4X62M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x62M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x62M02
1L1ZA 4DV0M 4DR3M 2VQEM 4JYAM 2F5PA 2OPFA 4JI2M 3U6MA 1K3XA 2UXBM 1IBLM 3U6QA 1R2ZA 1EE8A 4DUYM 3TWMA 2UUAM 1FJGM 3JAMS 3GQ3A 2ZM6M 1Z59A 3VK7A 2UUBM 3TWKA 3GPPA 2UU9M 1N36M 4JI4M 3J81S 3GPXA 1NNJA 1IBKM 3A45A 3J80S 1PJIA 4DV4M 5A2QS 5ITRA 2UXCM 4DR5M 3U6EA 3DOAA 2UUCM 4B3TM 2UXDM 1N33M 2E5LM 4LFCM 4JV5M 5LMNM 1MX0A 1L1TA 3GPYA 2VQFM 1K3WA 4JI0M 3GPUA 4NXNM 4G4RA 4G4NA 4NXMM 4JI6M 3GQ4A 4YY3M 3U6LA 3GQ5A 5FLXS 1I94M 4PDGA 1Z5BA 4JI8M 4X64M 4X62M 4JI5M 4DR6M 1IBMM 4B3SM 3SARA 4LF9M 1HNWM 3A42A 4DV5M 3T1HM 2XZFA 4DR1M 4PCZA 4JI1M 1TDZA 1MU5A 3U6CA 2F5NA 3SATA 4JI3M 1N32M 1HNZM 2F5QA 4DUZM 2OQ4A 1L2CA 1L2DA 1HR0M 2HKJA 1XC8A 1KFVA 3SBJA 4DR4M 4GKKM 3A46A 4LF5M 5ITQA 1HNXM 1XMOM 1XNRM 3VK8A 3C58A 3U6SA 1J5EM 1XMQM 1K82A 3J7AS 1L2BA 4LF4M 3GO8A 3SAWA 4X65M 4NRVA 3T1YM 5ITYA 4OX9M 1PJJA 1R2YA 4ITQA 3SAUA 5ITXA 5IWAM 1Q3BA 4B3MM 4DV2M 4DV6M 4PDIA 2F5SA 4GKJM 4X66M 4MB7A 4YHHM 2ZBKB 2EA0A 2XZUA 4LF6M 4DR7M 4LF8M 1Q39A 4JI7M 4LFBM 3JR5A 4DV1M 1N34M 4PD2A 5LMUM 3U6PA 4G4OA 1Z5CA 2F5OA 1Z5AA 3W0FA 5ITXE 3SAVA 5ITTA 3U6OA 2F4VM 4NRWA 3SASA 3JR4A 4B3RM 4DR2M 4G4QA 5ITUA 4DV3M 3U6DA 4CISA 4LF7M 1Q3CA 4DV7M 2Q2EB 4K0KM 4LFAM 1XNQM 5IT9S 3GP1A 3OTOM 4AQYM 2HHHM 3TWLA 1PM5A 1TDHA 4KHPM 5BR8M
chains in the Genus database with same CATH superfamily
4BLCA 4DV0M 3FRIA 3LW5F 4L78A 1HQYE 1ZV1A 3J2PB 3RGPA 1UM8A 3FYCA 1OFIA 1OTRA 1R6BX 4IBDA 1Z6TA 2KNVA 3FTFA 1PGYA 2J7NA 4MH0E 4B08A 5KPTA 1R2ZA 5C18A 2VF8A 1FJGM 1XXHA 1QYRA 1Z59A 4IBEA 5EP4A 3KP0E 3HU3A 2ZM6M 2C96A 2MH8A 2R45A 5JI2E 1IN4A 3ZH9B 2KHHA 3B74A 3F92A 2DWMA 2KDLA 2EKKA 2KNAA 4OVZB 3VKGA 4S12A 3AL0C 3HX3A 1IM2A 4JXJA 1WGLA 3B7NA 3A45A 3DFZA 3CGWA 3GRRA 4FWGA 5A2QS 2UXCM 3FUTA 2LTUA 4DBGB 3DOAA 5H37D 1IY2A 3LMMA 4JN6A 2RRUA 4FCWA 1QUTA 3U60B 3M0EA 3PNYA 4HL4A 3GPYA 2MROB 1XHBA 2MJ5B 3KXEC 2ZAOA 4GMQA 4JI0M 1K3WA 1HJPA 4G4RA 4G3OA 1YUBA 4NXMM 1OIPA 3U6LA 3GQ5A 1Z5BA 2DZLA 4WP2A 1IXSA 1SXJD 2QPAA 4IBGA 1GKIA 1R7RA 3L27A 1TTEA 5KO3A 3GRVA 2FNAA 4AZFA 4QHTA 4LF9M 4L6V6 3K2LA 5IZ7D 2XZFA 4DR1M 2R4EA 2J5YA 1MU5A 2F5NA 2WSEF 2DKLA 3SATA 2G8LA 4NL4H 2ERCA 4LJ9A 1VDDA 2WSFF 2A5YB 4AG5A 2L6OA 4IIWA 2DHYA 2F5QA 3WHLA 2OQ4A 4DUZM 1L2CA 1L2DA 1N78A 1KFVA 1YSYA 4DR4M 2DI0A 1LV7A 2MR9A 2JWSA 5ITQA 1HNXM 3I51A 3VK8A 3A98B 1UFZA 3CTWB 2QP9X 3GLHB 1SXJA 1K82A 4F1IA 4LJAA 2LNHC 1TH2A 4LF4M 2CHGA 3KSXA 4FVMA 2XLJA 3SAWA 2JP7A 3GLHE 3T1YM 1I4WA 2WZJA 4HEOA 1G59A 4AKIA 1BVSA 1QAMA 1GVNA 3ILKA 5IREB 3HU1A 3FKEA 3GLGE 2KW0A 4DV6M 1X37A 4PDIA 3FUXA 2FE8A 5E26A 3HHWA 2RGHA 1IN7A 4L8RC 2V1UA 1JQJC 1SXJC 3RE8A 1DGHA 2XZUA 1SG9A 1OJLA 1D0LA 4DR7M 3U61A 2D7HA 5FTNA 4LFBM 1D0KA 1GLNA 1VEKA 2Z4SA 4IBFA 4WURA 3M6AA 2DWNA 1C7YA 2F5OA 1QQWA 2VDBB 3E21A 4IBCA 5ITXE 3GLIE 1IFYA 2LWXA 3U6OA 2F4VM 3SASA 4G6ZA 4FD2A 4B3RM 3GLGB 1G4AE 1R5LA 1OKSA 5EP1A 5ITUA 2LHGA 3UGJA 4CIZA 3U6DA 4CISA 2YQZA 2K0BX 1RU3A 2JUJA 2EJSA 1DGBA 2CHQA 5FTKA 3SMPA 1TF0B 3LQRA 4REZA 3FTDA 4AQYM 4NSRA 3SYLA 1QDRA 3GLIA 1TGUA 2DNAA 5BR8M 3B7ZA 2Z7JA 1F4IA 4DR3M 5KPZA 4JYAM 4OVZA 3ZQJA 3CF0A 1XB2B 1DO0A 2OPFA 1K3XA 4JI2M 1N75A 1IBLM 4WW0A 2OO9A 3FYDA 1PJQA 1XWIA 2R0IA 2APLA 4M0WA 2JNHA 4II7A 2UUAM 2DZOB 3MK6A 3HJSA 1IXZA 2BNKA 3SHFA 2C9CA 2QBYB 1GABA 4OU7A 1T43A 1VEJA 1NNUC 2JY8A 3BBZA 3BOSA 3J81S 2YR0A 3GPXA 3LVWA 2GNOA 3LCVB 2DHRA 4TUWA 2V6ZM 4B7FA 1Q02A 4DV4M 3UJNA 2R44A 4AKGA 4DR5M 4FWHA 4LJ5A 2BWBA 3UZUA 4L4UA 1WJ7A 1N33M 4I81A 3T6PA 4JV5M 5DYIA 1MX0A 4LZJA 5LMNM 3H4JA 4EIWA 1L1TA 2VQFM 1G8PA 2DVWB 4I5SA 3SC3A 1DGFA 4R71A 4JI6M 3GQ4A 1MJGM 2R6FA 1I94M 4PDGA 1QVRA 3Q8GA 4NSOB 4RF0A 1T3TA 2DAMA 3AOEA 1DGHB 3NWLA 4X64M 4X62M 3KVWA 5DFLA 4DR6M 1G3IA 3HKPA 1NVMA 1IQPA 3U61B 1V92A 2VF7A 2JZ0A 1OIZA 2Y21A 4GC5A 3SARA 1AIPC 3L29A 4DV5M 3T1HM 1DGGA 4L15A 