1ZMWA 3NTIA 2EJGC 1Q3BA 1JE5A 3HOVH 3URYA 3D4WA 3D0FA 4I81A 3U6EA 4GN4B 3I56A 1EY8A 4DAVA 4M1UB 3KP1E 8CATA 3NBHA 4Z6YA 5K36G 1GUGA 4LFBL 2F0WA 3FE3A 3H0GG 5GAHC 3OIPA 2IX1A 3CF2A 2BA0A 3KLSX 4B3TM 4IBEA 1YHAA 1TH3A 1IFYA 2EYLA 4RCOA 5IT9c 5C0XI 2L6OA 1HNXL 4CISA 4DR1Q 3L28A 1G3IA 1VQ5A 3VKHA 1K9MC 3DA1A 2KEDA 1LTRD 4ZQ3A 2EKFA 3RMHA 2JA7H 3KDFA 3U9SA 3KLRA 4B7GA 4LF7Q 4FW9A 5GROA 3TZUA 4J6HA 3Q0AA 1N9WA 4DV7M 2I7NA 1IHZA 1C4QA 5CORA 2ZANA 4DXFA 3I90A 1ENFA 4LJ7A 3ZC7B 5EPJA 4A3VB 1KDAA 2E5LQ 1VQMA 2F4IA 2XSCA 4BA2I 2K01A 4BY7G 3GTKB 1ASYA 1CKNB 3R8BA 4MNOA 4REZA 2EJMA 5COYA 2SDFA 3IG5A 1SMXA 4B08A 1XPRA 3GTPB 4TQUS 3C46A 4IUPA 4HL4A 2Z6KC 4AYBG 5IE8A 3TRZA 1DGHB 1BQQT 4DV2M 1R4PB 4G7ZC 4IFDG 2DVWB 5DFLA 1IXRA 4G6ZA 3HOXB 1JR3A 4B9WA 5G3LF 4LF9Q 1EWCA 4WORA 1J5EL 4G4RA 3F1ZA 3J80S 1SYEA 3RE8A 4BWGB 1HA6A 2MHVA 3BXWA 3H0GB 2B8GA 3I4YA 4PCZA 1SRUA 3L7ZC 3GO8A 1SSOA 3TP7A 4ANRA 4K14A 1T43A 3C3LA 3TP6A 4Y7NH 1YJ9A 4IFDH 3A8KE 3IL8A 4EQNA 2ZTEA 1B1ZA 1XNQM 4XDXA 2XN9C 4OHJA 3KLWA 4LFBQ 2L15A 1TS2A 4FXKC 2NN6G 5JEAJ 1XC8A 1SXTA 2QEJC 4AKGA 1F9RA 3KSXA 3SE0A 1QVFA 2PCFB 4LMQD 5HGTA 1L1OA 3CMAA 4A3EG 3J7YW 3GPXA 5FTKA 4B3SM 3AL0C 2ZXOA 3S9WA 4A3JH 4GC9A 2IPKD 4XXEA 1SLJA 4JV5Q 2BNKA 4JYAM 1DONA 2H4OA 3OOCA 4MTKA 5BN3A 2OT2A 3MXPA 1ENCA 3B7QA 3FDTA 3GTJB 2VF7A 1CKMA 1R4GA 1TWCB 2NTSA 2A5HA 3D8BA 1FD7D 4BY7B 1V43A 2EY6A 4A93G 3VR6A 1R9TH 2BWEA 4HLQA 2AHMA 3UK6A 1JQJC 2K5NA 1CTMA 1E22A 5DLQE 4LRTA 1LACA 4DXGA 5KIXA 2B2UC 2JXNA 4AKIA 2XZFA 4JOIA 4AYBB 4DR7L 2D5DA 4NXMQ 4L6V6 2LS01 3SBJA 4AKHA 1IBLQ 3T56B 2QA4A 2ENBA 1HZBA 1HZ9A 2OQKA 4KN7C 4KHPL 2DXIA 3W0LB 2F0QA 2CFOA 2K75A 4YWMA 4UAIA 3I2ZA 1EZ8A 2YTVA 3H3VI 2RCFA 3GPUA 4ZRZA 3NELA 1R7RA 4RGOS 1L0XB 3CC2A 1RJTA 3TZDA 2TMPA 4PMCA 3G7LA 4EVOA 2LSSA 2KNAA 4X66M 4AW4A 1KIXA 3NP8A 5C3XA 4DAPA 4A3EB 3M3YB 3NBHB 2QF7A 5BPVA 4LG2A 4OONA 1J09A 2XVSA 2HHHQ 2UXDL 1IN5A 1W5SA 3SHFA 1TU2B 2K50A 4DK6C 3HU1A 2ZXRA 3WWVA 3TQSA 1V1PB 3ZYYX 1TIID 2CP8A 2OTJA 4ZPXA 3SASA 4BB9A 5IT9L 1ICWA 1X3FA 4BBRH 1PRTC 4QF4A 3CF5A 1IKMA 4A93B 5FTJA 1B9MA 4HSVA 3VLFB 3L29A 4JI5Q 1IXZA 3I72A 1V9PA 1HNXM 3KDFB 4DUYM 3KF8A 3I8ZA 4YY3Q 2EA0A 1U4LA 4IUUA 2UXCQ 1WIVA 1T5XD 4P2CB 2K6AA 2F0VA 3SDZA 2ZM6Q 1A63A 1LT4D 2AQ1B 2WSFF 4PZ6A 1PH5A 1QWYA 4MGHA 5I4DA 3R2IA 2J7ZA 2B3GA 4LW1A 2MO1A 4L78A 2JSOA 3EQLC 3Q23A 4XQNA 3DM1A 1HQCA 3L2PA 5G3LD 3IHPA 1HT1E 1STGA 1T3TA 4JBMA 4LGYA 1QAMA 3PF5A 1EQQA 3SATA 1MX0A 4EX5A 4P74A 5IGGA 2X69A 2B29A 4K2LA 5CR3A 1N75A 3OTOM 2F0IA 2IT1A 1VQIA 1YBYA 3I4NG 1FNNA 1G6ZA 4IUVA 4Q5VA 3IFTA 1QUTA 1NNXA 2KCCA 2LVAA 3K7AB 1E24A 2EYHA 3X3NA 1WGLA 3DMUA 3HU3A 1FJGM 1I4QA 3NQIA 3PO3G 1ZV1A 1PH2A 3SFZA 4IBJA 1LV7A 1PH3A 1R6BX 2H5XA 5LMUM 3BG3A 2VL6A 3PUYA 3C3DA 4XYOA 1J5EM 5IGDA 1TWAH 5A2QS 3LQQA 3JAMc 1B8AA 3CCSA 3HKZG 1BO0A 4BY1H 3U6SA 1DCZA 2GVBA 1ENAA 2KQ3A 1Y1WH 3ZH9B 2DY7A 2YR0A 3F92A 2XH9A 5E1FA 2PMZB 5C3EG 2CW0C 2DHRA 4DR5L 1HXYD 4Y52H 1L1OB 2XSZA 3RLNA 2EYMA 2YU9B 2FFJA 1N36M 2X4AA 4J1MA 4A3LG 3KXEC 3M7NA 3U50C 1NTGA 4LF6Q 3J81c 3HGIA 5C4XH 3V2TA 4DV1Q 1DGGA 1MHWC 1LTSD 1XPOA 4WURA 4LF5M 4DKAC 5C3EH 4CHTB 3KBXA 3PSIA 1LT6D 4YWKA 5C4HA 4LY6A 1EZ6A 2A6ED 3ND8A 3GTGB 1QZMA 2K33A 1HNWM 1LT5D 1IKLA 2E2IB 3J7AV 5ELFA 4DUZL 1S3OA 1FNUA 2MGWA 4DV5Q 1PH4A 3I4NB 3D31A 2IW3A 3F2UA 3HOYG 4RHSA 3AU7A 3UDIA 1N8RC 2NVQB 3F2BA 4TRDA 3SMSA 3STBD 1KRTA 4A3DH 3PO3B 4BLCA 2B2VC 4K5XA 1LV9A 4IFDJ 4KLKA 4K2KA 4DR7M 4G4QA 2KHIA 1JMCA 1SN8A 1GLNA 4GEWA 3T1YL 5I6YA 1OJLA 2CV1A 4OXPA 1X37A 4KHPM 3HKZB 1GHJA 1IW7C 1LTGD 2R18A 1QZEA 2BH8A 1VDDA 2L55A 2NB0A 1HJPA 4K6LA 1X56A 3FPPA 3FUUA 3FTFA 3HEJA 1JB3A 5JJIA 1DOKA 4FCWA 4H13C 3DWQA 4LFAQ 1G4AE 4RNAA 4LF8L 2G3QA 1B53A 4NOOB 3T13A 4DV6L 3HJ8A 2L9HA 1WXQA 3LVVA 4GMQA 4X64L 2UXDM 2Z8YM 1K0RA 2C35B 3K5MA 2F3VA 3FVQA 2JEAI 1A6XA 4OU7A 5KYIA 3D3RA 5EGTA 1NVMA 1DOLA 4L5SA 2CV2A 3T6PA 2I46A 4BBSH 1UFZA 1I6HB 3DEPA 3KF8B 3CC7A 1EE8A 3L27A 4GN3B 1RKNA 1DYQA 3OW7A 3QJYA 5AFWA 5FOBB 5IYCH 2B3TA 2MH8A 2DZNB 4GKKL 2ZBKB 4IO9A 1TWHB 2HQEA 3SEBA 1SJED 3HOYB 4JI1M 4DR6L 1ZQ9A 1PMRA 1CK1A 5C4ZA 2R93G 1HNZQ 3MJ5A 3I4MG 4LJ5A 3VDUA 2C5CA 3HOZH 2CVRA 3AFQA 3K5OA 1PTOB 1IYVA 5C4JB 1P3QQ 3B89A 5IIFA 3H6MA 4OX9L 4KHZA 2B2TA 3CW2C 5I2YA 3UDGA 5KGUA 1XPUA 4ID6A 3K7UC 1Y8OB 3E3XA 4C1NI 2R93H 3CAMA 1MSGA 5JPMC 3TWKA 1O7YA 5JOBA 1XX8A 5IWAL 2LH0A 3DEOA 2Q2UA 2R7FA 3HP3A 2VZAA 3T1YQ 3D6CA 1AP0A 1LTID 3AYHB 1OAOC 3QWNA 1GHKA 1VQKA 4I8OA 1NJFA 3TREA 5EPLA 4IBDA 4XT3B 2XZUA 1N78A 1C7YA 5L8RF 1XXHA 3HOUG 4HEDA 2AUJD 4KMUC 1V1QA 3MFGA 1GO5A 2XGNA 3VFDA 3JAML 1EL0A 1VQEA 1AN8A 4RGMA 2A6HC 2KA7A 3GLHA 2B2YA 4L5RC 3V05A 1AUAA 5LL6S 2UXBQ 2WSCF 5DNFA 2K47A 5M3FG 2K6BA 3BZDB 3RZDB 4TUWA 2FJ2A 4HR7B 1MU5A 1CHPD 3UE0A 3J81L 4K0KQ 1E2ZA 4WP2A 2PW5A 4U673 4KKUA 3S17H 5C44B 1O80A 1Q3CA 4PZ7A 4KLNA 3BZCA 3MTSA 2UUBL 3K0YA 5F2DA 3I4MB 2NVTB 1VDZA 4RHRA 1PJTA 2VQEQ 1IBKL 2V6ZM 1RF2D 2OTLA 1G2TA 1OKSA 1QANA 3ZQJA 4C1NK 2O5JC 4AQYM 1LABA 4X65Q 4GKKQ 1KAAA 1QILA 3LCVB 5KQDA 1CZWA 2B8FA 5M9OA 2E2JH 4MGKE 4A3FG 2QBYA 3MXGA 4IURA 3SYLA 4F7XA 1Q1BA 2UUAL 2Z6BA 3S1RB 1TH4A 5FLXE 4NSOB 3TQYA 3JC66 3C3EA 1Q1EA 2LXJA 4WRDA 3MEFA 1Z5CA 1SYDA 3CQZB 2R6GA 1YJNA 4A3GG 2HQLA 4KY7A 3PIOA 1J6QA 1I3QB 2D7GA 2R0IA 1H9JA 1TVXA 5BR8L 3HOUB 4HMJA 1D2NA 4OWWB 2A68D 1BUVT 5C3WA 2PI2E 5FKAC 4U68A 2XF3A 1JORA 5EXXA 1K0SA 5E4WC 4A3GH 2WSEF 3S1MH 3Q8DA 2CCZA 3ERSX 4RGTA 5NUCA 3E0JA 3KSJA 3BBZA 1B3QA 1VQJA 5M3FB 1NBWA 3B7ZA 1Z6TA 3RFWA 3U60A 2Y0QA 2DJGC 4DV7L 3MZ5A 1XNRL 1HR0L 2KVMA 4JI4Q 3UMMA 4A3CH 2Y0TA 4KODA 1HUNA 2R62A 1WTPA 4QMGA 1NNJA 3F2CA 4XBOA 3K58A 3THGA 4DV6M 1A3VA 2LKVA 4IN3A 1BCPB 3QOJA 4C3JG 1SFOH 4Y28F 1YNJC 3H4MA 2KW0A 2VQFM 1F2MA 3EN2A 4DAYA 4V190 3LGJA 2MPMA 3HJQA 2WACA 4A3FB 1WTRA 3C58A 2LNHC 3TBIB 3U6CA 4FYDA 3IECA 2A69D 3KS4A 3CCRA 1NY5A 3SYKA 2I5HA 2BJWA 1DOMA 1PYBA 3CKIB 2R6FA 4JI8Q 4DV0L 1XTDA 3D8LA 5EKIA 1L2FA 2YYZA 3BS1A 1EYAA 4JI7L 3GTMH 4GH9A 3U58A 4DR6M 3CHBD 2K5QA 5BN5A 2K52A 4EQ5A 1HUMA 4YWLA 2RSNA 1I4XA 2F4VL 5BR8Q 5ITRA 5ITXE 1RL2A 3I01M 1IY0A 1FGBD 2CKZB 1X9NA 2R65A 2QW7A 4KJOA 2B63G 2JY7A 1PFMA 4N9TA 3MXNA 5DYIA 4G4NA 1KDBA 4OX9M 3NQTA 3X3MA 1TTEA 1RDPD 5EBDA 5JVG3 3R2TA 4H0LC 4P73A 2UUCM 1GUNA 2PQEA 4RG1A 2DHYA 4LJZC 3DZDA 1G2SA 4DV3M 4AIMA 4B3TQ 4B3SL 2AHOB 2RA4A 3ERQA 2WB1G 1L1OC 3RLOA 2B63H 4M9ZA 1XXHB 3M7GA 1WTOA 2JWSA 2E2HB 1JR3D 2LTUA 3L2AA 1PTOF 1TY0A 2KCMA 3ULPA 1IZ6A 2QHOB 4ZCKA 2LBCA 3RN5A 2KOLA 2Z4IA 3TE6A 3GLHB 3S2HH 1VCIA 4C3JB 2SNSA 5FLXS 3Q6SA 4OO1G 1N32Q 3CGWA 2FH0A 4DV7Q 4H44C 5ITUA 4R71A 4DNIA 4XTCS 5KPRA 3EIEA 3UGJA 4O2DA 4YCUA 1E2WA 2N78A 1IBMM 1LO5D 4GNXA 2C96A 4IBCA 2OWOA 3CRKC 4M8AA 4TKOB 3V96A 1JWMD 2KNZA 2JUJA 2DJFC 5E26A 2VB2X 3BYTB 1PH8A 1ET9A 3DOAA 5EKKA 1KXLA 2ES2A 4KTAA 1MGSA 1Q7YC 4NB3A 5JI3E 4CDFC 5M3MG 1KD1C 2F5PA 3ICEA 2FNAA 1YVCA 1OIZA 5LL6X 1BKBA 1IY2A 1P16A 1G41A 3M4QA 3T51B 2NVXB 1V33A 3K92A 1EEID 1JB0F 2YTYA 1VQ1A 4GS3A 1A8VA 3AMUA 1I94L 2V1CC 3LX0A 4J8QA 2Z7JA 2NQ8C 1IBKM 4DV2Q 2F0FA 2QBYB 4M0DA 3QO2A 3VDPA 1N34Q 1V34A 4M9XA 5CBAE 1GXDC 2FINB 3K9OA 1Y14B 4LJ9A 5M5XB 3K5NA 1N33L 5F3WA 3OMGA 5M3MH 2DENA 1NCVA 3PVSA 1E9RA 3B74A 2QCUA 2YNMD 2AMCB 1OIPA 4DFAA 2A1AA 2UUAM 3FHWA 1AZQA 1OXUA 1K83B 2NUCA 2Z1CA 2WB1B 3HOXG 4OWXB 4DR3Q 4GOPA 2CWPA 1J7KA 2F0UA 2K5HA 3OMCA 2RF4A 4FWDA 1Y1VG 3AB9A 5H1SE 3I4OA 4JI2L 2D7EA 1UUPA 3W3AA 4JC0A 4A3MG 1NUCA 3CCMA 1Z6HA 1TS5A 3TEHB 1W6KA 3GP1A 3GTPH 2K28A 4HMIA 1BBXC 1VQLA 2R3ZA 4LF4L 1VQAA 4A3BG 3D6WA 2ERCA 2NTTA 2WFWA 4QB4A 2EVBA 3HOXH 4DUYL 3GTLB 5ELEA 3NSWA 4JW0A 4JYAQ 1ZMVA 2FMCA 1RD9D 5K36H 3U60B 4FF2A 4A3MH 4M9SA 3K8ZA 5JI2E 3H0GH 3L0OA 4ZUJA 2AQ3B 1CA6A 3GV3A 1YHQA 1F2YA 2G8LA 1AEXA 1AIPC 4RGNA 2I5LX 2BCOA 3BDLA 2FHTA 1XNQQ 3FUWA 3GTKH 1TR8A 1WCMG 2CH4W 4ZAIA 1XNRM 1BXTA 1HR0M 2EYPA 5M3MB 2P5TA 4WJ4A 4Q7JA 1EY6A 5CGKA 1D1IA 1SNCA 2BA1A 4LCBA 2JA9A 5T1IA 1BBUA 4DAYB 2OQ4A 5EQ0A 3TMEA 1TY2A 1NMGA 1PTOC 4DK0A 3PFIA 1JR3E 4KD4A 1Q81C 2XRQD 1DV0A 3OTOL 2RGHA 3DXJC 3P75A 5I9OA 4S3SA 1OAIA 3V76A 4X3TA 1PH1A 1M4VA 1TR5A 3K81C 2SEBD 4R9WA 3DLLA 3W67A 3SVMA 1FJGL 4UN2B 1F9PA 4A3IG 1Q86C 3GTJH 1GOZA 1SNOA 1PVOA 2FE8A 2ZTDA 2WZJA 2EYFA 1TWCH 3A42A 3VDYA 3LNNA 2JZ0A 4DV0M 1X3PA 5LMUL 2ZAOA 4BY7H 2VDBB 1RHPA 4BXXG 3BDOA 4HTHA 4JI7M 1STNA 1Y1VB 4B3MM 2Z4RA 4CGYB 2NVYB 4QUFA 2PMZE 4JI3M 2Z9HA 1BCPF 4X66Q 4A3MB 1Y69U 1EY5A 1AE3A 3LW5F 2F4VM 1NJIC 4LFCM 3MXNB 4IPGA 2CUZA 1WFQA 2QGQA 2NBFA 3SARA 4A3KG 3LQRA 3I4VA 1PTOD 1AW7A 4LUZA 3KOXE 3J7ZC 2CQOA 4A3BB 1K8OA 1QVGA 4KKTA 3FRPB 1CT1D 1JWUD 4NSRA 4GKJM 1CKOA 3FTEA 1N36L 5IOCA 3GQ3A 1VQ8A 4Z8XA 3TP5A 3VA5A 2R4EA 1PJIA 2EY2A 1G8PA 4GZYC 2D0PA 1SXJA 1H6UA 4LF5L 2DZOB 2I0QA 4QCLA 1WCMB 1HNXQ 3PUWA 1OFIA 4DGZA 2ZAMA 1PHJA 4JI6M 2NN6H 1X6OA 1HNWL 2ICEC 5C18A 2DN8A 1OTRA 1G71A 2GQFA 4A3EH 1S5FD 3M3YH 1SE8A 2OO9A 3NUCA 4FCTA 2MQHA 4GNXB 5E3FA 5A2QE 4LRSA 3RR5A 2HAKA 4JXJA 3S16B 3PGZA 2EJFC 2XSZD 3KK7A 3GQBA 2R92G 1SE3A 2PQAA 4A3IB 3RZOB 4AI6A 4DR1M 4S12A 4P75A 5FO7B 4L4UA 4N9PA 1ZEQX 2E8GA 2DNCA 1TWGB 2XIWA 3HKZE 4G57A 1Q39A 3IRBA 2MGSA 3OTOQ 1B70B 4A93H 4QL5A 4X3SA 1DM0B 3C1FA 1E0BA 3FUTA 2Z4SA 4CDDC 1JJGA 4A3KB 3U6PA 2UU9L 1QG7A 1I94M 2BDOA 1YHBA 1LTLA 3WHKA 4G4KA 4DR2L 4CKCA 2YV5A 5KPZA 2F0JA 3T53B 2DWZB 2ZJRA 1N33M 2EDGA 1J5EQ 5FLMG 3PUZA 1VQ9A 3MHVC 4R3DA 2VF8A 2DNEA 2H1RA 3VR2A 4IJFA 1Z47A 5CV4A 2B2WA 4R4QA 4GOPB 1V8QA 2X6GA 5M5YB 4OW0A 3K9PA 4ZLTF 1KSFX 1WTWA 2KUMA 1L0YB 4OEMB 3Q8GA 4JI2M 1GABA 1SYGA 5FLMH 2JA5B 1NHGC 1X32A 3GLFA 1GKIA 4KV6A 2DAMA 1YNXA 1MSHA 1TH2A 2HKJA 2R7DA 1IN6A 4LF9M 2CEAA 2RQXA 3K7AH 1E32A 3NWTA 3OIQA 2JQOA 4IUNA 2N8NA 1R4QB 3EIHA 4KKSA 4LF4M 2A5YB 2RKSA 4RAUC 4DR4L 3FKIG 4FO2A 4RMFA 3HJSA 1FYCA 3BU2A 3IG8A 5EXPA 3OYYA 1VQFA 1K3RA 5D65A 5KRUA 3AEVA 2DZLA 3A8JE 4JI1L 4HIMA 3CCLA 2R92B 1PYWD 4RF1A 3F8TA 1E1OA 3GPPA 4XT1B 1WTHA 4E6IA 5CV9A 2KXEA 1CQVA 3MMPA 4LWCA 1VQCA 4UHVA 4IZ8A 3GD7A 5IY0A 3I55A 4IBBA 1E1TA 2YU9H 4GHAA 4ULLA 1IYUA 5EJCA 2B2TC 4JV5M 1BCPD 1STHA 4DR7Q 4LUOA 1L1ZA 3G4SA 5LHY1 3RUZA 1YI2A 1ILPA 1GL7A 4GIPA 4D82A 2MUYA 1NHWC 1PZID 1XMOL 5LMNL 5HURA 4L6TB 4DNRB 4HJ8A 4NXNL 2LFNA 1D1KA 3CPFA 1MD2D 4NW2A 3GTGH 4KHPQ 4L16A 4TSSA 1DGSA 1KLGD 3UDXA 4EGVA 2E2IH 2LVQD 4BBAA 2JA6G 4UY8C 3WOFA 1WHCA 4L5QA 5KQ8A 1E2VA 5D14A 4C3IG 3I4NH 2CE7A 1SYBA 4M0WA 4DV4L 1I6VC 2LVOC 4CJ6A 2JA2A 3AOEC 2F5OA 1EY4A 1JOOA 1LTTD 2A6EC 2NVQH 2OOAA 2FS1A 1VQOA 2CHBD 1EFWA 3PO3H 1B9NA 2C9CA 2B2YC 3D8GA 1VG5A 2XEPA 3PCOB 1WTXA 2Z6KA 3FKIB 3GRUA 2UXDQ 2EPBA 4CKEA 2Q2IA 1SXJB 1SROA 3BJUA 3R3OA 1SYFA 1VQ7A 3RN2A 2Q2HA 3STBC 3FTCA 3W5OA 4LZJA 1UE5A 1MJEA 1L2BA 4IBKA 3GTOB 2F0DA 4AQYL 2HD3A 4PDGA 3L9AX 5E4XA 2F5QA 4DPGA 3T1HL 2G9HD 4NMZA 1ORYB 1WD0A 2VNUD 1I50H 1SNMA 5EQTA 4ABNA 4POFA 5AJ3L 4A3LH 4O0AA 2PYKA 4YHHL 3VK7A 1Q8IA 4QY7A 3MFYA 1BOSA 2RBMA 2H1EA 4JG2A 1PJSA 2J4XA 2SNMA 3J80c 4WFN3 5C0XG 2L2DA 2PQAB 1KHIA 4OVZA 3WHLA 4F88A 5JJLA 1KFVA 3MWYW 2HUGA 5CBEE 3P7JA 4K6DA 2ID0A 1SNPA 2J0TD 1IYJB 2PO4A 3OWEB 5ELNA 1VQPA 2JA6B 1D2BA 1I6HH 4W5WA 