4X62M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x62M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x62M02
4JI3M 5LMUM 4G4NA 2UUBM 3GPUA 3GPPA 1R2YA 5LMNM 1TDHA 4DUZM 4G4QA 4NRVA 3JAMS 4JI4M 4YY3M 1N32M 3SASA 4LF5M 1XNQM 2E5LM 4B3RM 4JI2M 1L1ZA 3GO8A 1Q3CA 1PJIA 4LF4M 4DV7M 5BR8M 5ITYA 3U6OA 4DV3M 2EA0A 1HR0M 1PM5A 3OTOM 4JI8M 2ZM6M 1J5EM 1IBMM 2VQFM 5ITRA 4X65M 2VQEM 1FJGM 3U6PA 1R2ZA 4ITQA 3SARA 3C58A 4DR2M 3U6CA 3JR4A 3J81S 4MB7A 3VK8A 1PJJA 2UXDM 1N36M 1K3XA 1N34M 1XC8A 3VK7A 4YHHM 1XMOM 4X62M 4B3MM 4G4OA 4LFBM 4DV4M 2OQ4A 4KHPM 4B3TM 4DV0M 5ITQA 3T1YM 3TWMA 4GKKM 1TDZA 1K3WA 1L2BA 4JV5M 1Z59A 4JI6M 1HNZM 2F5QA 2F5SA 4JI5M 3J80S 3U6MA 4JYAM 3W0FA 1XMQM 2F5NA 4PDIA 3A42A 3GQ4A 4LF9M 3A45A 5FLXS 3JR5A 1IBLM 4LFAM 5ITXE 1I94M 3U6EA 2UUAM 4PCZA 2ZBKB 3SATA 2F5PA 4NRWA 1Q39A 5A2QS 1XNRM 3SAVA 4CISA 1L2CA 2OPFA 3SAWA 1HNWM 4X64M 4JI7M 1MU5A 4GKJM 3U6SA 2UXCM 1Q3BA 4B3SM 2F4VM 4DR3M 4JI1M 2F5OA 4OX9M 4DUYM 3SAUA 2Q2EB 4DV5M 1L1TA 1IBKM 4LF8M 4LF7M 4DR1M 3SBJA 4DR6M 2XZUA 1Z5BA 4K0KM 2HKJA 4DR4M 3GQ3A 4NXMM 2XZFA 3TWKA 3GPYA 5IWAM 4DR5M 2UXBM 3U6QA 4DV6M 1K82A 4NXNM 5ITXA 4LFCM 3GQ5A 1KFVA 3GP1A 3J7AS 4G4RA 4DV2M 3A46A 1Z5AA 1NNJA 2HHHM 5ITUA 3GPXA 3U6LA 1HNXM 4DR7M 1N33M 2UU9M 4JI0M 3DOAA 1L2DA 1MX0A 3T1HM 4PDGA 4AQYM 4X66M 3U6DA 2UUCM 1Z5CA 5ITTA 5IT9S 1EE8A 4DV1M 4LF6M 4PD2A 3TWLA
chains in the Genus database with same CATH superfamily
2VIIA 4G4NA 3U60A 1QZMA 3HJ8A 2QBYA 2J7OA 1R2YA 1TDHA 4UN2B 2HCBA 4KLNA 3J27B 4LJ8A 1AIPC 1IY2A 3HU1A 4YY3M 2CV1A 1N32M 1W5TA 3SASA 4LF5M 1MN3A 1XNQM 2E5LM 4M0WA 4JI2M 1AUAA 1J09A 3J2PB 1GJTA 3GO8A 1PJIA 4DV7M 4ANRA 5FTKA 2LNHC 4DV3M 1QAMA 2GNOA 3KSJA 2EA0A 3ZCBB 1IY1A 2KZSA 2O5RA 1QUTA 1G3IA 2ZM6M 1FJGM 5ITRA 3BBZA 4X65M 1ZMUA 2XH9A 1WXQA 4GEWA 3WHLA 1R2ZA 2Z7JA 4ITQA 4L8RC 2C9OA 4GC9A 4QNMA 3W68A 3C58A 3U6CA 3VLFB 3I4VA 2CEAA 1S3SA 2UXDM 3LVVA 1N36M 2DAMA 1IN5A 1JB0F 1IQPA 2VF7A 2QENA 4GHLA 3KS4A 1DGGA 4NC6A 3KDSE 4YHHM 2XSZD 2D7EA 4I5SA 2L7HA 2R44A 1VDLA 2WZJA 2MGWA 2O25A 3TWMA 5E6JA 1TDZA 3HZJA 3NWLA 3UZUA 1JQJC 3GLIE 4IBKA 2M5ZA 3RGPA 4GIPA 2ZTDA 2L09A 3CF2A 1DGHB 1YSYA 2F5NA 1XWIA 4FW9A 1OJLA 4PDIA 3V76A 4XK8F 3GQ4A 3B7NA 4LF9M 4LJ7A 4LJAA 1SG9A 1V33A 2D7GA 2VF8A 1GL7A 4KT0F 1E9SA 3U6EA 1SXJA 2UUAM 2ZBKB 1QANA 4GHAA 4LZZA 2LVQD 5JI3E 1CUKA 3TE6A 3SMPA 1FNNA 1Z6TA 1HT2E 4FVMA 4NOOB 3ZC7B 3SAVA 1L2CA 2DI0A 4CISA 5C1BA 4JI7M 2D7HA 4GKJM 2J5YA 2UXCM 1EIJA 1IY0A 2K9DA 2J7NA 1Q3BA 2FFJA 4NSOB 2P5TA 5EP3A 3PNYA 1WIVA 3KSXA 4AG6A 2EUCA 4DBGB 1IN8A 2JZ1A 2AHMA 4Y28F 4DV5M 2V1UA 4LF8M 1OTRA 3E9SA 4DR1M 3L25A 3CGWA 3DFZA 2OO9A 3GRUA 2HKJA 4Q7JA 4LG2A 5EXPA 5KPTA 2DVWB 3K9PA 4FWHA 4LGMA 2XZFA 2YR0A 2ZAOA 1IXZA 3T38A 2DXIA 3VKHA 3H4JA 1OKSA 4DV6M 3DA1A 3FTCA 2QSFX 2YQZA 3J7BA 5ITXA 1NJFA 2LHCA 4GMQA 2JY7A 3GQ5A 1Q02A 4LFCM 2RKOA 3FRIA 1NO1A 4I81A 4G4RA 5EJCA 1KYIA 3SHFA 2KNVA 4IIWA 4I8OA 3R9XB 3FTDA 1TH4A 1WR1B 2BWEA 2CHGA 2K6BA 3HGIA 4RF1A 5ITUA 3GLIB 4DR7M 4LGYA 3HHYA 4B7FA 4LRSA 1G4AE 1D2NA 4WW0A 2R45A 5L8RF 4MGZE 1QUSA 1TTEA 4X66M 1Z5CA 3GLIA 2LH0A 3HU2A 4IBBA 4IBEA 4AZFA 2CV0A 4WP2A 5ITTA 2FNAA 4GH9A 4JI3M 5LMUM 2G5GX 4F2LA 5DNYA 3GPUA 3B74A 3ILKA 4L4UA 5H37D 4DUZM 4NRVA 3M6AA 1GVNA 4XBOA 4ZPXA 1T6OA 1A5TA 4GITA 3GRYA 3AV0A 4R7GA 1IXSA 2XEPA 2Y20A 3SC3A 3EIHA 1Q3CA 3M7GA 1XB2B 3HHWA 1Y8GA 2C99A 2C5RA 3BXWA 1R6BX 3BOSA 4QOSA 3UJNA 1HR0M 2HL7A 3U61B 5EXXA 2R6FA 4JI8M 2DENA 3MHVC 3U60B 2VQFM 2XSZA 2QBYB 1TGUA 2LTUA 3KOXE 3AKZA 4MGHA 3UK6A 2R65A 3HHZA 3ZH9B 1LTMA 3M0EA 3U61A 2BWBA 1P3QQ 1NJGA 1SXJE 3SFZA 1VEKA 1QZEA 1K3XA 2QHOB 2KA6B 1XC8A 1N34M 1XMOM 2DAKA 2JUJA 3FYCA 4BLCA 4DV0M 2QNJA 1C1KA 5ITQA 4IJFA 3T1YM 4JV5M 1DO0A 3Q8GA 5KPRA 3C3EA 2OOBA 1DGFA 1DV0A 3KVWA 3J80S 4IJEA 4MGIE 3W0FA 3B89A 1YUBA 4B08A 4MH0E 1NSFA 1W5SA 3A42A 1YLAA 3H4MA 3E46A 3A45A 2O01F 3HKPA 2Y0TA 1T3TA 1GL6A 2L4FA 3KOWE 5ITXE 