4X62M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x62M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x62M02
2UXBM 2ZBKB 4B3SM 1Z5AA 3DOAA 1HNZM 2UU9M 3U6MA 2UUAM 1IBLM 3VK8A 2VQFM 3SBJA 4LF9M 3J81S 1MX0A 4LF6M 4OX9M 2F5PA 4PD2A 2Q2EB 3SASA 3GPPA 1PJJA 4DR1M 4G4RA 3JR5A 3TWMA 4DUYM 1L2CA 1L2BA 1TDZA 2EA0A 4X62M 2HHHM 4PCZA 3GQ5A 3U6SA 1K3WA 4JI6M 4DV2M 5LMNM 1XNRM 3GP1A 3SAVA 4G4NA 5IWAM 4JI0M 3TWLA 5ITYA 3U6OA 3JR4A 3W0FA 5ITTA 1N32M 4JV5M 3VK7A 4DV0M 1MU5A 3U6LA 3T1YM 2UXDM 3U6CA 4JI2M 3A42A 3U6DA 5ITRA 2F5OA 2F5SA 3GPXA 5ITXE 5A2QS 2F5QA 3GQ3A 1L2DA 4MB7A 1KFVA 3A46A 2VQEM 4DUZM 3GO8A 2XZUA 4JI7M 4X66M 4LF8M 4KHPM 4JI1M 4DV7M 3U6QA 3JAMS 1FJGM 5ITQA 1J5EM 4DV5M 3SAUA 1HR0M 1TDHA 4DR2M 4JYAM 4JI5M 3SARA 4AQYM 1XMQM 5ITXA 1Q3CA 4PDIA 3U6PA 1NNJA 1XMOM 1PM5A 5LMUM 1L1TA 4YY3M 3U6EA 1L1ZA 4X64M 4LF4M 2UUCM 4DV6M 1K82A 4DV4M 1Z59A 4G4OA 1XNQM 1Z5CA 2E5LM 3GPYA 2XZFA 1R2YA 1N36M 2UUBM 2F5NA 4DR4M 4YHHM 2ZM6M 5FLXS 4NXNM 2HKJA 1Q39A 4DR5M 4JI4M 4LF7M 4NRVA 1Z5BA 1IBKM 4PDGA 1K3XA 2UXCM 4CISA 1EE8A 1XC8A 3A45A 2F4VM 1N33M 3TWKA 3SAWA 1HNXM 4G4QA 1N34M 4NXMM 4DV3M 4DR7M 1IBMM 5BR8M 4K0KM 3GQ4A 1I94M 4NRWA 3GPUA 4GKKM 2OPFA 4LF5M 4X65M 4B3RM 5IT9S 3OTOM 2OQ4A 1PJIA 3J80S 3T1HM 4ITQA 4JI8M 4DV1M 1HNWM 4B3TM 4LFCM 4LFAM 4DR3M 3C58A 4LFBM 4DR6M 4GKJM 1R2ZA 1Q3BA 4B3MM 4JI3M 3SATA 5ITUA 3J7AS
chains in the Genus database with same CATH superfamily
2DHRA 4R3DA 3ZC7B 3R8FA 4B3SM 3LCUA 2R18A 1SXJA 1JR3E 2L6OA 3U6MA 2UU9M 4AI6A 1DGHA 2APLA 3HU1A 1NJGA 2ZAMA 4IBBA 4FD2A 2MH8A 3J81S 1MX0A 4LF6M 2L7IA 4KO8A 4MM3B 1PJJA 2DWMA 3HU2A 3DFZA 5FTLA 2K9DA 4DR1M 3TWMA 1OIZA 1L2CA 1GJSA 3HHZA 4GHLA 1TDZA 4II7A 3MK6A 1VDDA 4QOZC 1HQCA 2HL7A 1P3QQ 4B7GA 4WP2A 3Q8GA 5EP2A 1NHWC 3LW5F 2Y21A 1SXJC 4NC6A 4G4NA 3LMMA 4QHSA 1DGGA 3LQRA 4KODA 1XXHB 3VK7A 4JV5M 4OVZA 2QPAA 1NJFA 1V34A 4QNMA 3FTCA 2WZJA 3T1YM 2RGHA 4HL4A 2XSZA 3AFHA 4G6ZA 4JI2M 3A42A 3U6DA 2RGOA 3GRRA 2F5SA 4IIWA 4FVMA 3ZH9B 4DBGB 5A2QS 2CEAA 2F5QA 2DAGA 3FYCA 4MB7A 3THGA 3A46A 3UGJA 2C99A 4DUZM 2XZUA 3KFUG 4NOOB 4IBFA 4LF8M 1GABA 1J09A 3PVSA 1WIVA 3B74A 3FYDA 2QZ4A 2G5GX 3KOWE 4EIWA 1TDHA 1DGBA 3IHPA 4FCWA 4JI5M 5IZ7D 2XH9A 1FNNA 2B3TA 4UN2B 1T43A 3HHYA 1NNJA 4AZFA 1ZMVA 4GITA 2LVNC 4FWDA 1NY5A 3U6EA 2AHMA 3CGWA 2UUCM 1XXHA 3W67A 2DZNB 1LTMA 2KNZA 2D7EA 2L7HA 3NBIA 4DV6M 1GJTA 2XEPA 1IN7A 1XNQM 2VIIA 2ZTDA 2EUCA 3V76A 2E5LM 4OU7A 2CWBA 1R2YA 5GKNA 1D2NA 3D8BA 1G4AE 2KDLA 1TGUA 1IY0A 1E9SA 2HCBA 4CJ6A 4DR4M 1Q39A 2L09A 3KOZE 4DR5M 3FUTA 1WGLA 3I4VA 3RGPA 2YQZA 1Z5BA 1K3XA 1GKIA 4KT0F 3H4JA 4LCBA 4RF1A 1IFYA 1ORYB 3A45A 4MGZE 2I7NA 4Q7JA 2EKKA 2DWNA 3U61A 4G4QA 2JY7A 1OAOC 2FOIC 3FKEA 1OFHA 2LVPC 1YLAA 4DR7M 5EXTA 1IY2A 5C18A 2C5RA 4LZZA 3U60A 1QVRA 2R4EA 3TQSA 2ZTCA 2OPFA 3KS4A 5DYIA 1NSFA 3T15A 4L8RC 3FUXA 5IT9S 1IN4A 1S3SA 1UM8A 2LHGA 3L26A 1DO2A 3K2LA 4B3TM 1V33A 4LFCM 2M60A 4LFAM 3AOGA 4DR3M 4NL4H 4JXJA 4LFBM 3M7GA 4PT5A 4MH0E 4FWHA 4IJEA 1TF0B 2L4FA 4JI3M 3SATA 3J7AS 4XK8F 1TH4A 2UXBM 3HZJA 2KNVA 2FE8A 1R7RA 2ZBKB 3VKHA 1IN5A 2CHVA 4L15A 2QHOB 2LWXA 1Z5AA 3K9OA 3K92A 2G8LA 1HNZM 4GHAA 2CHGA 4CIZA 3GLHA 1CUKA 3BOSA 2VF7A 3GRUA 4IBEA 3GLFB 2VQFM 3FRHA 3E9SA 1QQWA 3VK8A 1IBLM 4LF9M 4MGHA 3AOEC 4RF0A 2R65A 2Q2EB 3FUWA 4PD2A 4MGIE 4GRIA 3JR5A 4GEWA 2M5ZA 2JY6B 1EIJA 2LNHC 3QYEA 1GLNA 1K3WA 1IN6A 2YFQA 4L78A 2ZAOA 4LGYA 5H37D 3BXWA 3C3EA 1NO1A 3GP1A 3SAVA 1QDTA 4I5SA 2WSCF 1A5TA 2R44A 3I04M 2JUJA 3U6OA 3GLHE 3HHWA 1QAOA 3GLHB 2QP9X 4M9ZA 1N32M 4LJ9A 2P5TA 5EXPA 1QZEA 3U5ZB 1SG9A 4IBDA 3Q8XA 3BBZA 4A3VB 4NSRA 3SFZA 2F5OA 2JXNA 3KOYE 5ITXE 3GPXA 2DWLA 3GQ3A 5DYGA 2H1RA 1IXSA 1NNUC 1X37A 2BWBA 5BPVA 4LJ8A 3GO8A 1PJQA 3J2PB 4X66M 2X4AA 1E94E 2JWSA 2KXEA 3UK6A 5F3WA 1OAIA 4D80A 2MGWA 4JI1M 2JZ0A 3SYKA 5ITQA 2FS1A 3PNVA 1J5EM 1QZMA 4FCTA 1D0KA 1DGFA 2FFJA 3PFIA 3T38A 4AQYM 3ZCBB 1Q3CA 1JR3D 3DZDA 5FSWA 