2A74C 3IKJA 4B3RL 1M90C 3H15A 4C3IB 1NY4A 4NL4H 4H7BA 1TWHH 4NKLA 3HOYH 1VMPA 1BVSA 5EP2A 1PM5A 2MP1A 4K5WA 4N8X1 1A5TA 3U6DA 4UP7A 4OELB 2QDLA 1NV9A 5KNCA 2J7OA 2EYOA 4GN5A 4JBWA 1K28A 2UU9M 3Q22A 3CF0A 1G6PA 2FFKB 1GM5A 1MN3A 2MJ8A 1SMYD 2K1BA 4DR2M 2KHHA 1EEFD 1PTOH 1U4MA 1LTBD 1G51A 5C4JH 3FUXA 3CU7A 3R93A 3VA7A 1A2UA 3A56A 1I50B 3KW6A 1B4OA 2OOBA 3FMCA 1S5ED 5DM63 4L8RC 4JVZA 1VQNA 3QAUA 1HPCA 2M2LA 1Y8NB 2E75C 4ME3A 5IP7G 1IL8A 3GLFB 2VS1A 2L7IA 4MHEA 2I7PA 4DR5Q 3M9BA 4R4IA 5DYGA 2VQFL 1OFHA 1QAOA 1PLFA 2NZHA 1M8AA 1TF0B 4O1NA 1MJGM 2L4EA 1SAPA 2XRSD 1CA5A 1MBYA 3GLIA 1JCKB 3TWLA 4DR4M 2F0NA 1Y8GA 5IYBG 3Q8XA 1KAWA 3K59A 3I4LA 3EVQA 1I4PA 5M5WB 3NK9A 3KF6A 2J5YA 5C44G 3DUZA 4C2MB 2JA8B 1F9SA 4HIKA 2QPAA 4IBIA 4DUZQ 2DGYA 3ER0A 2C99A 1EIHA 5IYBH 3RZDH 3MAQA 2CHGA 3FD9A 4LF6M 2XNAC 3I91A 3PO2G 5KO3A 2CQAA 3T16A 3D4DA 4KY5A 2CWBA 2O5IC 5DNYA 5C44H 2UUCL 1XXHE 1W6JA 3I4MH 2NVTH 4JI0L 3OW2A 2BDNA 4EQOA 3G6EA 4DV3L 2QKIC 1JOKA 1YLAA 1SG9A 1XMOM 2F3IA 3NPPA 1A2TA 2F0PA 2ZTCA 1VQBA 1SDFA 2HT1A 3S14B 1NO1A 5LMNM 1QB5D 3GLHE 1YZ6A 2DY8A 3M4OB 1ZYRC 5FO8B 4NXNM 3OSOA 5FTNA 4LAAA 5FJ8G 1HTLD 4CBVA 3QYBA 1VQHA 3TN2A 4R8NA 3S1RH 1UE1A 2JXMB 1DJRD 2CFMA 2K5WA 1KL9A 3A8IE 2XFSA 4JN6A 1ET6A 3U4ZA 1EIFA 1HRJA 4DV4M 1O7IA 3CQZH 3NEMA 4Q0FA 3PIP3 2N55A 2LXKA 3A5UA 2NZ1D 5EP3A 2QCPX 5BN4A 4PDIA 1IBML 2X8AA 4LF8Q 5FJ8H 1I3QH 3HOUH 4DV6Q 3ND9A 5IYDG 2K5VA 4X64Q 1D8LA 3N52A 4R4TA 3TDQA 1XMQL 5FSWA 2VQFQ 1QZHA 1ZYRD 4IIWA 2BOSA 1CSQA 4I4LA 3PF4A 1S4ZA 4FVMA 2CRUA 4BS9A 1D7QA 1NNUC 1NR4A 5ELBA 5M3FH 2HDLA 1I5FA 2DAKA 2A68C 2GN5A 1B2TA 3QB3A 3PO2B 3U5ZA 1HQMC 1BR9A 3CPWA 3T1HM 1ICFB 2L7HA 2YFQA 1YJWA 1IN8A 1D6EC 3HFZB 4DR6Q 2QZ4A 3SC3A 4KK7A 4X3UA 2WB1E 4IFDI 3MK6A 2IX3A 1X65A 3J80L 2QEXA 2ASBA 4YHHM 3P20A 2A8VA 1OXVA 3NWSA 2E74C 5IT9S 5E7NA 1R2YA 1GUOA 1WI5A 1F77A 5EJWA 4OX9Q 1AH9A 4QJFA 5E6JA 2L09A 5FTMA 1AZPA 3QYEA 1C9OA 1TT2A 3KOYE 4A3FH 4RKUF 3S2DB 3UZUA 5IWAQ 3GRVA 4IALA 4NC6A 4B3RM 1PZJD 3ZJYC 3A45A 2NN6I 1HNZM 2K03A 3CC4A 1PXUA 1ONLA 4MGIE 3VR4A 4DBGB 4KD3A 4DK1A 3L3OC 1ILQA 4X62L 1H9SA 4B7HA 5IP9G 2B2VA 2KECA 2A69C 3AFPA 2AQ2B 1PFNA 1STYA 2K32A 3W1BA 2O5RA 4UPAA 3J7A5 3K8AA 2ZJPA 3FKEA 1KNAA 4NRWA 2HCCA 1PA6A 3SK5A 3GTQB 1STEA 3KVWA 3E21A 1A3TA 4ITQA 3B9PA 1KRSA 1U0LA 2AKWB 1F2ZA 4IJHA 3GLIB 3A0JA 4UDUC 1XXGA 4L15A 2PZTA 3OHXC 4NP5A 3GRYA 2E2HH 1YE9A 1Z7TA 1HFNA 3B6YA 5EBCA 3UE1A 1OQYA 1HFGA 2UUBQ 1PJQA 2Q2EB 3AJIB 2IY5B 5C0XJ 2KDLA 3JR5A 4OGQC 1IBKQ 3GP7A 4C3JH 3LWUA 1OO9B 3NTHA 2W82A 4B3ML 3CCJA 3S1QH 1IXRC 1CZGA 4JI3L 3KP0E 1A0IA 3E6ZX 4LFCL 1AFPA 2UUAQ 1SNDA 4A75A 4UP9A 1JC7A 3HOWG 2OPFA 2DUDA 2D2CC 3HHYA 4POGA 4DK3C 4LNQA 2Z3XA 2B39A 3KOJA 4L63B 1DGBA 3VK8A 1DD2A 3QG1A 1RU3A 4GKJL 2QDBA 4GLXA 3U9OA 3TL4X 2V1UA 1S3SA 3S1NB 2NVXH 3TP8A 1EU3A 1QAQA 1NAPA 2DAIA 4JI0M 1Z9FA 4X6AH 4KI0A 1DGHA 4YCVA 4ZUIA 1KC8C 5DEHA 3JAME 1X54A 3R9XB 1C1KA 3HHZA 1K3WA 2HIXA 4CIZA 1S5DD 5M5XH 2CWAA 2JE6I 3VYTA 4JI6L 3LVWA 1EY7A 3S15B 3CXCA 5HY6A 1GVPA 1C48A 2LHGA 5CMDA 2LXEA 1V92A 2FXQA 2O2LD 2MROB 3O13A 4IJEA 4IOAA 1HZAA 1K83H 4R4OA 3S1QB 1XNRQ 3TS2A 1GUWA 1HR0Q 3J81E 1MI2A 4QNRA 3L25A 3T15A 5H37D 2Y0SB 4WJWA 3H09A 4DR1L 4EIWA 2N35A 3G48A 2EJSA 1CI3M 4P16A 4PMBA 5CV7A 2QP9X 4OO1H 1EUJA 1SXJD 4ILWA 4PG3A 1XMQM 4JOIC 4IQZA 2RDHA 3ULLA 4KN4C 4DNTB 1ZAEA 1Z59A 5LMNW 2R46A 4LF7L 3EIVA 3GTLH 2KEBA 4LZZA 2ICIA 1SE4A 2IL8A 1XB2B 4XYQA 1EQVA 4R8IA 3P1HA 1H9MA 3HOWB 3U5ZB 4C3HG 3F2DA 2IJ0A 2KA6B 4DV0Q 2F0LA 5J1ZA 3R8FA 3KUPA 3FTDA 4HCSA 1IXSA 2QSFX 1CSPA 2HIVA 4JI7Q 3CF6E 2E5LL 5C1BA 2DI0A 4OIKA 1H95A 3E4RA 5ELCA 2QILA 5C5LA 4XIGS 3QIAA 2F4VQ 1D5ZC 1KDCA 3VYRA 3GPYA 1H9KA 2G5DA 1YNNC 1BDOA 5A2QL 3KJOA 3CD6A 2ZT9C 2JN4A 1OTCA 3E9HA 1L2CA 4I7ZC 3RNUA 4D81A 4CKBA 2VW9A 2JYOA 1VQDA 2PNHA 3GLGA 3H94A 1QNKA 2K14A 1I4RA 2RHQB 2ALYB 1NY6A 3H4JA 4JI8M 3HOVG 3HHXA 3M0EA 2I07B 2ZXPA 2XLJA 2KZSA 4LF9L 3SMPA 2JY8A 3U61A 4XQQA 5IODA 3PV0A 2QNJA 1I4WA 4MGZE 3U6LA 2EYJA 5GAEC 1HT2E 1NSNS 4B3SQ 3RLFA 3CMEA 1TWFB 2L11A 1Y1VH 4R7GA 1YEZA 5IZ7D 1NR2A 4IBGA 2NVYH 4JI6Q 1PRBA 4HJ9A 1YNND 4G4OA 4X62M 2Z4HA 1X3GA 2EOTA 4DU9A 3ILKA 1FVIA 4MTNA 3MC0B 4MM3B 1Y8PB 4ALPA 4A3BH 1YIJA 1N77A 3M6AA 4MZ9A 5D3IB 2QQ8A 1L2DA 1XTCD 2JA7G 1EIGA 4YIJA 5EKLA 3EROA 1O7ZA 4LJ4A 2F03A 1V1PA 1UE7A 1VF7A 4C3HB 1EWIA 3ITPA 2O4XA 1YUBA 2KCTA 4FXDA 4JV5L 2HCBA 3MXUA 1PGYA 2APLA 1O78A 2M5ZA 1Q46A 2HDMA 3AQQA 2M9VA 4CJ0B 3AKZA 4ODGA 4KY6A 3PXGA 1WCMH 3BVMA 3MHBA 4LK1C 3K5LA 3JAMS 1PJJA 5DAUA 1EIYB 1HHVA 1N32M 3SXHA 1D5MC 1NJGA 5J39A 1B44D 4R4CA 1I94Q 1HTPA 1T5EA 2P5ZX 3J2PB 1UE6A 5GADC 4L8JA 2RDGA 4JBJA 3HZJA 2LMCB 1N33Q 2F0SA 4JBKA 4NXML 2RCNA 3EJIA 3PQIA 3HOVB 4MH0E 1IM2A 3J81S 3S16H 4X3KA 1DXMA 1W3SA 2Z8LA 2JJQA 5ITTA 4A3IH 3RZOH 1IBLL 4LUVA 1SXJE 2WKDA 2KNVA 3FPUB 2JNHA 4LJ8A 2BJVA 1TWGH 1GJTA 2N49A 5KYLA 2HL7A 4BXXH 4JI2Q 4ZYSA 1VQGA 1VEGA 4GC5A 4LJAA 1IL2A 1GD7A 2EY5A 2VUMG 1N34M 3NHHA 3HHWA 3VYUA 5T1GA 3KDSE 1ZMUA 1E3PA 4HAEA 3FUVA 4A3KH 4FF1A 4LF4Q 3C9PA 1TS3A 2RRUA 1PRTF 2R61A 4N8FA 3HG9A 3K1JA 3C2PA 3U6MA 2D9UA 1EOTA 2JA7B 2RVLA 4DUYQ 1PYSB 4L5TA 4PMWA 3AV0A 1B3AA 2HHHL 2JA5G 2EZVA 4FP5D 1SE2A 2VUMH 4A3JG 2JK8A 4DR3M 2R45A 5M5YH 1STAA 2MFIA 5GKNA 2D0OA 5EXSA 1BNZA 1ASZA 1XWIA 1TDZA 2RDFA 5KNBA 5J22A 1UM8A 1L8QA 4RKLA 1L0WA 4IJLA 1G8ZD 4ME5A 4CJ1B 1X3EA 2JA5H 3KOWE 3HGBA 4JPBW 3PMFA 3VR3A 4JI5L 2ZJQA 3FEWX 3GV6A 3HY5A 2V4DA 2KZUA 3PUXA 3A7AB 4YY3L 1JE4A 1L1TA 1J8IA 4NRVA 2UXCL 4WW0A 1KYIA 4J15A 4QIWB 2ZM6L 3SHGB 4I65A 3DWPA 3E5SA 4LF7M 5FO9B 2IWHA 1QJOA 1IXSB 1SYCA 3SHLA 1FJGQ 2R92H 2EUCA 2KEEA 3MVVA 4LJ6A 4IOCA 5LMUQ 1KTKA 3FRIA 3JR4A 2L4FA 2LY7A 2A73B 4AG6A 2E5LM 3GLFE 4Y7NB 2VUMB 3VKGA 3JAMi 3GLGB 1Q12A 3H3VC 5FLXc 1HCZA 3BYYB 2J7NA 4QNMA 4XK8F 3W0FA 5TSSA 5I6WA 2V1CA 3AFHA 1D0LA 2D7HA 4FWGA 1EU4A 4P72A 3U61B 4DF7A 3BZKA 1S5CD 1N36Q 4A3JB 3ULJA 1EWHA 1QE6A 3OPOA 1QYRA 3TWMA 2LVNC 1EIJA 2ATWA 2WV6D 1BCPC 1RTOA 4LF5Q 3SK4A 3A55A 3GQ4A 4KT0F 2C98A 3LCUA 1MJCA 1SR3A 2RSOA 3I3CA 4BBRG 4FD2A 2MR9A 1VQ4A 2R7ZG 1HNWQ 3KBGA 5CYUA 1R9TB 2JP7A 2D62A 1HQRD 1J9OA 2Z0SA 4LFBM 1EQTA 3BDCA 3FKIH 3N6RA 2QENA 3J80i 2M60A 4LF6L 1DZ1A 4DV1L 1V1OA 2R44A 4FF4A 3S24A 1R5LA 3KJPA 3CP0A 2R7ZH 3I70A 4KO8A 2F0KA 1NV8A 4DN4M 2EY1A 2I5MX 2A19A 3Q24A 1Z5BA 5EPKA 2VY3A 3GQ5A 4CDEC 3GTOH 1P8LA 4G7OC 4HCEA 3M4PA 5IGBA 2Q2TA 1O7LA 4RCNA 4DV5L 3SK6A 3L26A 3A7LA 2UU9Q 4F8MA 3T4AC 2F3WA 3E46A 1S5BD 5IGCA 1F2LA 3TS0A 1K82A 1PH6A 4DR2Q 2LWXA 2Q8RE 3BOSA 5JJZA 4CJ2C 5DM73 4A4IA 1W2BA 1HR0W 1PRTD 4QGUA 1TDHA 4NXMM 4FDBA 2E76C 1MKHA 4K8IA 1QUQA 3I73A 3K6OA 2JA6H 1IBLM 2K4KA 2PNRC 1A62A 3CTWB 3MA2B 4IPCA 4R1JA 2EE1A 2K7VA 5IREB 4BY1G 1I4HA 3HRZC 4MN3A 1HZCA 4FWHA 4C3IH 2KHSA 1Y1WG 3J7AS 4BBRB 1A15A 4G7HC 1VQ6A 1PZKD 1RCVD 3U6QA 2R7ZB 2GNOA 2KCNA 2F0TA 3SAVA 2G9DA 4GLVB 1LTMA 2F1MA 4C56C 4LFAL 2R4JA 4DR4Q 3NWLA 4F87A 1BF4A 2WAQE 3K57A 1WVLA 2EKKA 1QDTA 1R2ZA 5C4XG 2L5TA 1IN4A 4JI1Q 1G91A 4B7FA 3H91A 5IGEA 3CCQA 2HHHM 3A74A 2KJXA 1WGNA 2F0HA 5ELDA 1X3QA 3G6JB 1ZKOA 3UDFA 4PQXA 3M85A 3HKPA 1HH2P 1X55A 1PFSA 1SMYC 1RODA 1TGUA 2AWOA 1I4GA 4O42A 2YQZA 4JI5M 5HGQA 1K3BC 5EP1A 1LTAD 4QUCA 2JA8G 4YY3M 2TSSA 2Y21A 4TVAB 2N88A 5C6AA 2UXCM 1EYGA 5C0XH 4A3DG 1HNZL 1XMOQ 2BH2A 2ZM6M 5LMNQ 1E9SA 5A35A 1GO3E 2PZWA 2CW0D 1TS4A 2SOBA 3VR5A 4NXNQ 5M5WH 1G59A 1FGUA 2B2UA 3CCUA 1ZXTA 1TWAB 4RWSC 4C2MH 1S40A 4QOZC 1WR1B 2EIFA 2JA8H 1JT8A 1NMFA 1IQPA 3D4RA 4BY1B 2XWBB 2VXWA 3SAWA 3LWEA 4APVA 2O25A 1Y1WB 3T38A 3I51A 5FLXL 4DV4Q 2K5DA 4XQJA 3EFXD 4OO1I 3AOGA 3GLIE 1QNUA 1SBBB 2PPBC 1FR3A 2PW7A 5IT9E 4MIUA 3DFZA 1EY0A 2F0EA 1HQYE 3GO5A 4EQPA 2MNAA 3K0XA 4HJAA 5C4XB 1Q3LA 1K8GA 3QWLA 1KABA 3A46A 3S14H 5C5MA 2NYZD 5C3EB 5JVH3 3M4OH 4RFBA 4B9XA 1M1KC 1DGFA 5EP4A 5IP7H 2K04A 3EA6A 1NSFA 4HSPA 1JB7A 1YSYA 2MO0A 4BBSG 5KPTA 2F52A 4AQYQ 2UXBL 1OXSC 1GL6A 4PZ8A 5JJKA 3SGIA 3T1HQ 4IUTA 1RIPA 4I5SA 2GA4B 5IYCG 5AJ3Q 1FNVA 1XYIA 3SK8A 3J81i 1PDQA 2IX0A 4YHHQ 3NBXX 2LHCA 2JY6B 3QR8A 4K0KL 1B7YB 4HJ5A 4P71A 3HX3A 4A3DB 1IW7D 2RGOA 5KNDA 1U4RA 1A3UA 3DHQA 4DV1M 4F2LA 3DM3A 2Q8TA 3HOZG 2BWBA 1B50A 1GUTA 2VQEL 1SEBD 4FCVA 2DAEA 3KLSA 3KYHC 4X65L 4GRIA 4GHLA 2VIIA 2WAQG 2YTXA 4RF0A 3KS8A 3J7BA 2EQSA 1CUKA 2WIIB 2XWJB 4JCVE 3PIPA 4ZKCB 4B3RQ 1K3XA 4H02A 3PO2H 2X49A 1TQOA 3K80C 1CQFA 1E7ZA 3PNVA 4DV5M 1RTNA 2CV0A 2XTIA 1WYDA 3B7NA 3LMMA 1PV4A 4UP8A 1Q8KA 2OQ0A 2Y0SE 1QUQB 5I9PA 2VB3X 2XFTA 2WP8J 1CFMA 1GJSA 1QCBD 4HN7A 4OL7A 2BE5C 1S72A 3HU2A 1QOHA 3CRLC 4DA2A 2EXZA 3KFUA 2OEOA 3M4YA 1C0AA 5ITYA 1ESRA 4QHSA 3S2DH 3FYCA 2DWLA 1LLRD 4GNXC 2F0GA 3TSSA 4HIOA 4BBSB 1VDLA 1K73C 1EY9A 2KBNA 3HS0C 3J81j 3QOLA 5KEEA 3PUVA 3AOEA 2K0BX 2L4NA 7CATA 1YITA 4JI4L 3H3VH 1XWEA 4P17A 4RA8A 4LFAM 1H9RA 1JOQA 5IYDH 1QDRA 1LUZA 4ZK9B 1STBA 1VMCA 5ISRA 3HOZB 5ELOA 2BE5D 4I7AA 4XGIA 1DO0A 4WJ3M 4DR5M 1EQRA 4F1IA 2WAQB 4G3OA 4OVZB 4D80A 1ESFA 1U5KA 3GTQH 5CV8A 3IFDA 5JPNC 5FK9C 2R93B 2EO2A 3EBEA 5L37A 3RGSA 1Q90A 2GVAA 4NPSA 2OCEA 2NWGA 1EYDA 4JI8L 4K5VA 3FYDA 2K05A 4GOPC 4HIDA 1C8CA 2CHQA 1UNSA 4AH6A 2UUCQ 2A6HD 4KJNA 4JI0Q 2EXDA 4DV3Q 1Z5AA 1EFUB 1JWSD 2Y20A 4AZFA 1MIUA
chains in the Genus database with same CATH topology
5EXTA 3BVGA 2X6LA 3DWAA 4KHVA 4DUZM 2WINB 2M00A 1DO2A 1XHBA 2OXPA 3GRRA 1FNWA 1WD1A 4IBFA 1HA5A 1ML0D 2E2DC 2F0OA 3TPZA 1II3A 5JAVA 3J27B 3A98B 1LT3D 3T1YM 2PZUA 2FOIC 2JP1A 5I2XA 3S17B 3UI2A 4FXGC 1G291 1D5XC 1WTQA 3KFUG 1OXTA 1OXXK 5CV6A 3J7AF 1IN7A 3OWFA 5JEAG 2KRKA 3E9SA 3VYSA 3K2LA 1GUSA 4PT5A 3NE5B 1TKWB 3PIO3 4V0BA 1GVNA 2E2JB 4LF8M 4IUQA 2UXBM 5JEAH 3NTKA 2C9OA 1PRTB 4NDXA 4X64M 5CV5A 3ONAB 1IY1A 2WKCA 2HCIA 3RD4A 4II7A 5ITQA 2DWNA 4K0KM 3HWSA 3UJNA 1KLUD 3W2DA 3C1EA 2F5SA 3SAUA 1F9QA 2VQEM 4PV1C 4X65M 2C5RA 1KNEA 4PD2A 3BVZA 4Z9CB 4GKKM 2AUKA 2AWNA 2L1BA 4A3GB 3S1MB 3IAYA 1PFBA 1SXJC 1K8MA 5D3DA 2Q8IB 1EYCA 3WOEA 1UAPA 4QHTA 1SJHD 1YNJD 2CHVA 3KOZE 4LGMA 4FF3A 2JEBI 2L12A 1EFID 4RH6A 1E94E 4BA1I 3SR1A 1U9RA 2F5NA 2DWMA 1WTVA 5IWAM 2F0MA 1VF5C 5ITXA 1SFOB 3PNYA 4QOSA 2KRUA 4K8JA 4FNFA 1CHQD 1U4PA 4RKBA 4OIJA 1SNQA 3MEHA 1UEAB 2FMMA 3J80E 5IGFA 2G5GX 3GTMB 4ZKBB 1QVRA 4JI4M 3A54A 5K5PA 4MGYE 3U6OA 4PNYA 4MB7A 1CM9A 3NBIA 1GJXA 2L0CA 1W5TA 1JQYD 2RKOA 4JK1C 1JR0D 3WDNA 3ZCBB 5CC4A 2B2WC 1JICA 2UUBM 5FTLA 4GITA 2B63B 3HZXA 3NXWA 4AG5A 5BR8M 2OF1A 1QQWA 1H9SB 3RGPA 3S2HB 3NTIA 2EJGC 1Q3BA 3URYA 3D4WA 4I81A 3U6EA 1EY8A 4DAVA 4M1UB 3KP1E 8CATA 3NBHA 4Z6YA 5K36G 1GUGA 2F0WA 3OIPA 2IX1A 3CF2A 2BA0A 3KLSX 4B3TM 4IBEA 1TH3A 2EYLA 4RCOA 5C0XI 2L6OA 4CISA 3L28A 1G3IA 3VKHA 3DA1A 2KEDA 1LTRD 4ZQ3A 3RMHA 3U9SA 3KLRA 4B7GA 4FW9A 3TZUA 4J6HA 3Q0AA 4DV7M 2I7NA 1IHZA 1C4QA 5CORA 2ZANA 4DXFA 3I90A 1ENFA 4LJ7A 3ZC7B 5EPJA 4A3VB 1KDAA 2F4IA 2XSCA 4BA2I 2K01A 3GTKB 3R8BA 4REZA 2EJMA 5COYA 2SDFA 3IG5A 4B08A 3GTPB 4TQUS 3C46A 4IUPA 4HL4A 1DGHB 1BQQT 4DV2M 1R4PB 4G7ZC 4IFDG 2DVWB 4G6ZA 3HOXB 1JR3A 4B9WA 5G3LF 1EWCA 4WORA 4G4RA 3J80S 1SYEA 3RE8A 4BWGB 1HA6A 2MHVA 3H0GB 2B8GA 3I4YA 4PCZA 3L7ZC 3TP7A 3GO8A 1SSOA 4K14A 3C3LA 3TP6A 4IFDH 