4X62M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x62M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x62M02
3SARA 5IT9S 2F5OA 1HR0M 3JR4A 1N34M 1K82A 2UU9M 4B3SM 1IBLM 3J7AS 4PDIA 3DOAA 4JI7M 4KHPM 3U6EA 3W0FA 1L2CA 4G4NA 4DUYM 2XZUA 4PD2A 3U6PA 4DR5M 3SASA 3U6SA 3SAWA 4JI2M 2E5LM 4JI6M 4PCZA 3TWLA 1XMOM 5ITQA 1XC8A 2F5SA 4LF6M 5BR8M 1NNJA 5ITTA 1N36M 1K3XA 1IBKM 2UXBM 1N32M 3TWKA 1PJJA 4JI0M 1PJIA 1K3WA 4DR2M 3SAVA 1EE8A 3GQ4A 1MX0A 5LMNM 3TWMA 1L2BA 1Z5BA 4JI5M 4DV2M 1I94M 2F4VM 4LFAM 3C58A 1Z5AA 3A46A 1Z5CA 1Q39A 5IWAM 3GQ5A 5ITUA 4DUZM 2HKJA 4PDGA 2F5NA 4B3TM 4DR3M 2OPFA 4X66M 4B3RM 4X65M 4LF5M 3SAUA 5ITXE 1MU5A 1L1ZA 2HHHM 2VQEM 1L2DA 1J5EM 3VK8A 3VK7A 4DV5M 4LFCM 4NXMM 4OX9M 3A45A 1TDZA 1N33M 2ZBKB 4DR4M 4CISA 3GP1A 4X62M 2UXDM 4GKKM 5LMUM 1Q3BA 4DV7M 1HNZM 3GPPA 3U6CA 3GPYA 4YY3M 4NXNM 1HNWM 4DV6M 1XMQM 3GO8A 4JI3M 2VQFM 4LF9M 5ITRA 2F5QA 4JI8M 2OQ4A 5FLXS 4NRWA 2F5PA 1IBMM 3SATA 3JR5A 4G4QA 3GQ3A 3OTOM 4X64M 4DV3M 3J81S 1KFVA 3SBJA 2UXCM 4NRVA 5ITYA 1FJGM 1R2YA 3JAMS 3A42A 4DV1M 3U6MA 4K0KM 4AQYM 1XNRM 2UUBM 4B3MM 1R2ZA 2UUCM 4G4RA 5A2QS 4JI4M 2UUAM 3U6LA 2XZFA 1PM5A 3J80S 4MB7A 3U6QA 3U6OA 4G4OA 4JI1M 4LF7M 4DR1M 4DV4M 3GPUA 4JYAM 4DR7M 1XNQM 4DV0M 1HNXM 3GPXA 3T1HM 4ITQA 4LFBM 1TDHA 2EA0A 5ITXA 3U6DA 2Q2EB 1L1TA 4DR6M 1Z59A 4LF4M 4GKJM 4YHHM 1Q3CA 4JV5M 3T1YM 2ZM6M 4LF8M
chains in the Genus database with same CATH superfamily
4QHSA 1N78A 1SXJE 3U5ZA 3JR4A 1K82A 4I4LA 1W5SA 5DFLA 2BWEA 2KNZA 2C96A 1SXJB 1HQCA 2JY5A 3FUXA 4R3DA 2I7NA 2N35A 4KHPM 3SHGB 4LZZA 1JQJC 2L7IA 3U6EA 5EP3A 2FH0A 2KRUA 3FYDA 3FTDA 4OVZA 2DZOB 4CHTB 3U6PA 2R4EA 2CV2A 1J09A 5FTNA 1GL6A 2QSFX 1TH3A 2DAMA 4Y28F 3GRVA 3ZQJA 1NSFA 4ANRA 1XC8A 2F5SA 3PFIA 3VKGA 1NNJA 3I4VA 4AKIA 1NNUC 2CUZA 1N36M 1IBKM 3KSXA 3VLFB 1QVRA 1V33A 2BNKA 2R62A 3KP0E 1MJGM 4LJ6A 4RF0A 3T6PA 3QYEA 4GHLA 2H1RA 3UGJA 1MX0A 1XXHB 1DV0A 3GLIA 3J2PB 4L15A 2MJ5B 1QYRA 4UN2B 1Z5BA 4JI5M 2G8LA 1VQ1A 2L6OA 2LNHC 2WSCF 3MMPA 2F4VM 1I94M 2QBYB 4GITA 4IBGA 2CFOA 5ITUA 1WIVA 4REZA 1G71A 1OAOC 4B3TM 1VEKA 4LY6A 2WSFF 4DR3M 4X66M 2HCBA 2ZAOA 4FD2A 4M9ZA 3SAUA 1MU5A 4AI6A 3KXEC 4LCBA 1GL7A 2ERCA 4JN6A 3VK8A 2CHVA 3Q8GA 2M60A 5EXPA 4D81A 1VDDA 4Z8XA 4MGYE 1QQWA 1L8QA 1ZV1A 2KZSA 5GKNA 4D82A 4NSOB 3GLHE 2CV1A 4LG2A 4DR4M 2DZLA 3HJQA 3KS4A 4MGKE 3HJ8A 3C9PA 3GLFA 2UXDM 3GLHB 2Z3XA 4HEOA 2V1UA 1HNWM 1G41A 4NC6A 3L29A 2Y0TA 4LJ9A 1E94E 1J7KA 5ITRA 1SXJD 2O01F 2OQ4A 3VKHA 2DZNB 2F5PA 2J7NA 3AFHA 1VDLA 2CEAA 3UMMA 5KPRA 3JR5A 2OOAA 4DV3M 1YSYA 1HQYE 1KFVA 2DHRA 2FS1A 4CGYB 5ITYA 1XXHA 2D7EA 3CF0A 2X49A 3A42A 3FYCA 3GRRA 3J7BA 3SHFA 1XNRM 3WHLA 1R2ZA 1D2NA 3KOZE 4L4UA 2O5RA 1PJTA 2DAKA 3KFUG 2V6ZM 2QBYA 3U61B 1TF0B 3CTWB 5BPVA 3KS8A 2LH0A 1D0KA 4MB7A 3U6QA 3U6OA 2OOBA 2JY6B 4JI1M 1HJPA 1IXSB 2I7PA 1D0LA 1DGHA 2LVQD 4FCTA 4LRTA 1G3IA 2C5RA 3GPXA 3T1HM 1TDHA 3I51A 5IREB 2QZ4A 3W68A 1QZMA 3C3DA 4OW0A 3M7GA 3U6DA 1EIJA 2CRUA 3VDPA 3K9PA 1Z59A 2ZAMA 4LJ4A 4F2LA 3KSJA 3LVWA 2C98A 5EXSA 3H4JA 3HGIA 1Q3CA 3GLHA 4LZJA 4I8OA 4RNAA 2ZM6M 1OIZA 3HU1A 5IT9S 1HR0M 1DGGA 3GRUA 1N34M 1JR3D 2UU9M 4B3SM 5FTKA 3FTFA 1IN4A 2KDLA 1YLAA 3LCUA 5EXTA 4PDIA 2LHCA 2D7GA 2YFQA 2KEBA 3B7NA 3W0FA 1GO5A 2K0BX 1TH4A 4JXJA 3AL0C 3HWSA 4RF1A 3RFWA 2L7HA 4DR5M 3SASA 3SAWA 4JI2M 3PVSA 2R44A 1E9SA 2BJVA 3CF2A 2E5LM 4JI6M 2DNAA 5EJCA 4NSRA 1QUSA 1C1KA 3DFZA 5BR8M 2BWBA 1JB0F 5DYGA 3KOXE 3TWKA 1PJJA 1IXSA 1NY6A 2R0IA 2GQFA 5C1BA 5KPTA 3SAVA 1EE8A 4WURA 1VEGA 4LJ7A 2LXEA 3GQ4A 4LRSA 5LMNM 3IG5A 1LTMA 1V34A 1V92A 1L2BA 5EP4A 4FWDA 3FUVA 5JI3E 3A98B 4XBOA 3K92A 1FNNA 3HU3A 4QOSA 2YQZA 4PDGA 3SC3A 2F5NA 3L25A 3FKEA 1ZQ9A 4KO8A 4Q7JA 4BBAA 2KA6B 1IN6A 2D7HA 1HT2E 4NL4H 3PXGA 1A5TA 1L2DA 1J5EM 1GJSA 2LHGA 4IJEA 1WR1B 4L6V6 4OX9M 1DO0A 2OO9A 2RRUA 3SYKA 3UZUA 3U60B 2ZBKB 3HU2A 4IIWA 2VF7A 4MH0E 3R9XB 1QAOA 1PGYA 1HNZM 3D8LA 1IY2A 3HHWA 4P17A 