4CHTB

Crystal structure of the human topoisomerase iii alpha-rmi1 complex with bound calcium ion
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
215
structure length
215
Chain Sequence
b'NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA TOPOISOMERASE 3-ALPHA
publication title Structural and Mechanistic Insight Into Holliday-Junction Dissolution by Topoisomerase Iiialpha and Rmi1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 55
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4chtB01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4chtB02
3NBIA 4CHTB 4CGYB
chains in the Genus database with same CATH superfamily
2F0UA 2X69A 2ERCA 4GITA 2WP8J 2PYKA 4G7HC 4JI5M 4G3OA 4OO1H 3NELA 4ID6A 3ZH9B 3NQTA 5LMNW 2NVTB 1PH7A 4LJ7A 3P1HA 1ASYA 1EY4A 3NXWA 1KL9A 1WR1B 3UE0A 2F0TA 2D62A 1GXDC 1AE3A 1UE7A 1FJGL 1GJTA 5IT9L 4IBJA 3ULLA 3S1NH 1EQTA 1EIJA 1I50B 4CDEC 4JBKA 1B3AA 3E21A 1VQDA 4H44C 3D3RA 3GTOH 4OELB 2XGNA 3U6SA 4RCOA 2D7GA 3M85A 5FLXc 1PH1A 1YBYA 1JORA 1SNOA 4N8X1 3HOVH 4GN4B 4M9ZA 5C4JB 2Z4RA 1E2ZA 2VQFQ 2JSOA 4X62M 2M5ZA 1TQOA 4CJ6A 2B63H 3KS8A 3SGIA 2Q2IA 1W3SA 4L5TA 1K8GA 2RQXA 4WRDA 2GNOA 1XNRM 3SC3A 2A68C 4RF0A 2MQHA 1K82A 4L78A 1Q3BA 4PZ6A 3KF8A 3BDLA 3R9XB 1AFPA 2UUAQ 1NJFA 3M7GA 5BN4A 2BOSA 5EGTA 1QZMA 2ZM6L 1EOTA 3S1MH 1RHPA 1NHWC 4GNXB 3SE0A 3Q8DA 1QNKA 2NZ1D 3RZDH 3M9BA 1DGBA 1ET6A 3LX0A 3FRPB 4DNIA 2BWEA 1JR3A 1JOKA 2ZANA 4B3TM 4LF4M 2JNHA 4BY7H 1RL2A 3KUPA 5IP7G 4X65M 4GKJL 1Z59A 5C0XJ 3D4DA 5GKNA 3MAQA 1DOMA 2XVSA 1XPOA 4AIMA 2C98A 1IXRA 5M3FH 5FTKA 3H15A 1TDHA 4K14A 2WIIB 4U673 1S5DD 4V0BA 3KDSE 3A56A 5BN3A 1D1KA 1JQJC 1QUSA 5BPVA 1N9WA 2CVRA 2ZTDA 1PJTA 5E3FA 2IWHA 1HNZL 1JQYD 4I7ZC 4NRVA 1LTBD 1MBYA 3H3VI 1GUNA 4P74A 4FNFA 1KDBA 1RF2D 3AMUA 1Y1WB 1NMGA 2NN6I 1IBMQ 1X55A 4BY1H 3K6OA 3HOZH 3I91A 1LT5D 5M5YH 5C44B 3V05A 2PW7A 1UEAB 4N9PA 5IWAM 2JA5G 2F4IA 3I01M 3BYYB 3K80C 5IP7H 2NQ8C 4G7ZC 2MJ5B 5IOCA 4DR3M 3OWEB 1IKLA 1OO9B 2WB1E 2LVNC 3LCVB 3S16B 3ERSX 2DAKA 1V8QA 3DMUA 1TWHB 3L29A 2K05A 1YNND 2CUZA 1SNMA 1TS5A 1DYQA 2I46A 3KLSA 3FYDA 3GDEA 4YCWA 3JAML 2XH9A 2F0GA 1FGBD 1QUTA 3NWLA 4ILWA 4YCUA 1C48A 3FUVA 3BYTB 3OWFA 2EYHA 2HL7A 2BA0A 4KLKA 1DD2A 2K33A 2X49A 3GPUA 2R61A 2UXCM 2LS01 5DM73 1J5EL 3CP0A 1X3FA 1ZMUA 3IG8A 3GLGE 1NR4A 4IIWA 4FF4A 5ELNA 4DR5L 1EEFD 1KYIA 4J8QA 1KDCA 3K8AA 1OXUA 4FXKC 5EJWA 5EKIA 2RCNA 1IZ6A 5G3LD 2F03A 2Q8RE 1U5KA 3AL0C 3P75A 1EY8A 1XXHA 2BCOA 4DV6Q 4KV6A 4H7BA 1AEXA 2K7VA 1U4RA 3MTSA 5KNDA 4CDCC 3J80c 1GM5A 3QWLA 4KY6A 1YNNC 4DR4Q 1XMOQ 4OWWB 2VDBB 4KJOA 3SR1A 4XGIA 1N36M 5I9PA 2CH4W 4L8JA 4ALPA 4O0AA 3RFWA 1EQQA 1JJGA 3GLFB 3T13A 4DV5M 1V9PA 4HJ8A 3FYCA 4DV0L 1RD9D 2L12A 4JI2L 3M3YH 1HNWQ 1QDTA 4DV1M 2EY6A 3PO3G 5M5XB 4LFCM 3OIQA 3FDTA 3GTGH 2HCBA 1JR3E 4L4UA 1BCPB 4QF4A 5H37D 1WYDA 4PZ7A 4JC0A 4A3GG 1EWHA 4I7AA 3K7AB 4HJAA 2KZSA 2FFKB 5IODA 1IKMA 3UGJA 2EJGC 5IY0A 1Q3CA 3L2PA 4KHVA 2AQ3B 4KN7C 1WJJA 3KK7A 2EY5A 3ONAB 1BO0A 4X66Q 1PJQA 2Z1CA 1QVCA 3AFQA 3U5ZA 2OTJA 2B8GA 3QJYA 1L1OB 1OQYA 3Q22A 4LZZA 4LF8Q 3PO2H 3IFDA 1V33A 2ZTCA 3KLWA 1D0MA 3PF5A 2KCTA 4NXNM 2FS1A 4KODA 2R93B 3GD7A 3DZDA 1Q8KA 4RWSC 3J81S 2QBYB 2KA7A 1TWGB 1D5XC 4FWHA 4IUNA 5EXPA 5EPLA 3DLLA 3PFIA 1YLAA 5KPZA 3CHBD 1Z6HA 3AKZA 1J7KA 5LMUL 5F3WA 2ENBA 5E4XA 2Y0SE 4J1MA 1VQCA 1E24A 1N32L 3MFGA 3BG3A 3HOWG 5EKLA 4REZA 4R71A 1IY2A 3SAWA 3U58A 2VQFM 1NV9A 1N75A 4AH6A 1H6UA 2JP1A 1EY7A 2X6GA 3SFZA 5C0XI 4A3BG 4JI4L 3TP7A 2YFQA 2FFJA 1O7LA 3M4QA 3HG9A 2N8NA 2A73B 2CH4A 1CK1A 4POGA 3FHWA 2L5TA 1V1PA 3HZXA 3PUZA 1ESFA 1H9RA 3DXJC 1AW7A 2A6ED 2B2WA 2DNEA 3IL8A 1D0KA 1OXXK 2L6OA 3SK4A 5IYCH 4GKKQ 2DNAA 3QB3A 3CCLA 3K59A 4LRSA 3HWSA 1IFYA 5C4HA 1PH3A 1J8IA 4QUFA 2ICIA 5NUCA 1GHKA 3HHWA 1HR0W 3STBC 1S3SA 1R4QB 4H13C 5HY6A 4OX9L 1QDRA 1R4GA 2KUMA 4LMQD 4LF9L 3OMCA 2E2JB 1W5TA 1CKMA 4GKJQ 3PUYA 2VB3X 5FTLA 4DK3C 1PFBA 3GV3A 5EBCA 1S5BD 2EQSA 2K5NA 2MGSA 4IUQA 1ZV1A 1E2WA 4MM3B 1EFUB 2XRSD 5M3MB 2DGYA 4Q0FA 1WTOA 4XTCS 3PIP3 3VDPA 3H3VH 2DAEA 4WW0A 4GHAA 1XXHE 4UAIA 5FKAC 3DA1A 3PIO3 5EBDA 3HOYB 1X6OA 1PTOB 2JY7A 3TWKA 3KFUA 1XXGA 1V92A 4EQPA 2G3QA 5KYIA 1VF5C 2L4NA 1S3OA 4Z9CB 4DV4L 4NB3A 2E76C 2A6EC 1VEKA 2Z3XA 1PH9A 3UJNA 5G3LF 1IN5A 4DPGA 2Q2UA 2ZAMA 4IN3A 4ABNA 2NVTH 5K36H 4BBRB 2UUBL 3GLHB 2R6FA 4KKSA 1R2ZA 3OW2A 2G5DA 1PYSB 3B7ZA 2A5YB 1IBMM 3I56A 1Y8GA 5EP1A 5D65A 1NV8A 1SG9A 5KEEA 4KI0A 2UXDQ 2HT1A 4KHPQ 3SYKA 2E2HB 2HIXA 1QANA 2F0LA 2VZAA 2RCFA 1PZKD 5JI2E 3KOXE 4IZ8A 3TP8A 3D6CA 1T5XD 4LJZC 1PDQA 2YU9B 4R9WA 2MPMA 2XRQD 1XWEA 1SSOA 1U4MA 3VFDA 2Z6BA 1OJLA 2F5OA 4AYBE 5I4DA 2LXKA 4B3RQ 2M00A 3DWQA 1NO1A 1Z9FA 4RKLA 1S4ZA 1H95A 4XXEA 2AQ1B 4Z8XA 4P16A 2PZUA 2XF3A 2R4JA 3LWUA 1VMPA 3K1JA 4NW2A 3KLRA 1GLNA 1LTAD 3P7JA 2L15A 2O5IC 1DOLA 2LVAA 4A3CH 4L5SA 2VUMH 4M0WA 1Z5BA 3IAYA 2KOLA 1B3QA 4DR7M 3DFZA 4O1NA 4JI6M 4IJHA 2B63B 1ZQ9A 1Y1WG 1P3QQ 4DAYB 2P5TA 1UAPA 3T1YQ 3G48A 4B9XA 5C44G 1HZ9A 4JI7Q 1LTGD 2F0JA 3FUTA 3MJ5A 1NHGC 5IT9S 2X4AA 1U4PA 2KQ3A 4AQYM 4KD3A 3GTPH 2PCFB 4HTHA 4NXMM 3UE1A 1SN8A 1PH5A 1VDZA 3HX3A 5AJ3L 2APLA 3IKJA 3FVQA 1I4WA 1LM0A 4WORA 1YUBA 3S1MB 4KY5A 3W1GA 3BJUA 1IXSA 4OEMB 4HMJA 2KCNA 2H1EA 1XMOM 2G5GX 1SMXA 2F4VQ 4IFDJ 1KTKA 3KDFB 1MI2A 4JI2Q 4NRWA 3OTOQ 3NWTA 4XIGS 1EFWA 3DOAA 1VQOA 3QYBA 1EY0A 4QNMA 1HNWM 4BY7B 1IYUA 4KMUC 2PNRC 2MJ8A 1K0RA 3N52A 3NBXX 3ND8A 4TSSA 1UNSA 1TS2A 1L2DA 1D8LA 2C99A 5EQTA 2A69D 2ZAOA 2YTXA 1S5ED 5CV5A 1E2VA 3S2HB 3V2TA 3F2DA 2ES2A 3C3EA 4R4IA 3AQQA 1NTGA 2SDFA 3NTKA 2LFNA 3L9AX 4QIWE 1DM0B 5D3DA 4X66M 3GPPA 2EE1A 4JXJA 2RDHA 5EP3A 1N34L 4MGZE 4DK6C 4LF8M 1JICA 1SYEA 1FJGM 4PMCA 2A19A 3GP7A 1MD2D 3E0EA 5DLQE 4FF1A 1N8RC 4P17A 3HOZB 3I55A 3GTJH 1F2LA 3CW2C 2BH2A 5IGDA 1D2NA 1BCPD 4DAVA 1FR3A 4YHHL 4ME5A 4AG6A 2IPKD 3FEWX 4YCVA 1Q1BA 2RDGA 3A8KE 4DNTB 2DJGC 4DV2Q 1BR9A 1S40A 3JR5A 2PMZB 4AKHA 4M1UB 2CW0D 1BUVT 4A3KH 1HT1E 4R4TA 1QAMA 3ILKA 3G6JB 1PXUA 2NVXB 2O01F 4EGVA 4Y28F 4G57A 2ZT9C 5J1ZA 5DFLA 5LMNL 3L7ZC 1XNRQ 1IBLL 1T5EA 2XGTA 3MXNA 4UDUC 1OTRA 5KRUA 3HEJA 1DJRD 1KDAA 1EIFA 2ZM6M 1AZPA 3I3CA 1ESRA 1M4VA 2Q8IB 4B08A 1CA6A 2QHOB 3MZ5A 4GH9A 4G4QA 2HDMA 3NK9A 1VQ9A 5C3XA 3H0GH 4OX9Q 4LF9Q 2R93G 1QNUA 1YNJD 1WD0A 2HWJA 2EJMA 2OTLA 3KF6B 4B3TQ 4GKJM 1YITA 2NZOA 2HDLA 5AFWA 3J81L 3HGBA 1T43A 4X65Q 2CW0C 1JWMD 5C5LA 4EIWA 3JAMS 5DYIA 1O78A 1LTRD 2K5VA 5J3BA 2K47A 3K7AH 1D5MC 1NNUC 3MXPA 1C7YA 1H9KA 3RGSA 2K50A 1VQPA 1DONA 3LQRA 2DZNB 1HTPA 3PSIA 1OXVA 4DV4Q 4Y7NH 1Y8PB 1HNZM 2E2IH 3D8GA 1ZYRD 1EZ6A 2WKDA 5L8RF 2Y20A 4R4OA 2UUBQ 1M90C 5IIFA 4LUOA 2RGHA 3ULPA 1Q81C 1YZ6A 4IQZA 2QCUA 1WHCA 3U6DA 3E6ZX 3C1FA 5EP2A 1STNA 5IGBA 4RHSA 1TWGH 2EJFC 3WOFA 3GRYA 4NSOB 2UXDM 3TSSA 1E9RA 4HSPA 1PH4A 1EY6A 4RMFA 5JEAH 4DR3Q 2A74C 5IGCA 4A3JG 4IJLA 3QOLA 3GLIA 1CKNB 2ZXRA 3GQ4A 1HPCA 2A5HA 1HNXL 3PO2B 5EXSA 5ITTA 1PTOD 3D8BA 4DR6L 3MEHA 4L16A 3QOJA 2BWBA 3KOYE 4B9WA 3RUZA 4UP8A 3LCUA 5F2DA 4K5VA 1EL0A 2JA6B 3EFXD 2DI0A 1X3QA 2RDFA 2KHIA 4C1NK 2V1CA 2Z8LA 3HOYG 4IFDI 5FSWA 3OMGA 1J5EM 5DNYA 2QW7A 1NAPA 2E5LL 2UXCQ 2HIVA 5ITUA 1OIPA 4HJ9A 3B9PA 3U9SA 1XMQL 1HFNA 3PUWA 4DR5M 2R4EA 1CUKA 1SR3A 2MNAA 3X3MA 1IBKQ 3AYHB 2F0SA 4BBRG 1G6ZA 1SEBD 1DGHB 3TE6A 1CZWA 4IO9A 5BN5A 1JC7A 4LG2A 2J7NA 3RE8A 4FF2A 1QUQB 5DAUA 4ZKCB 2E2JH 4IPCA 3KXEC 2O5JC 3SAVA 5AJ3Q 5EAYA 1TXYA 2XEPA 1DCZA 2RHSB 4YWKA 1K9MC 1EEID 4HMIA 5M3MH 1ENCA 4OO1G 1JB7A 1WCMB 1E32A 4EX5A 4KN4C 3EJIA 4APVA 1N36Q 4IUUA 2R7DA 1SYCA 2F4VM 3CF2A 1PTOH 4JI2M 3A5ZB 3K8ZA 2TSSA 4DN4M 4KTAA 2R6GA 3CC4A 4P75A 1BBUA 1EY9A 3PUXA 5H1SE 3HHZA 3IRBA 3OW7A 2NTSA 2WSFF 3OIPA 1FYCA 2EKFA 4LFCQ 2CHGA 1RTNA 4BBRH 4BBSB 2CKZB 2CWPA 4RKBA 4CGYB 2A6HD 4P72A 2RF4A 2C5RA 1L0XB 4RGMA 1SAPA 3C9PA 4OHJA 4JI8L 2AWOA 1NY5A 1TWAH 1AIPC 2E2HH 1F9SA 1DOKA 1SJED 2E8GA 5ITXA 2B63G 2QDLA 4JN6A 3E0JA 2EVBA 5KPTA 2YU9H 4DK1A 1VQHA 3KP1E 3FP9A 4JOIC 5FLXE 1BOSA 2GQFA 4DUZL 4NXNQ 1SE2A 2RA4A 4QOSA 3A7LA 3FKEA 2FH0A 4HCEA 1X37A 3T53B 1X54A 3AOGA 4RNAA 2B3GA 2K5HA 2CQAA 4NC6A 2KCCA 2JY8A 1KXLA 2L9HA 3D8LA 1G41A 4B3SL 4CHTB 4JI1Q 1WI5A 4C3HH 3DWAA 1U9RA 4DV2M 5KNCA 4GOPB 4GIPA 1G2SA 3R93A 5EKKA 4BY7G 1CKOA 1PFSA 4JI4M 2SNMA 3NBHA 2XZFA 3GLIE 1OKSA 1HA5A 1SXJC 2IT1A 3UDFA 3E9SA 2BJVA 5FLMH 2EUCA 2V1UA 1TR5A 2RGOA 5M3FG 1XTCD 5E6JA 5KIXA 5BR8L 3BOSA 1OXTA 2FINB 5EP4A 1STBA 1SYFA 1W2BA 3W0FA 1T6OA 3S1RH 3S9WA 1IN4A 4YY3L 2VUMB 5I6YA 4WJ4A 3FTCA 4RHRA 4OX9M 1N33Q 2WAQE 1IXZA 4LF9M 3K7UC 1EIHA 4I5SA 4BY1G 3U60B 2SNSA 3FKIB 3HOZG 2WB1B 3NQIA 1G4AE 4OWTB 3R8BA 3SK6A 3GTPB 5FK9C 3HJQA 1I4GA 1VQGA 3K9PA 5GAGC 2KEDA 2CHBD 1WGNA 1TVXA 4CJ0B 4L5QA 3G4SA 1CT1D 3F2UA 4JBJA 4KHZA 1C4QA 4WURA 1PYBA 3S2HH 4X3UA 2L4FA 1B44D 1LUZA 3JR4A 2F0NA 1TF0B 4DV4M 2LH0A 2LVPC 2K32A 3ZJYC 1Z6TA 1LV7A 3I4OA 4YWMA 2KEBA 4GN5A 1TH3A 5M5WB 1W6KA 1KSFX 3T38A 1CFMA 3J2PB 2UUBM 2F3IA 4FD2A 3BVMA 4A3MB 1HR0L 4IBIA 1DZ1A 3T56B 2R7ZH 1VQ7A 1VG5A 3GLGB 2F3WA 2K14A 2L0CA 3SMSA 1ENAA 1LTSD 1LYLA 3A0JA 3E3XA 5T1GA 2KZUA 2R44A 2C35B 1EUJA 4BWGB 4DV7Q 1ASZA 1OXSC 2DKLA 3VKGA 4KKUA 1YSYA 1SJHD 3K2LA 3CRLC 1WTRA 4DR6Q 2NVQB 4DF7A 7CATA 2BDOA 4K0KL 2VF7A 4PT5A 5ITXE 1NY6A 4UHVA 4LF6L 4ZYSA 4IFDH 1KNAA 3H91A 1LT4D 4L6TB 1A62A 1PRTB 5CORA 3RN5A 4LF5L 4DGZA 4OIKA 2NVXH 2DVWB 3CCQA 1I94Q 5GAEC 4XT1B 3GTJB 3GLFA 1O7ZA 2EY1A 3T6PA 1NNXA 1EYCA 4GLVB 3JC66 5C6AA 5D3IB 3MK6A 1I4XA 4P73A 2XFTA 2R45A 1BKBA 2KBNA 3OPOA 4A3IH 1SLJA 2F0HA 2UXBL 1UWVA 3FUUA 1GO3E 4IPHA 4POFA 4DXGA 1EYAA 3B6YA 1LTTD 2KCMA 2UU9Q 3HKZE 2WFWA 4LFBL 5I9OA 4II7A 1L0YB 4A3KB 1JWSD 2F5QA 4DK0A 1CA5A 3CCEA 1NCVA 1UM8A 4DR7Q 1QE6A 4JI6Q 1IBKM 4FCVA 1N78A 2QDBA 4ANRA 1TU2B 1SE8A 2VXWA 3JAMi 3J80E 4FCWA 1ONLA 3AEVA 2BA1A 3FTDA 1GL7A 3GO8A 4AQYQ 3SDZA 4BA1I 4XDXA 4AG5A 1SYDA 1QZEA 4LGMA 2RVLA 1PHJA 4NXMQ 2F0EA 4G7OC 1TDZA 4JG2A 2FJ2A 4P71A 2DY7A 1E3PA 2AMCB 4DR2L 4DBGB 1Q02A 2CE7A 3PO2G 3BXWA 2OCEA 3LVVA 3H0GB 1B50A 2O5RA 2XLJA 2MUYA 3VK7A 3PVSA 2B2TC 4XQJA 4OW0A 4XQNA 3CKIB 3HGIA 2Y0SB 1HZCA 1V1OA 2EIFA 1ZKOA 4H0LC 2UUCL 3A46A 2JA9A 1JOOA 1V34A 2LBCA 3L2AA 2OPFA 1MIUA 1UE6A 1AN8A 4A3LH 2KHHA 1GUGA 4X3KA 2D7HA 4A3EB 1XWIA 4K2KA 2J0TD 1EU3A 4KK7A 4I65A 2JY5A 5C3EH 4Y7NB 1WTWA 2E2IB 5ISRA 4CIZA 2JZ0A 2WZJA 3A8JE 2FMMA 1MX0A 1FNVA 3OHXC 2N78A 3FUWA 3BU2A 3CAMA 1FJGQ 2KVMA 5CBEE 4KO8A 4QHSA 3T1HL 5E7NA 2CWAA 1K8AC 4EQNA 1LT6D 2LSSA 4YHHM 3CTWB 5IYCG 2JA6H 4HN7A 2LHCA 2K5QA 3U6LA 2B8FA 1RU3A 3UK6A 3VA7A 1QVGA 2D0OA 3QYEA 2K9DA 2BH8A 1A2UA 3H6MA 3G71A 1DO0A 2FHTA 1F9QA 2K5WA 2M2LA 3VR5A 1B2TA 4JI1M 3I73A 1PH8A 1LO5D 2KXEA 1X3GA 2JQOA 2Z4HA 4C3JH 3WWVA 1L2CA 3DEPA 3EIHA 4NMZA 2TMPA 4IBEA 2Q8TA 2RSOA 1XXHB 2IW3A 2FOIC 4L63B 1TS3A 4BBSG 1E9SA 4RF1A 2WACA 3B7QA 1IBLM 2VB2X 2QCPX 2R18A 1UUPA 1KRTA 3PV0A 1IY1A 4HR7B 3BZKA 4H02A 1PH6A 1LT3D 2NVYH 2NN6G 3SYLA 2IY5B 2ZM6Q 3WHLA 1AE2A 4IURA 5LL6S 1ZEQX 2KW0A 2L2DA 4IPGA 5FLXL 2LVOC 3A8IE 1T9HA 1WCMH 3RGPA 3T15A 3AJIB 5K36G 3GQBA 4CJ1B 1GABA 3V96A 4LF7L 4IBKA 1VQMA 2XSZD 2CHQA 4LJ9A 1N33M 1EYGA 2QEJC 2CV1A 2ZJRA 1MJCA 4I4LA 4PQXA 4KY7A 3H3VC 2JWSA 1JB3A 4LUVA 3CCVA 1TWCH 3QWNA 1K0SA 4OONA 3RZOH 5FTMA 4AW4A 4BBSH 1XPUA 5FJ8H 4AYBB 3SXHA 2IL8A 4PD2A 1SNCA 2D9UA 4DUYL 4JOIA 1IL8A 1EIYB 1U4LA 4R4QA 3U6OA 3A55A 2NN6H 1ICWA 2KNZA 1HNZQ 4B3ML 2JA7H 5HURA 2NZHA 3RLFA 3VA5A 1MGSA 2DAIA 1E0BA 1TH2A 2DHYA 1IY0A 1HZBA 4R8IA 1EOVA 2BNKA 1GO5A 3TWMA 