2KRUA 1L8QA 1OFHA 3KOZE 4R71A 4NRWA 1QAOA 3HX3A 4KODA 1XNRM 2BJWA 3B7ZA 2JWSA 2QCUA 1JR3D 3LCUA 3SAWA 2X49A 4IBGA 5EP2A 8CATA 4OU7A 3U6SA 1IN6A 1NV8A 4OW0A 3QWLA 4DR3M 3WHKA 2K47A 3THGA 4JI1M 3A98B 1IM2A 3AOEA 4NL4H 7CATA 1GO5A 3TPZA 1QQWA 2EO2A 3K2LA 1L1TA 1BVSA 3MMPA 1TH2A 3I04M 3SBJA 2LHGA 4DR6M 4JI4M 4K0KM 4IBIA 5EP4A 2JA2A 1SXJB 3LMMA 2DWZB 3D8BA 1VEJA 3GLHE 1GABA 5IWAM 1G41A 1K82A 2APLA 3AFHA 3T6PA 4HLQA 1KFVA 2C9CA 3E21A 5KQDA 3J7AS 3U5ZA 1HQYE 4P17A 2DZLA 2HHHM 3GPXA 1HNXM 3FKEA 2UU9M 3Q8XA 4L6V6 3DOAA 1L2DA 1JR3E 3GRRA 1E94E 3EIEA 3U6DA 2DZOB 2UUCM 2BNKA 2NQ8C 2CUZA 4M0DA 4TUWA 4LJ5A 5IT9S 1EE8A 4LF6M 1QAQA 3K1JA 4JI6M 2DNAA 4BBAA 2JY8A 5LMNM 4PT5A 1NV9A 1G71A 1HQCA 2FH0A 3FUUA 3C9PA 4G6ZA 4GC5A 4LJ6A 1NY6A 4IBFA 3SMSA 3VKGA 1TR8A 2L4EA 2KNAA 4B3RM 2EKKA 2N35A 2XFSA 2R0IA 1L1ZA 4AI6A 4FCTA 4LF4M 2M60A 4Z6YA 1QDTA 2JP7A 3AJIB 5ITYA 3U6OA 2R62A 2G8LA 3KP1E 2L2DA 5FSWA 3GLGE 1HT1E 5IREB 1PM5A 4EIWA 1IFYA 1NHWC 1OQYA 5E26A 2CWBA 2JNHA 1EFUB 1IBMM 1KSFX 4D81A 1J5EM 3JAMS 2VQEM 1ZMVA 1NHGC 3U6PA 3VFDA 2DHRA 3GLHB 3SARA 3JR4A 4L16A 2V6ZM 2KXEA 2DAIA 1UFZA 4MB7A 3VK8A 3IG5A 4IBCA 1IXSB 5DFLA 3GLHA 4AKGA 1RU3A 3KW6A 3K92A 2YFQA 1D0MA 3AOGA 3HJSA 4D82A 4X62M 1GJSA 1VQ1A 3GRVA 4XGIA 4KHPM 4B3TM 3T15A 2LVNC 5C18A 3W0LB 2A5YB 3CF0A 5EXTA 2GQFA 4B7GA 1DO2A 1DGBA 1K3WA 2VDBB 1MJGM 2F5QA 1QDRA 2XGNA 2Z8YM 2Z4RA 1VEGA 3L2AA 4IBDA 2LXEA 3C3DA 4OVZB 3RE8A 1XMQM 3FUVA 2H5XA 1G8PA 1T43A 1JR3A 2L7IA 4LCBA 3RFWA 3B7QA 2DWNA 2JXNA 3LCVB 3MJ5A 4OVZA 3UGJA 2I7PA 2LWXA 2ZANA 1QVRA 3SATA 2H1RA 2F5PA 2DZNB 3TL4X 5A2QS 2KHHA 2OPFA 3HWSA 2BJVA 3PFIA 3FUWA 4NSRA 4X64M 1MU5A 3K8ZA 3VDPA 3GLFA 2R4JA 2CHVA 3FRHA 3IECA 5EQTA 2RRUA 2CHQA 3E4RA 2DWLA 4MGKE 3GLGB 2QQ8A 1WGLA 3LVWA 2F5OA 2XFTA 3I51A 4OX9M 2Q2EB 4JXJA 4IBJA 1IBKM 3PXGA 4LF7M 3ZQJA 2XZUA 1Z5BA 3GLGA 3I01M 1GKIA 1VDDA 2QP9X 4DR4M 2EJSA 1ZMWA 4NXMM 3GPYA 1PRBA 3CTWB 3L28A 1TH3A 2R18A 1ZV1A 1LV7A 2UXBM 4NXNM 1J7KA 2RGHA 4AW4A 2EKFA 3GP1A 4G3OA 1H6UA 1Z5AA 1N75A 2KRKA 4GRIA 3FE3A 3U6LA 2DWMA 2RGOA 1N33M 5EXSA 4LY6A 4FCVA 2MH8A 1MX0A 4D80A 3T1HM 4PDGA 5F3WA 2MROB 3RGSA 3FTEA 2KEBA 1R5LA 3K9OA 4QNRA 4FD2A 2XF3A 4DV1M 3LQRA 2CP8A 4PD2A 3TWLA 2UUBM 4HL4A 1UM8A 2HWJA 4RNAA 2FOIC 3GPPA 2X4AA 3AL0C 5FTNA 3U5ZB 3HHXA 4M9SA 4G4QA 3QAUA 1OAOC 3MK6A 3L26A 3PVSA 5DYIA 2ZTCA 3IG8A 3KS8A 2I7NA 3VDUA 3B9PA 3FTFA 2CE7A 3R8FA 1NVMA 2QPAA 4JN6A 2CFOA 2JZ0A 5BR8M 1WHCA 2YNMD 3LW5F 1PJTA 2X8AA 5KQ8A 2W82A 2L6OA 4II7A 1E9RA 4M9XA 1R7RA 3KXEC 3OTOM 3L29A 3HJQA 1X37A 4BB9A 1NY5A 2FS1A 2MR9A 3CF6E 3DZDA 1XHBA 2FE8A 1V92A 3FUXA 5DYGA 1DGHA 2Z3XA 4DR2M 4L78A 1OFIA 2KW0A 1HJPA 3J81S 1N78A 4HEOA 1V34A 1I4WA 1PJJA 1F4IA 2C98A 4A3VB 2CV2A 3KFUG 4S12A 4L15A 3VK7A 4LFBM 4B3MM 4G4OA 3GLFE 4DV4M 2OQ4A 1N77A 1OAIA 1PJQA 4RF0A 4GKKM 4F1IA 4LJ4A 1L2BA 4AKHA 1Z59A 2KZUA 3HY5A 2LVAA 3I4YA 3QYEA 1HNZM 1IXRC 2F5SA 1XXHE 4JI5M 3U6MA 1NNUC 1D0KA 2JY6B 1ORYB 4WURA 4JYAM 5KPZA 4RKUF 1R4GA 4FWDA 2JY5A 3SHGB 5FTJA 2ZAMA 2LVPC 4Z8XA 1GLNA 2Y21A 2K0BX 3W67A 5FLXS 5IZ7D 3JR5A 3QYBA 1IBLM 4I4LA 4MM3B 5FTMA 4LFAM 2KDLA 2QZ4A 3IHPA 4P16A 1TF0B 1I94M 4LRTA 3LQQA 2WSEF 5GKNA 4PCZA 2XLJA 1Q39A 1VG5A 2C96A 3D8LA 3AOEC 4FWGA 3SYKA 1HNWM 2KNZA 3PNVA 5JI2E 1WGNA 2MJ5B 4M9ZA 1ZQ9A 5EP1A 2DHYA 2Y0QA 2V1CA 4B3SM 2F4VM 3L27A 2R46A 2WSCF 1G59A 1SXJD 2CRUA 4DUYM 1PJSA 2HAKA 4CJ6A 3SAUA 4QOZC 3FYDA 4W5WA 4CHTB 5KO3A 4KO8A 3UMMA 1IN7A 4CGYB 2DKLA 2DAEA 1SXJC 1OIPA 4QHSA 3NBIA 4AG5A 3GQ3A 4R3DA 2G3QA 2WSFF 2Z4SA 3TWKA 3KOYE 4CIZA 1PGYA 5FTLA 4DR5M 2LBCA 5BPVA 4LZJA 3U6QA 3HU3A 4REZA 4AKIA 3GLFB 4LJ9A 2OOAA 4MGYE 2DAGA 4DV2M 3FUTA 2ERCA 3A46A 3TQSA 4QHTA 1NNJA 1C7YA 4B7HA 1D0LA 3KP0E 1XXHB 3NBXX 4JI0M 2R4EA 2B3TA 2LVOC 1QYRA 1ZAEA 1OIZA 3F92A 3SYLA 4AQYM 3FD9A 4FCWA 1WJ7A 1XXHA 1E32A 1YE9A 1IN4A
chains in the Genus database with same CATH topology