1D0MA 3EIHA 2L2DA 4IBIA 3SMSA 3UZUA 1PRBA 4FW9A 2R62A 3MMPA 3GLFA 4L6V6 5KPTA 4X64M 3C9PA 3HGIA 1VQ1A 2KZSA 2KEBA 1ZMUA 2Y0QA 4DV4M 3EIEA 1Z5CA 3GPYA 1N36M 1C7YA 2C98A 3HU3A 1L8QA 2ZM6M 4JI4M 4NXNM 2HKJA 4WURA 4LF7M 1DO0A 1HQYE 3CF6E 4XGIA 4L4UA 4PDGA 1XB2B 3SHGB 2KHHA 1OIPA 3I51A 4HLQA 3VFDA 5BR8M 4DV3M 1GL7A 4IJFA 3GLIB 3M0EA 2LVQD 4IBKA 4MGKE 1QYRA 4GKKM 3IG5A 2DAEA 4FWGA 2KW0A 1GL6A 2LHCA 4GC5A 2V1CA 2LVOC 4AG6A 2CV1A 4B3RM 2J7OA 1PJIA 1IXSB 1KYIA 3J80S 4LRTA 3U60B 4JI8M 1R5LA 3AKZA 2DAKA 3C58A 1HT1E 1WR1B 2V1UA 4AKGA 2XF3A 2XGNA 2J7NA 3VDUA 5DNYA 1R2ZA 4LJ7A 4B3MM 4IBGA 4BLCA 1IXZA 3OTOM 3B7NA 1SXJE 3KSJA 4AW4A 3R9XB 3HJSA 4RNAA 1MN3A 1SXJD 2XLJA 4CHTB 3DOAA 3H4MA 1YUBA 2CRUA 3HY5A 1YSYA 2VF8A 3WHLA 3K1JA 4ANRA 2R4JA 3MJ5A 5EJCA 3T6PA 2F5PA 3SASA 2Z4RA 3FD9A 1XWIA 1WGNA 4DUYM 2RRUA 3HWSA 3KP1E 3LVVA 2HHHM 2QCUA 3K8ZA 4PCZA 4LJ6A 1OFIA 2CFOA 4B7HA 2DKLA 5C1BA 3GQ5A 3IECA 3U6SA 1KSFX 5LMNM 4JI6M 1XNRM 3HX3A 2CE7A 4JI0M 2RKOA 3W68A 2XFTA 3JR4A 3W0FA 5ITTA 2Z8YM 1JR3A 1E32A 1DGHB 5FTJA 3RE8A 3VLFB 1PGYA 1OJLA 3KW6A 3GLFE 4IBCA 1MU5A 4L16A 5IREB 3RFWA 2BNKA 2N35A 2JNHA 3CF2A 3FTDA 4GIPA 4R71A 3LVWA 4AKIA 5ITRA 5KQ8A 5EQTA 2CUZA 2LTUA 3B7ZA 2QSFX 3TE6A 2NQ8C 4XBOA 2XFSA 2VQEM 2A5YB 4JI7M 4LJ5A 1DV0A 4LZJA 3GLGB 2KZUA 4I8OA 1J7KA 4KHPM 2QQ8A 1XXHE 1FJGM 2KA6B 2DI0A 1QUSA 4DV5M 2QENA 1N75A 1HR0M 1MJGM 2HAKA 4DR2M 2DNAA 3F92A 3QYBA 2Z3XA 2LVAA 3ILKA 1XMQM 4P16A 1ZAEA 4PDIA 5E26A 2R6FA 2G3QA 5LMUM 4WW0A 3FE3A 3KOXE 3HKPA 3PXGA 4YY3M 1G41A 1L1ZA 1WXQA 1IY1A 4LF4M 1OTRA 2DAIA 1SXJB 4Z6YA 1AIPC 1N78A 1K82A 1IXRC 5KPRA 1Z59A 1JQJC 1R6BX 3FTFA 4CGYB 1YE9A 2VDBB 5EP3A 2XZFA 3K9PA 2F5NA 4YHHM 5FLXS 3GLIA 4IBJA 4M0DA 2MROB 1QANA 5JI2E 4CISA 1R4GA 5FTNA 1EE8A 2O5RA 2R46A 3A98B 2DVWB 3MHVC 1VEGA 2F4VM 3TWKA 2DAMA 4OW0A 3SAWA 2Z4SA 3GRYA 3PNYA 4R7GA 1HNXM 4NXMM 5L8RF 1IBMM 1F4IA 2X49A 1RU3A 2DWZB 4NSOB 1G71A 3LCVB 4Z8XA 2DXIA 1T6OA 1QDRA 3B89A 4FCVA 4F2LA 4M9XA 5FTKA 3SC3A 7CATA 1V92A 1WJ7A 4LJ4A 2OOAA 3E46A 5EP4A 3T1HM 1NHGC 1NY6A 1Q02A 4M9SA 2DZLA 1HNWM 1Z6TA 2KRUA 5JI3E 3L2AA 2Y0TA 3L28A 4S12A 4TUWA 3UMMA 2FH0A 2W82A 1JB0F 4DR6M 4GKJM 3J7BA 3NWLA 1Q3BA 2O01F 2OO9A 1HJPA 4OVZB 1XHBA 2K6BA 2GNOA 5ITUA 2CV0A 4QOSA 3J27B 3KXEC 3I01M 1G8PA 2MR9A 2GQFA 2ZANA 4D82A 4JN6A 1PJTA 1QAQA 1OQYA 2QNJA 4BBAA 1N77A 2UUAM 3SBJA 2R0IA 2QBYB 2BJVA 4OX9M 1GO5A 2DENA 5KO3A 3GPPA 2KNAA 3AOEA 4G4RA 1NV8A 1BVSA 3FUUA 4QHTA 3TPZA 4LGMA 2EA0A 1L2BA 3FTEA 4X62M 1PJSA 3L25A 3FUVA 3UJNA 2YR0A 4DV2M 4D81A 1VEJA 3KSXA 5IWAM 5ITYA 3TWLA 2LXEA 4LG2A 5EXSA 1H6UA 2R45A 3KDSE 4AG5A 2BWEA 1VEKA 3B7QA 2CHQA 4GH9A 4DV0M 3VDPA 4QNRA 5DFLA 4P17A 1NV9A 3U6LA 3AL0C 2UXDM 3U6CA 2KRKA 3IG8A 1G59A 2WSEF 2C96A 2LH0A 3B9PA 4LRSA 1QAMA 2YNMD 3LQQA 1L2DA 2DHYA 1KFVA 2C9OA 1W5TA 5E6JA 2C9CA 1VDLA 1G3IA 2EJSA 3D8LA 4B08A 2HWJA 4DV7M 1UFZA 3JAMS 3U6QA 1VG5A 2Z7JA 1E9RA 3L29A 2XSZD 3SAUA 1HT2E 3KP0E 3L27A 3SMPA 4JYAM 1ZMWA 3GRVA 3SARA 1IM2A 1LV7A 1W5SA 5ITXA 4F1IA 3CF0A 3U6PA 1C1KA 1XMOM 1PM5A 3KS8A 2WSFF 8CATA 2JY5A 1L1TA 2L4EA 3AV0A 3HJ8A 1IN8A 1Y8GA 3QWLA 3C3DA 4GC9A 4MGYE 4I81A 2JZ1A 2EKFA 4REZA 4BB9A 3GLIE 3GLGE 2J5YA 4G4OA 1NVMA 2QBYA 1OKSA 2BJWA 2H5XA 4I4LA 1D0LA 2UUBM 4KLNA 4Y28F 5FTMA 4GMQA 4RKUF 5KQDA 3GLGA 2DZOB 2LBCA 1AUAA 3I4YA 1EFUB 1IQPA 1ZQ9A 2JP7A 4M0WA 2V6ZM 5EXXA 4NRVA 3U61B 1IBKM 2CV2A 3HHXA 2UXCM 2D7GA 2ERCA 3NBXX 3SHFA 3SYLA 1XC8A 1N33M 1TH2A 4LY6A 1N34M 4W5WA 1WHCA 2K47A 2X8AA 3E4RA 3FRIA 4G3OA 1TH3A 4K0KM 3U5ZA 2EO2A 2MJ5B 3GQ4A 4ZPXA 1I94M 5KPZA 3GPUA 1TR8A 3AJIB 3M6AA 4NRWA 2JY8A 3CTWB 4B7FA 4AKHA 2O25A 4X65M 4LF5M 1GVNA 3HJQA 2JA2A 4LJAA 2D7HA 3KVWA 2OQ4A 2I7PA 3RGSA 2FNAA 4ITQA 3QAUA 4DV1M 1ZV1A 4HEOA 3DA1A 3WHKA 3TL4X 2Y20A 2K0BX 3VKGA 2OOBA 3W0LB 5EP1A 3E21A 1QUTA 1TTEA 2CP8A 1I4WA 1T3TA 3ZQJA
chains in the Genus database with same CATH topology