4QUCA 2VY3A 1SFOB 4HLQA 4QNRA 4DR1L 3C2PA 4JYAL 4R4CA 1TGUA 4A3CG 3NHHA 2EOTA 2K04A 2MROB 2VUMG 4PV1C 4JI0L 1AUAA 1TWAB 4DV7M 1Q7YC 1TIID 1SNQA 2DZOB 1HNXM 1SXJA 4FO2A 4TKOB 4FWDA 4DR6M 4C2MH 4LF6Q 1VEGA 1F2YA 1V1PB 2WB1G 3VYSA 1FNUA 3VYTA 4K6LA 3MEFA 4P2CB 3KVWA 4IJFA 1B7YB 3VYRA 4AKGA 4UY8C 1B9NA 1I94M 1WTVA 5ELDA 3L0OA 5FOBB 2HQLA 3FD9A 5C4ZA 5DEHA 3LW5F 1Z47A 4GNXC 1YHBA 4LFBQ 1A5TA 3C3DA 3EIEA 2E5LM 4C3HB 1XMQM 5IWAL 1J5EQ 2GVBA 3G6EA 2XSCA 3K5NA 2UU9M 3MVVA 1IW7D 1CZGA 2Z0SA 4DR5Q 1WD1A 3QIAA 3SAUA 2QEXA 5JVH3 4QIWB 5IP9H 2X6LA 1WJ7A 1QZHA 2MP1A 5GROA 1R4PB 1ZXTA 3FKIH 1PRTD 2DWLA 4LJ4A 4JPBW 1Z5AA 3K5OA 1VQ1A 4DKAC 4IBBA 1K8MA 1KABA 1YI2A 3ICEA 4OXPA 3PNYA 4PDIA 2B2YC 4OL7A 4DR2Q 3S1RB 4DNRB 3KBXA 2LXEA 3MMPA 4CBVA 4DV3L 3U6QA 3GRRA 2MO0A 4DFAA 1Z7TA 1JR3D 3BS1A 2E74C 2ID0A 4RGOS 5DM63 2J5YA 4BA2I 4JV5L 4QGUA 2EY2A 1DV0A 4JW0A 4DV0Q 4OGQC 1VQ5A 2UUCQ 2XNAC 4PMWA 4D80A 4RCNA 5M5WH 1QG7A 2OEOA 2HQEA 2N35A 2G9HD 1R6BX 3V76A 4A3MH 3Q8GA 1S5CD 2NWGA 3GTLB 1I6HB 3MHBA 1PM5A 4O42A 4X3TA 3U6EA 2I5HA 1GVPA 3VDUA 3OYYA 2JN4A 1I5FA 1E22A 4A3KG 2QSFX 1QWYA 4AZFA 3U9OA 5I2YA 4IBGA 5KYLA 1PRTC 3J80L 3N6RA 1I3QH 1LTMA 2NVQH 3NBIA 3J7AV 1SNPA 1GJSA 1PFNA 4DUZM 4CISA 2EPBA 2YNMD 4DV5L 1XJVA 2CFMA 1K8OA 2KRKA 2R7ZB 4PZ8A 4IBCA 3U61A 1WFQA 2HKJA 1I4QA 4CKCA 2JP7A 1HFGA 1Q82C 1PZID 3HKPA 1S72A 1O7YA 3I2ZA 3E4RA 5LMUQ 2KEEA 4LW1A 1HQCA 1T3TA 1E1TA 1PFMA 1RCVD 3H0GG 2L55A 2IX3A 4X64L 4G4OA 5C0XH 1N32Q 3NENA 4LCBA 3SATA 2DNCA 4MGIE 1AH9A 3SK5A 3J7AS 1H9SA 1CM9A 2JXMB 2XN9C 2Y0SG 5D14A 3VLFB 3I8ZA 4FF3A 3ZYYX 2DHRA 4JI4Q 1SXJE 3M6AA 3NTIA 5JI3E 1SMYD 4ZRZA 4EQOA 3TDQA 5A35A 3Q24A 2A69C 4K8JA 4C1NI 4LFAL 2AUJD 3C58A 4K8IA 4MNOA 3D31A 1K73C 4QB4A 1L1ZA 1GJXA 1JOQA 5BR8M 1IXSB 1DGSA 4I8OA 2IX1A 2DAGA 1R7RA 4OVZB 3BBZA 4A3EG 2BE5D 3HRZC 4A3IB 2C5CA 1YVCA 3F8TA 4YY3M 1OFIA 3HU2A 1STEA 2QENA 3AU7A 3HFZB 1TY0A 3ULJA 1JWUD 4CDDC 1A15A 5A2QE 4NL4H 3GTMB 5T1IA 2F0MA 5IYDH 2YYZA 3U4VA 3CCMA 2AWNA 3W0LB 4JI3L 3KS4A 1IN8A 1EQVA 4HCSA 1BCPC 3MA2B 3ERQA 3EBEA 2DZLA 4F1IA 4HIMA 2NUCA 1CQFA 4HIOA 3R2IA 4HJ7A 4IALA 3T4AC 4F88A 3PNVA 3L25A 1TWFH 2WSEF 1B8AA 1QOHA 2J7ZA 2CFOA 1JE4A 2XWBB 3VR3A 4HJ5A 1KRSA 3Q6SA 3W5OA 3EIVA 5CV6A 1L1OC 4LAAA 2YTVA 2F0WA 3QO2A 4D81A 2UUAL 1X65A 2JA5B 3PXGA 1X32A 4ZCKA 4A3EH 1Q12A 2F0PA 1Q1EA 1VF7A 4BXXH 1PRTF 5CMDA 3TEHB 2X8AA 3UI2A 3J81i 4DXFA 3SVMA 3K5MA 4DR1Q 1KLUD 4JYAQ 3H09A 2DXIA 2Q2HA 4M9XA 5IYBH 5ELFA 3J7YW 1XC8A 2EDGA 2O25A 2EJSA 2Z4IA 1HA6A 1DGHA 2EYJA 1JCKB 4KLNA 3TREA 1YNJC 3W3AA 3GTQH 3HKSA 2WKCA 2EXZA 5C3EB 4FW9A 4GLAC 2EZVA 1IYJB 4K0KM 2JA8B 1J09A 2JA2A 1ILQA 2R65A 4FWGA 3DHQA 1C9OA 4LGYA 4LF6M 1IQPA 2Z9HA 3B74A 4Z6YA 4LF5M 1FNWA 5FTJA 2K6BA 2AKWB 2HHHL 2PQAA 3KOZE 3B89A 1Y69U 1IM2A 1GOZA 4UPAA 3KJOA 1Q86C 1CSQA 4L8RC 4AYBG 3JAMc 2QILA 4GHLA 2VF8A 5M3MG 3CF6E 2D5DA 4L5RC 4A3DH 1C0AA 3M7NA 1BNZA 3SHFA 3ZQJA 4DAMA 1IBML 2UXBM 2ATWA 4IUTA 1ZYRC 4LFBM 3TMEA 2NYZD 2L1BA 4C3JB 4MGHA 2RHQB 3QG1A 1NJIC 1QAQA 1JJ2A 2H4OA 1ICFB 3TS0A 4C3IH 1XX8A 1CQVA 2NB0A 3M4PA 2JJQA 3GRUA 3NUCA 3KJPA 3M0EA 4DAPA 2K01A 1MJGM 5C4XH 3UDGA 4NSRA 2LMCB 2WINB 2K75A 2QP9X 1UEBA 1BCPF 2F0FA 4F7XA 2EYOA 3D0FA 3E9IA 3W68A 2KA6B 1ENFA 2FXQA 4FXGC 4MTKA 1MJEA 2NVYB 1BQQT 3K92A 3I7FA 2K4KA 4DR2M 1KHIA 2L11A 3NP8A 3TPZA 1PTOC 2IJ0A 4A3GB 4G4NA 2K28A 5I2XA 1OAIA 2K1BA 3T16A 3W2DA 3SBJA 2NBFA 1EYDA 3HZJA 4CKEA 1DO2A 4L15A 3A7AB 3RD4A 4KT0F 4DV0M 1STAA 2OWOA 1KD1C 3S14H 4CJ2C 2UUCM 4ZUIA 1HXYD 1B70B 4L6V6 1TWCB 2F5PA 4HIKA 5JEAG 3RZOB 4C3HG 3GLIB 4GC5A 4FP5D 4UP9A 4MGKE 3CGWA 1SFOH 2AHOB 2F0KA 4DV6L 1E7ZA 4PCZA 2I07B 4LJ6A 1N34Q 5FLXS 1SROA 4PMBA 2JA7B 2LKVA 5FLMG 4J15A 1SXTA 4DR4L 3C46A 1IN6A 4QJFA 1Y1VB 4MB7A 2DY8A 2B29A 3VK8A 3T1HM 1WGLA 1ILPA 3UDXA 3PQIA 1NMFA 4GNXA 1JT8A 4ZQ3A 1IL2A 3RMHA 3HOUH 5CC4A 4YHHQ 1HUNA 2WAQB 1KNEA 4DA2A 2V6ZM 2MR9A 1I6VC 1GUWA 2QPAA 4FVMA 3GPXA 3IHPA 5LMUM 1Q90A 4F2LA 1N32M 2A68D 4MIUA 2JEAI 1KAWA 1KFVA 4F87A 1YJWA 2R46A 4HAEA 4C2MB 2QA4A 4X66L 2WV6D 4LFAQ 2Z7JA 3CCJA 2FE8A 4ZLTF 4LF8L 2A6HC 4X3SA 2AUKA 3HOXH 4R7GA 1TS4A 2CWBA 5LMNQ 5KQ8A 3VKHA 2B2YA 4RGTA 1IBLQ 3KOWE 1PJJA 2RSNA 3KBGA 3KLSX 4JCVE 1Y8NB 2VQEL 3GLGA 1VQKA 3I4NH 4JI3Q 1D6EC 2R62A 1PTOF 5LL6X 1VQ4A 1HUMA 4R8NA 5EPJA 4LF7M 1I4RA 2KNVA 3R3OA 1STHA 2R7ZG 4A3VB 1A3UA 4A93H 5CV8A 2PZWA 3J7BA 3TL4X 3VDYA 4OIJA 4GRIA 1G71A 4GEWA 1K28A 1B53A 1WOCA 5GAHC 1JMCA 5JJLA 3S2DB 2QKIC 2LWXA 3HP3A 4MZ9A 1CTMA 1XB2B 1SE4A 3LGJA 1K3BC 5EQ0A 3GTLH 1I6HH 4S3SA 3GTKH 1X3PA 4DUYM 4MTNA 1HQYE 2MHVA 1CI3M 1Q3LA 3AV0A 4QY7A 3KW6A 2CP8A 1W5SA 1F2MA 5ELEA 1KAAA 3NPPA 4LUZA 1ORYB 1BXTA 1XTDA 4WP2A 4HEDA 2XTIA 4B3MM 3NEMA 1TT2A 4GKKL 4IFDG 2ZBKB 2C9OA 3S1QB 3GQ5A 3EVQA 4U68A 3KYHC 3M4YA 2EXDA 2Q2EB 5CV4A 1L2BA 4AI6A 5CR3A 2PQEA 5JVG3 3HU1A 3HKZB 2JY6B 1SYBA 4JBMA 3S15H 4DR1M 1IN7A 4A3IG 4JYAM 2ZXOA 2LXJA 3NSWA 4LK1C 5A2QL 3AOEC 1G8ZD 1YJNA 1EY5A 1VS0A 1M1KC 4JI0M 2Z6KC 1WIVA 1V1QA 2Y0TA 1P16A 1NE3A 2XWJB 3NBHB 4WJWA 2R92B 1AP0A 3HJ8A 2A1AA 4XK8F 3MC0B 1HNXQ 3J27B 2V4DA 1I3QB 2HHHQ 1G3IA 4OWXB 1EQRA 2JE6I 4GZYC 1PRBA 3C1EA 1TKWB 4N9TA 5TSSA 3TZDA 4D82A 4BBAA 3KF8B 2ASBA 3KOJA 3WOEA 1QZGA 3EQLC 2DWZB 2LVQD 3TP6A 2J4XA 4WFN3 5GADC 4QQBX 3TQSA 2F0QA 2L09A 3D4RA 3DEOA 1TR8A 2E5LQ 1M8AA 1JR0D 1LTLA 1XMQQ 2UXDL 1VCIA 4KHPL 1PVOA 1HJPA 3SK8A 3KP0E 2ZJQA 1U0LA 3GTMH 4E6IA 1VQNA 2RRUA 3J80S 4B7HA 3DWPA 4IBFA 3TBIB 3Q8XA 2Q2TA 2XIWA 1O80A 2F0DA 3VR4A 4QOZC 1B1ZA 5C5MA 3CQZH 3GP1A 1VEJA 1K83H 1SDFA 1L1OA 1RKNA 2A8VA 3J7AF 4A3LG 4B3RL 5JOBA 3BVGA 2FMCA 2R3ZA 3ITPA 3RN2A 3WHKA 5C3EG 3MXUA 4TUWA 4DV3M 1QVFA 5DYGA 1BBWA 2EO2A 2JA8G 3H4JA 1X56A 1GL6A 4X6AH 2D7EA 4JV5M 3HJSA 2KJXA 4G6ZA 4KKTA 2QBYA 5IGEA 3S17B 3I70A 5IZ7D 2JA5H 2ZXPA 4LJAA 2N3SA 3IECA 3SMPA 2XZUA 3URYA 5KNBA 3CU7A 1P8LA 2JA6G 1HQRD 2K5DA 1X9NA 2ZTEA 3T1YL 1XNQL 5FO8B 2Y0QA 3CC7A 4JI7L 2F5SA 1TWFB 1LV9A 2OQ0A 3E46A 4JI8Q 5JJZA 4C3JG 3SEBA 5JEAJ 2F52A 3TP5A 2F5NA 2F1MA 3VR2A 1BVSA 2OQKA 5EPKA 2VW9A 1D0LA 5DNFA 2KECA 2E2DC 1I4HA 4ME3A 2QNJA 1NVMA 1N34M 3LNNA 3A5UA 2HCIA 3AFPA 3I90A 1BDOA 2JA8H 3CCSA 2PPBC 1Q46A 4DUZQ 2F4VL 3LVWA 2VNUD 2L7HA 1GKIA 1YIJA 3OTOL 1FGUA 1R2YA 1MHWC 1RODA 1TH4A 2M9VA 4BS9A 1KC8C 1G6PA 4IOAA 4B7FA 4RFBA 3J81j 3R8FA 2F0VA 1A8VA 4X64M 1WCMG 1F9RA 4B3SQ 2MGWA 5JPMC 3GTQB 1EWCA 5CYUA 2HUGA 2IHEA 2C9CA 2QZ4A 1A2TA 1YNXA 1PJSA 2Z8YM 1NNJA 1CHQD 1H9JA 2YV5A 3I4MB 2F3VA 5LHY1 5JJKA 2ICEC 4LFAM 2HAKA 4ZKBB 4JI5L 4HL4A 1VDDA 5LMNM 1G291 5FJ8G 2LHGA 5EJCA 3K0XA 3HHXA 4A3DB 4LRTA 1K3RA 4RGNA 5BR8Q 3STBD 3CCRA 3CPWA 2LY7A 3MXGA 4YIJA 2VQEQ 3PO3H 3WDNA 2BJWA 1XHBA 3I51A 1A0IA 8CATA 4YWLA 1D2BA 1HHVA 3GLFE 2L7IA 4YY3Q 3C3LA 3GLHA 2JA7G 3J81E 1GHJA 3FPUB 5ITRA 1R9TH 4A3GH 1L2FA 4JI3M 3M4OB 2VIIA 2PZTA 4C3IB 3RR5A 2Y21A 5C18A 3FUXA 1D1IA 1Y1VG 4IBDA 1HZAA 1SRUA 3K58A 4DV2L 2RKOA 2EYPA 4XYQA 3U6PA 3S24A 1UE1A 4HEOA 3Q0AA 5C4XB 4LWCA 5EXTA 4X62L 2RBMA 3TQYA 1WTHA 4QCLA 3K9OA 4XBOA 2WAQG 3NE5B 3CRKC 1NY4A 1XPRA 4JVZA 3J81c 1WTPA 4NOOB 2OF1A 1SYGA 3U4ZA 3F1ZA 2DAMA 4G4KA 2PO4A 3U6CA 1XNRL 1EE8A 3TN2A 5IGFA 3U5ZB 3QR8A 5C1BA 1J6QA 4Q5VA 4F8MA 2UUAM 1CSPA 2K6AA 1A3TA 3FTEA 1NR2A 3L28A 2R7FA 4GS3A 4Y52H 3I4YA 3F2BA 1S5FD 2V1CC 4IUPA 3CC2A 3HY5A 3W67A 2CV0A 1I4PA 2FNAA 4A3JB 4W5WA 3S14B 4FYDA 1HR0Q 2B3TA 2IX0A 3D6WA 3HOWH 1X3EA 2D2CC 4UP7A 1Y1VH 5ITYA 1A63A 3THGA 2I5LX 4B3TL 4LF4L 1WTQA 3CMEA 4C56C 1WVLA 2DWNA 4NKLA 2EYFA 4A3BH 5M9OA 3UMMA 4HIDA 4MHEA 4IJEA 2G9DA 4DAYA 4X65L 1YJ9A 4GOPC 1ZMWA 2OOBA 5J39A 2OQ4A 1JB0F 2HD3A 1VDLA 4A3FB 5J22A 1G2TA 5IP9G 4K0KQ 1LTID 2B2UC 2HHHM 1QYRA 3FKIG 5FO7B 2DJFC 4LF5Q 5KPRA 3K5LA 2PW5A 5JAVA 3HOUB 1VQ8A 4K6DA 2GN5A 4JBWA 3HHYA 3KDFA 3FE3A 1L1TA 1I50H 1VQJA 2UXBQ 1VQ6A 2XFSA 1OTCA 4RH6A 4GN3B 2B2VC 1LLRD 3L3OC 3GO5A 2BDNA 1OAOC 1FNNA 1C1KA 1ZAEA 4DR3L 3NTHA 1J9OA 3HKZG 5C4JH 4A3MG 2JUJA 4LJ5A 1MKHA 1MSGA 1Y8OB 3HOXB 2Z4SA 2MFIA 1BBXC 3O13A 1Y14B 1QQWA 4ULLA 5ELOA 4XQQA 3S1NB 4LY6A 3A42A 3QAUA 1NJGA 1VQAA 3S2DH 4B7GA 4PDGA 3GTOB 2R92G 4NP5A 1FD7D 2YTYA 2KDLA 3RNUA 2J7OA 2VL6A 4XT3B 3I4NB 2I5MX 3CF0A 3HOVB 1ZMVA 3MFYA 3GLHE 2UXCL 3H4MA 4A93B 2OOAA 4NPSA 4EVOA 1MU5A 2OT2A 3SARA 3AOEA 3S1QH 2PI2A 1IBKL 2QGQA 1XNQQ 2Z6KA 1QCBD 1PYWD 3G7LA 4IPDA 1GD7A 2VS1A 5C0XG 1SXJB 2QQ8A 3GTKB 2N55A 3IG5A 1IW7C 5KQDA 2RKSA 4DV6M 4M9SA 4JI8M 1L8QA 2ALYB 2SOBA 5IT9E 2JXNA 4XYOA 5ELCA 2R92H 3RZDB 4A76A 4OVZA 4DR4M 4M0DA 2LNHC 5KGUA 2P5ZX 1VQLA 2F0IA 2DN8A 1D7QA 1G51A 1N36L 1HCZA 4TRDA 3U6MA 1E1OA 1GUTA 1PLFA 4CKBA 4ZK9B 4FXDA 3T1HQ 4V190 3S15B 2E75C 5IT9c 3RLNA 3KSJA 2K03A 1Z5CA 4DV1L 2LTUA 3EROA 1HT2E 4LFCL 1Y1WH 5ITQA 3FPPA 5IYDG 2KNAA 1JJCB 5M3FB 4CDFC 2K52A 5C44H 4K2LA 5K5PA 1NSFA 2EA0A 4B3SM 2DENA 3KF6A 2KRUA 3J80i 3LQQA 3AB9A 1GUSA 1NSNS 4ZPXA 1FL0A 3HS0C 3CCUA 3CF5A 3J7ZC 3D4WA 3TZUA 3A45A 1NBWA 3X3NA 3E5SA 4JI5Q 3BZDB 1IXRC 1WTXA 3J7A5 3U50C 4RKUF 2MO1A 4IOCA 1YHAA 3S16H 4NDXA 5L37A 4HSVA 4R1JA 1F9PA 1IHZA 1TWHH 4BY1B 3BVZA 5CV7A 4NXNL 4K5XA 4ZAIA 5M5YB 5A2QS 3H94A 4OO1I 4ODGA 1C8CA 2CRUA 2VQEM 3SHGB 1LABA 3I72A 4UN2B 3EN2A 2WSCF 1QJOA 4M8AA 3GV6A 2JK8A 3AFHA 3R2TA 1G91A 4MH0E 2H1RA 2CV2A 2B2TA 4JK1C 4BXXG 1B4OA 5ELBA 2R0IA 4JI1L 3LWEA 3PF4A 1H9MA 5IE8A 4LF7Q 2G8LA 4K5WA 1EFID 3S17H 4X62Q 3K57A 1DGGA 1F2ZA 3FRHA 1YE9A 5E26A 1PV4A 3A54A 5IYBG 3IFTA 2VQFL 1A3VA 5GQOA 4I81A 3CQZB 5FTNA 3CXCA 1K83B 5IREB 1CKNA 1VQBA 1OFHA 1SBBB 2JEBI 4FCTA 1EU4A 1PMRA 3UDIA 2I0QA 2AHMA 1GKHA 3F2CA 2L4EA 1PA6A 4DUYQ 2JYOA 3P20A 1ET9A 2B39A 4KJNA 3PUVA 1SMYC 4GKKM 1CHPD 3PIPA 2GA4B 4GMQA 3MWYW 3UZUA 5E4WC 3I4MG 4LJ8A 1G59A 3U61B 4MN3A 1MN3A 4B3MQ 1JE5A 3PIOA 4LNQA 3B7NA 1RDPD 1ML0D 1L0WA 2CCZA 4A3DG 2C96A 1HR0M 1N33L 2BE5C 5JJIA 4LF4Q 3L27A 2ZJPA 4GLXA 1QILA 5FO9B 2F0OA 2PI2E 5M5XH 1KIXA 3OOCA 1Q8IA 3LMMA 1H9SB 4IUVA 1STYA 2YQZA 2PMZE 4JI0Q 3DUZA 1SE3A 4S12A 1VMCA 4C3IG 1HTLD 4MGYE 3I4VA 5KO3A 4PNYA 2YR0A 1QUQA 2KHJA 3PGZA 1EWIA 3SASA 3ND9A 3JAME 4R3DA 5C4XG 3A74A 4KD4A 2O4XA 1PGYA 4QMGA 1K3XA 1QB5D 3PCOB 1RTOA 2I7PA 1O7IA 4J6HA 3MXNB 3M3YB 4GC9A 3I4MH 3FRIA 3FMCA 1QAOA 3DM1A 3T51B 4BLCA 3ZCBB 1VQIA 5HGTA 3GTGB 2NTTA 1K3WA 1EIGA 2CHVA 3L26A 2R93H 2DWMA 2I7NA 1NUCA 3MHVC 3VR6A 4A4IA 3EA6A 1YEZA 2SEBD 5IWAQ 3HU3A 4KHPM 4A75A 4ZUJA 2D0PA 1STGA 1RIPA 3BDCA 4DV7L 1PH2A 4G4RA 1N77A 3TS2A 4Q7JA 1TTEA 3PMFA 1VQEA 1F77A 3M4OH 4WJ3M 5CGKA 3SHLA 3Q23A 4AKIA 1FVIA 1UE5A 1XYIA 3TWLA 4B3RM 2GVAA 1G8PA 1KLGD 3I04M 3FTFA 5E1FA 3GQ3A 3NWSA 3W1BA 1OIZA 3GPYA 1HQMC 4ITQA 2PNHA 3E9HA 1GUOA 4EQ5A 1I94L 3PO3B 1IYVA 4O2DA 1R5LA 1SNDA 2W82A 4QL5A 5IGGA 4BB9A 2QF7A 2H5XA 4FDBA 4DV3Q 4QHTA 4A3FG 2HCCA 3CPFA 2IHFA 1R9TB 1BF4A 1HRJA 2OXPA 3DM3A 3ZC7B 1TY2A 5JPNC 1MSHA 4PG3A 4JV5Q 2EKKA 1Q39A 1D5ZC 2K0BX 4RA8A 3BZCA 4RAUC 2UU9L 3TRZA 1HH2P 1A6XA 5C3WA 3KSXA 3GRVA 5CBAE 1AZQA 3VYUA 3HOUG 1LACA 2O2LD 4A3JH 4DR7L 4JI6L 1E94E 1RJTA 3T1YM 1XNQM 2N49A 2DUDA 4JI7M 2JZ1A 4GOPA 3CMAA 4OU7A 1KQSA 2XSZA 3ER0A 2EYLA 2EYMA 2CEAA 1UFZA 2AQ2B 2N88A 3BDOA 5EXXA 4AQYL 2CQOA 4NXML 2B2UA 2PQAB 2KENA 4N8FA 1GVNA 2OO9A 1W6JA 3CD6A 3K81C 1YHQA 3HOYH 3HOXG 2B2WC 3RLOA 4A3FH 1II3A 4DV5Q 1QVRA 1DGFA 3A98B 1XMOL 5CV9A 3OTOM 3HOWB 4LZJA 1F4IA 1PZJD 3OSOA 4DV1Q 1EZ8A 5COYA 1PJIA 1V43A 2MH8A 3I4LA 2M60A 5I6WA 1HNWL 4RG1A 3KFUG 2B2VA 4TVAB 1WXQA 4A3BB 1VQFA 3I4NG 3K0YA 1SXJD 3U60A 4X64Q 3HOVG 1B9MA 2KHSA 5HGQA 1DXMA 4TQUS 4A93G 3F92A 4DU9A