4NXNM 1Y8GA 4NOOB 3KOWE 2MR9A 2LVAA 1N75A 4LF9M 4JI8M 4BB9A 3W0LB 5FLXS 1G8PA 3MHVC 1QUTA 3NBXX 2DWNA 4L8RC 5KQDA 4M0DA 2B3TA 4CIZA 4G4QA 3GQ3A 4AZFA 3LMMA 3ZH9B 2DAEA 3OTOM 1PJSA 4G3OA 2LVNC 3SBJA 2UXCM 1IXZA 1YE9A 3KW6A 4NRVA 1FJGM 1JR3E 3JAMS 4DV1M 1MN3A 4K0KM 3HY5A 5KQ8A 2HAKA 2X4AA 2K47A 1SXJA 4JI4M 3BOSA 4AKGA 3DZDA 1ZMVA 3J80S 1PJQA 3L2AA 1XHBA 2JUJA 4FW9A 3TL4X 4G4OA 4DR1M 3FUWA 3V76A 3GPUA 2JA2A 3PNYA 1OAIA 1SG9A 2AHMA 3I04M 2DAGA 3QWLA 4GH9A 3UK6A 2XLJA 2FE8A 4PT5A 4DV0M 3FTEA 2LWXA 2EA0A 1IQPA 4FWHA 2DENA 1RU3A 2EJSA 4G6ZA 4M9SA 4ZPXA 2JWSA 2Q2EB 1L1TA 3CF6E 2JP7A 4DR6M 1IN5A 3GRYA 3VDUA 2XF3A 2XEPA 4LF4M 4GKJM 4F1IA 4WP2A 1ZMUA 4JV5M 1QANA 3LW5F 2X8AA 2DWMA 1F4IA 1Q02A 4XGIA 1WXQA 1N77A 2F5OA 3K9OA 1VEJA 1IM2A 1UM8A 4QHTA 2KZUA 4LJ5A 4A3VB 1NY5A 2DKLA 1I4WA 2HWJA 4IBDA 3J7AS 2R18A 2Y21A 2LVPC 1SXJC 1AUAA 2XSZA 4GMQA 4KLNA 1L2CA 4G4NA 2H5XA 3KDSE 1VG5A 3FD9A 2V1CA 2XZUA 2Z4RA 2CHQA 4MGZE 4IBJA 2LVOC 2JY8A 3J27B 3RGSA 1W5TA 4WW0A 2L4EA 1XWIA 3E4RA 1JR3A 4D80A 1TR8A 4PCZA 5ITQA 1XMOM 4LF6M 2XSZD 1S3SA 5FTLA 2UXBM 1K3XA 3B7QA 4I5SA 3ILKA 1TGUA 4JI0M 1PJIA 1K3WA 4FCVA 2MROB 2HL7A 2XFTA 1IXRC 3W67A 1R6BX 2FFJA 2JZ1A 1G59A 1C7YA 2XGNA 4AG6A 2KXEA 4MM3B 4B08A 5KO3A 2EUCA 3U5ZB 1QAMA 2G3QA 2G5GX 3T38A 1NJGA 5JI2E 4DV2M 2L4FA 4CJ6A 5FTJA 1Z5CA 1Q39A 3A46A 5DNYA 4IBIA 2HKJA 3AJIB 4TUWA 1GKIA 2ZTDA 1KSFX 4HLQA 2OPFA 4B3RM 3T15A 4X65M 3M0EA 4LF5M 1TH2A 3HHXA 5ITXE 1R4GA 1D0MA 4IBEA 4DUZM 2K9DA 4QNRA 2Y20A 1IN8A 4OVZB 3VK7A 3EIHA 2P5TA 1DGBA 3AOEA 4LFCM 3IG8A 3A45A 3U61A 1TDZA 3IECA 4GIPA 3THGA 3GP1A 2YNMD 1YUBA 2RKOA 4X62M 2CE7A 4M0WA 3GLIE 3U6CA 1OKSA 3MK6A 4HL4A 3EIEA 1NV8A 2WSEF 2ZTCA 1XMQM 2DHYA 3AOGA 3GO8A 1GABA 2VDBB 3GLIB 2KNAA 3NBIA 2APLA 2C99A 1GJTA 4FCWA 2DVWB 1X37A 2R6FA 4MGIE 3KOYE 4II7A 3H4MA 1NHGC 2L2DA 3CGWA 1IBMM 1CUKA 3FE3A 3LQRA 4X64M 3J81S 1R2YA 4LJ8A 3B9PA 5EXXA 3RE8A 2JNHA 3DA1A 2QP9X 2UUBM 3HX3A 4B3MM 1ZAEA 4IBFA 2UUCM 5H37D 3U6LA 3C3EA 2ZANA 5EP2A 4M9XA 5C18A 1OQYA 3AOEC 2LBCA 2J7OA 3GLFE 4GHAA 1T6OA 4LF7M 3B89A 5EQTA 3K2LA 4DV4M 3GLFB 1IN7A 2BJWA 4IBBA 4IBCA 2QENA 4JYAM 2Y0QA 1ZMWA 4S12A 3VFDA 3GLGE 1HNXM 4ITQA 3I4YA 1QDRA 3F92A 3E46A 5ITXA 3TQSA 3GLGB 3Q8XA 2EKFA 3FRIA 1EFUB 2CP8A 2J5YA 2QPAA 3QYBA 2DXIA 3LCVB 1GVNA 1E32A 2DAIA 4QNMA 1NO1A 2W82A 2O25A 1XXHE 4FWGA 4GEWA 4YHHM 1DGFA 4OU7A 2FNAA 2RGHA 5E26A 4LF8M 3SARA 3TPZA 2L09A 4KT0F 4XK8F 1QAQA 1IBLM 2DWZB 2MGWA 2RGOA 8CATA 2Z4SA 3K1JA 1OIPA 2JXNA 4FVMA 3DOAA 5IZ7D 4EIWA 3WHKA 4Z6YA 4JI7M 1KYIA 3M6AA 3LVVA 1WHCA 1NV9A 3HHZA 2M5ZA 3IHPA 2JZ0A 3L26A 4DUYM 4PD2A 2Z7JA 1UFZA 1DGHB 1P3QQ 2QNJA 3UJNA 3U6SA 3NWLA 1H6UA 3T1YM 4B7HA 1IY0A 3TWLA 3U60A 2MH8A 3FRHA 3R8FA 5ITTA 1WJ7A 2R46A 3B7ZA 3FUUA 1N32M 1R7RA 1QDTA 2A5YB 4GC9A 3BXWA 4DR2M 3E9SA 3PNVA 4MGHA 4IJFA 1PRBA 3TWMA 1T3TA 1IY1A 1AIPC 1E9RA 2FOIC 3LQQA 3E21A 3AKZA 4LFAM 4L78A 1Z5AA 4W5WA 3GLGA 5IWAM 2EKKA 4LJAA 3FTCA 3GQ5A 3C58A 3HHYA 3TE6A 4QOZC 2VIIA 3AV0A 2NQ8C 2QQ8A 3SYLA 1L1ZA 2KW0A 4RKUF 1QZEA 3I01M 2HHHM 2VQEM 3HJSA 4DV5M 1LV7A 3KVWA 2C9OA 4NXMM 4B7FA 1GLNA 1N33M 2KNVA 1OFHA 1NVMA 1OJLA 4LGYA 4CISA 4GC5A 5FSWA 3HZJA 4GKKM 5LMUM 1Q3BA 1WGLA 4DV7M 4I81A 3GPPA 1IFYA 3GPYA 4YY3M 4LGMA 1T43A 4DV6M 5F3WA 1BVSA 4JI3M 2VQFM 2CHGA 1R5LA 5EP1A 2F5QA 1DO2A 2R45A 2LTUA 4NRWA 2XFSA 1WGNA 3HKPA 3MJ5A 3SATA 1OFIA 2C9CA 3B74A 3QAUA 2R4JA 3FUTA 4P16A 2XH9A 4R71A 2GNOA 4B7GA 2Z8YM 4GRIA 3U6MA 2KHHA 2QHOB 3BBZA 4KODA 3SFZA 2YR0A 3ZC7B 5KPZA 1XB2B 4AQYM 4G4RA 5A2QS 2QCUA 2UUAM 2CV0A 3D8BA 2WZJA 2CWBA 5DYIA 2XZFA 1PM5A 2EO2A 4IBKA 1Z6TA 2DWLA 3L28A 1G4AE 1ORYB 2KRKA 4L16A 4AG5A 1NHWC 2JY7A 1HT1E 1XNQM 5FTMA 4DR7M 2DI0A 5E6JA 4LFBM 3SMPA 3KP1E 4R7GA 2VF8A 3RGPA 4DBGB 1TTEA 3SMSA 5L8RF 4BLCA 4AKHA 4AW4A 3K8ZA 3L27A 3ZCBB 1NJFA 2K6BA 7CATA 2R65A 1OTRA
chains in the Genus database with same CATH topology