2DHRA 4R3DA 3ZC7B 3R8FA 4B3SM 2R18A 1SXJA 2UU9M 2L6OA 3U6MA 4AI6A 1DGHA 3HU1A 1NJGA 2ZAMA 4IBBA 4FD2A 3J81S 1MX0A 4LF6M 2L7IA 4KO8A 4MM3B 1PJJA 2DWMA 3HU2A 3DFZA 5FTLA 4DR1M 3TWMA 1L2CA 3HHZA 4GHLA 1TDZA 4II7A 3MK6A 1VDDA 4QOZC 1HQCA 2HL7A 4B7GA 5EP2A 1NHWC 4G4NA 2Y21A 1SXJC 3LMMA 4QHSA 1DGGA 3LQRA 4KODA 1XXHB 3VK7A 4JV5M 4OVZA 2QPAA 1NJFA 4QNMA 3FTCA 3T1YM 2RGHA 4HL4A 2XSZA 3AFHA 4G6ZA 4JI2M 3A42A 3U6DA 2RGOA 3GRRA 2F5SA 4IIWA 4FVMA 3ZH9B 5A2QS 2CEAA 2F5QA 3FYCA 4MB7A 3THGA 3A46A 3UGJA 2C99A 4DUZM 2XZUA 3KFUG 4NOOB 4IBFA 4LF8M 1J09A 3PVSA 3FYDA 2QZ4A 2G5GX 3KOWE 4EIWA 1TDHA 1DGBA 4FCWA 4JI5M 5IZ7D 2XH9A 1FNNA 3HHYA 1NNJA 4AZFA 4GITA 4FWDA 1NY5A 3U6EA 2AHMA 2UUCM 1XXHA 2DZNB 3NBIA 4DV6M 2D7EA 2L7HA 2XEPA 1IN7A 1XNQM 2VIIA 2EUCA 2E5LM 4OU7A 1R2YA 5GKNA 1D2NA 3D8BA 1G4AE 1TGUA 1IY0A 1E9SA 2HCBA 4DR4M 1Q39A 2L09A 3KOZE 4DR5M 3FUTA 3I4VA 3RGPA 2YQZA 1Z5BA 1K3XA 1GKIA 4LCBA 4RF1A 1ORYB 3A45A 4MGZE 2I7NA 2DWNA 3U61A 4G4QA 3FKEA 2FOIC 4DR7M 1OFHA 5EXTA 1IY2A 5C18A 2C5RA 4LZZA 3U60A 1QVRA 2R4EA 3TQSA 2OPFA 3KS4A 5DYIA 1NSFA 3T15A 4L8RC 3FUXA 5IT9S 1IN4A 1S3SA 1UM8A 3L26A 1DO2A 3K2LA 4B3TM 4LFCM 2M60A 4LFAM 3AOGA 4DR3M 4NL4H 4JXJA 4LFBM 3M7GA 4PT5A 4MH0E 4FWHA 4IJEA 4JI3M 3SATA 3J7AS 1TH4A 2UXBM 2FE8A 1R7RA 2ZBKB 3VKHA 1IN5A 2CHVA 4L15A 2LWXA 1Z5AA 3K92A 2G8LA 1HNZM 4GHAA 2CHGA 3GLHA 3GRUA 3BOSA 3GLFB 4IBEA 1IBLM 3VK8A 2VQFM 4LF9M 3E9SA 1QQWA 4MGHA 3AOEC 4RF0A 2R65A 2Q2EB 3FUWA 4PD2A 4MGIE 4GRIA 3JR5A 2M5ZA 2LNHC 1GLNA 1K3WA 1IN6A 2YFQA 4L78A 2ZAOA 4LGYA 5H37D 3GP1A 3SAVA 4I5SA 3U6OA 3HHWA 1QAOA 3GLHB 2QP9X 4M9ZA 1N32M 4LJ9A 2P5TA 5EXPA 3U5ZB 4IBDA 3Q8XA 4A3VB 4NSRA 3SFZA 2F5OA 3KOYE 5ITXE 3GPXA 2DWLA 3GQ3A 5DYGA 2H1RA 1NNUC 1X37A 5BPVA 4LJ8A 3GO8A 3J2PB 4X66M 2X4AA 1E94E 2KXEA 3UK6A 5F3WA 4D80A 4JI1M 3SYKA 5ITQA 3PNVA 1J5EM 1QZMA 4FCTA 1DGFA 2FFJA 3PFIA 3T38A 4AQYM 3ZCBB 1Q3CA 1JR3D 3DZDA 5FSWA 3EIHA 4IBIA 3SMSA 3UZUA 4FW9A 2R62A 3GLFA 4X64M 5KPTA 3HGIA 2KZSA 2KEBA 2Y0QA 4DV4M 3EIEA 1Z5CA 3GPYA 1N36M 2C98A 3HU3A 1L8QA 2ZM6M 4JI4M 4NXNM 2HKJA 4WURA 4LF7M 1DO0A 1HQYE 3CF6E 4XGIA 4L4UA 4PDGA 3SHGB 3VFDA 3I51A 4HLQA 5BR8M 4DV3M 1GL7A 4IJFA 3GLIB 3M0EA 4IBKA 4MGKE 1QYRA 4GKKM 3IG5A 4FWGA 2KW0A 1GL6A 4GC5A 4AG6A 2V1CA 2CV1A 4B3RM 2J7OA 1PJIA 1IXSB 1KYIA 3J80S 4LRTA 3U60B 4JI8M 3AKZA 3C58A 1HT1E 2V1UA 4AKGA 2XF3A 2XGNA 2J7NA 3VDUA 5DNYA 1R2ZA 4LJ7A 4B3MM 4IBGA 4BLCA 1IXZA 3OTOM 1SXJE 3KSJA 4AW4A 3R9XB 3HJSA 4RNAA 1SXJD 2XLJA 4CHTB 3DOAA 3H4MA 1YUBA 1YSYA 3WHLA 3K1JA 2R4JA 3MJ5A 5EJCA 2F5PA 3SASA 2Z4RA 3FD9A 1XWIA 4DUYM 3HWSA 3KP1E 3LVVA 2HHHM 2QCUA 3K8ZA 4PCZA 4LJ6A 1OFIA 2CFOA 4B7HA 3GQ5A 5C1BA 3U6SA 4JI6M 1KSFX 5LMNM 1XNRM 2CE7A 4JI0M 2RKOA 2XFTA 3JR4A 3W0FA 5ITTA 3RE8A 1JR3A 1E32A 1DGHB 5FTJA 3VLFB 1OJLA 3KW6A 4IBCA 1MU5A 4L16A 5IREB 3RFWA 2BNKA 3FTDA 3CF2A 4GIPA 4AKIA 3LVWA 5ITRA 5KQ8A 5EQTA 2CUZA 3TE6A 2NQ8C 4XBOA 2XFSA 2VQEM 2A5YB 4JI7M 4LJ5A 4LZJA 3GLGB 2KZUA 4I8OA 1J7KA 4KHPM 2KA6B 4DV5M 1N75A 2QENA 1HR0M 4DR2M 2Z3XA 1XMQM 3ILKA 4P16A 1ZAEA 4PDIA 5E26A 5LMUM 4WW0A 3KOXE 3HKPA 3PXGA 4YY3M 1G41A 1L1ZA 1WXQA 1IY1A 4LF4M 1SXJB 4Z6YA 1N78A 1K82A 1IXRC 5KPRA 1Z59A 1JQJC 1R6BX 3FTFA 4CGYB 1YE9A 5EP3A 2XZFA 2F5NA 4YHHM 5FLXS 3GLIA 4IBJA 4M0DA 1QANA 5JI2E 4CISA 5FTNA 1EE8A 2O5RA 2R46A 3A98B 2DVWB 3MHVC 2F4VM 3TWKA 4OW0A 3SAWA 1HNXM 2Z4SA 3GRYA 3PNYA 4R7GA 4NXMM 1IBMM 2X49A 2DWZB 4NSOB 4Z8XA 2DXIA 4FCVA 4M9XA 5FTKA 3SC3A 7CATA 4LJ4A 5EP4A 3T1HM 1NHGC 1NY6A 4M9SA 1HNWM 1Z6TA 2KRUA 5JI3E 3L2AA 2Y0TA 3L28A 4S12A 4TUWA 3UMMA 4DR6M 2W82A 4GKJM 3J7BA 3NWLA 1Q3BA 4OVZB 1XHBA 5ITUA 2CV0A 4QOSA 3J27B 3KXEC 1G8PA 2ZANA 4D82A 4JN6A 1QAQA 4BBAA 1N77A 2UUAM 2QBYB 3SBJA 2BJVA 4OX9M 3GPPA 5KO3A 3AOEA 4G4RA 3TPZA 3FUUA 4QHTA 1L2BA 4LGMA 2EA0A 3FTEA 4X62M 3L25A 3FUVA 3UJNA 2YR0A 4DV2M 4D81A 3KSXA 5IWAM 5ITYA 3TWLA 2LXEA 4LG2A 5EXSA 1H6UA 2R45A 3KDSE 4AG5A 2CHQA 4GH9A 4DV0M 3VDPA 4QNRA 3U6LA 3AL0C 2UXDM 