3A8KE 3IL8A 4EQNA 4XDXA 1B1ZA 1XNQM 2XN9C 4OHJA 4FXKC 1TS2A 5JEAJ 2NN6G 1XC8A 1SXTA 2QEJC 4AKGA 1F9RA 3KSXA 3SE0A 2PCFB 4LMQD 5HGTA 3J7YW 3GPXA 5FTKA 4B3SM 3AL0C 2ZXOA 3S9WA 4GC9A 2IPKD 4XXEA 2BNKA 4JYAM 1DONA 2H4OA 3OOCA 5BN3A 2OT2A 3MXPA 1ENCA 3FDTA 3GTJB 1TWCB 2NTSA 2A5HA 3D8BA 1FD7D 4BY7B 1V43A 2EY6A 3VR6A 4HLQA 2AHMA 3UK6A 1JQJC 1CTMA 4LRTA 1LACA 4DXGA 5KIXA 2B2UC 4AKIA 2XZFA 4AYBB 2D5DA 2LS01 3SBJA 4AKHA 3T56B 2ENBA 4KN7C 2DXIA 3W0LB 2F0QA 2CFOA 4UAIA 1EZ8A 3GPUA 4ZRZA 1R7RA 4RGOS 1L0XB 1RJTA 3TZDA 2TMPA 4PMCA 3G7LA 4EVOA 4X66M 4AW4A 3NP8A 5C3XA 4DAPA 4A3EB 3M3YB 2QF7A 5BPVA 4LG2A 1J09A 2XVSA 1IN5A 1W5SA 3SHFA 1TU2B 3HU1A 2ZXRA 3TQSA 1V1PB 3ZYYX 1TIID 4ZPXA 3SASA 4BB9A 5IT9L 1ICWA 1PRTC 4QF4A 1IKMA 4A93B 5FTJA 1B9MA 4HSVA 3VLFB 3L29A 1IXZA 3I72A 1HNXM 4DUYM 3KF8A 3I8ZA 2EA0A 1U4LA 4IUUA 1T5XD 4P2CB 2K6AA 2F0VA 3SDZA 1LT4D 2AQ1B 1QWYA 4MGHA 5I4DA 3R2IA 2J7ZA 4L78A 2JSOA 3EQLC 3Q23A 4XQNA 3DM1A 1HQCA 5G3LD 1HT1E 1STGA 1T3TA 4LGYA 1QAMA 3SATA 1MX0A 5IGGA 2X69A 4K2LA 5CR3A 1N75A 3OTOM 2F0IA 2IT1A 1FNNA 1G6ZA 4IUVA 4Q5VA 3IFTA 2KCCA 3K7AB 3X3NA 2EYHA 3NQIA 3DMUA 3HU3A 1FJGM 1I4QA 3SFZA 4IBJA 1LV7A 1R6BX 5LMUM 3BG3A 3PUYA 4XYOA 1J5EM 5IGDA 5A2QS 3LQQA 1BO0A 3U6SA 1DCZA 1ENAA 2KQ3A 3ZH9B 2DY7A 2YR0A 2XH9A 5E1FA 2PMZB 2CW0C 2DHRA 1HXYD 2XSZA 2EYMA 2YU9B 2FFJA 1N36M 2X4AA 4J1MA 3KXEC 3M7NA 3HGIA 3V2TA 1DGGA 1LTSD 4WURA 4LF5M 4CHTB 3KBXA 1LT6D 5C4HA 4LY6A 1EZ6A 2A6ED 3ND8A 3GTGB 1QZMA 2K33A 1HNWM 1LT5D 1IKLA 2E2IB 3J7AV 5ELFA 1FNUA 3I4NB 3D31A 2IW3A 3F2UA 4RHSA 3AU7A 2NVQB 4TRDA 3SMSA 3PO3B 4BLCA 2B2VC 4K5XA 1LV9A 4IFDJ 4K2KA 4DR7M 4G4QA 1GLNA 5I6YA 1OJLA 2CV1A 1X37A 4KHPM 3HKZB 1GHJA 1IW7C 1LTGD 2R18A 2NB0A 1VDDA 2L55A 4K6LA 3FPPA 3FUUA 3FTFA 3HEJA 1JB3A 1DOKA 4FCWA 4H13C 3DWQA 1G4AE 4RNAA 1B53A 4NOOB 3T13A 3HJ8A 2L9HA 1WXQA 3LVVA 4GMQA 2UXDM 3K5MA 2F3VA 3FVQA 2JEAI 1A6XA 4OU7A 5KYIA 3D3RA 5EGTA 1NVMA 1DOLA 2CV2A 2I46A 1I6HB 3DEPA 1EE8A 3L27A 1RKNA 1DYQA 3OW7A 3QJYA 5AFWA 5FOBB 2DZNB 2ZBKB 1TWHB 2HQEA 3SEBA 1SJED 3HOYB 4JI1M 1ZQ9A 1PMRA 1CK1A 5C4ZA 3MJ5A 4LJ5A 3VDUA 2C5CA 2CVRA 3K5OA 1PTOB 1IYVA 5C4JB 5IIFA 3H6MA 4KHZA 2B2TA 5I2YA 5KGUA 4ID6A 1Y8OB 4C1NI 1MSGA 5JPMC 3TWKA 1O7YA 5JOBA 1XX8A 2LH0A 3DEOA 3HP3A 3D6CA 1AP0A 1LTID 3QWNA 1GHKA 4I8OA 1NJFA 5EPLA 4IBDA 4XT3B 2XZUA 1N78A 1XXHA 4HEDA 2AUJD 4KMUC 3MFGA 2XGNA 3VFDA 3JAML 1EL0A 1AN8A 4RGMA 2A6HC 2KA7A 3GLHA 2B2YA 3V05A 5LL6S 5DNFA 2K47A 3BZDB 3RZDB 4TUWA 2FJ2A 4HR7B 1MU5A 1CHPD 3J81L 1E2ZA 2PW5A 4U673 4KKUA 5C44B 1O80A 1Q3CA 4KLNA 3MTSA 3I4MB 3K0YA 5F2DA 2NVTB 1VDZA 4RHRA 1G2TA 2V6ZM 1RF2D 1QANA 4C1NK 2O5JC 4AQYM 1LABA 1KAAA 1QILA 5KQDA 1CZWA 2B8FA 5M9OA 4MGKE 2QBYA 3MXGA 4IURA 3SYLA 4F7XA 1Q1BA 3S1RB 1TH4A 5FLXE 4NSOB 1Q1EA 4WRDA 1Z5CA 1SYDA 3CQZB 2R6GA 4KY7A 1I3QB 2D7GA 1H9JA 1TVXA 3HOUB 4HMJA 1D2NA 2A68D 1BUVT 5C3WA 5FKAC 4U68A 2XF3A 1JORA 5EXXA 5E4WC 4RGTA 5NUCA 3E0JA 3KSJA 5M3FB 1Z6TA 3RFWA 3U60A 2Y0QA 3MZ5A 2KVMA 3UMMA 2Y0TA 4KODA 1HUNA 2R62A 1WTPA 4QMGA 1NNJA 4XBOA 3K58A 3THGA 4DV6M 1A3VA 2LKVA 4IN3A 1BCPB 3QOJA 4C3JG 1YNJC 3H4MA 2KW0A 2VQFM 1F2MA 4DAYA 4V190 2MPMA 3HJQA 2WACA 4A3FB 1WTRA 3C58A 2LNHC 3TBIB 3U6CA 4FYDA 2A69D 3KS4A 1NY5A 3SYKA 3CKIB 2BJWA 1DOMA 3D8LA 5EKIA 2YYZA 3BS1A 1EYAA 4GH9A 4DR6M 3CHBD 2K5QA 5BN5A 1HUMA 2RSNA 1I4XA 5ITRA 5ITXE 1IY0A 1FGBD 2R65A 4KJOA 1PFMA 4N9TA 3MXNA 5DYIA 4G4NA 1KDBA 4OX9M 3NQTA 3X3MA 5EBDA 1RDPD 5JVG3 3R2TA 4H0LC 2UUCM 1GUNA 2PQEA 4LJZC 3DZDA 1G2SA 4DV3M 2RA4A 3ERQA 4M9ZA 1XXHB 3M7GA 1WTOA 2E2HB 1JR3D 3L2AA 1PTOF 1TY0A 2KOLA 2Z4IA 3TE6A 3GLHB 1VCIA 4C3JB 2SNSA 5FLXS 3Q6SA 4OO1G 4H44C 5ITUA 4XTCS 5KPRA 3EIEA 3UGJA 1E2WA 1IBMM 1LO5D 2C96A 4IBCA 3CRKC 4M8AA 4TKOB 3V96A 1JWMD 2VB2X 5E26A 3BYTB 1ET9A 3DOAA 5EKKA 4KTAA 1MGSA 5JI3E 2F5PA 2FNAA 5LL6X 1IY2A 1G41A 3T51B 2NVXB 3K92A 1EEID 3AMUA 3LX0A 4J8QA 2Z7JA 2NQ8C 1IBKM 2F0FA 2QBYB 4M0DA 3QO2A 3VDPA 4M9XA 5CBAE 1GXDC 2FINB 4LJ9A 5M5XB 3K5NA 5F3WA 3OMGA 1NCVA 3PVSA 1E9RA 2QCUA 2YNMD 4DFAA 2UUAM 1AZQA 1OXUA 1K83B 2NUCA 2Z1CA 2WB1B 2F0UA 1J7KA 3OMCA 4FWDA 3AB9A 2D7EA 1UUPA 3W3AA 1NUCA 1Z6HA 1TS5A 1W6KA 3GP1A 2K28A 4HMIA 1BBXC 2R3ZA 3D6WA 2ERCA 2NTTA 4QB4A 2EVBA 3GTLB 5ELEA 3NSWA 2FMCA 1RD9D 5K36H 3U60B 4FF2A 4M9SA 3K8ZA 5JI2E 4ZUJA 2AQ3B 1CA6A 3GV3A 1F2YA 2G8LA 1AEXA 4RGNA 2BCOA 3BDLA 2FHTA 3FUWA 4ZAIA 1XNRM 1BXTA 1HR0M 2EYPA 5M3MB 2P5TA 1EY6A 5CGKA 1D1IA 1SNCA 2BA1A 4LCBA 5T1IA 2OQ4A 5EQ0A 3TMEA 1TY2A 1PTOC 4DK0A 3PFIA 4KD4A 2XRQD 2RGHA 3DXJC 3P75A 5I9OA 4S3SA 4X3TA 1M4VA 1TR5A 2SEBD 4R9WA 3SVMA 1F9PA 1GOZA 1SNOA 2FE8A 2EYFA 3A42A 3LNNA 4DV0M 1X3PA 2ZAOA 1RHPA 3BDOA 4HTHA 4JI7M 1STNA 1Y1VB 4B3MM 2Z4RA 4CGYB 2NVYB 4QUFA 4A3MB 4JI3M 1BCPF 1Y69U 1EY5A 2F4VM 4LFCM 2CUZA 2NBFA 3SARA 3LQRA 3I4VA 1PTOD 1AW7A 3KOXE 4A3BB 1K8OA 4KKTA 3FRPB 1CT1D 1JWUD 4NSRA 4GKJM 3FTEA 5IOCA 3GQ3A 4Z8XA 3TP5A 3VA5A 2R4EA 1PJIA 2EY2A 1G8PA 4GZYC 1SXJA 1H6UA 2DZOB 4QCLA 1WCMB 3PUWA 1OFIA 4DGZA 2ZAMA 4JI6M 2NN6H 2ICEC 5C18A 2DN8A 1S5FD 3NUCA 4FCTA 5E3FA 5A2QE 4LRSA 4JXJA 3S16B 2EJFC 2XSZD 3KK7A 3GQBA 1SE3A 4A3IB 3RZOB 4AI6A 4DR1M 4S12A 5FO7B 4L4UA 4N9PA 1ZEQX 2DNCA 1TWGB 2XIWA 4G57A 1Q39A 2MGSA 4X3SA 1DM0B 3C1FA 1E0BA 3FUTA 2Z4SA 4A3KB 3U6PA 1QG7A 1I94M 2BDOA 3WHKA 4G4KA 4CKCA 5KPZA 2F0JA 3T53B 2DWZB 1N33M 2EDGA 3PUZA 3MHVC 4R3DA 2DNEA 2H1RA 3VR2A 4IJFA 1Z47A 5CV4A 2B2WA 5M5YB 1V8QA 2X6GA 4OW0A 4ZLTF 1KSFX 1WTWA 2KUMA 1L0YB 4JI2M 1SYGA 2JA5B 1NHGC 1X32A 3GLFA 1GKIA 4KV6A 1MSHA 1TH2A 2HKJA 2RQXA 1IN6A 4LF9M 2CEAA 3OIQA 4IUNA 1E32A 3NWTA 3SK8A 4KKSA 1R4QB 3EIHA 4LF4M 2A5YB 2RKSA 4RAUC 4FO2A 3HJSA 1FYCA 3IG8A 5EXPA 5D65A 5KRUA 3A8JE 2R92B 1PYWD 4RF1A 3GPPA 4XT1B 4E6IA 5CV9A 2KXEA 1CQVA 4IZ8A 3GD7A 4IBBA 4GHAA 4ULLA 1IYUA 5EJCA 2B2TC 4JV5M 1BCPD 1STHA 1L1ZA 5LHY1 3RUZA 1ILPA 1GL7A 4GIPA 4D82A 2MUYA 1NHWC 1PZID 5HURA 4L6TB 4DNRB 2LFNA 1D1KA 1MD2D 4NW2A 4L16A 4TSSA 1KLGD 4EGVA 4BBAA 3WOFA 5KQ8A 1E2VA 5D14A 4C3IG 2CE7A 1SYBA 4M0WA 1I6VC 2F5OA 2JA2A 3AOEC 1EY4A 2A6EC 1JOOA 1LTTD 2CHBD 1B9NA 2C9CA 2B2YC 3D8GA 1WTXA 2XEPA 3FKIB 3GRUA 2EPBA 4CKEA 1SXJB 3R3OA 1SYFA 3FTCA 4LZJA 1L2BA 4IBKA 3GTOB 2F0DA 4PDGA 3L9AX 5E4XA 2F5QA 2VNUD 2G9HD 4NMZA 1ORYB 1WD0A 1SNMA 5EQTA 4ABNA 2PYKA 3VK7A 1Q8IA 3MFYA 1BOSA 2RBMA 2H1EA 2J4XA 2SNMA 4WFN3 5C0XG 4OVZA 3WHLA 4F88A 1KFVA 3MWYW 2HUGA 5CBEE 3P7JA 4K6DA 2ID0A 1SNPA 2J0TD 2PO4A 1BNZA 3OWEB 2JA6B 1D2BA 4W5WA 2A74C 3IKJA 4C3IB 4NL4H 4H7BA 4NKLA 1VMPA 5EP2A 1PM5A 2MP1A 4K5WA 3U6DA 5KNCA 2J7OA 2EYOA 4JBWA 3Q22A 2UU9M 3CF0A 2FFKB 2MJ8A 1SMYD 2K1BA 4DR2M 1EEFD 1PTOH 1U4MA 1LTBD 3FUXA 3CU7A 3R93A 3VA7A 1A2UA 3A56A 1I50B 3KW6A 1B4OA 3FMCA 1S5ED 5DM63 4L8RC 3QAUA 1HPCA 2M2LA 1Y8NB 2E75C 1IL8A 3GLFB 2L7IA 4MHEA 2I7PA 5DYGA 1OFHA 1QAOA 1PLFA 1M8AA 4O1NA 1SAPA 2XRSD 1CA5A 1MBYA 3GLIA 1JCKB 3TWLA 4DR4M 2F0NA 3Q8XA 3K59A 3I4LA 3EVQA 1I4PA 5M5WB 3NK9A 3DUZA 4C2MB 2JA8B 1F9SA 2QPAA 4IBIA 2C99A 1EIHA 3MAQA 2CHGA 3FD9A 4LF6M 2XNAC 3I91A 5KO3A 2CQAA 3T16A 3D4DA 4KY5A 2O5IC 5DNYA 1W6JA 2BDNA 4EQOA 2QKIC 1JOKA 1XMOM 3NPPA 1A2TA 2F0PA 1SDFA 3S14B 5LMNM 1QB5D 2DY8A 3M4OB 1ZYRC 5FO8B 4NXNM 3OSOA 5FTNA 4LAAA 1HTLD 4CBVA 3TN2A 4R8NA 2JXMB 1DJRD 2K5WA 3A8IE 2XFSA 4JN6A 1ET6A 1HRJA 4DV4M 4Q0FA 3PIP3 2N55A 2NZ1D 5EP3A 2QCPX 5BN4A 4PDIA 2X8AA 3ND9A 3N52A 3TDQA 5FSWA 1ZYRD 4IIWA 2BOSA 4I4LA 1S4ZA 4FVMA 4BS9A 1NNUC 1NR4A 5ELBA 2HDLA 2A68C 1B2TA 3QB3A 3PO2B 3U5ZA 1HQMC 1BR9A 3T1HM 2L7HA 2YFQA 1IN8A 1D6EC 2QZ4A 3SC3A 4KK7A 4X3UA 4IFDI 3MK6A 2IX3A 3J80L 4YHHM 3P20A 1OXVA 3NWSA 2E74C 5IT9S 1R2YA 1GUOA 1F77A 5EJWA 5E6JA 2L09A 5FTMA 1AZPA 1TT2A 3KOYE 3S2DB 3UZUA 3GRVA 4IALA 4B3RM 1PZJD 3A45A 2NN6I 1HNZM 2K03A 1PXUA 1ONLA 4MGIE 3VR4A 4KD3A 4DK1A 3L3OC 1ILQA 1H9SA 4B7HA 2B2VA 2KECA 2A69C 2AQ2B 1PFNA 1STYA 2K32A 2O5RA 3FKEA 1KNAA 4NRWA 2HCCA 3SK5A 3GTQB 1STEA 3KVWA 1A3TA 4ITQA 3B9PA 1F2ZA 3GLIB 4UDUC 1XXGA 4L15A 2PZTA 3OHXC 4NP5A 3GRYA 1YE9A 1Z7TA 1HFNA 5EBCA 1HFGA 2Q2EB 3AJIB 5C0XJ 3JR5A 4OGQC 3GP7A 3LWUA 1OO9B 3NTHA 2W82A 1IXRC 1CZGA 3KP0E 3E6ZX 1AFPA 1SNDA 1JC7A 2OPFA 2D2CC 3HHYA 2Z3XA 2B39A 4L63B 1DGBA 3VK8A 1DD2A 3QG1A 2QDBA 3U9OA 3TL4X 2V1UA 1S3SA 3S1NB 3TP8A 1EU3A 1QAQA 1NAPA 4JI0M 4KI0A 1DGHA 4ZUIA 5DEHA 3JAME 3R9XB 1C1KA 3HHZA 1K3WA 1S5DD 2JE6I 3VYTA 3LVWA 1EY7A 3S15B 1C48A 5CMDA 2LXEA 2O2LD 3O13A 4IJEA 3S1QB 1GUWA 3J81E 1MI2A 4QNRA 3L25A 3T15A 5H37D 2Y0SB 4WJWA 3H09A 4EIWA 1CI3M 4P16A 4PMBA 5CV7A 2QP9X 4OO1H 4ILWA 1SXJD 1XMQM 4IQZA 2RDHA 4DNTB 4KN4C 1ZAEA 1Z59A 2R46A 2KEBA 4LZZA 2ICIA 1SE4A 2IL8A 4XYQA 1EQVA 4R8IA 3P1HA 1H9MA 3HOWB 3U5ZB 4C3HG 2IJ0A 2KA6B 2F0LA 5J1ZA 3R8FA 3KUPA 3FTDA 4HCSA 3CF6E 5C1BA 4OIKA 3E4RA 5ELCA 2QILA 5C5LA 4XIGS 3QIAA 1D5ZC 1KDCA 3VYRA 3GPYA 1H9KA 1YNNC 1BDOA 5A2QL 2ZT9C 1L2CA 4I7ZC 4D81A 4CKBA 2JYOA 3GLGA 3H94A 1QNKA 1I4RA 1NY6A 4JI8M 3HHXA 3M0EA 2I07B 2ZXPA 2XLJA 2KZSA 3SMPA 4XQQA 3U61A 5IODA 3PV0A 1I4WA 4MGZE 3U6LA 2EYJA 1HT2E 1NSNS 3RLFA 1TWFB 2L11A 4R7GA 5IZ7D 1NR2A 4IBGA 1YNND 4G4OA 4X62M 2Z4HA 2EOTA 4DU9A 3ILKA 3MC0B 4MM3B 1Y8PB 1N77A 3M6AA 5D3IB 1L2DA 1XTCD 1EIGA 4YIJA 5EKLA 3EROA 1O7ZA 4LJ4A 2F03A 1V1PA 1VF7A 4C3HB 3ITPA 2O4XA 1YUBA 4FXDA 2HCBA 3MXUA 1O78A 2M5ZA 2HDMA 4CJ0B 2M9VA 3AKZA 4ODGA 4KY6A 3PXGA 3MHBA 3BVMA 4LK1C 3K5LA 3JAMS 1PJJA 5DAUA 1HHVA 1N32M 3SXHA 1D5MC 1NJGA 5J39A 1B44D 1HTPA 1T5EA 3J2PB 4L8JA 2RDGA 2LMCB 2F0SA 3EJIA 3HOVB 4MH0E 1IM2A 3J81S 4X3KA 1DXMA 2Z8LA 5ITTA 1SXJE 2WKDA 3FPUB 4LJ8A 2BJVA 5KYLA 2HL7A 4ZYSA 4GC5A 4LJAA 2EY5A 1N34M 3NHHA 3HHWA 3VYUA 5T1GA 3KDSE 4HAEA 3FUVA 4FF1A 1TS3A 1PRTF 2R61A 3HG9A 3K1JA 3C2PA 3U6MA 2D9UA 1EOTA 2JA7B 2RVLA 4PMWA 3AV0A 1B3AA 2EZVA 4FP5D 1SE2A 4DR3M 2R45A 1STAA 5GKNA 5EXSA 1XWIA 1TDZA 2RDFA 5KNBA 5J22A 1UM8A 1L8QA 4RKLA 1G8ZD 4ME5A 4CJ1B 3KOWE 3HGBA 3VR3A 3PMFA 3FEWX 3GV6A 2V4DA 2KZUA 3PUXA 3A7AB 1JE4A 1L1TA 1J8IA 4NRVA 4WW0A 1KYIA 4QIWB 3SHGB 4I65A 3DWPA 3E5SA 4LF7M 5FO9B 2IWHA 1QJOA 1IXSB 1SYCA 3SHLA 2EUCA 2KEEA 3MVVA 4LJ6A 1KTKA 3JR4A 2LY7A 2A73B 4AG6A 2E5LM 4Y7NB 2VUMB 3VKGA 3GLGB 1Q12A 3H3VC 1HCZA 3BYYB 2J7NA 4QNMA 3W0FA 5TSSA 5I6WA 2V1CA 3AFHA 2D7HA 4FWGA 1EU4A 3U61B 4DF7A 1S5CD 4A3JB 1EWHA 1QE6A 3OPOA 1QYRA 3TWMA 2WV6D 1BCPC 1RTOA 3SK4A 3A55A 3GQ4A 2C98A 3I3CA 2RSOA 4FD2A 3KBGA 5CYUA 1R9TB 2D62A 1HQRD 1J9OA 4LFBM 1EQTA 3BDCA 3N6RA 2QENA 2M60A 1DZ1A 1V1OA 4FF4A 3I70A 4KO8A 2F0KA 4DN4M 2EY1A 3Q24A 1Z5BA 5EPKA 3GQ5A 4G7OC 4HCEA 5IGBA 1O7LA 4RCNA 3SK6A 3L26A 3A7LA 4F8MA 3T4AC 2F3WA 1S5BD 5IGCA 1F2LA 1K82A 2LWXA 2Q8RE 3BOSA 5JJZA 4CJ2C 5DM73 1PRTD 1TDHA 4NXMM 2E76C 4K8IA 3I73A 3K6OA 1IBLM 2PNRC 3MA2B 3CTWB 2EE1A 2K7VA 5IREB 1I4HA 3HRZC 4MN3A 4FWHA 2KHSA 3J7AS 4BBRB 1A15A 4G7HC 1PZKD 1RCVD 3U6QA 2R7ZB 2KCNA 2F0TA 3SAVA 2G9DA 2F1MA 4C56C 2R4JA 3NWLA 4F87A 1BF4A 3K57A 1WVLA 1R2ZA 2L5TA 1IN4A 1G91A 4B7FA 3H91A 5IGEA 2HHHM 2KJXA 2F0HA 5ELDA 1X3QA 3G6JB 1ZKOA 3M85A 4PQXA 3HKPA 1SMYC 1RODA 1TGUA 2AWOA 1I4GA 4O42A 2YQZA 4JI5M 5EP1A 1LTAD 4QUCA 4YY3M 2TSSA 2Y21A 2N88A 5C6AA 2UXCM 5C0XH 2ZM6M 1E9SA 5A35A 2PZWA 2CW0D 1TS4A 2SOBA 3VR5A 1G59A 2B2UA 1ZXTA 1TWAB 4RWSC 4QOZC 1IQPA 3D4RA 4BY1B 2XWBB 2VXWA 3SAWA 3LWEA 1Y1WB 3T38A 3I51A 5FLXL 2K5DA 4XQJA 3EFXD 4OO1I 3AOGA 1QNUA 1SBBB 2PPBC 1FR3A 2PW7A 5IT9E 4MIUA 3DFZA 1EY0A 2F0EA 1HQYE 3GO5A 4EQPA 5C4XB 1Q3LA 3QWLA 1KABA 3A46A 5C5MA 2NYZD 5C3EB 5JVH3 4RFBA 4B9XA 1DGFA 5EP4A 2K04A 3EA6A 1NSFA 4HSPA 1YSYA 5KPTA 1OXSC 1GL6A 4IUTA 4I5SA 2GA4B 1FNVA 1XYIA 1PDQA 2IX0A 4A3DB 1IW7D 2RGOA 5KNDA 1U4RA 1A3UA 3DHQA 4DV1M 2Q8TA 1B50A 1GUTA 1SEBD 4FCVA 3KLSA 4GRIA 4GHLA 2VIIA 4RF0A 3KS8A 3J7BA 2WIIB 2XWJB 4ZKCB 1K3XA 2X49A 1TQOA 1CQFA 3PNVA 4DV5M 1RTNA 2CV0A 3LMMA 5I9PA 2VB3X 2XFTA 2WP8J 1CFMA 1QCBD 4HN7A 4OL7A 2BE5C 3HU2A 1QOHA 3CRLC 4DA2A 2EXZA 2OEOA 3M4YA 5ITYA 1ESRA 4QHSA 3FYCA 2DWLA 1LLRD 4BBSB 2F0GA 3TSSA 1EY9A 3HS0C 3QOLA 5KEEA 3PUVA 3AOEA 2L4NA 7CATA 1XWEA 4RA8A 4LFAM 1H9RA 1JOQA 4ZK9B 1STBA 1VMCA 5ISRA 3HOZB 2BE5D 4XGIA 1DO0A 4DR5M 2WAQB 4OVZB 4D80A 1ESFA 5CV8A 3IFDA 5JPNC 5FK9C 2R93B 2EO2A 3RGSA 1Q90A 2NWGA 1EYDA 4K5VA 3FYDA 2K05A 1C8CA 2CHQA 1UNSA 2A6HD 4KJNA 1Z5AA 1JWSD 2Y20A 4AZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBI A;  4CHT B;  4CGY B; 
