4X62M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x62M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x62M02
5IWAM 5BR8M 3T1HM 4LF6M 1PJJA 2OQ4A 4DV1M 1L1ZA 4JI6M 4JI7M 1XMQM 1J5EM 4JYAM 4DV2M 3OTOM 3GP1A 3GQ3A 1XC8A 3U6DA 2F5SA 3U6LA 3JAMS 2ZM6M 1PJIA 3J80S 5IT9S 4DUZM 3SAUA 3JR5A 4DV0M 4NRVA 2UXBM 4G4OA 3GPPA 3TWMA 4LF8M 1MX0A 3VK7A 5ITXA 1R2ZA 4JI0M 2F5PA 4JI3M 3SBJA 3U6SA 1HNZM 1Z59A 3U6OA 3GQ4A 2OPFA 1IBKM 2E5LM 5ITYA 4LFBM 3SASA 3J81S 3T1YM 4PDGA 1TDHA 4JI4M 4DR7M 4LF4M 3DOAA 4DUYM 4LFAM 3A42A 3JR4A 5ITTA 1L2BA 5LMNM 1N36M 4GKJM 1Z5AA 4CISA 1Q3BA 1FJGM 4NXNM 3GPUA 3GPYA 4AQYM 4PDIA 3A46A 4YHHM 4DR1M 4NRWA 4X64M 2HHHM 4B3SM 4JI8M 1Z5CA 4MB7A 3C58A 4DV6M 2XZFA 4LF5M 4G4NA 4DV5M 1PM5A 1IBLM 3SAWA 2F5OA 3SATA 4NXMM 5LMUM 4DR6M 2UUCM 4DR5M 3U6CA 3VK8A 2XZUA 5ITQA 3TWLA 4DR3M 1HNWM 4JI2M 1KFVA 3A45A 5FLXS 5ITUA 4GKKM 2EA0A 4X66M 3W0FA 1MU5A 4DV4M 1K3WA 1K82A 1N33M 3U6MA 4JV5M 4ITQA 1EE8A 4PD2A 1R2YA 1NNJA 4KHPM 1L2DA 2UU9M 4B3MM 3TWKA 2Q2EB 1K3XA 4JI1M 2ZBKB 1XNQM 2UXCM 1I94M 4G4QA 1HNXM 4LF9M 3GPXA 2F5NA 1L2CA 1IBMM 4YY3M 4X62M 4G4RA 3GO8A 4LF7M 4K0KM 4OX9M 3U6PA 2UUAM 1TDZA 5A2QS 1XMOM 5ITRA 4DV3M 2HKJA 1L1TA 4PCZA 4B3TM 4LFCM 2VQEM 3GQ5A 3U6QA 5ITXE 3SAVA 3SARA 4DV7M 1HR0M 1Q39A 2VQFM 2F5QA 1N32M 2F4VM 1N34M 4X65M 4B3RM 1Q3CA 1Z5BA 2UXDM 4DR2M 4JI5M 3U6EA 3J7AS 1XNRM 4DR4M 2UUBM
chains in the Genus database with same CATH superfamily
4PT5A 2DWZB 3TE6A 2OQ4A 4DV1M 3FUWA 2DXIA 3LQRA 1J5EM 1JR3A 1NSFA 1SG9A 3E4RA 3OTOM 3GRVA 1XC8A 2D7HA 3U6LA 1IXRC 1MJGM 3V76A 4LG2A 2BJVA 2LVOC 3JR5A 2WSFF 3UZUA 1G41A 2Z7JA 3HHWA 4GMQA 2BWEA 2Y20A 2D7EA 2MROB 4JI0M 1T43A 1WXQA 2L6OA 1QDTA 3E46A 3Q8GA 3AOEC 3SYKA 3SHGB 1ZAEA 1TR8A 2R6FA 3SBJA 4AI6A 2R0IA 1ORYB 3RGSA 3EIHA 3T38A 3ZC7B 1DGHA 1OAIA 1XHBA 2R65A 2D7GA 3E21A 3W67A 5C18A 4PDGA 4AKIA 3FUXA 4XK8F 3B9PA 4AW4A 4DR7M 2Z4RA 3FRIA 2DWMA 3IG5A 4TUWA 1L2BA 1GVNA 1Z5AA 4CISA 1V33A 1D0LA 3ZH9B 1CUKA 1OKSA 1SXJD 4B7HA 2XGNA 1PGYA 3ZCBB 2J7NA 4AQYM 4R7GA 5DYIA 2XLJA 4MGYE 4X64M 3GLGA 1LV7A 4RF1A 4B3SM 4JI8M 4DV6M 2EKFA 3NWLA 1JB0F 2JY7A 4I8OA 1OIZA 1PM5A 3SATA 3NBIA 4DR6M 3D8LA 1T6OA 3SFZA 2VIIA 2KA6B 4NL4H 3FUTA 5ITQA 2YQZA 1DGHB 4KLNA 1N75A 5E6JA 4X66M 2JZ1A 1L8QA 2BWBA 2G8LA 4M9ZA 1OFHA 3R9XB 2MGWA 3U6MA 4IJEA 3Q8XA 4ITQA 4PD2A 1R2YA 4AZFA 2K47A 1NNJA 1QQWA 4B3MM 3TWKA 1IXSA 3MJ5A 4GEWA 2MR9A 2DAKA 1VEKA 1RU3A 2DHYA 1PJQA 2WZJA 2DENA 2ZTCA 3GRRA 3VDUA 1TF0B 2EJSA 3GPXA 2F5NA 5EP1A 4I5SA 3E9SA 5IREB 1ZMVA 3L27A 4IBBA 3GO8A 3K9OA 4LF7M 1QANA 2Z3XA 4K0KM 3KOWE 3MK6A 5ITRA 4WURA 4BLCA 4MGZE 2P5TA 3CTWB 3T6PA 5F3WA 2A5YB 4LFCM 5FSWA 1QUTA 3GQ5A 2Y0TA 2VQEM 3R8FA 2EUCA 5DFLA 2KNZA 3HZJA 2O01F 2YNMD 4Z8XA 1XB2B 4DV7M 1Q39A 1GKIA 8CATA 3L28A 2VQFM 2O5RA 3U61A 1N32M 4S12A 4MGIE 2HL7A 3W68A 5EP4A 4X65M 3GLHE 4HL4A 1NJGA 3FTFA 1IN4A 2ZAMA 3I4VA 4RF0A 3ZQJA 3RGPA 3BBZA 4NOOB 4OVZA 5KQDA 2LTUA 4KODA 2DAEA 4DR4M 2QBYA 1H6UA 5DYGA 2ERCA 4F2LA 2C98A 4JI6M 1W5SA 5EXXA 2KHHA 3QAUA 3AOGA 3WHLA 2CHVA 3A98B 3K8ZA 3U6DA 3HHZA 3L29A 1D0MA 3TPZA 4CHTB 5IT9S 3HJSA 3KSXA 2KNAA 5EXSA 4LJ8A 3GLIA 4BBAA 1E9SA 2CHQA 3FE3A 4GC5A 4HLQA 4G4OA 3U61B 2YFQA 3GPPA 3TWMA 3VK7A 1J09A 2QZ4A 1OIPA 5EQTA 2DAGA 2AHMA 1EFUB 2LVPC 2R4EA 3BOSA 4NSOB 2F5PA 4JI3M 3KS8A 1NNUC 4FWDA 4W5WA 3U6SA 4OU7A 4JXJA 3GQ4A 3U6OA 2CRUA 1AIPC 4OVZB 1R4GA 2DWLA 3UGJA 1SXJA 2E5LM 2QBYB 4LFBM 3DA1A 1YUBA 4IBIA 3J81S 3SASA 1TDHA 2K0BX 4A3VB 4GC9A 4JI4M 3KP0E 1IN7A 4LF4M 4MH0E 2JXNA 3A42A 4LFAM 3JR4A 3KOXE 3HU3A 2FH0A 2JUJA 3HU2A 1N36M 4GKJM 1VQ1A 2JY6B 2CV2A 3FUVA 1FJGM 2DZNB 4NXNM 3GLFA 4DBGB 3GPYA 3WHKA 3FYCA 1WHCA 3L2AA 3GLGE 4YHHM 4B7GA 2Y21A 4FWGA 3FYDA 4M9XA 4M9SA 2BNKA 2C96A 1V34A 4MB7A 2LH0A 1GLNA 5FTMA 1VDLA 4II7A 4G4NA 1E32A 4XBOA 4AKHA 2LNHC 1HQCA 1D2NA 3GLHB 4L6V6 5LMUM 3HGIA 4LJ7A 3VFDA 1IFYA 4DR5M 3U60A 3FKEA 2XEPA 3B74A 2FE8A 1HT2E 4JI2M 3CF6E 