4X62M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x62M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x62M02
3GO8A 4JI5M 1R2YA 4K0KM 1XC8A 2UU9M 4JI1M 1HNZM 4GKJM 4LF6M 2UUBM 3JR4A 1L1ZA 3U6QA 3J7AS 5ITXE 4LFCM 3OTOM 4LFAM 4CISA 1FJGM 4X65M 4LF7M 1L2DA 4DV2M 5IT9S 5ITXA 4OX9M 4DV7M 3U6MA 3GPXA 4B3TM 1K82A 3U6EA 1Z5CA 1J5EM 3C58A 3A46A 3U6LA 1XNQM 5ITUA 2E5LM 3SATA 4DR3M 4PCZA 4GKKM 4PDIA 1IBMM 4DUZM 1MU5A 3GQ5A 4DR5M 3J80S 1MX0A 4DR4M 4LF5M 1Q39A 3GP1A 3SASA 4ITQA 4JI2M 3A42A 4B3MM 5FLXS 3T1HM 1Z5BA 4DV4M 4NRVA 4YHHM 2XZUA 3TWLA 3JAMS 2UUCM 4DR7M 3TWKA 1PJIA 1IBLM 1N36M 1PM5A 3GQ3A 1HNWM 4YY3M 4G4QA 4LF8M 1N33M 3GPPA 2UXCM 1XMOM 4JV5M 5ITRA 4X66M 4AQYM 3SAWA 3VK8A 3GPUA 3TWMA 1L2CA 5LMNM 3DOAA 2Q2EB 1R2ZA 1K3XA 3GPYA 3A45A 4G4RA 1NNJA 2F5OA 2F5SA 3SBJA 2HKJA 1N34M 4NRWA 2F5NA 1PJJA 1N32M 2F5PA 2HHHM 4NXNM 1TDZA 1KFVA 2F5QA 3SAUA 3U6PA 4JI4M 4DV6M 4JI0M 4DV0M 5ITTA 3U6DA 4PD2A 1XMQM 1XNRM 2OQ4A 3W0FA 3U6CA 2UXBM 4G4NA 3U6SA 2EA0A 5IWAM 4LF9M 4X62M 1L1TA 4JYAM 4JI6M 4X64M 5LMUM 4DR6M 5ITYA 4JI3M 4G4OA 4MB7A 4LF4M 3T1YM 4JI8M 3JR5A 1HNXM 1EE8A 4DV3M 2UUAM 4DR1M 2VQEM 2ZM6M 1L2BA 1K3WA 1Z5AA 4DV1M 4PDGA 5ITQA 4NXMM 3SAVA 4KHPM 1IBKM 5A2QS 3SARA 3GQ4A 2F4VM 2XZFA 2UXDM 3J81S 2ZBKB 3VK7A 2OPFA 1Q3CA 4DV5M 1I94M 4B3RM 4DR2M 4DUYM 5BR8M 1HR0M 1TDHA 4LFBM 1Q3BA 3U6OA 2VQFM 4JI7M 1Z59A 4B3SM
chains in the Genus database with same CATH superfamily
3HU1A 1T6OA 1VQ1A 1HNZM 2V1UA 2ZAMA 2UUBM 4REZA 1SXJB 4FCWA 2XFTA 1YE9A 4JXJA 3FUUA 4MH0E 3I51A 2MROB 5ITXE 1ZV1A 4LJ6A 4W5WA 1PJSA 5IZ7D 4CISA 1Q02A 3R8FA 2Z3XA 1VDDA 3HJ8A 1I4WA 1NV8A 3RFWA 4DV7M 1DV0A 4IBDA 5KO3A 3V76A 5GKNA 4G3OA 4QNMA 4IBIA 1Z5CA 2DNAA 2JWSA 1J09A 5KPZA 1YSYA 3A46A 4KO8A 2HCBA 3HX3A 3U5ZA 1QANA 1SG9A 3SATA 3LCVB 3E4RA 1SXJD 2QQ8A 1IBMM 3MHVC 1R7RA 4FCTA 4DR5M 2LVAA 4L6V6 2CHGA 1Z6TA 2DZLA 1ZAEA 3FUVA 4NL4H 2KEBA 3GLFE 2NQ8C 2GNOA 2DAIA 2QZ4A 4ITQA 2VF7A 3T1HM 3RGSA 1EIJA 3GLFB 3KSXA 2UUCM 4AZFA 3LQQA 1N75A 1VDLA 1PM5A 3U61A 2CEAA 2LVOC 2X8AA 2LVNC 3RE8A 3UJNA 3GPPA 2BWEA 3GLHA 4GRIA 2L2DA 3FTCA 4AQYM 2EKKA 2M60A 3LW5F 3GPUA 3F92A 1L2CA 2QSFX 3HKPA 2XSZD 2L4FA 2Q2EB 2APLA 4G4RA 2F5SA 1G4AE 4AKGA 4LGYA 3FD9A 4OVZB 3M7GA 2ZANA 3GRVA 3KW6A 2LNHC 2DVWB 1JQJC 3E9SA 1ZMVA 5EXXA 5ITTA 1XB2B 2LTUA 2LHGA 2LWXA 3CTWB 2C99A 4M9SA 1HT2E 3W0FA 4B7HA 4G4NA 4MGKE 2CUZA 4LJ8A 2YQZA 4LRSA 4MGHA 1WIVA 2EA0A 3U6SA 2JY8A 5IWAM 1IN7A 1QVRA 2C9CA 3L2AA 4X64M 3L29A 2DWZB 1WGNA 1A5TA 4JI3M 4PT5A 4G4OA 3D8LA 1LV7A 3HJQA 1TTEA 3E46A 4LF4M 3JR5A 2H1RA 4CGYB 2KRUA 1LTMA 1NY6A 2MH8A 4KLNA 4TUWA 5EP3A 3ZC7B 2DXIA 1R4GA 1CUKA 5EJCA 4I5SA 2XF3A 5KPRA 4IBKA 1IBKM 2RKOA 2CP8A 4L4UA 3GQ4A 2CV1A 3K8ZA 3J81S 2LVQD 2Y20A 2C96A 1SXJC 3HGIA 1I94M 3FTEA 3FUXA 4DR2M 5BR8M 3B89A 4QOSA 4CJ6A 2CHQA 3U60A 1HQYE 2RGOA 1Q3BA 2A5YB 1Z59A 1UM8A 3VDPA 3LVWA 4HEOA 1XC8A 4IBEA 2UU9M 3SMSA 3T6PA 1ZMUA 4AG5A 1WJ7A 1G41A 1GL6A 4GH9A 3THGA 4S12A 2R44A 3KOZE 1L1ZA 2DHRA 3U6QA 3ZH9B 2CWBA 2KNZA 1XXHA 3FUWA 4LFAM 2X4AA 1L2DA 2YNMD 2DAGA 5E26A 2JY7A 1G8PA 3B9PA 5IREB 3U6MA 3AKZA 3PFIA 3U61B 4B3TM 2B3TA 2CHVA 1ORYB 2R65A 1IN8A 3VFDA 2DWNA 3GLHB 2XGNA 3SHFA 1E9SA 4P17A 4D80A 1OAIA 2QBYB 5ITUA 3FKEA 1SXJE 4L15A 2R4EA 4LJ4A 5F3WA 2EKFA 3GLIE 4DUZM 3W67A 1MX0A 5KQDA 2VDBB 4DR4M 2BNKA 3GP1A 3SASA 4KT0F 3GLIB 4JI2M 2JY6B 1NHGC 1QAOA 2DZNB 1TH4A 1W5SA 4XBOA 1Z5BA 1DGBA 2XZUA 4DR7M 2AHMA 3JAMS 2K0BX 3Q8GA 2V6ZM 3SHGB 4L8RC 1IBLM 1PJQA 1NSFA 1QZMA 4LZJA 1N36M 4I81A 3ILKA 1QAMA 2KDLA 3H4MA 3B7NA 5EP2A 1N33M 1D0MA 3SYKA 2KNAA 4JV5M 2OOAA 2J7OA 3I01M 3KOWE 3KSJA 3DFZA 1DGGA 5ITRA 1E9RA 2L7IA 4LJ5A 3PXGA 1IXSA 4BBAA 4GC9A 5DYIA 4B7FA 5LMNM 3I4YA 1HT1E 1D0LA 5C18A 3HU2A 4Q7JA 2L09A 4FCVA 1P3QQ 3SBJA 3AL0C 4IJEA 1KYIA 2K9DA 1X37A 2F5NA 1W5TA 4P16A 4NXNM 4GC5A 2YFQA 4DV6M 4QHTA 3I4VA 4GIPA 2O5RA 1IY0A 1VEJA 2L7HA 4PD2A 2DKLA 1QAQA 1YLAA 5DFLA 1DGFA 