#chains in the Genus database with same CATH topology
 5EXT A;  2JY5 A;  3BVG A;  2X6L A;  3DWA A;  5EAY A;  4KHV A;  4DUZ M;  2WIN B;  2M00 A;  1DO2 A;  1XHB A;  2OXP A;  3GRR A;  2CH4 A;  1FNW A;  1WD1 A;  4IBF A;  1T9H A;  1HA5 A;  1ML0 D;  1FL0 A;  2E2D C;  2F0O A;  3TPZ A;  1II3 A;  3A5Z B;  5JAV A;  3J27 B;  3A98 B;  1LM0 A;  2O01 F;  1LT3 D;  3CCE A;  4B3T L;  3T1Y M;  1IBM Q;  2PZU A;  2LVP C;  5IP9 H;  2FOI C;  3S1N H;  2JP1 A;  5I2X A;  3S17 B;  3UI2 A;  1PH9 A;  1KQS A;  4A3C G;  4FXG C;  2K9D A;  1G29 1;  1D5X C;  1WTQ A;  3KFU G;  1OXT A;  1OXX K;  5CV6 A;  3J7A F;  1IN7 A;  1XMQ Q;  3OWF A;  2RHS B;  5JEA G;  2KRK A;  3E9S A;  3VYS A;  1PH7 A;  2NZO A;  3K2L A;  1GUS A;  1N32 L;  1UWV A;  4PT5 A;  2Y0S G;  3NE5 B;  4IPD A;  1TKW B;  1QVC A;  3S15 H;  2PI2 A;  3PIO 3;  3I7F A;  4V0B A;  3G71 A;  1GVN A;  1XJV A;  2JZ1 A;  2E2J B;  3W68 A;  5GQO A;  3KF6 B;  4HEO A;  2MJ5 B;  4LF8 M;  2XGT A;  4IUQ A;  1VS0 A;  2UXB M;  3W1G A;  3NTK A;  5JEA H;  2C9O A;  1LYL A;  1PRT B;  4NDX A;  4X64 M;  5CV5 A;  3ONA B;  1IY1 A;  2WKC A;  2HCI A;  3RD4 A;  4II7 A;  5ITQ A;  1WJJ A;  2DWN A;  1QUS A;  2DAG A;  4K0K M;  4OWT B;  3HWS A;  3UJN A;  1KLU D;  1AE2 A;  3NEN A;  1T6O A;  1VEJ A;  3W2D A;  3C1E A;  2F5S A;  3SAU A;  1BBW A;  1WJ7 A;  1F9Q A;  1CKN A;  2VQE M;  4DV2 L;  4PV1 C;  1N34 L;  4X65 M;  2C5R A;  1KNE A;  4PD2 A;  3BVZ A;  4Z9C B;  4GKK M;  2AUK A;  2AWN A;  3HOW H;  2L1B A;  4A3G B;  3S1M B;  1EOV A;  3IAY A;  1PFB A;  1SXJ C;  1K8M A;  1JJ2 A;  5D3D A;  1GKH A;  2Q8I B;  1EYC A;  1Q02 A;  1UAP A;  3WOE A;  4QHT A;  1SJH D;  1NE3 A;  4CDC C;  1YNJ D;  2CHV A;  3KOZ E;  4DR3 L;  4X62 Q;  1XNQ L;  4LGM A;  4FF3 A;  2JEB I;  2L12 A;  1EFI D;  4RH6 A;  1E94 E;  4BA1 I;  3SR1 A;  1U9R A;  4DAM A;  2F5N A;  1QZG A;  2DWM A;  1JJC B;  1WTV A;  5IWA M;  4A76 A;  2F0M A;  1F4I A;  1VF5 C;  5ITX A;  4QQB X;  1SFO B;  3PNY A;  4QOS A;  2KRU A;  2KEN A;  4QIW E;  3E9I A;  4K8J A;  4FNF A;  1CHQ D;  4JYA L;  1U4P A;  4RKB A;  4OIJ A;  1TWF H;  1SNQ A;  3MEH A;  4IPH A;  1UEA B;  1UEB A;  2FMM A;  3J80 E;  5IGF A;  2G5G X;  3GTM B;  4ZKB B;  4AYB E;  3U4V A;  1QVR A;  4JI4 M;  3A54 A;  5K5P A;  4MGY E;  3U6O A;  2IHF A;  4PNY A;  3GLG E;  4MB7 A;  1CM9 A;  3NBI A;  1K8A C;  1GJX A;  1D0M A;  2L0C A;  3E0E A;  4B3M Q;  1Q82 C;  4JI3 Q;  1W5T A;  4HJ7 A;  3HKS A;  2DKL A;  4LFC Q;  1D0K A;  4C3H H;  1JQY D;  2RKO A;  4JK1 C;  4GLA C;  1JR0 D;  2N3S A;  3WDN A;  1VEK A;  3ZCB B;  5CC4 A;  2B2W C;  1JIC A;  2UUB M;  1TXY A;  5FTL A;  4GKJ Q;  4GIT A;  3FRH A;  3I04 M;  2B63 B;  1WOC A;  3HZX A;  4YCW A;  3NXW A;  5J3B A;  2DNA A;  4AG5 A;  4X66 L;  3FP9 A;  2HWJ A;  5BR8 M;  2OF1 A;  1QQW A;  1H9S B;  3CCV A;  5GAG C;  2KHJ A;  3RGP A;  2IHE A;  3GDE A;  3S2H B;  1ZMW A;  3NTI A;  2EJG C;  1Q3B A;  1JE5 A;  3HOV H;  3URY A;  3D4W A;  3D0F A;  4I81 A;  3U6E A;  4GN4 B;  3I56 A;  1EY8 A;  4DAV A;  4M1U B;  3KP1 E;  8CAT A;  3NBH A;  4Z6Y A;  5K36 G;  1GUG A;  4LFB L;  2F0W A;  3FE3 A;  3H0G G;  5GAH C;  3OIP A;  2IX1 A;  3CF2 A;  2BA0 A;  3KLS X;  4B3T M;  4IBE A;  1YHA A;  1TH3 A;  1IFY A;  2EYL A;  4RCO A;  5IT9 c;  5C0X I;  2L6O A;  1HNX L;  4CIS A;  4DR1 Q;  3L28 A;  1G3I A;  1VQ5 A;  3VKH A;  1K9M C;  3DA1 A;  2KED A;  1LTR D;  4ZQ3 A;  2EKF A;  3RMH A;  2JA7 H;  3KDF A;  3U9S A;  3KLR A;  4B7G A;  4LF7 Q;  4FW9 A;  5GRO A;  3TZU A;  4J6H A;  3Q0A A;  1N9W A;  4DV7 M;  2I7N A;  1IHZ A;  1C4Q A;  5COR A;  2ZAN A;  4DXF A;  3I90 A;  1ENF A;  4LJ7 A;  3ZC7 B;  5EPJ A;  4A3V B;  1KDA A;  2E5L Q;  1VQM A;  2F4I A;  2XSC A;  4BA2 I;  2K01 A;  4BY7 G;  3GTK B;  1ASY A;  1CKN B;  3R8B A;  4MNO A;  4REZ A;  2EJM A;  5COY A;  2SDF A;  3IG5 A;  1SMX A;  4B08 A;  1XPR A;  3GTP B;  4TQU S;  3C46 A;  4IUP A;  4HL4 A;  2Z6K C;  4AYB G;  5IE8 A;  3TRZ A;  1DGH B;  1BQQ T;  4DV2 M;  1R4P B;  4G7Z C;  4IFD G;  2DVW B;  5DFL A;  1IXR A;  4G6Z A;  3HOX B;  1JR3 A;  4B9W A;  5G3L F;  4LF9 Q;  1EWC A;  4WOR A;  1J5E L;  4G4R A;  3F1Z A;  3J80 S;  1SYE A;  3RE8 A;  4BWG B;  1HA6 A;  2MHV A;  3BXW A;  3H0G B;  2B8G A;  3I4Y A;  4PCZ A;  1SRU A;  3L7Z C;  3GO8 A;  1SSO A;  3TP7 A;  4ANR A;  4K14 A;  1T43 A;  3C3L A;  3TP6 A;  4Y7N H;  1YJ9 A;  4IFD H;  3A8K E;  3IL8 A;  4EQN A;  2ZTE A;  1B1Z A;  1XNQ M;  4XDX A;  2XN9 C;  4OHJ A;  3KLW A;  4LFB Q;  2L15 A;  1TS2 A;  4FXK C;  2NN6 G;  5JEA J;  1XC8 A;  1SXT A;  2QEJ C;  4AKG A;  1F9R A;  3KSX A;  3SE0 A;  1QVF A;  2PCF B;  4LMQ D;  5HGT A;  1L1O A;  3CMA A;  4A3E G;  3J7Y W;  3GPX A;  5FTK A;  4B3S M;  3AL0 C;  2ZXO A;  3S9W A;  4A3J H;  4GC9 A;  2IPK D;  4XXE A;  1SLJ A;  4JV5 Q;  2BNK A;  4JYA M;  1DON A;  2H4O A;  3OOC A;  4MTK A;  5BN3 A;  2OT2 A;  3MXP A;  1ENC A;  3B7Q A;  3FDT A;  3GTJ B;  2VF7 A;  1CKM A;  1R4G A;  1TWC B;  2NTS A;  2A5H A;  3D8B A;  1FD7 D;  4BY7 B;  1V43 A;  2EY6 A;  4A93 G;  3VR6 A;  1R9T H;  2BWE A;  4HLQ A;  2AHM A;  3UK6 A;  1JQJ C;  2K5N A;  1CTM A;  1E22 A;  5DLQ E;  4LRT A;  1LAC A;  4DXG A;  5KIX A;  2B2U C;  2JXN A;  4AKI A;  2XZF A;  4JOI A;  4AYB B;  4DR7 L;  2D5D A;  4NXM Q;  4L6V 6;  2LS0 1;  3SBJ A;  4AKH A;  1IBL Q;  3T56 B;  2QA4 A;  2ENB A;  1HZB A;  1HZ9 A;  2OQK A;  4KN7 C;  4KHP L;  2DXI A;  3W0L B;  2F0Q A;  2CFO A;  2K75 A;  4YWM A;  4UAI A;  3I2Z A;  1EZ8 A;  2YTV A;  3H3V I;  2RCF A;  3GPU A;  4ZRZ A;  3NEL A;  1R7R A;  4RGO S;  1L0X B;  3CC2 A;  1RJT A;  3TZD A;  2TMP A;  4PMC A;  3G7L A;  4EVO A;  2LSS A;  2KNA A;  4X66 M;  4AW4 A;  1KIX A;  3NP8 A;  5C3X A;  4DAP A;  4A3E B;  3M3Y B;  3NBH B;  2QF7 A;  5BPV A;  4LG2 A;  4OON A;  1J09 A;  2XVS A;  2HHH Q;  2UXD L;  1IN5 A;  1W5S A;  3SHF A;  1TU2 B;  2K50 A;  4DK6 C;  3HU1 A;  2ZXR A;  3WWV A;  3TQS A;  1V1P B;  3ZYY X;  1TII D;  2CP8 A;  2OTJ A;  4ZPX A;  3SAS A;  4BB9 A;  5IT9 L;  1ICW A;  1X3F A;  4BBR H;  1PRT C;  4QF4 A;  3CF5 A;  1IKM A;  4A93 B;  5FTJ A;  1B9M A;  4HSV A;  3VLF B;  3L29 A;  4JI5 Q;  1IXZ A;  3I72 A;  1V9P A;  1HNX M;  3KDF B;  4DUY M;  3KF8 A;  3I8Z A;  4YY3 Q;  2EA0 A;  1U4L A;  4IUU A;  2UXC Q;  1WIV A;  1T5X D;  4P2C B;  2K6A A;  2F0V A;  3SDZ A;  2ZM6 Q;  1A63 A;  1LT4 D;  2AQ1 B;  2WSF F;  4PZ6 A;  1PH5 A;  1QWY A;  4MGH A;  5I4D A;  3R2I A;  2J7Z A;  2B3G A;  4LW1 A;  2MO1 A;  4L78 A;  2JSO A;  3EQL C;  3Q23 A;  4XQN A;  3DM1 A;  1HQC A;  3L2P A;  5G3L D;  3IHP A;  1HT1 E;  1STG A;  1T3T A;  4JBM A;  4LGY A;  1QAM A;  3PF5 A;  1EQQ A;  3SAT A;  1MX0 A;  4EX5 A;  4P74 A;  5IGG A;  2X69 A;  2B29 A;  4K2L A;  5CR3 A;  1N75 A;  3OTO M;  2F0I A;  2IT1 A;  1VQI A;  1YBY A;  3I4N G;  1FNN A;  1G6Z A;  4IUV A;  4Q5V A;  3IFT A;  1QUT A;  1NNX A;  2KCC A;  2LVA A;  3K7A B;  1E24 A;  2EYH A;  3X3N A;  1WGL A;  3DMU A;  3HU3 A;  1FJG M;  1I4Q A;  3NQI A;  3PO3 G;  1ZV1 A;  1PH2 A;  3SFZ A;  4IBJ A;  1LV7 A;  1PH3 A;  1R6B X;  2H5X A;  5LMU M;  3BG3 A;  2VL6 A;  3PUY A;  3C3D A;  4XYO A;  1J5E M;  5IGD A;  1TWA H;  5A2Q S;  3LQQ A;  3JAM c;  1B8A A;  3CCS A;  3HKZ G;  1BO0 A;  4BY1 H;  3U6S A;  1DCZ A;  2GVB A;  1ENA A;  2KQ3 A;  1Y1W H;  3ZH9 B;  2DY7 A;  2YR0 A;  3F92 A;  2XH9 A;  5E1F A;  2PMZ B;  5C3E G;  2CW0 C;  2DHR A;  4DR5 L;  1HXY D;  4Y52 H;  1L1O B;  2XSZ A;  3RLN A;  2EYM A;  2YU9 B;  2FFJ A;  1N36 M;  2X4A A;  4J1M A;  4A3L G;  3KXE C;  3M7N A;  3U50 C;  1NTG A;  4LF6 Q;  3J81 c;  3HGI A;  5C4X H;  3V2T A;  4DV1 Q;  1DGG A;  1MHW C;  1LTS D;  1XPO A;  4WUR A;  4LF5 M;  4DKA C;  5C3E H;  4CHT B;  3KBX A;  3PSI A;  1LT6 D;  4YWK A;  5C4H A;  4LY6 A;  1EZ6 A;  2A6E D;  3ND8 A;  3GTG B;  1QZM A;  2K33 A;  1HNW M;  1LT5 D;  1IKL A;  2E2I B;  3J7A V;  5ELF A;  4DUZ L;  1S3O A;  1FNU A;  2MGW A;  4DV5 Q;  1PH4 A;  3I4N B;  3D31 A;  2IW3 A;  3F2U A;  3HOY G;  4RHS A;  3AU7 A;  3UDI A;  1N8R C;  2NVQ B;  3F2B A;  4TRD A;  3SMS A;  3STB D;  1KRT A;  4A3D H;  3PO3 B;  4BLC A;  2B2V C;  4K5X A;  1LV9 A;  4IFD J;  4KLK A;  4K2K A;  4DR7 M;  4G4Q A;  2KHI A;  1JMC A;  1SN8 A;  1GLN A;  4GEW A;  3T1Y L;  5I6Y A;  1OJL A;  2CV1 A;  4OXP A;  1X37 A;  4KHP M;  3HKZ B;  1GHJ A;  1IW7 C;  1LTG D;  2R18 A;  1QZE A;  2BH8 A;  1VDD A;  2L55 A;  2NB0 A;  1HJP A;  4K6L A;  1X56 A;  3FPP A;  3FUU A;  3FTF A;  3HEJ A;  1JB3 A;  5JJI A;  1DOK A;  4FCW A;  4H13 C;  3DWQ A;  4LFA Q;  1G4A E;  4RNA A;  4LF8 L;  2G3Q A;  1B53 A;  4NOO B;  3T13 A;  4DV6 L;  3HJ8 A;  2L9H A;  1WXQ A;  3LVV A;  4GMQ A;  4X64 L;  2UXD M;  2Z8Y M;  1K0R A;  2C35 B;  3K5M A;  2F3V A;  3FVQ A;  2JEA I;  1A6X A;  4OU7 A;  5KYI A;  3D3R A;  5EGT A;  1NVM A;  1DOL A;  4L5S A;  2CV2 A;  3T6P A;  2I46 A;  4BBS H;  1UFZ A;  1I6H B;  3DEP A;  3KF8 B;  3CC7 A;  1EE8 A;  3L27 A;  4GN3 B;  1RKN A;  1DYQ A;  3OW7 A;  3QJY A;  5AFW A;  5FOB B;  5IYC H;  2B3T A;  2MH8 A;  2DZN B;  4GKK L;  2ZBK B;  4IO9 A;  1TWH B;  2HQE A;  3SEB A;  1SJE D;  3HOY B;  4JI1 M;  4DR6 L;  1ZQ9 A;  1PMR A;  1CK1 A;  5C4Z A;  2R93 G;  1HNZ Q;  3MJ5 A;  3I4M G;  4LJ5 A;  3VDU A;  2C5C A;  3HOZ H;  2CVR A;  3AFQ A;  3K5O A;  1PTO B;  1IYV A;  5C4J B;  1P3Q Q;  3B89 A;  5IIF A;  3H6M A;  4OX9 L;  4KHZ A;  2B2T A;  3CW2 C;  5I2Y A;  3UDG A;  5KGU A;  1XPU A;  4ID6 A;  3K7U C;  1Y8O B;  3E3X A;  4C1N I;  2R93 H;  3CAM A;  1MSG A;  5JPM C;  3TWK A;  1O7Y A;  5JOB A;  1XX8 A;  5IWA L;  2LH0 A;  3DEO A;  2Q2U A;  2R7F A;  3HP3 A;  2VZA A;  3T1Y Q;  3D6C A;  1AP0 A;  1LTI D;  3AYH B;  1OAO C;  3QWN A;  1GHK A;  1VQK A;  4I8O A;  1NJF A;  3TRE A;  5EPL A;  4IBD A;  4XT3 B;  2XZU A;  1N78 A;  1C7Y A;  5L8R F;  1XXH A;  3HOU G;  4HED A;  2AUJ D;  4KMU C;  1V1Q A;  3MFG A;  1GO5 A;  2XGN A;  3VFD A;  3JAM L;  1EL0 A;  1VQE A;  1AN8 A;  4RGM A;  2A6H C;  2KA7 A;  3GLH A;  2B2Y A;  4L5R C;  3V05 A;  1AUA A;  5LL6 S;  2UXB Q;  2WSC F;  5DNF A;  2K47 A;  5M3F G;  2K6B A;  3BZD B;  