4F2LA 3FTCA 4D80A 4PCZA 1HT2E 3L28A 3U6CA 5L8RF 2LBCA 2OOBA 4JI3M 4B7HA 1N32M 3E46A 3TE6A 4AW4A 2CUZA 2LVNC 4W5WA 1GJTA 4R3DA 1NJGA 1HNZM 3SMSA 1HR0M 3SBJA 3A46A 2KNZA 4NC6A 2QNJA 2L4FA 3PFIA 1XNRM 3KP1E 3PVSA 2L09A 1NHWC 3C58A 2J7OA 3U6SA 1XMQM 2DWZB 5DNYA 1NHGC 1V33A 2O5RA 4GH9A 4QHSA 3AV0A 4X65M 4NRVA 1WXQA 4IJFA 1PJJA 4ITQA 1GL7A 4XBOA 5JI3E 3AJIB 4P16A 3B7QA 4FCVA 3VDUA 2EO2A 1G41A 1Q3BA 1ZMVA 4I4LA 2JA2A 7CATA 4DV2M 2MGWA 3L25A 1S3SA 3VDPA 4M0DA 3HU2A 3KOZE 2QENA 3L26A 2K47A 4GKJM 2KA6B 3PXGA 4YHHM 3UMMA 3KS8A 3KW6A 5EXSA 3E9SA 1XXHE 1VG5A 1H6UA 2XFSA 3MHVC 2BWEA 2EA0A 2CRUA 3HJQA 2WSCF 4QNRA 3M7GA 1Q39A 3DZDA 3K8ZA 4ZPXA 3Q8XA 4CJ6A 3ZCBB 3U6PA 1NV8A 4XGIA 1Z5AA 1OAIA 4M9SA 3SAVA 4NRWA 1QZMA 4LY6A 3JR4A 4DR2M 2BJWA 2BJVA 2LVOC 4MGKE 2Y20A 4MGYE 3GLGA 2DZNB 2DXIA 1T6OA 4LF7M 1Q3CA 2XSZA 5FTJA 2L7HA 4LFAM 2H1RA 2FFJA 3EIEA 3KOYE 3J7BA 3AOGA 3OTOM 3TWLA 4GEWA 2NQ8C 1ZAEA 2K9DA 1NSFA 1C1KA 3W68A 1JR3D 2KRUA 5IWAM 1L1ZA 2VQEM 3TPZA 3B89A 2QHOB 2Y0TA 3T15A 1PJSA 2DAKA 2LH0A 3C9PA 4KODA 2QZ4A 2ZAMA 3U6QA 1VEGA 3FUVA 4LJ6A 3TWMA 2XH9A 3JAMS 3GQ3A 3VK7A 1WHCA 2K6BA 2UUBM 1HT1E 3GPPA 3GLHA 1KSFX 2AHMA 3MMPA 4AG6A 1JR3A 1N36M 4LGMA 2C98A 4JI4M 4GITA 1NNJA 1PJIA 2RKOA 3QAUA 2R65A 2KZUA 5C1BA 8CATA 5ITRA 1ZQ9A 5EXTA 1GO5A 2X49A 3W0LB 2E5LM 2GQFA 4LFCM 2DENA 3RGSA 3IG8A 2DAEA 1TH4A 4GC9A 1EIJA 1YLAA 4NXNM 4RF1A 3B9PA 3THGA 2R18A 4CHTB 1IN8A 2O25A 2JY7A 4LCBA 2G5GX 2C9OA 5DYGA 1KYIA 2LVAA 2ZANA 2M60A 2Z4RA 5KQDA 3T38A 2LVPC 2HCBA 4QNMA 5KQ8A 4QOSA 3C3EA 3HWSA 2YFQA 3GRYA 1DV0A 4R7GA 4AI6A 1TDZA 3GRUA 1E94E 1QUSA 4OW0A 2DWLA 1NY5A 2CV1A 3U5ZA 3HZJA 1EFUB 3FTEA 1CUKA 2XEPA 3D8LA 2D7GA 2HKJA 2CV0A 4UN2B 1XXHB 5EP2A 2I7PA 1NJFA 1XMOM 3SHGB 2LXEA 1LTMA 1QAOA 2XSZD 2LVQD 4FCTA 3J7AS 1L2BA 4GRIA 3GO8A 2QCUA 2N35A 3KFUG 5ITYA 4OX9M 4LRTA 3AKZA 5ITXA 1WGNA 1WIVA 2Y0QA 4Z8XA 3SAUA 1IN6A 4B3MM 3U5ZB 4BBAA 3SFZA 2FS1A 3K9OA 2F5SA 2W82A 3IG5A 5EP3A 2JXNA 4MB7A 3I01M 4I8OA 1E9SA 1NY6A 3V76A 1PRBA 3IHPA 5EXXA 4D81A 3QWLA 4LF6M 5BPVA 2X8AA 2HL7A 4LF8M 1NV9A 3NBXX 5EQTA 3FUUA 1ORYB 2YNMD 3HHXA 3H4MA 4LJ7A 3W67A 5LMUM 2QQ8A 1Z5CA 4G4OA 1E9RA 1YE9A 3K9PA 4LRSA 3GLFB 3LVVA 3HHZA 1W5SA 5FSWA 4HLQA 4Z6YA 2QSFX 1ZMWA 5ITTA 3HHYA 3DA1A 3VFDA 1IY0A 1SXJE 2ZTCA 4DV3M 4Y28F 4B7GA 2CFOA 4K0KM 5IT9S 3C3DA 4ANRA 3GP1A 2HHHM 2X4AA 1TDHA 4KHPM 1OFHA 2CHVA 1JB0F 1NO1A 4QOZC 1D0MA 2Z3XA 3EIHA 3VLFB 4LJ8A 4GHLA 1VQ1A 2F5PA 4Q7JA 2M5ZA 2UXBM 2XF3A 1AUAA 4D82A 3U6MA 1D2NA 2CV2A 2EUCA 3L2AA 2DAIA 1EE8A 1W5TA 3KOWE 4DUYM 1QANA 1QDTA 2R62A 4FW9A 5FTLA 1A5TA 4P17A 1OQYA 1J7KA 3TWKA 4PT5A 2O01F 2UU9M 4AKHA 4GHAA 1PJTA 3R9XB 2I7NA 2D7EA 1QZEA 2JY5A 3J80S 1IBKM 5EJCA 3D8BA 4IBBA 2CP8A 2HWJA 3U6EA 1MN3A 3KOXE 2UUCM 4B3TM 3K1JA 4XK8F 2R46A 1J09A 2UXDM 1ZMUA 2V1CA 3LQQA 1R4GA 2L4EA 2EKFA 3RFWA 3KDSE 1DO2A 3SYKA 3ZC7B 4RNAA 2P5TA 4BB9A 3GPUA 2C5RA 4G4NA 1IN5A 3U60A 4LG2A 5EXPA 3I04M 4A3VB 4YY3M 3BXWA 1IXSB 5FLXS 4MM3B 4JI8M 4IBIA 4KLNA 2XFTA 3UK6A 2H5XA 3NBIA 4JI5M 3E4RA 2XGNA 3K92A 1IBMM 3FE3A 3FUWA 1GL6A 1VDLA 4B3SM 1IY1A 3HGIA 1HNWM 3A42A 3QYBA 3QYEA 4GIPA 1GJSA 4JI1M 1N77A 2JY6B 3CF6E 2LHCA 2VIIA 3I4VA 3IECA 2DAGA 1XC8A 3VKHA 2CE7A 2ZTDA 4FWDA 4LF5M 4GKKM 4LGYA 3I4YA 5E6JA 1WR1B 1SXJB 2FH0A 4IBJA 4CGYB 1QAQA 2QBYA 1J5EM 2KEBA 4MGZE 3PNVA 4M9XA 3GLFE 4MGIE 1R2YA 4KO8A 1L8QA 3KS4A 4LJ4A 5KPRA 4IJEA 2JZ1A 2HAKA 2R4JA 3AOEC 3HY5A 3FRHA 1E32A 1V34A 1FNNA 1HQCA 1JR3E 4X66M 4IBKA 1OAOC 2B3TA 2CEAA 4LZZA 3MJ5A 2C99A 2ZBKB 4M9ZA 4MGHA 4JI7M 2G3QA 3JR5A 3CF2A 3J27B 2KZSA 4DV1M 3GLIB 2OOAA 1N34M 4KT0F 5GKNA 4PD2A 2CWBA 3W0FA 3WHKA 1IXRC 3LCUA 1TR8A 1TH3A 3GLFA 2KXEA 1Y8GA 2L7IA 3TL4X 4G4QA 2KRKA 4RKUF 1G71A 3HJ8A 2L2DA 2Z8YM 3R8FA 4DV7M 2Q2EB 2RGOA 3FD9A 3KSJA 5F3WA 1XNQM 1P3QQ 3TQSA 2FOIC 5FTMA 4L16A 3AFHA 4NOOB 1PM5A
chains in the Genus database with same CATH topology