3U6CA 2KRKA 3IG8A 1G59A 2C96A 2LH0A 3B9PA 4LRSA 1QAMA 2YNMD 3LQQA 1L2DA 1KFVA 2C9OA 1W5TA 5E6JA 2C9CA 1G3IA 3D8LA 4B08A 4DV7M 3U6QA 3JAMS 2Z7JA 1E9RA 3L29A 2XSZD 3SAUA 1HT2E 3KP0E 3L27A 3SMPA 4JYAM 3GRVA 3SARA 1IM2A 1LV7A 1W5SA 5ITXA 3CF0A 3U6PA 1C1KA 1XMOM 1PM5A 3KS8A 8CATA 1L1TA 3AV0A 3HJ8A 1IN8A 3QWLA 4GC9A 4MGYE 4I81A 4REZA 4BB9A 4G4OA 1NVMA 2QBYA 2BJWA 4I4LA 2UUBM 4KLNA 5FTMA 4GMQA 5KQDA 3GLGA 2DZOB 3I4YA 1ZQ9A 1IQPA 4M0WA 2V6ZM 5EXXA 4NRVA 3U61B 1IBKM 2CV2A 3HHXA 2UXCM 2D7GA 2ERCA 3SHFA 1XC8A 3SYLA 1N33M 1TH2A 4LY6A 1N34M 4W5WA 3E4RA 2K47A 2X8AA 1TH3A 4K0KM 3U5ZA 2EO2A 3GQ4A 4ZPXA 1I94M 5KPZA 3GPUA 3AJIB 3M6AA 4NRWA 3CTWB 4B7FA 4AKHA 4LF5M 4X65M 1GVNA 3HJQA 2JA2A 4LJAA 2D7HA 3KVWA 2OQ4A 2I7PA 3RGSA 2FNAA 4ITQA 3QAUA 4DV1M 3DA1A 3WHKA 3TL4X 2Y20A 3VKGA 3W0LB 5EP1A 1FJGM 1I4WA 1T3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB M;  2ZBK B;  4B3S M;  1Z5A A;  3DOA A;  1HNZ M;  2UU9 M;  3U6M A;  2UUA M;  1IBL M;  3VK8 A;  2VQF M;  3SBJ A;  4LF9 M;  3J81 S;  1MX0 A;  4LF6 M;  4OX9 M;  2F5P A;  4PD2 A;  2Q2E B;  3SAS A;  3GPP A;  1PJJ A;  4DR1 M;  4G4R A;  3JR5 A;  3TWM A;  4DUY M;  1L2C A;  1L2B A;  1TDZ A;  2EA0 A;  4X62 M;  2HHH M;  4PCZ A;  3GQ5 A;  3U6S A;  1K3W A;  4JI6 M;  4DV2 M;  5LMN M;  1XNR M;  3GP1 A;  3SAV A;  4G4N A;  5IWA M;  4JI0 M;  3TWL A;  5ITY A;  3U6O A;  3JR4 A;  3W0F A;  5ITT A;  1N32 M;  4JV5 M;  3VK7 A;  4DV0 M;  1MU5 A;  3U6L A;  3T1Y M;  2UXD M;  3U6C A;  4JI2 M;  3A42 A;  3U6D A;  5ITR A;  2F5O A;  2F5S A;  3GPX A;  5ITX E;  5A2Q S;  2F5Q A;  3GQ3 A;  1L2D A;  4MB7 A;  1KFV A;  3A46 A;  2VQE M;  4DUZ M;  3GO8 A;  2XZU A;  4JI7 M;  4X66 M;  4LF8 M;  4KHP M;  4JI1 M;  4DV7 M;  3U6Q A;  3JAM S;  1FJG M;  5ITQ A;  1J5E M;  4DV5 M;  3SAU A;  1HR0 M;  1TDH A;  4DR2 M;  4JYA M;  4JI5 M;  3SAR A;  4AQY M;  1XMQ M;  5ITX A;  1Q3C A;  4PDI A;  3U6P A;  1NNJ A;  1XMO M;  1PM5 A;  5LMU M;  1L1T A;  4YY3 M;  3U6E A;  1L1Z A;  4X64 M;  4LF4 M;  2UUC M;  4DV6 M;  1K82 A;  4DV4 M;  1Z59 A;  4G4O A;  1XNQ M;  1Z5C A;  2E5L M;  3GPY A;  2XZF A;  1R2Y A;  1N36 M;  2UUB M;  2F5N A;  4DR4 M;  4YHH M;  2ZM6 M;  5FLX S;  4NXN M;  2HKJ A;  1Q39 A;  4DR5 M;  4JI4 M;  4LF7 M;  4NRV A;  1Z5B A;  1IBK M;  4PDG A;  1K3X A;  2UXC M;  4CIS A;  1EE8 A;  1XC8 A;  3A45 A;  2F4V M;  1N33 M;  3TWK A;  3SAW A;  1HNX M;  4G4Q A;  1N34 M;  4NXM M;  4DV3 M;  4DR7 M;  1IBM M;  5BR8 M;  4K0K M;  3GQ4 A;  1I94 M;  4NRW A;  3GPU A;  4GKK M;  2OPF A;  4LF5 M;  4X65 M;  4B3R M;  5IT9 S;  3OTO M;  2OQ4 A;  1PJI A;  3J80 S;  3T1H M;  4ITQ A;  4JI8 M;  4DV1 M;  1HNW M;  4B3T M;  4LFC M;  4LFA M;  4DR3 M;  3C58 A;  4LFB M;  4DR6 M;  4GKJ M;  1R2Z A;  1Q3B A;  4B3M M;  4JI3 M;  3SAT A;  5ITU A;  3J7A S; 
#chains in the Genus database with same CATH topology
 2DHR A;  4R3D A;  3ZC7 B;  3R8F A;  4B3S M;  3LCU A;  2R18 A;  1SXJ A;  1JR3 E;  2L6O A;  3U6M A;  2UU9 M;  4AI6 A;  1DGH A;  2APL A;  3HU1 A;  1NJG A;  2ZAM A;  4IBB A;  4FD2 A;  2MH8 A;  3J81 S;  1MX0 A;  4LF6 M;  2L7I A;  4KO8 A;  4MM3 B;  1PJJ A;  2DWM A;  3HU2 A;  3DFZ A;  5FTL A;  2K9D A;  4DR1 M;  3TWM A;  1OIZ A;  1L2C A;  1GJS A;  3HHZ A;  4GHL A;  1TDZ A;  4II7 A;  3MK6 A;  1VDD A;  4QOZ C;  1HQC A;  2HL7 A;  1P3Q Q;  4B7G A;  4WP2 A;  3Q8G A;  5EP2 A;  1NHW C;  3LW5 F;  2Y21 A;  1SXJ C;  4NC6 A;  4G4N A;  3LMM A;  4QHS A;  1DGG A;  3LQR A;  4KOD A;  1XXH B;  3VK7 A;  4JV5 M;  4OVZ A;  2QPA A;  1NJF A;  1V34 A;  4QNM A;  3FTC A;  2WZJ A;  3T1Y M;  2RGH A;  4HL4 A;  2XSZ A;  3AFH A;  4G6Z A;  4JI2 M;  3A42 A;  3U6D A;  2RGO A;  3GRR A;  2F5S A;  4IIW A;  4FVM A;  3ZH9 B;  4DBG B;  5A2Q S;  2CEA A;  2F5Q A;  2DAG A;  3FYC A;  4MB7 A;  3THG A;  3A46 A;  3UGJ A;  2C99 A;  4DUZ M;  2XZU A;  3KFU G;  4NOO B;  4IBF A;  4LF8 M;  1GAB A;  1J09 A;  3PVS A;  1WIV A;  3B74 A;  3FYD A;  2QZ4 A;  2G5G X;  