2VIIA 4G4NA 3U60A 1QZMA 3HJ8A 2QBYA 2J7OA 1R2YA 1TDHA 2HCBA 4KLNA 3J27B 4LJ8A 1IY2A 3HU1A 4YY3M 2CV1A 1N32M 1W5TA 3SASA 4LF5M 1XNQM 2E5LM 4M0WA 4JI2M 1J09A 3J2PB 3GO8A 1PJIA 4DV7M 5FTKA 2LNHC 4DV3M 1QAMA 3KSJA 2EA0A 3ZCBB 1IY1A 2KZSA 2O5RA 1G3IA 2ZM6M 1FJGM 5ITRA 4X65M 2XH9A 1WXQA 3WHLA 1R2ZA 4L8RC 2Z7JA 4ITQA 2C9OA 4GC9A 4QNMA 3C58A 3U6CA 3VLFB 3I4VA 2CEAA 1S3SA 2UXDM 3LVVA 1N36M 1IN5A 4GHLA 1IQPA 2QENA 3KS4A 1DGGA 4YHHM 3KDSE 2XSZD 2D7EA 4I5SA 2L7HA 3TWMA 5E6JA 1TDZA 3NWLA 3UZUA 1JQJC 4IBKA 2M5ZA 3RGPA 4GIPA 3CF2A 2L09A 1DGHB 1YSYA 2F5NA 1XWIA 4FW9A 1OJLA 4PDIA 3GQ4A 4LF9M 4LJ7A 4LJAA 2D7GA 1GL7A 1E9SA 3U6EA 1SXJA 2UUAM 2ZBKB 1QANA 4GHAA 4LZZA 5JI3E 3TE6A 3SMPA 1FNNA 1Z6TA 1HT2E 4FVMA 4NOOB 3ZC7B 3SAVA 1L2CA 4CISA 5C1BA 4JI7M 2D7HA 4GKJM 2UXCM 1IY0A 2J7NA 1Q3BA 2FFJA 4NSOB 2P5TA 5EP3A 3PNYA 4AG6A 3KSXA 2EUCA 1IN8A 2AHMA 4DV5M 2V1UA 4LF8M 3E9SA 4DR1M 3L25A 3DFZA 3GRUA 2HKJA 4LG2A 5EXPA 5KPTA 2DVWB 4FWHA 4LGMA 2XZFA 2YR0A 2ZAOA 1IXZA 3T38A 2DXIA 3VKHA 4DV6M 3DA1A 3FTCA 3J7BA 2YQZA 5ITXA 4LFCM 1NJFA 4GMQA 3GQ5A 2RKOA 4I81A 4G4RA 5EJCA 1KYIA 3SHFA 4IIWA 3R9XB 4I8OA 3FTDA 1TH4A 5ITUA 2CHGA 3HGIA 4RF1A 3GLIB 4DR7M 4LGYA 3HHYA 4B7FA 4LRSA 1G4AE 1D2NA 4WW0A 2R45A 4MGZE 4X66M 1Z5CA 3GLIA 2LH0A 3HU2A 4IBBA 4IBEA 4AZFA 2CV0A 5ITTA 2FNAA 4GH9A 4JI3M 5LMUM 2G5GX 3GPUA 5DNYA 3ILKA 4L4UA 5H37D 4DUZM 4NRVA 3M6AA 1GVNA 4XBOA 4ZPXA 4GITA 3GRYA 3AV0A 4R7GA 2XEPA 2Y20A 3SC3A 3EIHA 1Q3CA 3M7GA 3HHWA 2C99A 2C5RA 1R6BX 3BOSA 4QOSA 3UJNA 1HR0M 2HL7A 3U61B 5EXXA 4JI8M 3MHVC 3U60B 2VQFM 2XSZA 2QBYB 1TGUA 3AKZA 3KOXE 4MGHA 3UK6A 2R65A 3HHZA 3ZH9B 3M0EA 3U61A 1NJGA 1SXJE 3SFZA 1K3XA 2KA6B 1XC8A 1N34M 1XMOM 3FYCA 4BLCA 4DV0M 5ITQA 1C1KA 3T1YM 4IJFA 4JV5M 1DO0A 5KPRA 1DGFA 3KVWA 3J80S 4IJEA 4MGIE 3W0FA 1YUBA 4B08A 4MH0E 1NSFA 1W5SA 3A42A 3H4MA 3A45A 3HKPA 2Y0TA 1T3TA 1GL6A 5ITXE 3KOWE 2KRUA 1L8QA 1OFHA 3KOZE 4NRWA 1QAOA 4KODA 1XNRM 2BJWA 3SAWA 2QCUA 1JR3D 2X49A 4IBGA 5EP2A 8CATA 4OU7A 3U6SA 1IN6A 4OW0A 3QWLA 4DR3M 3WHKA 2K47A 3THGA 4JI1M 3A98B 1IM2A 3AOEA 4NL4H 7CATA 3TPZA 1QQWA 2EO2A 3K2LA 1L1TA 1TH2A 3SBJA 4K0KM 4DR6M 4IBIA 5EP4A 2JA2A 1SXJB 3LMMA 2DWZB 3D8BA 5IWAM 1G41A 1K82A 3AFHA 4HLQA 1KFVA 2C9CA 5KQDA 3J7AS 3U5ZA 1HQYE 2HHHM 3GPXA 1HNXM 3FKEA 2UU9M 3Q8XA 3DOAA 1L2DA 3GRRA 1E94E 3EIEA 3U6DA 2DZOB 2UUCM 2BNKA 2NQ8C 2CUZA 4M0DA 4TUWA 4LJ5A 5IT9S 1EE8A 4LF6M 1QAQA 3K1JA 4JI6M 4BBAA 5LMNM 4PT5A 1HQCA 3FUUA 4G6ZA 4GC5A 3SMSA 3JAMS 4LJ6A 1NY6A 4IBFA 4JI4M 3VKGA 4B3RM 2XFSA 1L1ZA 4AI6A 4FCTA 4LF4M 2M60A 4Z6YA 3AJIB 5ITYA 3U6OA 2R62A 2G8LA 3KP1E 5FSWA 1HT1E 5IREB 1PM5A 4EIWA 1NHWC 5E26A 1IBMM 1KSFX 4D81A 1J5EM 2VQEM 3U6PA 1NHGC 3VFDA 2DHRA 3GLHB 3SARA 3JR4A 4L16A 2V6ZM 2KXEA 4MB7A 3VK8A 3IG5A 4IBCA 1IXSB 3GLHA 4AKGA 3KW6A 3K92A 2YFQA 3AOGA 3HJSA 4D82A 4X62M 3GRVA 4XGIA 4KHPM 4B3TM 3T15A 5C18A 3W0LB 2A5YB 3CF0A 5EXTA 4B7GA 1K3WA 1DO2A 1DGBA 2F5QA 2XGNA 3L2AA 2Z4RA 4IBDA 2LXEA 4OVZB 3RE8A 1XMQM 3FUVA 1G8PA 2L7IA 1JR3A 3RFWA 4LCBA 2DWNA 3MJ5A 4OVZA 3UGJA 2I7PA 2LWXA 2ZANA 1QVRA 3SATA 2H1RA 2F5PA 2DZNB 3TL4X 5A2QS 2OPFA 3HWSA 2BJVA 3PFIA 3FUWA 4NSRA 4X64M 1MU5A 3K8ZA 3VDPA 3GLFA 2R4JA 2CHVA 5EQTA 2CHQA 3E4RA 2DWLA 4MGKE 3GLGB 3LVWA 2F5OA 2XFTA 3I51A 4OX9M 2Q2EB 4JXJA 4IBJA 1IBKM 3PXGA 4LF7M 2XZUA 1Z5BA 3GLGA 1GKIA 1VDDA 2QP9X 4DR4M 4NXMM 3GPYA 3L28A 3CTWB 1TH3A 2R18A 2UXBM 1LV7A 4NXNM 1J7KA 2RGHA 4AW4A 3GP1A 1H6UA 1Z5AA 1N75A 2KRKA 4GRIA 3U6LA 2DWMA 2RGOA 1N33M 5EXSA 4LY6A 4FCVA 1MX0A 4D80A 3T1HM 4PDGA 5F3WA 3RGSA 3FTEA 2KEBA 4QNRA 4FD2A 2XF3A 4DV1M 3LQRA 4PD2A 3TWLA 2UUBM 4HL4A 1UM8A 4RNAA 2FOIC 3GPPA 2X4AA 3AL0C 5FTNA 3U5ZB 3HHXA 4M9SA 4G4QA 3QAUA 3MK6A 3L26A 3PVSA 5DYIA 3IG8A 3KS8A 2I7NA 3VDUA 3B9PA 3FTFA 2CE7A 3R8FA 1NVMA 2QPAA 4JN6A 2CFOA 5BR8M 2YNMD 2X8AA 5KQ8A 2W82A 2L6OA 4II7A 1E9RA 4M9XA 1R7RA 3KXEC 3OTOM 3L29A 3HJQA 1X37A 4BB9A 1NY5A 3CF6E 3DZDA 1XHBA 2FE8A 3FUXA 5DYGA 2Z3XA 1DGHA 4DR2M 4L78A 