chains in the Genus database with same CATH topology
2F0UA 2X69A 2ERCA 4GITA 2WP8J 2PYKA 4G7HC 4JI5M 4OO1H 4ID6A 3ZH9B 3NQTA 2NVTB 4LJ7A 3P1HA 1EY4A 3NXWA 2F0TA 2D62A 1GXDC 5IT9L 4IBJA 1EQTA 1I50B 1B3AA 4H44C 3D3RA 2XGNA 3U6SA 4RCOA 2D7GA 3M85A 1JORA 1SNOA 4M9ZA 5C4JB 2Z4RA 1E2ZA 2JSOA 4X62M 2M5ZA 1TQOA 3KS8A 2RQXA 4WRDA 1XNRM 3SC3A 2A68C 4RF0A 1K82A 4L78A 1Q3BA 3KF8A 3BDLA 3R9XB 1AFPA 1NJFA 3M7GA 5BN4A 2BOSA 5EGTA 1QZMA 1EOTA 1RHPA 1NHWC 3SE0A 1QNKA 2NZ1D 1DGBA 1ET6A 3LX0A 3FRPB 1JR3A 1JOKA 2ZANA 4B3TM 4LF4M 3KUPA 4X65M 1Z59A 5C0XJ 3D4DA 5GKNA 3MAQA 1DOMA 2XVSA 2C98A 5FTKA 1TDHA 4K14A 2WIIB 4U673 1S5DD 4V0BA 3KDSE 3A56A 5BN3A 1D1KA 1JQJC 5BPVA 2IWHA 2CVRA 5E3FA 1JQYD 4I7ZC 4NRVA 1LTBD 1MBYA 1GUNA 4FNFA 1KDBA 1RF2D 3AMUA 1Y1WB 2NN6I 3K6OA 3I91A 1LT5D 5C44B 3V05A 2PW7A 1UEAB 4N9PA 5IWAM 2F4IA 3BYYB 4G7ZC 2NQ8C 5IOCA 4DR3M 3OWEB 1IKLA 1OO9B 3S16B 1V8QA 3DMUA 1TWHB 3L29A 2K05A 1YNND 2CUZA 1SNMA 1TS5A 1DYQA 2I46A 3KLSA 3FYDA 3JAML 2XH9A 2F0GA 1FGBD 3NWLA 4ILWA 1C48A 3FUVA 3BYTB 3OWFA 2EYHA 2HL7A 2BA0A 1DD2A 2K33A 2X49A 3GPUA 2R61A 2UXCM 2LS01 5DM73 3IG8A 1NR4A 4IIWA 4FF4A 1EEFD 1KYIA 4J8QA 1KDCA 1OXUA 4FXKC 5EJWA 5EKIA 5G3LD 2F03A 2Q8RE 3P75A 3AL0C 1EY8A 1XXHA 2BCOA 4KV6A 4H7BA 1AEXA 2K7VA 1U4RA 3MTSA 5KNDA 3QWLA 4KY6A 1YNNC 4KJOA 3SR1A 4XGIA 1N36M 5I9PA 4L8JA 3RFWA 3GLFB 3T13A 4DV5M 3FYCA 1RD9D 2L12A 4DV1M 2EY6A 5M5XB 4LFCM 3OIQA 3FDTA 2HCBA 4L4UA 1BCPB 4QF4A 5H37D 1EWHA 3K7AB 2KZSA 2FFKB 5IODA 1IKMA 3UGJA 2EJGC 1Q3CA 4KHVA 2AQ3B 4KN7C 3KK7A 3ONAB 2EY5A 1BO0A 2Z1CA 3U5ZA 2B8GA 3QJYA 3Q22A 4LZZA 3IFDA 4NXNM 4KODA 2R93B 3GD7A 3DZDA 4RWSC 3J81S 2QBYB 2KA7A 1TWGB 1D5XC 4FWHA 4IUNA 5EXPA 5EPLA 3PFIA 5KPZA 3CHBD 1Z6HA 3AKZA 1J7KA 5F3WA 2ENBA 5E4XA 4J1MA 3MFGA 3BG3A 5EKLA 4REZA 1IY2A 3SAWA 2VQFM 1N75A 1H6UA 2JP1A 1EY7A 2X6GA 3SFZA 5C0XI 3TP7A 2YFQA 2FFJA 1O7LA 3HG9A 2A73B 1CK1A 2L5TA 1V1PA 3HZXA 3PUZA 1ESFA 1H9RA 3DXJC 1AW7A 2A6ED 2B2WA 2DNEA 3IL8A 1OXXK 2L6OA 3SK4A 3QB3A 3K59A 4LRSA 3HWSA 5C4HA 1J8IA 4QUFA 2ICIA 5NUCA 1GHKA 3HHWA 1S3SA 1R4QB 4H13C 2KUMA 4LMQD 3OMCA 2E2JB 1W5TA 3PUYA 2VB3X 5FTLA 1PFBA 3GV3A 5EBCA 1S5BD 2MGSA 4IUQA 1E2WA 4MM3B 2XRSD 5M3MB 4Q0FA 1WTOA 4XTCS 3PIP3 3VDPA 4WW0A 4GHAA 4UAIA 5FKAC 3DA1A 3PIO3 5EBDA 3HOYB 1PTOB 3TWKA 1XXGA 4EQPA 5KYIA 1VF5C 2L4NA 4Z9CB 2E76C 2A6EC 2Z3XA 3UJNA 5G3LF 1IN5A 2ZAMA 4IN3A 4ABNA 5K36H 4BBRB 3GLHB 4KKSA 1R2ZA 2A5YB 1IBMM 5EP1A 5D65A 5KEEA 4KI0A 3SYKA 2E2HB 1QANA 2F0LA 1PZKD 5JI2E 3KOXE 4IZ8A 3TP8A 3D6CA 1T5XD 4LJZC 1PDQA 2YU9B 4R9WA 2MPMA 2XRQD 1XWEA 1SSOA 1U4MA 3VFDA 1OJLA 2F5OA 5I4DA 2M00A 3DWQA 4RKLA 1S4ZA 4XXEA 2AQ1B 4Z8XA 4P16A 2PZUA 2XF3A 2R4JA 3LWUA 1VMPA 3K1JA 4NW2A 3KLRA 1GLNA 1LTAD 3P7JA 2O5IC 1DOLA 4M0WA 1Z5BA 3IAYA 2KOLA 4DR7M 3DFZA 4O1NA 4JI6M 2B63B 1ZQ9A 2P5TA 1UAPA 4B9XA 1LTGD 2F0JA 3FUTA 3MJ5A 1NHGC 5IT9S 2X4AA 1U4PA 2KQ3A 4AQYM 4KD3A 2PCFB 4HTHA 4NXMM 1VDZA 3IKJA 3FVQA 1I4WA 4WORA 1YUBA 3S1MB 4KY5A 4HMJA 2KCNA 2H1EA 1XMOM 2G5GX 4IFDJ 1KTKA 1MI2A 4NRWA 3NWTA 4XIGS 3DOAA 1EY0A 4QNMA 1HNWM 4BY7B 1IYUA 4KMUC 2PNRC 2MJ8A 4TSSA 3N52A 3ND8A 1UNSA 1TS2A 1L2DA 2C99A 5EQTA 2A69D 2ZAOA 1S5ED 5CV5A 1E2VA 3S2HB 3V2TA 3NTKA 2SDFA 2LFNA 3L9AX 5D3DA 1DM0B 4X66M 3GPPA 2EE1A 4JXJA 2RDHA 5EP3A 4MGZE 4LF8M 1JICA 1SYEA 1FJGM 4PMCA 3GP7A 1MD2D 4FF1A 3HOZB 1F2LA 5IGDA 1D2NA 1BCPD 4DAVA 1FR3A 4ME5A 4AG6A 2IPKD 3FEWX 1Q1BA 2RDGA 3A8KE 4DNTB 1BR9A 3JR5A 2PMZB 4AKHA 4M1UB 2CW0D 1BUVT 1HT1E 1QAMA 3ILKA 3G6JB 1PXUA 2NVXB 4EGVA 4G57A 5J1ZA 2ZT9C 3L7ZC 1T5EA 3MXNA 4UDUC 5KRUA 3HEJA 1DJRD 1KDAA 2ZM6M 1AZPA 3I3CA 1ESRA 1M4VA 2Q8IB 4B08A 1CA6A 3MZ5A 4GH9A 4G4QA 2HDMA 3NK9A 5C3XA 1QNUA 1YNJD 1WD0A 2EJMA 4GKJM 2HDLA 5AFWA 3J81L 3HGBA 2CW0C 1JWMD 5C5LA 4EIWA 3JAMS 5DYIA 1O78A 1LTRD 2K47A 1D5MC 1NNUC 3MXPA 1H9KA 3RGSA 1DONA 3LQRA 2DZNB 1HTPA 1OXVA 1Y8PB 1HNZM 3D8GA 1ZYRD 1EZ6A 2WKDA 2Y20A 5IIFA 2RGHA 4IQZA 2QCUA 3U6DA 3E6ZX 3C1FA 5EP2A 1STNA 5IGBA 4RHSA 2EJFC 3WOFA 3GRYA 4NSOB 2UXDM 3TSSA 1E9RA 4HSPA 1EY6A 5JEAH 2A74C 5IGCA 3QOLA 3GLIA 2ZXRA 3GQ4A 1HPCA 2A5HA 3PO2B 5EXSA 5ITTA 1PTOD 3D8BA 3MEHA 4L16A 3QOJA 3KOYE 4B9WA 3RUZA 5F2DA 4K5VA 1EL0A 2JA6B 3EFXD 1X3QA 2RDFA 4C1NK 2V1CA 2Z8LA 4IFDI 5FSWA 3OMGA 1J5EM 5DNYA 1NAPA 5ITUA 3B9PA 3U9SA 1HFNA 3PUWA 4DR5M 2R4EA 3X3MA 2F0SA 1G6ZA 1SEBD 1DGHB 3TE6A 1CZWA 5BN5A 1JC7A 4LG2A 2J7NA 3RE8A 4FF2A 5DAUA 4ZKCB 2O5JC 3KXEC 3SAVA 2XEPA 1DCZA 1EEID 4HMIA 1ENCA 4OO1G 1WCMB 1E32A 4KN4C 3EJIA 4IUUA 1SYCA 2F4VM 3CF2A 1PTOH 4JI2M 3K8ZA 2TSSA 4DN4M 4KTAA 2R6GA 1EY9A 3PUXA 3HHZA 3OW7A 2NTSA 3OIPA 1FYCA 2CHGA 1RTNA 4BBSB 4RKBA 4CGYB 2A6HD 2C5RA 1L0XB 4RGMA 1SAPA 4OHJA 2AWOA 1NY5A 1F9SA 1DOKA 1SJED 5ITXA 3E0JA 4JN6A 2EVBA 5KPTA 4DK1A 3KP1E 5FLXE 1BOSA 1SE2A 2RA4A 4QOSA 3A7LA 3FKEA 4HCEA 1X37A 3T53B 3AOGA 4RNAA 2CQAA 2KCCA 2L9HA 3D8LA 1G41A 4CHTB 3DWAA 1U9RA 4DV2M 5KNCA 4GIPA 1G2SA 3R93A 5EKKA 4JI4M 2SNMA 3NBHA 2XZFA 1HA5A 1SXJC 2IT1A 3E9SA 2BJVA 2EUCA 2V1UA 1TR5A 2RGOA 1XTCD 5E6JA 5KIXA 3BOSA 1OXTA 2FINB 5EP4A 1STBA 1SYFA 3W0FA 3S9WA 1IN4A 2VUMB 5I6YA 3FTCA 4RHRA 4OX9M 1IXZA 4LF9M 1EIHA 4I5SA 3U60B 2SNSA 3FKIB 2WB1B 3NQIA 1G4AE 3R8BA 3SK6A 3GTPB 5FK9C 3HJQA 1I4GA 2KEDA 2CHBD 1TVXA 4CJ0B 1CT1D 3F2UA 4KHZA 1C4QA 4WURA 4X3UA 2F0NA 1B44D 3JR4A 2K32A 4DV4M 2LH0A 1Z6TA 1LV7A 2KEBA 1TH3A 5M5WB 1W6KA 1KSFX 3T38A 1CFMA 3J2PB 2UUBM 4FD2A 3BVMA 4A3MB 4IBIA 1DZ1A 3T56B 3GLGB 2F3WA 2L0CA 3SMSA 1ENAA 1LTSD 5T1GA 2KZUA 4BWGB 1OXSC 3VKGA 4KKUA 1YSYA 1SJHD 3K2LA 3CRLC 1WTRA 2NVQB 4DF7A 7CATA 2BDOA 4PT5A 5ITXE 1NY6A 4IFDH 4ZYSA 1KNAA 3H91A 1LT4D 4L6TB 1PRTB 5CORA 4DGZA 4OIKA 2DVWB 4XT1B 3GTJB 3GLFA 1O7ZA 2EY1A 1EYCA 5C6AA 5D3IB 3MK6A 1I4XA 2XFTA 2R45A 3OPOA 2F0HA 3FUUA 4DXGA 1EYAA 1LTTD 5I9OA 4II7A 1L0YB 4A3KB 1JWSD 2F5QA 4DK0A 1CA5A 1NCVA 1UM8A 1QE6A 1IBKM 4FCVA 1N78A 2QDBA 1TU2B 2VXWA 3J80E 4FCWA 1ONLA 2BA1A 3FTDA 1GL7A 3GO8A 3SDZA 4BA1I 4XDXA 4AG5A 1SYDA 4LGMA 2RVLA 2F0EA 4G7OC 1TDZA 2FJ2A 2DY7A 2CE7A 3LVVA 3H0GB 1B50A 2O5RA 2XLJA 2MUYA 3VK7A 3PVSA 2B2TC 4XQJA 4OW0A 4XQNA 3CKIB 3HGIA 2Y0SB 1V1OA 1ZKOA 4H0LC 3A46A 1JOOA 3L2AA 2OPFA 1AN8A 1GUGA 4X3KA 2D7HA 4A3EB 1XWIA 4K2KA 2J0TD 1EU3A 4KK7A 4I65A 4Y7NB 1WTWA 2E2IB 5ISRA 3A8JE 2FMMA 1MX0A 1FNVA 3OHXC 3FUWA 2KVMA 5CBEE 4KO8A 4QHSA 4EQNA 1LT6D 4YHHM 3CTWB 4HN7A 2K5QA 3U6LA 2B8FA 3UK6A 3VA7A 1A2UA 3H6MA 1DO0A 2FHTA 1F9QA 2K5WA 2M2LA 3VR5A 1B2TA 4JI1M 3I73A 1LO5D 2KXEA 2Z4HA 1L2CA 3DEPA 3EIHA 4NMZA 2TMPA 4IBEA 2Q8TA 2RSOA 1XXHB 2IW3A 2FOIC 4L63B 1TS3A 1E9SA 4RF1A 2WACA 1IBLM 2VB2X 2QCPX 2R18A 1UUPA 3PV0A 1IY1A 4HR7B 1LT3D 2NN6G 3SYLA 3WHLA 4IURA 5LL6S 1ZEQX 2KW0A 5FLXL 3A8IE 3RGPA 3T15A 3AJIB 5K36G 3GQBA 4CJ1B 3V96A 4IBKA 2XSZD 2CHQA 4LJ9A 1N33M 2QEJC 2CV1A 4I4LA 4PQXA 4KY7A 3H3VC 1JB3A 3QWNA 5FTMA 4AW4A 4AYBB 3SXHA 2IL8A 4PD2A 1SNCA 2D9UA 1IL8A 1U4LA 3U6OA 3A55A 2NN6H 1ICWA 5HURA 3RLFA 3VA5A 1MGSA 1E0BA 1TH2A 1IY0A 4R8IA 2BNKA 3TWMA 4QUCA 1SFOB 4HLQA 4QNRA 3C2PA 1TGUA 3NHHA 2EOTA 2K04A 4PV1C 1TWAB 4DV7M 1TIID 1SNQA 2DZOB 1HNXM 1SXJA 4FO2A 4TKOB 4FWDA 4DR6M 1F2YA 1V1PB 3VYSA 1FNUA 3VYTA 4K6LA 4P2CB 3KVWA 4IJFA 3VYRA 4AKGA 1B9NA 1I94M 1WTVA 5ELDA 5FOBB 5C4ZA 3FD9A 5DEHA 1Z47A 3EIEA 2E5LM 4C3HB 1XMQM 2XSCA 3K5NA 2UU9M 3MVVA 1IW7D 1CZGA 1WD1A 3QIAA 3SAUA 5JVH3 4QIWB 2X6LA 2MP1A 1R4PB 1ZXTA 1PRTD 4LJ4A 2DWLA 1Z5AA 3K5OA 4IBBA 1K8MA 1KABA 3PNYA 4PDIA 2B2YC 4OL7A 3S1RB 4DNRB 3KBXA 2LXEA 4CBVA 3U6QA 3GRRA 4DFAA 1Z7TA 1JR3D 3BS1A 2E74C 2ID0A 4RGOS 5DM63 4BA2I 2EY2A 4OGQC 2XNAC 4PMWA 4D80A 4RCNA 1QG7A 2OEOA 2HQEA 2G9HD 1R6BX 3GTLB 2NWGA 1S5CD 1I6HB 3MHBA 1PM5A 4O42A 4X3TA 3U6EA 3VDUA 1QWYA 4AZFA 3U9OA 5I2YA 4IBGA 5KYLA 1PRTC 3J80L 3N6RA 3NBIA 3J7AV 1SNPA 1PFNA 4DUZM 4CISA 2EPBA 2YNMD 1K8OA 2KRKA 2R7ZB 4IBCA 3U61A 2HKJA 1I4QA 4CKCA 1HFGA 1PZID 3HKPA 1O7YA 3E4RA 2KEEA 1HQCA 1T3TA 1PFMA 1RCVD 2IX3A 2L55A 5C0XH 4G4OA 4LCBA 3SATA 2DNCA 4MGIE 3SK5A 3J7AS 1H9SA 1CM9A 2JXMB 2XN9C 5D14A 4FF3A 3VLFB 3I8ZA 3ZYYX 2DHRA 1SXJE 3M6AA 3NTIA 5JI3E 1SMYD 4ZRZA 4EQOA 3TDQA 5A35A 3Q24A 2A69C 4K8JA 4C1NI 2AUJD 3C58A 4K8IA 1GJXA 3D31A 4QB4A 1L1ZA 1JOQA 5BR8M 1IXSB 4I8OA 2IX1A 1R7RA 4OVZB 2BE5D 3HRZC 4A3IB 2C5CA 4YY3M 1OFIA 3HU2A 1STEA 2QENA 3AU7A 5A2QE 1TY0A 3GTMB 1JWUD 1A15A 4NL4H 5T1IA 2F0MA 2YYZA 2AWNA 3W0LB 3KS4A 1IN8A 1EQVA 4HCSA 1BCPC 3MA2B 3ERQA 2NUCA 1CQFA 3R2IA 4IALA 3T4AC 4F88A 3PNVA 3L25A 2XWBB 5JEAG 1QOHA 2J7ZA 3VR3A 2CFOA 1JE4A 3Q6SA 5CV6A 4LAAA 3QO2A 2F0WA 4D81A 2JA5B 3PXGA 1X32A 1Q12A 2F0PA 1Q1EA 1VF7A 1PRTF 5CMDA 2X8AA 3UI2A 4DXFA 3SVMA 3K5MA 1KLUD 3H09A 2DXIA 4M9XA 5ELFA 3J7YW 1XC8A 2EDGA 2Z4IA 1HA6A 1DGHA 2EYJA 1JCKB 4KLNA 1YNJC 3W3AA 2WKCA 2EXZA 5C3EB 4FW9A 2EZVA 4K0KM 2JA8B 1J09A 2JA2A 1ILQA 2R65A 4FWGA 3DHQA 4LGYA 4LF6M 1IQPA 4LF5M 4Z6YA 1FNWA 5FTJA 3KOZE 1Y69U 1IM2A 1GOZA 4L8RC 2QILA 4GHLA 3CF6E 2D5DA 3M7NA 1BNZA 3SHFA 2UXBM 4IUTA 1ZYRC 4LFBM 3TMEA 2NYZD 2L1BA 4C3JB 4MGHA 3QG1A 1QAQA 2H4OA 1XX8A 1CQVA 2NB0A 3GRUA 3NUCA 3M0EA 4DAPA 2K01A 4NSRA 2LMCB 2WINB 2QP9X 1BCPF 2F0FA 4F7XA 2EYOA 4FXGC 2KA6B 1ENFA 2NVYB 1BQQT 3K92A 4DR2M 2L11A 3NP8A 3TPZA 1PTOC 2IJ0A 4A3GB 4G4NA 2K28A 5I2XA 2K1BA 3T16A 3W2DA 3SBJA 2NBFA 1EYDA 4CKEA 1DO2A 4L15A 3A7AB 3RD4A 4DV0M 1STAA 4CJ2C 2UUCM 4ZUIA 1HXYD 1TWCB 2F5PA 3RZOB 4C3HG 3GLIB 4GC5A 4FP5D 4MGKE 2F0KA 4PCZA 2I07B 4LJ6A 5FLXS 4PMBA 2JA7B 2LKVA 1SXTA 3C46A 1IN6A 1Y1VB 4MB7A 2DY8A 3VK8A 3T1HM 1ILPA 4ZQ3A 3RMHA 5CC4A 1HUNA 2WAQB 1KNEA 4DA2A 2V6ZM 1I6VC 1GUWA 2QPAA 4FVMA 3GPXA 5LMUM 1Q90A 1N32M 2A68D 4MIUA 2JEAI 1KFVA 4F87A 2R46A 4HAEA 4C2MB 2WV6D 2Z7JA 2FE8A 4ZLTF 2A6HC 4X3SA 2AUKA 4R7GA 1TS4A 5KQ8A 3VKHA 2B2YA 4RGTA 3KOWE 1PJJA 2RSNA 3KBGA 3KLSX 1Y8NB 3GLGA 1D6EC 2R62A 1PTOF 5LL6X 1HUMA 4R8NA 5EPJA 4LF7M 1I4RA 3R3OA 1STHA 4A3VB 1A3UA 5CV8A 2PZWA 3J7BA 3TL4X 4OIJA 4GRIA 1B53A 3S2DB 2QKIC 2LWXA 3HP3A 1CTMA 1SE4A 5EQ0A 4S3SA 1X3PA 4DUYM 1HQYE 2MHVA 1CI3M 1Q3LA 3AV0A 3KW6A 1W5SA 1F2MA 5ELEA 1KAAA 3NPPA 1ORYB 1BXTA 4HEDA 4IFDG 4B3MM 1TT2A 2ZBKB 2C9OA 3S1QB 3GQ5A 3EVQA 4U68A 3M4YA 2Q2EB 5CV4A 1L2BA 4AI6A 5CR3A 2PQEA 5JVG3 3HU1A 3HKZB 1SYBA 4DR1M 1IN7A 4JYAM 2ZXOA 3NSWA 4LK1C 5A2QL 3AOEC 1G8ZD 1EY5A 4JI0M 2Y0TA 2R92B 2XWJB 4WJWA 1AP0A 3HJ8A 3MC0B 3J27B 2V4DA 1I3QB 1G3IA 2JE6I 4GZYC 3C1EA 1TKWB 4N9TA 5TSSA 3TZDA 4D82A 4BBAA 3WOEA 3EQLC 2DWZB 3TP6A 2J4XA 4WFN3 3TQSA 2F0QA 2L09A 3D4RA 3DEOA 1M8AA 1JR0D 1VCIA 3SK8A 3KP0E 4E6IA 3J80S 4B7HA 3DWPA 4IBFA 3TBIB 3Q8XA 2XIWA 1O80A 2F0DA 3VR4A 4QOZC 1B1ZA 5C5MA 3GP1A 1SDFA 1RKNA 3J7AF 5JOBA 3BVGA 2FMCA 2R3ZA 3ITPA 3WHKA 3MXUA 4TUWA 4DV3M 5DYGA 2EO2A 1GL6A 2D7EA 4JV5M 3HJSA 2KJXA 4G6ZA 4KKTA 2QBYA 5IGEA 3S17B 3I70A 5IZ7D 2ZXPA 4LJAA 3SMPA 2XZUA 3URYA 5KNBA 3CU7A 1HQRD 2K5DA 5FO8B 2Y0QA 2F5SA 1TWFB 1LV9A 5JJZA 4C3JG 3SEBA 5JEAJ 3TP5A 2F5NA 2F1MA 3VR2A 5EPKA 5DNFA 2KECA 2E2DC 1I4HA 1NVMA 1N34M 3LNNA 2HCIA 3I90A 1BDOA 2PPBC 3LVWA 2VNUD 2L7HA 1GKIA 1R2YA 1RODA 2M9VA 1TH4A 4BS9A 4B7FA 4RFBA 3R8FA 2F0VA 4X64M 1F9RA 5JPMC 3GTQB 1EWCA 5CYUA 2HUGA 2C9CA 2QZ4A 1A2TA 1NNJA 1CHQD 1H9JA 3I4MB 2F3VA 5LHY1 2ICEC 4LFAM 4ZKBB 4HL4A 1VDDA 5LMNM 1G291 5EJCA 4A3DB 3HHXA 4LRTA 4RGNA 2LY7A 3MXGA 4YIJA 3WDNA 2BJWA 1XHBA 3I51A 1D2BA 8CATA 1HHVA 2L7IA 3C3LA 3GLHA 3J81E 1GHJA 3FPUB 5ITRA 4JI3M 3M4OB 2VIIA 2PZTA 4C3IB 2Y21A 5C18A 3FUXA 1D1IA 3K58A 4IBDA 2RKOA 2EYPA 4XYQA 3U6PA 3Q0AA 5C4XB 5EXTA 2RBMA 4QCLA 4XBOA 3NE5B 3CRKC 1WTPA 4NOOB 2OF1A 