3RZD B;  4TUW A;  2FJ2 A;  4HR7 B;  1MU5 A;  1CHP D;  3UE0 A;  3J81 L;  4K0K Q;  1E2Z A;  4WP2 A;  2PW5 A;  4U67 3;  4KKU A;  3S17 H;  5C44 B;  1O80 A;  1Q3C A;  4PZ7 A;  4KLN A;  3BZC A;  3MTS A;  2UUB L;  3K0Y A;  5F2D A;  3I4M B;  2NVT B;  1VDZ A;  4RHR A;  1PJT A;  2VQE Q;  1IBK L;  2V6Z M;  1RF2 D;  2OTL A;  1G2T A;  1OKS A;  1QAN A;  3ZQJ A;  4C1N K;  2O5J C;  4AQY M;  1LAB A;  4X65 Q;  4GKK Q;  1KAA A;  1QIL A;  3LCV B;  5KQD A;  1CZW A;  2B8F A;  5M9O A;  2E2J H;  4MGK E;  4A3F G;  2QBY A;  3MXG A;  4IUR A;  3SYL A;  4F7X A;  1Q1B A;  2UUA L;  2Z6B A;  3S1R B;  1TH4 A;  5FLX E;  4NSO B;  3TQY A;  3JC6 6;  3C3E A;  1Q1E A;  2LXJ A;  4WRD A;  3MEF A;  1Z5C A;  1SYD A;  3CQZ B;  2R6G A;  1YJN A;  4A3G G;  2HQL A;  4KY7 A;  3PIO A;  1J6Q A;  1I3Q B;  2D7G A;  2R0I A;  1H9J A;  1TVX A;  5BR8 L;  3HOU B;  4HMJ A;  1D2N A;  4OWW B;  2A68 D;  1BUV T;  5C3W A;  2PI2 E;  5FKA C;  4U68 A;  2XF3 A;  1JOR A;  5EXX A;  1K0S A;  5E4W C;  4A3G H;  2WSE F;  3S1M H;  3Q8D A;  2CCZ A;  3ERS X;  4RGT A;  5NUC A;  3E0J A;  3KSJ A;  3BBZ A;  1B3Q A;  1VQJ A;  5M3F B;  1NBW A;  3B7Z A;  1Z6T A;  3RFW A;  3U60 A;  2Y0Q A;  2DJG C;  4DV7 L;  3MZ5 A;  1XNR L;  1HR0 L;  2KVM A;  4JI4 Q;  3UMM A;  4A3C H;  2Y0T A;  4KOD A;  1HUN A;  2R62 A;  1WTP A;  4QMG A;  1NNJ A;  3F2C A;  4XBO A;  3K58 A;  3THG A;  4DV6 M;  1A3V A;  2LKV A;  4IN3 A;  1BCP B;  3QOJ A;  4C3J G;  1SFO H;  4Y28 F;  1YNJ C;  3H4M A;  2KW0 A;  2VQF M;  1F2M A;  3EN2 A;  4DAY A;  4V19 0;  3LGJ A;  2MPM A;  3HJQ A;  2WAC A;  4A3F B;  1WTR A;  3C58 A;  2LNH C;  3TBI B;  3U6C A;  4FYD A;  3IEC A;  2A69 D;  3KS4 A;  3CCR A;  1NY5 A;  3SYK A;  2I5H A;  2BJW A;  1DOM A;  1PYB A;  3CKI B;  2R6F A;  4JI8 Q;  4DV0 L;  1XTD A;  3D8L A;  5EKI A;  1L2F A;  2YYZ A;  3BS1 A;  1EYA A;  4JI7 L;  3GTM H;  4GH9 A;  3U58 A;  4DR6 M;  3CHB D;  2K5Q A;  5BN5 A;  2K52 A;  4EQ5 A;  1HUM A;  4YWL A;  2RSN A;  1I4X A;  2F4V L;  5BR8 Q;  5ITR A;  5ITX E;  1RL2 A;  3I01 M;  1IY0 A;  1FGB D;  2CKZ B;  1X9N A;  2R65 A;  2QW7 A;  4KJO A;  2B63 G;  2JY7 A;  1PFM A;  4N9T A;  3MXN A;  5DYI A;  4G4N A;  1KDB A;  4OX9 M;  3NQT A;  3X3M A;  1TTE A;  1RDP D;  5EBD A;  5JVG 3;  3R2T A;  4H0L C;  4P73 A;  2UUC M;  1GUN A;  2PQE A;  4RG1 A;  2DHY A;  4LJZ C;  3DZD A;  1G2S A;  4DV3 M;  4AIM A;  4B3T Q;  4B3S L;  2AHO B;  2RA4 A;  3ERQ A;  2WB1 G;  1L1O C;  3RLO A;  2B63 H;  4M9Z A;  1XXH B;  3M7G A;  1WTO A;  2JWS A;  2E2H B;  1JR3 D;  2LTU A;  3L2A A;  1PTO F;  1TY0 A;  2KCM A;  3ULP A;  1IZ6 A;  2QHO B;  4ZCK A;  2LBC A;  3RN5 A;  2KOL A;  2Z4I A;  3TE6 A;  3GLH B;  3S2H H;  1VCI A;  4C3J B;  2SNS A;  5FLX S;  3Q6S A;  4OO1 G;  1N32 Q;  3CGW A;  2FH0 A;  4DV7 Q;  4H44 C;  5ITU A;  4R71 A;  4DNI A;  4XTC S;  5KPR A;  3EIE A;  3UGJ A;  4O2D A;  4YCU A;  1E2W A;  2N78 A;  1IBM M;  1LO5 D;  4GNX A;  2C96 A;  4IBC A;  2OWO A;  3CRK C;  4M8A A;  4TKO B;  3V96 A;  1JWM D;  2KNZ A;  2JUJ A;  2DJF C;  5E26 A;  2VB2 X;  3BYT B;  1PH8 A;  1ET9 A;  3DOA A;  5EKK A;  1KXL A;  2ES2 A;  4KTA A;  1MGS A;  1Q7Y C;  4NB3 A;  5JI3 E;  4CDF C;  5M3M G;  1KD1 C;  2F5P A;  3ICE A;  2FNA A;  1YVC A;  1OIZ A;  5LL6 X;  1BKB A;  1IY2 A;  1P16 A;  1G41 A;  3M4Q A;  3T51 B;  2NVX B;  1V33 A;  3K92 A;  1EEI D;  1JB0 F;  2YTY A;  1VQ1 A;  4GS3 A;  1A8V A;  3AMU A;  1I94 L;  2V1C C;  3LX0 A;  4J8Q A;  2Z7J A;  2NQ8 C;  1IBK M;  4DV2 Q;  2F0F A;  2QBY B;  4M0D A;  3QO2 A;  3VDP A;  1N34 Q;  1V34 A;  4M9X A;  5CBA E;  1GXD C;  2FIN B;  3K9O A;  1Y14 B;  4LJ9 A;  5M5X B;  3K5N A;  1N33 L;  5F3W A;  3OMG A;  5M3M H;  2DEN A;  1NCV A;  3PVS A;  1E9R A;  3B74 A;  2QCU A;  2YNM D;  2AMC B;  1OIP A;  4DFA A;  2A1A A;  2UUA M;  3FHW A;  1AZQ A;  1OXU A;  1K83 B;  2NUC A;  2Z1C A;  2WB1 B;  3HOX G;  4OWX B;  4DR3 Q;  4GOP A;  2CWP A;  1J7K A;  2F0U A;  2K5H A;  3OMC A;  2RF4 A;  4FWD A;  1Y1V G;  3AB9 A;  5H1S E;  3I4O A;  4JI2 L;  2D7E A;  1UUP A;  3W3A A;  4JC0 A;  4A3M G;  1NUC A;  3CCM A;  1Z6H A;  1TS5 A;  3TEH B;  1W6K A;  3GP1 A;  3GTP H;  2K28 A;  4HMI A;  1BBX C;  1VQL A;  2R3Z A;  4LF4 L;  1VQA A;  4A3B G;  3D6W A;  2ERC A;  2NTT A;  2WFW A;  4QB4 A;  2EVB A;  3HOX H;  4DUY L;  3GTL B;  5ELE A;  3NSW A;  4JW0 A;  4JYA Q;  1ZMV A;  2FMC A;  1RD9 D;  5K36 H;  3U60 B;  4FF2 A;  4A3M H;  4M9S A;  3K8Z A;  5JI2 E;  3H0G H;  3L0O A;  4ZUJ A;  2AQ3 B;  1CA6 A;  3GV3 A;  1YHQ A;  1F2Y A;  2G8L A;  1AEX A;  1AIP C;  4RGN A;  2I5L X;  2BCO A;  3BDL A;  2FHT A;  1XNQ Q;  3FUW A;  3GTK H;  1TR8 A;  1WCM G;  2CH4 W;  4ZAI A;  1XNR M;  1BXT A;  1HR0 M;  2EYP A;  5M3M B;  2P5T A;  4WJ4 A;  4Q7J A;  1EY6 A;  5CGK A;  1D1I A;  1SNC A;  2BA1 A;  4LCB A;  2JA9 A;  5T1I A;  1BBU A;  4DAY B;  2OQ4 A;  5EQ0 A;  3TME A;  1TY2 A;  1NMG A;  1PTO C;  4DK0 A;  3PFI A;  1JR3 E;  4KD4 A;  1Q81 C;  2XRQ D;  1DV0 A;  3OTO L;  2RGH A;  3DXJ C;  3P75 A;  5I9O A;  4S3S A;  1OAI A;  3V76 A;  4X3T A;  1PH1 A;  1M4V A;  1TR5 A;  3K81 C;  2SEB D;  4R9W A;  3DLL A;  3W67 A;  3SVM A;  1FJG L;  4UN2 B;  1F9P A;  4A3I G;  1Q86 C;  3GTJ H;  1GOZ A;  1SNO A;  1PVO A;  2FE8 A;  2ZTD A;  2WZJ A;  2EYF A;  1TWC H;  3A42 A;  3VDY A;  3LNN A;  2JZ0 A;  4DV0 M;  1X3P A;  5LMU L;  2ZAO A;  4BY7 H;  2VDB B;  1RHP A;  4BXX G;  3BDO A;  4HTH A;  4JI7 M;  1STN A;  1Y1V B;  4B3M M;  2Z4R A;  4CGY B;  2NVY B;  4QUF A;  2PMZ E;  4JI3 M;  2Z9H A;  1BCP F;  4X66 Q;  4A3M B;  1Y69 U;  1EY5 A;  1AE3 A;  3LW5 F;  2F4V M;  1NJI C;  4LFC M;  3MXN B;  4IPG A;  2CUZ A;  1WFQ A;  2QGQ A;  2NBF A;  3SAR A;  4A3K G;  3LQR A;  3I4V A;  1PTO D;  1AW7 A;  4LUZ A;  3KOX E;  3J7Z C;  2CQO A;  4A3B B;  1K8O A;  1QVG A;  4KKT A;  3FRP B;  1CT1 D;  1JWU D;  4NSR A;  4GKJ M;  1CKO A;  3FTE A;  1N36 L;  5IOC A;  3GQ3 A;  1VQ8 A;  4Z8X A;  3TP5 A;  3VA5 A;  2R4E A;  1PJI A;  2EY2 A;  1G8P A;  4GZY C;  2D0P A;  1SXJ A;  1H6U A;  4LF5 L;  2DZO B;  2I0Q A;  4QCL A;  1WCM B;  1HNX Q;  3PUW A;  1OFI A;  4DGZ A;  2ZAM A;  1PHJ A;  4JI6 M;  2NN6 H;  1X6O A;  1HNW L;  2ICE C;  5C18 A;  2DN8 A;  1OTR A;  1G71 A;  2GQF A;  4A3E H;  1S5F D;  3M3Y H;  1SE8 A;  2OO9 A;  3NUC A;  4FCT A;  2MQH A;  4GNX B;  5E3F A;  5A2Q E;  4LRS A;  3RR5 A;  2HAK A;  4JXJ A;  3S16 B;  3PGZ A;  2EJF C;  2XSZ D;  3KK7 A;  3GQB A;  2R92 G;  1SE3 A;  2PQA A;  4A3I B;  3RZO B;  4AI6 A;  4DR1 M;  4S12 A;  4P75 A;  5FO7 B;  4L4U A;  4N9P A;  1ZEQ X;  2E8G A;  2DNC A;  1TWG B;  2XIW A;  3HKZ E;  4G57 A;  1Q39 A;  3IRB A;  2MGS A;  3OTO Q;  1B70 B;  4A93 H;  4QL5 A;  4X3S A;  1DM0 B;  3C1F A;  1E0B A;  3FUT A;  2Z4S A;  4CDD C;  1JJG A;  4A3K B;  3U6P A;  2UU9 L;  1QG7 A;  1I94 M;  2BDO A;  1YHB A;  1LTL A;  3WHK A;  4G4K A;  4DR2 L;  4CKC A;  2YV5 A;  5KPZ A;  2F0J A;  3T53 B;  2DWZ B;  2ZJR A;  1N33 M;  2EDG A;  1J5E Q;  5FLM G;  3PUZ A;  1VQ9 A;  3MHV C;  4R3D A;  2VF8 A;  2DNE A;  2H1R A;  3VR2 A;  4IJF A;  1Z47 A;  5CV4 A;  2B2W A;  4R4Q A;  4GOP B;  1V8Q A;  2X6G A;  5M5Y B;  4OW0 A;  3K9P A;  4ZLT F;  1KSF X;  1WTW A;  2KUM A;  1L0Y B;  4OEM B;  3Q8G A;  4JI2 M;  1GAB A;  1SYG A;  5FLM H;  2JA5 B;  1NHG C;  1X32 A;  3GLF A;  1GKI A;  4KV6 A;  2DAM A;  1YNX A;  1MSH A;  1TH2 A;  2HKJ A;  2R7D A;  1IN6 A;  4LF9 M;  2CEA A;  2RQX A;  3K7A H;  1E32 A;  3NWT A;  3OIQ A;  2JQO A;  4IUN A;  2N8N A;  1R4Q B;  3EIH A;  4KKS A;  4LF4 M;  2A5Y B;  2RKS A;  4RAU C;  4DR4 L;  3FKI G;  4FO2 A;  4RMF A;  3HJS A;  1FYC A;  3BU2 A;  3IG8 A;  5EXP A;  3OYY A;  1VQF A;  1K3R A;  5D65 A;  5KRU A;  3AEV A;  2DZL A;  3A8J E;  4JI1 L;  4HIM A;  3CCL A;  2R92 B;  1PYW D;  4RF1 A;  3F8T A;  1E1O A;  3GPP A;  4XT1 B;  1WTH A;  4E6I A;  5CV9 A;  2KXE A;  1CQV A;  3MMP A;  4LWC A;  1VQC A;  4UHV A;  4IZ8 A;  3GD7 A;  5IY0 A;  3I55 A;  4IBB A;  1E1T A;  2YU9 H;  4GHA A;  4ULL A;  1IYU A;  5EJC A;  2B2T C;  4JV5 M;  1BCP D;  1STH A;  4DR7 Q;  4LUO A;  1L1Z A;  3G4S A;  5LHY 1;  3RUZ A;  1YI2 A;  1ILP A;  1GL7 A;  4GIP A;  4D82 A;  2MUY A;  1NHW C;  1PZI D;  1XMO L;  5LMN L;  5HUR A;  4L6T B;  4DNR B;  4HJ8 A;  4NXN L;  2LFN A;  1D1K A;  3CPF A;  1MD2 D;  4NW2 A;  3GTG H;  4KHP Q;  4L16 A;  4TSS A;  1DGS A;  1KLG D;  3UDX A;  4EGV A;  2E2I H;  2LVQ D;  4BBA A;  2JA6 G;  4UY8 C;  3WOF A;  1WHC A;  4L5Q A;  5KQ8 A;  1E2V A;  5D14 A;  4C3I G;  3I4N H;  2CE7 A;  1SYB A;  4M0W A;  4DV4 L;  1I6V C;  2LVO C;  4CJ6 A;  2JA2 A;  3AOE C;  2F5O A;  1EY4 A;  1JOO A;  1LTT D;  2A6E C;  2NVQ H;  2OOA A;  2FS1 A;  1VQO A;  2CHB D;  1EFW A;  3PO3 H;  1B9N A;  2C9C A;  2B2Y C;  3D8G A;  1VG5 A;  2XEP A;  3PCO B;  1WTX A;  2Z6K A;  3FKI B;  3GRU A;  2UXD Q;  2EPB A;  4CKE A;  2Q2I A;  1SXJ B;  1SRO A;  3BJU A;  3R3O A;  1SYF A;  1VQ7 A;  3RN2 A;  2Q2H A;  3STB C;  3FTC A;  3W5O A;  4LZJ A;  1UE5 A;  1MJE A;  1L2B A;  4IBK A;  3GTO B;  2F0D A;  4AQY L;  2HD3 A;  4PDG A;  3L9A X;  5E4X A;  2F5Q A;  4DPG A;  3T1H L;  2G9H D;  4NMZ A;  1ORY B;  1WD0 A;  2VNU D;  1I50 H;  1SNM A;  5EQT A;  4ABN A;  4POF A;  5AJ3 L;  4A3L H;  4O0A A;  2PYK A;  4YHH L;  3VK7 A;  1Q8I A;  4QY7 A;  3MFY A;  1BOS A;  2RBM A;  2H1E A;  4JG2 A;  1PJS A;  2J4X A;  2SNM A;  3J80 c;  4WFN 3;  5C0X G;  2L2D A;  2PQA B;  1KHI A;  4OVZ A;  3WHL A;  4F88 A;  5JJL A;  1KFV A;  3MWY W;  2HUG A;  5CBE E;  3P7J A;  4K6D A;  2ID0 A;  1SNP A;  2J0T D;  1IYJ B;  2PO4 A;  3OWE B;  5ELN A;  1VQP A;  2JA6 B;  1D2B A;  1I6H H;  4W5W A;  2A74 C;  3IKJ A;  4B3R L;  1M90 C;  3H15 A;  4C3I B;  1NY4 A;  4NL4 H;  4H7B A;  1TWH H;  4NKL A;  3HOY H;  1VMP A;  1BVS A;  5EP2 A;  1PM5 A;  2MP1 A;  4K5W A;  4N8X 1;  1A5T A;  3U6D A;  4UP7 A;  4OEL B;  2QDL A;  1NV9 A;  5KNC A;  2J7O A;  2EYO A;  4GN5 A;  4JBW A;  1K28 A;  2UU9 M;  3Q22 A;  3CF0 A;  1G6P A;  2FFK B;  1GM5 A;  1MN3 A;  2MJ8 A;  1SMY D;  2K1B A;  4DR2 M;  2KHH A;  1EEF D;  1PTO H;  1U4M A;  1LTB D;  1G51 A;  5C4J H;  3FUX A;  3CU7 A;  3R93 A;  3VA7 A;  1A2U A;  3A56 A;  1I50 B;  3KW6 A;  1B4O A;  2OOB A;  3FMC A;  1S5E D;  5DM6 3;  4L8R C;  4JVZ A;  1VQN A;  3QAU A;  1HPC A;  2M2L A;  1Y8N B;  2E75 C;  4ME3 A;  5IP7 G;  1IL8 A;  3GLF B;  2VS1 A;  2L7I A;  4MHE A;  2I7P A;  4DR5 Q;  3M9B A;  4R4I A;  5DYG A;  2VQF L;  1OFH A;  1QAO A;  1PLF A;  2NZH A;  1M8A A;  1TF0 B;  4O1N A;  1MJG M;  2L4E A;  1SAP A;  2XRS D;  1CA5 A;  1MBY A;  3GLI A;  1JCK B;  3TWL A;  4DR4 M;  2F0N A;  1Y8G A;  5IYB G;  3Q8X A;  1KAW A;  3K59 A;  3I4L A;  3EVQ A;  1I4P A;  5M5W B;  3NK9 A;  3KF6 A;  2J5Y A;  5C44 G;  3DUZ A;  4C2M B;  2JA8 B;  1F9S A;  4HIK A;  2QPA A;  4IBI A;  4DUZ Q;  2DGY A;  3ER0 A;  2C99 A;  1EIH A;  5IYB H;  3RZD H;  3MAQ A;  2CHG A;  3FD9 A;  4LF6 M;  2XNA C;  3I91 A;  3PO2 G;  5KO3 A;  2CQA A;  3T16 A;  3D4D A;  4KY5 A;  2CWB A;  2O5I C;  5DNY A;  5C44 H;  2UUC L;  1XXH E;  1W6J A;  3I4M H;  2NVT H;  4JI0 L;  3OW2 A;  2BDN A;  4EQO A;  3G6E A;  4DV3 L;  2QKI C;  1JOK A;  1YLA A;  1SG9 A;  1XMO M;  2F3I A;  3NPP A;  1A2T A;  2F0P