3KOW E;  4EIW A;  1TDH A;  1DGB A;  3IHP A;  4FCW A;  4JI5 M;  5IZ7 D;  2XH9 A;  1FNN A;  2B3T A;  4UN2 B;  1T43 A;  3HHY A;  1NNJ A;  4AZF A;  1ZMV A;  4GIT A;  2LVN C;  4FWD A;  1NY5 A;  3U6E A;  2AHM A;  3CGW A;  2UUC M;  1XXH A;  3W67 A;  2DZN B;  1LTM A;  2KNZ A;  2D7E A;  2L7H A;  3NBI A;  4DV6 M;  1GJT A;  2XEP A;  1IN7 A;  1XNQ M;  2VII A;  2ZTD A;  2EUC A;  3V76 A;  2E5L M;  4OU7 A;  2CWB A;  1R2Y A;  5GKN A;  1D2N A;  3D8B A;  1G4A E;  2KDL A;  1TGU A;  1IY0 A;  1E9S A;  2HCB A;  4CJ6 A;  4DR4 M;  1Q39 A;  2L09 A;  3KOZ E;  4DR5 M;  3FUT A;  1WGL A;  3I4V A;  3RGP A;  2YQZ A;  1Z5B A;  1K3X A;  1GKI A;  4KT0 F;  3H4J A;  4LCB A;  4RF1 A;  1IFY A;  1ORY B;  3A45 A;  4MGZ E;  2I7N A;  4Q7J A;  2EKK A;  2DWN A;  3U61 A;  4G4Q A;  2JY7 A;  1OAO C;  2FOI C;  3FKE A;  1OFH A;  2LVP C;  1YLA A;  4DR7 M;  5EXT A;  1IY2 A;  5C18 A;  2C5R A;  4LZZ A;  3U60 A;  1QVR A;  2R4E A;  3TQS A;  2ZTC A;  2OPF A;  3KS4 A;  5DYI A;  1NSF A;  3T15 A;  4L8R C;  3FUX A;  5IT9 S;  1IN4 A;  1S3S A;  1UM8 A;  2LHG A;  3L26 A;  1DO2 A;  3K2L A;  4B3T M;  1V33 A;  4LFC M;  2M60 A;  4LFA M;  3AOG A;  4DR3 M;  4NL4 H;  4JXJ A;  4LFB M;  3M7G A;  4PT5 A;  4MH0 E;  4FWH A;  4IJE A;  1TF0 B;  2L4F A;  4JI3 M;  3SAT A;  3J7A S;  4XK8 F;  1TH4 A;  2UXB M;  3HZJ A;  2KNV A;  2FE8 A;  1R7R A;  2ZBK B;  3VKH A;  1IN5 A;  2CHV A;  4L15 A;  2QHO B;  2LWX A;  1Z5A A;  3K9O A;  3K92 A;  2G8L A;  1HNZ M;  4GHA A;  2CHG A;  4CIZ A;  3GLH A;  1CUK A;  3BOS A;  2VF7 A;  3GRU A;  4IBE A;  3GLF B;  2VQF M;  3FRH A;  3E9S A;  1QQW A;  3VK8 A;  1IBL M;  4LF9 M;  4MGH A;  3AOE C;  4RF0 A;  2R65 A;  2Q2E B;  3FUW A;  4PD2 A;  4MGI E;  4GRI A;  3JR5 A;  4GEW A;  2M5Z A;  2JY6 B;  1EIJ A;  2LNH C;  3QYE A;  1GLN A;  1K3W A;  1IN6 A;  2YFQ A;  4L78 A;  2ZAO A;  4LGY A;  5H37 D;  3BXW A;  3C3E A;  1NO1 A;  3GP1 A;  3SAV A;  1QDT A;  4I5S A;  2WSC F;  1A5T A;  2R44 A;  3I04 M;  2JUJ A;  3U6O A;  3GLH E;  3HHW A;  1QAO A;  3GLH B;  2QP9 X;  4M9Z A;  1N32 M;  4LJ9 A;  2P5T A;  5EXP A;  1QZE A;  3U5Z B;  1SG9 A;  4IBD A;  3Q8X A;  3BBZ A;  4A3V B;  4NSR A;  3SFZ A;  2F5O A;  2JXN A;  3KOY E;  5ITX E;  3GPX A;  2DWL A;  3GQ3 A;  5DYG A;  2H1R A;  1IXS A;  1NNU C;  1X37 A;  2BWB A;  5BPV A;  4LJ8 A;  3GO8 A;  1PJQ A;  3J2P B;  4X66 M;  2X4A A;  1E94 E;  2JWS A;  2KXE A;  3UK6 A;  5F3W A;  1OAI A;  4D80 A;  2MGW A;  4JI1 M;  2JZ0 A;  3SYK A;  5ITQ A;  2FS1 A;  3PNV A;  1J5E M;  1QZM A;  4FCT A;  1D0K A;  1DGF A;  2FFJ A;  3PFI A;  3T38 A;  4AQY M;  3ZCB B;  1Q3C A;  1JR3 D;  3DZD A;  5FSW A;  1D0M A;  3EIH A;  2L2D A;  4IBI A;  3SMS A;  3UZU A;  1PRB A;  4FW9 A;  2R62 A;  3MMP A;  3GLF A;  4L6V 6;  5KPT A;  4X64 M;  3C9P A;  3HGI A;  1VQ1 A;  2KZS A;  2KEB A;  1ZMU A;  2Y0Q A;  4DV4 M;  3EIE A;  1Z5C A;  3GPY A;  1N36 M;  1C7Y A;  2C98 A;  3HU3 A;  1L8Q A;  2ZM6 M;  4JI4 M;  4NXN M;  2HKJ A;  4WUR A;  4LF7 M;  1DO0 A;  1HQY E;  3CF6 E;  4XGI A;  4L4U A;  4PDG A;  1XB2 B;  3SHG B;  2KHH A;  1OIP A;  3I51 A;  4HLQ A;  3VFD A;  5BR8 M;  4DV3 M;  1GL7 A;  4IJF A;  3GLI B;  3M0E A;  2LVQ D;  4IBK A;  4MGK E;  1QYR A;  4GKK M;  3IG5 A;  2DAE A;  4FWG A;  2KW0 A;  1GL6 A;  2LHC A;  4GC5 A;  2V1C A;  2LVO C;  4AG6 A;  2CV1 A;  4B3R M;  2J7O A;  1PJI A;  1IXS B;  1KYI A;  3J80 S;  4LRT A;  3U60 B;  4JI8 M;  1R5L A;  3AKZ A;  2DAK A;  3C58 A;  1HT1 E;  1WR1 B;  2V1U A;  4AKG A;  2XF3 A;  2XGN A;  2J7N A;  3VDU A;  5DNY A;  1R2Z A;  4LJ7 A;  4B3M M;  4IBG A;  4BLC A;  1IXZ A;  3OTO M;  3B7N A;  1SXJ E;  3KSJ A;  4AW4 A;  3R9X B;  3HJS A;  4RNA A;  1MN3 A;  1SXJ D;  2XLJ A;  4CHT B;  3DOA A;  3H4M A;  1YUB A;  2CRU A;  3HY5 A;  1YSY A;  2VF8 A;  3WHL A;  3K1J A;  4ANR A;  2R4J A;  3MJ5 A;  5EJC A;  3T6P A;  2F5P A;  3SAS A;  2Z4R A;  3FD9 A;  1XWI A;  1WGN A;  4DUY M;  2RRU A;  3HWS A;  3KP1 E;  3LVV A;  