4QHSA 1N78A 1SXJE 3U5ZA 3JR4A 1K82A 4I4LA 1W5SA 2C96A 1SXJB 1HQCA 3FUXA 4R3DA 2I7NA 4KHPM 3SHGB 4LZZA 1JQJC 2L7IA 3U6EA 5EP3A 2KRUA 3FYDA 3FTDA 4OVZA 2DZOB 4CHTB 3U6PA 2R4EA 2CV2A 1J09A 5FTNA 1GL6A 1TH3A 3GRVA 1NSFA 1XC8A 2F5SA 3PFIA 3VKGA 1NNJA 3I4VA 4AKIA 1NNUC 2CUZA 1N36M 1IBKM 3KSXA 3VLFB 1QVRA 2BNKA 3KP0E 2R62A 4LJ6A 4RF0A 4GHLA 2H1RA 3UGJA 1MX0A 1XXHB 3GLIA 3J2PB 4L15A 1QYRA 1Z5BA 4JI5M 2G8LA 2L6OA 2LNHC 2F4VM 1I94M 2QBYB 4GITA 4IBGA 2CFOA 5ITUA 4REZA 4B3TM 4LY6A 4DR3M 4X66M 2HCBA 2ZAOA 4FD2A 4M9ZA 3SAUA 1MU5A 4AI6A 3KXEC 4LCBA 1GL7A 2ERCA 4JN6A 3VK8A 2CHVA 5EXPA 2M60A 4D81A 1VDDA 4Z8XA 4MGYE 1QQWA 1L8QA 2KZSA 5GKNA 4D82A 2CV1A 4NSOB 4LG2A 4DR4M 3HJQA 3KS4A 4MGKE 3HJ8A 3GLFA 2UXDM 3GLHB 2Z3XA 2V1UA 1HNWM 1G41A 3L29A 2Y0TA 4LJ9A 1E94E 1J7KA 5ITRA 1SXJD 2OQ4A 3VKHA 2DZNB 2F5PA 2J7NA 3AFHA 2CEAA 3UMMA 3JR5A 5KPRA 4DV3M 1YSYA 1HQYE 1KFVA 2DHRA 4CGYB 5ITYA 1XXHA 2D7EA 3CF0A 2X49A 3A42A 3FYCA 3GRRA 3J7BA 3SHFA 1XNRM 3WHLA 1R2ZA 1D2NA 3KOZE 4L4UA 2O5RA 3KFUG 2V6ZM 2QBYA 3U61B 5BPVA 3CTWB 3KS8A 2LH0A 4MB7A 3U6QA 3U6OA 4JI1M 1IXSB 2I7PA 1DGHA 4FCTA 4LRTA 1G3IA 2C5RA 3GPXA 3T1HM 1TDHA 3I51A 5IREB 2QZ4A 1QZMA 4OW0A 3M7GA 3U6DA 3VDPA 1Z59A 2ZAMA 4LJ4A 3KSJA 3LVWA 2C98A 5EXSA 3HGIA 1Q3CA 3GLHA 4LZJA 4I8OA 4RNAA 2ZM6M 3HU1A 5IT9S 1HR0M 1DGGA 3GRUA 1N34M 1JR3D 2UU9M 4B3SM 5FTKA 3FTFA 1IN4A 5EXTA 4PDIA 2D7GA 2YFQA 2KEBA 3W0FA 1TH4A 4JXJA 3AL0C 3HWSA 4RF1A 3RFWA 2L7HA 4DR5M 3SASA 3SAWA 4JI2M 3PVSA 1E9SA 2BJVA 3CF2A 2E5LM 4JI6M 5EJCA 4NSRA 1C1KA 3DFZA 5BR8M 5DYGA 3KOXE 3TWKA 1PJJA 1NY6A 5C1BA 5KPTA 3SAVA 1EE8A 4WURA 4LJ7A 3GQ4A 2LXEA 5LMNM 4LRSA 3IG5A 1L2BA 5EP4A 4FWDA 3FUVA 5JI3E 3A98B 4XBOA 3K92A 1FNNA 3HU3A 4QOSA 2YQZA 4PDGA 3SC3A 2F5NA 3L25A 3FKEA 1ZQ9A 4KO8A 4BBAA 2KA6B 1IN6A 2D7HA 1HT2E 4NL4H 3PXGA 1L2DA 1J5EM 4IJEA 4OX9M 1DO0A 3UZUA 3SYKA 3U60B 2ZBKB 3HU2A 4IIWA 4MH0E 3R9XB 1QAOA 1HNZM 3D8LA 1IY2A 3HHWA 4NXNM 4NOOB 3KOWE 1N75A 4LF9M 4JI8M 4BB9A 3W0LB 5FLXS 1G8PA 3MHVC 2DWNA 4L8RC 5KQDA 4M0DA 4G4QA 3GQ3A 4AZFA 3LMMA 3ZH9B 3OTOM 3SBJA 2UXCM 1IXZA 1YE9A 3KW6A 4NRVA 1FJGM 3JAMS 4DV1M 4K0KM 5KQ8A 2X4AA 2K47A 1SXJA 4JI4M 3BOSA 4AKGA 3DZDA 3J80S 3L2AA 3TL4X 1XHBA 4FW9A 4G4OA 4DR1M 3FUWA 3GPUA 2JA2A 3PNYA 2AHMA 3QWLA 4GH9A 3UK6A 4DV0M 2XLJA 2FE8A 4PT5A 3FTEA 2LWXA 2EA0A 1IQPA 4FWHA 4G6ZA 4M9SA 4ZPXA 2Q2EB 1L1TA 3CF6E 4DR6M 1IN5A 3GRYA 3VDUA 2XF3A 2XEPA 4LF4M 4GKJM 4JV5M 1QANA 2X8AA 2DWMA 4XGIA 1WXQA 1N77A 2F5OA 1IM2A 1UM8A 4QHTA 2KZUA 4LJ5A 4A3VB 1NY5A 3J7AS 1I4WA 4IBDA 2R18A 2Y21A 1SXJC 2XSZA 4GMQA 4KLNA 1L2CA 4G4NA 3KDSE 3FD9A 2V1CA 2XZUA 2Z4RA 2CHQA 4MGZE 4IBJA 3J27B 3RGSA 1W5TA 4WW0A 1XWIA 3E4RA 1JR3A 4D80A 4PCZA 5ITQA 1XMOM 4LF6M 2XSZD 1S3SA 5FTLA 2UXBM 1K3XA 4I5SA 3ILKA 1TGUA 4JI0M 1PJIA 1K3WA 4FCVA 2HL7A 2XFTA 1IXRC 1R6BX 2FFJA 1G59A 2XGNA 4AG6A 2KXEA 4MM3B 4B08A 5KO3A 2EUCA 3U5ZB 1QAMA 2G5GX 3T38A 1NJGA 5JI2E 4DV2M 3A46A 5FTJA 1Z5CA 1Q39A 5DNYA 4IBIA 2HKJA 3AJIB 4TUWA 1GKIA 1KSFX 4HLQA 2OPFA 4B3RM 3T15A 4X65M 3M0EA 4LF5M 1TH2A 3HHXA 5ITXE 4IBEA 4QNRA 2Y20A 1IN8A 4OVZB 3VK7A 3EIHA 2P5TA 1DGBA 3AOEA 4LFCM 3IG8A 3A45A 3U61A 1TDZA 3THGA 4GIPA 3GP1A 2YNMD 1YUBA 2RKOA 4X62M 2CE7A 4M0WA 3U6CA 3MK6A 4HL4A 3EIEA 1XMQM 3GO8A 3AOGA 3GLIB 3NBIA 2C99A 4FCWA 2DVWB 1X37A 4MGIE 3KOYE 4II7A 3H4MA 1NHGC 1IBMM 3LQRA 4X64M 3J81S 1R2YA 4LJ8A 3B9PA 5EXXA 3RE8A 3DA1A 2QP9X 2UUBM 4B3MM 1ZAEA 4IBFA 2UUCM 5H37D 3U6LA 5EP2A 2ZANA 4M9XA 5C18A 3AOEC 2J7OA 4GHAA 4LF7M 5EQTA 3K2LA 4DV4M 3GLFB 1IN7A 2BJWA 4IBBA 4IBCA 2QENA 4JYAM 2Y0QA 4S12A 3VFDA 1HNXM 4ITQA 3I4YA 5ITXA 3TQSA 3GLGB 3Q8XA 2DXIA 2QPAA 1GVNA 1E32A 4QNMA 2W82A 4YHHM 4FWGA 1DGFA 4OU7A 2RGHA 2FNAA 5E26A 4LF8M 3SARA 3TPZA 2L09A 1QAQA 1IBLM 2DWZB 2RGOA 8CATA 2Z4SA 3K1JA 4EIWA 4FVMA 5IZ7D 3DOAA 4Z6YA 4JI7M 3WHKA 1KYIA 3M6AA 3LVVA 3HHZA 2M5ZA 3L26A 4DUYM 4PD2A 2Z7JA 1DGHB 3U6SA 3UJNA 3NWLA 1H6UA 3T1YM 4B7HA 1IY0A 3TWLA 3U60A 3R8FA 5ITTA 2R46A 3FUUA 