1OQYA 4EIWA 3U60B 3AV0A 3NBXX 3QWLA 4HLQA 3RGPA 2Z7JA 3B74A 3H4JA 3HY5A 2JZ0A 4I8OA 1L1TA 3BXWA 3FTDA 4JI6M 5LMUM 2R4JA 2O25A 3FYCA 3AJIB 2R62A 2EJSA 3W68A 1XXHE 1PJTA 2VF8A 2LH0A 1EE8A 2N35A 2V1CA 3PNYA 5EP4A 1F4IA 1TR8A 4IBGA 1XXHB 2UUAM 2VQEM 2K47A 3J27B 4QOZC 4NXMM 4DV1M 4II7A 1NJGA 3MJ5A 4KHPM 1QDTA 5A2QS 4IJFA 4I4LA 3GLGE 1KSFX 2XZFA 3KS4A 4R71A 3VK7A 2VQFM 3KDSE 1Q3CA 4B3RM 3GLGB 1TDHA 3SC3A 3IHPA 4IIWA 3VK8A 4JI7M 2KXEA 3GO8A 4MM3B 2L4EA 4JI5M 2C9OA 4JI1M 4NOOB 4LF6M 1OIZA 3FUTA 2R6FA 3L28A 2GQFA 1IXRC 5FTKA 1TF0B 1R5LA 3EIHA 5KQ8A 4LY6A 3BOSA 3J7BA 5EXSA 4M9XA 4LFCM 3C3EA 3OTOM 1RU3A 1FJGM 4LF7M 1H6UA 4DV2M 1VG5A 1T43A 1IY2A 4LZZA 2Z4SA 5ITXA 1G3IA 3QYBA 3TQSA 1PGYA 5FTMA 1K82A 1R6BX 2FNAA 4G6ZA 4D81A 5FTJA 3B7QA 2YR0A 4RF0A 3K9OA 2WZJA 1J5EM 4DBGB 5JI3E 3C58A 1OJLA 2J5YA 2FS1A 3U6LA 1IXSB 3U5ZB 1QUSA 4LCBA 1DGHA 2KRKA 1XNQM 5FTLA 2JUJA 2VIIA 4LJ9A 3K92A 4PDIA 1QQWA 4NSOB 3GQ5A 3J80S 2LVPC 1NNUC 1OTRA 4FWHA 3TL4X 4LF5M 3CGWA 1Q39A 1TH2A 1QUTA 3VKGA 4FVMA 2JNHA 4B3MM 2ERCA 4F2LA 2QHOB 4AW4A 4NRVA 4YHHM 3KS8A 3UMMA 3TWKA 1PJIA 2JXNA 2WSEF 3HWSA 2DAKA 3GLHE 3HU3A 1GLNA 3CF2A 3GQ3A 3LQRA 4FWGA 4YY3M 1HNWM 3CF6E 4G4QA 2CV2A 4LF8M 1C7YA 4GEWA 3M0EA 1DO0A 3VLFB 4XK8F 4A3VB 1XMOM 2DWMA 2J7NA 3SAWA 2XEPA 3C9PA 2G3QA 4ZPXA 2KZSA 2MGWA 2HL7A 5KPTA 1VEGA 1NO1A 3DOAA 3HHZA 3GPYA 3A45A 2XH9A 2BJWA 1IN6A 4L78A 1IFYA 1ZMWA 4AKIA 2DZOB 4R7GA 1NJFA 1N34M 2R18A 1N32M 2RRUA 2MJ5B 4OVZA 2KW0A 4IBJA 1NV9A 2C5RA 2F5PA 2HHHM 1IXZA 2BWBA 3GRRA 4QNRA 3SAUA 4JI4M 4KODA 2QENA 1PRBA 4QHSA 1OFIA 4JI0M 3BBZA 3D8BA 2WSCF 1E94E 1OIPA 2ZTCA 4D82A 4F1IA 2Y0QA 3U6DA 4WURA 1XNRM 1WR1B 2OQ4A 1XHBA 3U6CA 2UXBM 3TPZA 2DI0A 1JR3D 3FE3A 4CIZA 4GMQA 5JI2E 1YUBA 1QZEA 1N77A 3QAUA 1HQCA 3GRYA 2P5TA 5EP1A 1G59A 1WGLA 4M0DA 4DR6M 5EQTA 4MB7A 2LHCA 4GHAA 4JI8M 4LGMA 2Z8YM 3KOYE 4AKHA 4AI6A 3FRHA 4B7GA 4WP2A 2XLJA 2HAKA 3MK6A 2Y21A 4RNAA 5FTNA 4DR1M 1BVSA 3Q8XA 1IY1A 1GJTA 4PDGA 2LBCA 2QCUA 5BPVA 3UGJA 3K1JA 3GRUA 2KHHA 3SARA 2DAEA 1G71A 2UXDM 3IG8A 1HJPA 2DHYA 2OPFA 1IN4A 3K2LA 1QDRA 4RF1A 4DV5M 2FFJA 2I7NA 1HR0M 3AFHA 1DGHB 3U6OA 2CFOA 4ANRA 4IBFA 3SMPA 2KNVA 1JR3A 1R2YA 4K0KM 5E6JA 1ZQ9A 5FSWA 1JB0F 2FOIC 4M0WA 4OU7A 4GKJM 1EFUB 3FRIA 2D7GA 3MMPA 2G5GX 4LJAA 2BJVA 7CATA 3JR4A 3T38A 2XFSA 3NWLA 3J7AS 3PVSA 4IBCA 4X65M 2ZTDA 4JN6A 4NC6A 3I04M 2LXEA 3UK6A 5IT9S 1T3TA 4LRTA 1AUAA 4Z8XA 4OX9M 1V34A 2KZUA 3KP0E 4MGYE 1WXQA 2Z4RA 5DYGA 3HHYA 4IBBA 3TE6A 3GPXA 3U6EA 2R0IA 1NHWC 3M6AA 2O01F 2QNJA 4Z6YA 3B7ZA 1S3SA 2HWJA 3HZJA 2E5LM 2I7PA 4DR3M 2QBYA 3LMMA 4GITA 4BLCA 4PCZA 4GKKM 2QPAA 4AG6A 4NSRA 3A98B 2W82A 3KVWA 1MU5A 1NY5A 1TGUA 1SXJA 1D2NA 3L25A 4R3DA 5H37D 4XGIA 1DO2A 2DENA 2EO2A 3A42A 5FLXS 3GLIA 1J7KA 4RKUF 3IECA 4DV4M 3FYDA 3TWLA 2EUCA 4MGIE 4UN2B 1IN5A 1N78A 1C1KA 5DNYA 3EIEA 4Y28F 2DWLA 3NBIA 1MN3A 1GJSA 2UXCM 2DAMA 4FWDA 3K9PA 4X66M 1VEKA 1Y8GA 4GHLA 3KXEC 2R45A 4HL4A 1GVNA 3AOEA 3TWMA 2K6BA 3HHWA 4FW9A 1D0KA 1TH3A 1K3XA 1AIPC 2JA2A 1R2ZA 2F5OA 1NNJA 4L16A 3WHLA 3J2PB 3QYEA 1OFHA 3DZDA 2XSZA 2HKJA 2JZ1A 4NRWA 1PJJA 4LJ7A 4OW0A 1TDZA 2D7EA 4BB9A 3DA1A 1IQPA 1KFVA 3U6PA 2QP9X 1E32A 2F5QA 3IG5A 5L8RF 3GLFA 3KOXE 4DV0M 4B08A 3ZCBB 2Y0TA 5EXPA 3PNVA 2ZAOA 1IM2A 1V33A 1XMQM 1JR3E 8CATA 5C1BA 3LVVA 2CRUA 1FNNA 2RGHA 1QYRA 3CF0A 1MJGM 4M9ZA 4LF9M 2R46A 4X62M 3FTFA 4JYAM 1UFZA 2OO9A 2CV0A 1OKSA 3VKHA 2JY5A 1WHCA 5ITYA 1GABA 4MGZE 3WHKA 1NVMA 3HHXA 3T1YM 2FE8A 1HNXM 3W0LB 4CHTB 2MR9A 3KP1E 2CE7A 4DV3M 1XWIA 4FD2A 2KA6B 3R9XB 1V92A 3L27A 2OOBA 3VDUA 2ZM6M 1L2BA 3ZQJA 4LG2A 1K3WA 1Z5AA 5ITQA 3AOEC 2H5XA 5EXTA 3UZUA 3SAVA 3LCUA 3SFZA 1OAOC 3E21A 2FH0A 2JP7A 2M5ZA 3L26A 2F4VM 2G8LA 2ZBKB 2X49A 2L6OA 3T15A 4WW0A 3AOGA 2C98A 3KFUG 3SYLA 1GKIA 4DUYM 1L8QA 1GO5A 3GLGA 2D7HA 1GL7A 2WSFF 3HJSA 4LFBM 3C3DA 4B3SM
chains in the Genus database with same CATH topology