1SYGA 4G4KA 2PO4A 3U6CA 1EE8A 3TN2A 5IGFA 3U5ZB 5C1BA 4Q5VA 4F8MA 2UUAM 2K6AA 1A3TA 3FTEA 1NR2A 3L28A 3I4YA 1S5FD 4IUPA 2CV0A 1I4PA 2FNAA 4A3JB 4W5WA 3S14B 4FYDA 2IX0A 3D6WA 2D2CC 5ITYA 3THGA 1WTQA 4C56C 1WVLA 2DWNA 4NKLA 2EYFA 5M9OA 3UMMA 4MHEA 4IJEA 2G9DA 4DAYA 5J39A 2OQ4A 4A3FB 5J22A 1G2TA 1LTID 2B2UC 2HHHM 1QYRA 5FO7B 5KPRA 3K5LA 2PW5A 5JAVA 3HOUB 4K6DA 4JBWA 3HHYA 1L1TA 2XFSA 4RH6A 2B2VC 1LLRD 3L3OC 3GO5A 2BDNA 1FNNA 1C1KA 1ZAEA 3NTHA 1J9OA 4LJ5A 1MSGA 1Y8OB 3HOXB 2Z4SA 1BBXC 3O13A 1QQWA 4ULLA 4XQQA 3S1NB 4LY6A 3A42A 3QAUA 1NJGA 4B7GA 4PDGA 3GTOB 4NP5A 1FD7D 2J7OA 4XT3B 3I4NB 3CF0A 3HOVB 3MFYA 3H4MA 4A93B 4EVOA 1MU5A 2OT2A 3SARA 3AOEA 1QCBD 1PYWD 3G7LA 5C0XG 1SXJB 3GTKB 2N55A 3IG5A 1IW7C 5KQDA 2RKSA 4DV6M 4M9SA 4JI8M 1L8QA 2SOBA 5IT9E 4XYOA 5ELCA 3RZDB 4OVZA 4DR4M 4M0DA 2LNHC 5KGUA 2F0IA 2DN8A 1HCZA 4TRDA 3U6MA 1GUTA 4ZK9B 1PLFA 4CKBA 4FXDA 4V190 3S15B 2E75C 3KSJA 2K03A 1Z5CA 3EROA 1HT2E 5ITQA 3FPPA 5M3FB 4K2LA 5K5PA 1NSFA 2EA0A 4B3SM 2KRUA 3LQQA 3AB9A 1GUSA 1NSNS 4ZPXA 3HS0C 3D4WA 3TZUA 3A45A 3X3NA 3E5SA 3BZDB 1IXRC 1WTXA 4NDXA 4HSVA 1F9PA 1IHZA 4BY1B 3BVZA 5CV7A 4K5XA 4ZAIA 5M5YB 5A2QS 3H94A 4OO1I 4ODGA 1C8CA 2VQEM 1LABA 3SHGB 3I72A 1QJOA 4M8AA 3GV6A 3R2TA 3AFHA 1G91A 4MH0E 2H1RA 2CV2A 2B2TA 4JK1C 1B4OA 5ELBA 3LWEA 1H9MA 2G8LA 4K5WA 1EFID 3K57A 1DGGA 1F2ZA 1YE9A 5E26A 3A54A 3IFTA 1A3VA 4I81A 3CQZB 5FTNA 1K83B 5IREB 1OFHA 1SBBB 2JEBI 4FCTA 1EU4A 1PMRA 2AHMA 2JYOA 3P20A 1ET9A 2B39A 4KJNA 3PUVA 1SMYC 4GKKM 1CHPD 2GA4B 4GMQA 3MWYW 3UZUA 5E4WC 4LJ8A 1G59A 3U61B 4MN3A 1RDPD 1ML0D 2C96A 1HR0M 2BE5C 3L27A 1QILA 5FO9B 2F0OA 3OOCA 1Q8IA 3LMMA 1H9SB 4IUVA 1STYA 2YQZA 3DUZA 1SE3A 4S12A 1VMCA 4C3IG 1HTLD 4MGYE 3I4VA 5KO3A 4PNYA 2YR0A 3SASA 3ND9A 3JAME 4R3DA 4KD4A 2O4XA 4QMGA 1K3XA 1QB5D 1RTOA 2I7PA 4J6HA 3M3YB 4GC9A 3FMCA 3T51B 1QAOA 3DM1A 4BLCA 3ZCBB 5HGTA 3GTGB 2NTTA 1K3WA 1EIGA 2CHVA 3L26A 2DWMA 2I7NA 1NUCA 3MHVC 3VR6A 3EA6A 2SEBD 3HU3A 4KHPM 4ZUJA 1STGA 3BDCA 4G4RA 1N77A 3PMFA 1F77A 5CGKA 3SHLA 3Q23A 4AKIA 1XYIA 3TWLA 4B3RM 1G8PA 1KLGD 5E1FA 3FTFA 3GQ3A 3NWSA 1HQMC 3GPYA 4ITQA 1GUOA 3PO3B 1IYVA 1SNDA 2W82A 5IGGA 4BB9A 2QF7A 1BF4A 4QHTA 2HCCA 1R9TB 1HRJA 2OXPA 3ZC7B 1TY2A 5JPNC 1MSHA 1D5ZC 1Q39A 4RA8A 4RAUC 1A6XA 5C3WA 3KSXA 3GRVA 5CBAE 1AZQA 3VYUA 1LACA 2O2LD 1E94E 1RJTA 3T1YM 1XNQM 4JI7M 4OU7A 2XSZA 2EYLA 2EYMA 2CEAA 2AQ2B 2N88A 3BDOA 5EXXA 2B2UA 1GVNA 1W6JA 2B2WC 1II3A 1QVRA 1DGFA 3A98B 5CV9A 3OTOM 3HOWB 4LZJA 1PZJD 3OSOA 1EZ8A 5COYA 1PJIA 1V43A 3I4LA 2M60A 5I6WA 3KFUG 2B2VA 4A3BB 1WXQA 3K0YA 1SXJD 3U60A 1B9MA 2KHSA 1DXMA 4TQUS 4DU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBI A;  4CHT B;  4CGY B; 
#chains in the Genus database with same CATH topology
 2F0U A;  2X69 A;  2ERC A;  4GIT A;  2WP8 J;  2PYK A;  4G7H C;  4JI5 M;  4G3O A;  4OO1 H;  3NEL A;  4ID6 A;  3ZH9 B;  3NQT A;  5LMN W;  2NVT B;  1PH7 A;  4LJ7 A;  3P1H A;  1ASY A;  1EY4 A;  3NXW A;  1KL9 A;  1WR1 B;  3UE0 A;  2F0T A;  2D62 A;  1GXD C;  1AE3 A;  1UE7 A;  1FJG L;  1GJT A;  5IT9 L;  4IBJ A;  3ULL A;  3S1N H;  1EQT A;  1EIJ A;  1I50 B;  4CDE C;  4JBK A;  1B3A A;  3E21 A;  1VQD A;  4H44 C;  3D3R A;  3GTO H;  4OEL B;  2XGN A;  3U6S A;  4RCO A;  2D7G A;  3M85 A;  5FLX c;  1PH1 A;  1YBY A;  1JOR A;  1SNO A;  4N8X 1;  3HOV H;  4GN4 B;  4M9Z A;  5C4J B;  2Z4R A;  1E2Z A;  2VQF Q;  2JSO A;  4X62 M;  2M5Z A;  1TQO A;  4CJ6 A;  2B63 H;  3KS8 A;  3SGI A;  2Q2I A;  1W3S A;  4L5T A;  1K8G A;  2RQX A;  4WRD A;  2GNO A;  1XNR M;  3SC3 A;  2A68 C;  4RF0 A;  2MQH A;  1K82 A;  4L78 A;  1Q3B A;  4PZ6 A;  3KF8 A;  3BDL A;  3R9X B;  1AFP A;  2UUA Q;  1NJF A;  3M7G A;  5BN4 A;  2BOS A;  5EGT A;  1QZM A;  2ZM6 L;  1EOT A;  3S1M H;  1RHP A;  1NHW C;  4GNX B;  3SE0 A;  3Q8D A;  1QNK A;  2NZ1 D;  3RZD H;  3M9B A;  1DGB A;  1ET6 A;  3LX0 A;  3FRP B;  4DNI A;  2BWE A;  1JR3 A;  1JOK A;  2ZAN A;  4B3T M;  4LF4 M;  2JNH A;  4BY7 H;  1RL2 A;  3KUP A;  5IP7 G;  4X65 M;  4GKJ L;  1Z59 A;  5C0X J;  3D4D A;  5GKN A;  3MAQ A;  1DOM A;  2XVS A;  1XPO A;  4AIM A;  2C98 A;  1IXR A;  5M3F H;  5FTK A;  3H15 A;  1TDH A;  4K14 A;  2WII B;  4U67 3;  1S5D D;  4V0B A;  3KDS E;  3A56 A;  5BN3 A;  1D1K A;  1JQJ C;  1QUS A;  5BPV A;  1N9W A;  2CVR A;  2ZTD A;  1PJT A;  5E3F A;  2IWH A;  1HNZ L;  1JQY D;  4I7Z C;  4NRV A;  1LTB D;  1MBY A;  3H3V I;  1GUN A;  4P74 A;  4FNF A;  1KDB A;  1RF2 D;  3AMU A;  1Y1W B;  1NMG A;  2NN6 I;  1IBM Q;  1X55 A;  4BY1 H;  3K6O A;  3HOZ H;  3I91 A;  1LT5 D;  5M5Y H;  5C44 B;  3V05 A;  2PW7 A;  1UEA B;  4N9P A;  5IWA M;  2JA5 G;  2F4I A;  3I01 M;  3BYY B;  3K80 C;  5IP7 H;  2NQ8 C;  4G7Z C;  2MJ5 B;  5IOC A;  4DR3 M;  3OWE B;  1IKL A;  1OO9 B;  2WB1 E;  2LVN C;  3LCV B;  3S16 B;  3ERS X;  2DAK A;  1V8Q A;  3DMU A;  1TWH B;  3L29 A;  2K05 A;  1YNN D;  2CUZ A;  1SNM A;  1TS5 A;  1DYQ A;  2I46 A;  3KLS A;  3FYD A;  3GDE A;  4YCW A;  3JAM L;  2XH9 A;  2F0G A;  1FGB D;  1QUT A;  3NWL A;  4ILW A;  4YCU A;  1C48 A;  3FUV A;  3BYT B;  3OWF A;  2EYH A;  2HL7 A;  2BA0 A;  4KLK A;  1DD2 A;  2K33 A;  2X49 A;  3GPU A;  2R61 A;  2UXC M;  2LS0 1;  5DM7 3;  1J5E L;  3CP0 A;  1X3F A;  1ZMU A;  3IG8 A;  3GLG E;  1NR4 A;  4IIW A;  4FF4 A;  5ELN A;  4DR5 L;  1EEF D;  1KYI A;  4J8Q A;  1KDC A;  3K8A A;  1OXU A;  4FXK C;  5EJW A;  5EKI A;  2RCN A;  1IZ6 A;  5G3L D;  2F03 A;  2Q8R E;  1U5K A;  3AL0 C;  3P75 A;  1EY8 A;  1XXH A;  2BCO A;  4DV6 Q;  4KV6 A;  4H7B A;  1AEX A;  2K7V A;  1U4R A;  3MTS A;  5KND A;  4CDC C;  3J80 c;  1GM5 A;  3QWL A;  4KY6 A;  1YNN C;  4DR4 Q;  1XMO Q;  4OWW B;  2VDB B;  4KJO A;  3SR1 A;  4XGI A;  1N36 M;  5I9P A;  2CH4 W;  4L8J A;  4ALP A;  4O0A A;  3RFW A;  1EQQ A;  1JJG A;  3GLF B;  3T13 A;  4DV5 M;  1V9P A;  4HJ8 A;  3FYC A;  4DV0 L;  1RD9 D;  2L12 A;  4JI2 L;  3M3Y H;  1HNW Q;  1QDT A;  4DV1 M;  2EY6 A;  3PO3 G;  5M5X B;  4LFC M;  3OIQ A;  3FDT A;  3GTG H;  2HCB A;  1JR3 E;  4L4U A;  1BCP B;  4QF4 A;  5H37 D;  1WYD A;  4PZ7 A;  4JC0 A;  4A3G G;  1EWH A;  4I7A A;  3K7A B;  4HJA A;  2KZS A;  2FFK B;  5IOD A;  1IKM A;  3UGJ A;  2EJG C;  5IY0 A;  1Q3C A;  3L2P A;  4KHV A;  2AQ3 B;  4KN7 C;  1WJJ A;  3KK7 A;  2EY5 A;  3ONA B;  1BO0 A;  4X66 Q;  1PJQ A;  2Z1C A;  1QVC A;  3AFQ A;  3U5Z A;  2OTJ A;  2B8G A;  3QJY A;  1L1O B;  1OQY A;  3Q22 A;  4LZZ A;  4LF8 Q;  3PO2 H;  3IFD A;  1V33 A;  2ZTC A;  3KLW A;  1D0M A;  3PF5 A;  2KCT A;  4NXN M;  2FS1 A;  4KOD A;  2R93 B;  3GD7 A;  3DZD A;  1Q8K A;  4RWS C;  3J81 S;  2QBY B;  2KA7 A;  1TWG B;  1D5X C;  4FWH A;  4IUN A;  5EXP A;  5EPL A;  3DLL A;  3PFI A;  1YLA A;  5KPZ A;  3CHB D;  1Z6H A;  3AKZ A;  1J7K A;  5LMU L;  5F3W A;  2ENB A;  5E4X A;  2Y0S E;  4J1M A;  1VQC A;  1E24 A;  1N32 L;  3MFG A;  3BG3 A;  3HOW G;  5EKL A;  4REZ A;  4R71 A;  1IY2 A;  3SAW A;  3U58 A;  2VQF M;  1NV9 A;  1N75 A;  4AH6 A;  1H6U A;  2JP1 A;  1EY7 A;  2X6G A;  3SFZ A;  5C0X I;  4A3B G;  4JI4 L;  3TP7 A;  2YFQ A;  2FFJ A;  1O7L A;  3M4Q A;  3HG9 A;  2N8N A;  2A73 B;  2CH4 A;  1CK1 A;  4POG A;  3FHW A;  2L5T A;  1V1P A;  3HZX A;  3PUZ A;  1ESF A;  1H9R A;  3DXJ C;  1AW7 A;  2A6E D;  2B2W A;  2DNE A;  3IL8 A;  1D0K A;  1OXX K;  2L6O A;  3SK4 A;  5IYC H;  4GKK Q;  2DNA A;  3QB3 A;  3CCL A;  3K59 A;  4LRS A;  3HWS A;  1IFY A;  5C4H A;  1PH3 A;  1J8I A;  4QUF A;  2ICI A;  5NUC A;  1GHK A;  3HHW A;  1HR0 W;  3STB C;  1S3S A;  1R4Q B;  4H13 C;  5HY6 A;  4OX9 L;  1QDR A;  1R4G A;  2KUM A;  4LMQ D;  4LF9 L;  3OMC A;  2E2J B;  1W5T A;  1CKM A;  4GKJ Q;  3PUY A;  2VB3 X;  5FTL A;  4DK3 C;  1PFB A;  3GV3 A;  5EBC A;  1S5B D;  2EQS A;  2K5N A;  2MGS A;  4IUQ A;  1ZV1 A;  1E2W A;  4MM3 B;  1EFU B;  2XRS D;  5M3M B;  2DGY A;  4Q0F A;  1WTO A;  4XTC S;  3PIP 3;  3VDP A;  3H3V H;  2DAE A;  4WW0 A;  4GHA A;  1XXH E;  4UAI A;  5FKA C;  3DA1 A;  3PIO 3;  5EBD A;  3HOY B;  1X6O A;  1PTO B;  2JY7 A;  3TWK A;  3KFU A;  1XXG A;  1V92 A;  4EQP A;  2G3Q A;  5KYI A;  1VF5 C;  2L4N A;  1S3O A;  4Z9C B;  4DV4 L;  4NB3 A;  2E76 C;  2A6E C;  1VEK A;  2Z3X A;  1PH9 A;  3UJN A;  5G3L F;  1IN5 A;  4DPG A;  2Q2U A;  2ZAM A;  4IN3 A;  4ABN A;  2NVT H;  5K36 H;  4BBR B;  2UUB L;  3GLH B;  2R6F A;  4KKS A;  1R2Z A;  3OW2 A;  2G5D A;  1PYS B;  3B7Z A;  2A5Y B;  1IBM M;  3I56 A;  1Y8G A;  5EP1 A;  5D65 A;  1NV8 A;  1SG9 A;  5KEE A;  4KI0 A;  2UXD Q;  2HT1 A;  4KHP Q;  3SYK A;  2E2H B;  2HIX A;  1QAN A;  2F0L A;  2VZA A;  2RCF A;  1PZK D;  5JI2 E;  3KOX E;  4IZ8 A;  3TP8 A;  3D6C A;  1T5X D;  4LJZ C;  1PDQ A;  2YU9 B;  4R9W A;  2MPM A;  2XRQ D;  1XWE A;  1SSO A;  1U4M A;  3VFD A;  2Z6B A;  1OJL A;  2F5O A;  4AYB E;  5I4D A;  2LXK A;  4B3R Q;  2M00 A;  3DWQ A;  1NO1 A;  1Z9F A;  4RKL A;  1S4Z A;  1H95 A;  4XXE A;  2AQ1 B;  4Z8X A;  4P16 A;  2PZU A;  2XF3 A;  2R4J A;  3LWU A;  1VMP A;  3K1J A;  4NW2 A;  3KLR A;  1GLN A;  1LTA D;  3P7J A;  2L15 A;  2O5I C;  1DOL A;  2LVA A;  4A3C H;  4L5S A;  2VUM H;  4M0W A;  1Z5B A;  3IAY A;  2KOL A;  1B3Q A;  4DR7 M;  3DFZ A;  4O1N A;  4JI6 M;  4IJH A;  2B63 B;  1ZQ9 A;  1Y1W G;  1P3Q Q;  4DAY B;  2P5T A;  1UAP A;  3T1Y Q;  3G48 A;  4B9X A;  5C44 G;  1HZ9 A;  4JI7 Q;  1LTG D;  2F0J A;  3FUT A;  3MJ5 A;  1NHG C;  5IT9 S;  2X4A A;  1U4P A;  2KQ3 A;  4AQY M;  4KD3 A;  3GTP H;  2PCF B;  4HTH A;  4NXM M;  3UE1 A;  1SN8 A;  1PH5 A;  1VDZ A;  3HX3 A;  5AJ3 L;  2APL A;  3IKJ A;  3FVQ A;  1I4W A;  1LM0 A;  4WOR A;  1YUB A;  3S1M B;  4KY5 A;  3W1G A;  3BJU A;  1IXS A;  4OEM B;  4HMJ A;  2KCN A;  2H1E A;  1XMO M;  2G5G X;  1SMX A;  2F4V Q;  4IFD J;  1KTK A;  3KDF B;  1MI2 A;  4JI2 Q;  4NRW A;  3OTO Q;  3NWT A;  4XIG S;  1EFW A;  3DOA A;  1VQO A;  3QYB A;  1EY0 A;  4QNM A;  1HNW M;  4BY7 B;  1IYU A;  4KMU C;  2PNR C;  2MJ8 A;  1K0R A;  3N52 A;  3NBX X;  3ND8 A;  4TSS A;  1UNS A;  1TS2 A;  1L2D A;  1D8L A;  2C99 A;  5EQT A;  2A69 D;  2ZAO A;  2YTX A;  1S5E D;  5CV5 A;  1E2V A;  3S2H B;  3V2T A;  3F2D A;  2ES2 A;  3C3E A;  4R4I A;  3AQQ A;  1NTG A;  2SDF A;  3NTK A;  2LFN A;  3L9A X;  4QIW E;  1DM0 B;  5D3D A;  4X66 M;  3GPP A;  2EE1 A;  4JXJ A;  2RDH A;  5EP3 A;  1N34 L;  4MGZ E;  4DK6 C;  4LF8 M;  1JIC A;  1SYE A;  1FJG M;  4PMC A;  2A19 A;  3GP7 A;  1MD2 D;  3E0E A;  5DLQ E;  4FF1 A;  1N8R C;  4P17 A;  3HOZ B;  3I55 A;  3GTJ H;  1F2L A;  3CW2 C;  2BH2 A;  5IGD A;  1D2N A;  1BCP D;  4DAV A;  1FR3 A;  4YHH L;  4ME5 A;  4AG6 A;  2IPK D;  3FEW X;  4YCV A;  1Q1B A;  2RDG A;  3A8K E;  4DNT B;  2DJG C;  4DV2 Q;  1BR9 A;  1S40 A;  3JR5 A;  2PMZ B;  4AKH A;  4M1U B;  2CW0 D;  1BUV T;  4A3K H;  1HT1 E;  4R4T A;  1QAM A;  3ILK A;  3G6J B;  1PXU A;  2NVX B;  2O01 F;  4EGV A;  4Y28 F;  4G57 A;  2ZT9 C;  5J1Z A;  5DFL A;  5LMN L;  3L7Z C;  1XNR Q;  1IBL L;  1T5E A;  2XGT A;  3MXN A;  4UDU C;  1OTR A;  5KRU A;  3HEJ A;  1DJR D;  1KDA A;  1EIF A;  2ZM6 M;  1AZP A;  3I3C A;  1ESR A;  1M4V A;  2Q8I B;  4B08 A;  1CA6 A;  2QHO B;  3MZ5 A;  4GH9 A;  4G4Q A;  2HDM A;  3NK9 A;  1VQ9 A;  5C3X A;  3H0G H;  4OX9 Q;  4LF9 Q;  2R93 G;  1QNU A;  1YNJ D;  1WD0 A;  2HWJ A;  2EJM A;  2OTL A;  3KF6 B;  4B3T Q;  4GKJ M;  1YIT A;  2NZO A;  2HDL A;  5AFW A;  3J81 L;  3HGB A;  1T43 A;  4X65 Q;  2CW0 C;  1JWM D;  5C5L A;  4EIW A;  3JAM S;  5DYI A;  1O78 A;  1LTR D;  2K5V A;  5J3B A;  2K47 A;  3K7A H;  1D5M C;  1NNU C;  3MXP A;  1C7Y