1NY6A 2EA0A 4D81A 2DVWB 1QZMA 5JI2E 4QOSA 4DV4M 3CF0A 2O25A 3PFIA 4AG5A 4JN6A 2CE7A 1EE8A 5E26A 2JY5A 4IBDA 2KRUA 2XSZD 3K1JA 4KO8A 4RKUF 3GLFB 5FTJA 2VDBB 4LRSA 4GHLA 2ZBKB 2N35A 4B08A 4F1IA 1I94M 1GO5A 5EXTA 2HCBA 4G4QA 1LTMA 3TL4X 3NBXX 1QYRA 3MMPA 4IJFA 3TQSA 1L2CA 1IBMM 4FW9A 3B7QA 2RGOA 4X62M 2J5YA 2KDLA 4D82A 4HEOA 3U60B 1GL6A 3ILKA 2UUAM 2DKLA 1BVSA 2ZAOA 2DZOB 1N77A 2JZ0A 2HKJA 5BPVA 4QOZC 4PCZA 2CV0A 1G71A 4FWHA 4B3TM 4B7FA 2C5RA 3U6QA 2XH9A 1PJSA 4UN2B 3DZDA 4MGHA 1EIJA 2LHCA 3KOZE 3HHXA 4MM3B 2RKOA 2X49A 4LGYA 4B3RM 1Q3CA 4EIWA 4JI5M 1A5TA 3U6EA 3GLGB 2MJ5B 5KPTA 4MGKE 1TTEA 2QNJA 2R46A 1IXZA 4G6ZA 4WW0A 1XNRM 2UUBM 5IWAM 1DO2A 1S3SA 3T1HM 2W82A 1PJJA 1R7RA 4D80A 4JI7M 5EXPA 3B89A 1XMQM 4ZPXA 2LVQD 4GIPA 3GP1A 4NC6A 3D8BA 2F5SA 2X8AA 3JAMS 1Z6TA 2C9OA 2ZM6M 1PJIA 2XFTA 3J80S 3GLIE 1X37A 3J2PB 3FTEA 4DUZM 2QPAA 3SAUA 4DV0M 2V6ZM 3FUUA 4Y28F 3QWLA 2UXBM 2LWXA 4LF8M 1MX0A 2H5XA 2CHGA 5KO3A 1IXSB 1DO0A 2QQ8A 4IIWA 3I01M 2DWNA 4LZJA 2QSFX 1HNZM 3SC3A 3KDSE 1SXJE 4LJ5A 2FS1A 4CJ6A 3EIEA 2QHOB 3VLFB 1IBKM 2KZSA 1D0KA 1NV8A 3HKPA 2Z4SA 3T1YM 3GRUA 2J7OA 1TH2A 4L4UA 2KXEA 2R18A 4QHTA 1ZMWA 1UFZA 3KVWA 2KW0A 3RFWA 5ITTA 5LMNM 1WGNA 3LCVB 3KW6A 3B7NA 3GLFE 2OOBA 1VEGA 1Q3BA 2JY8A 4P16A 1E94E 2DHRA 3J27B 2L7IA 7CATA 1MN3A 2KRKA 2FFJA 1XXHA 4LRTA 3FD9A 1JQJC 3LW5F 4PDIA 4GRIA 1IY0A 1GJSA 1YE9A 4GH9A 2HHHM 1C7YA 2CP8A 2KEBA 5DNYA 1DGBA 4DV5M 2EO2A 3T15A 1WJ7A 2YR0A 1G59A 2I7PA 1VDDA 2CFOA 1QVRA 3HJ8A 1XWIA 4CIZA 5JI3E 3IECA 5IZ7D 3I4YA 2XSZA 2XZUA 1IN8A 4DR3M 1ZV1A 2LBCA 1HNWM 3AL0C 2VF8A 4CGYB 3K92A 5EP2A 5ITUA 5FLXS 4QHSA 3HX3A 4GKKM 1MU5A 1K3WA 2L4EA 3FTCA 2L09A 4FCTA 5FTLA 1UM8A 3PXGA 4GITA 5EP3A 1L2DA 2R4JA 3AFHA 1WR1B 4XGIA 4I81A 3GLIB 2UU9M 2JA2A 1GJTA 2MH8A 1VEJA 4FVMA 1XXHB 1YSYA 1XNQM 1HNXM 2JP7A 1PJTA 1IY1A 1G8PA 4L8RC 4L15A 1GL7A 2CV1A 1G4AE 2DAMA 3H4JA 4G4RA 1T3TA 2FOIC 3UK6A 3UMMA 4IBCA 2R45A 4FCWA 4OX9M 3KFUG 3U6PA 2WSEF 1SXJB 1QDRA 2GNOA 3HJQA 5A2QS 1DGFA 1XMOM 2QP9X 1QAQA 1ZQ9A 2Z8YM 3HU1A 5FTKA 4FD2A 2R44A 4P17A 5FTNA 1SXJC 2H1RA 1J7KA 3PVSA 5ITXE 4Q7JA 3SAVA 3SARA 3U5ZA 1OAOC 2F4VM 1N34M 1Y8GA 2K9DA 2HWJA 2RRUA 4IBEA 1W5TA 2OOAA 5C1BA 1F4IA 1R6BX 3LVWA 3QYEA 2DNAA 3SYLA 1WIVA 3I51A 1HJPA 2L7HA 5BR8M 4LF6M 3UJNA 2CEAA 3B7ZA 1DGGA 1L1ZA 2V1UA 3M0EA 3KXEC 4JYAM 1OTRA 2G3QA 4DV2M 3GQ3A 3L25A 4REZA 3PNVA 2DAIA 4R71A 4NRVA 2V1CA 4LGMA 2LXEA 2CWBA 3KS4A 3CF2A 3I04M 2BJWA 3U5ZB 3AJIB 3BXWA 1JR3D 1R2ZA 5ITXA 5KPRA 2X4AA 2JWSA 4LJ4A 2L4FA 1VG5A 2HAKA 3C9PA 1TH3A 3AV0A 3QYBA 3LCUA 2APLA 1IN5A 1C1KA 3IG8A 1QZEA 3LMMA 1Z59A 3KSJA 2OPFA 1YLAA 1ZMUA 3CGWA 1IQPA 5ITYA 1IY2A 2XFSA 4GHAA 3DOAA 1Q02A 4I4LA 4DUYM 2LVAA 1E9RA 2M5ZA 1AUAA 3VKGA 5H37D 1NO1A 4L16A 3C3DA 4LJ9A 1XXHE 4FCVA 3VDPA 3GPUA 1NVMA 2C99A 1G3IA 4LY6A 3A46A 4DR1M 4NRWA 2LHGA 2VF7A 3THGA 3VKHA 2OO9A 2KZUA 3K9PA 3LQQA 3F92A 1Z5CA 3C58A 2WSCF 2XZFA 4LF5M 3FRHA 4IBGA 3H4MA 5GKNA 1IBLM 3SAWA 2F5OA 3RE8A 4NXMM 2DZLA 4IBFA 3SMSA 1GABA 2RGHA 3J7BA 4IBJA 2UUCM 4NSRA 4Z6YA 3U6CA 3VK8A 4LJAA 2R62A 3MHVC 3TWLA 3DFZA 3LVVA 1KFVA 3A45A 2G5GX 3PNYA 3W0FA 3HHYA 4G3OA 1QUSA 1K82A 1NV9A 3M7GA 1QAMA 1N33M 2GQFA 1IN6A 1NHWC 4LJ6A 4M0DA 4JV5M 4QNRA 3KOYE 4ANRA 4KHPM 1NHGC 1I4WA 2C9CA 1OJLA 4L78A 5L8RF 2Q2EB 3GRYA 3AKZA 1K3XA 4JI1M 4LCBA 2L2DA 2ZTDA 4LZZA 1PRBA 2EKKA 4WP2A 2UXCM 2XF3A 1NY5A 4R3DA 5EJCA 2QENA 2B3TA 1P3QQ 1HQYE 4LF9M 2I7NA 1HT1E 4YY3M 3SMPA 2K6BA 2LVNC 1JR3E 1IM2A 4M0WA 3HWSA 1KYIA 4AG6A 3M6AA 2CUZA 2KNVA 1TDZA 1DV0A 1V92A 2FNAA 4DV3M 2DI0A 1L1TA 4AKGA 3L26A 1KSFX 5KQ8A 4BB9A 4OW0A 3AOEA 3K2LA 1N78A 1R5LA 2JNHA 1NJFA 2NQ8C 3IHPA 3SHFA 2Y0QA 1HR0M 3C3EA 1FNNA 2F5QA 3W0LB 1WGLA 3FTDA 1TH4A 1QAOA 1Z5BA 2UXDM 4IBKA 2ZANA 4KT0F 4DR2M 3GLHA 1OQYA 1TGUA 2QCUA 3HY5A 4RNAA 2M60A 5KPZA 3J7AS 4QNMA 1OFIA 3KP1E
chains in the Genus database with same CATH topology