3HU1A 2V1UA 1HNZM 2ZAMA 2UUBM 4REZA 1SXJB 4FCWA 2XFTA 1YE9A 4JXJA 3FUUA 4MH0E 3I51A 5ITXE 4LJ6A 4W5WA 5IZ7D 4CISA 3R8FA 2Z3XA 1VDDA 3HJ8A 1I4WA 4DV7M 3RFWA 4IBDA 5KO3A 5GKNA 4QNMA 4IBIA 1Z5CA 1J09A 5KPZA 1YSYA 3A46A 4KO8A 2HCBA 3U5ZA 1QANA 3SATA 3E4RA 1SXJD 1IBMM 3MHVC 1R7RA 4FCTA 4DR5M 2CHGA 1Z6TA 4NL4H 1ZAEA 3FUVA 2KEBA 2NQ8C 4ITQA 2QZ4A 3T1HM 3RGSA 3GLFB 3KSXA 2UUCM 4AZFA 3LQQA 1N75A 1PM5A 3U61A 2CEAA 2X8AA 3RE8A 3UJNA 3GPPA 3GLHA 4GRIA 3FTCA 4AQYM 2M60A 3GPUA 1L2CA 3HKPA 2XSZD 2Q2EB 4G4RA 2F5SA 1G4AE 4AKGA 4LGYA 3FD9A 4OVZB 3M7GA 2ZANA 3GRVA 3KW6A 2LNHC 2DVWB 1JQJC 3E9SA 5EXXA 5ITTA 4M9SA 2LWXA 3CTWB 2C99A 3W0FA 1HT2E 4B7HA 4G4NA 4MGKE 2CUZA 4LJ8A 2YQZA 4LRSA 4MGHA 2EA0A 3U6SA 5IWAM 1IN7A 1QVRA 2C9CA 3L2AA 4X64M 3L29A 2DWZB 4JI3M 4G4OA 4PT5A 3D8LA 1LV7A 3HJQA 4LF4M 3JR5A 2H1RA 4CGYB 2KRUA 1NY6A 4KLNA 4TUWA 5EP3A 3ZC7B 2DXIA 5EJCA 4I5SA 2XF3A 5KPRA 4IBKA 1IBKM 2RKOA 4L4UA 3GQ4A 2CV1A 3K8ZA 3J81S 2Y20A 2C96A 1SXJC 3HGIA 1I94M 3FTEA 3FUXA 4DR2M 5BR8M 4QOSA 2CHQA 3U60A 1HQYE 2RGOA 1Q3BA 2A5YB 1Z59A 1UM8A 3VDPA 3LVWA 1XC8A 2UU9M 4IBEA 3SMSA 4AG5A 1G41A 1GL6A 4GH9A 3THGA 4S12A 3KOZE 1L1ZA 2DHRA 3U6QA 3ZH9B 1XXHA 3FUWA 4LFAM 2X4AA 1L2DA 2YNMD 5E26A 1G8PA 3B9PA 5IREB 3U6MA 3AKZA 3PFIA 3U61B 4B3TM 2CHVA 2R65A 1ORYB 1IN8A 3VFDA 2DWNA 3GLHB 2XGNA 3SHFA 1E9SA 4D80A 2QBYB 5ITUA 3FKEA 1SXJE 4L15A 2R4EA 4LJ4A 5F3WA 4DUZM 1MX0A 5KQDA 4DR4M 2BNKA 3GP1A 3SASA 3GLIB 4JI2M 1NHGC 1QAOA 2DZNB 1TH4A 1W5SA 4XBOA 1Z5BA 1DGBA 2XZUA 4DR7M 2AHMA 3JAMS 4L8RC 2V6ZM 3SHGB 1IBLM 1NSFA 1QZMA 4LZJA 1N36M 4I81A 3ILKA 1QAMA 3H4MA 5EP2A 1N33M 3SYKA 4JV5M 5ITRA 2J7OA 3KSJA 3KOWE 3DFZA 1DGGA 1E9RA 2L7IA 4LJ5A 3PXGA 4BBAA 4GC9A 5DYIA 4B7FA 5LMNM 3I4YA 1HT1E 5C18A 3HU2A 2L09A 4FCVA 3SBJA 3AL0C 4IJEA 1KYIA 1X37A 2F5NA 1W5TA 4P16A 4NXNM 4GC5A 2YFQA 4DV6M 4QHTA 3I4VA 4GIPA 2O5RA 1IY0A 2L7HA 4PD2A 1QAQA 1DGFA 4EIWA 3U60B 3AV0A 3QWLA 4HLQA 3RGPA 2Z7JA 4I8OA 1L1TA 3FTDA 4JI6M 5LMUM 2R4JA 3FYCA 3AJIB 2R62A 2LH0A 1EE8A 2V1CA 3PNYA 5EP4A 4IBGA 1XXHB 2UUAM 2VQEM 2K47A 3J27B 4QOZC 4NXMM 4DV1M 4II7A 1NJGA 3MJ5A 4KHPM 5A2QS 4IJFA 4I4LA 1KSFX 2XZFA 3KS4A 3VK7A 3KDSE 1Q3CA 4B3RM 3GLGB 1TDHA 3SC3A 3VK8A 4IIWA 4JI7M 2KXEA 3GO8A 4MM3B 4JI5M 2C9OA 4JI1M 4NOOB 4LF6M 3FUTA 3L28A 1IXRC 5FTKA 3EIHA 5KQ8A 4LY6A 3BOSA 3J7BA 5EXSA 4M9XA 4LFCM 3OTOM 1FJGM 4LF7M 1H6UA 4DV2M 1IY2A 4LZZA 2Z4SA 5ITXA 1G3IA 3TQSA 5FTMA 1K82A 1R6BX 2FNAA 4G6ZA 4D81A 5FTJA 2YR0A 4RF0A 1J5EM 5JI3E 3C58A 1OJLA 3U6LA 3U5ZB 1IXSB 1XNQM 4LCBA 1DGHA 2KRKA 5FTLA 4LJ9A 2VIIA 3K92A 4PDIA 1QQWA 4NSOB 3GQ5A 3J80S 1NNUC 4FWHA 3TL4X 4LF5M 1Q39A 1TH2A 3VKGA 4FVMA 4B3MM 2ERCA 4AW4A 4NRVA 4YHHM 3KS8A 3UMMA 3TWKA 1PJIA 3HWSA 3HU3A 1GLNA 3CF2A 3GQ3A 3LQRA 4FWGA 4YY3M 1HNWM 3CF6E 4G4QA 2CV2A 4LF8M 3M0EA 1DO0A 3VLFB 4A3VB 1XMOM 2DWMA 2J7NA 3SAWA 2XEPA 4ZPXA 2KZSA 2HL7A 5KPTA 3DOAA 3HHZA 3GPYA 3A45A 2XH9A 2BJWA 1IN6A 4L78A 4AKIA 2DZOB 4R7GA 1NJFA 1N34M 2R18A 1N32M 4OVZA 2F5PA 2HHHM 2KW0A 4IBJA 2C5RA 3GRRA 1IXZA 4QNRA 3SAUA 4JI4M 4KODA 2QENA 4QHSA 1OFIA 4JI0M 3D8BA 3U6DA 1E94E 4D82A 2Y0QA 4WURA 1XNRM 2OQ4A 1XHBA 3U6CA 2UXBM 3TPZA 1JR3D 4GMQA 5JI2E 1YUBA 1N77A 3QAUA 1HQCA 3GRYA 2P5TA 5EP1A 1G59A 4M0DA 4DR6M 5EQTA 4MB7A 4GHAA 4JI8M 4LGMA 4AKHA 3KOYE 4AI6A 4B7GA 2XLJA 3MK6A 2Y21A 4RNAA 5FTNA 4DR1M 3Q8XA 1IY1A 4PDGA 3UGJA 2QCUA 5BPVA 3K1JA 3GRUA 3SARA 2UXDM 3IG8A 2OPFA 1IN4A 3K2LA 4RF1A 4DV5M 2FFJA 2I7NA 1HR0M 3AFHA 1DGHB 3U6OA 2CFOA 4IBFA 3SMPA 1JR3A 1R2YA 4K0KM 5E6JA 1ZQ9A 5FSWA 2FOIC 4M0WA 4OU7A 4GKJM 2D7GA 2G5GX 4LJAA 2BJVA 7CATA 3JR4A 3T38A 2XFSA 3NWLA 3J7AS 3PVSA 4IBCA 4X65M 4JN6A 5IT9S 2LXEA 3UK6A 1T3TA 4LRTA 4OX9M 4Z8XA 2KZUA 3KP0E 4MGYE 1WXQA 2Z4RA 5DYGA 3HHYA 4IBBA 3TE6A 3GPXA 3U6EA 1NHWC 3M6AA 4Z6YA 1S3SA 2E5LM 2I7PA 4DR3M 2QBYA 3LMMA 4GITA 4BLCA 4PCZA 4GKKM 2QPAA 4AG6A 4NSRA 3A98B 2W82A 3KVWA 1MU5A 1NY5A 1TGUA 1SXJA 1D2NA 3L25A 4R3DA 5H37D 4XGIA 1DO2A 2EO2A 3A42A 5FLXS 3GLIA 