A;  2ZTC A;  1VQB A;  1SDF A;  2HT1 A;  3S14 B;  1NO1 A;  5LMN M;  1QB5 D;  3GLH E;  1YZ6 A;  2DY8 A;  3M4O B;  1ZYR C;  5FO8 B;  4NXN M;  3OSO A;  5FTN A;  4LAA A;  5FJ8 G;  1HTL D;  4CBV A;  3QYB A;  1VQH A;  3TN2 A;  4R8N A;  3S1R H;  1UE1 A;  2JXM B;  1DJR D;  2CFM A;  2K5W A;  1KL9 A;  3A8I E;  2XFS A;  4JN6 A;  1ET6 A;  3U4Z A;  1EIF A;  1HRJ A;  4DV4 M;  1O7I A;  3CQZ H;  3NEM A;  4Q0F A;  3PIP 3;  2N55 A;  2LXK A;  3A5U A;  2NZ1 D;  5EP3 A;  2QCP X;  5BN4 A;  4PDI A;  1IBM L;  2X8A A;  4LF8 Q;  5FJ8 H;  1I3Q H;  3HOU H;  4DV6 Q;  3ND9 A;  5IYD G;  2K5V A;  4X64 Q;  1D8L A;  3N52 A;  4R4T A;  3TDQ A;  1XMQ L;  5FSW A;  2VQF Q;  1QZH A;  1ZYR D;  4IIW A;  2BOS A;  1CSQ A;  4I4L A;  3PF4 A;  1S4Z A;  4FVM A;  2CRU A;  4BS9 A;  1D7Q A;  1NNU C;  1NR4 A;  5ELB A;  5M3F H;  2HDL A;  1I5F A;  2DAK A;  2A68 C;  2GN5 A;  1B2T A;  3QB3 A;  3PO2 B;  3U5Z A;  1HQM C;  1BR9 A;  3CPW A;  3T1H M;  1ICF B;  2L7H A;  2YFQ A;  1YJW A;  1IN8 A;  1D6E C;  3HFZ B;  4DR6 Q;  2QZ4 A;  3SC3 A;  4KK7 A;  4X3U A;  2WB1 E;  4IFD I;  3MK6 A;  2IX3 A;  1X65 A;  3J80 L;  2QEX A;  2ASB A;  4YHH M;  3P20 A;  2A8V A;  1OXV A;  3NWS A;  2E74 C;  5IT9 S;  5E7N A;  1R2Y A;  1GUO A;  1WI5 A;  1F77 A;  5EJW A;  4OX9 Q;  1AH9 A;  4QJF A;  5E6J A;  2L09 A;  5FTM A;  1AZP A;  3QYE A;  1C9O A;  1TT2 A;  3KOY E;  4A3F H;  4RKU F;  3S2D B;  3UZU A;  5IWA Q;  3GRV A;  4IAL A;  4NC6 A;  4B3R M;  1PZJ D;  3ZJY C;  3A45 A;  2NN6 I;  1HNZ M;  2K03 A;  3CC4 A;  1PXU A;  1ONL A;  4MGI E;  3VR4 A;  4DBG B;  4KD3 A;  4DK1 A;  3L3O C;  1ILQ A;  4X62 L;  1H9S A;  4B7H A;  5IP9 G;  2B2V A;  2KEC A;  2A69 C;  3AFP A;  2AQ2 B;  1PFN A;  1STY A;  2K32 A;  3W1B A;  2O5R A;  4UPA A;  3J7A 5;  3K8A A;  2ZJP A;  3FKE A;  1KNA A;  4NRW A;  2HCC A;  1PA6 A;  3SK5 A;  3GTQ B;  1STE A;  3KVW A;  3E21 A;  1A3T A;  4ITQ A;  3B9P A;  1KRS A;  1U0L A;  2AKW B;  1F2Z A;  4IJH A;  3GLI B;  3A0J A;  4UDU C;  1XXG A;  4L15 A;  2PZT A;  3OHX C;  4NP5 A;  3GRY A;  2E2H H;  1YE9 A;  1Z7T A;  1HFN A;  3B6Y A;  5EBC A;  3UE1 A;  1OQY A;  1HFG A;  2UUB Q;  1PJQ A;  2Q2E B;  3AJI B;  2IY5 B;  5C0X J;  2KDL A;  3JR5 A;  4OGQ C;  1IBK Q;  3GP7 A;  4C3J H;  3LWU A;  1OO9 B;  3NTH A;  2W82 A;  4B3M L;  3CCJ A;  3S1Q H;  1IXR C;  1CZG A;  4JI3 L;  3KP0 E;  1A0I A;  3E6Z X;  4LFC L;  1AFP A;  2UUA Q;  1SND A;  4A75 A;  4UP9 A;  1JC7 A;  3HOW G;  2OPF A;  2DUD A;  2D2C C;  3HHY A;  4POG A;  4DK3 C;  4LNQ A;  2Z3X A;  2B39 A;  3KOJ A;  4L63 B;  1DGB A;  3VK8 A;  1DD2 A;  3QG1 A;  1RU3 A;  4GKJ L;  2QDB A;  4GLX A;  3U9O A;  3TL4 X;  2V1U A;  1S3S A;  3S1N B;  2NVX H;  3TP8 A;  1EU3 A;  1QAQ A;  1NAP A;  2DAI A;  4JI0 M;  1Z9F A;  4X6A H;  4KI0 A;  1DGH A;  4YCV A;  4ZUI A;  1KC8 C;  5DEH A;  3JAM E;  1X54 A;  3R9X B;  1C1K A;  3HHZ A;  1K3W A;  2HIX A;  4CIZ A;  1S5D D;  5M5X H;  2CWA A;  2JE6 I;  3VYT A;  4JI6 L;  3LVW A;  1EY7 A;  3S15 B;  3CXC A;  5HY6 A;  1GVP A;  1C48 A;  2LHG A;  5CMD A;  2LXE A;  1V92 A;  2FXQ A;  2O2L D;  2MRO B;  3O13 A;  4IJE A;  4IOA A;  1HZA A;  1K83 H;  4R4O A;  3S1Q B;  1XNR Q;  3TS2 A;  1GUW A;  1HR0 Q;  3J81 E;  1MI2 A;  4QNR A;  3L25 A;  3T15 A;  5H37 D;  2Y0S B;  4WJW A;  3H09 A;  4DR1 L;  4EIW A;  2N35 A;  3G48 A;  2EJS A;  1CI3 M;  4P16 A;  4PMB A;  5CV7 A;  2QP9 X;  4OO1 H;  1EUJ A;  1SXJ D;  4ILW A;  4PG3 A;  1XMQ M;  4JOI C;  4IQZ A;  2RDH A;  3ULL A;  4KN4 C;  4DNT B;  1ZAE A;  1Z59 A;  5LMN W;  2R46 A;  4LF7 L;  3EIV A;  3GTL H;  2KEB A;  4LZZ A;  2ICI A;  1SE4 A;  2IL8 A;  1XB2 B;  4XYQ A;  1EQV A;  4R8I A;  3P1H A;  1H9M A;  3HOW B;  3U5Z B;  4C3H G;  3F2D A;  2IJ0 A;  2KA6 B;  4DV0 Q;  2F0L A;  5J1Z A;  3R8F A;  3KUP A;  3FTD A;  4HCS A;  1IXS A;  2QSF X;  1CSP A;  2HIV A;  4JI7 Q;  3CF6 E;  2E5L L;  5C1B A;  2DI0 A;  4OIK A;  1H95 A;  3E4R A;  5ELC A;  2QIL A;  5C5L A;  4XIG S;  3QIA A;  2F4V Q;  1D5Z C;  1KDC A;  3VYR A;  3GPY A;  1H9K A;  2G5D A;  1YNN C;  1BDO A;  5A2Q L;  3KJO A;  3CD6 A;  2ZT9 C;  2JN4 A;  1OTC A;  3E9H A;  1L2C A;  4I7Z C;  3RNU A;  4D81 A;  4CKB A;  2VW9 A;  2JYO A;  1VQD A;  2PNH A;  3GLG A;  3H94 A;  1QNK A;  2K14 A;  1I4R A;  2RHQ B;  2ALY B;  1NY6 A;  3H4J A;  4JI8 M;  3HOV G;  3HHX A;  3M0E A;  2I07 B;  2ZXP A;  2XLJ A;  2KZS A;  4LF9 L;  3SMP A;  2JY8 A;  3U61 A;  4XQQ A;  5IOD A;  3PV0 A;  2QNJ A;  1I4W A;  4MGZ E;  3U6L A;  2EYJ A;  5GAE C;  1HT2 E;  1NSN S;  4B3S Q;  3RLF A;  3CME A;  1TWF B;  2L11 A;  1Y1V H;  4R7G A;  1YEZ A;  5IZ7 D;  1NR2 A;  4IBG A;  2NVY H;  4JI6 Q;  1PRB A;  4HJ9 A;  1YNN D;  4G4O A;  4X62 M;  2Z4H A;  1X3G A;  2EOT A;  4DU9 A;  3ILK A;  1FVI A;  4MTN A;  3MC0 B;  4MM3 B;  1Y8P B;  4ALP A;  4A3B H;  1YIJ A;  1N77 A;  3M6A A;  4MZ9 A;  5D3I B;  2QQ8 A;  1L2D A;  1XTC D;  2JA7 G;  1EIG A;  4YIJ A;  5EKL A;  3ERO A;  1O7Z A;  4LJ4 A;  2F03 A;  1V1P A;  1UE7 A;  1VF7 A;  4C3H B;  1EWI A;  3ITP A;  2O4X A;  1YUB A;  2KCT A;  4FXD A;  4JV5 L;  2HCB A;  3MXU A;  1PGY A;  2APL A;  1O78 A;  2M5Z A;  1Q46 A;  2HDM A;  3AQQ A;  2M9V A;  4CJ0 B;  3AKZ A;  4ODG A;  4KY6 A;  3PXG A;  1WCM H;  3BVM A;  3MHB A;  4LK1 C;  3K5L A;  3JAM S;  1PJJ A;  5DAU A;  1EIY B;  1HHV A;  1N32 M;  3SXH A;  1D5M C;  1NJG A;  5J39 A;  1B44 D;  4R4C A;  1I94 Q;  1HTP A;  1T5E A;  2P5Z X;  3J2P B;  1UE6 A;  5GAD C;  4L8J A;  2RDG A;  4JBJ A;  3HZJ A;  2LMC B;  1N33 Q;  2F0S A;  4JBK A;  4NXM L;  2RCN A;  3EJI A;  3PQI A;  3HOV B;  4MH0 E;  1IM2 A;  3J81 S;  3S16 H;  4X3K A;  1DXM A;  1W3S A;  2Z8L A;  2JJQ A;  5ITT A;  4A3I H;  3RZO H;  1IBL L;  4LUV A;  1SXJ E;  2WKD A;  2KNV A;  3FPU B;  2JNH A;  4LJ8 A;  2BJV A;  1TWG H;  1GJT A;  2N49 A;  5KYL A;  2HL7 A;  4BXX H;  4JI2 Q;  4ZYS A;  1VQG A;  1VEG A;  4GC5 A;  4LJA A;  1IL2 A;  1GD7 A;  2EY5 A;  2VUM G;  1N34 M;  3NHH A;  3HHW A;  3VYU A;  5T1G A;  3KDS E;  1ZMU A;  1E3P A;  4HAE A;  3FUV A;  4A3K H;  4FF1 A;  4LF4 Q;  3C9P A;  1TS3 A;  2RRU A;  1PRT F;  2R61 A;  4N8F A;  3HG9 A;  3K1J A;  3C2P A;  3U6M A;  2D9U A;  1EOT A;  2JA7 B;  2RVL A;  4DUY Q;  1PYS B;  4L5T A;  4PMW A;  3AV0 A;  1B3A A;  2HHH L;  2JA5 G;  2EZV A;  4FP5 D;  1SE2 A;  2VUM H;  4A3J G;  2JK8 A;  4DR3 M;  2R45 A;  5M5Y H;  1STA A;  2MFI A;  5GKN A;  2D0O A;  5EXS A;  1BNZ A;  1ASZ A;  1XWI A;  1TDZ A;  2RDF A;  5KNB A;  5J22 A;  1UM8 A;  1L8Q A;  4RKL A;  1L0W A;  4IJL A;  1G8Z D;  4ME5 A;  4CJ1 B;  1X3E A;  2JA5 H;  3KOW E;  3HGB A;  4JPB W;  3PMF A;  3VR3 A;  4JI5 L;  2ZJQ A;  3FEW X;  3GV6 A;  3HY5 A;  2V4D A;  2KZU A;  3PUX A;  3A7A B;  4YY3 L;  1JE4 A;  1L1T A;  1J8I A;  4NRV A;  2UXC L;  4WW0 A;  1KYI A;  4J15 A;  4QIW B;  2ZM6 L;  3SHG B;  4I65 A;  3DWP A;  3E5S A;  4LF7 M;  5FO9 B;  2IWH A;  1QJO A;  1IXS B;  1SYC A;  3SHL A;  1FJG Q;  2R92 H;  2EUC A;  2KEE A;  3MVV A;  4LJ6 A;  4IOC A;  5LMU Q;  1KTK A;  3FRI A;  3JR4 A;  2L4F A;  2LY7 A;  2A73 B;  4AG6 A;  2E5L M;  3GLF E;  4Y7N B;  2VUM B;  3VKG A;  3JAM i;  3GLG B;  1Q12 A;  3H3V C;  5FLX c;  1HCZ A;  3BYY B;  2J7N A;  4QNM A;  4XK8 F;  3W0F A;  5TSS A;  5I6W A;  2V1C A;  3AFH A;  1D0L A;  2D7H A;  4FWG A;  1EU4 A;  4P72 A;  3U61 B;  4DF7 A;  3BZK A;  1S5C D;  1N36 Q;  4A3J B;  3ULJ A;  1EWH A;  1QE6 A;  3OPO A;  1QYR A;  3TWM A;  2LVN C;  1EIJ A;  2ATW A;  2WV6 D;  1BCP C;  1RTO A;  4LF5 Q;  3SK4 A;  3A55 A;  3GQ4 A;  4KT0 F;  2C98 A;  3LCU A;  1MJC A;  1SR3 A;  2RSO A;  3I3C A;  4BBR G;  4FD2 A;  2MR9 A;  1VQ4 A;  2R7Z G;  1HNW Q;  3KBG A;  5CYU A;  1R9T B;  2JP7 A;  2D62 A;  1HQR D;  1J9O A;  2Z0S A;  4LFB M;  1EQT A;  3BDC A;  3FKI H;  3N6R A;  2QEN A;  3J80 i;  2M60 A;  4LF6 L;  1DZ1 A;  4DV1 L;  1V1O A;  2R44 A;  4FF4 A;  3S24 A;  1R5L A;  3KJP A;  3CP0 A;  2R7Z H;  3I70 A;  4KO8 A;  2F0K A;  1NV8 A;  4DN4 M;  2EY1 A;  2I5M X;  2A19 A;  3Q24 A;  1Z5B A;  5EPK A;  2VY3 A;  3GQ5 A;  4CDE C;  3GTO H;  1P8L A;  4G7O C;  4HCE A;  3M4P A;  5IGB A;  2Q2T A;  1O7L A;  4RCN A;  4DV5 L;  3SK6 A;  3L26 A;  3A7L A;  2UU9 Q;  4F8M A;  3T4A C;  2F3W A;  3E46 A;  1S5B D;  5IGC A;  1F2L A;  3TS0 A;  1K82 A;  1PH6 A;  4DR2 Q;  2LWX A;  2Q8R E;  3BOS A;  5JJZ A;  4CJ2 C;  5DM7 3;  4A4I A;  1W2B A;  1HR0 W;  1PRT D;  4QGU A;  1TDH A;  4NXM M;  4FDB A;  2E76 C;  1MKH A;  4K8I A;  1QUQ A;  3I73 A;  3K6O A;  2JA6 H;  1IBL M;  2K4K A;  2PNR C;  1A62 A;  3CTW B;  3MA2 B;  4IPC A;  4R1J A;  2EE1 A;  2K7V A;  5IRE B;  4BY1 G;  1I4H A;  3HRZ C;  4MN3 A;  1HZC A;  4FWH A;  4C3I H;  2KHS A;  1Y1W G;  3J7A S;  4BBR B;  1A15 A;  4G7H C;  1VQ6 A;  1PZK D;  1RCV D;  3U6Q A;  2R7Z B;  2GNO A;  2KCN A;  2F0T A;  3SAV A;  2G9D A;  4GLV B;  1LTM A;  2F1M A;  4C56 C;  4LFA L;  2R4J A;  4DR4 Q;  3NWL A;  4F87 A;  1BF4 A;  2WAQ E;  3K57 A;  1WVL A;  2EKK A;  1QDT A;  1R2Z A;  5C4X G;  2L5T A;  1IN4 A;  4JI1 Q;  1G91 A;  4B7F A;  3H91 A;  5IGE A;  3CCQ A;  2HHH M;  3A74 A;  2KJX A;  1WGN A;  2F0H A;  5ELD A;  1X3Q A;  3G6J B;  1ZKO A;  3UDF A;  4PQX A;  3M85 A;  3HKP A;  1HH2 P;  1X55 A;  1PFS A;  1SMY C;  1ROD A;  1TGU A;  2AWO A;  1I4G A;  4O42 A;  2YQZ A;  4JI5 M;  5HGQ A;  1K3B C;  5EP1 A;  1LTA D;  4QUC A;  2JA8 G;  4YY3 M;  2TSS A;  2Y21 A;  4TVA B;  2N88 A;  5C6A A;  2UXC M;  1EYG A;  5C0X H;  4A3D G;  1HNZ L;  1XMO Q;  2BH2 A;  2ZM6 M;  5LMN Q;  1E9S A;  5A35 A;  1GO3 E;  2PZW A;  2CW0 D;  1TS4 A;  2SOB A;  3VR5 A;  4NXN Q;  5M5W H;  1G59 A;  1FGU A;  2B2U A;  3CCU A;  1ZXT A;  1TWA B;  4RWS C;  4C2M H;  1S40 A;  4QOZ C;  1WR1 B;  2EIF A;  2JA8 H;  1JT8 A;  1NMF A;  1IQP A;  3D4R A;  4BY1 B;  2XWB B;  2VXW A;  3SAW A;  3LWE A;  4APV A;  2O25 A;  1Y1W B;  3T38 A;  3I51 A;  5FLX L;  4DV4 Q;  2K5D A;  4XQJ A;  3EFX D;  4OO1 I;  3AOG A;  3GLI E;  1QNU A;  1SBB B;  2PPB C;  1FR3 A;  2PW7 A;  5IT9 E;  4MIU A;  3DFZ A;  1EY0 A;  2F0E A;  1HQY E;  3GO5 A;  4EQP A;  2MNA A;  3K0X A;  4HJA A;  5C4X B;  1Q3L A;  1K8G A;  3QWL A;  1KAB A;  3A46 A;  3S14 H;  5C5M A;  2NYZ D;  5C3E B;  5JVH 3;  3M4O H;  4RFB A;  4B9X A;  1M1K C;  1DGF A;  5EP4 A;  5IP7 H;  2K04 A;  3EA6 A;  1NSF A;  4HSP A;  1JB7 A;  1YSY A;  2MO0 A;  4BBS G;  5KPT A;  2F52 A;  4AQY Q;  2UXB L;  1OXS C;  1GL6 A;  4PZ8 A;  5JJK A;  3SGI A;  3T1H Q;  4IUT A;  1RIP A;  4I5S A;  2GA4 B;  5IYC G;  5AJ3 Q;  1FNV A;  1XYI A;  3SK8 A;  3J81 i;  1PDQ A;  2IX0 A;  4YHH Q;  3NBX X;  2LHC A;  2JY6 B;  3QR8 A;  4K0K L;  1B7Y B;  4HJ5 A;  4P71 A;  3HX3 A;  4A3D B;  1IW7 D;  2RGO A;  5KND A;  1U4R A;  1A3U A;  3DHQ A;  4DV1 M;  4F2L A;  3DM3 A;  2Q8T A;  3HOZ G;  2BWB A;  1B50 A;  1GUT A;  2VQE L;  1SEB D;  4FCV A;  2DAE A;  3KLS A;  3KYH C;  4X65 L;  4GRI A;  4GHL A;  2VII A;  2WAQ G;  2YTX A;  4RF0 A;  3KS8 A;  3J7B A;  2EQS A;  1CUK A;  2WII B;  2XWJ B;  4JCV E;  3PIP A;  4ZKC B;  4B3R Q;  1K3X A;  4H02 A;  3PO2 H;  2X49 A;  1TQO A;  3K80 C;  1CQF A;  1E7Z A;  3PNV A;  4DV5 M;  1RTN A;  2CV0 A;  2XTI A;  1WYD A;  3B7N A;  3LMM A;  1PV4 A;  4UP8 A;  1Q8K A;  2OQ0 A;  2Y0S E;  1QUQ B;  5I9P A;  2VB3 X;  2XFT A;  2WP8 J;  1CFM A;  1GJS A;  1QCB D;  4HN7 A;  4OL7 A;  2BE5 C;  1S72 A;  3HU2 A;  1QOH A;  3CRL C;  4DA2 A;  2EXZ A;  3KFU A;  2OEO A;  3M4Y A;  1C0A A;  5ITY A;  1ESR A;  4QHS A;  3S2D H;  3FYC A;  2DWL A;  1LLR D;  4GNX C;  2F0G A;  3TSS A;  4HIO A;  4BBS B;  1VDL A;  1K73 C;  1EY9 A;  2KBN A;  3HS0 C;  3J81 j;  3QOL A;  5KEE A;  3PUV A;  3AOE A;  2K0B X;  2L4N A;  7CAT A;  1YIT A;  4JI4 L;  3H3V H;  1XWE A;  4P17 A;  4RA8 A;  4LFA M;  1H9R A;  1JOQ A;  5IYD H;  1QDR A;  1LUZ A;  4ZK9 B;  1STB A;  1VMC A;  5ISR A;  3HOZ B;  5ELO A;  2BE5 D;  4I7A A;  4XGI A;  1DO0 A;  4WJ3 M;  4DR5 M;  1EQR A;  4F1I A;  2WAQ B;  4G3O A;  4OVZ B;  4D80 A;  1ESF A;  1U5K A;  3GTQ H;  5CV8 A;  3IFD A;  5JPN C;  5FK9 C;  2R93 B;  2EO2 A;  3EBE A;  5L37 A;  3RGS A;  1Q90 A;  2GVA A;  4NPS A;  2OCE A;  2NWG A;  1EYD A;  4JI8 L;  4K5V A;  3FYD A;  2K05 A;  4GOP C;  4HID A;  1C8C A;  2CHQ A;  1UNS A;  4AH6 A;  2UUC Q;  2A6H D;  4KJN A;  4JI0 Q;  2EXD A;  4DV3 Q;  1Z5A A;  1EFU B;  1JWS D;  2Y20 A;  4AZF A;  1MIU A; 