4PT5A 2DWZB 3TE6A 2OQ4A 4DV1M 3FUWA 2DXIA 3LQRA 1J5EM 1JR3A 1NSFA 3E4RA 3OTOM 3GRVA 1XC8A 2D7HA 3U6LA 1IXRC 4LG2A 2BJVA 3JR5A 3UZUA 1G41A 2Z7JA 3HHWA 4GMQA 2Y20A 2D7EA 4JI0M 1WXQA 2L6OA 3AOEC 3SYKA 3SHGB 1ZAEA 3SBJA 4AI6A 1ORYB 3RGSA 3EIHA 3T38A 3ZC7B 1DGHA 1XHBA 2R65A 2D7GA 5C18A 4PDGA 4AKIA 3FUXA 3B9PA 4AW4A 4DR7M 2Z4RA 2DWMA 3IG5A 4TUWA 1L2BA 1GVNA 1Z5AA 4CISA 3ZH9B 1SXJD 4B7HA 2XGNA 3ZCBB 2J7NA 4AQYM 4R7GA 5DYIA 2XLJA 4MGYE 4X64M 3GLGA 1LV7A 4RF1A 4B3SM 4JI8M 4DV6M 3NWLA 4I8OA 1PM5A 3SATA 3NBIA 4DR6M 3D8LA 3SFZA 2VIIA 2KA6B 4NL4H 3FUTA 5ITQA 2YQZA 1DGHB 4KLNA 1N75A 5E6JA 4X66M 1L8QA 2G8LA 4M9ZA 1OFHA 3R9XB 3U6MA 4IJEA 3Q8XA 4ITQA 4PD2A 1R2YA 4AZFA 2K47A 1NNJA 1QQWA 4B3MM 3TWKA 3MJ5A 3GRRA 3VDUA 3GPXA 2F5NA 5EP1A 4I5SA 3E9SA 5IREB 3L27A 4IBBA 3GO8A 4LF7M 1QANA 2Z3XA 4K0KM 3KOWE 3MK6A 5ITRA 4WURA 4BLCA 4MGZE 2P5TA 3CTWB 5F3WA 4LFCM 2A5YB 5FSWA 3GQ5A 2VQEM 2Y0TA 3R8FA 2EUCA 2YNMD 4Z8XA 4DV7M 3U61A 1Q39A 1GKIA 8CATA 3L28A 2VQFM 2O5RA 1N32M 4S12A 4MGIE 2HL7A 4X65M 5EP4A 4HL4A 1NJGA 3FTFA 1IN4A 2ZAMA 3I4VA 4RF0A 3RGPA 4NOOB 4OVZA 5KQDA 4DR4M 4KODA 2QBYA 1H6UA 5DYGA 2ERCA 2C98A 4JI6M 1W5SA 5EXXA 3QAUA 3AOGA 3WHLA 2CHVA 3A98B 3K8ZA 3U6DA 3HHZA 3L29A 3TPZA 4CHTB 5IT9S 3HJSA 3KSXA 5EXSA 4LJ8A 3GLIA 4BBAA 1E9SA 2CHQA 4GC5A 4HLQA 4G4OA 3U61B 2YFQA 3GPPA 3TWMA 3VK7A 1J09A 2QZ4A 5EQTA 2F5PA 2AHMA 2R4EA 3BOSA 4NSOB 3KS8A 4JI3M 1NNUC 4FWDA 4W5WA 3U6SA 4OU7A 4JXJA 3GQ4A 3U6OA 4OVZB 2DWLA 3UGJA 1SXJA 2E5LM 2QBYB 4LFBM 3DA1A 1YUBA 4IBIA 3J81S 3SASA 1TDHA 4A3VB 4GC9A 4JI4M 3KP0E 1IN7A 4LF4M 4MH0E 3A42A 4LFAM 3JR4A 3KOXE 3HU3A 1N36M 3HU2A 4GKJM 2CV2A 3FUVA 1FJGM 2DZNB 4NXNM 3GLFA 3GPYA 3WHKA 3FYCA 3L2AA 4YHHM 4B7GA 2Y21A 4FWGA 3FYDA 4M9XA 4M9SA 2BNKA 2C96A 4MB7A 5FTMA 2LH0A 1GLNA 4II7A 4G4NA 1E32A 4XBOA 4AKHA 2LNHC 1HQCA 1D2NA 3GLHB 5LMUM 3HGIA 4LJ7A 3VFDA 4DR5M 3U60A 3FKEA 2XEPA 2FE8A 1HT2E 4JI2M 3CF6E 1NY6A 2EA0A 4D81A 2DVWB 1QZMA 5JI2E 4QOSA 4DV4M 3CF0A 3PFIA 4AG5A 4JN6A 2CE7A 1EE8A 5E26A 4IBDA 2KRUA 2XSZD 3K1JA 4KO8A 3GLFB 5FTJA 4GHLA 4LRSA 2ZBKB 4B08A 1I94M 5EXTA 2HCBA 4G4QA 3TL4X 1QYRA 3TQSA 4IJFA 1L2CA 1IBMM 4FW9A 2RGOA 4X62M 4D82A 3U60B 1GL6A 3ILKA 2UUAM 2ZAOA 2DZOB 1N77A 2HKJA 5BPVA 4QOZC 4PCZA 2CV0A 4FWHA 4B3TM 4B7FA 2C5RA 3U6QA 2XH9A 3DZDA 4MGHA 3KOZE 3HHXA 4MM3B 2RKOA 2X49A 4LGYA 4B3RM 1Q3CA 4EIWA 4JI5M 3U6EA 3GLGB 5KPTA 4MGKE 2R46A 1IXZA 4G6ZA 4WW0A 1XNRM 2UUBM 5IWAM 1DO2A 1S3SA 3T1HM 2W82A 1PJJA 1R7RA 4D80A 4JI7M 5EXPA 1XMQM 4ZPXA 4GIPA 3GP1A 3D8BA 2F5SA 2X8AA 3JAMS 1Z6TA 2C9OA 2ZM6M 1PJIA 2XFTA 3J80S 1X37A 3J2PB 3FTEA 4DUZM 2QPAA 3SAUA 4DV0M 2V6ZM 3FUUA 3QWLA 2UXBM 2LWXA 4LF8M 1MX0A 2CHGA 5KO3A 1IXSB 1DO0A 4IIWA 2DWNA 4LZJA 1HNZM 3SC3A 3KDSE 1SXJE 4LJ5A 3EIEA 3VLFB 1IBKM 2KZSA 3HKPA 2Z4SA 3T1YM 3GRUA 2J7OA 1TH2A 4L4UA 2KXEA 2R18A 4QHTA 3KVWA 2KW0A 3RFWA 5ITTA 5LMNM 3KW6A 1Q3BA 4P16A 1E94E 2DHRA 3J27B 2L7IA 7CATA 2KRKA 2FFJA 1XXHA 4LRTA 3FD9A 1JQJC 4PDIA 4GRIA 1IY0A 1YE9A 4GH9A 2HHHM 2KEBA 5DNYA 1DGBA 4DV5M 2EO2A 3T15A 2YR0A 1G59A 2I7PA 1VDDA 2CFOA 1QVRA 3HJ8A 1XWIA 5JI3E 2XZUA 5IZ7D 3I4YA 2XSZA 1IN8A 4DR3M 1HNWM 3AL0C 4CGYB 5FLXS 3K92A 5EP2A 5ITUA 4GKKM 4QHSA 1MU5A 1K3WA 3FTCA 2L09A 4FCTA 5FTLA 1UM8A 3PXGA 4GITA 5EP3A 1L2DA 2R4JA 3AFHA 3GLIB 4XGIA 4I81A 2UU9M 2JA2A 4FVMA 1XXHB 1YSYA 1XNQM 1HNXM 1IY1A 1G8PA 4L8RC 4L15A 1GL7A 2CV1A 1G4AE 4G4RA 1T3TA 2FOIC 3UK6A 3UMMA 4IBCA 2R45A 4FCWA 4OX9M 3KFUG 3U6PA 1SXJB 3HJQA 5A2QS 1XMOM 1DGFA 2QP9X 1QAQA 1ZQ9A 3HU1A 5FTKA 4FD2A 5FTNA 1SXJC 2H1RA 1J7KA 3PVSA 5ITXE 3SAVA 3SARA 3U5ZA 2F4VM 1N34M 4IBEA 1W5TA 5C1BA 1R6BX 3LVWA 3SYLA 3I51A 2L7HA 5BR8M 4LF6M 3UJNA 2CEAA 1L1ZA 1DGGA 2V1UA 3M0EA 3KXEC 4JYAM 4DV2M 3L25A 3GQ3A 4REZA 3PNVA 4NRVA 2V1CA 4LGMA 2LXEA 3KS4A 3CF2A 2BJWA 3U5ZB 3AJIB 1JR3D 1R2ZA 5ITXA 5KPRA 2X4AA 4LJ4A 1TH3A 3AV0A 1IN5A 1C1KA 3IG8A 3LMMA 1Z59A 3KSJA 2OPFA 1IQPA 5ITYA 1IY2A 2XFSA 4GHAA 3DOAA 4I4LA 4DUYM 1E9RA 2M5ZA 3VKGA 