1J7KA 4DV4M 3FYDA 3TWLA 2EUCA 4MGIE 1IN5A 1N78A 1C1KA 5DNYA 3EIEA 2DWLA 3NBIA 2UXCM 4FWDA 4X66M 4GHLA 3KXEC 2R45A 4HL4A 1GVNA 3AOEA 3TWMA 3HHWA 4FW9A 1TH3A 1K3XA 1R2ZA 2JA2A 2F5OA 1NNJA 4L16A 3WHLA 3J2PB 1OFHA 3DZDA 2XSZA 2HKJA 4NRWA 1PJJA 4LJ7A 4OW0A 1TDZA 2D7EA 4BB9A 3DA1A 1IQPA 1KFVA 3U6PA 2QP9X 1E32A 2F5QA 3IG5A 3GLFA 3KOXE 4DV0M 4B08A 3ZCBB 2Y0TA 5EXPA 3PNVA 2ZAOA 1IM2A 1XMQM 8CATA 5C1BA 3LVVA 1FNNA 2RGHA 1QYRA 3CF0A 4M9ZA 4LF9M 3FTFA 2R46A 4X62M 4JYAM 2CV0A 3VKHA 5ITYA 4MGZE 3WHKA 1NVMA 3HHXA 3T1YM 2FE8A 1HNXM 3W0LB 4CHTB 3KP1E 2CE7A 4DV3M 1XWIA 4FD2A 2KA6B 3R9XB 3L27A 3VDUA 2ZM6M 1L2BA 4LG2A 1K3WA 1Z5AA 5ITQA 3AOEC 5EXTA 3UZUA 3SAVA 3SFZA 2M5ZA 2F4VM 3L26A 2G8LA 2ZBKB 2X49A 2L6OA 3T15A 4WW0A 3AOGA 2C98A 3KFUG 3SYLA 1GKIA 4DUYM 1L8QA 3GLGA 2D7HA 1GL7A 3HJSA 4LFBM 2VQFM 4B3SM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GO8 A;  4JI5 M;  1R2Y A;  4K0K M;  1XC8 A;  2UU9 M;  4JI1 M;  1HNZ M;  4GKJ M;  4LF6 M;  2UUB M;  3JR4 A;  1L1Z A;  3U6Q A;  3J7A S;  5ITX E;  4LFC M;  3OTO M;  4LFA M;  4CIS A;  1FJG M;  4X65 M;  4LF7 M;  1L2D A;  4DV2 M;  5IT9 S;  5ITX A;  4OX9 M;  4DV7 M;  3U6M A;  3GPX A;  4B3T M;  1K82 A;  3U6E A;  1Z5C A;  1J5E M;  3C58 A;  3A46 A;  3U6L A;  1XNQ M;  5ITU A;  2E5L M;  3SAT A;  4DR3 M;  4PCZ A;  4GKK M;  4PDI A;  1IBM M;  4DUZ M;  1MU5 A;  3GQ5 A;  4DR5 M;  3J80 S;  1MX0 A;  4DR4 M;  4LF5 M;  1Q39 A;  3GP1 A;  3SAS A;  4ITQ A;  4JI2 M;  3A42 A;  4B3M M;  5FLX S;  3T1H M;  1Z5B A;  4DV4 M;  4NRV A;  4YHH M;  2XZU A;  3TWL A;  3JAM S;  2UUC M;  4DR7 M;  3TWK A;  1PJI A;  1IBL M;  1N36 M;  1PM5 A;  3GQ3 A;  1HNW M;  4YY3 M;  4G4Q A;  4LF8 M;  1N33 M;  3GPP A;  2UXC M;  1XMO M;  4JV5 M;  5ITR A;  4X66 M;  4AQY M;  3SAW A;  3VK8 A;  3GPU A;  3TWM A;  1L2C A;  5LMN M;  3DOA A;  2Q2E B;  1R2Z A;  1K3X A;  3GPY A;  3A45 A;  4G4R A;  1NNJ A;  2F5O A;  2F5S A;  3SBJ A;  2HKJ A;  1N34 M;  4NRW A;  2F5N A;  1PJJ A;  1N32 M;  2F5P A;  2HHH M;  4NXN M;  1TDZ A;  1KFV A;  2F5Q A;  3SAU A;  3U6P A;  4JI4 M;  4DV6 M;  4JI0 M;  4DV0 M;  5ITT A;  3U6D A;  4PD2 A;  1XMQ M;  1XNR M;  2OQ4 A;  3W0F A;  3U6C A;  2UXB M;  4G4N A;  3U6S A;  2EA0 A;  5IWA M;  4LF9 M;  4X62 M;  1L1T A;  4JYA M;  4JI6 M;  4X64 M;  5LMU M;  4DR6 M;  5ITY A;  4JI3 M;  4G4O A;  4MB7 A;  4LF4 M;  3T1Y M;  4JI8 M;  3JR5 A;  1HNX M;  1EE8 A;  4DV3 M;  2UUA M;  4DR1 M;  2VQE M;  2ZM6 M;  1L2B A;  1K3W A;  1Z5A A;  4DV1 M;  4PDG A;  5ITQ A;  4NXM M;  3SAV A;  4KHP M;  1IBK M;  5A2Q S;  3SAR A;  3GQ4 A;  2F4V M;  2XZF A;  2UXD M;  3J81 S;  2ZBK B;  3VK7 A;  2OPF A;  1Q3C A;  4DV5 M;  1I94 M;  4B3R M;  4DR2 M;  4DUY M;  5BR8 M;  1HR0 M;  1TDH A;  4LFB M;  1Q3B A;  3U6O A;  2VQF M;  4JI7 M;  1Z59 A;  4B3S M; 
#chains in the Genus database with same CATH topology
 3HU1 A;  1T6O A;  1VQ1 A;  1HNZ M;  2V1U A;  2ZAM A;  2UUB M;  4REZ A;  1SXJ B;  4FCW A;  2XFT A;  1YE9 A;  4JXJ A;  3FUU A;  4MH0 E;  3I51 A;  2MRO B;  5ITX E;  1ZV1 A;  4LJ6 A;  4W5W A;  1PJS A;  5IZ7 D;  4CIS A;  1Q02 A;  3R8F A;  2Z3X A;  1VDD A;  3HJ8 A;  1I4W A;  1NV8 A;  3RFW A;  4DV7 M;  1DV0 A;  4IBD A;  5KO3 A;  3V76 A;  5GKN A;  4G3O A;  4QNM A;  4IBI A;  1Z5C A;  2DNA A;  2JWS A;  1J09 A;  5KPZ A;  1YSY A;  3A46 A;  4KO8 A;  2HCB A;  3HX3 A;  3U5Z A;  1QAN A;  1SG9 A;  3SAT A;  3LCV B;  3E4R A;  1SXJ D;  2QQ8 A;  1IBM M;  3MHV C;  1R7R A;  4FCT A;  4DR5 M;  2LVA A;  4L6V 6;  2CHG A;  1Z6T A;  2DZL A;  1ZAE A;  3FUV A;  4NL4 H;  2KEB A;  3GLF E;  2NQ8 C;  2GNO A;  2DAI A;  2QZ4 A;  4ITQ A;  2VF7 A;  3T1H M;  3RGS A;  1EIJ A;  3GLF B;  3KSX A;  2UUC M;  4AZF A;  3LQQ A;  1N75 A;  1VDL A;  1PM5 A;  3U61 A;  2CEA A;  2LVO C;  2X8A A;  2LVN C;  3RE8 A;  3UJN A;  3GPP A;  2BWE A;  3GLH A;  4GRI A;  2L2D A;  3FTC A;  4AQY M;  2EKK A;  2M60 A;  3LW5 F;  3GPU A;  3F92 A;  1L2C A;  2QSF X;  3HKP A;  