A;  1H9K A;  3RGS A;  2K50 A;  1VQP A;  1DON A;  3LQR A;  2DZN B;  1HTP A;  3PSI A;  1OXV A;  4DV4 Q;  4Y7N H;  1Y8P B;  1HNZ M;  2E2I H;  3D8G A;  1ZYR D;  1EZ6 A;  2WKD A;  5L8R F;  2Y20 A;  4R4O A;  2UUB Q;  1M90 C;  5IIF A;  4LUO A;  2RGH A;  3ULP A;  1Q81 C;  1YZ6 A;  4IQZ A;  2QCU A;  1WHC A;  3U6D A;  3E6Z X;  3C1F A;  5EP2 A;  1STN A;  5IGB A;  4RHS A;  1TWG H;  2EJF C;  3WOF A;  3GRY A;  4NSO B;  2UXD M;  3TSS A;  1E9R A;  4HSP A;  1PH4 A;  1EY6 A;  4RMF A;  5JEA H;  4DR3 Q;  2A74 C;  5IGC A;  4A3J G;  4IJL A;  3QOL A;  3GLI A;  1CKN B;  2ZXR A;  3GQ4 A;  1HPC A;  2A5H A;  1HNX L;  3PO2 B;  5EXS A;  5ITT A;  1PTO D;  3D8B A;  4DR6 L;  3MEH A;  4L16 A;  3QOJ A;  2BWB A;  3KOY E;  4B9W A;  3RUZ A;  4UP8 A;  3LCU A;  5F2D A;  4K5V A;  1EL0 A;  2JA6 B;  3EFX D;  2DI0 A;  1X3Q A;  2RDF A;  2KHI A;  4C1N K;  2V1C A;  2Z8L A;  3HOY G;  4IFD I;  5FSW A;  3OMG A;  1J5E M;  5DNY A;  2QW7 A;  1NAP A;  2E5L L;  2UXC Q;  2HIV A;  5ITU A;  1OIP A;  4HJ9 A;  3B9P A;  3U9S A;  1XMQ L;  1HFN A;  3PUW A;  4DR5 M;  2R4E A;  1CUK A;  1SR3 A;  2MNA A;  3X3M A;  1IBK Q;  3AYH B;  2F0S A;  4BBR G;  1G6Z A;  1SEB D;  1DGH B;  3TE6 A;  1CZW A;  4IO9 A;  5BN5 A;  1JC7 A;  4LG2 A;  2J7N A;  3RE8 A;  4FF2 A;  1QUQ B;  5DAU A;  4ZKC B;  2E2J H;  4IPC A;  3KXE C;  2O5J C;  3SAV A;  5AJ3 Q;  5EAY A;  1TXY A;  2XEP A;  1DCZ A;  2RHS B;  4YWK A;  1K9M C;  1EEI D;  4HMI A;  5M3M H;  1ENC A;  4OO1 G;  1JB7 A;  1WCM B;  1E32 A;  4EX5 A;  4KN4 C;  3EJI A;  4APV A;  1N36 Q;  4IUU A;  2R7D A;  1SYC A;  2F4V M;  3CF2 A;  1PTO H;  4JI2 M;  3A5Z B;  3K8Z A;  2TSS A;  4DN4 M;  4KTA A;  2R6G A;  3CC4 A;  4P75 A;  1BBU A;  1EY9 A;  3PUX A;  5H1S E;  3HHZ A;  3IRB A;  3OW7 A;  2NTS A;  2WSF F;  3OIP A;  1FYC A;  2EKF A;  4LFC Q;  2CHG A;  1RTN A;  4BBR H;  4BBS B;  2CKZ B;  2CWP A;  4RKB A;  4CGY B;  2A6H D;  4P72 A;  2RF4 A;  2C5R A;  1L0X B;  4RGM A;  1SAP A;  3C9P A;  4OHJ A;  4JI8 L;  2AWO A;  1NY5 A;  1TWA H;  1AIP C;  2E2H H;  1F9S A;  1DOK A;  1SJE D;  2E8G A;  5ITX A;  2B63 G;  2QDL A;  4JN6 A;  3E0J A;  2EVB A;  5KPT A;  2YU9 H;  4DK1 A;  1VQH A;  3KP1 E;  3FP9 A;  4JOI C;  5FLX E;  1BOS A;  2GQF A;  4DUZ L;  4NXN Q;  1SE2 A;  2RA4 A;  4QOS A;  3A7L A;  3FKE A;  2FH0 A;  4HCE A;  1X37 A;  3T53 B;  1X54 A;  3AOG A;  4RNA A;  2B3G A;  2K5H A;  2CQA A;  4NC6 A;  2KCC A;  2JY8 A;  1KXL A;  2L9H A;  3D8L A;  1G41 A;  4B3S L;  4CHT B;  4JI1 Q;  1WI5 A;  4C3H H;  3DWA A;  1U9R A;  4DV2 M;  5KNC A;  4GOP B;  4GIP A;  1G2S A;  3R93 A;  5EKK A;  4BY7 G;  1CKO A;  1PFS A;  4JI4 M;  2SNM A;  3NBH A;  2XZF A;  3GLI E;  1OKS A;  1HA5 A;  1SXJ C;  2IT1 A;  3UDF A;  3E9S A;  2BJV A;  5FLM H;  2EUC A;  2V1U A;  1TR5 A;  2RGO A;  5M3F G;  1XTC D;  5E6J A;  5KIX A;  5BR8 L;  3BOS A;  1OXT A;  2FIN B;  5EP4 A;  1STB A;  1SYF A;  1W2B A;  3W0F A;  1T6O A;  3S1R H;  3S9W A;  1IN4 A;  4YY3 L;  2VUM B;  5I6Y A;  4WJ4 A;  3FTC A;  4RHR A;  4OX9 M;  1N33 Q;  2WAQ E;  1IXZ A;  4LF9 M;  3K7U C;  1EIH A;  4I5S A;  4BY1 G;  3U60 B;  2SNS A;  3FKI B;  3HOZ G;  2WB1 B;  3NQI A;  1G4A E;  4OWT B;  3R8B A;  3SK6 A;  3GTP B;  5FK9 C;  3HJQ A;  1I4G A;  1VQG A;  3K9P A;  5GAG C;  2KED A;  2CHB D;  1WGN A;  1TVX A;  4CJ0 B;  4L5Q A;  3G4S A;  1CT1 D;  3F2U A;  4JBJ A;  4KHZ A;  1C4Q A;  4WUR A;  1PYB A;  3S2H H;  4X3U A;  2L4F A;  1B44 D;  1LUZ A;  3JR4 A;  2F0N A;  1TF0 B;  4DV4 M;  2LH0 A;  2LVP C;  2K32 A;  3ZJY C;  1Z6T A;  1LV7 A;  3I4O A;  4YWM A;  2KEB A;  4GN5 A;  1TH3 A;  5M5W B;  1W6K A;  1KSF X;  3T38 A;  1CFM A;  3J2P B;  2UUB M;  2F3I A;  4FD2 A;  3BVM A;  4A3M B;  1HR0 L;  4IBI A;  1DZ1 A;  3T56 B;  2R7Z H;  1VQ7 A;  1VG5 A;  3GLG B;  2F3W A;  2K14 A;  2L0C A;  3SMS A;  1ENA A;  1LTS D;  1LYL A;  3A0J A;  3E3X A;  5T1G A;  2KZU A;  2R44 A;  2C35 B;  1EUJ A;  4BWG B;  4DV7 Q;  1ASZ A;  1OXS C;  2DKL A;  3VKG A;  4KKU A;  1YSY A;  1SJH D;  3K2L A;  3CRL C;  1WTR A;  4DR6 Q;  2NVQ B;  4DF7 A;  7CAT A;  2BDO A;  4K0K L;  2VF7 A;  4PT5 A;  5ITX E;  1NY6 A;  4UHV A;  4LF6 L;  4ZYS A;  4IFD H;  1KNA A;  3H91 A;  1LT4 D;  4L6T B;  1A62 A;  1PRT B;  5COR A;  3RN5 A;  4LF5 L;  4DGZ A;  4OIK A;  2NVX H;  2DVW B;  3CCQ A;  1I94 Q;  5GAE C;  4XT1 B;  3GTJ B;  3GLF A;  1O7Z A;  2EY1 A;  3T6P A;  1NNX A;  1EYC A;  4GLV B;  3JC6 6;  5C6A A;  5D3I B;  3MK6 A;  1I4X A;  4P73 A;  2XFT A;  2R45 A;  1BKB A;  2KBN A;  3OPO A;  4A3I H;  1SLJ A;  2F0H A;  2UXB L;  1UWV A;  3FUU A;  1GO3 E;  4IPH A;  4POF A;  4DXG A;  1EYA A;  3B6Y A;  1LTT D;  2KCM A;  2UU9 Q;  3HKZ E;  2WFW A;  4LFB L;  5I9O A;  4II7 A;  1L0Y B;  4A3K B;  1JWS D;  2F5Q A;  4DK0 A;  1CA5 A;  3CCE A;  1NCV A;  1UM8 A;  4DR7 Q;  1QE6 A;  4JI6 Q;  1IBK M;  4FCV A;  1N78 A;  2QDB A;  4ANR A;  1TU2 B;  1SE8 A;  2VXW A;  3JAM i;  3J80 E;  4FCW A;  1ONL A;  3AEV A;  2BA1 A;  3FTD A;  1GL7 A;  3GO8 A;  4AQY Q;  3SDZ A;  4BA1 I;  4XDX A;  4AG5 A;  1SYD A;  1QZE A;  4LGM A;  2RVL A;  1PHJ A;  4NXM Q;  2F0E A;  4G7O C;  1TDZ A;  4JG2 A;  2FJ2 A;  4P71 A;  2DY7 A;  1E3P A;  2AMC B;  4DR2 L;  4DBG B;  1Q02 A;  2CE7 A;  3PO2 G;  3BXW A;  2OCE A;  3LVV A;  3H0G B;  1B50 A;  2O5R A;  2XLJ A;  2MUY A;  3VK7 A;  3PVS A;  2B2T C;  4XQJ A;  4OW0 A;  4XQN A;  3CKI B;  3HGI A;  2Y0S B;  1HZC A;  1V1O A;  2EIF A;  1ZKO A;  4H0L C;  2UUC L;  3A46 A;  2JA9 A;  1JOO A;  1V34 A;  2LBC A;  3L2A A;  2OPF A;  1MIU A;  1UE6 A;  1AN8 A;  4A3L H;  2KHH A;  1GUG A;  4X3K A;  2D7H A;  4A3E B;  1XWI A;  4K2K A;  2J0T D;  1EU3 A;  4KK7 A;  4I65 A;  2JY5 A;  5C3E H;  4Y7N B;  1WTW A;  2E2I B;  5ISR A;  4CIZ A;  2JZ0 A;  2WZJ A;  3A8J E;  2FMM A;  1MX0 A;  1FNV A;  3OHX C;  2N78 A;  3FUW A;  3BU2 A;  3CAM A;  1FJG Q;  2KVM A;  5CBE E;  4KO8 A;  4QHS A;  3T1H L;  5E7N A;  2CWA A;  1K8A C;  4EQN A;  1LT6 D;  2LSS A;  4YHH M;  3CTW B;  5IYC G;  2JA6 H;  4HN7 A;  2LHC A;  2K5Q A;  3U6L A;  2B8F A;  1RU3 A;  3UK6 A;  3VA7 A;  1QVG A;  2D0O A;  3QYE A;  2K9D A;  2BH8 A;  1A2U A;  3H6M A;  3G71 A;  1DO0 A;  2FHT A;  1F9Q A;  2K5W A;  2M2L A;  3VR5 A;  1B2T A;  4JI1 M;  3I73 A;  1PH8 A;  1LO5 D;  2KXE A;  1X3G A;  2JQO A;  2Z4H A;  4C3J H;  3WWV A;  1L2C A;  3DEP A;  3EIH A;  4NMZ A;  2TMP A;  4IBE A;  2Q8T A;  2RSO A;  1XXH B;  2IW3 A;  2FOI C;  4L63 B;  1TS3 A;  4BBS G;  1E9S A;  4RF1 A;  2WAC A;  3B7Q A;  1IBL M;  2VB2 X;  2QCP X;  2R18 A;  1UUP A;  1KRT A;  3PV0 A;  1IY1 A;  4HR7 B;  3BZK A;  4H02 A;  1PH6 A;  1LT3 D;  2NVY H;  2NN6 G;  3SYL A;  2IY5 B;  2ZM6 Q;  3WHL A;  1AE2 A;  4IUR A;  5LL6 S;  1ZEQ X;  2KW0 A;  2L2D A;  4IPG A;  5FLX L;  2LVO C;  3A8I E;  1T9H A;  1WCM H;  3RGP A;  3T15 A;  3AJI B;  5K36 G;  3GQB A;  4CJ1 B;  1GAB A;  3V96 A;  4LF7 L;  4IBK A;  1VQM A;  2XSZ D;  2CHQ A;  4LJ9 A;  1N33 M;  1EYG A;  2QEJ C;  2CV1 A;  2ZJR A;  1MJC A;  4I4L A;  4PQX A;  4KY7 A;  3H3V C;  2JWS A;  1JB3 A;  4LUV A;  3CCV A;  1TWC H;  3QWN A;  1K0S A;  4OON A;  3RZO H;  5FTM A;  4AW4 A;  4BBS H;  1XPU A;  5FJ8 H;  4AYB B;  3SXH A;  2IL8 A;  4PD2 A;  1SNC A;  2D9U A;  4DUY L;  4JOI A;  1IL8 A;  1EIY B;  1U4L A;  4R4Q A;  3U6O A;  3A55 A;  2NN6 H;  1ICW A;  2KNZ A;  1HNZ Q;  4B3M L;  2JA7 H;  5HUR A;  2NZH A;  3RLF A;  3VA5 A;  1MGS A;  2DAI A;  1E0B A;  1TH2 A;  2DHY A;  1IY0 A;  1HZB A;  4R8I A;  1EOV A;  2BNK A;  1GO5 A;  3TWM A;  4QUC A;  2VY3 A;  1SFO B;  4HLQ A;  4QNR A;  4DR1 L;  3C2P A;  4JYA L;  4R4C A;  1TGU A;  4A3C G;  3NHH A;  2EOT A;  2K04 A;  2MRO B;  2VUM G;  4PV1 C;  4JI0 L;  1AUA A;  1TWA B;  4DV7 M;  1Q7Y C;  1TII D;  1SNQ A;  2DZO B;  1HNX M;  1SXJ A;  4FO2 A;  4TKO B;  4FWD A;  4DR6 M;  4C2M H;  4LF6 Q;  1VEG A;  1F2Y A;  1V1P B;  2WB1 G;  3VYS A;  1FNU A;  3VYT A;  4K6L A;  3MEF A;  4P2C B;  3KVW A;  4IJF A;  1B7Y B;  3VYR A;  4AKG A;  4UY8 C;  1B9N A;  1I94 M;  1WTV A;  5ELD A;  3L0O A;  5FOB B;  2HQL A;  3FD9 A;  5C4Z A;  5DEH A;  3LW5 F;  1Z47 A;  4GNX C;  1YHB A;  4LFB Q;  1A5T A;  3C3D A;  3EIE A;  2E5L M;  4C3H B;  1XMQ M;  5IWA L;  1J5E Q;  2GVB A;  3G6E A;  2XSC A;  3K5N A;  2UU9 M;  3MVV A;  1IW7 D;  1CZG A;  2Z0S A;  4DR5 Q;  1WD1 A;  3QIA A;  3SAU A;  2QEX A;  5JVH 3;  4QIW B;  5IP9 H;  2X6L A;  1WJ7 A;  1QZH A;  2MP1 A;  5GRO A;  1R4P B;  1ZXT A;  3FKI H;  1PRT D;  2DWL A;  4LJ4 A;  4JPB W;  1Z5A A;  3K5O A;  1VQ1 A;  4DKA C;  4IBB A;  1K8M A;  1KAB A;  1YI2 A;  3ICE A;  4OXP A;  3PNY A;  4PDI A;  2B2Y C;  4OL7 A;  4DR2 Q;  3S1R B;  4DNR B;  3KBX A;  2LXE A;  3MMP A;  4CBV A;  4DV3 L;  3U6Q A;  3GRR A;  2MO0 A;  4DFA A;  1Z7T A;  1JR3 D;  3BS1 A;  2E74 C;  2ID0 A;  4RGO S;  5DM6 3;  2J5Y A;  4BA2 I;  4JV5 L;  4QGU A;  2EY2 A;  1DV0 A;  4JW0 A;  4DV0 Q;  4OGQ C;  1VQ5 A;  2UUC Q;  2XNA C;  4PMW A;  4D80 A;  4RCN A;  5M5W H;  1QG7 A;  2OEO A;  2HQE A;  2N35 A;  2G9H D;  1R6B X;  3V76 A;  4A3M H;  3Q8G A;  1S5C D;  2NWG A;  3GTL B;  1I6H B;  3MHB A;  1PM5 A;  4O42 A;  4X3T A;  3U6E A;  2I5H A;  1GVP A;  3VDU A;  3OYY A;  2JN4 A;  1I5F A;  1E22 A;  4A3K G;  2QSF X;  1QWY A;  4AZF A;  3U9O A;  5I2Y A;  4IBG A;  5KYL A;  1PRT C;  3J80 L;  3N6R A;  1I3Q H;  1LTM A;  2NVQ H;  3NBI A;  3J7A V;  1SNP A;  1GJS A;  1PFN A;  4DUZ M;  4CIS A;  2EPB A;  2YNM D;  4DV5 L;  1XJV A;  2CFM A;  1K8O A;  2KRK A;  2R7Z B;  4PZ8 A;  4IBC A;  3U61 A;  1WFQ A;  2HKJ A;  1I4Q A;  4CKC A;  2JP7 A;  1HFG A;  1Q82 C;  1PZI D;  3HKP A;  1S72 A;  1O7Y A;  3I2Z A;  3E4R A;  5LMU Q;  2KEE A;  4LW1 A;  1HQC A;  1T3T A;  1E1T A;  1PFM A;  1RCV D;  3H0G G;  2L55 A;  2IX3 A;  4X64 L;  4G4O A;  5C0X H;  1N32 Q;  3NEN A;  4LCB A;  3SAT A;  2DNC A;  4MGI E;  1AH9 A;  3SK5 A;  3J7A S;  1H9S A;  1CM9 A;  2JXM B;  2XN9 C;  2Y0S G;  5D14 A;  3VLF B;  3I8Z A;  4FF3 A;  3ZYY X;  2DHR A;  4JI4 Q;  1SXJ E;  3M6A A;  3NTI A;  5JI3 E;  1SMY D;  4ZRZ A;  4EQO A;  3TDQ A;  5A35 A;  3Q24 A;  2A69 C;  4K8J A;  4C1N I;  4LFA L;  2AUJ D;  3C58 A;  4K8I A;  4MNO A;  3D31 A;  1K73 C;  4QB4 A;  1L1Z A;  1GJX A;  1JOQ A;  5BR8 M;  1IXS B;  1DGS A;  4I8O A;  2IX1 A;  2DAG A;  1R7R A;  4OVZ B;  3BBZ A;  4A3E G;  2BE5 D;  3HRZ C;  4A3I B;  2C5C A;  1YVC A;  3F8T A;  4YY3 M;  1OFI A;  3HU2 A;  1STE A;  2QEN A;  3AU7 A;  3HFZ B;  1TY0 A;  3ULJ A;  1JWU D;  4CDD C;  1A15 A;  5A2Q E;  4NL4 H;  3GTM B;  5T1I A;  2F0M A;  5IYD H;  2YYZ A;  3U4V A;  3CCM A;  2AWN A;  3W0L B;  4JI3 L;  3KS4 A;  1IN8 A;  1EQV A;  4HCS A;  1BCP C;  3MA2 B;  3ERQ A;  3EBE A;  2DZL A;  4F1I A;  4HIM A;  2NUC A;  1CQF A;  4HIO A;  3R2I A;  4HJ7 A;  4IAL A;  3T4A C;  4F88 A;  3PNV A;  3L25 A;  1TWF H;  2WSE F;  1B8A A;  1QOH A;  2J7Z A;  2CFO A;  1JE4 A;  2XWB B;  3VR3 A;  4HJ5 A;  1KRS A;  3Q6S A;  3W5O A;  3EIV A;  5CV6 A;  1L1O C;  4LAA A;  2YTV A;  2F0W A;  3QO2 A;  4D81 A;  2UUA L;  1X65 A;  2JA5 B;  3PXG A;  1X32 A;  4ZCK A;  4A3E H;  1Q12 A;  2F0P A;  1Q1E A;  1VF7 A;  4BXX H;  1PRT F;  5CMD A;  3TEH B;  2X8A A;  3UI2 A;  3J81 i;  4DXF A;  3SVM A;  3K5M A;  4DR1 Q;  1KLU D;  4JYA Q;  3H09 A;  2DXI A;  2Q2H A;  4M9X A;  5IYB H;  5ELF A;  3J7Y W;  1XC8 A;  2EDG A;  2O25 A;  2EJS A;  2Z4I A;  1HA6 A;  1DGH A;  2EYJ A;  1JCK B;  4KLN A;  3TRE A;  1YNJ C;  3W3A A;  3GTQ H;  3HKS A;  2WKC A;  2EXZ A;  5C3E B;  4FW9 A;  4GLA C;  2EZV A;  1IYJ B;  4K0K M;  2JA8 B;  