5H37D 4L16A 4LJ9A 4FCVA 3VDPA 3GPUA 2C99A 1NVMA 1G3IA 4LY6A 3A46A 4DR1M 4NRWA 3VKHA 3THGA 2KZUA 3LQQA 1Z5CA 3C58A 2XZFA 4LF5M 4IBGA 3H4MA 5GKNA 1IBLM 3SAWA 2F5OA 3RE8A 4NXMM 4IBFA 3SMSA 2RGHA 3J7BA 4IBJA 2UUCM 4NSRA 4Z6YA 3U6CA 3VK8A 4LJAA 2R62A 3MHVC 3TWLA 3DFZA 3LVVA 1KFVA 3A45A 2G5GX 3PNYA 3W0FA 3HHYA 1K82A 3M7GA 1QAMA 1N33M 1IN6A 1NHWC 4LJ6A 4M0DA 4JV5M 4QNRA 3KOYE 4KHPM 1NHGC 1I4WA 2C9CA 1OJLA 4L78A 2Q2EB 3GRYA 3AKZA 1K3XA 4JI1M 4LCBA 4LZZA 2UXCM 2XF3A 1NY5A 4R3DA 5EJCA 2QENA 1HQYE 4LF9M 2I7NA 1HT1E 4YY3M 3SMPA 1IM2A 4M0WA 3HWSA 1KYIA 4AG6A 3M6AA 2CUZA 1TDZA 2FNAA 4DV3M 1L1TA 4AKGA 3L26A 1KSFX 5KQ8A 4BB9A 4OW0A 3AOEA 3K2LA 1N78A 2NQ8C 1NJFA 3SHFA 1HR0M 2Y0QA 1FNNA 2F5QA 3W0LB 3FTDA 1TH4A 1QAOA 1Z5BA 2UXDM 4IBKA 2ZANA 4DR2M 3GLHA 1TGUA 2QCUA 3J7AS 4RNAA 2M60A 5KPZA 4QNMA 1OFIA 3KP1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA M;  5BR8 M;  3T1H M;  4LF6 M;  1PJJ A;  2OQ4 A;  4DV1 M;  1L1Z A;  4JI6 M;  4JI7 M;  1XMQ M;  1J5E M;  4JYA M;  4DV2 M;  3OTO M;  3GP1 A;  3GQ3 A;  1XC8 A;  3U6D A;  2F5S A;  3U6L A;  3JAM S;  2ZM6 M;  1PJI A;  3J80 S;  5IT9 S;  4DUZ M;  3SAU A;  3JR5 A;  4DV0 M;  4NRV A;  2UXB M;  4G4O A;  3GPP A;  3TWM A;  4LF8 M;  1MX0 A;  3VK7 A;  5ITX A;  1R2Z A;  4JI0 M;  2F5P A;  4JI3 M;  3SBJ A;  3U6S A;  1HNZ M;  1Z59 A;  3U6O A;  3GQ4 A;  2OPF A;  1IBK M;  2E5L M;  5ITY A;  4LFB M;  3SAS A;  3J81 S;  3T1Y M;  4PDG A;  1TDH A;  4JI4 M;  4DR7 M;  4LF4 M;  3DOA A;  4DUY M;  4LFA M;  3A42 A;  3JR4 A;  5ITT A;  1L2B A;  5LMN M;  1N36 M;  4GKJ M;  1Z5A A;  4CIS A;  1Q3B A;  1FJG M;  4NXN M;  3GPU A;  3GPY A;  4AQY M;  4PDI A;  3A46 A;  4YHH M;  4DR1 M;  4NRW A;  4X64 M;  2HHH M;  4B3S M;  4JI8 M;  1Z5C A;  4MB7 A;  3C58 A;  4DV6 M;  2XZF A;  4LF5 M;  4G4N A;  4DV5 M;  1PM5 A;  1IBL M;  3SAW A;  2F5O A;  3SAT A;  4NXM M;  5LMU M;  4DR6 M;  2UUC M;  4DR5 M;  3U6C A;  3VK8 A;  2XZU A;  5ITQ A;  3TWL A;  4DR3 M;  1HNW M;  4JI2 M;  1KFV A;  3A45 A;  5FLX S;  5ITU A;  4GKK M;  2EA0 A;  4X66 M;  3W0F A;  1MU5 A;  4DV4 M;  1K3W A;  1K82 A;  1N33 M;  3U6M A;  4JV5 M;  4ITQ A;  1EE8 A;  4PD2 A;  1R2Y A;  1NNJ A;  4KHP M;  1L2D A;  2UU9 M;  4B3M M;  3TWK A;  2Q2E B;  1K3X A;  4JI1 M;  2ZBK B;  1XNQ M;  2UXC M;  1I94 M;  4G4Q A;  1HNX M;  4LF9 M;  3GPX A;  2F5N A;  1L2C A;  1IBM M;  4YY3 M;  4X62 M;  4G4R A;  3GO8 A;  4LF7 M;  4K0K M;  4OX9 M;  3U6P A;  2UUA M;  1TDZ A;  5A2Q S;  1XMO M;  5ITR A;  4DV3 M;  2HKJ A;  1L1T A;  4PCZ A;  4B3T M;  4LFC M;  2VQE M;  3GQ5 A;  3U6Q A;  5ITX E;  3SAV A;  3SAR A;  4DV7 M;  1HR0 M;  1Q39 A;  2VQF M;  2F5Q A;  1N32 M;  2F4V M;  1N34 M;  4X65 M;  4B3R M;  1Q3C A;  1Z5B A;  2UXD M;  4DR2 M;  4JI5 M;  3U6E A;  3J7A S;  1XNR M;  4DR4 M;  2UUB M; 
#chains in the Genus database with same CATH topology
 4PT5 A;  2DWZ B;  3TE6 A;  2OQ4 A;  4DV1 M;  3FUW A;  2DXI A;  3LQR A;  1J5E M;  1JR3 A;  1NSF A;  1SG9 A;  3E4R A;  3OTO M;  3GRV A;  1XC8 A;  2D7H A;  3U6L A;  1IXR C;  1MJG M;  3V76 A;  4LG2 A;  2BJV A;  2LVO C;  3JR5 A;  2WSF F;  3UZU A;  1G41 A;  2Z7J A;  3HHW A;  4GMQ A;  2BWE A;  2Y20 A;  2D7E A;  2MRO B;  4JI0 M;  1T43 A;  1WXQ A;  2L6O A;  1QDT A;  3E46 A;  3Q8G A;  3AOE C;  3SYK A;  3SHG B;  1ZAE A;  1TR8 A;  2R6F A;  3SBJ A;  4AI6 A;  2R0I A;  1ORY B;  3RGS A;  3EIH A;  3T38 A;  3ZC7 B;  1DGH A;  1OAI A;  1XHB A;  2R65 A;  2D7G A;  3E21 A;  3W67 A;  5C18 A;  4PDG A;  4AKI A;  3FUX A;  4XK8 F;  3B9P A;  4AW4 A;  4DR7 M;  2Z4R A;  3FRI A;  2DWM A;  3IG5 A;  4TUW A;  1L2B A;  1GVN A;  1Z5A A;  4CIS A;  1V33 A;  1D0L A;  3ZH9 B;  1CUK A;  1OKS A;  1SXJ D;  4B7H A;  2XGN A;  1PGY A;  3ZCB B;  2J7N A;  4AQY M;  4R7G A;  5DYI A;  2XLJ A;  4MGY E;  4X64 M;  3GLG A;  1LV7 A;  4RF1 A;  4B3S M;  4JI8 M;  4DV6 M;  2EKF A;  3NWL A;  1JB0 F;  2JY7 A;  4I8O A;  1OIZ A;  1PM5 A;  3SAT A;  3NBI A;  4DR6 M;  