2XSZ D;  2L4F A;  2Q2E B;  2APL A;  4G4R A;  2F5S A;  1G4A E;  4AKG A;  4LGY A;  3FD9 A;  4OVZ B;  3M7G A;  2ZAN A;  3GRV A;  3KW6 A;  2LNH C;  2DVW B;  1JQJ C;  3E9S A;  1ZMV A;  5EXX A;  5ITT A;  1XB2 B;  2LTU A;  2LHG A;  2LWX A;  3CTW B;  2C99 A;  4M9S A;  1HT2 E;  3W0F A;  4B7H A;  4G4N A;  4MGK E;  2CUZ A;  4LJ8 A;  2YQZ A;  4LRS A;  4MGH A;  1WIV A;  2EA0 A;  3U6S A;  2JY8 A;  5IWA M;  1IN7 A;  1QVR A;  2C9C A;  3L2A A;  4X64 M;  3L29 A;  2DWZ B;  1WGN A;  1A5T A;  4JI3 M;  4PT5 A;  4G4O A;  3D8L A;  1LV7 A;  3HJQ A;  1TTE A;  3E46 A;  4LF4 M;  3JR5 A;  2H1R A;  4CGY B;  2KRU A;  1LTM A;  1NY6 A;  2MH8 A;  4KLN A;  4TUW A;  5EP3 A;  3ZC7 B;  2DXI A;  1R4G A;  1CUK A;  5EJC A;  4I5S A;  2XF3 A;  5KPR A;  4IBK A;  1IBK M;  2RKO A;  2CP8 A;  4L4U A;  3GQ4 A;  2CV1 A;  3K8Z A;  3J81 S;  2LVQ D;  2Y20 A;  2C96 A;  1SXJ C;  3HGI A;  1I94 M;  3FTE A;  3FUX A;  4DR2 M;  5BR8 M;  3B89 A;  4QOS A;  4CJ6 A;  2CHQ A;  3U60 A;  1HQY E;  2RGO A;  1Q3B A;  2A5Y B;  1Z59 A;  1UM8 A;  3VDP A;  3LVW A;  4HEO A;  1XC8 A;  4IBE A;  2UU9 M;  3SMS A;  3T6P A;  1ZMU A;  4AG5 A;  1WJ7 A;  1G41 A;  1GL6 A;  4GH9 A;  3THG A;  4S12 A;  2R44 A;  3KOZ E;  1L1Z A;  2DHR A;  3U6Q A;  3ZH9 B;  2CWB A;  2KNZ A;  1XXH A;  3FUW A;  4LFA M;  2X4A A;  1L2D A;  2YNM D;  2DAG A;  5E26 A;  2JY7 A;  1G8P A;  3B9P A;  5IRE B;  3U6M A;  3AKZ A;  3PFI A;  3U61 B;  4B3T M;  2B3T A;  2CHV A;  1ORY B;  2R65 A;  1IN8 A;  3VFD A;  2DWN A;  3GLH B;  2XGN A;  3SHF A;  1E9S A;  4P17 A;  4D80 A;  1OAI A;  2QBY B;  5ITU A;  3FKE A;  1SXJ E;  4L15 A;  2R4E A;  4LJ4 A;  5F3W A;  2EKF A;  3GLI E;  4DUZ M;  3W67 A;  1MX0 A;  5KQD A;  2VDB B;  4DR4 M;  2BNK A;  3GP1 A;  3SAS A;  4KT0 F;  3GLI B;  4JI2 M;  2JY6 B;  1NHG C;  1QAO A;  2DZN B;  1TH4 A;  1W5S A;  4XBO A;  1Z5B A;  1DGB A;  2XZU A;  4DR7 M;  2AHM A;  3JAM S;  2K0B X;  3Q8G A;  2V6Z M;  3SHG B;  4L8R C;  1IBL M;  1PJQ A;  1NSF A;  1QZM A;  4LZJ A;  1N36 M;  4I81 A;  3ILK A;  1QAM A;  2KDL A;  3H4M A;  3B7N A;  5EP2 A;  1N33 M;  1D0M A;  3SYK A;  2KNA A;  4JV5 M;  2OOA A;  2J7O A;  3I01 M;  3KOW E;  3KSJ A;  3DFZ A;  1DGG A;  5ITR A;  1E9R A;  2L7I A;  4LJ5 A;  3PXG A;  1IXS A;  4BBA A;  4GC9 A;  5DYI A;  4B7F A;  5LMN M;  3I4Y A;  1HT1 E;  1D0L A;  5C18 A;  3HU2 A;  4Q7J A;  2L09 A;  4FCV A;  1P3Q Q;  3SBJ A;  3AL0 C;  4IJE A;  1KYI A;  2K9D A;  1X37 A;  2F5N A;  1W5T A;  4P16 A;  4NXN M;  4GC5 A;  2YFQ A;  4DV6 M;  4QHT A;  3I4V A;  4GIP A;  2O5R A;  1IY0 A;  1VEJ A;  2L7H A;  4PD2 A;  2DKL A;  1QAQ A;  1YLA A;  5DFL A;  1DGF A;  1OQY A;  4EIW A;  3U60 B;  3AV0 A;  3NBX X;  3QWL A;  4HLQ A;  3RGP A;  2Z7J A;  3B74 A;  3H4J A;  3HY5 A;  2JZ0 A;  4I8O A;  1L1T A;  3BXW A;  3FTD A;  4JI6 M;  5LMU M;  2R4J A;  2O25 A;  3FYC A;  3AJI B;  2R62 A;  2EJS A;  3W68 A;  1XXH E;  1PJT A;  2VF8 A;  2LH0 A;  1EE8 A;  2N35 A;  2V1C A;  3PNY A;  5EP4 A;  1F4I A;  1TR8 A;  4IBG A;  1XXH B;  2UUA M;  2VQE M;  2K47 A;  3J27 B;  4QOZ C;  4NXM M;  4DV1 M;  4II7 A;  1NJG A;  3MJ5 A;  4KHP M;  1QDT A;  5A2Q S;  4IJF A;  4I4L A;  3GLG E;  1KSF X;  2XZF A;  3KS4 A;  4R71 A;  3VK7 A;  2VQF M;  3KDS E;  1Q3C A;  4B3R M;  3GLG B;  1TDH A;  3SC3 A;  3IHP A;  4IIW A;  3VK8 A;  4JI7 M;  2KXE A;  3GO8 A;  4MM3 B;  2L4E A;  4JI5 M;  2C9O A;  4JI1 M;  4NOO B;  4LF6 M;  1OIZ A;  3FUT A;  2R6F A;  3L28 A;  2GQF A;  1IXR C;  5FTK A;  1TF0 B;  1R5L A;  3EIH A;  5KQ8 A;  4LY6 A;  3BOS A;  3J7B A;  5EXS A;  4M9X A;  4LFC M;  3C3E A;  3OTO M;  1RU3 A;  1FJG M;  4LF7 M;  1H6U A;  4DV2 M;  1VG5 A;  1T43 A;  1IY2 A;  4LZZ A;  2Z4S A;  5ITX A;  1G3I A;  3QYB A;  3TQS A;  1PGY A;  5FTM A;  1K82 A;  1R6B X;  2FNA A;  4G6Z A;  4D81 A;  5FTJ A;  3B7Q A;  2YR0 A;  4RF0 A;  3K9O A;  2WZJ A;  1J5E M;  4DBG B;  5JI3 E;  3C58 A;  1OJL A;  2J5Y A;  2FS1 A;  3U6L A;  1IXS B;  3U5Z B;  