1J09 A;  2JA2 A;  1ILQ A;  2R65 A;  4FWG A;  3DHQ A;  1C9O A;  4LGY A;  4LF6 M;  1IQP A;  2Z9H A;  3B74 A;  4Z6Y A;  4LF5 M;  1FNW A;  5FTJ A;  2K6B A;  2AKW B;  2HHH L;  2PQA A;  3KOZ E;  3B89 A;  1Y69 U;  1IM2 A;  1GOZ A;  4UPA A;  3KJO A;  1Q86 C;  1CSQ A;  4L8R C;  4AYB G;  3JAM c;  2QIL A;  4GHL A;  2VF8 A;  5M3M G;  3CF6 E;  2D5D A;  4L5R C;  4A3D H;  1C0A A;  3M7N A;  1BNZ A;  3SHF A;  3ZQJ A;  4DAM A;  1IBM L;  2UXB M;  2ATW A;  4IUT A;  1ZYR C;  4LFB M;  3TME A;  2NYZ D;  2L1B A;  4C3J B;  4MGH A;  2RHQ B;  3QG1 A;  1NJI C;  1QAQ A;  1JJ2 A;  2H4O A;  1ICF B;  3TS0 A;  4C3I H;  1XX8 A;  1CQV A;  2NB0 A;  3M4P A;  2JJQ A;  3GRU A;  3NUC A;  3KJP A;  3M0E A;  4DAP A;  2K01 A;  1MJG M;  5C4X H;  3UDG A;  4NSR A;  2LMC B;  2WIN B;  2K75 A;  2QP9 X;  1UEB A;  1BCP F;  2F0F A;  4F7X A;  2EYO A;  3D0F A;  3E9I A;  3W68 A;  2KA6 B;  1ENF A;  2FXQ A;  4FXG C;  4MTK A;  1MJE A;  2NVY B;  1BQQ T;  3K92 A;  3I7F A;  2K4K A;  4DR2 M;  1KHI A;  2L11 A;  3NP8 A;  3TPZ A;  1PTO C;  2IJ0 A;  4A3G B;  4G4N A;  2K28 A;  5I2X A;  1OAI A;  2K1B A;  3T16 A;  3W2D A;  3SBJ A;  2NBF A;  1EYD A;  3HZJ A;  4CKE A;  1DO2 A;  4L15 A;  3A7A B;  3RD4 A;  4KT0 F;  4DV0 M;  1STA A;  2OWO A;  1KD1 C;  3S14 H;  4CJ2 C;  2UUC M;  4ZUI A;  1HXY D;  1B70 B;  4L6V 6;  1TWC B;  2F5P A;  4HIK A;  5JEA G;  3RZO B;  4C3H G;  3GLI B;  4GC5 A;  4FP5 D;  4UP9 A;  4MGK E;  3CGW A;  1SFO H;  2AHO B;  2F0K A;  4DV6 L;  1E7Z A;  4PCZ A;  2I07 B;  4LJ6 A;  1N34 Q;  5FLX S;  1SRO A;  4PMB A;  2JA7 B;  2LKV A;  5FLM G;  4J15 A;  1SXT A;  4DR4 L;  3C46 A;  1IN6 A;  4QJF A;  1Y1V B;  4MB7 A;  2DY8 A;  2B29 A;  3VK8 A;  3T1H M;  1WGL A;  1ILP A;  3UDX A;  3PQI A;  1NMF A;  4GNX A;  1JT8 A;  4ZQ3 A;  1IL2 A;  3RMH A;  3HOU H;  5CC4 A;  4YHH Q;  1HUN A;  2WAQ B;  1KNE A;  4DA2 A;  2V6Z M;  2MR9 A;  1I6V C;  1GUW A;  2QPA A;  4FVM A;  3GPX A;  3IHP A;  5LMU M;  1Q90 A;  4F2L A;  1N32 M;  2A68 D;  4MIU A;  2JEA I;  1KAW A;  1KFV A;  4F87 A;  1YJW A;  2R46 A;  4HAE A;  4C2M B;  2QA4 A;  4X66 L;  2WV6 D;  4LFA Q;  2Z7J A;  3CCJ A;  2FE8 A;  4ZLT F;  4LF8 L;  2A6H C;  4X3S A;  2AUK A;  3HOX H;  4R7G A;  1TS4 A;  2CWB A;  5LMN Q;  5KQ8 A;  3VKH A;  2B2Y A;  4RGT A;  1IBL Q;  3KOW E;  1PJJ A;  2RSN A;  3KBG A;  3KLS X;  4JCV E;  1Y8N B;  2VQE L;  3GLG A;  1VQK A;  3I4N H;  4JI3 Q;  1D6E C;  2R62 A;  1PTO F;  5LL6 X;  1VQ4 A;  1HUM A;  4R8N A;  5EPJ A;  4LF7 M;  1I4R A;  2KNV A;  3R3O A;  1STH A;  2R7Z G;  4A3V B;  1A3U A;  4A93 H;  5CV8 A;  2PZW A;  3J7B A;  3TL4 X;  3VDY A;  4OIJ A;  4GRI A;  1G71 A;  4GEW A;  1K28 A;  1B53 A;  1WOC A;  5GAH C;  1JMC A;  5JJL A;  3S2D B;  2QKI C;  2LWX A;  3HP3 A;  4MZ9 A;  1CTM A;  1XB2 B;  1SE4 A;  3LGJ A;  1K3B C;  5EQ0 A;  3GTL H;  1I6H H;  4S3S A;  3GTK H;  1X3P A;  4DUY M;  4MTN A;  1HQY E;  2MHV A;  1CI3 M;  1Q3L A;  3AV0 A;  4QY7 A;  3KW6 A;  2CP8 A;  1W5S A;  1F2M A;  5ELE A;  1KAA A;  3NPP A;  4LUZ A;  1ORY B;  1BXT A;  1XTD A;  4WP2 A;  4HED A;  2XTI A;  4B3M M;  3NEM A;  1TT2 A;  4GKK L;  4IFD G;  2ZBK B;  2C9O A;  3S1Q B;  3GQ5 A;  3EVQ A;  4U68 A;  3KYH C;  3M4Y A;  2EXD A;  2Q2E B;  5CV4 A;  1L2B A;  4AI6 A;  5CR3 A;  2PQE A;  5JVG 3;  3HU1 A;  3HKZ B;  2JY6 B;  1SYB A;  4JBM A;  3S15 H;  4DR1 M;  1IN7 A;  4A3I G;  4JYA M;  2ZXO A;  2LXJ A;  3NSW A;  4LK1 C;  5A2Q L;  3AOE C;  1G8Z D;  1YJN A;  1EY5 A;  1VS0 A;  1M1K C;  4JI0 M;  2Z6K C;  1WIV A;  1V1Q A;  2Y0T A;  1P16 A;  1NE3 A;  2XWJ B;  3NBH B;  4WJW A;  2R92 B;  1AP0 A;  3HJ8 A;  2A1A A;  4XK8 F;  3MC0 B;  1HNX Q;  3J27 B;  2V4D A;  1I3Q B;  2HHH Q;  1G3I A;  4OWX B;  1EQR A;  2JE6 I;  4GZY C;  1PRB A;  3C1E A;  1TKW B;  4N9T A;  5TSS A;  3TZD A;  4D82 A;  4BBA A;  3KF8 B;  2ASB A;  3KOJ A;  3WOE A;  1QZG A;  3EQL C;  2DWZ B;  2LVQ D;  3TP6 A;  2J4X A;  4WFN 3;  5GAD C;  4QQB X;  3TQS A;  2F0Q A;  2L09 A;  3D4R A;  3DEO A;  1TR8 A;  2E5L Q;  1M8A A;  1JR0 D;  1LTL A;  1XMQ Q;  2UXD L;  1VCI A;  4KHP L;  1PVO A;  1HJP A;  3SK8 A;  3KP0 E;  2ZJQ A;  1U0L A;  3GTM H;  4E6I A;  1VQN A;  2RRU A;  3J80 S;  4B7H A;  3DWP A;  4IBF A;  3TBI B;  3Q8X A;  2Q2T A;  2XIW A;  1O80 A;  2F0D A;  3VR4 A;  4QOZ C;  1B1Z A;  5C5M A;  3CQZ H;  3GP1 A;  1VEJ A;  1K83 H;  1SDF A;  1L1O A;  1RKN A;  2A8V A;  3J7A F;  4A3L G;  4B3R L;  5JOB A;  3BVG A;  2FMC A;  2R3Z A;  3ITP A;  3RN2 A;  3WHK A;  5C3E G;  3MXU A;  4TUW A;  4DV3 M;  1QVF A;  5DYG A;  1BBW A;  2EO2 A;  2JA8 G;  3H4J A;  1X56 A;  1GL6 A;  4X6A H;  2D7E A;  4JV5 M;  3HJS A;  2KJX A;  4G6Z A;  4KKT A;  2QBY A;  5IGE A;  3S17 B;  3I70 A;  5IZ7 D;  2JA5 H;  2ZXP A;  4LJA A;  2N3S A;  3IEC A;  3SMP A;  2XZU A;  3URY A;  5KNB A;  3CU7 A;  1P8L A;  2JA6 G;  1HQR D;  2K5D A;  1X9N A;  2ZTE A;  3T1Y L;  1XNQ L;  5FO8 B;  2Y0Q A;  3CC7 A;  4JI7 L;  2F5S A;  1TWF B;  1LV9 A;  2OQ0 A;  3E46 A;  4JI8 Q;  5JJZ A;  4C3J G;  3SEB A;  5JEA J;  2F52 A;  3TP5 A;  2F5N A;  2F1M A;  3VR2 A;  1BVS A;  2OQK A;  5EPK A;  2VW9 A;  1D0L A;  5DNF A;  2KEC A;  2E2D C;  1I4H A;  4ME3 A;  2QNJ A;  1NVM A;  1N34 M;  3LNN A;  3A5U A;  2HCI A;  3AFP A;  3I90 A;  1BDO A;  2JA8 H;  3CCS A;  2PPB C;  1Q46 A;  4DUZ Q;  2F4V L;  3LVW A;  2VNU D;  2L7H A;  1GKI A;  1YIJ A;  3OTO L;  1FGU A;  1R2Y A;  1MHW C;  1ROD A;  1TH4 A;  2M9V A;  4BS9 A;  1KC8 C;  1G6P A;  4IOA A;  4B7F A;  4RFB A;  3J81 j;  3R8F A;  2F0V A;  1A8V A;  4X64 M;  1WCM G;  1F9R A;  4B3S Q;  2MGW A;  5JPM C;  3GTQ B;  1EWC A;  5CYU A;  2HUG A;  2IHE A;  2C9C A;  2QZ4 A;  1A2T A;  1YNX A;  1PJS A;  2Z8Y M;  1NNJ A;  1CHQ D;  1H9J A;  2YV5 A;  3I4M B;  2F3V A;  5LHY 1;  5JJK A;  2ICE C;  4LFA M;  2HAK A;  4ZKB B;  4JI5 L;  4HL4 A;  1VDD A;  5LMN M;  1G29 1;  5FJ8 G;  2LHG A;  5EJC A;  3K0X A;  3HHX A;  4A3D B;  4LRT A;  1K3R A;  4RGN A;  5BR8 Q;  3STB D;  3CCR A;  3CPW A;  2LY7 A;  3MXG A;  4YIJ A;  2VQE Q;  3PO3 H;  3WDN A;  2BJW A;  1XHB A;  3I51 A;  1A0I A;  8CAT A;  4YWL A;  1D2B A;  1HHV A;  3GLF E;  2L7I A;  4YY3 Q;  3C3L A;  3GLH A;  2JA7 G;  3J81 E;  1GHJ A;  3FPU B;  5ITR A;  1R9T H;  4A3G H;  1L2F A;  4JI3 M;  3M4O B;  2VII A;  2PZT A;  4C3I B;  3RR5 A;  2Y21 A;  5C18 A;  3FUX A;  1D1I A;  1Y1V G;  4IBD A;  1HZA A;  1SRU A;  3K58 A;  4DV2 L;  2RKO A;  2EYP A;  4XYQ A;  3U6P A;  3S24 A;  1UE1 A;  4HEO A;  3Q0A A;  5C4X B;  4LWC A;  5EXT A;  4X62 L;  2RBM A;  3TQY A;  1WTH A;  4QCL A;  3K9O A;  4XBO A;  2WAQ G;  3NE5 B;  3CRK C;  1NY4 A;  1XPR A;  4JVZ A;  3J81 c;  1WTP A;  4NOO B;  2OF1 A;  1SYG A;  3U4Z A;  3F1Z A;  2DAM A;  4G4K A;  2PO4 A;  3U6C A;  1XNR L;  1EE8 A;  3TN2 A;  5IGF A;  3U5Z B;  3QR8 A;  5C1B A;  1J6Q A;  4Q5V A;  4F8M A;  2UUA M;  1CSP A;  2K6A A;  1A3T A;  3FTE A;  1NR2 A;  3L28 A;  2R7F A;  4GS3 A;  4Y52 H;  3I4Y A;  3F2B A;  1S5F D;  2V1C C;  4IUP A;  3CC2 A;  3HY5 A;  3W67 A;  2CV0 A;  1I4P A;  2FNA A;  4A3J B;  4W5W A;  3S14 B;  4FYD A;  1HR0 Q;  2B3T A;  2IX0 A;  3D6W A;  3HOW H;  1X3E A;  2D2C C;  4UP7 A;  1Y1V H;  5ITY A;  1A63 A;  3THG A;  2I5L X;  4B3T L;  4LF4 L;  1WTQ A;  3CME A;  4C56 C;  1WVL A;  2DWN A;  4NKL A;  2EYF A;  4A3B H;  5M9O A;  3UMM A;  4HID A;  4MHE A;  4IJE A;  2G9D A;  4DAY A;  4X65 L;  1YJ9 A;  4GOP C;  1ZMW A;  2OOB A;  5J39 A;  2OQ4 A;  1JB0 F;  2HD3 A;  1VDL A;  4A3F B;  5J22 A;  1G2T A;  5IP9 G;  4K0K Q;  1LTI D;  2B2U C;  2HHH M;  1QYR A;  3FKI G;  5FO7 B;  2DJF C;  4LF5 Q;  5KPR A;  3K5L A;  2PW5 A;  5JAV A;  3HOU B;  1VQ8 A;  4K6D A;  2GN5 A;  4JBW A;  3HHY A;  3KDF A;  3FE3 A;  1L1T A;  1I50 H;  1VQJ A;  2UXB Q;  1VQ6 A;  2XFS A;  1OTC A;  4RH6 A;  4GN3 B;  2B2V C;  1LLR D;  3L3O C;  3GO5 A;  2BDN A;  1OAO C;  1FNN A;  1C1K A;  1ZAE A;  4DR3 L;  3NTH A;  1J9O A;  3HKZ G;  5C4J H;  4A3M G;  2JUJ A;  4LJ5 A;  1MKH A;  1MSG A;  1Y8O B;  3HOX B;  2Z4S A;  2MFI A;  1BBX C;  3O13 A;  1Y14 B;  1QQW A;  4ULL A;  5ELO A;  4XQQ A;  3S1N B;  4LY6 A;  3A42 A;  3QAU A;  1NJG A;  1VQA A;  3S2D H;  4B7G A;  4PDG A;  3GTO B;  2R92 G;  4NP5 A;  1FD7 D;  2YTY A;  2KDL A;  3RNU A;  2J7O A;  2VL6 A;  4XT3 B;  3I4N B;  2I5M X;  3CF0 A;  3HOV B;  1ZMV A;  3MFY A;  3GLH E;  2UXC L;  3H4M A;  4A93 B;  2OOA A;  4NPS A;  4EVO A;  1MU5 A;  2OT2 A;  3SAR A;  3AOE A;  3S1Q H;  2PI2 A;  1IBK L;  2QGQ A;  1XNQ Q;  2Z6K A;  1QCB D;  1PYW D;  3G7L A;  4IPD A;  1GD7 A;  2VS1 A;  5C0X G;  1SXJ B;  2QQ8 A;  3GTK B;  2N55 A;  3IG5 A;  1IW7 C;  5KQD A;  2RKS A;  4DV6 M;  4M9S A;  4JI8 M;  1L8Q A;  2ALY B;  2SOB A;  5IT9 E;  2JXN A;  4XYO A;  5ELC A;  2R92 H;  3RZD B;  4A76 A;  4OVZ A;  4DR4 M;  4M0D A;  2LNH C;  5KGU A;  2P5Z X;  1VQL A;  2F0I A;  2DN8 A;  1D7Q A;  1G51 A;  1N36 L;  1HCZ A;  4TRD A;  3U6M A;  1E1O A;  1GUT A;  1PLF A;  4CKB A;  4ZK9 B;  4FXD A;  3T1H Q;  4V19 0;  3S15 B;  2E75 C;  5IT9 c;  3RLN A;  3KSJ A;  2K03 A;  1Z5C A;  4DV1 L;  2LTU A;  3ERO A;  1HT2 E;  4LFC L;  1Y1W H;  5ITQ A;  3FPP A;  5IYD G;  2KNA A;  1JJC B;  5M3F B;  4CDF C;  2K52 A;  5C44 H;  4K2L A;  5K5P A;  1NSF A;  2EA0 A;  4B3S M;  2DEN A;  3KF6 A;  2KRU A;  3J80 i;  3LQQ A;  3AB9 A;  1GUS A;  1NSN S;  4ZPX A;  1FL0 A;  3HS0 C;  3CCU A;  3CF5 A;  3J7Z C;  3D4W A;  3TZU A;  3A45 A;  1NBW A;  3X3N A;  3E5S A;  4JI5 Q;  3BZD B;  1IXR C;  1WTX A;  3J7A 5;  3U50 C;  4RKU F;  2MO1 A;  4IOC A;  1YHA A;  3S16 H;  4NDX A;  5L37 A;  4HSV A;  4R1J A;  1F9P A;  1IHZ A;  1TWH H;  4BY1 B;  3BVZ A;  5CV7 A;  4NXN L;  4K5X A;  4ZAI A;  5M5Y B;  5A2Q S;  3H94 A;  4OO1 I;  4ODG A;  1C8C A;  2CRU A;  2VQE M;  3SHG B;  1LAB A;  3I72 A;  4UN2 B;  3EN2 A;  2WSC F;  1QJO A;  4M8A A;  3GV6 A;  2JK8 A;  3AFH A;  3R2T A;  1G91 A;  4MH0 E;  2H1R A;  2CV2 A;  2B2T A;  4JK1 C;  4BXX G;  1B4O A;  5ELB A;  2R0I A;  4JI1 L;  3LWE A;  3PF4 A;  1H9M A;  5IE8 A;  4LF7 Q;  2G8L A;  4K5W A;  1EFI D;  3S17 H;  4X62 Q;  3K57 A;  1DGG A;  1F2Z A;  3FRH A;  1YE9 A;  5E26 A;  1PV4 A;  3A54 A;  5IYB G;  3IFT A;  2VQF L;  1A3V A;  5GQO A;  4I81 A;  3CQZ B;  5FTN A;  3CXC A;  1K83 B;  5IRE B;  1CKN A;  1VQB A;  1OFH A;  1SBB B;  2JEB I;  4FCT A;  1EU4 A;  1PMR A;  3UDI A;  2I0Q A;  2AHM A;  1GKH A;  3F2C A;  2L4E A;  1PA6 A;  4DUY Q;  2JYO A;  3P20 A;  1ET9 A;  2B39 A;  4KJN A;  3PUV A;  1SMY C;  4GKK M;  1CHP D;  3PIP A;  2GA4 B;  4GMQ A;  3MWY W;  3UZU A;  5E4W C;  3I4M G;  4LJ8 A;  1G59 A;  3U61 B;  4MN3 A;  1MN3 A;  4B3M Q;  1JE5 A;  3PIO A;  4LNQ A;  3B7N A;  1RDP D;  1ML0 D;  1L0W A;  2CCZ A;  4A3D G;  2C96 A;  1HR0 M;  1N33 L;  2BE5 C;  5JJI A;  4LF4 Q;  3L27 A;  2ZJP A;  4GLX A;  1QIL A;  5FO9 B;  2F0O A;  2PI2 E;  5M5X H;  1KIX A;  3OOC A;  1Q8I A;  3LMM A;  1H9S B;  4IUV A;  1STY A;  2YQZ A;  2PMZ E;  4JI0 Q;  3DUZ A;  1SE3 A;  4S12 A;  1VMC A;  4C3I G;  1HTL D;  4MGY E;  3I4V A;  5KO3 A;  4PNY A;  2YR0 A;  1QUQ A;  2KHJ A;  3PGZ A;  1EWI A;  3SAS A;  3ND9 A;  3JAM E;  4R3D A;  5C4X G;  3A74 A;  4KD4 A;  2O4X A;  1PGY A;  4QMG A;  1K3X A;  1QB5 D;  3PCO B;  1RTO A;  2I7P A;  1O7I A;  4J6H A;  3MXN B;  3M3Y B;  4GC9 A;  3I4M H;  3FRI A;  3FMC A;  1QAO A;  3DM1 A;  3T51 B;  4BLC A;  3ZCB B;  1VQI A;  5HGT A;  3GTG B;  2NTT A;  1K3W A;  1EIG A;  2CHV A;  3L26 A;  2R93 H;  2DWM A;  2I7N A;  1NUC A;  3MHV C;  3VR6 A;  4A4I A;  3EA6 A;  1YEZ A;  2SEB D;  