4BLCA 4DV0M 4L78A 1HQYE 3J2PB 3RGPA 1UM8A 3FYCA 1OFIA 1R6BX 4IBDA 1Z6TA 3FTFA 2J7NA 4MH0E 4B08A 5KPTA 1R2ZA 5C18A 1FJGM 1XXHA 1QYRA 1Z59A 4IBEA 5EP4A 3KP0E 3HU3A 2ZM6M 2C96A 2R45A 5JI2E 1IN4A 3ZH9B 2DWMA 3VKGA 4OVZB 4S12A 3AL0C 1IM2A 4JXJA 3DFZA 3GRRA 3A45A 4FWGA 5A2QS 2UXCM 3FUTA 3DOAA 5H37D 1IY2A 3LMMA 4JN6A 4FCWA 3U60B 3M0EA 3PNYA 4HL4A 3GPYA 1K3WA 1XHBA 4GMQA 3KXEC 2ZAOA 4JI0M 4G4RA 4NXMM 1YUBA 3U6LA 3GQ5A 1Z5BA 1SXJD 2QPAA 4IBGA 1GKIA 1R7RA 3L27A 5KO3A 3GRVA 2FNAA 4AZFA 4QHTA 4LF9M 3K2LA 5IZ7D 2XZFA 4DR1M 2R4EA 1MU5A 2F5NA 3SATA 2G8LA 4NL4H 2ERCA 4LJ9A 1VDDA 2A5YB 4AG5A 2L6OA 4IIWA 2F5QA 3WHLA 2OQ4A 4DUZM 1L2CA 1L2DA 1N78A 1KFVA 1YSYA 4DR4M 1LV7A 5ITQA 1HNXM 3I51A 3VK8A 3A98B 3CTWB 2QP9X 3GLHB 1SXJA 1K82A 4LJAA 2LNHC 1TH2A 4LF4M 2CHGA 3KSXA 4FVMA 2XLJA 3SAWA 3T1YM 1I4WA 1G59A 4AKIA 1QAMA 1GVNA 3ILKA 5IREB 3HU1A 3FKEA 2KW0A 4DV6M 1X37A 4PDIA 3FUXA 2FE8A 5E26A 3HHWA 2RGHA 1IN7A 4L8RC 2V1UA 1SXJC 1JQJC 3RE8A 1DGHA 2XZUA 1OJLA 4DR7M 3U61A 2D7HA 5FTNA 4LFBM 1GLNA 4IBFA 2Z4SA 4WURA 3M6AA 2DWNA 2F5OA 1QQWA 4IBCA 5ITXE 2LWXA 3U6OA 2F4VM 3SASA 4G6ZA 4FD2A 4B3RM 3GLGB 1G4AE 5EP1A 5ITUA 3UGJA 3U6DA 4CISA 2YQZA 1DGBA 2CHQA 5FTKA 3SMPA 3LQRA 4REZA 3FTDA 4AQYM 4NSRA 3SYLA 3GLIA 1TGUA 5BR8M 2Z7JA 4DR3M 5KPZA 4JYAM 4OVZA 3CF0A 1DO0A 2OPFA 1K3XA 4JI2M 1N75A 1IBLM 4WW0A 3FYDA 1XWIA 4M0WA 4II7A 2UUAM 2DZOB 3MK6A 3HJSA 1IXZA 2BNKA 3SHFA 2C9CA 2QBYB 4OU7A 1NNUC 3BOSA 3J81S 2YR0A 3GPXA 3LVWA 2DHRA 4TUWA 2V6ZM 4B7FA 4DV4M 3UJNA 4AKGA 4DR5M 4FWHA 4LJ5A 3UZUA 4L4UA 1N33M 4I81A 4JV5M 5DYIA 1MX0A 4LZJA 5LMNM 4EIWA 1L1TA 2VQFM 1G8PA 2DVWB 4I5SA 3SC3A 1DGFA 4JI6M 3GQ4A 1I94M 4PDGA 1QVRA 4NSOB 4RF0A 1T3TA 3AOEA 4X64M 1DGHB 3NWLA 4X62M 3KVWA 4DR6M 1G3IA 3HKPA 1NVMA 1IQPA 3U61B 2Y21A 4GC5A 3SARA 3L29A 4DV5M 3T1HM 1DGGA 4L15A 3FTCA 4D80A 4PCZA 1HT2E 3L28A 3U6CA 4JI3M 4B7HA 1N32M 3TE6A 4AW4A 2CUZA 4W5WA 4R3DA 1HNZM 1NJGA 3SMSA 1HR0M 3SBJA 3A46A 3PFIA 1XNRM 3PVSA 3KP1E 2L09A 1NHWC 3C58A 2J7OA 3U6SA 1XMQM 2DWZB 5DNYA 1NHGC 2O5RA 4GH9A 4QHSA 3AV0A 4X65M 4NRVA 1WXQA 4IJFA 1PJJA 4ITQA 1GL7A 4XBOA 5JI3E 3AJIB 4P16A 4FCVA 3VDUA 2EO2A 1G41A 1Q3BA 4I4LA 3L25A 2JA2A 7CATA 4DV2M 1S3SA 3VDPA 4M0DA 3HU2A 3KOZE 2QENA 3L26A 2K47A 4GKJM 2KA6B 3PXGA 4YHHM 3UMMA 3KS8A 3KW6A 5EXSA 3E9SA 1H6UA 2XFSA 3MHVC 2EA0A 3HJQA 4QNRA 3M7GA 1Q39A 3DZDA 3K8ZA 4ZPXA 3Q8XA 3ZCBB 3U6PA 4XGIA 1Z5AA 4M9SA 3SAVA 4NRWA 1QZMA 4LY6A 3JR4A 4DR2M 2BJWA 2BJVA 4MGKE 4MGYE 2Y20A 3GLGA 2DZNB 2DXIA 4LF7M 1Q3CA 2XSZA 5FTJA 2L7HA 4LFAM 2H1RA 2FFJA 3EIEA 3KOYE 3J7BA 3AOGA 3OTOM 3TWLA 2NQ8C 1ZAEA 1NSFA 1C1KA 5IWAM 1L1ZA 1JR3D 2KRUA 2VQEM 3TPZA 2Y0TA 3T15A 2LH0A 4KODA 3U6QA 2QZ4A 2ZAMA 3FUVA 4LJ6A 3TWMA 2XH9A 3JAMS 3GQ3A 3VK7A 2UUBM 1HT1E 3GPPA 3GLHA 1KSFX 2AHMA 4AG6A 1JR3A 1N36M 4LGMA 2C98A 4JI4M 4GITA 1NNJA 1PJIA 2RKOA 3QAUA 2R65A 2KZUA 5C1BA 8CATA 5ITRA 1ZQ9A 5EXTA 2X49A 3W0LB 2E5LM 4LFCM 3RGSA 3IG8A 1TH4A 4GC9A 4NXNM 4RF1A 3B9PA 3THGA 2R18A 4CHTB 1IN8A 4LCBA 2G5GX 2C9OA 5DYGA 1KYIA 2ZANA 2M60A 2Z4RA 5KQDA 3T38A 2HCBA 4QNMA 5KQ8A 4QOSA 3HWSA 2YFQA 3GRYA 4R7GA 4AI6A 1TDZA 3GRUA 1E94E 4OW0A 2DWLA 1NY5A 2CV1A 3U5ZA 3FTEA 2XEPA 3D8LA 2D7GA 2HKJA 2CV0A 1XXHB 5EP2A 2I7PA 1NJFA 1XMOM 3SHGB 2LXEA 1QAOA 2XSZD 4FCTA 3J7AS 1L2BA 4GRIA 3GO8A 2QCUA 3KFUG 5ITYA 4OX9M 4LRTA 3AKZA 5ITXA 4Z8XA 2Y0QA 3SAUA 1IN6A 4B3MM 3U5ZB 4BBAA 3SFZA 2F5SA 2W82A 3IG5A 5EP3A 4MB7A 4I8OA 1E9SA 1NY6A 5EXXA 4D81A 3QWLA 4LF6M 5BPVA 2X8AA 2HL7A 4LF8M 5EQTA 3FUUA 1ORYB 2YNMD 3HHXA 3H4MA 4LJ7A 5LMUM 4G4OA 1Z5CA 1E9RA 1YE9A 4LRSA 3GLFB 3LVVA 3HHZA 1W5SA 5FSWA 4HLQA 4Z6YA 5ITTA 3HHYA 3DA1A 3VFDA 1IY0A 1SXJE 4DV3M 4B7GA 2CFOA 4K0KM 5IT9S 3GP1A 2HHHM 2X4AA 1TDHA 4KHPM 1OFHA 2CHVA 4QOZC 2Z3XA 3EIHA 3VLFB 4LJ8A 4GHLA 2F5PA 2M5ZA 2UXBM 2XF3A 4D82A 3U6MA 1D2NA 2CV2A 2EUCA 3L2AA 1EE8A 1W5TA 3KOWE 4DUYM 1QANA 2R62A 4FW9A 5FTLA 1J7KA 3TWKA 4PT5A 2UU9M 4AKHA 4GHAA 3R9XB 2I7NA 2D7EA 1IBKM 3J80S 5EJCA 