1QUS A;  4LCB A;  1DGH A;  2KRK A;  1XNQ M;  5FTL A;  2JUJ A;  2VII A;  4LJ9 A;  3K92 A;  4PDI A;  1QQW A;  4NSO B;  3GQ5 A;  3J80 S;  2LVP C;  1NNU C;  1OTR A;  4FWH A;  3TL4 X;  4LF5 M;  3CGW A;  1Q39 A;  1TH2 A;  1QUT A;  3VKG A;  4FVM A;  2JNH A;  4B3M M;  2ERC A;  4F2L A;  2QHO B;  4AW4 A;  4NRV A;  4YHH M;  3KS8 A;  3UMM A;  3TWK A;  1PJI A;  2JXN A;  2WSE F;  3HWS A;  2DAK A;  3GLH E;  3HU3 A;  1GLN A;  3CF2 A;  3GQ3 A;  3LQR A;  4FWG A;  4YY3 M;  1HNW M;  3CF6 E;  4G4Q A;  2CV2 A;  4LF8 M;  1C7Y A;  4GEW A;  3M0E A;  1DO0 A;  3VLF B;  4XK8 F;  4A3V B;  1XMO M;  2DWM A;  2J7N A;  3SAW A;  2XEP A;  3C9P A;  2G3Q A;  4ZPX A;  2KZS A;  2MGW A;  2HL7 A;  5KPT A;  1VEG A;  1NO1 A;  3DOA A;  3HHZ A;  3GPY A;  3A45 A;  2XH9 A;  2BJW A;  1IN6 A;  4L78 A;  1IFY A;  1ZMW A;  4AKI A;  2DZO B;  4R7G A;  1NJF A;  1N34 M;  2R18 A;  1N32 M;  2RRU A;  2MJ5 B;  4OVZ A;  2KW0 A;  4IBJ A;  1NV9 A;  2C5R A;  2F5P A;  2HHH M;  1IXZ A;  2BWB A;  3GRR A;  4QNR A;  3SAU A;  4JI4 M;  4KOD A;  2QEN A;  1PRB A;  4QHS A;  1OFI A;  4JI0 M;  3BBZ A;  3D8B A;  2WSC F;  1E94 E;  1OIP A;  2ZTC A;  4D82 A;  4F1I A;  2Y0Q A;  3U6D A;  4WUR A;  1XNR M;  1WR1 B;  2OQ4 A;  1XHB A;  3U6C A;  2UXB M;  3TPZ A;  2DI0 A;  1JR3 D;  3FE3 A;  4CIZ A;  4GMQ A;  5JI2 E;  1YUB A;  1QZE A;  1N77 A;  3QAU A;  1HQC A;  3GRY A;  2P5T A;  5EP1 A;  1G59 A;  1WGL A;  4M0D A;  4DR6 M;  5EQT A;  4MB7 A;  2LHC A;  4GHA A;  4JI8 M;  4LGM A;  2Z8Y M;  3KOY E;  4AKH A;  4AI6 A;  3FRH A;  4B7G A;  4WP2 A;  2XLJ A;  2HAK A;  3MK6 A;  2Y21 A;  4RNA A;  5FTN A;  4DR1 M;  1BVS A;  3Q8X A;  1IY1 A;  1GJT A;  4PDG A;  2LBC A;  2QCU A;  5BPV A;  3UGJ A;  3K1J A;  3GRU A;  2KHH A;  3SAR A;  2DAE A;  1G71 A;  2UXD M;  3IG8 A;  1HJP A;  2DHY A;  2OPF A;  1IN4 A;  3K2L A;  1QDR A;  4RF1 A;  4DV5 M;  2FFJ A;  2I7N A;  1HR0 M;  3AFH A;  1DGH B;  3U6O A;  2CFO A;  4ANR A;  4IBF A;  3SMP A;  2KNV A;  1JR3 A;  1R2Y A;  4K0K M;  5E6J A;  1ZQ9 A;  5FSW A;  1JB0 F;  2FOI C;  4M0W A;  4OU7 A;  4GKJ M;  1EFU B;  3FRI A;  2D7G A;  3MMP A;  2G5G X;  4LJA A;  2BJV A;  7CAT A;  3JR4 A;  3T38 A;  2XFS A;  3NWL A;  3J7A S;  3PVS A;  4IBC A;  4X65 M;  2ZTD A;  4JN6 A;  4NC6 A;  3I04 M;  2LXE A;  3UK6 A;  5IT9 S;  1T3T A;  4LRT A;  1AUA A;  4Z8X A;  4OX9 M;  1V34 A;  2KZU A;  3KP0 E;  4MGY E;  1WXQ A;  2Z4R A;  5DYG A;  3HHY A;  4IBB A;  3TE6 A;  3GPX A;  3U6E A;  2R0I A;  1NHW C;  3M6A A;  2O01 F;  2QNJ A;  4Z6Y A;  3B7Z A;  1S3S A;  2HWJ A;  3HZJ A;  2E5L M;  2I7P A;  4DR3 M;  2QBY A;  3LMM A;  4GIT A;  4BLC A;  4PCZ A;  4GKK M;  2QPA A;  4AG6 A;  4NSR A;  3A98 B;  2W82 A;  3KVW A;  1MU5 A;  1NY5 A;  1TGU A;  1SXJ A;  1D2N A;  3L25 A;  4R3D A;  5H37 D;  4XGI A;  1DO2 A;  2DEN A;  2EO2 A;  3A42 A;  5FLX S;  3GLI A;  1J7K A;  4RKU F;  3IEC A;  4DV4 M;  3FYD A;  3TWL A;  2EUC A;  4MGI E;  4UN2 B;  1IN5 A;  1N78 A;  1C1K A;  5DNY A;  3EIE A;  4Y28 F;  2DWL A;  3NBI A;  1MN3 A;  1GJS A;  2UXC M;  2DAM A;  4FWD A;  3K9P A;  4X66 M;  1VEK A;  1Y8G A;  4GHL A;  3KXE C;  2R45 A;  4HL4 A;  1GVN A;  3AOE A;  3TWM A;  2K6B A;  3HHW A;  4FW9 A;  1D0K A;  1TH3 A;  1K3X A;  1AIP C;  2JA2 A;  1R2Z A;  2F5O A;  1NNJ A;  4L16 A;  3WHL A;  3J2P B;  3QYE A;  1OFH A;  3DZD A;  2XSZ A;  2HKJ A;  2JZ1 A;  4NRW A;  1PJJ A;  4LJ7 A;  4OW0 A;  1TDZ A;  2D7E A;  4BB9 A;  3DA1 A;  1IQP A;  1KFV A;  3U6P A;  2QP9 X;  1E32 A;  2F5Q A;  3IG5 A;  5L8R F;  3GLF A;  3KOX E;  4DV0 M;  4B08 A;  3ZCB B;  2Y0T A;  5EXP A;  3PNV A;  2ZAO A;  1IM2 A;  1V33 A;  1XMQ M;  1JR3 E;  8CAT A;  5C1B A;  3LVV A;  2CRU A;  1FNN A;  2RGH A;  1QYR A;  3CF0 A;  1MJG M;  4M9Z A;  4LF9 M;  2R46 A;  4X62 M;  3FTF A;  4JYA M;  1UFZ A;  2OO9 A;  2CV0 A;  1OKS A;  3VKH A;  2JY5 A;  1WHC A;  5ITY A;  1GAB A;  4MGZ E;  3WHK A;  1NVM A;  3HHX A;  3T1Y M;  2FE8 A;  1HNX M;  3W0L B;  4CHT B;  2MR9 A;  3KP1 E;  2CE7 A;  4DV3 M;  1XWI A;  4FD2 A;  2KA6 B;  3R9X B;  1V92 A;  3L27 A;  2OOB A;  3VDU A;  2ZM6 M;  1L2B A;  3ZQJ A;  4LG2 A;  1K3W A;  1Z5A A;  5ITQ A;  3AOE C;  2H5X A;  5EXT A;  3UZU A;  3SAV A;  3LCU A;  3SFZ A;  1OAO C;  3E21 A;  2FH0 A;  2JP7 A;  2M5Z A;  3L26 A;  2F4V M;  2G8L A;  2ZBK B;  2X49 A;  2L6O A;  3T15 A;  4WW0 A;  3AOG A;  2C98 A;  3KFU G;  3SYL A;  1GKI A;  4DUY M;  1L8Q A;  1GO5 A;  3GLG A;  2D7H A;  1GL7 A;  2WSF F;  3HJS A;  4LFB M;  3C3D A;  4B3S M; 