1N32M 1R7RA 2A5YB 4GC9A 4DR2M 3E9SA 3PNVA 4MGHA 4IJFA 3TWMA 1T3TA 1IY1A 3LQQA 1E9RA 2FOIC 3AKZA 4LFAM 4L78A 1Z5AA 4W5WA 3GLGA 5IWAM 3C58A 4LJAA 3FTCA 3GQ5A 4DUZM 3HHYA 3TE6A 4QOZC 2VIIA 3AV0A 2NQ8C 3SYLA 1L1ZA 2KW0A 2HHHM 2VQEM 3HJSA 4DV5M 1LV7A 3KVWA 2C9OA 4NXMM 4B7FA 1GLNA 1N33M 1OFHA 1NVMA 1OJLA 4LGYA 4CISA 4GC5A 5FSWA 4GKKM 5LMUM 1Q3BA 4DV7M 4I81A 3GPPA 3GPYA 4YY3M 4LGMA 4DV6M 5F3WA 4JI3M 2VQFM 2CHGA 5EP1A 2F5QA 1DO2A 2R45A 4NRWA 2XFSA 3HKPA 3MJ5A 3SATA 1OFIA 2C9CA 3QAUA 2R4JA 3FUTA 4P16A 2XH9A 4B7GA 4GRIA 3U6MA 4AQYM 3SFZA 4KODA 3ZC7B 2YR0A 5KPZA 4G4RA 5A2QS 2QCUA 2UUAM 2CV0A 3D8BA 2XZFA 5DYIA 1PM5A 2EO2A 4IBKA 1Z6TA 2DWLA 3L28A 1G4AE 1ORYB 2KRKA 4L16A 4AG5A 1NHWC 1HT1E 1XNQM 5FTMA 4DR7M 4LFBM 5E6JA 3SMPA 3KP1E 4R7GA 3RGPA 3SMSA 4BLCA 4AKHA 4AW4A 3K8ZA 3L27A 3ZCBB 1NJFA 7CATA 2R65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAR A;  5IT9 S;  2F5O A;  1HR0 M;  3JR4 A;  1N34 M;  1K82 A;  2UU9 M;  4B3S M;  1IBL M;  3J7A S;  4PDI A;  3DOA A;  4JI7 M;  4KHP M;  3U6E A;  3W0F A;  1L2C A;  4G4N A;  4DUY M;  2XZU A;  4PD2 A;  3U6P A;  4DR5 M;  3SAS A;  3U6S A;  3SAW A;  4JI2 M;  2E5L M;  4JI6 M;  4PCZ A;  3TWL A;  1XMO M;  5ITQ A;  1XC8 A;  2F5S A;  4LF6 M;  5BR8 M;  1NNJ A;  5ITT A;  1N36 M;  1K3X A;  1IBK M;  2UXB M;  1N32 M;  3TWK A;  1PJJ A;  4JI0 M;  1PJI A;  1K3W A;  4DR2 M;  3SAV A;  1EE8 A;  3GQ4 A;  1MX0 A;  5LMN M;  3TWM A;  1L2B A;  1Z5B A;  4JI5 M;  4DV2 M;  1I94 M;  2F4V M;  4LFA M;  3C58 A;  1Z5A A;  3A46 A;  1Z5C A;  1Q39 A;  5IWA M;  3GQ5 A;  5ITU A;  4DUZ M;  2HKJ A;  4PDG A;  2F5N A;  4B3T M;  4DR3 M;  2OPF A;  4X66 M;  4B3R M;  4X65 M;  4LF5 M;  3SAU A;  5ITX E;  1MU5 A;  1L1Z A;  2HHH M;  2VQE M;  1L2D A;  1J5E M;  3VK8 A;  3VK7 A;  4DV5 M;  4LFC M;  4NXM M;  4OX9 M;  3A45 A;  1TDZ A;  1N33 M;  2ZBK B;  4DR4 M;  4CIS A;  3GP1 A;  4X62 M;  2UXD M;  4GKK M;  5LMU M;  1Q3B A;  4DV7 M;  1HNZ M;  3GPP A;  3U6C A;  3GPY A;  4YY3 M;  4NXN M;  1HNW M;  4DV6 M;  1XMQ M;  3GO8 A;  4JI3 M;  2VQF M;  4LF9 M;  5ITR A;  2F5Q A;  4JI8 M;  2OQ4 A;  5FLX S;  4NRW A;  2F5P A;  1IBM M;  3SAT A;  3JR5 A;  4G4Q A;  3GQ3 A;  3OTO M;  4X64 M;  4DV3 M;  3J81 S;  1KFV A;  3SBJ A;  2UXC M;  4NRV A;  5ITY A;  1FJG M;  1R2Y A;  3JAM S;  3A42 A;  4DV1 M;  3U6M A;  4K0K M;  4AQY M;  1XNR M;  2UUB M;  4B3M M;  1R2Z A;  2UUC M;  4G4R A;  5A2Q S;  4JI4 M;  2UUA M;  3U6L A;  2XZF A;  1PM5 A;  3J80 S;  4MB7 A;  3U6Q A;  3U6O A;  4G4O A;  4JI1 M;  4LF7 M;  4DR1 M;  4DV4 M;  3GPU A;  4JYA M;  4DR7 M;  1XNQ M;  4DV0 M;  1HNX M;  3GPX A;  3T1H M;  4ITQ A;  4LFB M;  1TDH A;  2EA0 A;  5ITX A;  3U6D A;  2Q2E B;  1L1T A;  4DR6 M;  1Z59 A;  4LF4 M;  4GKJ M;  4YHH M;  1Q3C A;  4JV5 M;  3T1Y M;  2ZM6 M;  4LF8 M; 
#chains in the Genus database with same CATH topology
 4QHS A;  1N78 A;  1SXJ E;  3U5Z A;  3JR4 A;  1K82 A;  4I4L A;  1W5S A;  5DFL A;  2BWE A;  2KNZ A;  2C96 A;  1SXJ B;  1HQC A;  2JY5 A;  3FUX A;  4R3D A;  2I7N A;  2N35 A;  4KHP M;  3SHG B;  4LZZ A;  1JQJ C;  2L7I A;  3U6E A;  5EP3 A;  2FH0 A;  2KRU A;  3FYD A;  3FTD A;  4OVZ A;  2DZO B;  4CHT B;  3U6P A;  2R4E A;  2CV2 A;  1J09 A;  5FTN A;  1GL6 A;  2QSF X;  1TH3 A;  2DAM A;  4Y28 F;  3GRV A;  3ZQJ A;  1NSF A;  4ANR A;  1XC8 A;  2F5S A;  3PFI A;  3VKG A;  1NNJ A;  3I4V A;  4AKI A;  1NNU C;  2CUZ A;  1N36 M;  1IBK M;  3KSX A;  3VLF B;  1QVR A;  1V33 A;  2BNK A;  2R62 A;  3KP0 E;  1MJG M;  4LJ6 A;  4RF0 A;  3T6P A;  3QYE A;  4GHL A;  2H1R A;  3UGJ A;  1MX0 A;  1XXH B;  1DV0 A;  3GLI A;  3J2P B;  4L15 A;  2MJ5 B;  1QYR A;  4UN2 B;  1Z5B A;  4JI5 M;  2G8L A;  1VQ1 A;  2L6O A;  2LNH C;  2WSC F;  3MMP A;  2F4V M;  1I94 M;  2QBY B;  4GIT A;  4IBG A;  2CFO A;  5ITU A;  1WIV A;  4REZ A;  1G71 A;  1OAO C;  4B3T M;  1VEK A;  4LY6 A;  2WSF F;  4DR3 M;  4X66 M;  2HCB A;  2ZAO A;  4FD2 A;  4M9Z A;  3SAU A;  1MU5 A;  