2HHH M;  2QCU A;  3K8Z A;  4PCZ A;  4LJ6 A;  1OFI A;  2CFO A;  4B7H A;  2DKL A;  5C1B A;  3GQ5 A;  3IEC A;  3U6S A;  1KSF X;  5LMN M;  4JI6 M;  1XNR M;  3HX3 A;  2CE7 A;  4JI0 M;  2RKO A;  3W68 A;  2XFT A;  3JR4 A;  3W0F A;  5ITT A;  2Z8Y M;  1JR3 A;  1E32 A;  1DGH B;  5FTJ A;  3RE8 A;  3VLF B;  1PGY A;  1OJL A;  3KW6 A;  3GLF E;  4IBC A;  1MU5 A;  4L16 A;  5IRE B;  3RFW A;  2BNK A;  2N35 A;  2JNH A;  3CF2 A;  3FTD A;  4GIP A;  4R71 A;  3LVW A;  4AKI A;  5ITR A;  5KQ8 A;  5EQT A;  2CUZ A;  2LTU A;  3B7Z A;  2QSF X;  3TE6 A;  2NQ8 C;  4XBO A;  2XFS A;  2VQE M;  2A5Y B;  4JI7 M;  4LJ5 A;  1DV0 A;  4LZJ A;  3GLG B;  2KZU A;  4I8O A;  1J7K A;  4KHP M;  2QQ8 A;  1XXH E;  1FJG M;  2KA6 B;  2DI0 A;  1QUS A;  4DV5 M;  2QEN A;  1N75 A;  1HR0 M;  1MJG M;  2HAK A;  4DR2 M;  2DNA A;  3F92 A;  3QYB A;  2Z3X A;  2LVA A;  3ILK A;  1XMQ M;  4P16 A;  1ZAE A;  4PDI A;  5E26 A;  2R6F A;  2G3Q A;  5LMU M;  4WW0 A;  3FE3 A;  3KOX E;  3HKP A;  3PXG A;  4YY3 M;  1G41 A;  1L1Z A;  1WXQ A;  1IY1 A;  4LF4 M;  1OTR A;  2DAI A;  1SXJ B;  4Z6Y A;  1AIP C;  1N78 A;  1K82 A;  1IXR C;  5KPR A;  1Z59 A;  1JQJ C;  1R6B X;  3FTF A;  4CGY B;  1YE9 A;  2VDB B;  5EP3 A;  2XZF A;  3K9P A;  2F5N A;  4YHH M;  5FLX S;  3GLI A;  4IBJ A;  4M0D A;  2MRO B;  1QAN A;  5JI2 E;  4CIS A;  1R4G A;  5FTN A;  1EE8 A;  2O5R A;  2R46 A;  3A98 B;  2DVW B;  3MHV C;  1VEG A;  2F4V M;  3TWK A;  2DAM A;  4OW0 A;  3SAW A;  2Z4S A;  3GRY A;  3PNY A;  4R7G A;  1HNX M;  4NXM M;  5L8R F;  1IBM M;  1F4I A;  2X49 A;  1RU3 A;  2DWZ B;  4NSO B;  1G71 A;  3LCV B;  4Z8X A;  2DXI A;  1T6O A;  1QDR A;  3B89 A;  4FCV A;  4F2L A;  4M9X A;  5FTK A;  3SC3 A;  7CAT A;  1V92 A;  1WJ7 A;  4LJ4 A;  2OOA A;  3E46 A;  5EP4 A;  3T1H M;  1NHG C;  1NY6 A;  1Q02 A;  4M9S A;  2DZL A;  1HNW M;  1Z6T A;  2KRU A;  5JI3 E;  3L2A A;  2Y0T A;  3L28 A;  4S12 A;  4TUW A;  3UMM A;  2FH0 A;  2W82 A;  1JB0 F;  4DR6 M;  4GKJ M;  3J7B A;  3NWL A;  1Q3B A;  2O01 F;  2OO9 A;  1HJP A;  4OVZ B;  1XHB A;  2K6B A;  2GNO A;  5ITU A;  2CV0 A;  4QOS A;  3J27 B;  3KXE C;  3I01 M;  1G8P A;  2MR9 A;  2GQF A;  2ZAN A;  4D82 A;  4JN6 A;  1PJT A;  1QAQ A;  1OQY A;  2QNJ A;  4BBA A;  1N77 A;  2UUA M;  3SBJ A;  2R0I A;  2QBY B;  2BJV A;  4OX9 M;  1GO5 A;  2DEN A;  5KO3 A;  3GPP A;  2KNA A;  3AOE A;  4G4R A;  1NV8 A;  1BVS A;  3FUU A;  4QHT A;  3TPZ A;  4LGM A;  2EA0 A;  1L2B A;  3FTE A;  4X62 M;  1PJS A;  3L25 A;  3FUV A;  3UJN A;  2YR0 A;  4DV2 M;  4D81 A;  1VEJ A;  3KSX A;  5IWA M;  5ITY A;  3TWL A;  2LXE A;  4LG2 A;  5EXS A;  1H6U A;  2R45 A;  3KDS E;  4AG5 A;  2BWE A;  1VEK A;  3B7Q A;  2CHQ A;  4GH9 A;  4DV0 M;  3VDP A;  4QNR A;  5DFL A;  4P17 A;  1NV9 A;  3U6L A;  3AL0 C;  2UXD M;  3U6C A;  2KRK A;  3IG8 A;  1G59 A;  2WSE F;  2C96 A;  2LH0 A;  3B9P A;  4LRS A;  1QAM A;  2YNM D;  3LQQ A;  1L2D A;  2DHY A;  1KFV A;  2C9O A;  1W5T A;  5E6J A;  2C9C A;  1VDL A;  1G3I A;  2EJS A;  3D8L A;  4B08 A;  2HWJ A;  4DV7 M;  1UFZ A;  3JAM S;  3U6Q A;  1VG5 A;  2Z7J A;  1E9R A;  3L29 A;  2XSZ D;  3SAU A;  1HT2 E;  3KP0 E;  3L27 A;  3SMP A;  4JYA M;  1ZMW A;  3GRV A;  3SAR A;  1IM2 A;  1LV7 A;  1W5S A;  5ITX A;  4F1I A;  3CF0 A;  3U6P A;  1C1K A;  1XMO M;  1PM5 A;  3KS8 A;  2WSF F;  8CAT A;  2JY5 A;  1L1T A;  2L4E A;  3AV0 A;  3HJ8 A;  1IN8 A;  1Y8G A;  3QWL A;  3C3D A;  4GC9 A;  4MGY E;  4I81 A;  2JZ1 A;  2EKF A;  4REZ A;  4BB9 A;  3GLI E;  3GLG E;  2J5Y A;  4G4O A;  1NVM A;  2QBY A;  1OKS A;  2BJW A;  2H5X A;  4I4L A;  1D0L A;  2UUB M;  4KLN A;  4Y28 F;  5FTM A;  4GMQ A;  4RKU F;  5KQD A;  3GLG A;  2DZO B;  2LBC A;  1AUA A;  3I4Y A;  1EFU B;  1IQP A;  1ZQ9 A;  2JP7 A;  4M0W A;  2V6Z M;  5EXX A;  4NRV A;  3U61 B;  1IBK M;  2CV2 A;  3HHX A;  2UXC M;  2D7G A;  2ERC A;  3NBX X;  3SHF A;  3SYL A;  1XC8 A;  1N33 M;  1TH2 A;  4LY6 A;  1N34 M;  4W5W A;  1WHC A;  2K47 A;  2X8A A;  3E4R A;  3FRI A;  4G3O A;  1TH3 A;  4K0K M;  3U5Z A;  2EO2 A;  2MJ5 B;  3GQ4 A;  4ZPX A;  1I94 M;  5KPZ A;  3GPU A;  1TR8 A;  3AJI B;  3M6A A;  4NRW A;  2JY8 A;  3CTW B;  4B7F A;  4AKH A;  2O25 A;  4X65 M;  4LF5 M;  1GVN A;  3HJQ A;  2JA2 A;  4LJA A;  2D7H A;  3KVW A;  2OQ4 A;  2I7P A;  3RGS A;  2FNA A;  4ITQ A;  3QAU A;  4DV1 M;  1ZV1 A;  4HEO A;  3DA1 A;  3WHK A;  3TL4 X;  2Y20 A;  2K0B X;  3VKG A;  2OOB A;  3W0L B;  5EP1 A;  3E21 A;  1QUT A;  1TTE A;  2CP8 A;  1I4W A;  1T3T A;  3ZQJ A; 