#chains in the Genus database with same CATH homology
 3HU1 A;  2V1U A;  1HNZ M;  2ZAM A;  2UUB M;  4REZ A;  1SXJ B;  4FCW A;  2XFT A;  1YE9 A;  4JXJ A;  3FUU A;  4MH0 E;  3I51 A;  5ITX E;  4LJ6 A;  4W5W A;  5IZ7 D;  4CIS A;  3R8F A;  2Z3X A;  1VDD A;  3HJ8 A;  1I4W A;  4DV7 M;  3RFW A;  4IBD A;  5KO3 A;  5GKN A;  4QNM A;  4IBI A;  1Z5C A;  1J09 A;  5KPZ A;  1YSY A;  3A46 A;  4KO8 A;  2HCB A;  3U5Z A;  1QAN A;  3SAT A;  3E4R A;  1SXJ D;  1IBM M;  3MHV C;  1R7R A;  4FCT A;  4DR5 M;  2CHG A;  1Z6T A;  4NL4 H;  1ZAE A;  3FUV A;  2KEB A;  2NQ8 C;  4ITQ A;  2QZ4 A;  3T1H M;  3RGS A;  3GLF B;  3KSX A;  2UUC M;  4AZF A;  3LQQ A;  1N75 A;  1PM5 A;  3U61 A;  2CEA A;  2X8A A;  3RE8 A;  3UJN A;  3GPP A;  3GLH A;  4GRI A;  3FTC A;  4AQY M;  2M60 A;  3GPU A;  1L2C A;  3HKP A;  2XSZ D;  2Q2E B;  4G4R A;  2F5S A;  1G4A E;  4AKG A;  4LGY A;  3FD9 A;  4OVZ B;  3M7G A;  2ZAN A;  3GRV A;  3KW6 A;  2LNH C;  2DVW B;  1JQJ C;  3E9S A;  5EXX A;  5ITT A;  4M9S A;  2LWX A;  3CTW B;  2C99 A;  3W0F A;  1HT2 E;  4B7H A;  4G4N A;  4MGK E;  2CUZ A;  4LJ8 A;  2YQZ A;  4LRS A;  4MGH A;  2EA0 A;  3U6S A;  5IWA M;  1IN7 A;  1QVR A;  2C9C A;  3L2A A;  4X64 M;  3L29 A;  2DWZ B;  4JI3 M;  4G4O A;  4PT5 A;  3D8L A;  1LV7 A;  3HJQ A;  4LF4 M;  3JR5 A;  2H1R A;  4CGY B;  2KRU A;  1NY6 A;  4KLN A;  4TUW A;  5EP3 A;  3ZC7 B;  2DXI A;  5EJC A;  4I5S A;  2XF3 A;  5KPR A;  4IBK A;  1IBK M;  2RKO A;  4L4U A;  3GQ4 A;  2CV1 A;  3K8Z A;  3J81 S;  2Y20 A;  2C96 A;  1SXJ C;  3HGI A;  1I94 M;  3FTE A;  3FUX A;  4DR2 M;  5BR8 M;  4QOS A;  2CHQ A;  3U60 A;  1HQY E;  2RGO A;  1Q3B A;  2A5Y B;  1Z59 A;  1UM8 A;  3VDP A;  3LVW A;  1XC8 A;  2UU9 M;  4IBE A;  3SMS A;  4AG5 A;  1G41 A;  1GL6 A;  4GH9 A;  3THG A;  4S12 A;  3KOZ E;  1L1Z A;  2DHR A;  3U6Q A;  3ZH9 B;  1XXH A;  3FUW A;  4LFA M;  2X4A A;  1L2D A;  2YNM D;  5E26 A;  1G8P A;  3B9P A;  5IRE B;  3U6M A;  3AKZ A;  3PFI A;  3U61 B;  4B3T M;  2CHV A;  2R65 A;  1ORY B;  1IN8 A;  3VFD A;  2DWN A;  3GLH B;  2XGN A;  3SHF A;  1E9S A;  4D80 A;  2QBY B;  5ITU A;  3FKE A;  1SXJ E;  4L15 A;  2R4E A;  4LJ4 A;  5F3W A;  4DUZ M;  1MX0 A;  5KQD A;  4DR4 M;  2BNK A;  3GP1 A;  3SAS A;  3GLI B;  4JI2 M;  1NHG C;  1QAO A;  2DZN B;  1TH4 A;  1W5S A;  4XBO A;  1Z5B A;  1DGB A;  2XZU A;  4DR7 M;  2AHM A;  3JAM S;  4L8R C;  2V6Z M;  3SHG B;  1IBL M;  1NSF A;  1QZM A;  4LZJ A;  1N36 M;  4I81 A;  3ILK A;  1QAM A;  3H4M A;  5EP2 A;  1N33 M;  3SYK A;  4JV5 M;  5ITR A;  2J7O A;  3KSJ A;  3KOW E;  3DFZ A;  1DGG A;  1E9R A;  2L7I A;  4LJ5 A;  3PXG A;  4BBA A;  4GC9 A;  5DYI A;  4B7F A;  5LMN M;  3I4Y A;  1HT1 E;  5C18 A;  3HU2 A;  2L09 A;  4FCV A;  3SBJ A;  3AL0 C;  4IJE A;  1KYI A;  1X37 A;  2F5N A;  1W5T A;  4P16 A;  4NXN M;  4GC5 A;  2YFQ A;  4DV6 M;  4QHT A;  3I4V A;  4GIP A;  2O5R A;  1IY0 A;  2L7H A;  4PD2 A;  1QAQ A;  1DGF A;  4EIW A;  3U60 B;  3AV0 A;  3QWL A;  4HLQ A;  3RGP A;  2Z7J A;  4I8O A;  1L1T A;  3FTD A;  4JI6 M;  5LMU M;  2R4J A;  3FYC A;  3AJI B;  2R62 A;  2LH0 A;  1EE8 A;  2V1C A;  3PNY A;  5EP4 A;  4IBG A;  1XXH B;  2UUA M;  2VQE M;  2K47 A;  3J27 B;  4QOZ C;  4NXM M;  4DV1 M;  4II7 A;  1NJG A;  3MJ5 A;  4KHP M;  5A2Q S;  4IJF A;  4I4L A;  1KSF X;  2XZF A;  3KS4 A;  3VK7 A;  3KDS E;  1Q3C A;  4B3R M;  3GLG B;  1TDH A;  3SC3 A;  3VK8 A;  4IIW A;  4JI7 M;  