3D8BA 4IBBA 3U6EA 3KOXE 2UUCM 4B3TM 3K1JA 2UXDM 2R46A 1J09A 2V1CA 3LQQA 3RFWA 3KDSE 1DO2A 3SYKA 3ZC7B 4RNAA 2P5TA 4BB9A 3GPUA 2C5RA 4G4NA 1IN5A 3U60A 4LG2A 5EXPA 4YY3M 4A3VB 5FLXS 1IXSB 4MM3B 4JI8M 4IBIA 4KLNA 2XFTA 3UK6A 4JI5M 3NBIA 3E4RA 2XGNA 3K92A 1IBMM 3FUWA 1GL6A 4B3SM 1IY1A 3HGIA 1HNWM 3A42A 4GIPA 4JI1M 1N77A 3CF6E 2VIIA 3I4VA 1XC8A 3VKHA 2CE7A 4FWDA 4GKKM 4LF5M 4LGYA 3I4YA 5E6JA 1SXJB 4CGYB 4IBJA 1QAQA 2QBYA 1J5EM 2KEBA 4MGZE 3PNVA 4M9XA 4MGIE 1R2YA 4KO8A 1L8QA 3KS4A 4LJ4A 5KPRA 4IJEA 2R4JA 3AOEC 1E32A 1FNNA 1HQCA 4X66M 4IBKA 2CEAA 4LZZA 3MJ5A 2C99A 2ZBKB 4M9ZA 4MGHA 4JI7M 3JR5A 3CF2A 3J27B 2KZSA 4DV1M 3GLIB 1N34M 5GKNA 4PD2A 3W0FA 3WHKA 1IXRC 1TH3A 3GLFA 2KXEA 2L7IA 3TL4X 4G4QA 2KRKA 3HJ8A 3R8FA 4DV7M 2Q2EB 2RGOA 3FD9A 3KSJA 5F3WA 1XNQM 3TQSA 2FOIC 5FTMA 4L16A 3AFHA 4NOOB 1PM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1Z A;  4DV0 M;  4DR3 M;  2VQE M;  4JYA M;  2F5P A;  2OPF A;  4JI2 M;  3U6M A;  1K3X A;  2UXB M;  1IBL M;  3U6Q A;  1R2Z A;  1EE8 A;  4DUY M;  3TWM A;  2UUA M;  1FJG M;  3JAM S;  3GQ3 A;  2ZM6 M;  1Z59 A;  3VK7 A;  2UUB M;  3TWK A;  3GPP A;  2UU9 M;  1N36 M;  4JI4 M;  3J81 S;  3GPX A;  1NNJ A;  1IBK M;  3A45 A;  3J80 S;  1PJI A;  4DV4 M;  5A2Q S;  5ITR A;  2UXC M;  4DR5 M;  3U6E A;  3DOA A;  2UUC M;  4B3T M;  2UXD M;  1N33 M;  2E5L M;  4LFC M;  4JV5 M;  5LMN M;  1MX0 A;  1L1T A;  3GPY A;  2VQF M;  1K3W A;  4JI0 M;  3GPU A;  4NXN M;  4G4R A;  4G4N A;  4NXM M;  4JI6 M;  3GQ4 A;  4YY3 M;  3U6L A;  3GQ5 A;  5FLX S;  1I94 M;  4PDG A;  1Z5B A;  4JI8 M;  4X64 M;  4X62 M;  4JI5 M;  4DR6 M;  1IBM M;  4B3S M;  3SAR A;  4LF9 M;  1HNW M;  3A42 A;  4DV5 M;  3T1H M;  2XZF A;  4DR1 M;  4PCZ A;  4JI1 M;  1TDZ A;  1MU5 A;  3U6C A;  2F5N A;  3SAT A;  4JI3 M;  1N32 M;  1HNZ M;  2F5Q A;  4DUZ M;  2OQ4 A;  1L2C A;  1L2D A;  1HR0 M;  2HKJ A;  1XC8 A;  1KFV A;  3SBJ A;  4DR4 M;  4GKK M;  3A46 A;  4LF5 M;  5ITQ A;  1HNX M;  1XMO M;  1XNR M;  3VK8 A;  3C58 A;  3U6S A;  1J5E M;  1XMQ M;  1K82 A;  3J7A S;  1L2B A;  4LF4 M;  3GO8 A;  3SAW A;  4X65 M;  4NRV A;  3T1Y M;  5ITY A;  4OX9 M;  1PJJ A;  1R2Y A;  4ITQ A;  3SAU A;  5ITX A;  5IWA M;  1Q3B A;  4B3M M;  4DV2 M;  4DV6 M;  4PDI A;  2F5S A;  4GKJ M;  4X66 M;  4MB7 A;  4YHH M;  2ZBK B;  2EA0 A;  2XZU A;  4LF6 M;  4DR7 M;  4LF8 M;  1Q39 A;  4JI7 M;  4LFB M;  3JR5 A;  4DV1 M;  1N34 M;  4PD2 A;  5LMU M;  3U6P A;  4G4O A;  1Z5C A;  2F5O A;  1Z5A A;  3W0F A;  5ITX E;  3SAV A;  5ITT A;  3U6O A;  2F4V M;  4NRW A;  3SAS A;  3JR4 A;  4B3R M;  4DR2 M;  4G4Q A;  5ITU A;  4DV3 M;  3U6D A;  4CIS A;  4LF7 M;  1Q3C A;  4DV7 M;  2Q2E B;  4K0K M;  4LFA M;  1XNQ M;  5IT9 S;  3GP1 A;  3OTO M;  4AQY M;  2HHH M;  3TWL A;  1PM5 A;  1TDH A;  4KHP M;  5BR8 M; 
#chains in the Genus database with same CATH topology
 4BLC A;  4DV0 M;  3FRI A;  3LW5 F;  4L78 A;  1HQY E;  1ZV1 A;  3J2P B;  3RGP A;  1UM8 A;  3FYC A;  1OFI A;  1OTR A;  1R6B X;  4IBD A;  1Z6T A;  2KNV A;  3FTF A;  1PGY A;  2J7N A;  4MH0 E;  4B08 A;  5KPT A;  1R2Z A;  5C18 A;  2VF8 A;  1FJG M;  1XXH A;  1QYR A;  1Z59 A;  4IBE A;  5EP4 A;  3KP0 E;  3HU3 A;  2ZM6 M;  2C96 A;  2MH8 A;  2R45 A;  5JI2 E;  1IN4 A;  3ZH9 B;  2KHH A;  3B74 A;  3F92 A;  2DWM A;  2KDL A;  2EKK A;  2KNA A;  4OVZ B;  3VKG A;  4S12 A;  3AL0 C;  3HX3 A;  1IM2 A;  4JXJ A;  1WGL A;  3B7N A;  3A45 A;  3DFZ A;  3CGW A;  3GRR A;  4FWG A;  5A2Q S;  2UXC M;  3FUT A;  2LTU A;  4DBG B;  3DOA A;  5H37 D;  1IY2 A;  3LMM A;  4JN6 A;  2RRU A;  4FCW A;  1QUT A;  3U60 B;  3M0E A;  3PNY A;  4HL4 A;  3GPY A;  2MRO B;  1XHB A;  2MJ5 B;  3KXE C;  2ZAO A;  4GMQ A;  4JI0 M;  1K3W A;  1HJP A;  4G4R A;  4G3O A;  1YUB A;  4NXM M;  1OIP A;  3U6L A;  3GQ5 A;  1Z5B A;  2DZL A;  4WP2 A;  1IXS A;  1SXJ D;  2QPA A;  4IBG A;  1GKI A;  1R7R A;  3L27 A;  1TTE A;  5KO3 A;  3GRV A;  2FNA A;  4AZF A;  4QHT A;  4LF9 M;  