3D8L A;  1T6O A;  3SFZ A;  2VII A;  2KA6 B;  4NL4 H;  3FUT A;  5ITQ A;  2YQZ A;  1DGH B;  4KLN A;  1N75 A;  5E6J A;  4X66 M;  2JZ1 A;  1L8Q A;  2BWB A;  2G8L A;  4M9Z A;  1OFH A;  3R9X B;  2MGW A;  3U6M A;  4IJE A;  3Q8X A;  4ITQ A;  4PD2 A;  1R2Y A;  4AZF A;  2K47 A;  1NNJ A;  1QQW A;  4B3M M;  3TWK A;  1IXS A;  3MJ5 A;  4GEW A;  2MR9 A;  2DAK A;  1VEK A;  1RU3 A;  2DHY A;  1PJQ A;  2WZJ A;  2DEN A;  2ZTC A;  3GRR A;  3VDU A;  1TF0 B;  2EJS A;  3GPX A;  2F5N A;  5EP1 A;  4I5S A;  3E9S A;  5IRE B;  1ZMV A;  3L27 A;  4IBB A;  3GO8 A;  3K9O A;  4LF7 M;  1QAN A;  2Z3X A;  4K0K M;  3KOW E;  3MK6 A;  5ITR A;  4WUR A;  4BLC A;  4MGZ E;  2P5T A;  3CTW B;  3T6P A;  5F3W A;  2A5Y B;  4LFC M;  5FSW A;  1QUT A;  3GQ5 A;  2Y0T A;  2VQE M;  3R8F A;  2EUC A;  5DFL A;  2KNZ A;  3HZJ A;  2O01 F;  2YNM D;  4Z8X A;  1XB2 B;  4DV7 M;  1Q39 A;  1GKI A;  8CAT A;  3L28 A;  2VQF M;  2O5R A;  3U61 A;  1N32 M;  4S12 A;  4MGI E;  2HL7 A;  3W68 A;  5EP4 A;  4X65 M;  3GLH E;  4HL4 A;  1NJG A;  3FTF A;  1IN4 A;  2ZAM A;  3I4V A;  4RF0 A;  3ZQJ A;  3RGP A;  3BBZ A;  4NOO B;  4OVZ A;  5KQD A;  2LTU A;  4KOD A;  2DAE A;  4DR4 M;  2QBY A;  1H6U A;  5DYG A;  2ERC A;  4F2L A;  2C98 A;  4JI6 M;  1W5S A;  5EXX A;  2KHH A;  3QAU A;  3AOG A;  3WHL A;  2CHV A;  3A98 B;  3K8Z A;  3U6D A;  3HHZ A;  3L29 A;  1D0M A;  3TPZ A;  4CHT B;  5IT9 S;  3HJS A;  3KSX A;  2KNA A;  5EXS A;  4LJ8 A;  3GLI A;  4BBA A;  1E9S A;  2CHQ A;  3FE3 A;  4GC5 A;  4HLQ A;  4G4O A;  3U61 B;  2YFQ A;  3GPP A;  3TWM A;  3VK7 A;  1J09 A;  2QZ4 A;  1OIP A;  5EQT A;  2DAG A;  2AHM A;  1EFU B;  2LVP C;  2R4E A;  3BOS A;  4NSO B;  2F5P A;  4JI3 M;  3KS8 A;  1NNU C;  4FWD A;  4W5W A;  3U6S A;  4OU7 A;  4JXJ A;  3GQ4 A;  3U6O A;  2CRU A;  1AIP C;  4OVZ B;  1R4G A;  2DWL A;  3UGJ A;  1SXJ A;  2E5L M;  2QBY B;  4LFB M;  3DA1 A;  1YUB A;  4IBI A;  3J81 S;  3SAS A;  1TDH A;  2K0B X;  4A3V B;  4GC9 A;  4JI4 M;  3KP0 E;  1IN7 A;  4LF4 M;  4MH0 E;  2JXN A;  3A42 A;  4LFA M;  3JR4 A;  3KOX E;  3HU3 A;  2FH0 A;  2JUJ A;  3HU2 A;  1N36 M;  4GKJ M;  1VQ1 A;  2JY6 B;  2CV2 A;  3FUV A;  1FJG M;  2DZN B;  4NXN M;  3GLF A;  4DBG B;  3GPY A;  3WHK A;  3FYC A;  1WHC A;  3L2A A;  3GLG E;  4YHH M;  4B7G A;  2Y21 A;  4FWG A;  3FYD A;  4M9X A;  4M9S A;  2BNK A;  2C96 A;  1V34 A;  4MB7 A;  2LH0 A;  1GLN A;  5FTM A;  1VDL A;  4II7 A;  4G4N A;  1E32 A;  4XBO A;  4AKH A;  2LNH C;  1HQC A;  1D2N A;  3GLH B;  4L6V 6;  5LMU M;  3HGI A;  4LJ7 A;  3VFD A;  1IFY A;  4DR5 M;  3U60 A;  3FKE A;  2XEP A;  3B74 A;  2FE8 A;  1HT2 E;  4JI2 M;  3CF6 E;  1NY6 A;  2EA0 A;  4D81 A;  2DVW B;  1QZM A;  5JI2 E;  4QOS A;  4DV4 M;  3CF0 A;  2O25 A;  3PFI A;  4AG5 A;  4JN6 A;  2CE7 A;  1EE8 A;  5E26 A;  2JY5 A;  4IBD A;  2KRU A;  2XSZ D;  3K1J A;  4KO8 A;  4RKU F;  3GLF B;  5FTJ A;  2VDB B;  4LRS A;  4GHL A;  2ZBK B;  2N35 A;  4B08 A;  4F1I A;  1I94 M;  1GO5 A;  5EXT A;  2HCB A;  4G4Q A;  1LTM A;  3TL4 X;  3NBX X;  1QYR A;  3MMP A;  4IJF A;  3TQS A;  1L2C A;  1IBM M;  4FW9 A;  3B7Q A;  2RGO A;  4X62 M;  2J5Y A;  2KDL A;  4D82 A;  4HEO A;  3U60 B;  1GL6 A;  3ILK A;  2UUA M;  2DKL A;  1BVS A;  2ZAO A;  2DZO B;  1N77 A;  2JZ0 A;  2HKJ A;  5BPV A;  4QOZ C;  4PCZ A;  2CV0 A;  1G71 A;  4FWH A;  4B3T M;  4B7F A;  2C5R A;  3U6Q A;  2XH9 A;  1PJS A;  4UN2 B;  3DZD A;  4MGH A;  1EIJ A;  2LHC A;  3KOZ E;  3HHX A;  4MM3 B;  2RKO A;  2X49 A;  4LGY A;  4B3R M;  1Q3C A;  4EIW A;  4JI5 M;  1A5T A;  3U6E A;  3GLG B;  2MJ5 B;  5KPT A;  4MGK E;  1TTE A;  2QNJ A;  2R46 A;  1IXZ A;  4G6Z A;  4WW0 A;  1XNR M;  2UUB M;  5IWA M;  1DO2 A;  1S3S A;  3T1H M;  2W82 A;  1PJJ A;  1R7R A;  4D80 A;  4JI7 M;  5EXP A;  3B89 A;  1XMQ M;  4ZPX A;  2LVQ D;  4GIP A;  3GP1 A;  4NC6 A;  3D8B A;  2F5S A;  2X8A A;  3JAM S;  1Z6T A;  2C9O A;  2ZM6 M;  1PJI A;  2XFT A;  3J80 S;  3GLI E;  1X37 A;  3J2P B;  