1OFIA 2KW0A 3J81S 1N78A 1I4WA 1PJJA 2C98A 4A3VB 2CV2A 3KFUG 4S12A 4L15A 3VK7A 4LFBM 4B3MM 4G4OA 4DV4M 2OQ4A 1N77A 4RF0A 4GKKM 4LJ4A 1L2BA 4AKHA 1Z59A 2KZUA 3I4YA 1HNZM 1IXRC 2F5SA 4JI5M 3U6MA 1NNUC 1ORYB 4WURA 4JYAM 5KPZA 3SHGB 4FWDA 5FTJA 2ZAMA 4Z8XA 1GLNA 2Y21A 5FLXS 5IZ7D 3JR5A 1IBLM 4I4LA 4MM3B 5FTMA 4LFAM 2QZ4A 4P16A 1I94M 4LRTA 3LQQA 4PCZA 5GKNA 2XLJA 1Q39A 2C96A 3D8LA 4FWGA 3AOEC 3SYKA 1HNWM 3PNVA 5JI2E 4M9ZA 1ZQ9A 5EP1A 2Y0QA 2V1CA 4B3SM 2F4VM 3L27A 2R46A 1G59A 1SXJD 4DUYM 3SAUA 4QOZC 3FYDA 4W5WA 4CHTB 5KO3A 4KO8A 3UMMA 1IN7A 4CGYB 1SXJC 4QHSA 3NBIA 4AG5A 3GQ3A 4R3DA 2Z4SA 3TWKA 3KOYE 4DR5M 5FTLA 5BPVA 4LZJA 3U6QA 3HU3A 4REZA 4AKIA 3GLFB 4LJ9A 4MGYE 4DV2M 3FUTA 2ERCA 3A46A 3TQSA 4QHTA 1NNJA 4B7HA 3KP0E 1XXHB 4JI0M 2R4EA 1QYRA 1ZAEA 3SYLA 4AQYM 3FD9A 4FCWA 1XXHA 1E32A 1YE9A 1IN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 M;  5LMU M;  4G4N A;  2UUB M;  3GPU A;  3GPP A;  1R2Y A;  5LMN M;  1TDH A;  4DUZ M;  4G4Q A;  4NRV A;  3JAM S;  4JI4 M;  4YY3 M;  1N32 M;  3SAS A;  4LF5 M;  1XNQ M;  2E5L M;  4B3R M;  4JI2 M;  1L1Z A;  3GO8 A;  1Q3C A;  1PJI A;  4LF4 M;  4DV7 M;  5BR8 M;  5ITY A;  3U6O A;  4DV3 M;  2EA0 A;  1HR0 M;  1PM5 A;  3OTO M;  4JI8 M;  2ZM6 M;  1J5E M;  1IBM M;  2VQF M;  5ITR A;  4X65 M;  2VQE M;  1FJG M;  3U6P A;  1R2Z A;  4ITQ A;  3SAR A;  3C58 A;  4DR2 M;  3U6C A;  3JR4 A;  3J81 S;  4MB7 A;  3VK8 A;  1PJJ A;  2UXD M;  1N36 M;  1K3X A;  1N34 M;  1XC8 A;  3VK7 A;  4YHH M;  1XMO M;  4X62 M;  4B3M M;  4G4O A;  4LFB M;  4DV4 M;  2OQ4 A;  4KHP M;  4B3T M;  4DV0 M;  5ITQ A;  3T1Y M;  3TWM A;  4GKK M;  1TDZ A;  1K3W A;  1L2B A;  4JV5 M;  1Z59 A;  4JI6 M;  1HNZ M;  2F5Q A;  2F5S A;  4JI5 M;  3J80 S;  3U6M A;  4JYA M;  3W0F A;  1XMQ M;  2F5N A;  4PDI A;  3A42 A;  3GQ4 A;  4LF9 M;  3A45 A;  5FLX S;  3JR5 A;  1IBL M;  4LFA M;  5ITX E;  1I94 M;  3U6E A;  2UUA M;  4PCZ A;  2ZBK B;  3SAT A;  2F5P A;  4NRW A;  1Q39 A;  5A2Q S;  1XNR M;  3SAV A;  4CIS A;  1L2C A;  2OPF A;  3SAW A;  1HNW M;  4X64 M;  4JI7 M;  1MU5 A;  4GKJ M;  3U6S A;  2UXC M;  1Q3B A;  4B3S M;  2F4V M;  4DR3 M;  4JI1 M;  2F5O A;  4OX9 M;  4DUY M;  3SAU A;  2Q2E B;  4DV5 M;  1L1T A;  1IBK M;  4LF8 M;  4LF7 M;  4DR1 M;  3SBJ A;  4DR6 M;  2XZU A;  1Z5B A;  4K0K M;  2HKJ A;  4DR4 M;  3GQ3 A;  4NXM M;  2XZF A;  3TWK A;  3GPY A;  5IWA M;  4DR5 M;  2UXB M;  3U6Q A;  4DV6 M;  1K82 A;  4NXN M;  5ITX A;  4LFC M;  3GQ5 A;  1KFV A;  3GP1 A;  3J7A S;  4G4R A;  4DV2 M;  3A46 A;  1Z5A A;  1NNJ A;  2HHH M;  5ITU A;  3GPX A;  3U6L A;  1HNX M;  4DR7 M;  1N33 M;  2UU9 M;  4JI0 M;  3DOA A;  1L2D A;  1MX0 A;  3T1H M;  4PDG A;  4AQY M;  4X66 M;  3U6D A;  2UUC M;  1Z5C A;  5ITT A;  5IT9 S;  1EE8 A;  4DV1 M;  4LF6 M;  4PD2 A;  3TWL A; 
#chains in the Genus database with same CATH topology
 2VII A;  4G4N A;  3U60 A;  1QZM A;  3HJ8 A;  2QBY A;  2J7O A;  1R2Y A;  1TDH A;  4UN2 B;  2HCB A;  4KLN A;  3J27 B;  4LJ8 A;  1AIP C;  1IY2 A;  3HU1 A;  4YY3 M;  2CV1 A;  1N32 M;  1W5T A;  3SAS A;  4LF5 M;  1MN3 A;  1XNQ M;  2E5L M;  4M0W A;  4JI2 M;  1AUA A;  1J09 A;  3J2P B;  1GJT A;  3GO8 A;  1PJI A;  4DV7 M;  4ANR A;  5FTK A;  2LNH C;  4DV3 M;  1QAM A;  2GNO A;  3KSJ A;  2EA0 A;  3ZCB B;  1IY1 A;  2KZS A;  2O5R A;  1QUT A;  1G3I A;  2ZM6 M;  1FJG M;  5ITR A;  3BBZ A;  4X65 M;  1ZMU A;  2XH9 A;  1WXQ A;  4GEW A;  3WHL A;  1R2Z A;  2Z7J A;  4ITQ A;  4L8R C;  2C9O A;  4GC9 A;  4QNM A;  3W68 A;  3C58 A;  3U6C A;  3VLF B;  3I4V A;  2CEA A;  1S3S A;  2UXD M;  3LVV A;  1N36 M;  2DAM A;  1IN5 A;  1JB0 F;  1IQP A;  2VF7 A;  2QEN A;  4GHL A;  3KS4 A;  1DGG A;  4NC6 A;  3KDS E;  4YHH M;  2XSZ D;  2D7E A;  4I5S A;  2L7H A;  2R44 A;  1VDL A;  2WZJ A;  2MGW A;  2O25 A;  3TWM A;  5E6J A;  1TDZ A;  3HZJ A;  3NWL A;  3UZU A;  1JQJ C;  3GLI E;  4IBK A;  2M5Z A;  3RGP A;  4GIP A;  2ZTD A;  2L09 A;  3CF2 A;  1DGH B;  