4L6V 6;  3K2L A;  5IZ7 D;  2XZF A;  4DR1 M;  2R4E A;  2J5Y A;  1MU5 A;  2F5N A;  2WSE F;  2DKL A;  3SAT A;  2G8L A;  4NL4 H;  2ERC A;  4LJ9 A;  1VDD A;  2WSF F;  2A5Y B;  4AG5 A;  2L6O A;  4IIW A;  2DHY A;  2F5Q A;  3WHL A;  2OQ4 A;  4DUZ M;  1L2C A;  1L2D A;  1N78 A;  1KFV A;  1YSY A;  4DR4 M;  2DI0 A;  1LV7 A;  2MR9 A;  2JWS A;  5ITQ A;  1HNX M;  3I51 A;  3VK8 A;  3A98 B;  1UFZ A;  3CTW B;  2QP9 X;  3GLH B;  1SXJ A;  1K82 A;  4F1I A;  4LJA A;  2LNH C;  1TH2 A;  4LF4 M;  2CHG A;  3KSX A;  4FVM A;  2XLJ A;  3SAW A;  2JP7 A;  3GLH E;  3T1Y M;  1I4W A;  2WZJ A;  4HEO A;  1G59 A;  4AKI A;  1BVS A;  1QAM A;  1GVN A;  3ILK A;  5IRE B;  3HU1 A;  3FKE A;  3GLG E;  2KW0 A;  4DV6 M;  1X37 A;  4PDI A;  3FUX A;  2FE8 A;  5E26 A;  3HHW A;  2RGH A;  1IN7 A;  4L8R C;  2V1U A;  1JQJ C;  1SXJ C;  3RE8 A;  1DGH A;  2XZU A;  1SG9 A;  1OJL A;  1D0L A;  4DR7 M;  3U61 A;  2D7H A;  5FTN A;  4LFB M;  1D0K A;  1GLN A;  1VEK A;  2Z4S A;  4IBF A;  4WUR A;  3M6A A;  2DWN A;  1C7Y A;  2F5O A;  1QQW A;  2VDB B;  3E21 A;  4IBC A;  5ITX E;  3GLI E;  1IFY A;  2LWX A;  3U6O A;  2F4V M;  3SAS A;  4G6Z A;  4FD2 A;  4B3R M;  3GLG B;  1G4A E;  1R5L A;  1OKS A;  5EP1 A;  5ITU A;  2LHG A;  3UGJ A;  4CIZ A;  3U6D A;  4CIS A;  2YQZ A;  2K0B X;  1RU3 A;  2JUJ A;  2EJS A;  1DGB A;  2CHQ A;  5FTK A;  3SMP A;  1TF0 B;  3LQR A;  4REZ A;  3FTD A;  4AQY M;  4NSR A;  3SYL A;  1QDR A;  3GLI A;  1TGU A;  2DNA A;  5BR8 M;  3B7Z A;  2Z7J A;  1F4I A;  4DR3 M;  5KPZ A;  4JYA M;  4OVZ A;  3ZQJ A;  3CF0 A;  1XB2 B;  1DO0 A;  2OPF A;  1K3X A;  4JI2 M;  1N75 A;  1IBL M;  4WW0 A;  2OO9 A;  3FYD A;  1PJQ A;  1XWI A;  2R0I A;  2APL A;  4M0W A;  2JNH A;  4II7 A;  2UUA M;  2DZO B;  3MK6 A;  3HJS A;  1IXZ A;  2BNK A;  3SHF A;  2C9C A;  2QBY B;  1GAB A;  4OU7 A;  1T43 A;  1VEJ A;  1NNU C;  2JY8 A;  3BBZ A;  3BOS A;  3J81 S;  2YR0 A;  3GPX A;  3LVW A;  2GNO A;  3LCV B;  2DHR A;  4TUW A;  2V6Z M;  4B7F A;  1Q02 A;  4DV4 M;  3UJN A;  2R44 A;  4AKG A;  4DR5 M;  4FWH A;  4LJ5 A;  2BWB A;  3UZU A;  4L4U A;  1WJ7 A;  1N33 M;  4I81 A;  3T6P A;  4JV5 M;  5DYI A;  1MX0 A;  4LZJ A;  5LMN M;  3H4J A;  4EIW A;  1L1T A;  2VQF M;  1G8P A;  2DVW B;  4I5S A;  3SC3 A;  1DGF A;  4R71 A;  4JI6 M;  3GQ4 A;  1MJG M;  2R6F A;  1I94 M;  4PDG A;  1QVR A;  3Q8G A;  4NSO B;  4RF0 A;  1T3T A;  2DAM A;  3AOE A;  1DGH B;  3NWL A;  4X64 M;  4X62 M;  3KVW A;  5DFL A;  4DR6 M;  1G3I A;  3HKP A;  1NVM A;  1IQP A;  3U61 B;  1V92 A;  2VF7 A;  2JZ0 A;  1OIZ A;  2Y21 A;  4GC5 A;  3SAR A;  1AIP C;  3L29 A;  4DV5 M;  3T1H M;  1DGG A;  4L15 A;  4F2L A;  3FTC A;  4D80 A;  4PCZ A;  1HT2 E;  3L28 A;  3U6C A;  5L8R F;  2LBC A;  2OOB A;  4JI3 M;  4B7H A;  1N32 M;  3E46 A;  3TE6 A;  4AW4 A;  2CUZ A;  2LVN C;  4W5W A;  1GJT A;  4R3D A;  1NJG A;  1HNZ M;  3SMS A;  1HR0 M;  3SBJ A;  3A46 A;  2KNZ A;  4NC6 A;  2QNJ A;  2L4F A;  3PFI A;  1XNR M;  3KP1 E;  3PVS A;  2L09 A;  1NHW C;  3C58 A;  2J7O A;  3U6S A;  1XMQ M;  2DWZ B;  5DNY A;  1NHG C;  1V33 A;  2O5R A;  4GH9 A;  4QHS A;  3AV0 A;  4X65 M;  4NRV A;  1WXQ A;  4IJF A;  1PJJ A;  4ITQ A;  1GL7 A;  4XBO A;  5JI3 E;  3AJI B;  4P16 A;  3B7Q A;  4FCV A;  3VDU A;  2EO2 A;  1G41 A;  1Q3B A;  1ZMV A;  4I4L A;  2JA2 A;  7CAT A;  4DV2 M;  2MGW A;  3L25 A;  1S3S A;  3VDP A;  4M0D A;  3HU2 A;  3KOZ E;  2QEN A;  3L26 A;  2K47 A;  4GKJ M;  2KA6 B;  3PXG A;  4YHH M;  3UMM A;  3KS8 A;  3KW6 A;  5EXS A;  3E9S A;  1XXH E;  1VG5 A;  1H6U A;  2XFS A;  3MHV C;  2BWE A;  2EA0 A;  2CRU A;  3HJQ A;  2WSC F;  4QNR A;  3M7G A;  1Q39 A;  3DZD A;  3K8Z A;  4ZPX A;  3Q8X A;  4CJ6 A;  3ZCB B;  3U6P A;  1NV8 A;  4XGI A;  1Z5A A;  1OAI A;  4M9S A;  3SAV A;  4NRW A;  1QZM A;  4LY6 A;  3JR4 A;  4DR2 M;  2BJW A;  2BJV A;  2LVO C;  4MGK E;  2Y20 A;  4MGY E;  3GLG A;  2DZN B;  2DXI A;  1T6O A;  4LF7 M;  1Q3C A;  2XSZ A;  5FTJ A;  2L7H A;  