#chains in the Genus database with same CATH homology
 5EXT A;  3BVG A;  2X6L A;  3DWA A;  4KHV A;  4DUZ M;  2WIN B;  2M00 A;  1DO2 A;  1XHB A;  2OXP A;  3GRR A;  1FNW A;  1WD1 A;  4IBF A;  1HA5 A;  1ML0 D;  2E2D C;  2F0O A;  3TPZ A;  1II3 A;  5JAV A;  3J27 B;  3A98 B;  1LT3 D;  3T1Y M;  2PZU A;  2FOI C;  2JP1 A;  5I2X A;  3S17 B;  3UI2 A;  4FXG C;  1G29 1;  1D5X C;  1WTQ A;  3KFU G;  1OXT A;  1OXX K;  5CV6 A;  3J7A F;  1IN7 A;  3OWF A;  5JEA G;  2KRK A;  3E9S A;  3VYS A;  3K2L A;  1GUS A;  4PT5 A;  3NE5 B;  1TKW B;  3PIO 3;  4V0B A;  1GVN A;  2E2J B;  4LF8 M;  4IUQ A;  2UXB M;  5JEA H;  3NTK A;  2C9O A;  1PRT B;  4NDX A;  4X64 M;  5CV5 A;  3ONA B;  1IY1 A;  2WKC A;  2HCI A;  3RD4 A;  4II7 A;  5ITQ A;  2DWN A;  4K0K M;  3HWS A;  3UJN A;  1KLU D;  3W2D A;  3C1E A;  2F5S A;  3SAU A;  1F9Q A;  2VQE M;  4PV1 C;  4X65 M;  2C5R A;  1KNE A;  4PD2 A;  3BVZ A;  4Z9C B;  4GKK M;  2AUK A;  2AWN A;  2L1B A;  4A3G B;  3S1M B;  3IAY A;  1PFB A;  1SXJ C;  1K8M A;  5D3D A;  2Q8I B;  1EYC A;  3WOE A;  1UAP A;  4QHT A;  1SJH D;  1YNJ D;  2CHV A;  3KOZ E;  4LGM A;  4FF3 A;  2JEB I;  2L12 A;  1EFI D;  4RH6 A;  1E94 E;  4BA1 I;  3SR1 A;  1U9R A;  2F5N A;  2DWM A;  1WTV A;  5IWA M;  2F0M A;  1VF5 C;  5ITX A;  1SFO B;  3PNY A;  4QOS A;  2KRU A;  4K8J A;  4FNF A;  1CHQ D;  1U4P A;  4RKB A;  4OIJ A;  1SNQ A;  3MEH A;  1UEA B;  2FMM A;  3J80 E;  5IGF A;  2G5G X;  3GTM B;  4ZKB B;  1QVR A;  4JI4 M;  3A54 A;  5K5P A;  4MGY E;  3U6O A;  4PNY A;  4MB7 A;  1CM9 A;  3NBI A;  1GJX A;  2L0C A;  1W5T A;  1JQY D;  2RKO A;  4JK1 C;  1JR0 D;  3WDN A;  3ZCB B;  5CC4 A;  2B2W C;  1JIC A;  2UUB M;  5FTL A;  4GIT A;  2B63 B;  3HZX A;  3NXW A;  4AG5 A;  5BR8 M;  2OF1 A;  1QQW A;  1H9S B;  3RGP A;  3S2H B;  3NTI A;  2EJG C;  1Q3B A;  3URY A;  3D4W A;  4I81 A;  3U6E A;  1EY8 A;  4DAV A;  4M1U B;  3KP1 E;  8CAT A;  3NBH A;  4Z6Y A;  5K36 G;  1GUG A;  2F0W A;  3OIP A;  2IX1 A;  3CF2 A;  2BA0 A;  3KLS X;  4B3T M;  4IBE A;  1TH3 A;  2EYL A;  4RCO A;  5C0X I;  2L6O A;  4CIS A;  3L28 A;  1G3I A;  3VKH A;  3DA1 A;  2KED A;  1LTR D;  4ZQ3 A;  3RMH A;  3U9S A;  3KLR A;  4B7G A;  4FW9 A;  3TZU A;  4J6H A;  3Q0A A;  4DV7 M;  2I7N A;  1IHZ A;  1C4Q A;  5COR A;  2ZAN A;  4DXF A;  3I90 A;  1ENF A;  4LJ7 A;  3ZC7 B;  5EPJ A;  4A3V B;  1KDA A;  2F4I A;  2XSC A;  4BA2 I;  2K01 A;  3GTK B;  3R8B A;  4REZ A;  2EJM A;  5COY A;  2SDF A;  3IG5 A;  4B08 A;  3GTP B;  4TQU S;  3C46 A;  4IUP A;  4HL4 A;  1DGH B;  1BQQ T;  4DV2 M;  1R4P B;  4G7Z C;  4IFD G;  2DVW B;  4G6Z A;  3HOX B;  1JR3 A;  4B9W A;  5G3L F;  1EWC A;  4WOR A;  4G4R A;  3J80 S;  1SYE A;  3RE8 A;  4BWG B;  1HA6 A;  2MHV A;  3H0G B;  2B8G A;  3I4Y A;  4PCZ A;  3L7Z C;  3TP7 A;  3GO8 A;  1SSO A;  4K14 A;  3C3L A;  3TP6 A;  4IFD H;  3A8K E;  3IL8 A;  4EQN A;  4XDX A;  1B1Z A;  1XNQ M;  2XN9 C;  4OHJ A;  4FXK C;  1TS2 A;  5JEA J;  2NN6 G;  1XC8 A;  1SXT A;  2QEJ C;  4AKG A;  1F9R A;  3KSX A;  3SE0 A;  2PCF B;  4LMQ D;  5HGT A;  3J7Y W;  3GPX A;  5FTK A;  4B3S M;  3AL0 C;  2ZXO A;  3S9W A;  4GC9 A;  2IPK D;  4XXE A;  2BNK A;  4JYA M;  1DON A;  2H4O A;  3OOC A;  5BN3 A;  2OT2 A;  3MXP A;  1ENC A;  3FDT A;  3GTJ B;  1TWC B;  2NTS A;  2A5H A;  3D8B A;  1FD7 D;  4BY7 B;  1V43 A;  2EY6 A;  3VR6 A;  4HLQ A;  2AHM A;  3UK6 A;  1JQJ C;  1CTM A;  4LRT A;  1LAC A;  4DXG A;  5KIX A;  2B2U C;  4AKI A;  2XZF A;  4AYB B;  2D5D A;  2LS0 1;  3SBJ A;  4AKH A;  3T56 B;  2ENB A;  4KN7 C;  2DXI A;  3W0L B;  2F0Q A;  2CFO A;  4UAI A;  1EZ8 A;  3GPU A;  4ZRZ A;  1R7R A;  4RGO S;  1L0X B;  1RJT A;  3TZD A;  2TMP A;  4PMC A;  3G7L A;  4EVO A;  4X66 M;  4AW4 A;  3NP8 A;  5C3X A;  4DAP A;  4A3E B;  3M3Y B;  2QF7 A;  5BPV A;  4LG2 A;  1J09 A;  2XVS A;  1IN5 A;  1W5S A;  3SHF A;  1TU2 B;  3HU1 A;  2ZXR A;  3TQS A;  1V1P B;  3ZYY X;  1TII D;  4ZPX A;  3SAS A;  4BB9 A;  5IT9 L;  1ICW A;  1PRT C;  4QF4 A;  1IKM A;  4A93 B;  5FTJ A;  1B9M A;  4HSV A;  3VLF B;  3L29 A;  1IXZ A;  3I72 A;  1HNX M;  4DUY M;  3KF8 A;  3I8Z A;  2EA0 A;  1U4L A;  4IUU A;  1T5X D;  4P2C B;  2K6A A;  2F0V A;  3SDZ A;  1LT4 D;  2AQ1 B;  1QWY A;  4MGH A;  5I4D A;  3R2I A;  2J7Z A;  4L78 A;  2JSO A;  3EQL C;  3Q23 A;  4XQN A;  3DM1 A;  1HQC A;  5G3L D;  1HT1 E;  1STG A;  1T3T A;  4LGY A;  1QAM A;  3SAT A;  1MX0 A;  5IGG A;  2X69 A;  4K2L A;  5CR3 A;  1N75 A;  3OTO M;  2F0I A;  2IT1 A;  1FNN A;  1G6Z A;  4IUV A;  4Q5V A;  3IFT A;  2KCC A;  3K7A B;  3X3N A;  2EYH A;  3NQI A;  3DMU A;  3HU3 A;  1FJG M;  1I4Q A;  3SFZ A;  4IBJ A;  1LV7 A;  1R6B X;  5LMU M;  3BG3 A;  3PUY A;  4XYO A;  1J5E M;  5IGD A;  5A2Q S;  3LQQ A;  1BO0 A;  3U6S A;  1DCZ A;  1ENA A;  2KQ3 A;  3ZH9 B;  2DY7 A;  2YR0 A;  2XH9 A;  5E1F A;  2PMZ B;  2CW0 C;  2DHR A;  1HXY D;  2XSZ A;  2EYM A;  2YU9 B;  2FFJ A;  1N36 M;  2X4A A;  4J1M A;  3KXE C;  3M7N A;  3HGI A;  3V2T A;  1DGG A;  1LTS D;  4WUR A;  4LF5 M;  4CHT B;  3KBX A;  1LT6 D;  5C4H A;  4LY6 A;  1EZ6 A;  2A6E D;  3ND8 A;  3GTG B;  1QZM A;  2K33 A;  1HNW M;  1LT5 D;  1IKL A;  2E2I B;  3J7A V;  5ELF A;  1FNU A;  3I4N B;  3D31 A;  2IW3 A;  3F2U A;  4RHS A;  3AU7 A;  2NVQ B;  4TRD A;  3SMS A;  3PO3 B;  4BLC A;  2B2V C;  4K5X A;  1LV9 A;  4IFD J;  4K2K A;  4DR7 M;  4G4Q A;  1GLN A;  5I6Y A;  1OJL A;  2CV1 A;  1X37 A;  4KHP M;  3HKZ B;  1GHJ A;  1IW7 C;  1LTG D;  2R18 A;  2NB0 A;  1VDD A;  2L55 A;  4K6L A;  3FPP A;  3FUU A;  3FTF A;  3HEJ A;  1JB3 A;  1DOK A;  4FCW A;  4H13 C;  3DWQ A;  1G4A E;  4RNA A;  1B53 A;  4NOO B;  3T13 A;  3HJ8 A;  2L9H A;  1WXQ A;  3LVV A;  4GMQ A;  2UXD M;  3K5M A;  2F3V A;  3FVQ A;  2JEA I;  1A6X A;  4OU7 A;  5KYI A;  3D3R A;  5EGT A;  1NVM A;  1DOL A;  2CV2 A;  2I46 A;  1I6H B;  3DEP A;  1EE8 A;  3L27 A;  1RKN A;  1DYQ A;  3OW7 A;  3QJY A;  5AFW A;  5FOB B;  2DZN B;  2ZBK B;  1TWH B;  2HQE A;  3SEB A;  1SJE D;  3HOY B;  4JI1 M;  1ZQ9 A;  1PMR A;  1CK1 A;  5C4Z A;  3MJ5 A;  4LJ5 A;  3VDU A;  2C5C A;  2CVR A;  3K5O A;  1PTO B;  1IYV A;  5C4J B;  5IIF A;  3H6M A;  4KHZ A;  2B2T A;  5I2Y A;  5KGU A;  4ID6 A;  1Y8O B;  4C1N I;  1MSG A;  5JPM C;  3TWK A;  1O7Y A;  5JOB A;  1XX8 A;  2LH0 A;  3DEO A;  3HP3 A;  3D6C A;  1AP0 A;  1LTI D;  3QWN A;  1GHK A;  4I8O A;  1NJF A;  5EPL A;  4IBD A;  4XT3 B;  2XZU A;  1N78 A;  1XXH A;  4HED A;  2AUJ D;  4KMU C;  3MFG A;  2XGN A;  3VFD A;  3JAM L;  1EL0 A;  1AN8 A;  4RGM A;  2A6H C;  2KA7 A;  3GLH A;  2B2Y A;  3V05 A;  5LL6 S;  5DNF A;  2K47 A;  3BZD B;  3RZD B;  4TUW A;  2FJ2 A;  4HR7 B;  1MU5 A;  1CHP D;  3J81 L;  1E2Z A;  2PW5 A;  4U67 3;  4KKU A;  5C44 B;  1O80 A;  1Q3C A;  4KLN A;  3MTS A;  3I4M B;  3K0Y A;  5F2D A;  2NVT B;  1VDZ A;  4RHR A;  1G2T A;  2V6Z M;  1RF2 D;  1QAN A;  4C1N K;  2O5J C;  4AQY M;  1LAB A;  1KAA A;  1QIL A;  5KQD A;  1CZW A;  2B8F A;  5M9O A;  4MGK E;  2QBY A;  3MXG A;  4IUR A;  3SYL A;  4F7X A;  1Q1B A;  3S1R B;  1TH4 A;  5FLX E;  4NSO B;  1Q1E A;  4WRD A;  1Z5C A;  1SYD A;  3CQZ B;  2R6G A;  4KY7 A;  1I3Q B;  2D7G A;  1H9J A;  1TVX A;  3HOU B;  4HMJ A;  1D2N A;  2A68 D;  1BUV T;  5C3W A;  5FKA C;  4U68 A;  2XF3 A;  1JOR A;  5EXX A;  5E4W C;  4RGT A;  5NUC A;  3E0J A;  3KSJ A;  5M3F B;  1Z6T A;  3RFW A;  3U60 A;  2Y0Q A;  3MZ5 A;  2KVM A;  3UMM A;  2Y0T A;  4KOD A;  1HUN A;  2R62 A;  1WTP A;  4QMG A;  1NNJ A;  4XBO A;  3K58 A;  3THG A;  4DV6 M;  1A3V A;  2LKV A;  4IN3 A;  1BCP B;  3QOJ A;  4C3J G;  1YNJ C;  3H4M A;  2KW0 A;  2VQF M;  1F2M A;  4DAY A;  4V19 0;  2MPM A;  3HJQ A;  2WAC A;  4A3F B;  1WTR A;  3C58 A;  2LNH C;  3TBI B;  3U6C A;  4FYD A;  2A69 D;  3KS4 A;  1NY5 A;  3SYK A;  3CKI B;  2BJW A;  1DOM A;  3D8L A;  5EKI A;  2YYZ A;  3BS1 A;  1EYA A;  4GH9 A;  4DR6 M;  3CHB D;  2K5Q A;  5BN5 A;  1HUM A;  2RSN A;  1I4X A;  5ITR A;  5ITX E;  1IY0 A;  1FGB D;  2R65 A;  4KJO A;  1PFM A;  4N9T A;  3MXN A;  5DYI A;  4G4N A;  1KDB A;  4OX9 M;  3NQT A;  3X3M A;  5EBD A;  1RDP D;  5JVG 3;  3R2T A;  4H0L C;  2UUC M;  1GUN A;  2PQE A;  4LJZ C;  3DZD A;  1G2S A;  4DV3 M;  2RA4 A;  3ERQ A;  4M9Z A;  1XXH B;  3M7G A;  1WTO A;  2E2H B;  1JR3 D;  3L2A A;  1PTO F;  1TY0 A;  2KOL A;  2Z4I A;  3TE6 A;  3GLH B;  1VCI A;  4C3J B;  2SNS A;  5FLX S;  3Q6S A;  4OO1 G;  4H44 C;  5ITU A;  4XTC S;  5KPR A;  3EIE A;  3UGJ A;  1E2W A;  1IBM M;  1LO5 D;  2C96 A;  4IBC A;  3CRK C;  4M8A A;  4TKO B;  3V96 A;  1JWM D;  2VB2 X;  5E26 A;  3BYT B;  1ET9 A;  3DOA A;  5EKK A;  4KTA A;  1MGS A;  5JI3 E;  2F5P A;  2FNA A;  5LL6 X;  1IY2 A;  1G41 A;  3T51 B;  2NVX B;  3K92 A;  1EEI D;  3AMU A;  3LX0 A;  4J8Q A;  2Z7J A;  2NQ8 C;  1IBK M;  2F0F A;  2QBY B;  4M0D A;  3QO2 A;  3VDP A;  4M9X A;  5CBA E;  1GXD C;  2FIN B;  4LJ9 A;  5M5X B;  3K5N A;  5F3W A;  3OMG A;  1NCV A;  3PVS A;  1E9R A;  2QCU A;  2YNM D;  4DFA A;  2UUA M;  1AZQ A;  1OXU A;  1K83 B;  2NUC A;  2Z1C A;  2WB1 B;  2F0U A;  1J7K A;  3OMC A;  4FWD A;  3AB9 A;  2D7E A;  1UUP A;  3W3A A;  1NUC A;  1Z6H A;  1TS5 A;  1W6K A;  3GP1 A;  2K28 A;  4HMI A;  1BBX C;  2R3Z A;  3D6W A;  2ERC A;  2NTT A;  4QB4 A;  2EVB A;  3GTL B;  5ELE A;  3NSW A;  2FMC A;  1RD9 D;  5K36 H;  3U60 B;  4FF2 A;  4M9S A;  3K8Z A;  5JI2 E;  4ZUJ A;  2AQ3 B;  1CA6 A;  3GV3 A;  1F2Y A;  2G8L A;  1AEX A;  4RGN A;  2BCO A;  3BDL A;  2FHT A;  3FUW A;  4ZAI A;  1XNR M;  1BXT A;  1HR0 M;  2EYP A;  5M3M B;  2P5T A;  1EY6 A;  5CGK A;  1D1I A;  1SNC A;  2BA1 A;  4LCB A;  5T1I A;  2OQ4 A;  5EQ0 A;  3TME A;  1TY2 A;  1PTO C;  4DK0 A;  3PFI A;  4KD4 A;  2XRQ D;  2RGH A;  3DXJ C;  3P75 A;  5I9O A;  4S3S A;  4X3T A;  1M4V A;  1TR5 A;  2SEB D;  4R9W A;  3SVM A;  1F9P A;  1GOZ A;  1SNO A;  2FE8 A;  2EYF A;  3A42 A;  3LNN A;  4DV0 M;  1X3P A;  2ZAO A;  1RHP A;  3BDO A;  4HTH A;  4JI7 M;  1STN A;  1Y1V B;  4B3M M;  2Z4R A;  4CGY B;  2NVY B;  4QUF A;  4A3M B;  4JI3 M;  1BCP F;  1Y69 U;  1EY5 A;  2F4V M;  4LFC M;  2CUZ A;  