3FTE A;  4DUZ M;  2QPA A;  3SAU A;  4DV0 M;  2V6Z M;  3FUU A;  4Y28 F;  3QWL A;  2UXB M;  2LWX A;  4LF8 M;  1MX0 A;  2H5X A;  2CHG A;  5KO3 A;  1IXS B;  1DO0 A;  2QQ8 A;  4IIW A;  3I01 M;  2DWN A;  4LZJ A;  2QSF X;  1HNZ M;  3SC3 A;  3KDS E;  1SXJ E;  4LJ5 A;  2FS1 A;  4CJ6 A;  3EIE A;  2QHO B;  3VLF B;  1IBK M;  2KZS A;  1D0K A;  1NV8 A;  3HKP A;  2Z4S A;  3T1Y M;  3GRU A;  2J7O A;  1TH2 A;  4L4U A;  2KXE A;  2R18 A;  4QHT A;  1ZMW A;  1UFZ A;  3KVW A;  2KW0 A;  3RFW A;  5ITT A;  5LMN M;  1WGN A;  3LCV B;  3KW6 A;  3B7N A;  3GLF E;  2OOB A;  1VEG A;  1Q3B A;  2JY8 A;  4P16 A;  1E94 E;  2DHR A;  3J27 B;  2L7I A;  7CAT A;  1MN3 A;  2KRK A;  2FFJ A;  1XXH A;  4LRT A;  3FD9 A;  1JQJ C;  3LW5 F;  4PDI A;  4GRI A;  1IY0 A;  1GJS A;  1YE9 A;  4GH9 A;  2HHH M;  1C7Y A;  2CP8 A;  2KEB A;  5DNY A;  1DGB A;  4DV5 M;  2EO2 A;  3T15 A;  1WJ7 A;  2YR0 A;  1G59 A;  2I7P A;  1VDD A;  2CFO A;  1QVR A;  3HJ8 A;  1XWI A;  4CIZ A;  5JI3 E;  3IEC A;  5IZ7 D;  3I4Y A;  2XSZ A;  2XZU A;  1IN8 A;  4DR3 M;  1ZV1 A;  2LBC A;  1HNW M;  3AL0 C;  2VF8 A;  4CGY B;  3K92 A;  5EP2 A;  5ITU A;  5FLX S;  4QHS A;  3HX3 A;  4GKK M;  1MU5 A;  1K3W A;  2L4E A;  3FTC A;  2L09 A;  4FCT A;  5FTL A;  1UM8 A;  3PXG A;  4GIT A;  5EP3 A;  1L2D A;  2R4J A;  3AFH A;  1WR1 B;  4XGI A;  4I81 A;  3GLI B;  2UU9 M;  2JA2 A;  1GJT A;  2MH8 A;  1VEJ A;  4FVM A;  1XXH B;  1YSY A;  1XNQ M;  1HNX M;  2JP7 A;  1PJT A;  1IY1 A;  1G8P A;  4L8R C;  4L15 A;  1GL7 A;  2CV1 A;  1G4A E;  2DAM A;  3H4J A;  4G4R A;  1T3T A;  2FOI C;  3UK6 A;  3UMM A;  4IBC A;  2R45 A;  4FCW A;  4OX9 M;  3KFU G;  3U6P A;  2WSE F;  1SXJ B;  1QDR A;  2GNO A;  3HJQ A;  5A2Q S;  1DGF A;  1XMO M;  2QP9 X;  1QAQ A;  1ZQ9 A;  2Z8Y M;  3HU1 A;  5FTK A;  4FD2 A;  2R44 A;  4P17 A;  5FTN A;  1SXJ C;  2H1R A;  1J7K A;  3PVS A;  5ITX E;  4Q7J A;  3SAV A;  3SAR A;  3U5Z A;  1OAO C;  2F4V M;  1N34 M;  1Y8G A;  2K9D A;  2HWJ A;  2RRU A;  4IBE A;  1W5T A;  2OOA A;  5C1B A;  1F4I A;  1R6B X;  3LVW A;  3QYE A;  2DNA A;  3SYL A;  1WIV A;  3I51 A;  1HJP A;  2L7H A;  5BR8 M;  4LF6 M;  3UJN A;  2CEA A;  3B7Z A;  1DGG A;  1L1Z A;  2V1U A;  3M0E A;  3KXE C;  4JYA M;  1OTR A;  2G3Q A;  4DV2 M;  3GQ3 A;  3L25 A;  4REZ A;  3PNV A;  2DAI A;  4R71 A;  4NRV A;  2V1C A;  4LGM A;  2LXE A;  2CWB A;  3KS4 A;  3CF2 A;  3I04 M;  2BJW A;  3U5Z B;  3AJI B;  3BXW A;  1JR3 D;  1R2Z A;  5ITX A;  5KPR A;  2X4A A;  2JWS A;  4LJ4 A;  2L4F A;  1VG5 A;  2HAK A;  3C9P A;  1TH3 A;  3AV0 A;  3QYB A;  3LCU A;  2APL A;  1IN5 A;  1C1K A;  3IG8 A;  1QZE A;  3LMM A;  1Z59 A;  3KSJ A;  2OPF A;  1YLA A;  1ZMU A;  3CGW A;  1IQP A;  5ITY A;  1IY2 A;  2XFS A;  4GHA A;  3DOA A;  1Q02 A;  4I4L A;  4DUY M;  2LVA A;  1E9R A;  2M5Z A;  1AUA A;  3VKG A;  5H37 D;  1NO1 A;  4L16 A;  3C3D A;  4LJ9 A;  1XXH E;  4FCV A;  3VDP A;  3GPU A;  1NVM A;  2C99 A;  1G3I A;  4LY6 A;  3A46 A;  4DR1 M;  4NRW A;  2LHG A;  2VF7 A;  3THG A;  3VKH A;  2OO9 A;  2KZU A;  3K9P A;  3LQQ A;  3F92 A;  1Z5C A;  3C58 A;  2WSC F;  2XZF A;  4LF5 M;  3FRH A;  4IBG A;  3H4M A;  5GKN A;  1IBL M;  3SAW A;  2F5O A;  3RE8 A;  4NXM M;  2DZL A;  4IBF A;  3SMS A;  1GAB A;  2RGH A;  3J7B A;  4IBJ A;  2UUC M;  4NSR A;  4Z6Y A;  3U6C A;  3VK8 A;  4LJA A;  2R62 A;  3MHV C;  3TWL A;  3DFZ A;  3LVV A;  1KFV A;  3A45 A;  2G5G X;  3PNY A;  3W0F A;  3HHY A;  4G3O A;  1QUS A;  1K82 A;  1NV9 A;  3M7G A;  1QAM A;  1N33 M;  2GQF A;  1IN6 A;  1NHW C;  4LJ6 A;  4M0D A;  4JV5 M;  4QNR A;  3KOY E;  4ANR A;  4KHP M;  1NHG C;  1I4W A;  2C9C A;  1OJL A;  4L78 A;  5L8R F;  2Q2E B;  3GRY A;  3AKZ A;  1K3X A;  4JI1 M;  4LCB A;  2L2D A;  2ZTD A;  4LZZ A;  1PRB A;  2EKK A;  4WP2 A;  2UXC M;  2XF3 A;  1NY5 A;  4R3D A;  5EJC A;  2QEN A;  2B3T A;  1P3Q Q;  1HQY E;  4LF9 M;  2I7N A;  1HT1 E;  4YY3 M;  3SMP A;  2K6B A;  2LVN C;  1JR3 E;  1IM2 A;  4M0W A;  3HWS A;  1KYI A;  4AG6 A;  3M6A A;  2CUZ A;  2KNV A;  1TDZ A;  1DV0 A;  1V92 A;  2FNA A;  4DV3 M;  2DI0 A;  1L1T A;  4AKG A;  3L26 A;  1KSF X;  5KQ8 A;  4BB9 A;  4OW0 A;  3AOE A;  3K2L A;  1N78 A;  1R5L A;  2JNH A;  1NJF A;  2NQ8 C;  3IHP A;  3SHF A;  2Y0Q A;  1HR0 M;  3C3E A;  1FNN A;  2F5Q A;  3W0L B;  1WGL A;  3FTD A;  1TH4 A;  1QAO A;  1Z5B A;  2UXD M;  4IBK A;  2ZAN A;  4KT0 F;  4DR2 M;  3GLH A;  1OQY A;  1TGU A;  2QCU A;  3HY5 A;  4RNA A;  2M60 A;  5KPZ A;  3J7A S;  4QNM A;  1OFI A;  3KP1 E; 