4LFA M;  2H1R A;  2FFJ A;  3EIE A;  3KOY E;  3J7B A;  3AOG A;  3OTO M;  3TWL A;  4GEW A;  2NQ8 C;  1ZAE A;  2K9D A;  1NSF A;  1C1K A;  3W68 A;  1JR3 D;  2KRU A;  5IWA M;  1L1Z A;  2VQE M;  3TPZ A;  3B89 A;  2QHO B;  2Y0T A;  3T15 A;  1PJS A;  2DAK A;  2LH0 A;  3C9P A;  4KOD A;  2QZ4 A;  2ZAM A;  3U6Q A;  1VEG A;  3FUV A;  4LJ6 A;  3TWM A;  2XH9 A;  3JAM S;  3GQ3 A;  3VK7 A;  1WHC A;  2K6B A;  2UUB M;  1HT1 E;  3GPP A;  3GLH A;  1KSF X;  2AHM A;  3MMP A;  4AG6 A;  1JR3 A;  1N36 M;  4LGM A;  2C98 A;  4JI4 M;  4GIT A;  1NNJ A;  1PJI A;  2RKO A;  3QAU A;  2R65 A;  2KZU A;  5C1B A;  8CAT A;  5ITR A;  1ZQ9 A;  5EXT A;  1GO5 A;  2X49 A;  3W0L B;  2E5L M;  2GQF A;  4LFC M;  2DEN A;  3RGS A;  3IG8 A;  2DAE A;  1TH4 A;  4GC9 A;  1EIJ A;  1YLA A;  4NXN M;  4RF1 A;  3B9P A;  3THG A;  2R18 A;  4CHT B;  1IN8 A;  2O25 A;  2JY7 A;  4LCB A;  2G5G X;  2C9O A;  5DYG A;  1KYI A;  2LVA A;  2ZAN A;  2M60 A;  2Z4R A;  5KQD A;  3T38 A;  2LVP C;  2HCB A;  4QNM A;  5KQ8 A;  4QOS A;  3C3E A;  3HWS A;  2YFQ A;  3GRY A;  1DV0 A;  4R7G A;  4AI6 A;  1TDZ A;  3GRU A;  1E94 E;  1QUS A;  4OW0 A;  2DWL A;  1NY5 A;  2CV1 A;  3U5Z A;  3HZJ A;  1EFU B;  3FTE A;  1CUK A;  2XEP A;  3D8L A;  2D7G A;  2HKJ A;  2CV0 A;  4UN2 B;  1XXH B;  5EP2 A;  2I7P A;  1NJF A;  1XMO M;  3SHG B;  2LXE A;  1LTM A;  1QAO A;  2XSZ D;  2LVQ D;  4FCT A;  3J7A S;  1L2B A;  4GRI A;  3GO8 A;  2QCU A;  2N35 A;  3KFU G;  5ITY A;  4OX9 M;  4LRT A;  3AKZ A;  5ITX A;  1WGN A;  1WIV A;  2Y0Q A;  4Z8X A;  3SAU A;  1IN6 A;  4B3M M;  3U5Z B;  4BBA A;  3SFZ A;  2FS1 A;  3K9O A;  2F5S A;  2W82 A;  3IG5 A;  5EP3 A;  2JXN A;  4MB7 A;  3I01 M;  4I8O A;  1E9S A;  1NY6 A;  3V76 A;  1PRB A;  3IHP A;  5EXX A;  4D81 A;  3QWL A;  4LF6 M;  5BPV A;  2X8A A;  2HL7 A;  4LF8 M;  1NV9 A;  3NBX X;  5EQT A;  3FUU A;  1ORY B;  2YNM D;  3HHX A;  3H4M A;  4LJ7 A;  3W67 A;  5LMU M;  2QQ8 A;  1Z5C A;  4G4O A;  1E9R A;  1YE9 A;  3K9P A;  4LRS A;  3GLF B;  3LVV A;  3HHZ A;  1W5S A;  5FSW A;  4HLQ A;  4Z6Y A;  2QSF X;  1ZMW A;  5ITT A;  3HHY A;  3DA1 A;  3VFD A;  1IY0 A;  1SXJ E;  2ZTC A;  4DV3 M;  4Y28 F;  4B7G A;  2CFO A;  4K0K M;  5IT9 S;  3C3D A;  4ANR A;  3GP1 A;  2HHH M;  2X4A A;  1TDH A;  4KHP M;  1OFH A;  2CHV A;  1JB0 F;  1NO1 A;  4QOZ C;  1D0M A;  2Z3X A;  3EIH A;  3VLF B;  4LJ8 A;  4GHL A;  1VQ1 A;  2F5P A;  4Q7J A;  2M5Z A;  2UXB M;  2XF3 A;  1AUA A;  4D82 A;  3U6M A;  1D2N A;  2CV2 A;  2EUC A;  3L2A A;  2DAI A;  1EE8 A;  1W5T A;  3KOW E;  4DUY M;  1QAN A;  1QDT A;  2R62 A;  4FW9 A;  5FTL A;  1A5T A;  4P17 A;  1OQY A;  1J7K A;  3TWK A;  4PT5 A;  2O01 F;  2UU9 M;  4AKH A;  4GHA A;  1PJT A;  3R9X B;  2I7N A;  2D7E A;  1QZE A;  2JY5 A;  3J80 S;  1IBK M;  5EJC A;  3D8B A;  4IBB A;  2CP8 A;  2HWJ A;  3U6E A;  1MN3 A;  3KOX E;  2UUC M;  4B3T M;  3K1J A;  4XK8 F;  2R46 A;  1J09 A;  2UXD M;  1ZMU A;  2V1C A;  3LQQ A;  1R4G A;  2L4E A;  2EKF A;  3RFW A;  3KDS E;  1DO2 A;  3SYK A;  3ZC7 B;  4RNA A;  2P5T A;  4BB9 A;  3GPU A;  2C5R A;  4G4N A;  1IN5 A;  3U60 A;  4LG2 A;  5EXP A;  3I04 M;  4A3V B;  4YY3 M;  3BXW A;  1IXS B;  5FLX S;  4MM3 B;  4JI8 M;  4IBI A;  4KLN A;  2XFT A;  3UK6 A;  2H5X A;  3NBI A;  4JI5 M;  3E4R A;  2XGN A;  3K92 A;  1IBM M;  3FE3 A;  3FUW A;  1GL6 A;  1VDL A;  4B3S M;  1IY1 A;  3HGI A;  1HNW M;  3A42 A;  3QYB A;  3QYE A;  4GIP A;  1GJS A;  4JI1 M;  1N77 A;  2JY6 B;  3CF6 E;  2LHC A;  2VII A;  3I4V A;  3IEC A;  2DAG A;  1XC8 A;  3VKH A;  2CE7 A;  2ZTD A;  4FWD A;  4LF5 M;  4GKK M;  4LGY A;  3I4Y A;  5E6J A;  1WR1 B;  1SXJ B;  2FH0 A;  4IBJ A;  4CGY B;  1QAQ A;  2QBY A;  1J5E M;  2KEB A;  4MGZ E;  3PNV A;  4M9X A;  3GLF E;  4MGI E;  1R2Y A;  4KO8 A;  1L8Q A;  3KS4 A;  4LJ4 A;  5KPR A;  4IJE A;  2JZ1 A;  2HAK A;  2R4J A;  3AOE C;  3HY5 A;  3FRH A;  1E32 A;  1V34 A;  1FNN A;  1HQC A;  1JR3 E;  4X66 M;  4IBK A;  1OAO C;  2B3T A;  2CEA A;  4LZZ A;  3MJ5 A;  2C99 A;  2ZBK B;  4M9Z A;  4MGH A;  4JI7 M;  2G3Q A;  3JR5 A;  3CF2 A;  3J27 B;  2KZS A;  4DV1 M;  3GLI B;  2OOA A;  1N34 M;  4KT0 F;  5GKN A;  4PD2 A;  2CWB A;  3W0F A;  3WHK A;  1IXR C;  3LCU A;  1TR8 A;  1TH3 A;  3GLF A;  2KXE A;  1Y8G A;  2L7I A;  3TL4 X;  4G4Q A;  2KRK A;  4RKU F;  1G71 A;  3HJ8 A;  2L2D A;  2Z8Y M;  3R8F A;  4DV7 M;  2Q2E B;  2RGO A;  3FD9 A;  3KSJ A;  5F3W A;  1XNQ M;  1P3Q Q;  3TQS A;  2FOI C;  5FTM A;  4L16 A;  3AFH A;  4NOO B;  1PM5 A; 