#chains in the Genus database with same CATH homology
 2DHR A;  4R3D A;  3ZC7 B;  3R8F A;  4B3S M;  2R18 A;  1SXJ A;  2UU9 M;  2L6O A;  3U6M A;  4AI6 A;  1DGH A;  3HU1 A;  1NJG A;  2ZAM A;  4IBB A;  4FD2 A;  3J81 S;  1MX0 A;  4LF6 M;  2L7I A;  4KO8 A;  4MM3 B;  1PJJ A;  2DWM A;  3HU2 A;  3DFZ A;  5FTL A;  4DR1 M;  3TWM A;  1L2C A;  3HHZ A;  4GHL A;  1TDZ A;  4II7 A;  3MK6 A;  1VDD A;  4QOZ C;  1HQC A;  2HL7 A;  4B7G A;  5EP2 A;  1NHW C;  4G4N A;  2Y21 A;  1SXJ C;  3LMM A;  4QHS A;  1DGG A;  3LQR A;  4KOD A;  1XXH B;  3VK7 A;  4JV5 M;  4OVZ A;  2QPA A;  1NJF A;  4QNM A;  3FTC A;  3T1Y M;  2RGH A;  4HL4 A;  2XSZ A;  3AFH A;  4G6Z A;  4JI2 M;  3A42 A;  3U6D A;  2RGO A;  3GRR A;  2F5S A;  4IIW A;  4FVM A;  3ZH9 B;  5A2Q S;  2CEA A;  2F5Q A;  3FYC A;  4MB7 A;  3THG A;  3A46 A;  3UGJ A;  2C99 A;  4DUZ M;  2XZU A;  3KFU G;  4NOO B;  4IBF A;  4LF8 M;  1J09 A;  3PVS A;  3FYD A;  2QZ4 A;  2G5G X;  3KOW E;  4EIW A;  1TDH A;  1DGB A;  4FCW A;  4JI5 M;  5IZ7 D;  2XH9 A;  1FNN A;  3HHY A;  1NNJ A;  4AZF A;  4GIT A;  4FWD A;  1NY5 A;  3U6E A;  2AHM A;  2UUC M;  1XXH A;  2DZN B;  3NBI A;  4DV6 M;  2D7E A;  2L7H A;  2XEP A;  1IN7 A;  1XNQ M;  2VII A;  2EUC A;  2E5L M;  4OU7 A;  1R2Y A;  5GKN A;  1D2N A;  3D8B A;  1G4A E;  1TGU A;  1IY0 A;  1E9S A;  2HCB A;  4DR4 M;  1Q39 A;  2L09 A;  3KOZ E;  4DR5 M;  3FUT A;  3I4V A;  3RGP A;  2YQZ A;  1Z5B A;  1K3X A;  1GKI A;  4LCB A;  4RF1 A;  1ORY B;  3A45 A;  4MGZ E;  2I7N A;  2DWN A;  3U61 A;  4G4Q A;  3FKE A;  2FOI C;  4DR7 M;  1OFH A;  5EXT A;  1IY2 A;  5C18 A;  2C5R A;  4LZZ A;  3U60 A;  1QVR A;  2R4E A;  3TQS A;  2OPF A;  3KS4 A;  5DYI A;  1NSF A;  3T15 A;  4L8R C;  3FUX A;  5IT9 S;  1IN4 A;  1S3S A;  1UM8 A;  3L26 A;  1DO2 A;  3K2L A;  4B3T M;  4LFC M;  2M60 A;  4LFA M;  3AOG A;  4DR3 M;  4NL4 H;  4JXJ A;  4LFB M;  3M7G A;  4PT5 A;  4MH0 E;  4FWH A;  4IJE A;  4JI3 M;  3SAT A;  3J7A S;  1TH4 A;  2UXB M;  2FE8 A;  1R7R A;  2ZBK B;  3VKH A;  1IN5 A;  2CHV A;  4L15 A;  2LWX A;  1Z5A A;  3K92 A;  2G8L A;  1HNZ M;  4GHA A;  2CHG A;  3GLH A;  3GRU A;  3BOS A;  3GLF B;  4IBE A;  1IBL M;  3VK8 A;  2VQF M;  4LF9 M;  3E9S A;  1QQW A;  4MGH A;  3AOE C;  4RF0 A;  2R65 A;  2Q2E B;  3FUW A;  4PD2 A;  4MGI E;  4GRI A;  3JR5 A;  2M5Z A;  2LNH C;  1GLN A;  1K3W A;  1IN6 A;  2YFQ A;  4L78 A;  2ZAO A;  4LGY A;  5H37 D;  3GP1 A;  3SAV A;  4I5S A;  3U6O A;  3HHW A;  1QAO A;  3GLH B;  2QP9 X;  4M9Z A;  1N32 M;  4LJ9 A;  2P5T A;  5EXP A;  3U5Z B;  4IBD A;  3Q8X A;  4A3V B;  4NSR A;  3SFZ A;  2F5O A;  3KOY E;  5ITX E;  3GPX A;  2DWL A;  3GQ3 A;  5DYG A;  2H1R A;  1NNU C;  1X37 A;  5BPV A;  4LJ8 A;  3GO8 A;  3J2P B;  4X66 M;  2X4A A;  1E94 E;  2KXE A;  3UK6 A;  5F3W A;  4D80 A;  4JI1 M;  3SYK A;  5ITQ A;  3PNV A;  1J5E M;  1QZM A;  4FCT A;  1DGF A;  2FFJ A;  3PFI A;  3T38 A;  4AQY M;  3ZCB B;  1Q3C A;  1JR3 D;  3DZD A;  5FSW A;  3EIH A;  4IBI A;  3SMS A;  3UZU A;  4FW9 A;  2R62 A;  3GLF A;  4X64 M;  5KPT A;  3HGI A;  2KZS A;  2KEB A;  2Y0Q A;  4DV4 M;  3EIE A;  1Z5C A;  3GPY A;  1N36 M;  2C98 A;  3HU3 A;  1L8Q A;  2ZM6 M;  4JI4 M;  4NXN M;  2HKJ A;  4WUR A;  4LF7 M;  1DO0 A;  1HQY E;  3CF6 E;  4XGI A;  4L4U A;  4PDG A;  3SHG B;  3VFD A;  3I51 A;  4HLQ A;  5BR8 M;  4DV3 M;  1GL7 A;  4IJF A;  3GLI B;  3M0E A;  4IBK A;  4MGK E;  1QYR A;  4GKK