1YSY A;  2F5N A;  1XWI A;  4FW9 A;  1OJL A;  4PDI A;  3V76 A;  4XK8 F;  3GQ4 A;  3B7N A;  4LF9 M;  4LJ7 A;  4LJA A;  1SG9 A;  1V33 A;  2D7G A;  2VF8 A;  1GL7 A;  4KT0 F;  1E9S A;  3U6E A;  1SXJ A;  2UUA M;  2ZBK B;  1QAN A;  4GHA A;  4LZZ A;  2LVQ D;  5JI3 E;  1CUK A;  3TE6 A;  3SMP A;  1FNN A;  1Z6T A;  1HT2 E;  4FVM A;  4NOO B;  3ZC7 B;  3SAV A;  1L2C A;  2DI0 A;  4CIS A;  5C1B A;  4JI7 M;  2D7H A;  4GKJ M;  2J5Y A;  2UXC M;  1EIJ A;  1IY0 A;  2K9D A;  2J7N A;  1Q3B A;  2FFJ A;  4NSO B;  2P5T A;  5EP3 A;  3PNY A;  1WIV A;  3KSX A;  4AG6 A;  2EUC A;  4DBG B;  1IN8 A;  2JZ1 A;  2AHM A;  4Y28 F;  4DV5 M;  2V1U A;  4LF8 M;  1OTR A;  3E9S A;  4DR1 M;  3L25 A;  3CGW A;  3DFZ A;  2OO9 A;  3GRU A;  2HKJ A;  4Q7J A;  4LG2 A;  5EXP A;  5KPT A;  2DVW B;  3K9P A;  4FWH A;  4LGM A;  2XZF A;  2YR0 A;  2ZAO A;  1IXZ A;  3T38 A;  2DXI A;  3VKH A;  3H4J A;  1OKS A;  4DV6 M;  3DA1 A;  3FTC A;  2QSF X;  2YQZ A;  3J7B A;  5ITX A;  1NJF A;  2LHC A;  4GMQ A;  2JY7 A;  3GQ5 A;  1Q02 A;  4LFC M;  2RKO A;  3FRI A;  1NO1 A;  4I81 A;  4G4R A;  5EJC A;  1KYI A;  3SHF A;  2KNV A;  4IIW A;  4I8O A;  3R9X B;  3FTD A;  1TH4 A;  1WR1 B;  2BWE A;  2CHG A;  2K6B A;  3HGI A;  4RF1 A;  5ITU A;  3GLI B;  4DR7 M;  4LGY A;  3HHY A;  4B7F A;  4LRS A;  1G4A E;  1D2N A;  4WW0 A;  2R45 A;  5L8R F;  4MGZ E;  1QUS A;  1TTE A;  4X66 M;  1Z5C A;  3GLI A;  2LH0 A;  3HU2 A;  4IBB A;  4IBE A;  4AZF A;  2CV0 A;  4WP2 A;  5ITT A;  2FNA A;  4GH9 A;  4JI3 M;  5LMU M;  2G5G X;  4F2L A;  5DNY A;  3GPU A;  3B74 A;  3ILK A;  4L4U A;  5H37 D;  4DUZ M;  4NRV A;  3M6A A;  1GVN A;  4XBO A;  4ZPX A;  1T6O A;  1A5T A;  4GIT A;  3GRY A;  3AV0 A;  4R7G A;  1IXS A;  2XEP A;  2Y20 A;  3SC3 A;  3EIH A;  1Q3C A;  3M7G A;  1XB2 B;  3HHW A;  1Y8G A;  2C99 A;  2C5R A;  3BXW A;  1R6B X;  3BOS A;  4QOS A;  3UJN A;  1HR0 M;  2HL7 A;  3U61 B;  5EXX A;  2R6F A;  4JI8 M;  2DEN A;  3MHV C;  3U60 B;  2VQF M;  2XSZ A;  2QBY B;  1TGU A;  2LTU A;  3KOX E;  3AKZ A;  4MGH A;  3UK6 A;  2R65 A;  3HHZ A;  3ZH9 B;  1LTM A;  3M0E A;  3U61 A;  2BWB A;  1P3Q Q;  1NJG A;  1SXJ E;  3SFZ A;  1VEK A;  1QZE A;  1K3X A;  2QHO B;  2KA6 B;  1XC8 A;  1N34 M;  1XMO M;  2DAK A;  2JUJ A;  3FYC A;  4BLC A;  4DV0 M;  2QNJ A;  1C1K A;  5ITQ A;  4IJF A;  3T1Y M;  4JV5 M;  1DO0 A;  3Q8G A;  5KPR A;  3C3E A;  2OOB A;  1DGF A;  1DV0 A;  3KVW A;  3J80 S;  4IJE A;  4MGI E;  3W0F A;  3B89 A;  1YUB A;  4B08 A;  4MH0 E;  1NSF A;  1W5S A;  3A42 A;  1YLA A;  3H4M A;  3E46 A;  3A45 A;  2O01 F;  3HKP A;  2Y0T A;  1T3T A;  1GL6 A;  2L4F A;  3KOW E;  5ITX E;  2KRU A;  1L8Q A;  1OFH A;  3KOZ E;  4R71 A;  4NRW A;  1QAO A;  3HX3 A;  4KOD A;  1XNR M;  2BJW A;  3B7Z A;  2JWS A;  2QCU A;  1JR3 D;  3LCU A;  3SAW A;  2X49 A;  4IBG A;  5EP2 A;  8CAT A;  4OU7 A;  3U6S A;  1IN6 A;  1NV8 A;  4OW0 A;  3QWL A;  4DR3 M;  3WHK A;  2K47 A;  3THG A;  4JI1 M;  3A98 B;  1IM2 A;  3AOE A;  4NL4 H;  7CAT A;  1GO5 A;  3TPZ A;  1QQW A;  2EO2 A;  3K2L A;  1L1T A;  1BVS A;  3MMP A;  1TH2 A;  3I04 M;  3SBJ A;  2LHG A;  4DR6 M;  4JI4 M;  4K0K M;  4IBI A;  5EP4 A;  2JA2 A;  1SXJ B;  3LMM A;  2DWZ B;  3D8B A;  1VEJ A;  3GLH E;  1GAB A;  5IWA M;  1G41 A;  1K82 A;  2APL A;  3AFH A;  3T6P A;  4HLQ A;  1KFV A;  2C9C A;  3E21 A;  5KQD A;  3J7A S;  3U5Z A;  1HQY E;  4P17 A;  2DZL A;  2HHH M;  3GPX A;  1HNX M;  3FKE A;  2UU9 M;  3Q8X A;  4L6V 6;  3DOA A;  1L2D A;  1JR3 E;  3GRR A;  1E94 E;  3EIE A;  3U6D A;  2DZO B;  2UUC M;  2BNK A;  2NQ8 C;  2CUZ A;  4M0D A;  4TUW A;  4LJ5 A;  5IT9 S;  1EE8 A;  4LF6 M;  1QAQ A;  3K1J A;  4JI6 M;  2DNA A;  4BBA A;  2JY8 A;  5LMN M;  4PT5 A;  1NV9 A;  1G71 A;  1HQC A;  2FH0 A;  3FUU A;  3C9P A;  4G6Z A;  4GC5 A;  4LJ6 A;  1NY6 A;  4IBF A;  3SMS A;  3VKG A;  1TR8 A;  2L4E A;  2KNA A;  4B3R M;  2EKK A;  2N35 A;  2XFS A;  2R0I A;  1L1Z A;  4AI6 A;  4FCT A;  4LF4 M;  