#chains in the Genus database with same CATH homology
 4BLC A;  4DV0 M;  4L78 A;  1HQY E;  3J2P B;  3RGP A;  1UM8 A;  3FYC A;  1OFI A;  1R6B X;  4IBD A;  1Z6T A;  3FTF A;  2J7N A;  4MH0 E;  4B08 A;  5KPT A;  1R2Z A;  5C18 A;  1FJG M;  1XXH A;  1QYR A;  1Z59 A;  4IBE A;  5EP4 A;  3KP0 E;  3HU3 A;  2ZM6 M;  2C96 A;  2R45 A;  5JI2 E;  1IN4 A;  3ZH9 B;  2DWM A;  3VKG A;  4OVZ B;  4S12 A;  3AL0 C;  1IM2 A;  4JXJ A;  3DFZ A;  3GRR A;  3A45 A;  4FWG A;  5A2Q S;  2UXC M;  3FUT A;  3DOA A;  5H37 D;  1IY2 A;  3LMM A;  4JN6 A;  4FCW A;  3U60 B;  3M0E A;  3PNY A;  4HL4 A;  3GPY A;  1K3W A;  1XHB A;  4GMQ A;  3KXE C;  2ZAO A;  4JI0 M;  4G4R A;  4NXM M;  1YUB A;  3U6L A;  3GQ5 A;  1Z5B A;  1SXJ D;  2QPA A;  4IBG A;  1GKI A;  1R7R A;  3L27 A;  5KO3 A;  3GRV A;  2FNA A;  4AZF A;  4QHT A;  4LF9 M;  3K2L A;  5IZ7 D;  2XZF A;  4DR1 M;  2R4E A;  1MU5 A;  2F5N A;  3SAT A;  2G8L A;  4NL4 H;  2ERC A;  4LJ9 A;  1VDD A;  2A5Y B;  4AG5 A;  2L6O A;  4IIW A;  2F5Q A;  3WHL A;  2OQ4 A;  4DUZ M;  1L2C A;  1L2D A;  1N78 A;  1KFV A;  1YSY A;  4DR4 M;  1LV7 A;  5ITQ A;  1HNX M;  3I51 A;  3VK8 A;  3A98 B;  3CTW B;  2QP9 X;  3GLH B;  1SXJ A;  1K82 A;  4LJA A;  2LNH C;  1TH2 A;  4LF4 M;  2CHG A;  3KSX A;  4FVM A;  2XLJ A;  3SAW A;  3T1Y M;  1I4W A;  1G59 A;  4AKI A;  1QAM A;  1GVN A;  3ILK A;  5IRE B;  3HU1 A;  3FKE A;  2KW0 A;  4DV6 M;  1X37 A;  4PDI A;  3FUX A;  2FE8 A;  5E26 A;  3HHW A;  2RGH A;  1IN7 A;  4L8R C;  2V1U A;  1SXJ C;  1JQJ C;  3RE8 A;  1DGH A;  2XZU A;  1OJL A;  4DR7 M;  3U61 A;  2D7H A;  5FTN A;  4LFB M;  1GLN A;  4IBF A;  2Z4S A;  4WUR A;  3M6A A;  2DWN A;  2F5O A;  1QQW A;  4IBC A;  5ITX E;  2LWX A;  3U6O A;  2F4V M;  3SAS A;  4G6Z A;  4FD2 A;  4B3R M;  3GLG B;  1G4A E;  5EP1 A;  5ITU A;  3UGJ A;  3U6D A;  4CIS A;  2YQZ A;  1DGB A;  2CHQ A;  5FTK A;  3SMP A;  3LQR A;  4REZ A;  3FTD A;  4AQY M;  4NSR A;  3SYL A;  3GLI A;  1TGU A;  5BR8 M;  2Z7J A;  4DR3 M;  5KPZ A;  4JYA M;  4OVZ A;  3CF0 A;  1DO0 A;  2OPF A;  1K3X A;  4JI2 M;  1N75 A;  1IBL M;  4WW0 A;  3FYD A;  1XWI A;  4M0W A;  4II7 A;  2UUA M;  2DZO B;  3MK6 A;  3HJS A;  1IXZ A;  2BNK A;  3SHF A;  2C9C A;  2QBY B;  4OU7 A;  1NNU C;  3BOS A;  3J81 S;  2YR0 A;  3GPX A;  3LVW A;  2DHR A;  4TUW A;  2V6Z M;  4B7F A;  4DV4 M;  3UJN A;  4AKG A;  4DR5 M;  4FWH A;  4LJ5 A;  3UZU A;  4L4U A;  1N33 M;  4I81 A;  4JV5 M;  5DYI A;  1MX0 A;  4LZJ A;  5LMN M;  4EIW A;  1L1T A;  2VQF M;  1G8P A;  2DVW B;  4I5S A;  3SC3 A;  1DGF A;  4JI6 M;  3GQ4 A;  1I94 M;  4PDG A;  1QVR A;  4NSO B;  4RF0 A;  1T3T A;  3AOE A;  4X64 M;  1DGH B;  3NWL A;  4X62 M;  3KVW A;  4DR6 M;  1G3I A;  3HKP A;  1NVM A;  1IQP A;  3U61 B;  2Y21 A;  4GC5 A;  3SAR A;  3L29 A;  4DV5 M;  3T1H M;  1DGG A;  4L15 A;  3FTC A;  4D80 A;  4PCZ A;  1HT2 E;  3L28 A;  3U6C A;  4JI3 M;  4B7H A;  1N32 M;  3TE6 A;  4AW4 A;  2CUZ A;  4W5W A;  4R3D A;  1HNZ M;  1NJG A;  3SMS A;  1HR0 M;  3SBJ A;  3A46 A;  3PFI A;  1XNR M;  3PVS A;  3KP1 E;  2L09 A;  1NHW C;  3C58 A;  2J7O A;  3U6S A;  1XMQ M;  2DWZ B;  5DNY A;  1NHG C;  2O5R A;  4GH9 A;  4QHS A;  3AV0 A;  4X65 M;  4NRV A;  1WXQ A;  4IJF A;  1PJJ A;  4ITQ A;  1GL7 A;  4XBO A;  5JI3 E;  3AJI B;  4P16 A;  4FCV A;  3VDU A;  2EO2 A;  1G41 A;  1Q3B A;  4I4L A;  3L25 A;  2JA2 A;  7CAT A;  4DV2 M;  1S3S A;  3VDP A;  4M0D A;  3HU2 