M;  3IG5 A;  4FWG A;  2KW0 A;  1GL6 A;  4GC5 A;  4AG6 A;  2V1C A;  2CV1 A;  4B3R M;  2J7O A;  1PJI A;  1IXS B;  1KYI A;  3J80 S;  4LRT A;  3U60 B;  4JI8 M;  3AKZ A;  3C58 A;  1HT1 E;  2V1U A;  4AKG A;  2XF3 A;  2XGN A;  2J7N A;  3VDU A;  5DNY A;  1R2Z A;  4LJ7 A;  4B3M M;  4IBG A;  4BLC A;  1IXZ A;  3OTO M;  1SXJ E;  3KSJ A;  4AW4 A;  3R9X B;  3HJS A;  4RNA A;  1SXJ D;  2XLJ A;  4CHT B;  3DOA A;  3H4M A;  1YUB A;  1YSY A;  3WHL A;  3K1J A;  2R4J A;  3MJ5 A;  5EJC A;  2F5P A;  3SAS A;  2Z4R A;  3FD9 A;  1XWI A;  4DUY M;  3HWS A;  3KP1 E;  3LVV A;  2HHH M;  2QCU A;  3K8Z A;  4PCZ A;  4LJ6 A;  1OFI A;  2CFO A;  4B7H A;  3GQ5 A;  5C1B A;  3U6S A;  4JI6 M;  1KSF X;  5LMN M;  1XNR M;  2CE7 A;  4JI0 M;  2RKO A;  2XFT A;  3JR4 A;  3W0F A;  5ITT A;  3RE8 A;  1JR3 A;  1E32 A;  1DGH B;  5FTJ A;  3VLF B;  1OJL A;  3KW6 A;  4IBC A;  1MU5 A;  4L16 A;  5IRE B;  3RFW A;  2BNK A;  3FTD A;  3CF2 A;  4GIP A;  4AKI A;  3LVW A;  5ITR A;  5KQ8 A;  5EQT A;  2CUZ A;  3TE6 A;  2NQ8 C;  4XBO A;  2XFS A;  2VQE M;  2A5Y B;  4JI7 M;  4LJ5 A;  4LZJ A;  3GLG B;  2KZU A;  4I8O A;  1J7K A;  4KHP M;  2KA6 B;  4DV5 M;  1N75 A;  2QEN A;  1HR0 M;  4DR2 M;  2Z3X A;  1XMQ M;  3ILK A;  4P16 A;  1ZAE A;  4PDI A;  5E26 A;  5LMU M;  4WW0 A;  3KOX E;  3HKP A;  3PXG A;  4YY3 M;  1G41 A;  1L1Z A;  1WXQ A;  1IY1 A;  4LF4 M;  1SXJ B;  4Z6Y A;  1N78 A;  1K82 A;  1IXR C;  5KPR A;  1Z59 A;  1JQJ C;  1R6B X;  3FTF A;  4CGY B;  1YE9 A;  5EP3 A;  2XZF A;  2F5N A;  4YHH M;  5FLX S;  3GLI A;  4IBJ A;  4M0D A;  1QAN A;  5JI2 E;  4CIS A;  5FTN A;  1EE8 A;  2O5R A;  2R46 A;  3A98 B;  2DVW B;  3MHV C;  2F4V M;  3TWK A;  4OW0 A;  3SAW A;  1HNX M;  2Z4S A;  3GRY A;  3PNY A;  4R7G A;  4NXM M;  1IBM M;  2X49 A;  2DWZ B;  4NSO B;  4Z8X A;  2DXI A;  4FCV A;  4M9X A;  5FTK A;  3SC3 A;  7CAT A;  4LJ4 A;  5EP4 A;  3T1H M;  1NHG C;  1NY6 A;  4M9S A;  1HNW M;  1Z6T A;  2KRU A;  5JI3 E;  3L2A A;  2Y0T A;  3L28 A;  4S12 A;  4TUW A;  3UMM A;  4DR6 M;  2W82 A;  4GKJ M;  3J7B A;  3NWL A;  1Q3B A;  4OVZ B;  1XHB A;  5ITU A;  2CV0 A;  4QOS A;  3J27 B;  3KXE C;  1G8P A;  2ZAN A;  4D82 A;  4JN6 A;  1QAQ A;  4BBA A;  1N77 A;  2UUA M;  2QBY B;  3SBJ A;  2BJV A;  4OX9 M;  3GPP A;  5KO3 A;  3AOE A;  4G4R A;  3TPZ A;  3FUU A;  4QHT A;  1L2B A;  4LGM A;  2EA0 A;  3FTE A;  4X62 M;  3L25 A;  3FUV A;  3UJN A;  2YR0 A;  4DV2 M;  4D81 A;  3KSX A;  5IWA M;  5ITY A;  3TWL A;  2LXE A;  4LG2 A;  5EXS A;  1H6U A;  2R45 A;  3KDS E;  4AG5 A;  2CHQ A;  4GH9 A;  4DV0 M;  3VDP A;  4QNR A;  3U6L A;  3AL0 C;  2UXD M;  3U6C A;  2KRK A;  3IG8 A;  1G59 A;  2C96 A;  2LH0 A;  3B9P A;  4LRS A;  1QAM A;  2YNM D;  3LQQ A;  1L2D A;  1KFV A;  2C9O A;  1W5T A;  5E6J A;  2C9C A;  1G3I A;  3D8L A;  4B08 A;  4DV7 M;  3U6Q A;  3JAM S;  2Z7J A;  1E9R A;  3L29 A;  2XSZ D;  3SAU A;  1HT2 E;  3KP0 E;  3L27 A;  3SMP A;  4JYA M;  3GRV A;  3SAR A;  1IM2 A;  1LV7 A;  1W5S A;  5ITX A;  3CF0 A;  3U6P A;  1C1K A;  1XMO M;  1PM5 A;  3KS8 A;  8CAT A;  1L1T A;  3AV0 A;  3HJ8 A;  1IN8 A;  3QWL A;  4GC9 A;  4MGY E;  4I81 A;  4REZ A;  4BB9 A;  4G4O A;  1NVM A;  2QBY A;  2BJW A;  4I4L A;  2UUB M;  4KLN A;  5FTM A;  4GMQ A;  5KQD A;  3GLG A;  2DZO B;  3I4Y A;  1ZQ9 A;  1IQP A;  4M0W A;  2V6Z M;  5EXX A;  4NRV A;  3U61 B;  1IBK M;  2CV2 A;  3HHX A;  2UXC M;  2D7G A;  2ERC A;  3SHF A;  1XC8 A;  3SYL A;  1N33 M;  1TH2 A;  4LY6 A;  1N34 M;  4W5W A;  3E4R A;  2K47 A;  2X8A A;  1TH3 A;  4K0K M;  3U5Z A;  2EO2 A;  3GQ4 A;  4ZPX A;  1I94 M;  5KPZ A;  3GPU A;  3AJI B;  3M6A A;  4NRW A;  3CTW B;  4B7F A;  4AKH A;  4LF5 M;  4X65 M;  1GVN A;  3HJQ A;  2JA2 A;  4LJA A;  2D7H A;  3KVW A;  2OQ4 A;  2I7P A;  3RGS A;  2FNA A;  4ITQ A;  3QAU A;  4DV1 M;  3DA1 A;  3WHK A;  3TL4 X;  2Y20 A;  3VKG A;  3W0L B;  5EP1 A;  1FJG M;  1I4W A;  1T3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...