4AI6 A;  3KXE C;  4LCB A;  1GL7 A;  2ERC A;  4JN6 A;  3VK8 A;  2CHV A;  3Q8G A;  2M60 A;  5EXP A;  4D81 A;  1VDD A;  4Z8X A;  4MGY E;  1QQW A;  1L8Q A;  1ZV1 A;  2KZS A;  5GKN A;  4D82 A;  4NSO B;  3GLH E;  2CV1 A;  4LG2 A;  4DR4 M;  2DZL A;  3HJQ A;  3KS4 A;  4MGK E;  3HJ8 A;  3C9P A;  3GLF A;  2UXD M;  3GLH B;  2Z3X A;  4HEO A;  2V1U A;  1HNW M;  1G41 A;  4NC6 A;  3L29 A;  2Y0T A;  4LJ9 A;  1E94 E;  1J7K A;  5ITR A;  1SXJ D;  2O01 F;  2OQ4 A;  3VKH A;  2DZN B;  2F5P A;  2J7N A;  3AFH A;  1VDL A;  2CEA A;  3UMM A;  5KPR A;  3JR5 A;  2OOA A;  4DV3 M;  1YSY A;  1HQY E;  1KFV A;  2DHR A;  2FS1 A;  4CGY B;  5ITY A;  1XXH A;  2D7E A;  3CF0 A;  2X49 A;  3A42 A;  3FYC A;  3GRR A;  3J7B A;  3SHF A;  1XNR M;  3WHL A;  1R2Z A;  1D2N A;  3KOZ E;  4L4U A;  2O5R A;  1PJT A;  2DAK A;  3KFU G;  2V6Z M;  2QBY A;  3U61 B;  1TF0 B;  3CTW B;  5BPV A;  3KS8 A;  2LH0 A;  1D0K A;  4MB7 A;  3U6Q A;  3U6O A;  2OOB A;  2JY6 B;  4JI1 M;  1HJP A;  1IXS B;  2I7P A;  1D0L A;  1DGH A;  2LVQ D;  4FCT A;  4LRT A;  1G3I A;  2C5R A;  3GPX A;  3T1H M;  1TDH A;  3I51 A;  5IRE B;  2QZ4 A;  3W68 A;  1QZM A;  3C3D A;  4OW0 A;  3M7G A;  3U6D A;  1EIJ A;  2CRU A;  3VDP A;  3K9P A;  1Z59 A;  2ZAM A;  4LJ4 A;  4F2L A;  3KSJ A;  3LVW A;  2C98 A;  5EXS A;  3H4J A;  3HGI A;  1Q3C A;  3GLH A;  4LZJ A;  4I8O A;  4RNA A;  2ZM6 M;  1OIZ A;  3HU1 A;  5IT9 S;  1HR0 M;  1DGG A;  3GRU A;  1N34 M;  1JR3 D;  2UU9 M;  4B3S M;  5FTK A;  3FTF A;  1IN4 A;  2KDL A;  1YLA A;  3LCU A;  5EXT A;  4PDI A;  2LHC A;  2D7G A;  2YFQ A;  2KEB A;  3B7N A;  3W0F A;  1GO5 A;  2K0B X;  1TH4 A;  4JXJ A;  3AL0 C;  3HWS A;  4RF1 A;  3RFW A;  2L7H A;  4DR5 M;  3SAS A;  3SAW A;  4JI2 M;  3PVS A;  2R44 A;  1E9S A;  2BJV A;  3CF2 A;  2E5L M;  4JI6 M;  2DNA A;  5EJC A;  4NSR A;  1QUS A;  1C1K A;  3DFZ A;  5BR8 M;  2BWB A;  1JB0 F;  5DYG A;  3KOX E;  3TWK A;  1PJJ A;  1IXS A;  1NY6 A;  2R0I A;  2GQF A;  5C1B A;  5KPT A;  3SAV A;  1EE8 A;  4WUR A;  1VEG A;  4LJ7 A;  2LXE A;  3GQ4 A;  4LRS A;  5LMN M;  3IG5 A;  1LTM A;  1V34 A;  1V92 A;  1L2B A;  5EP4 A;  4FWD A;  3FUV A;  5JI3 E;  3A98 B;  4XBO A;  3K92 A;  1FNN A;  3HU3 A;  4QOS A;  2YQZ A;  4PDG A;  3SC3 A;  2F5N A;  3L25 A;  3FKE A;  1ZQ9 A;  4KO8 A;  4Q7J A;  4BBA A;  2KA6 B;  1IN6 A;  2D7H A;  1HT2 E;  4NL4 H;  3PXG A;  1A5T A;  1L2D A;  1J5E M;  1GJS A;  2LHG A;  4IJE A;  1WR1 B;  4L6V 6;  4OX9 M;  1DO0 A;  2OO9 A;  2RRU A;  3SYK A;  3UZU A;  3U60 B;  2ZBK B;  3HU2 A;  4IIW A;  2VF7 A;  4MH0 E;  3R9X B;  1QAO A;  1PGY A;  1HNZ M;  3D8L A;  1IY2 A;  3HHW A;  4P17 A;  4NXN M;  1Y8G A;  4NOO B;  3KOW E;  2MR9 A;  2LVA A;  1N75 A;  4LF9 M;  4JI8 M;  4BB9 A;  3W0L B;  5FLX S;  1G8P A;  3MHV C;  1QUT A;  3NBX X;  2DWN A;  4L8R C;  5KQD A;  4M0D A;  2B3T A;  4CIZ A;  4G4Q A;  3GQ3 A;  4AZF A;  3LMM A;  3ZH9 B;  2DAE A;  3OTO M;  1PJS A;  4G3O A;  2LVN C;  3SBJ A;  2UXC M;  1IXZ A;  1YE9 A;  3KW6 A;  4NRV A;  1FJG M;  1JR3 E;  3JAM S;  4DV1 M;  1MN3 A;  4K0K M;  3HY5 A;  5KQ8 A;  2HAK A;  2X4A A;  2K47 A;  1SXJ A;  4JI4 M;  3BOS A;  4AKG A;  3DZD A;  1ZMV A;  3J80 S;  1PJQ A;  3L2A A;  1XHB A;  2JUJ A;  4FW9 A;  3TL4 X;  4G4O A;  4DR1 M;  3FUW A;  3V76 A;  3GPU A;  2JA2 A;  3PNY A;  1OAI A;  1SG9 A;  2AHM A;  3I04 M;  2DAG A;  3QWL A;  4GH9 A;  3UK6 A;  2XLJ A;  2FE8 A;  4PT5 A;  4DV0 M;  3FTE A;  2LWX A;  2EA0 A;  1IQP A;  4FWH A;  2DEN A;  1RU3 A;  2EJS A;  4G6Z A;  4M9S A;  4ZPX A;  2JWS A;  2Q2E B;  1L1T A;  3CF6 E;  2JP7 A;  4DR6 M;  1IN5 A;  3GRY A;  3VDU A;  2XF3 A;  2XEP A;  4LF4 M;  4GKJ M;  4F1I A;  4WP2 A;  1ZMU A;  4JV5 M;  1QAN A;  3LW5 F;  2X8A A;  2DWM A;  1F4I A;  1Q02 A;  4XGI A;  1WXQ A;  1N77 A;  2F5O A;  3K9O A;  1VEJ A;  1IM2 A;  1UM8 A;  4QHT A;  2KZU A;  4LJ5 A;  4A3V B;  1NY5 A;  2DKL A;  1I4W A;  2HWJ A;  4IBD A;  3J7A S;  2R18 A;  2Y21 A;  2LVP C;  1SXJ C;  1AUA A;  2XSZ A;  4GMQ A;  4KLN A;  1L2C A;  4G4N A;  2H5X A;  3KDS E;  1VG5 A;  3FD9 A;  2V1C A;  2XZU A;  2Z4R A;  2CHQ A;  4MGZ E;  4IBJ A;  2LVO C;  2JY8 A;  3J27 B;  3RGS A;  1W5T A;  4WW0 A;  2L4E A;  1XWI A;  3E4R A;  1JR3 A;  4D80 A;  1TR8 A;  4PCZ A;  5ITQ A;  1XMO M;  4LF6 M;  2XSZ D;  1S3S A;  5FTL A;  2UXB M;  1K3X A;  3B7Q A;  4I5S A;  3ILK A;  1TGU A;  4JI0 M;  1PJI A;  1K3W A;  4FCV A;  2MRO B;  2HL7 A;  2XFT A;  1IXR C;  3W67 A;  1R6B X;  2FFJ A;  2JZ1 A;  1G59 A;  1C7Y A;  2XGN A;  4AG6 A;  2KXE A;  4MM3 B;  4B08 A;  5KO3 A;  2EUC A;  3U5Z B;  1QAM A;  2G3Q A;  2G5G X;  3T38 A;  1NJG A;  5JI2 E;  4DV2 M;  2L4F A;  4CJ6 A;  5FTJ A;  1Z5C A;  1Q39 A;  3A46 A;  5DNY A;  4IBI A;  2HKJ A;  3AJI B;  4TUW A;  1GKI A;  2ZTD A;  1KSF X;  4HLQ A;  2OPF A;  4B3R M;  3T15 A;  4X65 M;  3M0E A;  4LF5 M;  1TH2 A;  3HHX A;  5ITX E;  1R4G A;  1D0M A;  4IBE A;  4DUZ M;  2K9D A;  4QNR A;  2Y20 A;  1IN8 A;  4OVZ B;  3VK7 A;  3EIH A;  2P5T A;  1DGB A;  3AOE A;  4LFC M;  3IG8 A;  3A45 A;  3U61 A;  1TDZ A;  3IEC A;  4GIP A;  3THG A;  3GP1 A;  2YNM D;  1YUB A;  2RKO A;  4X62 M;  2CE7 A;  4M0W A;  3GLI E;  3U6C A;  1OKS A;  3MK6 A;  4HL4 A;  3EIE A;  1NV8 A;  2WSE F;  2ZTC A;  1XMQ M;  2DHY A;  3AOG A;  3GO8 A;  1GAB A;  2VDB B;  3GLI B;  2KNA A;  3NBI A;  2APL A;  2C99 A;  1GJT A;  4FCW A;  2DVW B;  1X37 A;  2R6F A;  4MGI E;  3KOY E;  4II7 A;  3H4M A;  1NHG C;  2L2D A;  3CGW A;  1IBM M;  1CUK A;  3FE3 A;  3LQR A;  4X64 M;  3J81 S;  1R2Y A;  4LJ8 A;  3B9P A;  5EXX A;  3RE8 A;  2JNH A;  3DA1 A;  2QP9 X;  2UUB M;  3HX3 A;  4B3M M;  1ZAE A;  4IBF A;  2UUC M;  5H37 D;  3U6L A;  3C3E A;  2ZAN A;  5EP2 A;  4M9X A;  5C18 A;  1OQY A;  3AOE C;  2LBC A;  2J7O A;  3GLF E;  4GHA A;  1T6O A;  4LF7 M;  3B89 A;  5EQT A;  3K2L A;  4DV4 M;  3GLF B;  1IN7 A;  2BJW A;  4IBB A;  4IBC A;  2QEN A;  4JYA M;  2Y0Q A;  1ZMW A;  4S12 A;  3VFD A;  3GLG E;  1HNX M;  4ITQ A;  3I4Y A;  1QDR A;  3F92 A;  3E46 A;  5ITX A;  3TQS A;  3GLG B;  3Q8X A;  2EKF A;  3FRI A;  1EFU B;  2CP8 A;  2J5Y A;  2QPA A;  3QYB A;  2DXI A;  3LCV B;  1GVN A;  1E32 A;  2DAI A;  4QNM A;  1NO1 A;  2W82 A;  2O25 A;  1XXH E;  4FWG A;  4GEW A;  4YHH M;  1DGF A;  4OU7 A;  2FNA A;  2RGH A;  5E26 A;  4LF8 M;  3SAR A;  3TPZ A;  2L09 A;  4KT0 F;  4XK8 F;  1QAQ A;  1IBL M;  2DWZ B;  2MGW A;  2RGO A;  8CAT A;  2Z4S A;  3K1J A;  1OIP A;  2JXN A;  4FVM A;  3DOA A;  5IZ7 D;  4EIW A;  3WHK A;  4Z6Y A;  4JI7 M;  1KYI A;  3M6A A;  3LVV A;  1WHC A;  1NV9 A;  3HHZ A;  2M5Z A;  3IHP A;  2JZ0 A;  3L26 A;  4DUY M;  4PD2 A;  2Z7J A;  1UFZ A;  1DGH B;  1P3Q Q;  2QNJ A;  3UJN A;  3U6S A;  3NWL A;  1H6U A;  3T1Y M;  4B7H A;  1IY0 A;  3TWL A;  3U60 A;  2MH8 A;  3FRH A;  3R8F A;  5ITT A;  1WJ7 A;  2R46 A;  3B7Z A;  3FUU A;  1N32 M;  1R7R A;  1QDT A;  2A5Y B;  4GC9 A;  3BXW A;  4DR2 M;  3E9S A;  3PNV A;  4MGH A;  4IJF A;  1PRB A;  3TWM A;  1T3T A;  1IY1 A;  1AIP C;  1E9R A;  2FOI C;  3LQQ A;  3E21 A;  3AKZ A;  4LFA M;  4L78 A;  1Z5A A;  4W5W A;  3GLG A;  5IWA M;  2EKK A;  4LJA A;  3FTC A;  3GQ5 A;  3C58 A;  3HHY A;  3TE6 A;  4QOZ C;  2VII A;  3AV0 A;  2NQ8 C;  2QQ8 A;  3SYL A;  1L1Z A;  2KW0 A;  4RKU F;  1QZE A;  3I01 M;  2HHH M;  2VQE M;  3HJS A;  4DV5 M;  1LV7 A;  3KVW A;  2C9O A;  4NXM M;  4B7F A;  1GLN A;  1N33 M;  2KNV A;  1OFH A;  1NVM A;  1OJL A;  4LGY A;  4CIS A;  4GC5 A;  5FSW A;  3HZJ A;  4GKK M;  5LMU M;  1Q3B A;  1WGL A;  4DV7 M;  4I81 A;  3GPP A;  1IFY A;  3GPY A;  4YY3 M;  4LGM A;  1T43 A;  4DV6 M;  5F3W A;  1BVS A;  4JI3 M;  2VQF M;  2CHG A;  1R5L A;  5EP1 A;  2F5Q A;  1DO2 A;  2R45 A;  2LTU A;  4NRW A;  2XFS A;  1WGN A;  3HKP A;  3MJ5 A;  3SAT A;  1OFI A;  2C9C A;  3B74 A;  3QAU A;  2R4J A;  3FUT A;  4P16 A;  2XH9 A;  4R71 A;  2GNO A;  4B7G A;  2Z8Y M;  4GRI A;  3U6M A;  2KHH A;  2QHO B;  3BBZ A;  4KOD A;  3SFZ A;  2YR0 A;  3ZC7 B;  5KPZ A;  1XB2 B;  4AQY M;  4G4R A;  5A2Q S;  2QCU A;  2UUA M;  2CV0 A;  3D8B A;  2WZJ A;  2CWB A;  5DYI A;  2XZF A;  1PM5 A;  2EO2 A;  4IBK A;  1Z6T A;  2DWL A;  3L28 A;  1G4A E;  1ORY B;  2KRK A;  4L16 A;  4AG5 A;  1NHW C;  2JY7 A;  1HT1 E;  1XNQ M;  5FTM A;  4DR7 M;  2DI0 A;  5E6J A;  4LFB M;  3SMP A;  3KP1 E;  4R7G A;  2VF8 A;  3RGP A;  4DBG B;  1TTE A;  3SMS A;  5L8R F;  4BLC A;  4AKH A;  4AW4 A;  3K8Z A;  3L27 A;  3ZCB B;  1NJF A;  2K6B A;  7CAT A;  2R65 A;  1OTR A; 