#chains in the Genus database with same CATH homology
 4PT5 A;  2DWZ B;  3TE6 A;  2OQ4 A;  4DV1 M;  3FUW A;  2DXI A;  3LQR A;  1J5E M;  1JR3 A;  1NSF A;  3E4R A;  3OTO M;  3GRV A;  1XC8 A;  2D7H A;  3U6L A;  1IXR C;  4LG2 A;  2BJV A;  3JR5 A;  3UZU A;  1G41 A;  2Z7J A;  3HHW A;  4GMQ A;  2Y20 A;  2D7E A;  4JI0 M;  1WXQ A;  2L6O A;  3AOE C;  3SYK A;  3SHG B;  1ZAE A;  3SBJ A;  4AI6 A;  1ORY B;  3RGS A;  3EIH A;  3T38 A;  3ZC7 B;  1DGH A;  1XHB A;  2R65 A;  2D7G A;  5C18 A;  4PDG A;  4AKI A;  3FUX A;  3B9P A;  4AW4 A;  4DR7 M;  2Z4R A;  2DWM A;  3IG5 A;  4TUW A;  1L2B A;  1GVN A;  1Z5A A;  4CIS A;  3ZH9 B;  1SXJ D;  4B7H A;  2XGN A;  3ZCB B;  2J7N A;  4AQY M;  4R7G A;  5DYI A;  2XLJ A;  4MGY E;  4X64 M;  3GLG A;  1LV7 A;  4RF1 A;  4B3S M;  4JI8 M;  4DV6 M;  3NWL A;  4I8O A;  1PM5 A;  3SAT A;  3NBI A;  4DR6 M;  3D8L A;  3SFZ A;  2VII A;  2KA6 B;  4NL4 H;  3FUT A;  5ITQ A;  2YQZ A;  1DGH B;  4KLN A;  1N75 A;  5E6J A;  4X66 M;  1L8Q A;  2G8L A;  4M9Z A;  1OFH A;  3R9X B;  3U6M A;  4IJE A;  3Q8X A;  4ITQ A;  4PD2 A;  1R2Y A;  4AZF A;  2K47 A;  1NNJ A;  1QQW A;  4B3M M;  3TWK A;  3MJ5 A;  3GRR A;  3VDU A;  3GPX A;  2F5N A;  5EP1 A;  4I5S A;  3E9S A;  5IRE B;  3L27 A;  4IBB A;  3GO8 A;  4LF7 M;  1QAN A;  2Z3X A;  4K0K M;  3KOW E;  3MK6 A;  5ITR A;  4WUR A;  4BLC A;  4MGZ E;  2P5T A;  3CTW B;  5F3W A;  4LFC M;  2A5Y B;  5FSW A;  3GQ5 A;  2VQE M;  2Y0T A;  3R8F A;  2EUC A;  2YNM D;  4Z8X A;  4DV7 M;  3U61 A;  1Q39 A;  1GKI A;  8CAT A;  3L28 A;  2VQF M;  2O5R A;  1N32 M;  4S12 A;  4MGI E;  2HL7 A;  4X65 M;  5EP4 A;  4HL4 A;  1NJG A;  3FTF A;  1IN4 A;  2ZAM A;  3I4V A;  4RF0 A;  3RGP A;  4NOO B;  4OVZ A;  5KQD A;  4DR4 M;  4KOD A;  2QBY A;  1H6U A;  5DYG A;  2ERC A;  2C98 A;  4JI6 M;  1W5S A;  5EXX A;  3QAU A;  3AOG A;  3WHL A;  2CHV A;  3A98 B;  3K8Z A;  3U6D A;  3HHZ A;  3L29 A;  3TPZ A;  4CHT B;  5IT9 S;  3HJS A;  3KSX A;  5EXS A;  4LJ8 A;  3GLI A;  4BBA A;  1E9S A;  2CHQ A;  4GC5 A;  4HLQ A;  4G4O A;  3U61 B;  2YFQ A;  3GPP A;  3TWM A;  3VK7 A;  1J09 A;  2QZ4 A;  5EQT A;  2F5P A;  2AHM A;  2R4E A;  3BOS A;  4NSO B;  3KS8 A;  4JI3 M;  1NNU C;  4FWD A;  4W5W A;  3U6S A;  4OU7 A;  4JXJ A;  3GQ4 A;  3U6O A;  4OVZ B;  2DWL A;  3UGJ A;  1SXJ A;  2E5L M;  2QBY B;  4LFB M;  3DA1 A;  1YUB A;  4IBI A;  3J81 S;  3SAS A;  1TDH A;  4A3V B;  4GC9 A;  4JI4 M;  3KP0 E;  1IN7 A;  4LF4 M;  4MH0 E;  3A42 A;  4LFA M;  3JR4 A;  3KOX E;  3HU3 A;  1N36 M;  3HU2 A;  4GKJ M;  2CV2 A;  3FUV A;  1FJG M;  2DZN B;  4NXN M;  3GLF A;  3GPY A;  3WHK A;  3FYC A;  3L2A A;  4YHH M;  4B7G A;  2Y21 A;  4FWG A;  3FYD A;  4M9X A;  4M9S A;  2BNK A;  2C96 A;  4MB7 A;  5FTM A;  2LH0 A;  1GLN A;  4II7 A;  4G4N A;  1E32 A;  4XBO A;  4AKH A;  2LNH C;  1HQC A;  1D2N A;  3GLH B;  5LMU M;  3HGI A;  4LJ7 A;  3VFD A;  4DR5 M;  3U60 A;  3FKE A;  2XEP A;  2FE8 A;  1HT2 E;  4JI2 M;  3CF6 E;  1NY6 A;  2EA0 A;  4D81 A;  2DVW B;  1QZM A;  5JI2 E;  4QOS A;  4DV4 M;  3CF0 A;  3PFI A;  4AG5 A;  4JN6 A;  2CE7 A;  1EE8 A;  5E26 A;  4IBD A;  2KRU A;  2XSZ D;  3K1J A;  4KO8 A;  3GLF B;  5FTJ A;  4GHL A;  4LRS A;  2ZBK B;  4B08 A;  1I94 M;  5EXT A;  2HCB A;  4G4Q A;  3TL4 X;  1QYR A;  3TQS A;  4IJF A;  1L2C A;  1IBM M;  4FW9 A;  2RGO A;  4X62 M;  4D82 A;  3U60 B;  1GL6 A;  3ILK A;  2UUA M;  2ZAO A;  2DZO B;  1N77 A;  2HKJ A;  5BPV A;  4QOZ C;  4PCZ A;  2CV0 A;  4FWH A;  4B3T M;  4B7F A;  2C5R A;  3U6Q A;  2XH9 A;  3DZD A;  4MGH A;  3KOZ E;  3HHX A;  4MM3 B;  2RKO A;  2X49 A;  4LGY A;  4B3R M;  1Q3C A;  4EIW A;  4JI5 M;  3U6E A;  3GLG B;  5KPT A;  4MGK E;  2R46 A;  1IXZ A;  4G6Z A;  4WW0 A;  1XNR M;  2UUB M;  5IWA M;  1DO2 A;  1S3S A;  3T1H M;  2W82 A;  1PJJ A;  1R7R A;  4D80 A;  4JI7 M;  5EXP A;  1XMQ M;  4ZPX A;  4GIP A;  3GP1 A;  3D8B A;  2F5S A;  2X8A A;  3JAM S;  1Z6T A;  2C9O A;  2ZM6 M;  1PJI A;  2XFT A;  3J80 S;  1X37 A;  3J2P B;  3FTE A;  4DUZ M;  2QPA A;  3SAU A;  4DV0 M;  2V6Z M;  3FUU A;  3QWL A;  2UXB M;  2LWX A;  4LF8 M;  1MX0 A;  2CHG A;  5KO3 A;  1IXS B;  1DO0 A;  4IIW A;  2DWN A;  4LZJ A;  1HNZ M;  3SC3 A;  3KDS E;  1SXJ E;  4LJ5 A;  3EIE A;  3VLF B;  1IBK M;  2KZS A;  3HKP A;  2Z4S A;  3T1Y M;  3GRU A;  2J7O A;  1TH2 A;  4L4U A;  2KXE A;  2R18 A;  4QHT A;  3KVW A;  2KW0 A;  3RFW A;  5ITT A;  5LMN M;  3KW6 A;  1Q3B A;  4P16 A;  1E94 E;  2DHR A;  3J27 B;  2L7I A;  7CAT A;  2KRK A;  2FFJ A;  1XXH A;  4LRT A;  3FD9 A;  1JQJ C;  4PDI A;  4GRI A;  1IY0 A;  1YE9 A;  4GH9 A;  2HHH M;  2KEB A;  5DNY A;  1DGB A;  4DV5 M;  2EO2 A;  3T15 A;  2YR0 A;  1G59 A;  2I7P A;  1VDD A;  2CFO A;  1QVR A;  3HJ8 A;  1XWI A;  5JI3 E;  2XZU A;  5IZ7 D;  3I4Y A;  2XSZ A;  1IN8 A;  4DR3 M;  1HNW M;  3AL0 C;  4CGY B;  5FLX S;  3K92 A;  5EP2 A;  5ITU A;  4GKK M;  4QHS A;  1MU5 A;  1K3W A;  3FTC A;  2L09 A;  4FCT A;  5FTL A;  1UM8 A;  3PXG A;  4GIT A;  5EP3 A;  1L2D A;  2R4J A;  3AFH A;  3GLI B;  4XGI A;  4I81 A;  2UU9 M;  2JA2 A;  4FVM A;  1XXH B;  1YSY A;  1XNQ M;  1HNX M;  1IY1 A;  1G8P A;  4L8R C;  4L15 A;  1GL7 A;  2CV1 A;  1G4A E;  4G4R A;  1T3T A;  2FOI C;  3UK6 A;  3UMM A;  4IBC A;  2R45 A;  4FCW A;  4OX9 M;  3KFU G;  3U6P A;  1SXJ B;  3HJQ A;  5A2Q S;  1XMO M;  1DGF A;  2QP9 X;  1QAQ A;  1ZQ9 A;  3HU1 A;  5FTK A;  4FD2 A;  5FTN A;  1SXJ C;  2H1R A;  1J7K A;  3PVS A;  5ITX E;  3SAV A;  3SAR A;  3U5Z A;  2F4V M;  1N34 M;  4IBE A;  1W5T A;  5C1B A;  1R6B X;  3LVW A;  3SYL A;  3I51 A;  2L7H A;  5BR8 M;  4LF6 M;  3UJN A;  2CEA A;  1L1Z A;  1DGG A;  2V1U A;  3M0E A;  3KXE C;  4JYA M;  4DV2 M;  3L25 A;  3GQ3 A;  4REZ A;  3PNV A;  4NRV A;  2V1C A;  4LGM A;  2LXE A;  3KS4 A;  3CF2 A;  2BJW A;  3U5Z B;  3AJI B;  1JR3 D;  1R2Z A;  5ITX A;  5KPR A;  2X4A A;  4LJ4 A;  1TH3 A;  3AV0 A;  1IN5 A;  1C1K A;  3IG8 A;  3LMM A;  1Z59 A;  3KSJ A;  2OPF A;  1IQP A;  5ITY A;  1IY2 A;  2XFS A;  4GHA A;  3DOA A;  4I4L A;  4DUY M;  1E9R A;  2M5Z A;  3VKG A;  5H37 D;  4L16 A;  4LJ9 A;  4FCV A;  3VDP A;  3GPU A;  2C99 A;  1NVM A;  1G3I A;  4LY6 A;  3A46 A;  4DR1 M;  4NRW A;  3VKH A;  3THG A;  2KZU A;  3LQQ A;  1Z5C A;  3C58 A;  2XZF A;  4LF5 M;  4IBG A;  3H4M A;  5GKN A;  1IBL M;  3SAW A;  2F5O A;  3RE8 A;  4NXM M;  4IBF A;  3SMS A;  2RGH A;  3J7B A;  4IBJ A;  2UUC M;  4NSR A;  4Z6Y A;  3U6C A;  3VK8 A;  4LJA A;  2R62 A;  3MHV C;  3TWL A;  3DFZ A;  3LVV A;  1KFV A;  3A45 A;  2G5G X;  3PNY A;  3W0F A;  3HHY A;  1K82 A;  3M7G A;  1QAM A;  1N33 M;  1IN6 A;  1NHW C;  4LJ6 A;  4M0D A;  4JV5 M;  4QNR A;  3KOY E;  4KHP M;  1NHG C;  1I4W A;  2C9C A;  1OJL A;  4L78 A;  2Q2E B;  3GRY A;  3AKZ A;  1K3X A;  4JI1 M;  4LCB A;  4LZZ A;  2UXC M;  2XF3 A;  1NY5 A;  4R3D A;  5EJC A;  2QEN A;  1HQY E;  4LF9 M;  2I7N A;  1HT1 E;  4YY3 M;  3SMP A;  1IM2 A;  4M0W A;  3HWS A;  1KYI A;  4AG6 A;  3M6A A;  2CUZ A;  1TDZ A;  2FNA A;  4DV3 M;  1L1T A;  4AKG A;  3L26 A;  1KSF X;  5KQ8 A;  4BB9 A;  4OW0 A;  3AOE A;  3K2L A;  1N78 A;  2NQ8 C;  1NJF A;  3SHF A;  1HR0 M;  2Y0Q A;  1FNN A;  2F5Q A;  3W0L B;  3FTD A;  1TH4 A;  1QAO A;  1Z5B A;  2UXD M;  4IBK A;  2ZAN A;  4DR2 M;  3GLH A;  1TGU A;  2QCU A;  3J7A S;  4RNA A;  2M60 A;  5KPZ A;  4QNM A;  1OFI A;  3KP1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...