2NBF A;  3SAR A;  3LQR A;  3I4V A;  1PTO D;  1AW7 A;  3KOX E;  4A3B B;  1K8O A;  4KKT A;  3FRP B;  1CT1 D;  1JWU D;  4NSR A;  4GKJ M;  3FTE A;  5IOC A;  3GQ3 A;  4Z8X A;  3TP5 A;  3VA5 A;  2R4E A;  1PJI A;  2EY2 A;  1G8P A;  4GZY C;  1SXJ A;  1H6U A;  2DZO B;  4QCL A;  1WCM B;  3PUW A;  1OFI A;  4DGZ A;  2ZAM A;  4JI6 M;  2NN6 H;  2ICE C;  5C18 A;  2DN8 A;  1S5F D;  3NUC A;  4FCT A;  5E3F A;  5A2Q E;  4LRS A;  4JXJ A;  3S16 B;  2EJF C;  2XSZ D;  3KK7 A;  3GQB A;  1SE3 A;  4A3I B;  3RZO B;  4AI6 A;  4DR1 M;  4S12 A;  5FO7 B;  4L4U A;  4N9P A;  1ZEQ X;  2DNC A;  1TWG B;  2XIW A;  4G57 A;  1Q39 A;  2MGS A;  4X3S A;  1DM0 B;  3C1F A;  1E0B A;  3FUT A;  2Z4S A;  4A3K B;  3U6P A;  1QG7 A;  1I94 M;  2BDO A;  3WHK A;  4G4K A;  4CKC A;  5KPZ A;  2F0J A;  3T53 B;  2DWZ B;  1N33 M;  2EDG A;  3PUZ A;  3MHV C;  4R3D A;  2DNE A;  2H1R A;  3VR2 A;  4IJF A;  1Z47 A;  5CV4 A;  2B2W A;  5M5Y B;  1V8Q A;  2X6G A;  4OW0 A;  4ZLT F;  1KSF X;  1WTW A;  2KUM A;  1L0Y B;  4JI2 M;  1SYG A;  2JA5 B;  1NHG C;  1X32 A;  3GLF A;  1GKI A;  4KV6 A;  1MSH A;  1TH2 A;  2HKJ A;  2RQX A;  1IN6 A;  4LF9 M;  2CEA A;  3OIQ A;  4IUN A;  1E32 A;  3NWT A;  3SK8 A;  4KKS A;  1R4Q B;  3EIH A;  4LF4 M;  2A5Y B;  2RKS A;  4RAU C;  4FO2 A;  3HJS A;  1FYC A;  3IG8 A;  5EXP A;  5D65 A;  5KRU A;  3A8J E;  2R92 B;  1PYW D;  4RF1 A;  3GPP A;  4XT1 B;  4E6I A;  5CV9 A;  2KXE A;  1CQV A;  4IZ8 A;  3GD7 A;  4IBB A;  4GHA A;  4ULL A;  1IYU A;  5EJC A;  2B2T C;  4JV5 M;  1BCP D;  1STH A;  1L1Z A;  5LHY 1;  3RUZ A;  1ILP A;  1GL7 A;  4GIP A;  4D82 A;  2MUY A;  1NHW C;  1PZI D;  5HUR A;  4L6T B;  4DNR B;  2LFN A;  1D1K A;  1MD2 D;  4NW2 A;  4L16 A;  4TSS A;  1KLG D;  4EGV A;  4BBA A;  3WOF A;  5KQ8 A;  1E2V A;  5D14 A;  4C3I G;  2CE7 A;  1SYB A;  4M0W A;  1I6V C;  2F5O A;  2JA2 A;  3AOE C;  1EY4 A;  2A6E C;  1JOO A;  1LTT D;  2CHB D;  1B9N A;  2C9C A;  2B2Y C;  3D8G A;  1WTX A;  2XEP A;  3FKI B;  3GRU A;  2EPB A;  4CKE A;  1SXJ B;  3R3O A;  1SYF A;  3FTC A;  4LZJ A;  1L2B A;  4IBK A;  3GTO B;  2F0D A;  4PDG A;  3L9A X;  5E4X A;  2F5Q A;  2VNU D;  2G9H D;  4NMZ A;  1ORY B;  1WD0 A;  1SNM A;  5EQT A;  4ABN A;  2PYK A;  3VK7 A;  1Q8I A;  3MFY A;  1BOS A;  2RBM A;  2H1E A;  2J4X A;  2SNM A;  4WFN 3;  5C0X G;  4OVZ A;  3WHL A;  4F88 A;  1KFV A;  3MWY W;  2HUG A;  5CBE E;  3P7J A;  4K6D A;  2ID0 A;  1SNP A;  2J0T D;  2PO4 A;  1BNZ A;  3OWE B;  2JA6 B;  1D2B A;  4W5W A;  2A74 C;  3IKJ A;  4C3I B;  4NL4 H;  4H7B A;  4NKL A;  1VMP A;  5EP2 A;  1PM5 A;  2MP1 A;  4K5W A;  3U6D A;  5KNC A;  2J7O A;  2EYO A;  4JBW A;  3Q22 A;  2UU9 M;  3CF0 A;  2FFK B;  2MJ8 A;  1SMY D;  2K1B A;  4DR2 M;  1EEF D;  1PTO H;  1U4M A;  1LTB D;  3FUX A;  3CU7 A;  3R93 A;  3VA7 A;  1A2U A;  3A56 A;  1I50 B;  3KW6 A;  1B4O A;  3FMC A;  1S5E D;  5DM6 3;  4L8R C;  3QAU A;  1HPC A;  2M2L A;  1Y8N B;  2E75 C;  1IL8 A;  3GLF B;  2L7I A;  4MHE A;  2I7P A;  5DYG A;  1OFH A;  1QAO A;  1PLF A;  1M8A A;  4O1N A;  1SAP A;  2XRS D;  1CA5 A;  1MBY A;  3GLI A;  1JCK B;  3TWL A;  4DR4 M;  2F0N A;  3Q8X A;  3K59 A;  3I4L A;  3EVQ A;  1I4P A;  5M5W B;  3NK9 A;  3DUZ A;  4C2M B;  2JA8 B;  1F9S A;  2QPA A;  4IBI A;  2C99 A;  1EIH A;  3MAQ A;  2CHG A;  3FD9 A;  4LF6 M;  2XNA C;  3I91 A;  5KO3 A;  2CQA A;  3T16 A;  3D4D A;  4KY5 A;  2O5I C;  5DNY A;  1W6J A;  2BDN A;  4EQO A;  2QKI C;  1JOK A;  1XMO M;  3NPP A;  1A2T A;  2F0P A;  1SDF A;  3S14 B;  5LMN M;  1QB5 D;  2DY8 A;  3M4O B;  1ZYR C;  5FO8 B;  4NXN M;  3OSO A;  5FTN A;  4LAA A;  1HTL D;  4CBV A;  3TN2 A;  4R8N A;  2JXM B;  1DJR D;  2K5W A;  3A8I E;  2XFS A;  4JN6 A;  1ET6 A;  1HRJ A;  4DV4 M;  4Q0F A;  3PIP 3;  2N55 A;  2NZ1 D;  5EP3 A;  2QCP X;  5BN4 A;  4PDI A;  2X8A A;  3ND9 A;  3N52 A;  3TDQ A;  5FSW A;  1ZYR D;  4IIW A;  2BOS A;  4I4L A;  1S4Z A;  4FVM A;  4BS9 A;  1NNU C;  1NR4 A;  5ELB A;  2HDL A;  2A68 C;  1B2T A;  3QB3 A;  3PO2 B;  3U5Z A;  1HQM C;  1BR9 A;  3T1H M;  2L7H A;  2YFQ A;  1IN8 A;  1D6E C;  2QZ4 A;  3SC3 A;  4KK7 A;  4X3U A;  4IFD I;  3MK6 A;  2IX3 A;  3J80 L;  4YHH M;  3P20 A;  1OXV A;  3NWS A;  2E74 C;  5IT9 S;  1R2Y A;  1GUO A;  1F77 A;  5EJW A;  5E6J A;  2L09 A;  5FTM A;  1AZP A;  1TT2 A;  3KOY E;  3S2D B;  3UZU A;  3GRV A;  4IAL A;  4B3R M;  1PZJ D;  3A45 A;  2NN6 I;  1HNZ M;  2K03 A;  1PXU A;  1ONL A;  4MGI E;  3VR4 A;  4KD3 A;  4DK1 A;  3L3O C;  1ILQ A;  1H9S A;  4B7H A;  2B2V A;  2KEC A;  2A69 C;  2AQ2 B;  1PFN A;  1STY A;  2K32 A;  2O5R A;  3FKE A;  1KNA A;  4NRW A;  2HCC A;  3SK5 A;  3GTQ B;  1STE A;  3KVW A;  1A3T A;  4ITQ A;  3B9P A;  1F2Z A;  3GLI B;  4UDU C;  1XXG A;  4L15 A;  2PZT A;  3OHX C;  4NP5 A;  3GRY A;  1YE9 A;  1Z7T A;  1HFN A;  5EBC A;  1HFG A;  2Q2E B;  3AJI B;  5C0X J;  3JR5 A;  4OGQ C;  3GP7 A;  3LWU A;  1OO9 B;  3NTH A;  2W82 A;  1IXR C;  1CZG A;  3KP0 E;  3E6Z X;  1AFP A;  1SND A;  1JC7 A;  2OPF A;  2D2C C;  3HHY A;  2Z3X A;  2B39 A;  4L63 B;  1DGB A;  3VK8 A;  1DD2 A;  3QG1 A;  2QDB A;  3U9O A;  3TL4 X;  2V1U A;  1S3S A;  3S1N B;  3TP8 A;  1EU3 A;  1QAQ A;  1NAP A;  4JI0 M;  4KI0 A;  1DGH A;  4ZUI A;  5DEH A;  3JAM E;  3R9X B;  1C1K A;  3HHZ A;  1K3W A;  1S5D D;  2JE6 I;  3VYT A;  3LVW A;  1EY7 A;  3S15 B;  1C48 A;  5CMD A;  2LXE A;  2O2L D;  3O13 A;  4IJE A;  3S1Q B;  1GUW A;  3J81 E;  1MI2 A;  4QNR A;  3L25 A;  3T15 A;  5H37 D;  2Y0S B;  4WJW A;  3H09 A;  4EIW A;  1CI3 M;  4P16 A;  4PMB A;  5CV7 A;  2QP9 X;  4OO1 H;  4ILW A;  1SXJ D;  1XMQ M;  4IQZ A;  2RDH A;  4DNT B;  4KN4 C;  1ZAE A;  1Z59 A;  2R46 A;  2KEB A;  4LZZ A;  2ICI A;  1SE4 A;  2IL8 A;  4XYQ A;  1EQV A;  4R8I A;  3P1H A;  1H9M A;  3HOW B;  3U5Z B;  4C3H G;  2IJ0 A;  2KA6 B;  2F0L A;  5J1Z A;  3R8F A;  3KUP A;  3FTD A;  4HCS A;  3CF6 E;  5C1B A;  4OIK A;  3E4R A;  5ELC A;  2QIL A;  5C5L A;  4XIG S;  3QIA A;  1D5Z C;  1KDC A;  3VYR A;  3GPY A;  1H9K A;  1YNN C;  1BDO A;  5A2Q L;  2ZT9 C;  1L2C A;  4I7Z C;  4D81 A;  4CKB A;  2JYO A;  3GLG A;  3H94 A;  1QNK A;  1I4R A;  1NY6 A;  4JI8 M;  3HHX A;  3M0E A;  2I07 B;  2ZXP A;  2XLJ A;  2KZS A;  3SMP A;  4XQQ A;  3U61 A;  5IOD A;  3PV0 A;  1I4W A;  4MGZ E;  3U6L A;  2EYJ A;  1HT2 E;  1NSN S;  3RLF A;  1TWF B;  2L11 A;  4R7G A;  5IZ7 D;  1NR2 A;  4IBG A;  1YNN D;  4G4O A;  4X62 M;  2Z4H A;  2EOT A;  4DU9 A;  3ILK A;  3MC0 B;  4MM3 B;  1Y8P B;  1N77 A;  3M6A A;  5D3I B;  1L2D A;  1XTC D;  1EIG A;  4YIJ A;  5EKL A;  3ERO A;  1O7Z A;  4LJ4 A;  2F03 A;  1V1P A;  1VF7 A;  4C3H B;  3ITP A;  2O4X A;  1YUB A;  4FXD A;  2HCB A;  3MXU A;  1O78 A;  2M5Z A;  2HDM A;  4CJ0 B;  2M9V A;  3AKZ A;  4ODG A;  4KY6 A;  3PXG A;  3MHB A;  3BVM A;  4LK1 C;  3K5L A;  3JAM S;  1PJJ A;  5DAU A;  1HHV A;  1N32 M;  3SXH A;  1D5M C;  1NJG A;  5J39 A;  1B44 D;  1HTP A;  1T5E A;  3J2P B;  4L8J A;  2RDG A;  2LMC B;  2F0S A;  3EJI A;  3HOV B;  4MH0 E;  1IM2 A;  3J81 S;  4X3K A;  1DXM A;  2Z8L A;  5ITT A;  1SXJ E;  2WKD A;  3FPU B;  4LJ8 A;  2BJV A;  5KYL A;  2HL7 A;  4ZYS A;  4GC5 A;  4LJA A;  2EY5 A;  1N34 M;  3NHH A;  3HHW A;  3VYU A;  5T1G A;  3KDS E;  4HAE A;  3FUV A;  4FF1 A;  1TS3 A;  1PRT F;  2R61 A;  3HG9 A;  3K1J A;  3C2P A;  3U6M A;  2D9U A;  1EOT A;  2JA7 B;  2RVL A;  4PMW A;  3AV0 A;  1B3A A;  2EZV A;  4FP5 D;  1SE2 A;  4DR3 M;  2R45 A;  1STA A;  5GKN A;  5EXS A;  1XWI A;  1TDZ A;  2RDF A;  5KNB A;  5J22 A;  1UM8 A;  1L8Q A;  4RKL A;  1G8Z D;  4ME5 A;  4CJ1 B;  3KOW E;  3HGB A;  3VR3 A;  3PMF A;  3FEW X;  3GV6 A;  2V4D A;  2KZU A;  3PUX A;  3A7A B;  1JE4 A;  1L1T A;  1J8I A;  4NRV A;  4WW0 A;  1KYI A;  4QIW B;  3SHG B;  4I65 A;  3DWP A;  3E5S A;  4LF7 M;  5FO9 B;  2IWH A;  1QJO A;  1IXS B;  1SYC A;  3SHL A;  2EUC A;  2KEE A;  3MVV A;  4LJ6 A;  1KTK A;  3JR4 A;  2LY7 A;  2A73 B;  4AG6 A;  2E5L M;  4Y7N B;  2VUM B;  3VKG A;  3GLG B;  1Q12 A;  3H3V C;  1HCZ A;  3BYY B;  2J7N A;  4QNM A;  3W0F A;  5TSS A;  5I6W A;  2V1C A;  3AFH A;  2D7H A;  4FWG A;  1EU4 A;  3U61 B;  4DF7 A;  1S5C D;  4A3J B;  1EWH A;  1QE6 A;  3OPO A;  1QYR A;  3TWM A;  2WV6 D;  1BCP C;  1RTO A;  3SK4 A;  3A55 A;  3GQ4 A;  2C98 A;  3I3C A;  2RSO A;  4FD2 A;  3KBG A;  5CYU A;  1R9T B;  2D62 A;  1HQR D;  1J9O A;  4LFB M;  1EQT A;  3BDC A;  3N6R A;  2QEN A;  2M60 A;  1DZ1 A;  1V1O A;  4FF4 A;  3I70 A;  4KO8 A;  2F0K A;  4DN4 M;  2EY1 A;  3Q24 A;  1Z5B A;  5EPK A;  3GQ5 A;  4G7O C;  4HCE A;  5IGB A;  1O7L A;  4RCN A;  3SK6 A;  3L26 A;  3A7L A;  4F8M A;  3T4A C;  2F3W A;  1S5B D;  5IGC A;  1F2L A;  1K82 A;  2LWX A;  2Q8R E;  3BOS A;  5JJZ A;  4CJ2 C;  5DM7 3;  1PRT D;  1TDH A;  4NXM M;  2E76 C;  4K8I A;  3I73 A;  3K6O A;  1IBL M;  2PNR C;  3MA2 B;  3CTW B;  2EE1 A;  2K7V A;  5IRE B;  1I4H A;  3HRZ C;  4MN3 A;  4FWH A;  2KHS A;  3J7A S;  4BBR B;  1A15 A;  4G7H C;  1PZK D;  1RCV D;  3U6Q A;  2R7Z B;  2KCN A;  2F0T A;  3SAV A;  2G9D A;  2F1M A;  4C56 C;  2R4J A;  3NWL A;  4F87 A;  1BF4 A;  3K57 A;  1WVL A;  1R2Z A;  2L5T A;  1IN4 A;  1G91 A;  4B7F A;  3H91 A;  5IGE A;  2HHH M;  2KJX A;  2F0H A;  5ELD A;  1X3Q A;  3G6J B;  1ZKO A;  3M85 A;  4PQX A;  3HKP A;  1SMY C;  1ROD A;  1TGU A;  2AWO A;  1I4G A;  4O42 A;  2YQZ A;  4JI5 M;  5EP1 A;  1LTA D;  4QUC A;  4YY3 M;  2TSS A;  2Y21 A;  2N88 A;  5C6A A;  2UXC M;  5C0X H;  2ZM6 M;  1E9S A;  5A35 A;  2PZW A;  2CW0 D;  1TS4 A;  2SOB A;  3VR5 A;  1G59 A;  2B2U A;  1ZXT A;  1TWA B;  4RWS C;  4QOZ C;  1IQP A;  3D4R A;  4BY1 B;  2XWB B;  2VXW A;  3SAW A;  3LWE A;  1Y1W B;  3T38 A;  3I51 A;  5FLX L;  2K5D A;  4XQJ A;  3EFX D;  4OO1 I;  3AOG A;  1QNU A;  1SBB B;  2PPB C;  1FR3 A;  2PW7 A;  5IT9 E;  4MIU A;  3DFZ A;  1EY0 A;  2F0E A;  1HQY E;  3GO5 A;  4EQP A;  5C4X B;  1Q3L A;  3QWL A;  1KAB A;  3A46 A;  5C5M A;  2NYZ D;  5C3E B;  5JVH 3;  4RFB A;  4B9X A;  1DGF A;  5EP4 A;  2K04 A;  3EA6 A;  1NSF A;  4HSP A;  1YSY A;  5KPT A;  1OXS C;  1GL6 A;  4IUT A;  4I5S A;  2GA4 B;  1FNV A;  1XYI A;  1PDQ A;  2IX0 A;  4A3D B;  1IW7 D;  2RGO A;  5KND A;  1U4R A;  1A3U A;  3DHQ A;  4DV1 M;  2Q8T A;  1B50 A;  1GUT A;  1SEB D;  4FCV A;  3KLS A;  4GRI A;  4GHL A;  2VII A;  4RF0 A;  3KS8 A;  3J7B A;  2WII B;  2XWJ B;  4ZKC B;  1K3X A;  2X49 A;  1TQO A;  1CQF A;  3PNV A;  4DV5 M;  1RTN A;  2CV0 A;  3LMM A;  5I9P A;  2VB3 X;  2XFT A;  2WP8 J;  1CFM A;  1QCB D;  4HN7 A;  4OL7 A;  2BE5 C;  3HU2 A;  1QOH A;  3CRL C;  4DA2 A;  2EXZ A;  2OEO A;  3M4Y A;  5ITY A;  1ESR A;  4QHS A;  3FYC A;  2DWL A;  1LLR D;  4BBS B;  2F0G A;  3TSS A;  1EY9 A;  3HS0 C;  3QOL A;  5KEE A;  3PUV A;  3AOE A;  2L4N A;  7CAT A;  1XWE A;  4RA8 A;  4LFA M;  1H9R A;  1JOQ A;  4ZK9 B;  1STB A;  1VMC A;  5ISR A;  3HOZ B;  2BE5 D;  4XGI A;  1DO0 A;  4DR5 M;  2WAQ B;  4OVZ B;  4D80 A;  1ESF A;  5CV8 A;  3IFD A;  5JPN C;  5FK9 C;  2R93 B;  2EO2 A;  3RGS A;  1Q90 A;  2NWG A;  1EYD A;  4K5V A;  3FYD A;  2K05 A;  1C8C A;  2CHQ A;  1UNS A;  2A6H D;  4KJN A;  1Z5A A;  1JWS D;  2Y20 A;  4AZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...