5IWA Q;  3HU3 A;  4KHP M;  4A75 A;  4ZUJ A;  2D0P A;  1STG A;  1RIP A;  3BDC A;  4DV7 L;  1PH2 A;  4G4R A;  1N77 A;  3TS2 A;  4Q7J A;  1TTE A;  3PMF A;  1VQE A;  1F77 A;  3M4O H;  4WJ3 M;  5CGK A;  3SHL A;  3Q23 A;  4AKI A;  1FVI A;  1UE5 A;  1XYI A;  3TWL A;  4B3R M;  2GVA A;  1G8P A;  1KLG D;  3I04 M;  3FTF A;  5E1F A;  3GQ3 A;  3NWS A;  3W1B A;  1OIZ A;  3GPY A;  1HQM C;  4ITQ A;  2PNH A;  3E9H A;  1GUO A;  4EQ5 A;  1I94 L;  3PO3 B;  1IYV A;  4O2D A;  1R5L A;  1SND A;  2W82 A;  4QL5 A;  5IGG A;  4BB9 A;  2QF7 A;  2H5X A;  4FDB A;  4DV3 Q;  4QHT A;  4A3F G;  2HCC A;  3CPF A;  2IHF A;  1R9T B;  1BF4 A;  1HRJ A;  2OXP A;  3DM3 A;  3ZC7 B;  1TY2 A;  5JPN C;  1MSH A;  4PG3 A;  4JV5 Q;  2EKK A;  1Q39 A;  1D5Z C;  2K0B X;  4RA8 A;  3BZC A;  4RAU C;  2UU9 L;  3TRZ A;  1HH2 P;  1A6X A;  5C3W A;  3KSX A;  3GRV A;  5CBA E;  1AZQ A;  3VYU A;  3HOU G;  1LAC A;  2O2L D;  4A3J H;  4DR7 L;  4JI6 L;  1E94 E;  1RJT A;  3T1Y M;  1XNQ M;  2N49 A;  2DUD A;  4JI7 M;  2JZ1 A;  4GOP A;  3CMA A;  4OU7 A;  1KQS A;  2XSZ A;  3ER0 A;  2EYL A;  2EYM A;  2CEA A;  1UFZ A;  2AQ2 B;  2N88 A;  3BDO A;  5EXX A;  4AQY L;  2CQO A;  4NXM L;  2B2U A;  2PQA B;  2KEN A;  4N8F A;  1GVN A;  2OO9 A;  1W6J A;  3CD6 A;  3K81 C;  1YHQ A;  3HOY H;  3HOX G;  2B2W C;  3RLO A;  4A3F H;  1II3 A;  4DV5 Q;  1QVR A;  1DGF A;  3A98 B;  1XMO L;  5CV9 A;  3OTO M;  3HOW B;  4LZJ A;  1F4I A;  1PZJ D;  3OSO A;  4DV1 Q;  1EZ8 A;  5COY A;  1PJI A;  1V43 A;  2MH8 A;  3I4L A;  2M60 A;  5I6W A;  1HNW L;  4RG1 A;  3KFU G;  2B2V A;  4TVA B;  1WXQ A;  4A3B B;  1VQF A;  3I4N G;  3K0Y A;  1SXJ D;  3U60 A;  4X64 Q;  3HOV G;  1B9M A;  2KHS A;  5HGQ A;  1DXM A;  4TQU S;  4A93 G;  3F92 A;  4DU9 A; 
#chains in the Genus database with same CATH homology
 2F0U A;  2X69 A;  2ERC A;  4GIT A;  2WP8 J;  2PYK A;  4G7H C;  4JI5 M;  4OO1 H;  4ID6 A;  3ZH9 B;  3NQT A;  2NVT B;  4LJ7 A;  3P1H A;  1EY4 A;  3NXW A;  2F0T A;  2D62 A;  1GXD C;  5IT9 L;  4IBJ A;  1EQT A;  1I50 B;  1B3A A;  4H44 C;  3D3R A;  2XGN A;  3U6S A;  4RCO A;  2D7G A;  3M85 A;  1JOR A;  1SNO A;  4M9Z A;  5C4J B;  2Z4R A;  1E2Z A;  2JSO A;  4X62 M;  2M5Z A;  1TQO A;  3KS8 A;  2RQX A;  4WRD A;  1XNR M;  3SC3 A;  2A68 C;  4RF0 A;  1K82 A;  4L78 A;  1Q3B A;  3KF8 A;  3BDL A;  3R9X B;  1AFP A;  1NJF A;  3M7G A;  5BN4 A;  2BOS A;  5EGT A;  1QZM A;  1EOT A;  1RHP A;  1NHW C;  3SE0 A;  1QNK A;  2NZ1 D;  1DGB A;  1ET6 A;  3LX0 A;  3FRP B;  1JR3 A;  1JOK A;  2ZAN A;  4B3T M;  4LF4 M;  3KUP A;  4X65 M;  1Z59 A;  5C0X J;  3D4D A;  5GKN A;  3MAQ A;  1DOM A;  2XVS A;  2C98 A;  5FTK A;  1TDH A;  4K14 A;  2WII B;  4U67 3;  1S5D D;  4V0B A;  3KDS E;  3A56 A;  5BN3 A;  1D1K A;  1JQJ C;  5BPV A;  2IWH A;  2CVR A;  5E3F A;  1JQY D;  4I7Z C;  4NRV A;  1LTB D;  1MBY A;  1GUN A;  4FNF A;  1KDB A;  1RF2 D;  3AMU A;  1Y1W B;  2NN6 I;  3K6O A;  3I91 A;  1LT5 D;  5C44 B;  3V05 A;  2PW7 A;  1UEA B;  4N9P A;  5IWA M;  2F4I A;  3BYY B;  4G7Z C;  2NQ8 C;  5IOC A;  4DR3 M;  3OWE B;  1IKL A;  1OO9 B;  3S16 B;  1V8Q A;  3DMU A;  1TWH B;  3L29 A;  2K05 A;  1YNN D;  2CUZ A;  1SNM A;  1TS5 A;  1DYQ A;  2I46 A;  3KLS A;  3FYD A;  3JAM L;  2XH9 A;  2F0G A;  1FGB D;  3NWL A;  4ILW A;  1C48 A;  3FUV A;  3BYT B;  3OWF A;  2EYH A;  2HL7 A;  2BA0 A;  1DD2 A;  2K33 A;  2X49 A;  3GPU A;  2R61 A;  2UXC M;  2LS0 1;  5DM7 3;  3IG8 A;  1NR4 A;  4IIW A;  4FF4 A;  1EEF D;  1KYI A;  4J8Q A;  1KDC A;  1OXU A;  4FXK C;  5EJW A;  5EKI A;  5G3L D;  2F03 A;  2Q8R E;  3P75 A;  3AL0 C;  1EY8 A;  1XXH A;  2BCO A;  4KV6 A;  4H7B A;  1AEX A;  2K7V A;  1U4R A;  3MTS A;  5KND A;  3QWL A;  4KY6 A;  1YNN C;  4KJO A;  3SR1 A;  4XGI A;  1N36 M;  5I9P A;  4L8J A;  3RFW A;  3GLF B;  3T13 A;  4DV5 M;  3FYC A;  1RD9 D;  2L12 A;  4DV1 M;  2EY6 A;  5M5X B;  4LFC M;  3OIQ A;  3FDT A;  2HCB A;  4L4U A;  1BCP B;  4QF4 A;  5H37 D;  1EWH A;  3K7A B;  2KZS A;  2FFK B;  5IOD A;  1IKM A;  3UGJ A;  2EJG C;  1Q3C A;  4KHV A;  2AQ3 B;  4KN7 C;  3KK7 A;  3ONA B;  2EY5 A;  1BO0 A;  2Z1C A;  3U5Z A;  2B8G A;  3QJY A;  3Q22 A;  4LZZ A;  3IFD A;  4NXN M;  4KOD A;  2R93 B;  3GD7 A;  3DZD A;  4RWS C;  3J81 S;  2QBY B;  2KA7 A;  1TWG B;  1D5X C;  4FWH A;  4IUN A;  5EXP A;  5EPL A;  3PFI A;  5KPZ A;  3CHB D;  1Z6H A;  3AKZ A;  1J7K A;  5F3W A;  2ENB A;  5E4X A;  4J1M A;  3MFG A;  3BG3 A;  5EKL A;  4REZ A;  1IY2 A;  3SAW A;  2VQF M;  1N75 A;  1H6U A;  2JP1 A;  1EY7 A;  2X6G A;  3SFZ A;  5C0X I;  3TP7 A;  2YFQ A;  2FFJ A;  1O7L A;  3HG9 A;  2A73 B;  1CK1 A;  2L5T A;  1V1P A;  3HZX A;  3PUZ A;  1ESF A;  1H9R A;  3DXJ C;  1AW7 A;  2A6E D;  2B2W A;  2DNE A;  3IL8 A;  1OXX K;  2L6O A;  3SK4 A;  3QB3 A;  3K59 A;  4LRS A;  3HWS A;  5C4H A;  1J8I A;  4QUF A;  2ICI A;  5NUC A;  1GHK A;  3HHW A;  1S3S A;  1R4Q B;  4H13 C;  2KUM A;  4LMQ D;  3OMC A;  2E2J B;  1W5T A;  3PUY A;  2VB3 X;  5FTL A;  1PFB A;  3GV3 A;  5EBC A;  1S5B D;  2MGS A;  4IUQ A;  1E2W A;  4MM3 B;  2XRS D;  5M3M B;  4Q0F A;  1WTO A;  4XTC S;  3PIP 3;  3VDP A;  4WW0 A;  4GHA A;  4UAI A;  5FKA C;  3DA1 A;  3PIO 3;  5EBD A;  3HOY B;  1PTO B;  3TWK A;  1XXG A;  4EQP A;  5KYI A;  1VF5 C;  2L4N A;  4Z9C B;  2E76 C;  2A6E C;  2Z3X A;  3UJN A;  5G3L F;  1IN5 A;  2ZAM A;  4IN3 A;  4ABN A;  5K36 H;  4BBR B;  3GLH B;  4KKS A;  1R2Z A;  2A5Y B;  1IBM M;  5EP1 A;  5D65 A;  5KEE A;  4KI0 A;  3SYK A;  2E2H B;  1QAN A;  2F0L A;  1PZK D;  5JI2 E;  3KOX E;  4IZ8 A;  3TP8 A;  3D6C A;  1T5X D;  4LJZ C;  1PDQ A;  2YU9 B;  4R9W A;  2MPM A;  2XRQ D;  1XWE A;  1SSO A;  1U4M A;  3VFD A;  1OJL A;  2F5O A;  5I4D A;  2M00 A;  3DWQ A;  4RKL A;  1S4Z A;  4XXE A;  2AQ1 B;  4Z8X A;  4P16 A;  2PZU A;  2XF3 A;  2R4J A;  3LWU A;  1VMP A;  3K1J A;  4NW2 A;  3KLR A;  1GLN A;  1LTA D;  3P7J A;  2O5I C;  1DOL A;  4M0W A;  1Z5B A;  3IAY A;  2KOL A;  4DR7 M;  3DFZ A;  4O1N A;  4JI6 M;  2B63 B;  1ZQ9 A;  2P5T A;  1UAP A;  4B9X A;  1LTG D;  2F0J A;  3FUT A;  3MJ5 A;  1NHG C;  5IT9 S;  2X4A A;  1U4P A;  2KQ3 A;  4AQY M;  4KD3 A;  2PCF B;  4HTH A;  4NXM M;  1VDZ A;  3IKJ A;  3FVQ A;  1I4W A;  4WOR A;  1YUB A;  3S1M B;  4KY5 A;  4HMJ A;  2KCN A;  2H1E A;  1XMO M;  2G5G X;  4IFD J;  1KTK A;  1MI2 A;  4NRW A;  3NWT A;  4XIG S;  3DOA A;  1EY0 A;  4QNM A;  1HNW M;  4BY7 B;  1IYU A;  4KMU C;  2PNR C;  2MJ8 A;  4TSS A;  3N52 A;  3ND8 A;  1UNS A;  1TS2 A;  1L2D A;  2C99 A;  5EQT A;  2A69 D;  2ZAO A;  1S5E D;  5CV5 A;  1E2V A;  3S2H B;  3V2T A;  3NTK A;  2SDF A;  2LFN A;  3L9A X;  5D3D A;  1DM0 B;  4X66 M;  3GPP A;  2EE1 A;  4JXJ A;  2RDH A;  5EP3 A;  4MGZ E;  4LF8 M;  1JIC A;  1SYE A;  1FJG M;  4PMC A;  3GP7 A;  1MD2 D;  4FF1 A;  3HOZ B;  1F2L A;  5IGD A;  1D2N A;  1BCP D;  4DAV A;  1FR3 A;  4ME5 A;  4AG6 A;  2IPK D;  3FEW X;  1Q1B A;  2RDG A;  3A8K E;  4DNT B;  1BR9 A;  3JR5 A;  2PMZ B;  4AKH A;  4M1U B;  2CW0 D;  1BUV T;  1HT1 E;  1QAM A;  3ILK A;  3G6J B;  1PXU A;  2NVX B;  4EGV A;  4G57 A;  5J1Z A;  2ZT9 C;  3L7Z C;  1T5E A;  3MXN A;  4UDU C;  5KRU A;  3HEJ A;  1DJR D;  1KDA A;  2ZM6 M;  1AZP A;  3I3C A;  1ESR A;  1M4V A;  2Q8I B;  4B08 A;  1CA6 A;  3MZ5 A;  4GH9 A;  4G4Q A;  2HDM A;  3NK9 A;  5C3X A;  1QNU A;  1YNJ D;  1WD0 A;  2EJM A;  4GKJ M;  2HDL A;  5AFW A;  3J81 L;  3HGB A;  2CW0 C;  1JWM D;  5C5L A;  4EIW A;  3JAM S;  5DYI A;  1O78 A;  1LTR D;  2K47 A;  1D5M C;  1NNU C;  3MXP A;  1H9K A;  3RGS A;  1DON A;  3LQR A;  2DZN B;  1HTP A;  1OXV A;  1Y8P B;  1HNZ M;  3D8G A;  1ZYR D;  1EZ6 A;  2WKD A;  2Y20 A;  5IIF A;  2RGH A;  4IQZ A;  2QCU A;  3U6D A;  3E6Z X;  3C1F A;  5EP2 A;  1STN A;  5IGB A;  4RHS A;  2EJF C;  3WOF A;  3GRY A;  4NSO B;  2UXD M;  3TSS A;  1E9R A;  4HSP A;  1EY6 A;  5JEA H;  2A74 C;  5IGC A;  3QOL A;  3GLI A;  2ZXR A;  3GQ4 A;  1HPC A;  2A5H A;  3PO2 B;  5EXS A;  5ITT A;  1PTO D;  3D8B A;  3MEH A;  4L16 A;  3QOJ A;  3KOY E;  4B9W A;  3RUZ A;  5F2D A;  4K5V A;  1EL0 A;  2JA6 B;  3EFX D;  1X3Q A;  2RDF A;  4C1N K;  2V1C A;  2Z8L A;  4IFD I;  5FSW A;  3OMG A;  1J5E M;  5DNY A;  1NAP A;  5ITU A;  3B9P A;  3U9S A;  1HFN A;  3PUW A;  4DR5 M;  2R4E A;  3X3M A;  2F0S A;  1G6Z A;  1SEB D;  1DGH B;  3TE6 A;  1CZW A;  5BN5 A;  1JC7 A;  4LG2 A;  2J7N A;  3RE8 A;  4FF2 A;  5DAU A;  4ZKC B;  2O5J C;  3KXE C;  3SAV A;  2XEP A;  1DCZ A;  1EEI D;  4HMI A;  1ENC A;  4OO1 G;  1WCM B;  1E32 A;  4KN4 C;  3EJI A;  4IUU A;  1SYC A;  2F4V M;  3CF2 A;  1PTO H;  4JI2 M;  3K8Z A;  2TSS A;  4DN4 M;  4KTA A;  2R6G A;  1EY9 A;  3PUX A;  3HHZ A;  3OW7 A;  2NTS A;  3OIP A;  1FYC A;  2CHG A;  1RTN A;  4BBS B;  4RKB A;  4CGY B;  2A6H D;  2C5R A;  1L0X B;  4RGM A;  1SAP A;  4OHJ A;  2AWO A;  1NY5 A;  1F9S A;  1DOK A;  1SJE D;  5ITX A;  3E0J A;  4JN6 A;  2EVB A;  5KPT A;  4DK1 A;  3KP1 E;  5FLX E;  1BOS A;  1SE2 A;  2RA4 A;  4QOS A;  3A7L A;  3FKE A;  4HCE A;  1X37 A;  3T53 B;  3AOG A;  4RNA A;  2CQA A;  2KCC A;  2L9H A;  3D8L A;  1G41 A;  4CHT B;  3DWA A;  1U9R A;  4DV2 M;  5KNC A;  4GIP A;  1G2S A;  3R93 A;  5EKK A;  4JI4 M;  2SNM A;  3NBH A;  2XZF A;  1HA5 A;  1SXJ C;  2IT1 A;  3E9S A;  2BJV A;  2EUC A;  2V1U A;  1TR5 A;  2RGO A;  1XTC D;  5E6J A;  5KIX A;  3BOS A;  1OXT A;  2FIN B;  5EP4 A;  1STB A;  1SYF A;  3W0F A;  3S9W A;  1IN4 A;  2VUM B;  5I6Y A;  3FTC A;  4RHR A;  4OX9 M;  1IXZ A;  4LF9 M;  1EIH A;  4I5S A;  3U60 B;  2SNS A;  3FKI B;  2WB1 B;  3NQI A;  1G4A E;  3R8B A;  3SK6 A;  3GTP B;  5FK9 C;  3HJQ A;  1I4G A;  2KED A;  2CHB D;  1TVX A;  4CJ0 B;  1CT1 D;  3F2U A;  4KHZ A;  1C4Q A;  4WUR A;  4X3U A;  2F0N A;  1B44 D;  3JR4 A;  2K32 A;  4DV4 M;  2LH0 A;  1Z6T A;  1LV7 A;  2KEB A;  1TH3 A;  5M5W B;  1W6K A;  1KSF X;  3T38 A;  1CFM A;  3J2P B;  2UUB M;  4FD2 A;  3BVM A;  4A3M B;  4IBI A;  1DZ1 A;  3T56 B;  3GLG B;  2F3W A;  2L0C A;  3SMS A;  1ENA A;  1LTS D;  5T1G A;  2KZU A;  4BWG B;  1OXS C;  3VKG A;  4KKU A;  1YSY A;  1SJH D;  3K2L A;  3CRL C;  1WTR A;  2NVQ B;  4DF7 A;  7CAT A;  2BDO A;  4PT5 A;  5ITX E;  1NY6 A;  4IFD H;  4ZYS A;  1KNA A;  3H91 A;  1LT4 D;  4L6T B;  1PRT B;  5COR A;  4DGZ A;  4OIK A;  2DVW B;  4XT1 B;  3GTJ B;  3GLF A;  1O7Z A;  2EY1 A;  1EYC A;  5C6A A;  5D3I B;  3MK6 A;  1I4X A;  2XFT A;  2R45 A;  3OPO A;  2F0H A;  3FUU A;  4DXG A;  1EYA A;  1LTT D;  5I9O A;  4II7 A;  1L0Y B;  4A3K B;  1JWS D;  2F5Q A;  4DK0 A;  1CA5 A;  1NCV A;  1UM8 A;  1QE6 A;  1IBK M;  4FCV A;  1N78 A;  2QDB A;  1TU2 B;  2VXW A;  3J80 E;  4FCW A;  1ONL A;  2BA1 A;  3FTD A;  1GL7 A;  3GO8 A;  3SDZ A;  4BA1 I;  4XDX A;  4AG5 A;  1SYD A;  4LGM A;  2RVL A;  2F0E A;  4G7O C;  1TDZ A;  2FJ2 A;  2DY7 A;  2CE7 A;  3LVV A;  3H0G B;  1B50 A;  2O5R A;  2XLJ A;  2MUY A;  3VK7 A;  3PVS A;  2B2T C;  4XQJ A;  4OW0 A;  4XQN A;  3CKI B;  3HGI A;  2Y0S B;  1V1O A;  1ZKO A;  4H0L C;  3A46 A;  1JOO A;  3L2A A;  2OPF A;  1AN8 A;  1GUG A;  4X3K A;  2D7H A;  4A3E B;  1XWI A;  4K2K A;  2J0T D;  1EU3 A;  4KK7 A;  4I65 A;  4Y7N B;  1WTW A;  2E2I B;  5ISR A;  3A8J E;  2FMM A;  1MX0 A;  1FNV A;  3OHX C;  3FUW A;  2KVM A;  5CBE E;  4KO8 A;  4QHS A;  4EQN A;  1LT6 D;  4YHH M;  3CTW B;  4HN7 A;  2K5Q A;  3U6L A;  2B8F A;  3UK6 A;  3VA7 A;  1A2U A;  3H6M A;  1DO0 A;  2FHT A;  1F9Q A;  2K5W A;  2M2L A;  3VR5 A;  1B2T A;  4JI1 M;  3I73 A;  1LO5 D;  2KXE A;  2Z4H A;  1L2C A;  3DEP A;  3EIH A;  4NMZ A;  2TMP A;  4IBE A;  2Q8T A;  2RSO A;  1XXH B;  2IW3 A;  2FOI C;  4L63 B;  1TS3 A;  1E9S A;  4RF1 A;  2WAC A;  1IBL M;  2VB2 X;  2QCP X;  2R18 A;  1UUP A;  3PV0 A;  1IY1 A;  4HR7 B;  1LT3 D;  2NN6 G;  3SYL A;  3WHL A;  4IUR A;  5LL6 S;  1ZEQ X;  2KW0 A;  5FLX L;  3A8I E;  3RGP A;  3T15 A;  3AJI B;  5K36 G;  3GQB A;  4CJ1 B;  3V96 A;  4IBK A;  2XSZ D;  2CHQ A;  4LJ9 A;  1N33 M;  2QEJ C;  2CV1 A;  4I4L A;  4PQX A;  4KY7 A;  3H3V C;  1JB3 A;  3QWN A;  5FTM A;  4AW4 A;  4AYB B;  3SXH A;  2IL8 A;  4PD2 A;  1SNC A;  2D9U A;  1IL8 A;  1U4L A;  3U6O A;  3A55 A;  2NN6 H;  1ICW A;  5HUR A;  3RLF A;  3VA5 A;  1MGS A;  1E0B A;  1TH2 A;  1IY0 A;  4R8I A;  2BNK A;  3TWM A;  4QUC A;  1SFO B;  4HLQ A;  4QNR A;  3C2P A;  1TGU A;  3NHH A;  2EOT A;  2K04 A;  4PV1 C;  1TWA B;  4DV7 M;  1TII D;  1SNQ A;  2DZO B;  1HNX M;  1SXJ A;  4FO2 A;  4TKO B;  4FWD A;  4DR6 M;  1F2Y A;  1V1P B;  3VYS A;  1FNU A;  3VYT A;  4K6L A;  4P2C B;  3KVW A;  4IJF A;  3VYR A;  4AKG A;  1B9N A;  1I94 M;  1WTV A;  5ELD A;  5FOB B;  5C4Z A;  3FD9 A;  5DEH A;  1Z47 A;  3EIE A;  2E5L M;  4C3H B;  1XMQ M;  2XSC A;  3K5N A;  2UU9 M;  3MVV A;  1IW7 D;  1CZG A;  1WD1 A;  3QIA A;  3SAU A;  5JVH 3;  4QIW B;  2X6L A;  2MP1 A;  1R4P B;  1ZXT A;  1PRT D;  4LJ4 A;  2DWL A;  1Z5A A;  3K5O A;  4IBB A;  1K8M A;  1KAB A;  3PNY A;  4PDI A;  2B2Y C;  4OL7 A;  3S1R B;  4DNR B;  3KBX A;  2LXE A;  4CBV A;  3U6Q A;  3GRR A;  4DFA A;  1Z7T A;  1JR3 D;  3BS1 A;  2E74 C;  2ID0 A;  4RGO S;  5DM6 3;  4BA2 I;  2EY2 A;  4OGQ C;  2XNA C;  4PMW A;  4D80 A;  4RCN A;  1QG7 A;  2OEO A;  2HQE A;  2G9H D;  1R6B X;  3GTL B;  2NWG A;  1S5C D;  1I6H B;  3MHB A;  1PM5 A;  4O42 A;  4X3T A;  3U6E A;  3VDU A;  1QWY A;  4AZF A;  3U9O A;  5I2Y A;  4IBG A;  5KYL A;  1PRT C;  3J80 L;  3N6R A;  3NBI A;  3J7A V;  1SNP A;  1PFN A;  4DUZ M;  4CIS A;  2EPB A;  2YNM D;  1K8O A;  2KRK A;  2R7Z B;  4IBC A;  3U61 A;  2HKJ A;  1I4Q A;  4CKC A;  1HFG A;  1PZI D;  3HKP A;  1O7Y A;  3E4R A;  2KEE A;  1HQC A;  1T3T A;  1PFM A;  1RCV D;  2IX3 A;  2L55 A;  5C0X H;  4G4O A;  4LCB A;  3SAT A;  2DNC A;  4MGI E;  3SK5 A;  3J7A S;  1H9S A;  1CM9 A;  2JXM B;  2XN9 C;  5D14 A;  4FF3 A;  3VLF B;  3I8Z A;  3ZYY X;  2DHR A;  1SXJ E;  3M6A A;  3NTI A;  5JI3 E;  1SMY D;  4ZRZ A;  4EQO A;  3TDQ A;  5A35 A;  3Q24 A;  2A69 C;  4K8J A;  4C1N I;  2AUJ D;  3C58 A;  4K8I A;  1GJX A;  3D31 A;  4QB4 A;  1L1Z A;  1JOQ A;  5BR8 M;  1IXS B;  4I8O A;  2IX1 A;  1R7R A;  4OVZ B;  2BE5 D;  3HRZ C;  4A3I B;  2C5C A;  4YY3 M;  1OFI A;  3HU2 A;  1STE A;  2QEN A;  3AU7 A;  5A2Q E;  1TY0 A;  3GTM B;  1JWU D;  1A15 A;  4NL4 H;  5T1I A;  2F0M A;  2YYZ A;  2AWN A;  3W0L B;  3KS4 A;  1IN8 A;  1EQV A;  4HCS A;  1BCP C;  3MA2 B;  3ERQ A;  2NUC A;  1CQF A;  3R2I A;  4IAL A;  3T4A C;  4F88 A;  3PNV A;  3L25 A;  2XWB B;  5JEA G;  1QOH A;  2J7Z A;  3VR3 A;  2CFO A;  1JE4 A;  3Q6S A;  5CV6 A;  4LAA A;  3QO2 A;  2F0W A;  4D81 A;  2JA5 B;  3PXG A;  1X32 A;  1Q12 A;  2F0P A;  1Q1E A;  1VF7 A;  1PRT F;  5CMD A;  2X8A A;  3UI2 A;  4DXF A;  3SVM A;  3K5M A;  1KLU D;  3H09 A;  2DXI A;  4M9X A;  5ELF A;  3J7Y W;  1XC8 A;  2EDG A;  2Z4I A;  1HA6 A;  1DGH A;  2EYJ A;  1JCK B;  4KLN A;  1YNJ C;  3W3A A;  2WKC A;  2EXZ A;  5C3E B;  4FW9 A;  2EZV A;  4K0K M;  2JA8 B;  1J09 A;  2JA2 A;  1ILQ A;  2R65 A;  4FWG A;  3DHQ A;  4LGY A;  4LF6 M;  1IQP A;  4LF5 M;  4Z6Y A;  1FNW A;  5FTJ A;  3KOZ E;  1Y69 U;  1IM2 A;  1GOZ A;  4L8R C;  2QIL A;  4GHL A;  3CF6 E;  2D5D A;  3M7N A;  1BNZ A;  3SHF A;  2UXB M;  4IUT A;  1ZYR C;  4LFB M;  3TME A;  2NYZ D;  2L1B A;  4C3J B;  4MGH A;  3QG1 A;  1QAQ A;  2H4O A;  1XX8 A;  1CQV A;  2NB0 A;  3GRU A;  3NUC A;  3M0E A;  4DAP A;  2K01 A;  4NSR A;  2LMC B;  2WIN B;  2QP9 X;  1BCP F;  2F0F A;  4F7X A;  2EYO A;  4FXG C;  2KA6 B;  1ENF A;  2NVY B;  1BQQ T;  3K92 A;  4DR2 M;  2L11 A;  3NP8 A;  3TPZ A;  1PTO C;  2IJ0 A;  4A3G B;  4G4N A;  2K28 A;  5I2X A;  2K1B A;  3T16 A;  3W2D A;  3SBJ A;  2NBF A;  1EYD A;  4CKE A;  1DO2 A;  4L15 A;  3A7A B;  3RD4 A;  4DV0 M;  1STA A;  4CJ2 C;  2UUC M;  4ZUI A;  1HXY D;  1TWC B;  2F5P A;  3RZO B;  4C3H G;  3GLI B;  4GC5 A;  4FP5 D;  4MGK E;  2F0K A;  4PCZ A;  2I07 B;  4LJ6 A;  5FLX S;  4PMB A;  2JA7 B;  2LKV A;  1SXT A;  3C46 A;  1IN6 A;  1Y1V B;  4MB7 A;  2DY8 A;  3VK8 A;  3T1H M;  1ILP A;  4ZQ3 A;  3RMH A;  5CC4 A;  1HUN A;  2WAQ B;  1KNE A;  4DA2 A;  2V6Z M;  1I6V C;  1GUW A;  2QPA A;  4FVM A;  3GPX A;  5LMU M;  1Q90 A;  1N32 M;  2A68 D;  4MIU A;  2JEA I;  1KFV A;  4F87 A;  2R46 A;  4HAE A;  4C2M B;  2WV6 D;  2Z7J A;  2FE8 A;  4ZLT F;  2A6H C;  4X3S A;  2AUK A;  4R7G A;  1TS4 A;  5KQ8 A;  3VKH A;  2B2Y A;  4RGT A;  3KOW E;  1PJJ A;  2RSN A;  3KBG A;  3KLS X;  1Y8N B;  3GLG A;  1D6E C;  2R62 A;  1PTO F;  5LL6 X;  1HUM A;  4R8N A;  5EPJ A;  4LF7 M;  1I4R A;  3R3O A;  1STH A;  4A3V B;  1A3U A;  5CV8 A;  2PZW A;  3J7B A;  3TL4 X;  4OIJ A;  4GRI A;  1B53 A;  3S2D B;  2QKI C;  2LWX A;  3HP3 A;  1CTM A;  1SE4 A;  5EQ0 A;  4S3S A;  1X3P A;  4DUY M;  1HQY E;  2MHV A;  1CI3 M;  1Q3L A;  3AV0 A;  3KW6 A;  1W5S A;  1F2M A;  5ELE A;  1KAA A;  3NPP A;  1ORY B;  1BXT A;  4HED A;  4IFD G;  4B3M M;  1TT2 A;  2ZBK B;  2C9O A;  3S1Q B;  3GQ5 A;  3EVQ A;  4U68 A;  3M4Y A;  2Q2E B;  5CV4 A;  1L2B A;  4AI6 A;  5CR3 A;  2PQE A;  5JVG 3;  3HU1 A;  3HKZ B;  1SYB A;  4DR1 M;  1IN7 A;  4JYA M;  2ZXO A;  3NSW A;  4LK1 C;  5A2Q L;  3AOE C;  1G8Z D;  1EY5 A;  4JI0 M;  2Y0T A;  2R92 B;  2XWJ B;  4WJW A;  1AP0 A;  3HJ8 A;  3MC0 B;  3J27 B;  2V4D A;  1I3Q B;  1G3I A;  2JE6 I;  4GZY C;  3C1E A;  1TKW B;  4N9T A;  5TSS A;  3TZD A;  4D82 A;  4BBA A;  3WOE A;  3EQL C;  2DWZ B;  3TP6 A;  2J4X A;  4WFN 3;  3TQS A;  2F0Q A;  2L09 A;  3D4R A;  3DEO A;  1M8A A;  1JR0 D;  1VCI A;  3SK8 A;  3KP0 E;  4E6I A;  3J80 S;  4B7H A;  3DWP A;  4IBF A;  3TBI B;  3Q8X A;  2XIW A;  1O80 A;  2F0D A;  3VR4 A;  4QOZ C;  1B1Z A;  5C5M A;  3GP1 A;  1SDF A;  1RKN A;  3J7A F;  5JOB A;  3BVG A;  2FMC A;  2R3Z A;  3ITP A;  3WHK A;  3MXU A;  4TUW A;  4DV3 M;  5DYG A;  2EO2 A;  1GL6 A;  2D7E A;  4JV5 M;  3HJS A;  2KJX A;  4G6Z A;  4KKT A;  2QBY A;  5IGE A;  3S17 B;  3I70 A;  5IZ7 D;  2ZXP A;  4LJA A;  3SMP A;  2XZU A;  3URY A;  5KNB A;  3CU7 A;  1HQR D;  2K5D A;  5FO8 B;  2Y0Q A;  2F5S A;  1TWF B;  1LV9 A;  5JJZ A;  4C3J G;  3SEB A;  5JEA J;  3TP5 A;  2F5N A;  2F1M A;  3VR2 A;  5EPK A;  5DNF A;  2KEC A;  2E2D C;  1I4H A;  1NVM A;  1N34 M;  3LNN A;  2HCI A;  3I90 A;  1BDO A;  2PPB C;  3LVW A;  2VNU D;  2L7H A;  1GKI A;  1R2Y A;  1ROD A;  2M9V A;  1TH4 A;  4BS9 A;  4B7F A;  4RFB A;  3R8F A;  2F0V A;  4X64 M;  1F9R A;  5JPM C;  3GTQ B;  1EWC A;  5CYU A;  2HUG A;  2C9C A;  2QZ4 A;  1A2T A;  1NNJ A;  1CHQ D;  1H9J A;  3I4M B;  2F3V A;  5LHY 1;  2ICE C;  4LFA M;  4ZKB B;  4HL4 A;  1VDD A;  5LMN M;  1G29 1;  5EJC A;  4A3D B;  3HHX A;  4LRT A;  4RGN A;  2LY7 A;  3MXG A;  4YIJ A;  3WDN A;  2BJW A;  1XHB A;  3I51 A;  1D2B A;  8CAT A;  1HHV A;  2L7I A;  3C3L A;  3GLH A;  3J81 E;  1GHJ A;  3FPU B;  5ITR A;  4JI3 M;  3M4O B;  2VII A;  2PZT A;  4C3I B;  2Y21 A;  5C18 A;  3FUX A;  1D1I A;  3K58 A;  4IBD A;  2RKO A;  2EYP A;  4XYQ A;  3U6P A;  3Q0A A;  5C4X B;  5EXT A;  2RBM A;  4QCL A;  4XBO A;  3NE5 B;  3CRK C;  1WTP A;  4NOO B;  2OF1 A;  1SYG A;  4G4K A;  2PO4 A;  3U6C A;  1EE8 A;  3TN2 A;  5IGF A;  3U5Z B;  5C1B A;  4Q5V A;  4F8M A;  2UUA M;  2K6A A;  1A3T A;  3FTE A;  1NR2 A;  3L28 A;  3I4Y A;  1S5F D;  4IUP A;  2CV0 A;  1I4P A;  2FNA A;  4A3J B;  4W5W A;  3S14 B;  4FYD A;  2IX0 A;  3D6W A;  2D2C C;  5ITY A;  3THG A;  1WTQ A;  4C56 C;  1WVL A;  2DWN A;  4NKL A;  2EYF A;  5M9O A;  3UMM A;  4MHE A;  4IJE A;  2G9D A;  4DAY A;  5J39 A;  2OQ4 A;  4A3F B;  5J22 A;  1G2T A;  1LTI D;  2B2U C;  2HHH M;  1QYR A;  5FO7 B;  5KPR A;  3K5L A;  2PW5 A;  5JAV A;  3HOU B;  4K6D A;  4JBW A;  3HHY A;  1L1T A;  2XFS A;  4RH6 A;  2B2V C;  1LLR D;  3L3O C;  3GO5 A;  2BDN A;  1FNN A;  1C1K A;  1ZAE A;  3NTH A;  1J9O A;  4LJ5 A;  1MSG A;  1Y8O B;  3HOX B;  2Z4S A;  1BBX C;  3O13 A;  1QQW A;  4ULL A;  4XQQ A;  3S1N B;  4LY6 A;  3A42 A;  3QAU A;  1NJG A;  4B7G A;  4PDG A;  3GTO B;  4NP5 A;  1FD7 D;  2J7O A;  4XT3 B;  3I4N B;  3CF0 A;  3HOV B;  3MFY A;  3H4M A;  4A93 B;  4EVO A;  1MU5 A;  2OT2 A;  3SAR A;  3AOE A;  1QCB D;  1PYW D;  3G7L A;  5C0X G;  1SXJ B;  3GTK B;  2N55 A;  3IG5 A;  1IW7 C;  5KQD A;  2RKS A;  4DV6 M;  4M9S A;  4JI8 M;  1L8Q A;  2SOB A;  5IT9 E;  4XYO A;  5ELC A;  3RZD B;  4OVZ A;  4DR4 M;  4M0D A;  2LNH C;  5KGU A;  2F0I A;  2DN8 A;  1HCZ A;  4TRD A;  3U6M A;  1GUT A;  4ZK9 B;  1PLF A;  4CKB A;  4FXD A;  4V19 0;  3S15 B;  2E75 C;  3KSJ A;  2K03 A;  1Z5C A;  3ERO A;  1HT2 E;  5ITQ A;  3FPP A;  5M3F B;  4K2L A;  5K5P A;  1NSF A;  2EA0 A;  4B3S M;  2KRU A;  3LQQ A;  3AB9 A;  1GUS A;  1NSN S;  4ZPX A;  3HS0 C;  3D4W A;  3TZU A;  3A45 A;  3X3N A;  3E5S A;  3BZD B;  1IXR C;  1WTX A;  4NDX A;  4HSV A;  1F9P A;  1IHZ A;  4BY1 B;  3BVZ A;  5CV7 A;  4K5X A;  4ZAI A;  5M5Y B;  5A2Q S;  3H94 A;  4OO1 I;  4ODG A;  1C8C A;  2VQE M;  1LAB A;  3SHG B;  3I72 A;  1QJO A;  4M8A A;  3GV6 A;  3R2T A;  3AFH A;  1G91 A;  4MH0 E;  2H1R A;  2CV2 A;  2B2T A;  4JK1 C;  1B4O A;  5ELB A;  3LWE A;  1H9M A;  2G8L A;  4K5W A;  1EFI D;  3K57 A;  1DGG A;  1F2Z A;  1YE9 A;  5E26 A;  3A54 A;  3IFT A;  1A3V A;  4I81 A;  3CQZ B;  5FTN A;  1K83 B;  5IRE B;  1OFH A;  1SBB B;  2JEB I;  4FCT A;  1EU4 A;  1PMR A;  2AHM A;  2JYO A;  3P20 A;  1ET9 A;  2B39 A;  4KJN A;  3PUV A;  1SMY C;  4GKK M;  1CHP D;  2GA4 B;  4GMQ A;  3MWY W;  3UZU A;  5E4W C;  4LJ8 A;  1G59 A;  3U61 B;  4MN3 A;  1RDP D;  1ML0 D;  2C96 A;  1HR0 M;  2BE5 C;  3L27 A;  1QIL A;  5FO9 B;  2F0O A;  3OOC A;  1Q8I A;  3LMM A;  1H9S B;  4IUV A;  1STY A;  2YQZ A;  3DUZ A;  1SE3 A;  4S12 A;  1VMC A;  4C3I G;  1HTL D;  4MGY E;  3I4V A;  5KO3 A;  4PNY A;  2YR0 A;  3SAS A;  3ND9 A;  3JAM E;  4R3D A;  4KD4 A;  2O4X A;  4QMG A;  1K3X A;  1QB5 D;  1RTO A;  2I7P A;  4J6H A;  3M3Y B;  4GC9 A;  3FMC A;  3T51 B;  1QAO A;  3DM1 A;  4BLC A;  3ZCB B;  5HGT A;  3GTG B;  2NTT A;  1K3W A;  1EIG A;  2CHV A;  3L26 A;  2DWM A;  2I7N A;  1NUC A;  3MHV C;  3VR6 A;  3EA6 A;  2SEB D;  3HU3 A;  4KHP M;  4ZUJ A;  1STG A;  3BDC A;  4G4R A;  1N77 A;  3PMF A;  1F77 A;  5CGK A;  3SHL A;  3Q23 A;  4AKI A;  1XYI A;  3TWL A;  4B3R M;  1G8P A;  1KLG D;  5E1F A;  3FTF A;  3GQ3 A;  3NWS A;  1HQM C;  3GPY A;  4ITQ A;  1GUO A;  3PO3 B;  1IYV A;  1SND A;  2W82 A;  5IGG A;  4BB9 A;  2QF7 A;  1BF4 A;  4QHT A;  2HCC A;  1R9T B;  1HRJ A;  2OXP A;  3ZC7 B;  1TY2 A;  5JPN C;  1MSH A;  1D5Z C;  1Q39 A;  4RA8 A;  4RAU C;  1A6X A;  5C3W A;  3KSX A;  3GRV A;  5CBA E;  1AZQ A;  3VYU A;  1LAC A;  2O2L D;  1E94 E;  1RJT A;  3T1Y M;  1XNQ M;  4JI7 M;  4OU7 A;  2XSZ A;  2EYL A;  2EYM A;  2CEA A;  2AQ2 B;  2N88 A;  3BDO A;  5EXX A;  2B2U A;  1GVN A;  1W6J A;  2B2W C;  1II3 A;  1QVR A;  1DGF A;  3A98 B;  5CV9 A;  3OTO M;  3HOW B;  4LZJ A;  1PZJ D;  3OSO A;  1EZ8 A;  5COY A;  1PJI A;  1V43 A;  3I4L A;  2M60 A;  5I6W A;  3KFU G;  2B2V A;  4A3B B;  1WXQ A;  3K0Y A;  1SXJ D;  3U60 A;  1B9M A;  2KHS A;  1DXM A;  4TQU S;  4DU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...