#chains in the Genus database with same CATH homology
 4QHS A;  1N78 A;  1SXJ E;  3U5Z A;  3JR4 A;  1K82 A;  4I4L A;  1W5S A;  2C96 A;  1SXJ B;  1HQC A;  3FUX A;  4R3D A;  2I7N A;  4KHP M;  3SHG B;  4LZZ A;  1JQJ C;  2L7I A;  3U6E A;  5EP3 A;  2KRU A;  3FYD A;  3FTD A;  4OVZ A;  2DZO B;  4CHT B;  3U6P A;  2R4E A;  2CV2 A;  1J09 A;  5FTN A;  1GL6 A;  1TH3 A;  3GRV A;  1NSF A;  1XC8 A;  2F5S A;  3PFI A;  3VKG A;  1NNJ A;  3I4V A;  4AKI A;  1NNU C;  2CUZ A;  1N36 M;  1IBK M;  3KSX A;  3VLF B;  1QVR A;  2BNK A;  3KP0 E;  2R62 A;  4LJ6 A;  4RF0 A;  4GHL A;  2H1R A;  3UGJ A;  1MX0 A;  1XXH B;  3GLI A;  3J2P B;  4L15 A;  1QYR A;  1Z5B A;  4JI5 M;  2G8L A;  2L6O A;  2LNH C;  2F4V M;  1I94 M;  2QBY B;  4GIT A;  4IBG A;  2CFO A;  5ITU A;  4REZ A;  4B3T M;  4LY6 A;  4DR3 M;  4X66 M;  2HCB A;  2ZAO A;  4FD2 A;  4M9Z A;  3SAU A;  1MU5 A;  4AI6 A;  3KXE C;  4LCB A;  1GL7 A;  2ERC A;  4JN6 A;  3VK8 A;  2CHV A;  5EXP A;  2M60 A;  4D81 A;  1VDD A;  4Z8X A;  4MGY E;  1QQW A;  1L8Q A;  2KZS A;  5GKN A;  4D82 A;  2CV1 A;  4NSO B;  4LG2 A;  4DR4 M;  3HJQ A;  3KS4 A;  4MGK E;  3HJ8 A;  3GLF A;  2UXD M;  3GLH B;  2Z3X A;  2V1U A;  1HNW M;  1G41 A;  3L29 A;  2Y0T A;  4LJ9 A;  1E94 E;  1J7K A;  5ITR A;  1SXJ D;  2OQ4 A;  3VKH A;  2DZN B;  2F5P A;  2J7N A;  3AFH A;  2CEA A;  3UMM A;  3JR5 A;  5KPR A;  4DV3 M;  1YSY A;  1HQY E;  1KFV A;  2DHR A;  4CGY B;  5ITY A;  1XXH A;  2D7E A;  3CF0 A;  2X49 A;  3A42 A;  3FYC A;  3GRR A;  3J7B A;  3SHF A;  1XNR M;  3WHL A;  1R2Z A;  1D2N A;  3KOZ E;  4L4U A;  2O5R A;  3KFU G;  2V6Z M;  2QBY A;  3U61 B;  5BPV A;  3CTW B;  3KS8 A;  2LH0 A;  4MB7 A;  3U6Q A;  3U6O A;  4JI1 M;  1IXS B;  2I7P A;  1DGH A;  4FCT A;  4LRT A;  1G3I A;  2C5R A;  3GPX A;  3T1H M;  1TDH A;  3I51 A;  5IRE B;  2QZ4 A;  1QZM A;  4OW0 A;  3M7G A;  3U6D A;  3VDP A;  1Z59 A;  2ZAM A;  4LJ4 A;  3KSJ A;  3LVW A;  2C98 A;  5EXS A;  3HGI A;  1Q3C A;  3GLH A;  4LZJ A;  4I8O A;  4RNA A;  2ZM6 M;  3HU1 A;  5IT9 S;  1HR0 M;  1DGG A;  3GRU A;  1N34 M;  1JR3 D;  2UU9 M;  4B3S M;  5FTK A;  3FTF A;  1IN4 A;  5EXT A;  4PDI A;  2D7G A;  2YFQ A;  2KEB A;  3W0F A;  1TH4 A;  4JXJ A;  3AL0 C;  3HWS A;  4RF1 A;  3RFW A;  2L7H A;  4DR5 M;  3SAS A;  3SAW A;  4JI2 M;  3PVS A;  1E9S A;  2BJV A;  3CF2 A;  2E5L M;  4JI6 M;  5EJC A;  4NSR A;  1C1K A;  3DFZ A;  5BR8 M;  5DYG A;  3KOX E;  3TWK A;  1PJJ A;  1NY6 A;  5C1B A;  5KPT A;  3SAV A;  1EE8 A;  4WUR A;  4LJ7 A;  3GQ4 A;  2LXE A;  5LMN M;  4LRS A;  3IG5 A;  1L2B A;  5EP4 A;  4FWD A;  3FUV A;  5JI3 E;  3A98 B;  4XBO A;  3K92 A;  1FNN A;  3HU3 A;  4QOS A;  2YQZ A;  4PDG A;  3SC3 A;  2F5N A;  3L25 A;  3FKE A;  1ZQ9 A;  4KO8 A;  4BBA A;  2KA6 B;  1IN6 A;  2D7H A;  1HT2 E;  4NL4 H;  3PXG A;  1L2D A;  1J5E M;  4IJE A;  4OX9 M;  1DO0 A;  3UZU A;  3SYK A;  3U60 B;  2ZBK B;  3HU2 A;  4IIW A;  4MH0 E;  3R9X B;  1QAO A;  1HNZ M;  3D8L A;  1IY2 A;  3HHW A;  4NXN M;  4NOO B;  3KOW E;  1N75 A;  4LF9 M;  4JI8 M;  4BB9 A;  3W0L B;  5FLX S;  1G8P A;  3MHV C;  2DWN A;  4L8R C;  5KQD A;  4M0D A;  4G4Q A;  3GQ3 A;  4AZF A;  3LMM A;  3ZH9 B;  3OTO M;  3SBJ A;  2UXC M;  1IXZ A;  1YE9 A;  3KW6 A;  4NRV A;  1FJG M;  3JAM S;  4DV1 M;  4K0K M;  5KQ8 A;  2X4A A;  2K47 A;  1SXJ A;  4JI4 M;  3BOS A;  4AKG A;  3DZD A;  3J80 S;  3L2A A;  3TL4 X;  1XHB A;  4FW9 A;  4G4O