A;  3KOZ E;  2QEN A;  3L26 A;  2K47 A;  4GKJ M;  2KA6 B;  3PXG A;  4YHH M;  3UMM A;  3KS8 A;  3KW6 A;  5EXS A;  3E9S A;  1H6U A;  2XFS A;  3MHV C;  2EA0 A;  3HJQ A;  4QNR A;  3M7G A;  1Q39 A;  3DZD A;  3K8Z A;  4ZPX A;  3Q8X A;  3ZCB B;  3U6P A;  4XGI A;  1Z5A A;  4M9S A;  3SAV A;  4NRW A;  1QZM A;  4LY6 A;  3JR4 A;  4DR2 M;  2BJW A;  2BJV A;  4MGK E;  4MGY E;  2Y20 A;  3GLG A;  2DZN B;  2DXI A;  4LF7 M;  1Q3C A;  2XSZ A;  5FTJ A;  2L7H A;  4LFA M;  2H1R A;  2FFJ A;  3EIE A;  3KOY E;  3J7B A;  3AOG A;  3OTO M;  3TWL A;  2NQ8 C;  1ZAE A;  1NSF A;  1C1K A;  5IWA M;  1L1Z A;  1JR3 D;  2KRU A;  2VQE M;  3TPZ A;  2Y0T A;  3T15 A;  2LH0 A;  4KOD A;  3U6Q A;  2QZ4 A;  2ZAM A;  3FUV A;  4LJ6 A;  3TWM A;  2XH9 A;  3JAM S;  3GQ3 A;  3VK7 A;  2UUB M;  1HT1 E;  3GPP A;  3GLH A;  1KSF X;  2AHM A;  4AG6 A;  1JR3 A;  1N36 M;  4LGM A;  2C98 A;  4JI4 M;  4GIT A;  1NNJ A;  1PJI A;  2RKO A;  3QAU A;  2R65 A;  2KZU A;  5C1B A;  8CAT A;  5ITR A;  1ZQ9 A;  5EXT A;  2X49 A;  3W0L B;  2E5L M;  4LFC M;  3RGS A;  3IG8 A;  1TH4 A;  4GC9 A;  4NXN M;  4RF1 A;  3B9P A;  3THG A;  2R18 A;  4CHT B;  1IN8 A;  4LCB A;  2G5G X;  2C9O A;  5DYG A;  1KYI A;  2ZAN A;  2M60 A;  2Z4R A;  5KQD A;  3T38 A;  2HCB A;  4QNM A;  5KQ8 A;  4QOS A;  3HWS A;  2YFQ A;  3GRY A;  4R7G A;  4AI6 A;  1TDZ A;  3GRU A;  1E94 E;  4OW0 A;  2DWL A;  1NY5 A;  2CV1 A;  3U5Z A;  3FTE A;  2XEP A;  3D8L A;  2D7G A;  2HKJ A;  2CV0 A;  1XXH B;  5EP2 A;  2I7P A;  1NJF A;  1XMO M;  3SHG B;  2LXE A;  1QAO A;  2XSZ D;  4FCT A;  3J7A S;  1L2B A;  4GRI A;  3GO8 A;  2QCU A;  3KFU G;  5ITY A;  4OX9 M;  4LRT A;  3AKZ A;  5ITX A;  4Z8X A;  2Y0Q A;  3SAU A;  1IN6 A;  4B3M M;  3U5Z B;  4BBA A;  3SFZ A;  2F5S A;  2W82 A;  3IG5 A;  5EP3 A;  4MB7 A;  4I8O A;  1E9S A;  1NY6 A;  5EXX A;  4D81 A;  3QWL A;  4LF6 M;  5BPV A;  2X8A A;  2HL7 A;  4LF8 M;  5EQT A;  3FUU A;  1ORY B;  2YNM D;  3HHX A;  3H4M A;  4LJ7 A;  5LMU M;  4G4O A;  1Z5C A;  1E9R A;  1YE9 A;  4LRS A;  3GLF B;  3LVV A;  3HHZ A;  1W5S A;  5FSW A;  4HLQ A;  4Z6Y A;  5ITT A;  3HHY A;  3DA1 A;  3VFD A;  1IY0 A;  1SXJ E;  4DV3 M;  4B7G A;  2CFO A;  4K0K M;  5IT9 S;  3GP1 A;  2HHH M;  2X4A A;  1TDH A;  4KHP M;  1OFH A;  2CHV A;  4QOZ C;  2Z3X A;  3EIH A;  3VLF B;  4LJ8 A;  4GHL A;  2F5P A;  2M5Z A;  2UXB M;  2XF3 A;  4D82 A;  3U6M A;  1D2N A;  2CV2 A;  2EUC A;  3L2A A;  1EE8 A;  1W5T A;  3KOW E;  4DUY M;  1QAN A;  2R62 A;  4FW9 A;  5FTL A;  1J7K A;  3TWK A;  4PT5 A;  2UU9 M;  4AKH A;  4GHA A;  3R9X B;  2I7N A;  2D7E A;  1IBK M;  3J80 S;  5EJC A;  3D8B A;  4IBB A;  3U6E A;  3KOX E;  2UUC M;  4B3T M;  3K1J A;  2UXD M;  2R46 A;  1J09 A;  2V1C A;  3LQQ A;  3RFW A;  3KDS E;  1DO2 A;  3SYK A;  3ZC7 B;  4RNA A;  2P5T A;  4BB9 A;  3GPU A;  2C5R A;  4G4N A;  1IN5 A;  3U60 A;  4LG2 A;  5EXP A;  4YY3 M;  4A3V B;  5FLX S;  1IXS B;  4MM3 B;  4JI8 M;  4IBI A;  4KLN A;  2XFT A;  3UK6 A;  4JI5 M;  3NBI A;  3E4R A;  2XGN A;  3K92 A;  1IBM M;  3FUW A;  1GL6 A;  4B3S M;  1IY1 A;  3HGI A;  1HNW M;  3A42 A;  4GIP A;  4JI1 M;  1N77 A;  3CF6 E;  2VII A;  3I4V A;  1XC8 A;  3VKH A;  2CE7 A;  4FWD A;  4GKK M;  4LF5 M;  4LGY A;  3I4Y A;  5E6J A;  1SXJ B;  4CGY B;  4IBJ A;  1QAQ A;  2QBY A;  1J5E M;  2KEB A;  4MGZ E;  3PNV A;  4M9X A;  4MGI E;  1R2Y A;  4KO8 A;  1L8Q A;  3KS4 A;  4LJ4 A;  5KPR A;  4IJE A;  2R4J A;  3AOE C;  1E32 A;  1FNN A;  1HQC A;  4X66 M;  4IBK A;  2CEA A;  4LZZ A;  3MJ5 A;  2C99 A;  2ZBK B;  4M9Z A;  4MGH A;  4JI7 M;  3JR5 A;  3CF2 A;  3J27 B;  2KZS A;  4DV1 M;  3GLI B;  1N34 M;  5GKN A;  4PD2 A;  3W0F A;  3WHK A;  1IXR C;  1TH3 A;  3GLF A;  2KXE A;  2L7I A;  3TL4 X;  4G4Q A;  2KRK A;  3HJ8 A;  3R8F A;  4DV7 M;  2Q2E B;  2RGO A;  3FD9 A;  3KSJ A;  5F3W A;  1XNQ M;  3TQS A;  2FOI C;  5FTM A;  4L16 A;  3AFH A;  4NOO B;  1PM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...