2KXE A;  3GO8 A;  4MM3 B;  4JI5 M;  2C9O A;  4JI1 M;  4NOO B;  4LF6 M;  3FUT A;  3L28 A;  1IXR C;  5FTK A;  3EIH A;  5KQ8 A;  4LY6 A;  3BOS A;  3J7B A;  5EXS A;  4M9X A;  4LFC M;  3OTO M;  1FJG M;  4LF7 M;  1H6U A;  4DV2 M;  1IY2 A;  4LZZ A;  2Z4S A;  5ITX A;  1G3I A;  3TQS A;  5FTM A;  1K82 A;  1R6B X;  2FNA A;  4G6Z A;  4D81 A;  5FTJ A;  2YR0 A;  4RF0 A;  1J5E M;  5JI3 E;  3C58 A;  1OJL A;  3U6L A;  3U5Z B;  1IXS B;  1XNQ M;  4LCB A;  1DGH A;  2KRK A;  5FTL A;  4LJ9 A;  2VII A;  3K92 A;  4PDI A;  1QQW A;  4NSO B;  3GQ5 A;  3J80 S;  1NNU C;  4FWH A;  3TL4 X;  4LF5 M;  1Q39 A;  1TH2 A;  3VKG A;  4FVM A;  4B3M M;  2ERC A;  4AW4 A;  4NRV A;  4YHH M;  3KS8 A;  3UMM A;  3TWK A;  1PJI A;  3HWS A;  3HU3 A;  1GLN A;  3CF2 A;  3GQ3 A;  3LQR A;  4FWG A;  4YY3 M;  1HNW M;  3CF6 E;  4G4Q A;  2CV2 A;  4LF8 M;  3M0E A;  1DO0 A;  3VLF B;  4A3V B;  1XMO M;  2DWM A;  2J7N A;  3SAW A;  2XEP A;  4ZPX A;  2KZS A;  2HL7 A;  5KPT A;  3DOA A;  3HHZ A;  3GPY A;  3A45 A;  2XH9 A;  2BJW A;  1IN6 A;  4L78 A;  4AKI A;  2DZO B;  4R7G A;  1NJF A;  1N34 M;  2R18 A;  1N32 M;  4OVZ A;  2F5P A;  2HHH M;  2KW0 A;  4IBJ A;  2C5R A;  3GRR A;  1IXZ A;  4QNR A;  3SAU A;  4JI4 M;  4KOD A;  2QEN A;  4QHS A;  1OFI A;  4JI0 M;  3D8B A;  3U6D A;  1E94 E;  4D82 A;  2Y0Q A;  4WUR A;  1XNR M;  2OQ4 A;  1XHB A;  3U6C A;  2UXB M;  3TPZ A;  1JR3 D;  4GMQ A;  5JI2 E;  1YUB A;  1N77 A;  3QAU A;  1HQC A;  3GRY A;  2P5T A;  5EP1 A;  1G59 A;  4M0D A;  4DR6 M;  5EQT A;  4MB7 A;  4GHA A;  4JI8 M;  4LGM A;  4AKH A;  3KOY E;  4AI6 A;  4B7G A;  2XLJ A;  3MK6 A;  2Y21 A;  4RNA A;  5FTN A;  4DR1 M;  3Q8X A;  1IY1 A;  4PDG A;  3UGJ A;  2QCU A;  5BPV A;  3K1J A;  3GRU A;  3SAR A;  2UXD M;  3IG8 A;  2OPF A;  1IN4 A;  3K2L A;  4RF1 A;  4DV5 M;  2FFJ A;  2I7N A;  1HR0 M;  3AFH A;  1DGH B;  3U6O A;  2CFO A;  4IBF A;  3SMP A;  1JR3 A;  1R2Y A;  4K0K M;  5E6J A;  1ZQ9 A;  5FSW A;  2FOI C;  4M0W A;  4OU7 A;  4GKJ M;  2D7G A;  2G5G X;  4LJA A;  2BJV A;  7CAT A;  3JR4 A;  3T38 A;  2XFS A;  3NWL A;  3J7A S;  3PVS A;  4IBC A;  4X65 M;  4JN6 A;  5IT9 S;  2LXE A;  3UK6 A;  1T3T A;  4LRT A;  4OX9 M;  4Z8X A;  2KZU A;  3KP0 E;  4MGY E;  1WXQ A;  2Z4R A;  5DYG A;  3HHY A;  4IBB A;  3TE6 A;  3GPX A;  3U6E A;  1NHW C;  3M6A A;  4Z6Y A;  1S3S A;  2E5L M;  2I7P A;  4DR3 M;  2QBY A;  3LMM A;  4GIT A;  4BLC A;  4PCZ A;  4GKK M;  2QPA A;  4AG6 A;  4NSR A;  3A98 B;  2W82 A;  3KVW A;  1MU5 A;  1NY5 A;  1TGU A;  1SXJ A;  1D2N A;  3L25 A;  4R3D A;  5H37 D;  4XGI A;  1DO2 A;  2EO2 A;  3A42 A;  5FLX S;  3GLI A;  1J7K A;  4DV4 M;  3FYD A;  3TWL A;  2EUC A;  4MGI E;  1IN5 A;  1N78 A;  1C1K A;  5DNY A;  3EIE A;  2DWL A;  3NBI A;  2UXC M;  4FWD A;  4X66 M;  4GHL A;  3KXE C;  2R45 A;  4HL4 A;  1GVN A;  3AOE A;  3TWM A;  3HHW A;  4FW9 A;  1TH3 A;  1K3X A;  1R2Z A;  2JA2 A;  2F5O A;  1NNJ A;  4L16 A;  3WHL A;  3J2P B;  1OFH A;  3DZD A;  2XSZ A;  2HKJ A;  4NRW A;  1PJJ A;  4LJ7 A;  4OW0 A;  1TDZ A;  2D7E A;  4BB9 A;  3DA1 A;  1IQP A;  1KFV A;  3U6P A;  2QP9 X;  1E32 A;  2F5Q A;  3IG5 A;  3GLF A;  3KOX E;  4DV0 M;  4B08 A;  3ZCB B;  2Y0T A;  5EXP A;  3PNV A;  2ZAO A;  1IM2 A;  1XMQ M;  8CAT A;  5C1B A;  3LVV A;  1FNN A;  2RGH A;  1QYR A;  3CF0 A;  4M9Z A;  4LF9 M;  3FTF A;  2R46 A;  4X62 M;  4JYA M;  2CV0 A;  3VKH A;  5ITY A;  4MGZ E;  3WHK A;  1NVM A;  3HHX A;  3T1Y M;  2FE8 A;  1HNX M;  3W0L B;  4CHT B;  3KP1 E;  2CE7 A;  4DV3 M;  1XWI A;  4FD2 A;  2KA6 B;  3R9X B;  3L27 A;  3VDU A;  2ZM6 M;  1L2B A;  4LG2 A;  1K3W A;  1Z5A A;  5ITQ A;  3AOE C;  5EXT A;  3UZU A;  3SAV A;  3SFZ A;  2M5Z A;  2F4V M;  3L26 A;  2G8L A;  2ZBK B;  2X49 A;  2L6O A;  3T15 A;  4WW0 A;  3AOG A;  2C98 A;  3KFU G;  3SYL A;  1GKI A;  4DUY M;  1L8Q A;  3GLG A;  2D7H A;  1GL7 A;  3HJS A;  4LFB M;  2VQF M;  4B3S M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...