A;  4DR1 M;  3FUW A;  3GPU A;  2JA2 A;  3PNY A;  2AHM A;  3QWL A;  4GH9 A;  3UK6 A;  4DV0 M;  2XLJ A;  2FE8 A;  4PT5 A;  3FTE A;  2LWX A;  2EA0 A;  1IQP A;  4FWH A;  4G6Z A;  4M9S A;  4ZPX A;  2Q2E B;  1L1T A;  3CF6 E;  4DR6 M;  1IN5 A;  3GRY A;  3VDU A;  2XF3 A;  2XEP A;  4LF4 M;  4GKJ M;  4JV5 M;  1QAN A;  2X8A A;  2DWM A;  4XGI A;  1WXQ A;  1N77 A;  2F5O A;  1IM2 A;  1UM8 A;  4QHT A;  2KZU A;  4LJ5 A;  4A3V B;  1NY5 A;  3J7A S;  1I4W A;  4IBD A;  2R18 A;  2Y21 A;  1SXJ C;  2XSZ A;  4GMQ A;  4KLN A;  1L2C A;  4G4N A;  3KDS E;  3FD9 A;  2V1C A;  2XZU A;  2Z4R A;  2CHQ A;  4MGZ E;  4IBJ A;  3J27 B;  3RGS A;  1W5T A;  4WW0 A;  1XWI A;  3E4R A;  1JR3 A;  4D80 A;  4PCZ A;  5ITQ A;  1XMO M;  4LF6 M;  2XSZ D;  1S3S A;  5FTL A;  2UXB M;  1K3X A;  4I5S A;  3ILK A;  1TGU A;  4JI0 M;  1PJI A;  1K3W A;  4FCV A;  2HL7 A;  2XFT A;  1IXR C;  1R6B X;  2FFJ A;  1G59 A;  2XGN A;  4AG6 A;  2KXE A;  4MM3 B;  4B08 A;  5KO3 A;  2EUC A;  3U5Z B;  1QAM A;  2G5G X;  3T38 A;  1NJG A;  5JI2 E;  4DV2 M;  3A46 A;  5FTJ A;  1Z5C A;  1Q39 A;  5DNY A;  4IBI A;  2HKJ A;  3AJI B;  4TUW A;  1GKI A;  1KSF X;  4HLQ A;  2OPF A;  4B3R M;  3T15 A;  4X65 M;  3M0E A;  4LF5 M;  1TH2 A;  3HHX A;  5ITX E;  4IBE A;  4QNR A;  2Y20 A;  1IN8 A;  4OVZ B;  3VK7 A;  3EIH A;  2P5T A;  1DGB A;  3AOE A;  4LFC M;  3IG8 A;  3A45 A;  3U61 A;  1TDZ A;  3THG A;  4GIP A;  3GP1 A;  2YNM D;  1YUB A;  2RKO A;  4X62 M;  2CE7 A;  4M0W A;  3U6C A;  3MK6 A;  4HL4 A;  3EIE A;  1XMQ M;  3GO8 A;  3AOG A;  3GLI B;  3NBI A;  2C99 A;  4FCW A;  2DVW B;  1X37 A;  4MGI E;  3KOY E;  4II7 A;  3H4M A;  1NHG C;  1IBM M;  3LQR A;  4X64 M;  3J81 S;  1R2Y A;  4LJ8 A;  3B9P A;  5EXX A;  3RE8 A;  3DA1 A;  2QP9 X;  2UUB M;  4B3M M;  1ZAE A;  4IBF A;  2UUC M;  5H37 D;  3U6L A;  5EP2 A;  2ZAN A;  4M9X A;  5C18 A;  3AOE C;  2J7O A;  4GHA A;  4LF7 M;  5EQT A;  3K2L A;  4DV4 M;  3GLF B;  1IN7 A;  2BJW A;  4IBB A;  4IBC A;  2QEN A;  4JYA M;  2Y0Q A;  4S12 A;  3VFD A;  1HNX M;  4ITQ A;  3I4Y A;  5ITX A;  3TQS A;  3GLG B;  3Q8X A;  2DXI A;  2QPA A;  1GVN A;  1E32 A;  4QNM A;  2W82 A;  4YHH M;  4FWG A;  1DGF A;  4OU7 A;  2RGH A;  2FNA A;  5E26 A;  4LF8 M;  3SAR A;  3TPZ A;  2L09 A;  1QAQ A;  1IBL M;  2DWZ B;  2RGO A;  8CAT A;  2Z4S A;  3K1J A;  4EIW A;  4FVM A;  5IZ7 D;  3DOA A;  4Z6Y A;  4JI7 M;  3WHK A;  1KYI A;  3M6A A;  3LVV A;  3HHZ A;  2M5Z A;  3L26 A;  4DUY M;  4PD2 A;  2Z7J A;  1DGH B;  3U6S A;  3UJN A;  3NWL A;  1H6U A;  3T1Y M;  4B7H A;  1IY0 A;  3TWL A;  3U60 A;  3R8F A;  5ITT A;  2R46 A;  3FUU A;  1N32 M;  1R7R A;  2A5Y B;  4GC9 A;  4DR2 M;  3E9S A;  3PNV A;  4MGH A;  4IJF A;  3TWM A;  1T3T A;  1IY1 A;  3LQQ A;  1E9R A;  2FOI C;  3AKZ A;  4LFA M;  4L78 A;  1Z5A A;  4W5W A;  3GLG A;  5IWA M;  3C58 A;  4LJA A;  3FTC A;  3GQ5 A;  4DUZ M;  3HHY A;  3TE6 A;  4QOZ C;  2VII A;  3AV0 A;  2NQ8 C;  3SYL A;  1L1Z A;  2KW0 A;  2HHH M;  2VQE M;  3HJS A;  4DV5 M;  1LV7 A;  3KVW A;  2C9O A;  4NXM M;  4B7F A;  1GLN A;  1N33 M;  1OFH A;  1NVM A;  1OJL A;  4LGY A;  4CIS A;  4GC5 A;  5FSW A;  4GKK M;  5LMU M;  1Q3B A;  4DV7 M;  4I81 A;  3GPP A;  3GPY A;  4YY3 M;  4LGM A;  4DV6 M;  5F3W A;  4JI3 M;  2VQF M;  2CHG A;  5EP1 A;  2F5Q A;  1DO2 A;  2R45 A;  4NRW A;  2XFS A;  3HKP A;  3MJ5 A;  3SAT A;  1OFI A;  2C9C A;  3QAU A;  2R4J A;  3FUT A;  4P16 A;  2XH9 A;  4B7G A;  4GRI A;  3U6M A;  4AQY M;  3SFZ A;  4KOD A;  3ZC7 B;  2YR0 A;  5KPZ A;  4G4R A;  5A2Q S;  2QCU A;  2UUA M;  2CV0 A;  3D8B A;  2XZF A;  5DYI A;  1PM5 A;  2EO2 A;  4IBK A;  1Z6T A;  2DWL A;  3L28 A;  1G4A E;  1ORY B;  2KRK A;  4L16 A;  4AG5 A;  1NHW C;  1HT1 E;  1XNQ M;  5FTM A;  4DR7 M;  4LFB M;  5E6J A;  3SMP A;  3KP1 E;  4R7G A;  3RGP A;  3SMS A;  4BLC A;  4AKH A;  4AW4 A;  3K8Z A;  3L27 A;  3ZCB B;  1NJF A;  7CAT A;  2R65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...