2M60 A;  4Z6Y A;  1QDT A;  2JP7 A;  3AJI B;  5ITY A;  3U6O A;  2R62 A;  2G8L A;  3KP1 E;  2L2D A;  5FSW A;  3GLG E;  1HT1 E;  5IRE B;  1PM5 A;  4EIW A;  1IFY A;  1NHW C;  1OQY A;  5E26 A;  2CWB A;  2JNH A;  1EFU B;  1IBM M;  1KSF X;  4D81 A;  1J5E M;  3JAM S;  2VQE M;  1ZMV A;  1NHG C;  3U6P A;  3VFD A;  2DHR A;  3GLH B;  3SAR A;  3JR4 A;  4L16 A;  2V6Z M;  2KXE A;  2DAI A;  1UFZ A;  4MB7 A;  3VK8 A;  3IG5 A;  4IBC A;  1IXS B;  5DFL A;  3GLH A;  4AKG A;  1RU3 A;  3KW6 A;  3K92 A;  2YFQ A;  1D0M A;  3AOG A;  3HJS A;  4D82 A;  4X62 M;  1GJS A;  1VQ1 A;  3GRV A;  4XGI A;  4KHP M;  4B3T M;  3T15 A;  2LVN C;  5C18 A;  3W0L B;  2A5Y B;  3CF0 A;  5EXT A;  2GQF A;  4B7G A;  1DO2 A;  1DGB A;  1K3W A;  2VDB B;  1MJG M;  2F5Q A;  1QDR A;  2XGN A;  2Z8Y M;  2Z4R A;  1VEG A;  3L2A A;  4IBD A;  2LXE A;  3C3D A;  4OVZ B;  3RE8 A;  1XMQ M;  3FUV A;  2H5X A;  1G8P A;  1T43 A;  1JR3 A;  2L7I A;  4LCB A;  3RFW A;  3B7Q A;  2DWN A;  2JXN A;  3LCV B;  3MJ5 A;  4OVZ A;  3UGJ A;  2I7P A;  2LWX A;  2ZAN A;  1QVR A;  3SAT A;  2H1R A;  2F5P A;  2DZN B;  3TL4 X;  5A2Q S;  2KHH A;  2OPF A;  3HWS A;  2BJV A;  3PFI A;  3FUW A;  4NSR A;  4X64 M;  1MU5 A;  3K8Z A;  3VDP A;  3GLF A;  2R4J A;  2CHV A;  3FRH A;  3IEC A;  5EQT A;  2RRU A;  2CHQ A;  3E4R A;  2DWL A;  4MGK E;  3GLG B;  2QQ8 A;  1WGL A;  3LVW A;  2F5O A;  2XFT A;  3I51 A;  4OX9 M;  2Q2E B;  4JXJ A;  4IBJ A;  1IBK M;  3PXG A;  4LF7 M;  3ZQJ A;  2XZU A;  1Z5B A;  3GLG A;  3I01 M;  1GKI A;  1VDD A;  2QP9 X;  4DR4 M;  2EJS A;  1ZMW A;  4NXM M;  3GPY A;  1PRB A;  3CTW B;  3L28 A;  1TH3 A;  2R18 A;  1ZV1 A;  1LV7 A;  2UXB M;  4NXN M;  1J7K A;  2RGH A;  4AW4 A;  2EKF A;  3GP1 A;  4G3O A;  1H6U A;  1Z5A A;  1N75 A;  2KRK A;  4GRI A;  3FE3 A;  3U6L A;  2DWM A;  2RGO A;  1N33 M;  5EXS A;  4LY6 A;  4FCV A;  2MH8 A;  1MX0 A;  4D80 A;  3T1H M;  4PDG A;  5F3W A;  2MRO B;  3RGS A;  3FTE A;  2KEB A;  1R5L A;  3K9O A;  4QNR A;  4FD2 A;  2XF3 A;  4DV1 M;  3LQR A;  2CP8 A;  4PD2 A;  3TWL A;  2UUB M;  4HL4 A;  1UM8 A;  2HWJ A;  4RNA A;  2FOI C;  3GPP A;  2X4A A;  3AL0 C;  5FTN A;  3U5Z B;  3HHX A;  4M9S A;  4G4Q A;  3QAU A;  1OAO C;  3MK6 A;  3L26 A;  3PVS A;  5DYI A;  2ZTC A;  3IG8 A;  3KS8 A;  2I7N A;  3VDU A;  3B9P A;  3FTF A;  2CE7 A;  3R8F A;  1NVM A;  2QPA A;  4JN6 A;  2CFO A;  2JZ0 A;  5BR8 M;  1WHC A;  2YNM D;  3LW5 F;  1PJT A;  2X8A A;  5KQ8 A;  2W82 A;  2L6O A;  4II7 A;  1E9R A;  4M9X A;  1R7R A;  3KXE C;  3OTO M;  3L29 A;  3HJQ A;  1X37 A;  4BB9 A;  1NY5 A;  2FS1 A;  2MR9 A;  3CF6 E;  3DZD A;  1XHB A;  2FE8 A;  1V92 A;  3FUX A;  5DYG A;  1DGH A;  2Z3X A;  4DR2 M;  4L78 A;  1OFI A;  2KW0 A;  1HJP A;  3J81 S;  1N78 A;  4HEO A;  1V34 A;  1I4W A;  1PJJ A;  1F4I A;  2C98 A;  4A3V B;  2CV2 A;  3KFU G;  4S12 A;  4L15 A;  3VK7 A;  4LFB M;  4B3M M;  4G4O A;  3GLF E;  4DV4 M;  2OQ4 A;  1N77 A;  1OAI A;  1PJQ A;  4RF0 A;  4GKK M;  4F1I A;  4LJ4 A;  1L2B A;  4AKH A;  1Z59 A;  2KZU A;  3HY5 A;  2LVA A;  3I4Y A;  3QYE A;  1HNZ M;  1IXR C;  2F5S A;  1XXH E;  4JI5 M;  3U6M A;  1NNU C;  1D0K A;  2JY6 B;  1ORY B;  4WUR A;  4JYA M;  5KPZ A;  4RKU F;  1R4G A;  4FWD A;  2JY5 A;  3SHG B;  5FTJ A;  2ZAM A;  2LVP C;  4Z8X A;  1GLN A;  2Y21 A;  2K0B X;  3W67 A;  5FLX S;  5IZ7 D;  3JR5 A;  3QYB A;  1IBL M;  4I4L A;  4MM3 B;  5FTM A;  4LFA M;  2KDL A;  2QZ4 A;  3IHP A;  4P16 A;  1TF0 B;  1I94 M;  4LRT A;  3LQQ A;  2WSE F;  5GKN A;  4PCZ A;  2XLJ A;  1Q39 A;  1VG5 A;  2C96 A;  3D8L A;  3AOE C;  4FWG A;  3SYK A;  1HNW M;  2KNZ A;  3PNV A;  5JI2 E;  1WGN A;  2MJ5 B;  4M9Z A;  1ZQ9 A;  5EP1 A;  2DHY A;  2Y0Q A;  2V1C A;  4B3S M;  2F4V M;  3L27 A;  2R46 A;  2WSC F;  1G59 A;  1SXJ D;  2CRU A;  4DUY M;  1PJS A;  2HAK A;  4CJ6 A;  3SAU A;  4QOZ C;  3FYD A;  4W5W A;  4CHT B;  5KO3 A;  4KO8 A;  3UMM A;  1IN7 A;  4CGY B;  2DKL A;  2DAE A;  1SXJ C;  1OIP A;  4QHS A;  3NBI A;  4AG5 A;  3GQ3 A;  4R3D A;  2G3Q A;  2WSF F;  2Z4S A;  3TWK A;  3KOY E;  4CIZ A;  1PGY A;  5FTL A;  4DR5 M;  2LBC A;  5BPV A;  4LZJ A;  3U6Q A;  3HU3 A;  4REZ A;  4AKI A;  3GLF B;  4LJ9 A;  2OOA A;  4MGY E;  2DAG A;  4DV2 M;  3FUT A;  2ERC A;  3A46 A;  3TQS A;  4QHT A;  1NNJ A;  1C7Y A;  4B7H A;  1D0L A;  3KP0 E;  1XXH B;  3NBX X;  4JI0 M;  2R4E A;  2B3T A;  2LVO C;  1QYR A;  1ZAE A;  1OIZ A;  3F92 A;  3SYL A;  4AQY M;  3FD9 A;  4FCW A;  1WJ7 A;  1XXH A;  1E32 A;  1YE9 A;  1IN4 A; 
#chains in the Genus database with same CATH homology
 2VII A;  4G4N A;  3U60 A;  1QZM A;  3HJ8 A;  2QBY A;  2J7O A;  1R2Y A;  1TDH A;  2HCB A;  4KLN A;  3J27 B;  4LJ8 A;  1IY2 A;  3HU1 A;  4YY3 M;  2CV1 A;  1N32 M;  1W5T A;  3SAS A;  4LF5 M;  1XNQ M;  2E5L M;  4M0W A;  4JI2 M;  1J09 A;  3J2P B;  3GO8 A;  1PJI A;  4DV7 M;  5FTK A;  2LNH C;  4DV3 M;  1QAM A;  3KSJ A;  2EA0 A;  3ZCB B;  1IY1 A;  2KZS A;  2O5R A;  1G3I A;  2ZM6 M;  1FJG M;  5ITR A;  4X65 M;  2XH9 A;  1WXQ A;  3WHL A;  1R2Z A;  4L8R C;  2Z7J A;  4ITQ A;  2C9O A;  4GC9 A;  4QNM A;  3C58 A;  3U6C A;  3VLF B;  3I4V A;  2CEA A;  1S3S A;  2UXD M;  3LVV A;  1N36 M;  1IN5 A;  4GHL A;  1IQP A;  2QEN A;  3KS4 A;  1DGG A;  4YHH M;  3KDS E;  2XSZ D;  2D7E A;  4I5S A;  2L7H A;  3TWM A;  5E6J A;  1TDZ A;  3NWL A;  3UZU A;  1JQJ C;  4IBK A;  2M5Z A;  3RGP A;  4GIP A;  3CF2 A;  2L09 A;  1DGH B;  1YSY A;  2F5N A;  1XWI A;  4FW9 A;  1OJL A;  4PDI A;  3GQ4 A;  4LF9 M;  4LJ7 A;  4LJA A;  2D7G A;  1GL7 A;  1E9S A;  3U6E A;  1SXJ A;  2UUA M;  2ZBK B;  1QAN A;  4GHA A;  4LZZ A;  5JI3 E;  3TE6 A;  3SMP A;  1FNN A;  1Z6T A;  1HT2 E;  4FVM A;  4NOO B;  3ZC7 B;  3SAV A;  1L2C A;  4CIS A;  5C1B A;  4JI7 M;  2D7H A;  4GKJ M;  2UXC M;  1IY0 A;  2J7N A;  1Q3B A;  2FFJ A;  4NSO B;  2P5T A;  5EP3 A;  3PNY A;  4AG6 A;  3KSX A;  2EUC A;  1IN8 A;  2AHM A;  4DV5 M;  2V1U A;  4LF8 M;  3E9S A;  4DR1 M;  3L25 A;  3DFZ A;  3GRU A;  2HKJ A;  4LG2 A;  5EXP A;  5KPT A;  2DVW B;  4FWH A;  4LGM A;  2XZF A;  2YR0 A;  2ZAO A;  1IXZ A;  3T38 A;  2DXI A;  3VKH A;  4DV6 M;  3DA1 A;  3FTC A;  3J7B A;  2YQZ A;  5ITX A;  4LFC M;  1NJF A;  4GMQ A;  3GQ5 A;  2RKO A;  4I81 A;  4G4R A;  5EJC A;  1KYI A;  3SHF A;  4IIW A;  3R9X B;  4I8O A;  3FTD A;  1TH4 A;  5ITU A;  2CHG A;  3HGI A;  4RF1 A;  3GLI B;  4DR7 M;  4LGY A;  3HHY A;  4B7F A;  4LRS A;  1G4A E;  1D2N A;  4WW0 A;  2R45 A;  4MGZ E;  4X66 M;  1Z5C A;  3GLI A;  2LH0 A;  3HU2 A;  4IBB A;  4IBE A;  4AZF A;  2CV0 A;  5ITT A;  2FNA A;  4GH9 A;  4JI3 M;  5LMU M;  2G5G X;  3GPU A;  5DNY A;  3ILK A;  4L4U A;  5H37 D;  4DUZ M;  4NRV A;  3M6A A;  1GVN A;  4XBO A;  4ZPX A;  4GIT A;  3GRY A;  3AV0 A;  4R7G A;  2XEP A;  2Y20 A;  3SC3 A;  3EIH A;  1Q3C A;  3M7G A;  3HHW A;  2C99 A;  2C5R A;  1R6B X;  3BOS A;  4QOS A;  3UJN A;  1HR0 M;  2HL7 A;  3U61 B;  5EXX A;  4JI8 M;  3MHV C;  3U60 B;  2VQF M;  2XSZ A;  2QBY B;  1TGU A;  3AKZ A;  3KOX E;  4MGH A;  3UK6 A;  2R65 A;  3HHZ A;  3ZH9 B;  3M0E A;  3U61 A;  1NJG A;  1SXJ E;  3SFZ A;  1K3X A;  2KA6 B;  1XC8 A;  1N34 M;  1XMO M;  3FYC A;  4BLC A;  4DV0 M;  5ITQ A;  1C1K A;  3T1Y M;  4IJF A;  4JV5 M;  1DO0 A;  5KPR A;  1DGF A;  3KVW A;  3J80 S;  4IJE A;  4MGI E;  3W0F A;  1YUB A;  4B08 A;  4MH0 E;  1NSF A;  1W5S A;  3A42 A;  3H4M A;  3A45 A;  3HKP A;  2Y0T A;  1T3T A;  1GL6 A;  5ITX E;  3KOW E;  2KRU A;  1L8Q A;  1OFH A;  3KOZ E;  4NRW A;  1QAO A;  4KOD A;  1XNR M;  2BJW A;  3SAW A;  2QCU A;  1JR3 D;  2X49 A;  4IBG A;  5EP2 A;  8CAT A;  4OU7 A;  3U6S A;  1IN6 A;  4OW0 A;  3QWL A;  4DR3 M;  3WHK A;  2K47 A;  3THG A;  4JI1 M;  3A98 B;  1IM2 A;  3AOE A;  4NL4 H;  7CAT A;  3TPZ A;  1QQW A;  2EO2 A;  3K2L A;  1L1T A;  1TH2 A;  3SBJ A;  4K0K M;  4DR6 M;  4IBI A;  5EP4 A;  2JA2 A;  1SXJ B;  3LMM A;  2DWZ B;  3D8B A;  5IWA M;  1G41 A;  1K82 A;  3AFH A;  4HLQ A;  1KFV A;  2C9C A;  5KQD A;  3J7A S;  3U5Z A;  1HQY E;  2HHH M;  3GPX A;  1HNX M;  3FKE A;  2UU9 M;  3Q8X A;  3DOA A;  1L2D A;  3GRR A;  1E94 E;  3EIE A;  3U6D A;  2DZO B;  2UUC M;  2BNK A;  2NQ8 C;  2CUZ A;  4M0D A;  4TUW A;  4LJ5 A;  5IT9 S;  1EE8 A;  4LF6 M;  1QAQ A;  3K1J A;  4JI6 M;  4BBA A;  5LMN M;  4PT5 A;  1HQC A;  3FUU A;  4G6Z A;  4GC5 A;  3SMS A;  3JAM S;  4LJ6 A;  1NY6 A;  4IBF A;  4JI4 M;  3VKG A;  4B3R M;  2XFS A;  1L1Z A;  4AI6 A;  4FCT A;  4LF4 M;  2M60 A;  4Z6Y A;  3AJI B;  5ITY A;  3U6O A;  2R62 A;  2G8L A;  3KP1 E;  5FSW A;  1HT1 E;  5IRE B;  1PM5 A;  4EIW A;  1NHW C;  5E26 A;  1IBM M;  1KSF X;  4D81 A;  1J5E M;  2VQE M;  3U6P A;  1NHG C;  3VFD A;  2DHR A;  3GLH B;  3SAR A;  3JR4 A;  4L16 A;  2V6Z M;  2KXE A;  4MB7 A;  3VK8 A;  3IG5 A;  4IBC A;  1IXS B;  3GLH A;  4AKG A;  3KW6 A;  3K92 A;  2YFQ A;  3AOG A;  3HJS A;  4D82 A;  4X62 M;  3GRV A;  4XGI A;  4KHP M;  4B3T M;  3T15 A;  5C18 A;  3W0L B;  2A5Y B;  3CF0 A;  5EXT A;  4B7G A;  1K3W A;  1DO2 A;  1DGB A;  2F5Q A;  2XGN A;  3L2A A;  2Z4R A;  4IBD A;  2LXE A;  4OVZ B;  3RE8 A;  1XMQ M;  3FUV A;  1G8P A;  2L7I A;  1JR3 A;  3RFW A;  4LCB A;  2DWN A;  3MJ5 A;  4OVZ A;  3UGJ A;  2I7P A;  2LWX A;  2ZAN A;  1QVR A;  3SAT A;  2H1R A;  2F5P A;  2DZN B;  3TL4 X;  5A2Q S;  2OPF A;  3HWS A;  2BJV A;  3PFI A;  3FUW A;  4NSR A;  4X64 M;  1MU5 A;  3K8Z A;  3VDP A;  3GLF A;  2R4J A;  2CHV A;  5EQT A;  2CHQ A;  3E4R A;  2DWL A;  4MGK E;  3GLG B;  3LVW A;  2F5O A;  2XFT A;  3I51 A;  4OX9 M;  2Q2E B;  4JXJ A;  4IBJ A;  1IBK M;  3PXG A;  4LF7 M;  2XZU A;  1Z5B A;  3GLG A;  1GKI A;  1VDD A;  2QP9 X;  4DR4 M;  4NXM M;  3GPY A;  3L28 A;  3CTW B;  1TH3 A;  2R18 A;  2UXB M;  1LV7 A;  4NXN M;  1J7K A;  2RGH A;  4AW4 A;  3GP1 A;  1H6U A;  1Z5A A;  1N75 A;  2KRK A;  4GRI A;  3U6L A;  2DWM A;  2RGO A;  1N33 M;  5EXS A;  4LY6 A;  4FCV A;  1MX0 A;  4D80 A;  3T1H M;  4PDG A;  5F3W A;  3RGS A;  3FTE A;  2KEB A;  4QNR A;  4FD2 A;  2XF3 A;  4DV1 M;  3LQR A;  4PD2 A;  3TWL A;  2UUB M;  4HL4 A;  1UM8 A;  4RNA A;  2FOI C;  3GPP A;  2X4A A;  3AL0 C;  5FTN A;  3U5Z B;  3HHX A;  4M9S A;  4G4Q A;  3QAU A;  3MK6 A;  3L26 A;  3PVS A;  5DYI A;  3IG8 A;  3KS8 A;  2I7N A;  3VDU A;  3B9P A;  3FTF A;  2CE7 A;  3R8F A;  1NVM A;  2QPA A;  4JN6 A;  2CFO A;  5BR8 M;  2YNM D;  2X8A A;  5KQ8 A;  2W82 A;  2L6O A;  4II7 A;  1E9R A;  4M9X A;  1R7R A;  3KXE C;  3OTO M;  3L29 A;  3HJQ A;  1X37 A;  4BB9 A;  1NY5 A;  3CF6 E;  3DZD A;  1XHB A;  2FE8 A;  3FUX A;  5DYG A;  2Z3X A;  1DGH A;  4DR2 M;  4L78 A;  1OFI A;  2KW0 A;  3J81 S;  1N78 A;  1I4W A;  1PJJ A;  2C98 A;  4A3V B;  2CV2 A;  3KFU G;  4S12 A;  4L15 A;  3VK7 A;  4LFB M;  4B3M M;  4G4O A;  4DV4 M;  2OQ4 A;  1N77 A;  4RF0 A;  4GKK M;  4LJ4 A;  1L2B A;  4AKH A;  1Z59 A;  2KZU A;  3I4Y A;  1HNZ M;  1IXR C;  2F5S A;  4JI5 M;  3U6M A;  1NNU C;  1ORY B;  4WUR A;  4JYA M;  5KPZ A;  3SHG B;  4FWD A;  5FTJ A;  2ZAM A;  4Z8X A;  1GLN A;  2Y21 A;  5FLX S;  5IZ7 D;  3JR5 A;  1IBL M;  4I4L A;  4MM3 B;  5FTM A;  4LFA M;  2QZ4 A;  4P16 A;  1I94 M;  4LRT A;  3LQQ A;  4PCZ A;  5GKN A;  2XLJ A;  1Q39 A;  2C96 A;  3D8L A;  4FWG A;  3AOE C;  3SYK A;  1HNW M;  3PNV A;  5JI2 E;  4M9Z A;  1ZQ9 A;  5EP1 A;  2Y0Q A;  2V1C A;  4B3S M;  2F4V M;  3L27 A;  2R46 A;  1G59 A;  1SXJ D;  4DUY M;  3SAU A;  4QOZ C;  3FYD A;  4W5W A;  4CHT B;  5KO3 A;  4KO8 A;  3UMM A;  1IN7 A;  4CGY B;  1SXJ C;  4QHS A;  3NBI A;  4AG5 A;  3GQ3 A;  4R3D A;  2Z4S A;  3TWK A;  3KOY E;  4DR5 M;  5FTL A;  5BPV A;  4LZJ A;  3U6Q A;  3HU3 A;  4REZ A;  4AKI A;  3GLF B;  4LJ9 A;  4MGY E;  4DV2 M;  3FUT A;  2ERC A;  3A46 A;  3TQS A;  4QHT A;  1NNJ A;  4B7H A;  3KP0 E;  1XXH B;  4JI0 M;  2R4E A;  1QYR A;  1ZAE A;  3SYL A;  4AQY M;  3FD9 A;  4FCW A;  1XXH A;  1E32 A;  1YE9 A;  1IN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...